4U32A

Human mesotrypsin complexed with hai-2 kunitz domain 1
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
224
structure length
224
Chain Sequence
IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTAPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDAGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Kunitz-type protease inhibitor 2
publication title Sequence and Conformational Specificity in Substrate Recognition: SEVERAL HUMAN KUNITZ PROTEASE INHIBITOR DOMAINS ARE SPECIFIC SUBSTRATES OF MESOTRYPSIN.
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 224
sequence length 224
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2014-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4u32A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4u32A02
2VVCA 1BA8B 4I8HA 1G30B 4NIYA 1EB2A 1FN8A 4MPUA 1C1PA 2VB0A 1SR5C 4WMFA 3PROA 4BAMB 1ZPBA 1FAKH 1AE5A 1TNHA 2FOGA 2C90B 2UWPA 3TGJE 2PWXA 2QCYA 1O2YA 4NWLA 5C2ZA 2FTMA 2AGIX 4INLA 1SL3A 1TPAE 1C5ZB 1J8AA 4YOJA 4MG3A 1UVTH 2XC5A 3A86A 1SHHB 1F5KU 5ESBA 5DP5A 2ANKH 1XM1A 3FZDA 1QTFA 3RXTA 3MH6A 3SNDA 1RFNA 3A87A 1W2KH 1TA2A 1MZAA 2F9VA 3LC5A 1GI1A 1BHXF 3VFEA 4GCHG 2EA3A 3L33A 5E0HA 3RXCA 2FEQH 2ZKSA 1L1JA 3UUZA 3URCA 1XUIA 2ZGJA 2GZ7A 2F9OA 3KNXA 1HJAC 3H7TA 1O2JA 1MBMA 1LHDH 1O2SA 2FI4E 3B8JA 1GDNA 3BSQA 3TH4H 3RDZA 4XSKU 3QZQA 1C5XB 3M5NA 1GG6B 3T25A 1SOTA 5T6DA 1SPJA 1DE7H 1JRSA 3RXKA 3FP7E 1GGDB 2VWNA 1TGSZ 4OS5A 1QBNA 2W3IA 5JYIA 1V2PT 1G3BA 2FS8A 1TNGA 3ATKA 6LPRA 4D9RA 1RS0A 3E16B 5HGGA 1MTNB 1O3DA 2PUXB 1PJPA 4CBOA 3PMJA 2C8XB 4MPXA 1UVSH 4MDSA 3FP8E 5GDSH 2AMQA 2Z9IA 1UHBB 1GBFA 2OBOA 1WSSH 1BBRH 1QA7A 1F92A 4IGDA 2OD3B 7ESTE 2ZDMA 1C1WH 4R0IA 4I8KA 4B75A 1ZOMA 3LT3A 3P6ZB 4MNWA 4GSOA 1TRMA 3SGQE 1SGEE 2J94A 4O3TA 1TOMH 4Y8ZA 4LK4A 3ZV8A 1UTMA 2ESTE 4K69A 2BM2A 2R9PA 3KL6A 1YPEH 4ZROA 4NZQA 3KQEA 1CU1A 3SHCH 2G5NA 1IQKA 2ZNKH 2VINA 1GJ4H 2F83A 2LNCA 1XUKA 2ZO3H 3MH5A 1KXDA 2GZ9A 3RM2H 3QO6A 2Z3EA 3M7TA 3PV4A 2STBE 3RC6A 1A0JA 4YESB 1OOKB 1BRAA 1Z71A 5AFYH 4BXSA 1YF4A 2FI3E 3I29A 3LGYA 4I8GA 1NT1A 1T8OA 1D3QB 1IHTH 1LPGB 1OPHB 3VB3A 5IYTA 4ZXXH 3ZVDA 2F9PA 2LPRA 3AW1A 2BLQA 3T5FH 4B74A 1GMHF 1K21H 3T27A 4VGCB 3M61U 1BTYA 1SGFG 1SI5H 1UJ1A 1V2LT 5EODA 1AGJA 2ZCLP 5FPYA 3BTDE 2WYGA 4Q2KA 1ANBA 1NRRH 4BTUB 2G4UA 2BQWB 4ABHA 1O5FH 2O8MA 3P95A 3P70B 4Y7AA 5T6FA 1ELAA 4MTBA 3SJ9A 3SNEA 2WV5A 1C5TA 1O3IA 2ZTXA 3Q3YA 1C2KA 1AMHA 1TLDA 2XTTB 2BVSH 4ABFA 3LGVA 1YKTA 2FP7B 1BQYA 2HGTH 2Z9GA 1ELFA 2HPPH 2WUBA 3SBKA 1GHAF 1Y5AT 3ITIA 3SORA 1UCYE 3A8AA 2PSYA 1F0UA 3SV8A 4AFSA 3RXVA 5L6NH 2HNTE 4MNVA 4I31A 4JYUH 1F0RA 1ZJDA 3MU1A 4CR9A 2ODYB 5EQSA 1L4ZA 1MTVA 3KQCA 1AUTC 1QHRB 2BXTH 1UTNA 1O2XA 4JZDH 1RGQA 2ZU3A 3LH1A 2AIPA 1HAXB 1NPMA 1TMBH 2P3TB 2D2DA 1EAIA 1O2NA 2HNTF 2A4OA 4XBCA 2RA3A 3VB4A 1O2RA 2JETB 4FUBA 4X6MA 5I25A 3RXMA 1O2WA 2ZECA 4K5ZA 4BAKB 1TALA 6ESTA 3URDA 1QIXB 2BDCA 1O3HA 4X0WU 4K60A 4FUCA 1P2QA 1GJDB 1UTQA 2WUCA 2GV7A 3EGKH 2BLOA 3M5MA 3G01A 2GCTC 1D4PB 1C5SA 3MYWA 2GMTC 1BTWA 2Z3DA 1P12E 4B2CA 1K1JA 1Y5UT 1V2NT 5B6OA 1ESBA 1WV7H 5EXLA 3RP2A 7KMEH 2VIQA 1VCQA 4AZ2B 2BDHA 1JMOH 3BEFB 3PM3A 4A6LA 5FX5A 3SUDA 1W13U 1BUIA 2QXGA 1MKXH 2VVVA 4XOJA 3Q00A 1W0YH 1DT2A 1QJ1B 1SQTA 4ZAEA 5GJ4B 3M7UA 3QX5H 2JKHA 1ORFA 2JH6D 2PKAA 3BTHE 1P09A 4INHA 1C2DA 3SUGA 5A2MH 3A8CA 1DANH 2THFB 1LPKB 4JK5A 3FAOA 4X1NU 3LJOA 4CH2B 3RXRA 1BBRE 1GCDA 2VGCB 3K9XB 4DIIH 3PWCA 4YT6H 3K6ZA 4NIXA 2P59A 2VU8E 1O5BB 1G3DA 1SGPE 1EZSC 3DD2H 1KLIH 1GJ5H 4ZHAA 4YO9A 1OKXA 1K22H 4AB8A 4YTAA 1GI4A 3QWCH 3UPEA 1YPGH 3AASA 1YCPM 4ABDA 2FX4A 4FUJA 3U1JB 5EQQA 1K1MA 1LKBA 1Z1IA 1OP0A 1MD7A 3P92A 2A2QH 5FXLA 1PQ5A 2AEIH 1TFXA 1W3CA 3HGPA 1FNIA 3IG6B 2OCVB 2Q6DA 4B2BA 1K1PA 4DW2U 1CT4E 1J14A 1FY4A 2C3SA 1N6YA 1YLDA 1TGCA 1GJBB 3BF6H 3PTNA 2CXVA 1W10U 1CHOG 1TB6H 1VGCC 2Y5FA 1TA6A 1CA8B 1FPHH 5EXMA 1DPOA 4IMQA 2DE9A 2VIVA 1EOJA 1Y3YA 1C2EA 3S7HB 2UUFB 1FI8A 1TAWA 4UDWH 1P06A 3LC3A 2W5EA 1ZSKA 3GCHC 2BYAX 1HXEH 3UTUH 4CRAA 2Q6FA 2Z9JA 1INCA 5FPSA 1TGBA 2HRVA 3AVZA 3VEQB 1A3EH 1QL9A 2QXJA 3ZVBA 4RN6A 1ANDA 1NS3A 2BOHB 2Z6BD 4X8UH 5C67A 3S0NA 3RU4D 1J17T 1W11U 1AIXH 4Y8YA 1O3CA 1GBKA 3QZRA 1TQ7B 2F3CE 1V2KT 1P57B 1O5GH 2ANWA 1RD3B 2A45B 3M35A 3QN7A 1Q2WA 4DOQA 2ZGHA 4Y11E 3BTGE 1C9PA 4UFEH 5DKMA 3HK6B 1QURH 5A8YA 8ESTE 4K1TA 2BD3A 2C8YB 1ELCA 3ZZAA 5DJ7A 1C2JA 4FU8A 5JBCS 2XC4A 4OS2A 3PYHA 4BTTB 2C8ZB 2CF9H 4DJZB 2PKSB 1CGIE 1A5GH 5PTPA 2GKVE 5LPEA 1VR1H 2ZFQH 3FP6E 1OP8A 2GZ8A 4WXVA 3AW0A 3OY6U 4UE7H 4YOIA 2EI6A 3F9GA 1WBGB 1W0ZU 2A5IA 1GCTB 2STAE 3ELAH 4WH6A 5CHAC 3BTQE 2P3UB 4AORA 1KXCA 3P8NA 1HJ9A 1PPHE 2TGTA 3STJA 2O8LA 4Y8XA 2BXUH 4ZXYH 3LGIA 1TPOA 3OU0A 1BMNH 3MNXA 4I7YH 4RKOB 1YPHC 1HLTH 3C1KA 1A2CH 1A61H 4UFGH 1KXFA 2F91A 1UTPA 2FTLE 2J95A 3A7YA 1MMJN 2FO9A 1GDUA 2SNVA 3E91A 2XCNA 4ABBA 1TWXB 1EP5A 2O9QA 1K1LA 4Y10E 1IQIA 1TNKA 1TQ0B 1OXGA 2GTBA 4RKJB 3HPTB 4D76A 1SHYA 1P3EA 2VVUA 1C5QA 3ESTA 2W26A 5JDUB 3OY5U 4TPIZ 1AQ7A 1BB0B 3SU3A 4O9VA 1LO6A 1SQOA 1O2PA 3L3TA 3RXDA 1O5EH 2AMDA 1C1TA 1BTUA 4U01A 3BIUH 1RTFB 1QQUA 1UVOA 2BVRH 2GV6A 2XC0A 4TWYA 4JZEH 1JIMA 1Y8TA 4AYYB 2SNWA 2OQUA 4A1TA 3NWUA 1H9HE 3JZ2B 5DGJA 1A4WH 1UVUH 3UNSA 2CHAB 3SQEE 1Y59T 2I6QA 4ZKNU 1IAUA 5A8XA 1GL0E 5DP6A 4DCDA 3SU4A 3RC5A 1O2GH 1GJ8B 2ZGBH 1ELDE 3Q3XA 1GMHG 1P02A 2XWAA 1QL8A 1ARCA 1CA0C 3ZZDA 3BTEE 2G81E 1DUAA 3V3MA 1O2LA 3SU1A 2H5CA 2XBVA 1CQQA 4A1VA 1ZRBA 1HJAB 2C4FH 3EA9A 3PWBA 2OXSA 3TVJB 1CT0E 1MKWK 3S9BA 1AZ8A 1UMAH 1P04A 1N8OC 3SZNA 1ANEA 3H7OA 3ZVGA 1HB0B 4HTCH 1HFDA 2O8UA 1YPKH 3BTFE 2J34A 2FX6A 3SNBA 1C4V2 1DSTA 1P9UA 3MO3A 2NU4E 1FIWA 1ZGIA 2FESH 2CN0H 2WV4A 1MAXA 3A81A 1KSNA 3NCLA 2PUQH 1GHAG 3FZZA 2QYIA 3BG4B 4NIWA 5GCHG 1BZXE 4DIHH 1QBOA 1OWDA 1FIZA 2BDGA 2FODA 2J4IA 3IWMA 3VB6A 3BTME 3SV6A 2FPZA 5HXFA 1AVWA 2P8OC 1Y3XA 1NC6A 3QTOH 1H8IH 2P94A 4SGBE 1CHOF 1PFXC 3JZ1B 3LH3A 3SV7A 2UUKB 3TGIE 1FMGA 2BTCE 2A7HA 2NU2E 4X2WA 5C20A 2J38A 1HAVB 1J16A 4F4OC 1GVLA 1TBQH 1VJ9U 5EG4A 4X2YA 1OWJA 2ZU1A 1TNIA 1O3EA 2GCHF 2OLGA 1GBLA 3CS0A 1C5UA 1TGNA 1GVKB 4M7GA 2CF8H 1O33A 2ZHQH 2HPQH 2ULLA 4GUXA 1QJ6B 2J2UA 4OS7A 1NFYA 4BOHA 2BMGB 5F8XA 1NFXA 1HBTH 5DO4H 2VWLA 3TLOA 2Q1JA 1FZZA 1UK4A 1ABIH 2M5TA 4GAWA 1T31A 4GLYA 3UOPA 3QUMP 2R0KA 1G2LA 1U6QA 4BAOB 4JYVH 1HV7A 1EATA 2ALPA 2BZAA 2B0FA 2HVXA 3OYPA 3MU8A 4FXGH 3SGAE 2FZZA 5GIBA 3S9AA 1DSUA 2Q6GA 1AN1E 3BTKE 4X2VA 1C2LA 2D1JA 2H5DA 3SJOA 1P2KA 3KIDU 3A84A 3ZZ8A 1TABE 1TX8A 2VWMA 2ZWLH 1QGFA 3F1SB 2D8WA 1YBWA 4TY7A 1DWBH 2FYRA 1TBRH 1KDQA 3B9FH 5FBIA 3SV9A 2ASUB 1P2MA 2FM2A 5ABWA 3C27B 3EE0B 2ZHDA 1SGCA 1OWIA 3L6PA 2AFQB 4K1EA 1SLVB 2QC2A 1MU8B 1Y3VA 4TPYA 3VGCC 1LMWB 4JZIA 5E8EH 5HM2A 3TJUA 1MCTA 2WPMS 4O3UA 3PMAB 1SVPA 4FUHA 3UR9A 3MHWU 4XBDA 1SMFE 1B0EA 1G32B 3LDXH 1V2JT 4AGKA 4ESTE 4Y6DA 2WPJS 4X8TH 4X8VH 5JBBS 1ZHRA 3TK9A 5K7RA 3U8RH 2GGVB 3K65B 4MLFB 1V2RT 2ZP0H 3F68H 3RC4A 2O8TA 3UQOA 1AFQC 1LKAA 1V2WT 2GX4A 3RXIA 2BD9A 3GY8A 1HJ8A 1F0TA 1HIAA 4KELA 4NIVA 1UK3A 3W95A 3P8FA 1BJUA 1B7XB 1FY5A 1A7SA 1BMLA 1SFIA 2AERH 3SJIA 3K2UA 5K0HA 1CT2E 1PYTD 2BQ7B 1C5PA 4D7FA 5BPEA 2CMYA 3A82A 1FQ3A 1GHZA 2H1UA 4Y7BA 3ZVFA 1C5LH 1C2GA 1CVWH 3SNAA 1V3XA 2GCTB 4Y76A 1O3FA 1IQFA 3QGNB 1H4WA 1HAZB 1AI8H 3RXBA 2NU3E 4I32A 3ZZ6A 2ZDNA 4GHTA 5DP3A 3BTTE 1AB9B 1LHCH 1J15A 2SGQE 1LDTT 1SGRE 2OC1A 3ZZ5A 2QV1A 2QF3A 1VITF 3SJKA 1DXPA 1C2FA 4O03A 1IQHA 2ZGXH 1GMDG 1KYNA 3PMBB 3A7XA 3GY4A 4UD9H 3U98H 1E36B 4CHAC 3GISB 1UO6A 1IHSH 2UUYA 4AFUA 1C5MD 3M3TA 1A5HA 2R2WU 5E2PA 1XUGA 1ZRKA 2G00A 4H6TA 4FUDA 1AU8A 3P17H 1GJ9B 3SI3H 2FOCA 3MNSA 4WXIA 2ZEBA 1UHBA 5GCHF 1K1OA 1TMUH 1DWEH 4CRBA 1ESTA 1GVZA 1DX5M 1C1OA 2B8OH 1SLUB 1QBVH 1MQ6A 5JPMH 1P0SH 1QB1A 1C2HA 3D23A 3ZVAA 8KME2 3PLPA 2VIWA 2RA0A 4OGXA 1GGDC 1DVAH 2ZU4A 3E8LA 2IPHA 1O5DH 1OX1A 1DWDH 3DFJA 1FPCH 1HRTH 1BBRK 3LU9B 3E0NB 1C1SA 5F6MA 5FAHA 2HALA 2F9NA 1XVMA 4FU9A 4ABJA 1DDJA 5DP9A 1YPLH 2A0QB 2P16A 4IN1A 4U30A 3RXHA 3UNQA 3A83A 1T4VH 1CE5A 1VCWA 1Z8JB 1OP2A 3A88A 3RXPA 2A7JA 1G37A 1S5SA 2A31A 1K2I1 1FUJA 2GT8A 2TBSA 4DGJA 3A8DA 1XMNB 3EA8A 2ZGCA 1Z8RA 5H4IB 1HDTH 4NG9H 1PPBH 2H2ZA 2QXHA 3SU0A 3UREA 4E05H 4OGYA 1AVXA 1AD8H 1TONA 1VGCB 1BOQA 5AVDA 1PPZA 1SC8U 4CR5A 2VH0A 2SGAA 1SGQE 1ESAA 1YYY1 2VIOA 4XBBA 3VPKA 7GCHF 2A7CA 1GBEA 1HGTH 1SSXA 1D3TB 3GICB 4JCNA 3O8RA 1ZZZA 1C1RA 3BEIB 3PO1B 3M7QA 2TRMA 2FWWA 1L1NA 2IOTA 5F8TA 1JXPA 1FXYA 1MCVA 3GDSA 1DLEA 3BN9A 4Q80A 1EPTB 2BD4A 1LHGH 4YZUA 1MZDA 3PB1E 1BT7A 1UVPA 5FCKA 1EJAA 3FVFB 1AUJA 1SLXB 4VGCC 1A0HB 4ZHMU 5DG6A 4ZKOU 1QRWA 4FUIA 1SBWA 1TX7A 1OWEA 3UNRA 1ZYOA 1HPGA 2Y5HA 3SGBE 1Z6EA 2JH0D 4I8LA 5LH8A 2ZIQH 1DS2E 1O3GA 4ISNA 1DITH 4DY7B 4CBNA 1O3LA 4UFFH 8LPRA 3U69H 2YOLA 3M5OA 2FOMB 3KN2A 6CHAC 2BY6X 3MMGA 4WY3A 4K1SA 1C1MA 1E0FD 2QXIA 5EOKA 2F9BH 5E0GA 1GBAA 2GDEH 4X1QU 5GPIB 4FVDA 2ZHWH 1C5NH 1JOUB 4X1RU 1GI7B 1H9IE 1NFWA 1O3JA 1Z7KA 4MNYA 1WU1A 1ZHPA 5CHAB 5JBAS 3TPIZ 1O37A 2Z9LA 1SGTA 1LHFH 4WJG2 1YCPK 1C4Y2 1O30A 4ISIH 3MNCA 1W7GH 1MTUA 1NO9H 4TY6A 1MD8A 4GVUA 1K9OE 1GJ7B 2HWLB 4Q7XA 4ZHLU 8GCHF 1CO7E 2R3UA 4HI3A 1E34B 3GCOA 3F6UH 1GI9B 3GY2A 3HKIB 1RIWB 1ETSH 1GHYH 1GHVH 2JETC 3PTBA 4AN7A 1P9SA 1RRKA 2KAIB 2ZQ2A 3TJOA 1GJAB 3ZVEA 3LKWA 1P11E 4GPGA 1BMMH 1SQAA 1O34A 3EAJA 4YM9A 1GMDF 1QA0A 2PTCE 1QNJA 1MAYA 1S6HA 1W14U 1ZLRA 4JK6A 5CMXH 2ANMH 2XBXA 3RMMH 2GCHG 4MNXA 3VXEH 4Y79A 2OC7A 1JIRA 4B73A 2TIOA 4MQAA 1AWHB 1W12U 3ZZCA 5DP4A 1NROH 3QK1A 2ZFSA 4X1SU 1B5GH 1MUEB 3VB7A 1AKSB 5SGAE 3O8CA 1D6WA 1PPEE 3ZV9A 1D6RA 1SOZA 2ANYA 1QQ4A 4CH8B 5L2YH 4QT8C 6GCHF 2P3FH 2P93A 5CE1A 5FHTA 1NY22 4A7IB 2Y81A 1EX3A 1THSH 1GJCB 1UTLM 1JRTA 4AGJA 1CBWB 1V2TT 2EC9H 3GCTF 3R3GB 1CA0B 5J4SA 3VXFH 5DP7A 2WPIS 1UK2A 1F0SA 4K8BA 3A7ZA 4WH8A 1BTXA 2GD4B 2OQ5A 2XRCA 2Y7XA 1KY9A 2ZDLA 1OWKA 1OWHA 1RJXB 1YGCH 3EA7A 1GDQA 1SG8B 2ZFPH 4DURA 2BVXH 1DLKB 1SB1H 4A92A 2TGAA 1O2IA 5EXNA 2V35A 2YNBA 1MKWH 1GPZA 4B2AA 1AFEH 3NUMA 1QL7A 3KF2A 1GI0A 3UOUA 1CGJE 2CJIA 2XBYA 3MI4A 1OYTH 3SI4H 1ABJH 2WPKS 1DFPA 1EAUA 3T28A 1ZPCA 5DK1A 4ISHH 2P8OB 1Q3XA 2OTVA 1XKAC 2BY8X 3DUXH 4DG4A 5I46H 1P03A 2VNTA 3P8GA 1L1GA 1LCYA 2BY5X 3B23B 3KQBA 4MVNA 3E6PH 3RMOH 4FUGA 2FI5E 2BDIA 1O31A 2SGEE 1QY6A 1Z8IB 2FS9A 5AHGH 2ZTZA 3RXOA 1SGYE 1UTJA 2V6NA 3MO6A 2B9LA 2XBWA 1ACBE 1W7XH 1NTPA 3OX7U 1W8BH 1S82A 1C5RA 1FAXA 1O5AB 4IN2A 1GJ6A 1BRCE 3PLKA 5DP8A 3ZZ4A 1CGHA 3LJJA 1LQEA 3F9HA 1YPMH 3F9EA 4LZ4B 2FYQA 1EOLA 1D3PB 1L0ZA 1MH0A 2HNTC 2UWLA 3O8BA 4IC6A 4DT7B 2PGQB 3SUFA 3D65E 4HZHA 2BZ6H 5LPFA 4XFQA 1VITG 1P2NA 1L4DA 4PROA 4AX9H 3OTJE 3MFJA 2EEKA 2H9HA 5A09A 2PR3A 1HAOH 3A89A 4B1TA 4TWWA 4INKA 1H1BA 1HAHH 2Y7ZA 1ARBA 2ODPA 3SW2B 3SNCA 1O2KA 2AYWA 1GBDA 1HUTH 1XUJA 1TNLA 3S69A 1KLTA 3SHAH 1C5YB 2XYAA 4ABAA 3UWIA 2FDAA 1ZR0A 1S0QA 3KGPA 2K1QA 1ELEE 3BEUA 4NA9H 4KGAA 2GP9B 2D26C 2V0BA 3LGWA 3F9FA 1N1LA 5E2OA 1FY8E 3SN8A 1C5VA 2V3OH 3GY5A 1HYLA 1QJ7B 2GVFA 1TIOA 1X7AC 1NM6A 3AAVA 1A3BH 1O3KA 2FOHA 1A46H 3RUOA 3DA9B 4X2XA 1G3EA 3SU2A 4CRDA 1S84A 4NZLA 4YOGA 1P8VC 3RMLH 1DOJA 1IQNA 2ILNA 1O2UA 3SQHE 2FOEA 2OUAA 1IQEA 2OP9A 1EZUC 3FFGA 3QTVH 4X6PA 4NSYA 3LIWA 1OYQA 2QA9E 1TRNA 1CHGA 5E0JA 1HAIH 2ZF0H 3D62A 2BLWA 3LGTA 5EQRA 4A1XA 2BQ6B 1NZQH 2RG3A 1C1UH 3MNBA 4K2YA 2I6SA 4AG1A 1N6XA 3MOCA 1TPPA 2ZPQA 2B7DH 4CRCA 1CSOE 1GBCA 5C1XA 1P10A 1TGTA 1T8LA 2AIQA 3A85A 3IITA 1ZMLA 2W7UA 1E38B 1S6FA 1HIAB 1QRXA 1FLEE 4O97A 3ZZ9A 1SGFA 1V2ST 1WQSA 2RDLA 4ISOA 3O8DA 3A8BA 7GCHG 3GDVA 1ZTKA 2ZPRA 1KXBA 5T6GA 3UQVA 2ZZUH 4IC5A 4IW4E 1YM0A 4JZFH 2XXLA 4RSPA 5G4BA 3U8TH 2WYJA 1YP9A 1GBMA 1C2MA 1RTLA 1Z6JH 5EW1H 4E06H 3I78A 1NU7B 3OSYA 2CHAC 4CHAB 1KIGH 1AO5A 4HGCA 4I33A 1NRQH 5A8ZA 3BTWE 1KTTB 5GWZA 4AFQA 4K3JA 2NU1E 2G4TA 9LPRA 2PV9B 1AE8H 2BDYA 3MO9A 2SGDE 3FANA 1TRYA 3HATH 2W7SA 1SFQB 1O32A 2ZU5A 1LTOA 4UFDH 3MU0A 3A7WA 2AGGX 1V2OT 2BLVA 1ETRH 1MTWA 2SFAA 4X1PU 3GYLB 2FOFA 1ZSJA 4Y0YE 4CREA 4DVAU 3RM0H 1P01A 3SV2H 4Q7ZA 1WYKA 4KP0A 1HAYB 1MQ5A 3U1IB 1HAVA 5A0AE 3E3TA 2FOBA 4U32A 1TE0A 1Z8GA 5C1YA 3T29A 3DFLA 1EKBB 2NU0E 3TNSA 4YLUA 4XDEA 1P2JA 1AY6H 1UCYK 3E1XB 3BG4C 1C5OH 2FIRH 1TMTH 4MPWA 1V2QT 2A32A 1O38A 1T8NA 2A5AA 1GBJA 5A0BA 2A1DB 3CENA 2TPIZ 4NCYA 2OC8A 1GHBG 1LVBA 2FOAA 2GDDA 4A5TS 5JB9S 2PGBB 1G3CA 3RXQA 1WCZA 3A7TA 1GMCF 2VJ1A 4GHQA 4E7RG 1WQVH 2Z3CA 4D8NA 1O3BA 1TBZH 3MTYA 8GCHG 5JBTA 1C1VH 1T7CA 1GBTA 2GMTB 2C93B 1G36A 1XUHA 3N7OA 1P05A 3E0PB 4OS6A 1BTPA 3BIVH 5T3HA 2Z7FE 1E35B 3UY9A 4KTUA 2JH5D 3V7TA 1KXAA 2BB4A 3MU5A 1ZPZA 3T26A 1YPHE 4NSVA 1WTGH 1O2MA 1IQLA 2BX3A 4E7NA 4YLQH 2A4GA 2BD7A 2QAAA 1VZQH 4CRFA 5HYOA 2VWOA 2Y6TA 2VIDA 4ASHA 1EAXA 3BG8A 1P2OA 3V13A 1JWTA 3U8OH 2B5TB 1SGNE 4NGAH 2F9UA 2ODQA 1FJSA 1S83A 1B0FA 4AB9A 2DUCA 3EYDA 6GCHG 1HAPH 1K28D 4X6OA 3M3SA 3RXSA 5C3NA 5C5OA 4ABGA 2XCFA 1S0RA 4D9QA 3M3VA 3GCTG 1GG6C 3NK8A 1F7ZA 6CHAB 3Q3KA 4B71A 1QCPA 1PQ8A 2PSXA 4ZMAH 2PKAB 5AF9H 1NRSH 1T4UH 3SU6A 1MTNC 1PQ7A 4KTCA 1H8DH 1EQ9A 4JZ1A 1PPGE 2WPLS 1OSSA 1XXFA 2CGAA 4LOYH 1V2VT 2XWBI 2OINA 1V2UT 4IMZA 1GI6A 1WOFA 1BHXB 1EXFA 1GI3A 3TK6A 3GOVB 2AMPA 1BCUH 2J92A 5HM9A 5EW2H 1FY1A 3MU4A 3ATWA 1BITA 3SJ8A 1ELGA 1PQAA 3Q76A 2BD8A 2ZCHP 5ESTE 1YCPH 4KTSA 1O0DH 3AAUA 2QIQA 1WTHD 1O3AA 5EGMA 3RXGA 2G52A 4WWYA 3ATIA 4OS4A 1FV9A 1VCPA 1EJNA 1ZHMA 1O3NA 1EJMA 3GCHB 3GCNA 4FUFA 1AHTH 1BJVA 4IBLH 1Z1JA 1O3PB 2ZTYA 2A4QA 1TX6A 3ODFA 5F8ZA 5C5NA 1GBIA 4ZKSU 2A5KA 5AFZH 2BD2A 2ZDKA 1DXWA 3TH2H 3TH3H 1EZQA 3LGUA 4BAQB 5EPNA 2Y80A 1UTKA 2ZI2H 1AB9C 4THNH 4ZUHA 2OBQA 1D3DB 1GI5A 7LPRA 5BRRE 4KKDA 4GCHF 3RMNH 5GXPA 1MU6B 3ZVCA 3H5CB 1C1NA 5ETXA 1GWAA 1SGDE 1VJAU 3KCGH 1O39A 2AGEX 5FCRA 4AFZA 1LVYA 2FXRA 2AH4X 2TGDA 2CV3A 2QN5T 4Q7YA 3TNTA 1PPCE 1C5WB 4HFPB 2BX4A 2A4RA 4ZKRU 1NU9A 3EDXB 3RU4E 4WMDA 1NN6A 1F5LA 2EI7A 2ZHFH 1RXPA 2V3HH 3S9CA 1HCGA 3STIA 1HNEE 1EAWA 1ZSLA 1BRUP 3RXUA 4YT7H 3VB5A 1O3OA 5FBEA 2ZC9H 1OS8A 4ZH8A 3T2NA 5L2ZH 1GHBF 1XX9A 1A1RA 2VH6A 1NRNH 1KLJH 2P95A 2O8WA 1O2TA 1PYTC 4NWKA 1XKBC 2W3KA 3UR6A 4FUEA 4K8YA 3LONA 4I8JA 3Q77A 4SGAE 1JBUH 4F49A 3PMHB 1EP6A 3SO3A 4Z0KA 3GY6A 2R3YA 4NFFA 1GBBA 1ZTLA 1A0LA 4JMYA 4NA7A 2AS9A 2BDAA 1FY3A 3P8OA 1BRBE 1O3MA 3SU5A 3TGKE 1EUFA 5HMAA 1DY9A 1ZGVA 5EPYA 1FONA 3MWIU 1O2ZA 3RXJA 3A80A 3QGJA 5C1UA 1EPTA 2G51A 2ZA5A 1L2EA 1Q31A 4XE4A 3RU4T 4IS5A 1D9IA 1BDAA 3QLPH 1Y5BT 2QGRA 2ZPSA 5FX6A 3GY7A 1NRPH 1ZMJA 3DHKH 3M37A 1NESE 4R8TB 4BANB 1TPSA 3V12A 1IQJA 3UWJH 4Y0ZE 1MTSA 1MKXK 1O36A 4AOQA 4Z6AH 2QY0B 3LPRA 4CRGA 4BTIB 2G8TA 5EU8A 3PO1C 1V6DA 3EQ0H 2H9EH 3V0XA 3A7VA 2A2XH 1KXEA 2FLBH 1O2VA 1THRH 2ZCKP 4WF8A 3MH4A 1BTHH 4X8SH 3BV9B 5TJXA 1EPTC 2ZFFH 3TK5A 4H4FA 2EI8A 3U9AH 5LGOA 3PLBA 4LZ1H 1ZJKA 1XXDA 1DUEA 4FU7A 3D49H 5LPRA 1Y3UA 2FMJA 1ID5H 4ABIA 1YC0A 1C1QA 3MH7A 1DWCH 1GHXH 3LOXA 1K1IA 3K6YA 3RXAA 1RTKA 4WMEA 1FDPA 2ZDAH 3ZZBA 1ELVA 1N8OB 2GT7A 1GL1A 2IJOB 2VGCC 3W94A 4NA8A 2ALVA 1AZZA 1M9UA 2ZDVH 1LQDB 1NFUA 1QFKH 2UUJB 4H6SB 3RLWH 5IDKA 1J9CH 1GHWH 3ZYEA 4AYVB 1LHEH 2BY7X 1QR3E 4NFEA 1T8MA 2SGFE 1EZXC 2RCEA 1S85A 4BAHB 1ZTJA 3TJNA 2KAIA 1BMAA 3NKKA 1YLCA 3HKJB 1PPFE 1XUFA 3KHVA 1XVOA 1IQMA 1BTZA 1O2HA 1C2IA 2FLRH 2BOKA 2ZQ1A 2DE8A 1QRZA 3RXEA 4TYDA 1WUNH 2BD5A 2QF0A 1YPJH 1G9IE 2ZG0H 1A5IA 1DY8A 3ZZ7A 3I77A 1AKSA 2R2MB 3TITA 5J4QA 1O35A 2SGPE 3E90B 1O2QA 4OS1A 4AG2A 1RIWC 4ISLA 1K1NA 3T62A 2BY9X 2HOBA 1GBHA 1GMCG 3KEEA 1UTOA 3CP7A 3GYMA 2UWOA 3ATMA 2BDBA 3GY3A 1MBQA 1S81A 1T32A 1FN6A 2ZFRH 1V2MT 2PTNA 2WINI 1KTSB 1ETTH 1Y3WA 4J2YB 4UEHH 3TU7H 2ZU2A 3ZZ3A 1H9LB 2H9TH 4J1YA 2G55A 2PFEA 1HAGE 1SLWB 4WVPE 1F2SE 3HGNA 4D7GA 5F03A 1TNJA 3KQDA 3ATLA 4BNRA 2BHGA 3QDZB 2PW8H 2IN2A 3UFAA 3NXPA 4ABEA 1DM4B 1IQGA 5TCCA 1ELTA 1P2IA 3CS7A 1C9TA 1GI2A 1VITH 5DPAA 2PLXA 2XNIA 2H6MA 2VIPA 1AVGH 1WAYB 2J9NA 3UIRA 5TCAA 4MPVA 3ENSB 1CBWC 1LVOA 4U2WA 3DT0H 3M36A 3RLYH 2PKSC 2OC0A 1ELBA 1SGIB 3R0FA 5FPTA 9ESTA 3VGCB 3TIUA 3S7KB 3HK3B 1AWFH 4FVBA 2YNAA 2XW9A 2Z94A 1THPB 1LVMA 1TOCB 1LPZB 4X6NA 4BXWA 2HLCA 3RXLA 2C8WB 3RXFA 1EB1H 1P3CA 1GCTC 1BIOA 1F5RA 1KDQB 1QB6A 2Y5GA 5A0CA 3SUEA 4JYTA 2TGPZ 4B76A 2ZHEH 1GI8B 1AFQB 1DICA 2Z9KA 3NZIA 2NWNA 4Y71A 5JB8S 1O5CB 1C4U2 1TYNA 3NPSA 1UCYH 2PHBA 2Y82A 3ZYDA 2ZFTA 3TJVA 4H42U 1G2MA 5L30H 3SOSA 1O2OA 2R0LA 3GDUA 1ZMNA 1EASA 2WPHS 4LXBH 3WY8A 1ANCA 1E37B 3M5LA 4UONA 2G5VA 1QB9A 1IOEA 3ODDA 1HXFH
chains in the Genus database with same CATH superfamily
2VVCA 1BA8B 4I8HA 1G30B 4NIYA 1EB2A 1FN8A 4MPUA 1C1PA 2VB0A 1SR5C 4WMFA 3PROA 4BAMB 1ZPBA 1FAKH 1AE5A 1TNHA 2FOGA 2C90B 2UWPA 3TGJE 2PWXA 2QCYA 1O2YA 4NWLA 5C2ZA 2FTMA 2AGIX 4INLA 1SL3A 4Z1MD 1TPAE 1C5ZB 1J8AA 4YOJA 4MG3A 1UVTH 4AC9A 2XC5A 3A86A 1SHHB 1F5KU 5ESBA 5DP5A 2ANKH 1XM1A 3FZDA 1QTFA 3RXTA 3MH6A 3SNDA 1RFNA 3A87A 1W2KH 1TA2A 3EE7A 1MZAA 2F9VA 3W1EA 3LC5A 1GI1A 1COWD 1BHXF 3VFEA 4GCHG 2EA3A 3L33A 1SQRA 5E0HA 3RXCA 2FEQH 2ZKSA 1L1JA 3UUZA 5KEDA 3URCA 1XUIA 2ZGJA 4F55A 2GZ7A 2F9OA 3KNXA 1HJAC 3H7TA 1O2JA 1MBMA 1LHDH 1O2SA 2FI4E 3B8JA 1GDNA 3BSQA 3TH4H 3RDZA 4XSKU 3QZQA 1C5XB 3M5NA 1GG6B 3T25A 1SOTA 5T6DA 1SPJA 1DE7H 1JRSA 3RXKA 3FP7E 1GGDB 2VWNA 1TGSZ 4OS5A 1QBNA 2W3IA 5JYIA 1V2PT 1G3BA 2FS8A 3SZEA 1TNGA 3ATKA 3PV2A 6LPRA 4D9RA 1RS0A 3E16B 5HGGA 1MTNB 1O3DA 2PUXB 1PJPA 4CBOA 3PMJA 2C8XB 4MPXA 1UVSH 4MDSA 3FP8E 5GDSH 2AMQA 2Z9IA 1UHBB 1GBFA 2OBOA 1WSSH 1BBRH 1QA7A 1F92A 4IGDA 2OD3B 7ESTE 2ZDMA 3UB0A 1C1WH 4R0IA 4I8KA 4B75A 1ZOMA 3LT3A 3P6ZB 4MNWA 4GSOA 1TRMA 3SGQE 1SGEE 2J94A 4O3TA 1TOMH 4Y8ZA 4LK4A 3ZV8A 1UTMA 2ESTE 4K69A 2BM2A 2R9PA 3KL6A 1YPEH 2EY4C 4ZROA 4NZQA 3KQEA 1CU1A 3SHCH 2G5NA 1IQKA 2ZNKH 2VINA 1GJ4H 2F83A 2LNCA 1XUKA 2ZO3H 3MH5A 1KXDA 1FX0B 2GZ9A 3RM2H 3QO6A 2Z3EA 3M7TA 3PV4A 2STBE 3RC6A 1A0JA 4YESB 1OOKB 1BRAA 1Z71A 5AFYH 1VKYA 4BXSA 1YF4A 2FI3E 3I29A 3LGYA 4I8GA 1NT1A 1NBME 1T8OA 1D3QB 1IHTH 1LPGB 1OPHB 3VB3A 5IYTA 4ZXXH 3ZVDA 1WDIA 2F9PA 2LPRA 3AW1A 2BLQA 3T5FH 4B74A 1GMHF 1K21H 3T27A 4VGCB 3M61U 1BTYA 1SGFG 1SI5H 1UJ1A 1V2LT 5EODA 1AGJA 2ZCLP 5FPYA 3BTDE 2WYGA 4Q2KA 1ANBA 1NRRH 4BTUB 2G4UA 2BQWB 4ABHA 2LP6A 1O5FH 2O8MA 3P95A 3P70B 4Y7AA 5T6FA 1ELAA 4MTBA 3SJ9A 3SNEA 2WV5A 1C5TA 1O3IA 3WWFA 2ZTXA 3Q3YA 1C2KA 1AMHA 1TLDA 2XTTB 2BVSH 4ABFA 3LGVA 1YKTA 2FP7B 1BQYA 2HGTH 2Z9GA 1ELFA 2YMSD 2HPPH 2WUBA 3SBKA 1GHAF 1Y5AT 3ITIA 3SORA 1UCYE 3A8AA 2PSYA 1F0UA 3SV8A 4AFSA 3RXVA 5L6NH 2HNTE 4MNVA 4I31A 4JYUH 1F0RA 1ZJDA 3MU1A 4CR9A 2ODYB 5EQSA 1L4ZA 1MTVA 3KQCA 1AUTC 1QHRB 2BXTH 1UTNA 1O2XA 4JZDH 1RGQA 2ZU3A 3LH1A 2AIPA 1HAXB 1NPMA 1TMBH 2P3TB 2D2DA 1EAIA 1O2NA 2HNTF 2A4OA 4XBCA 2RA3A 3VB4A 1O2RA 2JETB 4FUBA 4X6MA 5I25A 4TT3D 1O2WA 3RXMA 2ZECA 4K5ZA 4BAKB 1TALA 6ESTA 3URDA 1QIXB 2BDCA 1O3HA 4X0WU 4K60A 4FUCA 2KM0A 2F43B 1P2QA 1GJDB 1UTQA 2WUCA 2GV7A 3EGKH 2BLOA 3M5MA 3G01A 4B6FA 2GCTC 1D4PB 1C5SA 3MYWA 2GMTC 1BTWA 2Z3DA 1P12E 4B2CA 1K1JA 1Y5UT 1V2NT 5B6OA 1ESBA 1WV7H 4HG6A 5EXLA 3RP2A 7KMEH 2VIQA 1VCQA 4AZ2B 2BDHA 1JMOH 2L6OA 3BEFB 3PM3A 4I86A 4A6LA 5FX5A 3SUDA 1W13U 1BUIA 2QXGA 1MKXH 2VVVA 4XOJA 3Q00A 1W0YH 1DT2A 1QJ1B 1SQTA 4ZAEA 5GJ4B 3M7UA 3QX5H 2JKHA 1ORFA 2JH6D 2PKAA 3OEED 3BTHE 1P09A 4XRNA 4INHA 1C2DA 3SUGA 5A2MH 4ASUD 3A8CA 1DANH 2THFB 1LPKB 4JK5A 3FAOA 4X1NU 1KMHB 3LJOA 4CH2B 3RXRA 1BBRE 3KYGA 1GCDA 2VGCB 3K9XB 4OM9A 4DIIH 3PWCA 4YT6H 3K6ZA 4NIXA 2P59A 2VU8E 1O5BB 1G3DA 1SGPE 1EZSC 3DD2H 1KLIH 1GJ5H 4ZHAA 4YO9A 1OKXA 1K22H 4AB8A 4YTAA 1GI4A 3QWCH 3SYJA 3UPEA 1YPGH 3AASA 1YCPM 4ABDA 2FX4A 4FUJA 5C17A 3U1JB 5EQQA 1K1MA 1LKBA 1Z1IA 1OP0A 1MD7A 2K8IA 3P92A 2A2QH 5FXLA 1PQ5A 2AEIH 1TFXA 1W3CA 3HGPA 5HKKD 1FNIA 3IG6B 2OCVB 2Q6DA 4B2BA 1K1PA 4DW2U 1CT4E 2WV9A 4FETA 1J14A 1FY4A 2C3SA 1N6YA 1YLDA 1TGCA 1GJBB 3BF6H 3PTNA 2CXVA 1W10U 1CHOG 1TB6H 1VGCC 2Y5FA 1TA6A 1CA8B 1FPHH 5EXMA 1DPOA 4IMQA 2DE9A 2VIVA 1EOJA 1Y3YA 1C2EA 3S7HB 2UUFB 1FI8A 1TAWA 4UDWH 1P06A 3LC3A 2W5EA 1ZSKA 3GCHC 2BYAX 1HXEH 3UTUH 4CRAA 2Q6FA 2Z9JA 1INCA 5FPSA 1TGBA 2HRVA 3AVZA 3VEQB 1A3EH 1QL9A 2QXJA 3ZVBA 4RN6A 1ANDA 1NS3A 2BOHB 2Z6BD 4X8UH 5C67A 3S0NA 3RU4D 1J17T 1W11U 1AIXH 4Y8YA 1O3CA 1GBKA 3QZRA 1TQ7B 2F3CE 1V2KT 1P57B 1O5GH 2ANWA 1RD3B 2A45B 3M35A 3QN7A 1Q2WA 4DOQA 2ZGHA 4Y11E 3BTGE 1C9PA 4UFEH 5DKMA 3HK6B 1QURH 5A8YA 8ESTE 4K1TA 2BD3A 2C8YB 1ELCA 3ZZAA 5DJ7A 1C2JA 4FU8A 5JBCS 2XC4A 2JJ1D 4OS2A 3PYHA 4BTTB 2C8ZB 2CF9H 4DJZB 2PKSB 1OHHD 1CGIE 1A5GH 5PTPA 2GKVE 5LPEA 1VR1H 2ZFQH 3FP6E 1OP8A 2GZ8A 4WXVA 3AW0A 3OY6U 4UE7H 4YOIA 2EI6A 3F9GA 1WBGB 1W0ZU 2A5IA 1GCTB 2STAE 3ELAH 4WH6A 5CHAC 3BTQE 2P3UB 4AORA 1KXCA 3P8NA 1HJ9A 1PPHE 2TGTA 3STJA 3OTPA 2O8LA 4Y8XA 2BXUH 4ZXYH 3LGIA 1TPOA 3OU0A 1BMNH 3MNXA 4I7YH 4RKOB 1YPHC 1HLTH 3C1KA 1A2CH 1A61H 4UFGH 1KXFA 2F91A 1UTPA 2FTLE 2J95A 3A7YA 1MMJN 2FO9A 1GDUA 2SNVA 2RDEA 3E91A 2XCNA 5F53A 4F48B 4ABBA 1TWXB 1EP5A 2O9QA 1K1LA 4Y10E 1IQIA 1TNKA 1TQ0B 1OXGA 2GTBA 4RKJB 3HPTB 4D76A 1SHYA 1P3EA 2VVUA 1C5QA 3ESTA 2W26A 5JDUB 3OY5U 4TPIZ 1AQ7A 1BB0B 3SU3A 4O9VA 1LO6A 1SQOA 1O2PA 3L3TA 3RXDA 1O5EH 2AMDA 1C1TA 1BTUA 4U01A 3BIUH 1RTFB 1QQUA 1UVOA 2BVRH 2GV6A 2XC0A 4TWYA 4JZEH 2V7QD 1JIMA 1Y8TA 4AYYB 2SNWA 2OQUA 4A1TA 3NWUA 1H9HE 3JZ2B 5DGJA 1A4WH 1UVUH 2WZQA 3UNSA 2CHAB 3SQEE 1Y59T 2I6QA 4ZKNU 1IAUA 2HLDD 5A8XA 1GL0E 5DP6A 4DCDA 3SU4A 3RC5A 1O2GH 1GJ8B 2ZGBH 1ELDE 3Q3XA 1GMHG 1P02A 2XWAA 1QL8A 1ARCA 1CA0C 3ZZDA 3BTEE 2G81E 1DUAA 3V3MA 1O2LA 3SU1A 2H5CA 2XBVA 1CQQA 5KGOA 4A1VA 1ZRBA 1HJAB 2C4FH 3EA9A 3PWBA 2OXSA 3TVJB 1CT0E 1MKWK 3S9BA 1AZ8A 1UMAH 1P04A 1N8OC 3SZNA 5EJZA 4ACAA 1ANEA 3H7OA 3ZVGA 1HB0B 4HTCH 1HFDA 2O8UA 1YPKH 3BTFE 3F2GA 2J34A 2FX6A 3SNBA 1C4V2 1DSTA 1P9UA 3MO3A 2NU4E 1FIWA 1ZGIA 2FESH 2CN0H 2WV4A 1MAXA 3A81A 1KSNA 3NCLA 2PUQH 1GHAG 3FZZA 2QYIA 3BG4B 4NIWA 5GCHG 1BZXE 4ACBA 4DIHH 1QBOA 1OWDA 1FIZA 2BDGA 2FODA 2J4IA 3IWMA 3VB6A 3BTME 3SV6A 2FPZA 4Q63A 5HXFA 1AVWA 2P8OC 1Y3XA 1NC6A 2QF5A 3QTOH 1H8IH 2P94A 4SGBE 1CHOF 1PFXC 3JZ1B 3LH3A 3SV7A 2UUKB 3TGIE 1FMGA 2BTCE 2A7HA 2NU2E 4X2WA 5C20A 2J38A 1HAVB 1J16A 4F4OC 1GVLA 1TBQH 1VJ9U 5EG4A 4X2YA 1OWJA 2ZU1A 1TNIA 1O3EA 2GCHF 2OLGA 1GBLA 3CS0A 1C5UA 1TGNA 1GVKB 4M7GA 2CF8H 1O33A 2ZHQH 2HPQH 2ULLA 4GUXA 1QJ6B 2J2UA 4OS7A 1NFYA 4BOHA 2BMGB 5F8XA 1NFXA 1HBTH 5DO4H 2VWLA 3TLOA 2Q1JA 1FZZA 1UK4A 1ABIH 2M5TA 4GAWA 1T31A 4GLYA 3UOPA 3QUMP 3NRLA 2R0KA 1G2LA 1U6QA 4P00A 4BAOB 4JYVH 1HV7A 4RI0A 2VBCA 1EATA 2ALPA 2BZAA 2B0FA 2HVXA 3OYPA 3MU8A 4FXGH 3SGAE 2FZZA 5GIBA 3S9AA 1DSUA 2Q6GA 1AN1E 3BTKE 4X2VA 1C2LA 2D1JA 2H5DA 3SJOA 1P2KA 2J98A 3KIDU 3A84A 3ZZ8A 2IJD1 1H8HD 1TABE 1TX8A 2VWMA 3VG8A 3OE7D 2ZWLH 1QGFA 3F1SB 2D8WA 1YBWA 4TY7A 1DWBH 2FYRA 1TBRH 1KDQA 3B9FH 5FBIA 3SV9A 2ASUB 1P2MA 2FM2A 5ABWA 3C27B 3EE0B 2ZHDA 1SGCA 1OWIA 3L6PA 2AFQB 4K1EA 1SLVB 2QC2A 2M2AA 1MU8B 1Y3VA 4TPYA 3VGCC 5IK2D 1LMWB 4JZIA 5E8EH 5HM2A 3TJUA 1MCTA 2WPMS 4O3UA 3PMAB 1SVPA 2KCPA 3FOAA 4FUHA 3UR9A 3MHWU 4XBDA 1SMFE 4B6EA 1B0EA 1G32B 3LDXH 1V2JT 3PRBA 2WHXA 4AGKA 4ESTE 4Y6DA 2WPJS 4X8TH 4X8VH 5JBBS 1ZHRA 3TK9A 5K7RA 3U8RH 2GGVB 3K65B 4MLFB 1V2RT 2ZP0H 3F68H 3RC4A 2O8TA 3UQOA 1AFQC 1LKAA 1V2WT 2GX4A 3RXIA 2BD9A 3GY8A 1HJ8A 1F0TA 1HIAA 4KELA 4NIVA 1UK3A 3W95A 3P8FA 1BJUA 1B7XB 1FY5A 1A7SA 1BMLA 1SFIA 2AERH 3SJIA 3K2UA 5K0HA 1CT2E 1PYTD 2BQ7B 1C5PA 4D7FA 5BPEA 2CMYA 3A82A 1FQ3A 1GHZA 2H1UA 4Y7BA 3ZVFA 1C5LH 1C2GA 1CVWH 3SNAA 1V3XA 2GCTB 4Y76A 1O3FA 1IQFA 3QGNB 1H4WA 1HAZB 1AI8H 3RXBA 3U28C 2NU3E 4I32A 3ZZ6A 2ZDNA 4GHTA 5DP3A 3BTTE 1AB9B 1LHCH 1J15A 2SGQE 1LDTT 1SGRE 2OC1A 3ZZ5A 2QV1A 2QF3A 1VITF 3SJKA 1DXPA 1C2FA 4O03A 1IQHA 2ZGXH 1GMDG 3DSPA 1KYNA 3PMBB 3A7XA 3GY4A 4UD9H 3U98H 1SKYE 1E36B 3OAAD 4CHAC 3GISB 1UO6A 1IHSH 2UUYA 4AFUA 3KQ5A 1C5MD 3M3TA 1A5HA 3F0OA 2R2WU 5E2PA 1XUGA 1ZRKA 2G00A 4H6TA 4FUDA 1AU8A 3DSOA 3P17H 1GJ9B 3SI3H 2FOCA 3MNSA 4WXIA 2ZEBA 1UHBA 5GCHF 1K1OA 1TMUH 1DWEH 3WWBA 4CRBA 1ESTA 2AHME 1GVZA 2RFKC 5C0TA 1DX5M 1C1OA 2B8OH 1SLUB 1QBVH 1MQ6A 5JPMH 1P0SH 1QB1A 1C2HA 3D23A 3ZVAA 8KME2 3PLPA 2LELA 2VIWA 2RA0A 4OGXA 1GGDC 1DVAH 2ZU4A 3E8LA 2IPHA 1O5DH 1OX1A 1DWDH 3DFJA 1FPCH 1HRTH 1BBRK 3LU9B 3E0NB 1C1SA 3F2HA 5F6MA 5FAHA 2HALA 2F9NA 1XVMA 4FU9A 4ABJA 1DDJA 5DP9A 4Q4LA 1YPLH 2A0QB 2P16A 4IN1A 4U30A 3RXHA 3UNQA 3A83A 1T4VH 1CE5A 1VCWA 1Z8JB 2JDID 1OP2A 3A88A 3RXPA 2A7JA 1G37A 1S5SA 2A31A 1K2I1 1FUJA 2GT8A 2TBSA 4DGJA 3A8DA 1XMNB 3EA8A 1NBMD 2ZGCA 1Z8RA 5H4IB 1HDTH 4NG9H 1PPBH 2H2ZA 2QXHA 5EJ1A 2WPDD 3SU0A 3UREA 4E05H 4OGYA 1AVXA 1AD8H 1TONA 1VGCB 1BOQA 5AVDA 1PPZA 1SC8U 4CR5A 2VH0A 2SGAA 1SGQE 1K0HA 1ESAA 1YYY1 2VIOA 4XBBA 3VPKA 7GCHF 2A7CA 1GBEA 1HGTH 1SSXA 1D3TB 3GICB 4JCNA 3O8RA 1ZZZA 1C1RA 3BEIB 3PO1B 3M7QA 2TRMA 2FWWA 1L1NA 2IOTA 5F8TA 1JXPA 1FXYA 1MCVA 3GDSA 1DLEA 3BN9A 2GJGA 4Q80A 1EPTB 2BD4A 1LHGH 4YZUA 1MZDA 3PB1E 1BT7A 1UVPA 5FCKA 5C0UA 1EJAA 3FVFB 1AUJA 1SLXB 4VGCC 1A0HB 4ZHMU 3WW7A 5DG6A 4ZKOU 1QRWA 4FUIA 4RT0A 1SBWA 1TX7A 1OWEA 3UNRA 1ZYOA 1HPGA 2Y5HA 3SGBE 1Z6EA 2JH0D 4I8LA 5LH8A 2ZIQH 1DS2E 1O3GA 4ISNA 1DITH 4DY7B 4CBNA 1O3LA 4UFFH 8LPRA 3U69H 2YOLA 3M5OA 2FOMB 3KN2A 3MQKC 6CHAC 2BY6X 3MMGA 4WY3A 4K1SA 1C1MA 1E0FD 2QXIA 5EOKA 2F9BH 5E0GA 1GBAA 2GDEH 4X1QU 5GPIB 4FVDA 2ZHWH 1C5NH 1JOUB 4X1RU 1GI7B 1H9IE 1NFWA 1O3JA 1Z7KA 4MNYA 1WU1A 1ZHPA 5CHAB 5JBAS 3TPIZ 3AK5A 1O37A 2Z9LA 1SGTA 1LHFH 4WJG2 1YCPK 1C4Y2 1O30A 4ISIH 3MNCA 1W7GH 1MTUA 1NO9H 4TY6A 1MD8A 4GVUA 1K9OE 1GJ7B 2HWLB 4Q7XA 4ZHLU 8GCHF 1CO7E 2R3UA 4HI3A 1E34B 3GCOA 2K0QA 3F6UH 1GI9B 3GY2A 3HKIB 1RIWB 1ETSH 1GHYH 1GHVH 2JETC 3PTBA 4AN7A 1P9SA 1RRKA 2KAIB 2W6JD 2ZQ2A 3TJOA 1GJAB 3ZVEA 3LKWA 1P11E 4GPGA 1BMMH 1SQAA 1O34A 3EAJA 4YM9A 1GMDF 1QA0A 2PTCE 1QNJA 1MAYA 1S6HA 1W14U 1ZLRA 5T1VA 4JK6A 5CMXH 2JIZD 2ANMH 2XBXA 3RMMH 2GCHG 4MNXA 3VXEH 4Y79A 2OC7A 1JIRA 4B73A 2TIOA 4MQAA 1AWHB 1W12U 3ZZCA 5DP4A 1NROH 3QK1A 2ZFSA 4X1SU 1B5GH 1MUEB 3VB7A 1AKSB 5SGAE 3O8CA 1D6WA 1PPEE 3ZV9A 1D6RA 1SOZA 2ANYA 1QQ4A 4CH8B 5L2YH 2KX4A 4QT8C 6GCHF 2P3FH 2P93A 5CE1A 5FHTA 1NY22 5KECA 4A7IB 2YMSC 2Y81A 1EX3A 1H8ED 1THSH 1GJCB 1UTLM 1JRTA 4AGJA 3PRDA 1CBWB 1V2TT 2EC9H 3GCTF 3R3GB 1CA0B 5J4SA 3VXFH 5DP7A 2WPIS 1UK2A 1F0SA 4K8BA 3A7ZA 4WH8A 1BTXA 2GD4B 2OQ5A 2XRCA 2Y7XA 1KY9A 2ZDLA 1OWKA 1OWHA 1RJXB 1YGCH 3EA7A 1GDQA 1SG8B 2ZFPH 4DURA 3ZIAD 2BVXH 1DLKB 1SB1H 2J5UA 4A92A 2TGAA 1O2IA 5EXNA 2V35A 2YNBA 1MKWH 1GPZA 4B2AA 3UAIC 1AFEH 3NUMA 1QL7A 3KF2A 1GI0A 3UOUA 1CGJE 2CJIA 2XBYA 4M9FA 3MI4A 1OYTH 3SI4H 3OFND 1ABJH 2WPKS 1DFPA 1EAUA 3T28A 1ZPCA 5DK1A 4ISHH 2P8OB 1Q3XA 2OTVA 1XKAC 2BY8X 3DUXH 4DG4A 5I46H 1P03A 2VNTA 3P8GA 1L1GA 1LCYA 2BY5X 3B23B 3KQBA 4MVNA 3E6PH 3RMOH 2KR7A 4FUGA 2FI5E 2BDIA 1O31A 2SGEE 1QY6A 1Z8IB 2FS9A 5AHGH 2ZTZA 3RXOA 1SGYE 1UTJA 3FKSD 2V6NA 3MO6A 2B9LA 2XBWA 1ACBE 1W7XH 1NTPA 3N7EA 3OX7U 1W8BH 1S82A 1C5RA 5GNDA 2F4LA 1FAXA 1O5AB 4IN2A 1GJ6A 1BRCE 3PLKA 5DP8A 1UW7A 3ZZ4A 1CGHA 3LJJA 1LQEA 3F9HA 1YPMH 3F9EA 4LZ4B 2FYQA 1EOLA 1D3PB 1E79D 1L0ZA 1MH0A 2HNTC 2UWLA 3O8BA 4IC6A 4DT7B 2PGQB 3SUFA 2JJ2D 3D65E 4HZHA 2BZ6H 5LPFA 4XFQA 1VITG 1P2NA 1L4DA 4PROA 4AX9H 3OTJE 2XOKD 3MFJA 2EEKA 2H9HA 5A09A 2PR3A 1HAOH 3A89A 4B1TA 4TWWA 4INKA 1H1BA 1HAHH 2Y7ZA 1ARBA 2ODPA 3SW2B 3SNCA 1O2KA 2AYWA 1GBDA 1HUTH 1XUJA 1TNLA 3S69A 1KLTA 3SHAH 1C5YB 2XYAA 4ABAA 3UWIA 2FDAA 1ZR0A 1S0QA 3KGPA 2K1QA 1ELEE 3BEUA 4NA9H 4KGAA 2GP9B 2D26C 2V0BA 3PV5A 3LGWA 3F9FA 1N1LA 5E2OA 1FY8E 3SN8A 1C5VA 2V3OH 3GY5A 1HYLA 1QJ7B 2GVFA 1TIOA 1W0JD 1X7AC 1NM6A 3AAVA 1A3BH 1YWUA 1O3KA 2FOHA 1A46H 3RUOA 3DA9B 4X2XA 1G3EA 3SU2A 4CRDA 1S84A 4NZLA 4YOGA 1P8VC 3RMLH 1DOJA 1IQNA 2ILNA 1O2UA 3SQHE 2FOEA 2OUAA 3N7DA 1IQEA 2OP9A 1EZUC 3FFGA 3QTVH 4X6PA 4NSYA 3LIWA 1OYQA 2QA9E 2IPQX 1TRNA 1CHGA 5E0JA 1HAIH 2ZF0H 3D62A 2BLWA 3LGTA 5EQRA 4A1XA 2BQ6B 1E1QD 1NZQH 2RG3A 1C1UH 3MNBA 4K2YA 2I6SA 4AG1A 1N6XA 3MOCA 1TPPA 2ZPQA 2B7DH 4CRCA 5CDFE 1CSOE 1GBCA 5C1XA 1P10A 1TGTA 1T8LA 2AIQA 3A85A 3IITA 1ZMLA 2W7UA 1E38B 1S6FA 1HIAB 1QRXA 1FLEE 4O97A 3ZZ9A 1SGFA 1V2ST 1WQSA 2RDLA 4ISOA 3O8DA 3A8BA 7GCHG 3GDVA 1ZTKA 2ZPRA 5EIYA 1KXBA 5T6GA 3UQVA 2ZZUH 4IC5A 4IW4E 1YM0A 4JZFH 2XXLA 4RSPA 5G4BA 3U8TH 4DT4A 5B6LA 2WYJA 1YP9A 1C2MA 1GBMA 5FL7D 1RTLA 1Z6JH 5EW1H 4E06H 3I78A 1NU7B 3OSYA 2CHAC 4CHAB 1KIGH 1AO5A 4HGCA 4I33A 1NRQH 5A8ZA 3BTWE 1KTTB 5GWZA 4AFQA 4K3JA 2NU1E 2G4TA 9LPRA 2PV9B 1AE8H 2BDYA 3MO9A 2SGDE 3FANA 1TRYA 3HATH 2W7SA 1SFQB 1O32A 2ZU5A 1LTOA 4UFDH 4TSFD 3MU0A 3A7WA 2AGGX 1V2OT 2BLVA 1ETRH 1MTWA 2SFAA 4X1PU 3GYLB 2FOFA 1ZSJA 4Y0YE 4CREA 4DVAU 5HIYA 1BMFD 2QE7D 1P01A 3RM0H 3SV2H 4Q7ZA 1WYKA 4KP0A 2KZ4A 1HAYB 1MQ5A 3U1IB 1HAVA 5A0AE 3E3TA 2FOBA 4U32A 1EFRD 1TE0A 1Z8GA 5C1YA 3T29A 3DFLA 1EKBB 2NU0E 3TNSA 4YLUA 4XDEA 1P2JA 1AY6H 3KYFA 1UCYK 3E1XB 3BG4C 1C5OH 2FIRH 1TMTH 4MPWA 1V2QT 4RT1A 2A32A 2A5AA 1O38A 1T8NA 1GBJA 5A0BA 2A1DB 3CENA 2TPIZ 4NCYA 2OC8A 1GHBG 1LVBA 2FOAA 2GDDA 4A5TS 5JB9S 2PGBB 1G3CA 3RXQA 1WCZA 3A7TA 1GMCF 2VJ1A 4GHQA 4E7RG 1WQVH 4ZCNA 2Z3CA 4D8NA 1O3BA 1TBZH 3MTYA 8GCHG 5JBTA 1C1VH 1T7CA 1GBTA 2GMTB 1S6LA 2J97A 2C93B 1G36A 1XUHA 3N7OA 1P05A 3E0PB 4OS6A 1BTPA 3BIVH 5T3HA 2Z7FE 1E35B 3UY9A 4KTUA 2JH5D 3V7TA 1KXAA 2BB4A 3MU5A 1ZPZA 3T26A 1YPHE 4NSVA 1WTGH 1O2MA 1IQLA 2BX3A 2KCYA 2QF4A 4E7NA 4YLQH 2A4GA 2BD7A 2QAAA 1VZQH 4CRFA 5HYOA 2VWOA 2Y6TA 2VIDA 4ASHA 1EAXA 3BG8A 1P2OA 3V13A 1JWTA 3U8OH 2B5TB 1SGNE 4NGAH 2F9UA 2ODQA 1FJSA 1S83A 1B0FA 4AB9A 2DUCA 3EYDA 6GCHG 1HAPH 1K28D 4X6OA 3M3SA 3RXSA 5C3NA 5C5OA 4ABGA 2XCFA 1S0RA 4D9QA 5DSFA 3M3VA 3GCTG 1GG6C 3NK8A 1F7ZA 6CHAB 3Q3KA 4B71A 1QCPA 1PQ8A 2PSXA 4ZMAH 2PKAB 5AF9H 1NRSH 1T4UH 3SU6A 1MTNC 1PQ7A 4KTCA 1H8DH 1EQ9A 4JZ1A 1PPGE 2WPLS 1OSSA 1XXFA 2CGAA 4LOYH 1V2VT 2XWBI 2OINA 1V2UT 4IMZA 1GI6A 1WOFA 1BHXB 1EXFA 1GI3A 2OK5A 3TK6A 3GOVB 2AMPA 1BCUH 2J92A 5HM9A 5EW2H 1FY1A 3MU4A 3ATWA 1BITA 3SJ8A 1ELGA 1PQAA 3Q76A 2BD8A 2ZCHP 5ESTE 1YCPH 4KTSA 1O0DH 3AAUA 2QIQA 1W0KD 3FO8D 1WTHD 1O3AA 5EGMA 3RXGA 2G52A 4WWYA 3ATIA 4FOUC 4OS4A 1FV9A 1VCPA 1EJNA 1ZHMA 1O3NA 1EJMA 3GCHB 3GCNA 4FUFA 1AHTH 1BJVA 4IBLH 1Z1JA 1O3PB 2ZTYA 2A4QA 1TX6A 1MABB 3ODFA 5F8ZA 5C5NA 1GBIA 4ZKSU 2A5KA 5AFZH 3DCLA 2BD2A 2ZDKA 1DXWA 3TH2H 3TH3H 1EZQA 3LGUA 4BAQB 2XNDD 5EPNA 2Y80A 1UTKA 2ZI2H 1AB9C 4THNH 4ZUHA 2OBQA 1D3DB 1GI5A 7LPRA 5BRRE 4KKDA 4GCHF 3RMNH 3GS9A 5GXPA 1MU6B 3ZVCA 3H5CB 1C1NA 5ETXA 1GWAA 1SGDE 1VJAU 3KCGH 1O39A 2AGEX 5FCRA 2YMSB 4AFZA 1LVYA 2FXRA 2AH4X 2TGDA 2CV3A 2WSSD 2QN5T 4Q7YA 3TNTA 3FN8A 1PPCE 1C5WB 4HFPB 2BX4A 2A4RA 4ZKRU 1NU9A 3EDXB 3F3BA 3RU4E 4WMDA 1NN6A 5HIZA 1F5LA 2EI7A 2ZHFH 1RXPA 2V3HH 3S9CA 1HCGA 3STIA 1HNEE 1EAWA 1ZSLA 1BRUP 3RXUA 4YT7H 3VB5A 1O3OA 5FBEA 2ZC9H 3N99A 1OS8A 4ZH8A 3T2NA 5L2ZH 1GHBF 1XX9A 1A1RA 2VH6A 1NRNH 1KLJH 2P95A 2O8WA 1O2TA 1PYTC 4NWKA 1XKBC 2W3KA 1QZ8A 3UR6A 4FUEA 4K8YA 3LONA 1YLNA 4I8JA 3Q77A 4SGAE 1JBUH 4F49A 3PMHB 2V3MA 1EP6A 3SO3A 4Z0KA 3GY6A 2R3YA 4NFFA 1GBBA 1ZTLA 1A0LA 4JMYA 2CK3D 4NA7A 2AS9A 2BDAA 1FY3A 3P8OA 1BRBE 1O3MA 3SU5A 3TGKE 1EUFA 5HMAA 1DY9A 1ZGVA 5EPYA 1FONA 3MWIU 1O2ZA 3RXJA 3A80A 3QGJA 5C1UA 1EPTA 2G51A 2ZA5A 1L2EA 1Q31A 4XE4A 3RU4T 4IS5A 1D9IA 3CNRA 1BDAA 3H09A 3QLPH 1Y5BT 2QGRA 3DSGA 2ZPSA 5FX6A 3GY7A 1NRPH 1ZMJA 3DHKH 2KCOA 3M37A 1NESE 4R8TB 4BANB 1TPSA 3V12A 1IQJA 3UWJH 4Y0ZE 1MTSA 1MKXK 1O36A 4AOQA 4Z6AH 2QY0B 4XD7D 3LPRA 4CRGA 4BTIB 2G8TA 5EU8A 3PO1C 1V6DA 3EQ0H 2H9EH 3V0XA 3A7VA 2A2XH 1KXEA 2FLBH 1O2VA 2W6ID 3F0PA 2L74A 1THRH 2ZCKP 4WF8A 3MH4A 1BTHH 4X8SH 3BV9B 5TJXA 1EPTC 2ZFFH 3TK5A 4H4FA 2EI8A 3U9AH 5LGOA 3PLBA 4LZ1H 1ZJKA 5CHBA 1XXDA 1DUEA 4FU7A 3D49H 5LPRA 1Y3UA 2FMJA 1ID5H 4ABIA 1YC0A 1C1QA 3MH7A 1DWCH 1GHXH 3LOXA 1K1IA 3K6YA 3RXAA 1RTKA 4WMEA 1FDPA 2ZDAH 3ZZBA 1ELVA 1N8OB 2GT7A 1GL1A 2IJOB 2VGCC 3W94A 4NA8A 2ALVA 1AZZA 1M9UA 2ZDVH 1LQDB 1NFUA 1QFKH 2UUJB 4H6SB 5C94A 3RLWH 2KFWA 5IDKA 1J9CH 1GHWH 3ZYEA 4AYVB 1LHEH 2BY7X 1QR3E 4NFEA 1T8MA 2SGFE 1EZXC 2RCEA 1S85A 2PP6A 1ZTJA 4BAHB 3TJNA 2KAIA 1BMAA 3NKKA 3F2FA 1YLCA 3HKJB 1PPFE 1XUFA 3KHVA 1XVOA 3OEHD 1IQMA 1BTZA 1O2HA 1C2IA 2FLRH 2BOKA 2ZQ1A 2DE8A 1QRZA 3RXEA 4TYDA 1WXRA 1WUNH 2BD5A 2QF0A 1YPJH 1G9IE 2ZG0H 1A5IA 1DY8A 2KCAA 4YXWD 3ZZ7A 3I77A 1AKSA 2R2MB 3TITA 5DN6D 1O35A 2SGPE 3E90B 5J4QA 1O2QA 4OS1A 4AG2A 1RIWC 4ISLA 1K1NA 3T62A 2BY9X 2HOBA 1GBHA 1GMCG 3KEEA 1UTOA 3CP7A 3GYMA 2UWOA 4P02A 3ATMA 2BDBA 3GY3A 1MBQA 1S81A 1T32A 1FN6A 2ZFRH 1V2MT 2PTNA 2WINI 1KTSB 1ETTH 1Y3WA 4J2YB 4UEHH 3TU7H 2ZU2A 3ZZ3A 1H9LB 2H9TH 4J1YA 2G55A 2PFEA 1HAGE 1SLWB 4WVPE 1F2SE 3HGNA 4D7GA 5F03A 1TNJA 3KQDA 2EQNA 2HVYB 3ATLA 4BNRA 2BHGA 3QDZB 2PW8H 2IN2A 3UFAA 3NXPA 4ABEA 1DM4B 1IQGA 5TCCA 1ELTA 1P2IA 3CS7A 1C9TA 1GI2A 1VITH 5DPAA 2PLXA 2XNIA 2H6MA 2VIPA 1AVGH 1WAYB 2J9NA 3UIRA 5TCAA 4MPVA 3ENSB 1CBWC 1LVOA 4U2WA 3DT0H 3M36A 3RLYH 2PKSC 2OC0A 1ELBA 1SGIB 3R0FA 5FPTA 9ESTA 3VGCB 3TIUA 3S7KB 3HK3B 1AWFH 1E1RD 4FVBA 2J98B 2YNAA 2XW9A 2Z94A 1THPB 1LVMA 1TOCB 1LPZB 4X6NA 4BXWA 2HLCA 3RXLA 2C8WB 3RXFA 1EB1H 1P3CA 1GCTC 1BIOA 1F5RA 1KDQB 1QB6A 2Y5GA 5A0CA 3SUEA 4JYTA 2TGPZ 4B76A 2ZHEH 1GI8B 1AFQB 1DICA 2Z9KA 3NZIA 1YY3A 2NWNA 4Y71A 5JB8S 1O5CB 1C4U2 1TYNA 3NPSA 1UCYH 2PHBA 2Y82A 3ZYDA 2ZFTA 3TJVA 4H42U 1G2MA 5L30H 3SOSA 1O2OA 2R0LA 3GDUA 1ZMNA 1EASA 2WPHS 4LXBH 3WY8A 1ANCA 1E37B 3M5LA 5EJLA 4UONA 2G5VA 1QB9A 1IOEA 3ODDA 1HXFH
chains in the Genus database with same CATH topology
2VVCA 1BA8B 4I8HA 1G30B 4NIYA 1EB2A 1FN8A 4MPUA 1C1PA 2VB0A 1SR5C 4WMFA 3PROA 4BAMB 1ZPBA 1FAKH 1AE5A 1TNHA 2FOGA 2C90B 2UWPA 3TGJE 2PWXA 2QCYA 1O2YA 4NWLA 5C2ZA 2FTMA 2AGIX 4INLA 1SL3A 1TPAE 1C5ZB 1J8AA 4YOJA 4MG3A 1UVTH 2XC5A 3A86A 1SHHB 1F5KU 5ESBA 5DP5A 2ANKH 1XM1A 3FZDA 1QTFA 3RXTA 3MH6A 3SNDA 1RFNA 3A87A 1W2KH 1TA2A 1MZAA 2F9VA 3LC5A 1GI1A 1BHXF 3VFEA 4GCHG 2EA3A 3L33A 5E0HA 3RXCA 2FEQH 2ZKSA 1L1JA 3UUZA 3URCA 1XUIA 2ZGJA 2GZ7A 2F9OA 3KNXA 1HJAC 3H7TA 1O2JA 1MBMA 1LHDH 1O2SA 2FI4E 3B8JA 1GDNA 3BSQA 3TH4H 3RDZA 4XSKU 3QZQA 1C5XB 3M5NA 1GG6B 3T25A 1SOTA 5T6DA 1SPJA 1DE7H 1JRSA 3RXKA 3FP7E 1GGDB 2VWNA 1TGSZ 4OS5A 1QBNA 2W3IA 5JYIA 1V2PT 1G3BA 2FS8A 1TNGA 3ATKA 6LPRA 4D9RA 1RS0A 3E16B 5HGGA 1MTNB 1O3DA 2PUXB 1PJPA 4CBOA 3PMJA 2C8XB 4MPXA 1UVSH 4MDSA 3FP8E 5GDSH 2AMQA 2Z9IA 1UHBB 1GBFA 2OBOA 1WSSH 1BBRH 1QA7A 1F92A 4IGDA 2OD3B 7ESTE 2ZDMA 1C1WH 4R0IA 4I8KA 4B75A 1ZOMA 3LT3A 3P6ZB 4MNWA 4GSOA 1TRMA 3SGQE 1SGEE 2J94A 4O3TA 1TOMH 4Y8ZA 4LK4A 3ZV8A 1UTMA 2ESTE 4K69A 2BM2A 2R9PA 3KL6A 1YPEH 4ZROA 4NZQA 3KQEA 1CU1A 3SHCH 2G5NA 1IQKA 2ZNKH 2VINA 1GJ4H 2F83A 2LNCA 1XUKA 2ZO3H 3MH5A 1KXDA 2GZ9A 3RM2H 3QO6A 2Z3EA 3M7TA 3PV4A 2STBE 3RC6A 1A0JA 4YESB 1OOKB 1BRAA 1Z71A 5AFYH 4BXSA 1YF4A 2FI3E 3I29A 3LGYA 4I8GA 1NT1A 1T8OA 1D3QB 1IHTH 1LPGB 1OPHB 3VB3A 5IYTA 4ZXXH 3ZVDA 2F9PA 2LPRA 3AW1A 2BLQA 3T5FH 4B74A 1GMHF 1K21H 3T27A 4VGCB 3M61U 1BTYA 1SGFG 1SI5H 1UJ1A 1V2LT 5EODA 1AGJA 2ZCLP 5FPYA 3BTDE 2WYGA 4Q2KA 1ANBA 1NRRH 4BTUB 2G4UA 2BQWB 4ABHA 1O5FH 2O8MA 3P95A 3P70B 4Y7AA 5T6FA 1ELAA 4MTBA 3SJ9A 3SNEA 2WV5A 1C5TA 1O3IA 2ZTXA 3Q3YA 1C2KA 1AMHA 1TLDA 2XTTB 2BVSH 4ABFA 3LGVA 1YKTA 2FP7B 1BQYA 2HGTH 2Z9GA 1ELFA 2HPPH 2WUBA 3SBKA 1GHAF 1Y5AT 3ITIA 3SORA 1UCYE 3A8AA 2PSYA 1F0UA 3SV8A 4AFSA 3RXVA 5L6NH 2HNTE 4MNVA 4I31A 4JYUH 1F0RA 1ZJDA 3MU1A 4CR9A 2ODYB 5EQSA 1L4ZA 1MTVA 3KQCA 1AUTC 1QHRB 2BXTH 1UTNA 1O2XA 4JZDH 1RGQA 2ZU3A 3LH1A 2AIPA 1HAXB 1NPMA 1TMBH 2P3TB 2D2DA 1EAIA 1O2NA 2HNTF 2A4OA 4XBCA 2RA3A 3VB4A 1O2RA 2JETB 4FUBA 4X6MA 5I25A 3RXMA 1O2WA 2ZECA 4K5ZA 4BAKB 1TALA 6ESTA 3URDA 1QIXB 2BDCA 1O3HA 4X0WU 4K60A 4FUCA 1P2QA 1GJDB 1UTQA 2WUCA 2GV7A 3EGKH 2BLOA 3M5MA 3G01A 2GCTC 1D4PB 1C5SA 3MYWA 2GMTC 1BTWA 2Z3DA 1P12E 4B2CA 1K1JA 1Y5UT 1V2NT 5B6OA 1ESBA 1WV7H 5EXLA 3RP2A 7KMEH 2VIQA 1VCQA 4AZ2B 2BDHA 1JMOH 3BEFB 3PM3A 4A6LA 5FX5A 3SUDA 1W13U 1BUIA 2QXGA 1MKXH 2VVVA 4XOJA 3Q00A 1W0YH 1DT2A 1QJ1B 1SQTA 4ZAEA 5GJ4B 3M7UA 3QX5H 2JKHA 1ORFA 2JH6D 2PKAA 3BTHE 1P09A 4INHA 1C2DA 3SUGA 5A2MH 3A8CA 1DANH 2THFB 1LPKB 4JK5A 3FAOA 4X1NU 3LJOA 4CH2B 3RXRA 1BBRE 1GCDA 2VGCB 3K9XB 4DIIH 3PWCA 4YT6H 3K6ZA 4NIXA 2P59A 2VU8E 1O5BB 1G3DA 1SGPE 1EZSC 3DD2H 1KLIH 1GJ5H 4ZHAA 4YO9A 1OKXA 1K22H 4AB8A 4YTAA 1GI4A 3QWCH 3UPEA 1YPGH 3AASA 1YCPM 4ABDA 2FX4A 4FUJA 3U1JB 5EQQA 1K1MA 1LKBA 1Z1IA 1OP0A 1MD7A 3P92A 2A2QH 5FXLA 1PQ5A 2AEIH 1TFXA 1W3CA 3HGPA 1FNIA 3IG6B 2OCVB 2Q6DA 4B2BA 1K1PA 4DW2U 1CT4E 1J14A 1FY4A 2C3SA 1N6YA 1YLDA 1TGCA 1GJBB 3BF6H 3PTNA 2CXVA 1W10U 1CHOG 1TB6H 1VGCC 2Y5FA 1TA6A 1CA8B 1FPHH 5EXMA 1DPOA 4IMQA 2DE9A 2VIVA 1EOJA 1Y3YA 1C2EA 3S7HB 2UUFB 1FI8A 1TAWA 4UDWH 1P06A 3LC3A 2W5EA 1ZSKA 3GCHC 2BYAX 1HXEH 3UTUH 4CRAA 2Q6FA 2Z9JA 1INCA 5FPSA 1TGBA 2HRVA 3AVZA 3VEQB 1A3EH 1QL9A 2QXJA 3ZVBA 4RN6A 1ANDA 1NS3A 2BOHB 2Z6BD 4X8UH 5C67A 3S0NA 3RU4D 1J17T 1W11U 1AIXH 4Y8YA 1O3CA 1GBKA 3QZRA 1TQ7B 2F3CE 1V2KT 1P57B 1O5GH 2ANWA 1RD3B 2A45B 3M35A 3QN7A 1Q2WA 4DOQA 2ZGHA 4Y11E 3BTGE 1C9PA 4UFEH 5DKMA 3HK6B 1QURH 5A8YA 8ESTE 4K1TA 2BD3A 2C8YB 1ELCA 3ZZAA 5DJ7A 1C2JA 4FU8A 5JBCS 2XC4A 4OS2A 3PYHA 4BTTB 2C8ZB 2CF9H 4DJZB 2PKSB 1CGIE 1A5GH 5PTPA 2GKVE 5LPEA 1VR1H 2ZFQH 3FP6E 1OP8A 2GZ8A 4WXVA 3AW0A 3OY6U 4UE7H 4YOIA 2EI6A 3F9GA 1WBGB 1W0ZU 2A5IA 1GCTB 2STAE 3ELAH 4WH6A 5CHAC 3BTQE 2P3UB 4AORA 1KXCA 3P8NA 1HJ9A 1PPHE 2TGTA 3STJA 2O8LA 4Y8XA 2BXUH 4ZXYH 3LGIA 1TPOA 3OU0A 1BMNH 3MNXA 4I7YH 4RKOB 1YPHC 1HLTH 3C1KA 1A2CH 1A61H 4UFGH 1KXFA 2F91A 1UTPA 2FTLE 2J95A 3A7YA 1MMJN 2FO9A 1GDUA 2SNVA 3E91A 2XCNA 4ABBA 1TWXB 1EP5A 2O9QA 1K1LA 4Y10E 1IQIA 1TNKA 1TQ0B 1OXGA 2GTBA 4RKJB 3HPTB 4D76A 1SHYA 1P3EA 2VVUA 1C5QA 3ESTA 2W26A 5JDUB 3OY5U 4TPIZ 1AQ7A 1BB0B 3SU3A 4O9VA 1LO6A 1SQOA 1O2PA 3L3TA 3RXDA 1O5EH 2AMDA 1C1TA 1BTUA 4U01A 3BIUH 1RTFB 1QQUA 1UVOA 2BVRH 2GV6A 2XC0A 4TWYA 4JZEH 1JIMA 1Y8TA 4AYYB 2SNWA 2OQUA 4A1TA 3NWUA 1H9HE 3JZ2B 5DGJA 1A4WH 1UVUH 3UNSA 2CHAB 3SQEE 1Y59T 2I6QA 4ZKNU 1IAUA 5A8XA 1GL0E 5DP6A 4DCDA 3SU4A 3RC5A 1O2GH 1GJ8B 2ZGBH 1ELDE 3Q3XA 1GMHG 1P02A 2XWAA 1QL8A 1ARCA 1CA0C 3ZZDA 3BTEE 2G81E 1DUAA 3V3MA 1O2LA 3SU1A 2H5CA 2XBVA 1CQQA 4A1VA 1ZRBA 1HJAB 2C4FH 3EA9A 3PWBA 2OXSA 3TVJB 1CT0E 1MKWK 3S9BA 1AZ8A 1UMAH 1P04A 1N8OC 3SZNA 1ANEA 3H7OA 3ZVGA 1HB0B 4HTCH 1HFDA 2O8UA 1YPKH 3BTFE 2J34A 2FX6A 3SNBA 1C4V2 1DSTA 1P9UA 3MO3A 2NU4E 1FIWA 1ZGIA 2FESH 2CN0H 2WV4A 1MAXA 3A81A 1KSNA 3NCLA 2PUQH 1GHAG 3FZZA 2QYIA 3BG4B 4NIWA 5GCHG 1BZXE 4DIHH 1QBOA 1OWDA 1FIZA 2BDGA 2FODA 2J4IA 3IWMA 3VB6A 3BTME 3SV6A 2FPZA 5HXFA 1AVWA 2P8OC 1Y3XA 1NC6A 3QTOH 1H8IH 2P94A 4SGBE 1CHOF 1PFXC 3JZ1B 3LH3A 3SV7A 2UUKB 3TGIE 1FMGA 2BTCE 2A7HA 2NU2E 4X2WA 5C20A 2J38A 1HAVB 1J16A 4F4OC 1GVLA 1TBQH 1VJ9U 5EG4A 4X2YA 1OWJA 2ZU1A 1TNIA 1O3EA 2GCHF 2OLGA 1GBLA 3CS0A 1C5UA 1TGNA 1GVKB 4M7GA 2CF8H 1O33A 2ZHQH 2HPQH 2ULLA 4GUXA 1QJ6B 2J2UA 4OS7A 1NFYA 4BOHA 2BMGB 5F8XA 1NFXA 1HBTH 5DO4H 2VWLA 3TLOA 2Q1JA 1FZZA 1UK4A 1ABIH 2M5TA 4GAWA 1T31A 4GLYA 3UOPA 3QUMP 2R0KA 1G2LA 1U6QA 4BAOB 4JYVH 1HV7A 1EATA 2ALPA 2BZAA 2B0FA 2HVXA 3OYPA 3MU8A 4FXGH 3SGAE 2FZZA 5GIBA 3S9AA 1DSUA 2Q6GA 1AN1E 3BTKE 4X2VA 1C2LA 2D1JA 2H5DA 3SJOA 1P2KA 3KIDU 3A84A 3ZZ8A 1TABE 1TX8A 2VWMA 2ZWLH 1QGFA 3F1SB 2D8WA 1YBWA 4TY7A 1DWBH 2FYRA 1TBRH 1KDQA 3B9FH 5FBIA 3SV9A 2ASUB 1P2MA 2FM2A 5ABWA 3C27B 3EE0B 2ZHDA 1SGCA 1OWIA 3L6PA 2AFQB 4K1EA 1SLVB 2QC2A 1MU8B 1Y3VA 4TPYA 3VGCC 1LMWB 4JZIA 5E8EH 5HM2A 3TJUA 1MCTA 2WPMS 4O3UA 3PMAB 1SVPA 4FUHA 3UR9A 3MHWU 4XBDA 1SMFE 1B0EA 1G32B 3LDXH 1V2JT 4AGKA 4ESTE 4Y6DA 2WPJS 4X8TH 4X8VH 5JBBS 1ZHRA 3TK9A 5K7RA 3U8RH 2GGVB 3K65B 4MLFB 1V2RT 2ZP0H 3F68H 3RC4A 2O8TA 3UQOA 1AFQC 1LKAA 1V2WT 2GX4A 3RXIA 2BD9A 3GY8A 1HJ8A 1F0TA 1HIAA 4KELA 4NIVA 1UK3A 3W95A 3P8FA 1BJUA 1B7XB 1FY5A 1A7SA 1BMLA 1SFIA 2AERH 3SJIA 3K2UA 5K0HA 1CT2E 1PYTD 2BQ7B 1C5PA 4D7FA 5BPEA 2CMYA 3A82A 1FQ3A 1GHZA 2H1UA 4Y7BA 3ZVFA 1C5LH 1C2GA 1CVWH 3SNAA 1V3XA 2GCTB 4Y76A 1O3FA 1IQFA 3QGNB 1H4WA 1HAZB 1AI8H 3RXBA 2NU3E 4I32A 3ZZ6A 2ZDNA 4GHTA 5DP3A 3BTTE 1AB9B 1LHCH 1J15A 2SGQE 1LDTT 1SGRE 2OC1A 3ZZ5A 2QV1A 2QF3A 1VITF 3SJKA 1DXPA 1C2FA 4O03A 1IQHA 2ZGXH 1GMDG 1KYNA 3PMBB 3A7XA 3GY4A 4UD9H 3U98H 1E36B 4CHAC 3GISB 1UO6A 1IHSH 2UUYA 4AFUA 1C5MD 3M3TA 1A5HA 2R2WU 5E2PA 1XUGA 1ZRKA 2G00A 4H6TA 4FUDA 1AU8A 3P17H 1GJ9B 3SI3H 2FOCA 3MNSA 4WXIA 2ZEBA 1UHBA 5GCHF 1K1OA 1TMUH 1DWEH 4CRBA 1ESTA 1GVZA 1DX5M 1C1OA 2B8OH 1SLUB 1QBVH 1MQ6A 5JPMH 1P0SH 1QB1A 1C2HA 3D23A 3ZVAA 8KME2 3PLPA 2VIWA 2RA0A 4OGXA 1GGDC 1DVAH 2ZU4A 3E8LA 2IPHA 1O5DH 1OX1A 1DWDH 3DFJA 1FPCH 1HRTH 1BBRK 3LU9B 3E0NB 1C1SA 5F6MA 5FAHA 2HALA 2F9NA 1XVMA 4FU9A 4ABJA 1DDJA 5DP9A 1YPLH 2A0QB 2P16A 4IN1A 4U30A 3RXHA 3UNQA 3A83A 1T4VH 1CE5A 1VCWA 1Z8JB 1OP2A 3A88A 3RXPA 2A7JA 1G37A 1S5SA 2A31A 1K2I1 1FUJA 2GT8A 2TBSA 4DGJA 3A8DA 1XMNB 3EA8A 2ZGCA 1Z8RA 5H4IB 1HDTH 4NG9H 1PPBH 2H2ZA 2QXHA 3SU0A 3UREA 4E05H 4OGYA 1AVXA 1AD8H 1TONA 1VGCB 1BOQA 5AVDA 1PPZA 1SC8U 4CR5A 2VH0A 2SGAA 1SGQE 1ESAA 1YYY1 2VIOA 4XBBA 3VPKA 7GCHF 2A7CA 1GBEA 1HGTH 1SSXA 1D3TB 3GICB 4JCNA 3O8RA 1ZZZA 1C1RA 3BEIB 3PO1B 3M7QA 2TRMA 2FWWA 1L1NA 2IOTA 5F8TA 1JXPA 1FXYA 1MCVA 3GDSA 1DLEA 3BN9A 4Q80A 1EPTB 2BD4A 1LHGH 4YZUA 1MZDA 3PB1E 1BT7A 1UVPA 5FCKA 1EJAA 3FVFB 1AUJA 1SLXB 4VGCC 1A0HB 4ZHMU 5DG6A 4ZKOU 1QRWA 4FUIA 1SBWA 1TX7A 1OWEA 3UNRA 1ZYOA 1HPGA 2Y5HA 3SGBE 1Z6EA 2JH0D 4I8LA 5LH8A 2ZIQH 1DS2E 1O3GA 4ISNA 1DITH 4DY7B 4CBNA 1O3LA 4UFFH 8LPRA 3U69H