4U32A

Human mesotrypsin complexed with hai-2 kunitz domain 1
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
224
structure length
224
Chain Sequence
IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTAPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDAGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kunitz-type protease inhibitor 2
publication title Sequence and Conformational Specificity in Substrate Recognition: SEVERAL HUMAN KUNITZ PROTEASE INHIBITOR DOMAINS ARE SPECIFIC SUBSTRATES OF MESOTRYPSIN.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 56
structure length 224
sequence length 224
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2014-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4u32A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4u32A02
3LJOA 1XVOA 2QF0A 4YT6H 4ISIH 2FZZA 3QDZB 1CT0E 1E38B 5A8YA 2OD3B 5HGGA 3D65E 1S0QA 4MTBA 1GI9B 4X2VA 1H9IE 1HYLA 2PGBB 5E8EH 3HK6B 3MU8A 2Z9LA 1TNKA 1CSOE 3ATIA 3VB7A 1O5GH 4YOGA 1ABIH 1GDNA 2FP7B 1VZQH 4PROA 3F9GA 3ODDA 1QJ7B 4FUGA 3SJOA 1C2MA 1X7AC 1ZHPA 5FBIA 1K1OA 2O8UA 3A7YA 3TNSA 4THNH 4MPWA 1CA0B 2QY0B 1BBRH 4ZXYH 1S81A 1TAWA 2ODPA 1TFXA 1GJ9B 3RXCA 1UHBA 1BTUA 4KTCA 3BV9B 3D23A 3KF2A 3ZVEA 1EQ9A 1TPSA 1AN1E 3I78A 2IJOB 1O2QA 2WV4A 1AUJA 1PPEE 1GHAF 2G4UA 1YBWA 4NWLA 1EJAA 3ZZCA 2WPLS 1P2KA 4OS2A 1MZAA 1DUEA 1NPMA 1ANBA 2SGDE 1XM1A 4X2WA 3RXAA 3UWJH 2HGTH 8KME2 4MG3A 4Y6DA 2JH6D 5ESTE 3IWMA 1S6FA 4FUHA 1L4ZA 1CU1A 1O2YA 1UVPA 2P94A 4WMEA 3SNEA 2ZEBA 4NIWA 3U9AH 4CBNA 3TH4H 1AMHA 1XUJA 1YP9A 2GV6A 1PFXC 1BMLA 2VGCC 1CT2E 3SBKA 1UK2A 3PO1B 5B6OA 1O36A 2A0QB 1MTWA 4I7YH 3RM0H 1UTKA 4IMZA 4TWWA 4H6TA 1K1PA 5E0HA 1GJ6A 2ODYB 1THSH 1G30B 1TA2A 2VWOA 4FUEA 4X6NA 1S84A 1ZMLA 3S7KB 3RXOA 5FXLA 3SUEA 2ZTZA 3EGKH 1HXFH 3PWBA 5EOKA 3GY2A 1AQ7A 1V2OT 1P04A 1A61H 1C5OH 1SFQB 1A0LA 2STAE 4AYYB 1A1RA 4XOJA 1C5NH 2Y81A 1GI8B 1IQEA 3OX7U 1AWFH 2R3UA 3FANA 4Q80A 3I29A 1WQVH 3FAOA 1BTXA 3URCA 2CHAB 3O8RA 1C4V2 2FI3E 3A89A 1TABE 1KXDA 1UTNA 2VB0A 3PMAB 2R0LA 2VIDA 3MH5A 3UR9A 2P95A 3SUFA 1HB0B 5C5NA 1FN6A 4KTSA 1D3DB 1W14U 3E16B 1BHXB 1N8OB 3ZYEA 2Y82A 1OYTH 1HIAB 1EX3A 2ZCKP 4TWYA 2AH4X 4OS1A 1CHGA 3I77A 1GHXH 2HALA 2PKAA 7GCHF 8LPRA 4D8NA 2J92A 3UY9A 1YPKH 5L2YH 1O3HA 1VGCB 4KP0A 2GZ7A 1TMTH 1GBDA 1EASA 5DG6A 3KEEA 1GI2A 1K22H 1WOFA 5JBCS 3RXMA 3QWCH 4OGXA 3GISB 4NZLA 1O3EA 2GCTB 2NU0E 4ABJA 2OP9A 1TONA 3GY4A 3QLPH 1L1NA 1WBGB 5C20A 1EP5A 3MI4A 1O34A 1LVOA 2VWLA 4ABHA 3BSQA 1C1NA 4BAQB 2QIQA 2P8OB 3TITA 1HV7A 4A7IB 1O2OA 2A31A 1RFNA 1FJSA 1LHCH 4FVBA 3RXSA 1RD3B 5AF9H 1TX7A 4JZIA 3TNTA 2TGPZ 3GCHB 3F6UH 1P05A 4NWKA 5EXNA 1J14A 1YPHE 4I8HA 4RKJB 2BY8X 3M3TA 3BTME 1KLTA 2ZU5A 2XBWA 3TGIE 2ZGHA 4FUDA 1C4U2 1THRH 1Y5AT 2STBE 1QQUA 1ZRKA 1KY9A 1QTFA 4K60A 4CH2B 1E0FD 4U30A 1BMNH 1EATA 2PFEA 1EZUC 4INKA 2ZKSA 2Q6DA 1UMAH 1G2MA 3KN2A 4DGJA 1D4PB 4CREA 3SNCA 4Y0YE 3BN9A 5CE1A 4Y76A 2OBQA 3A86A 3W95A 4DJZB 1C1VH 5AHGH 1YC0A 1TX8A 2G5NA 3RUOA 1MCVA 3VEQB 4GSOA 1UCYE 3E0NB 3TK6A 2FOHA 2UUJB 2QCYA 1GGDB 1C5QA 1NRQH 2KAIA 4AB9A 2VH0A 3A88A 4GUXA 4A92A 3ZZ5A 4K1SA 5ABWA 3TK5A 1P2QA 2AGIX 4MVNA 3TH3H 3PWCA 1DSTA 4IN2A 1TBRH 1O3PB 1UHBB 3P6ZB 1EPTA 1NU9A 2FODA 1C1MA 4D9RA 1H9HE 3SV7A 1QBOA 4X2XA 6GCHG 1ELTA 5DP7A 3HPTB 5F8XA 3VFEA 1DICA 1ZJKA 2ZFTA 4B73A 1SGNE 5ESBA 1K1JA 1DWEH 3KCGH 4FVDA 4INLA 1QHRB 4LK4A 1XKBC 2FDAA 2HRVA 1AVWA 1BMMH 1GI3A 1S6HA 2V0BA 1EJMA 5EU8A 2WPHS 2ZU1A 1MMJN 3FP7E 5I25A 1IQHA 3RXKA 1QCPA 1P2IA 2O8MA 3O8CA 1YPJH 2ZG0H 1DOJA 5F6MA 4ABDA 2BXTH 1Y8TA 3DD2H 4ISHH 1SLXB 2QXJA 4FUJA 2ULLA 1SVPA 2D8WA 1W0ZU 1HJAB 2Z6BD 2XC0A 3Q3KA 1OWHA 2K1QA 1TB6H 4B76A 2GCHG 4K5ZA 1J15A 1GI6A 2GZ8A 1YLCA 1LPGB 2F9OA 1AU8A 2AMPA 1BBRE 1F0TA 1AVGH 1PQ7A 4J1YA 1IQGA 4ZHMU 4O3TA 3OY5U 1DUAA 1V2JT 3SGQE 4DCDA 1ZPZA 2AFQB 2A2XH 1Y59T 2A32A 3BTFE 2F91A 1XUFA 1BTZA 3S0NA 3TK9A 7ESTE 1BTWA 4NCYA 4RN6A 1W13U 1HAGE 4D76A 3ZYDA 2YNAA 3L6PA 4AOQA 2Z3EA 1UTJA 4DW2U 2OINA 3NK8A 3JZ1B 2D2DA 1SHYA 1EZQA 2PHBA 1HDTH 4Q2KA 4CRAA 1QGFA 2O8WA 1W11U 4KTUA 1AB9C 4O03A 1JBUH 1Q31A 1D3TB 2SGQE 1O30A 3ZVGA 1HUTH 5TCAA 3ZZDA 3QTVH 5J4SA 3VB5A 4CR9A 1ELEE 3PLKA 1PQAA 5GPIB 3RXFA 3SV8A 1DXPA 3KQBA 3MU1A 1P0SH 1UTLM 4HTCH 4H42U 2VVVA 3AW1A 1HRTH 3UUZA 3PMBB 3TGJE 1BTHH 2EI7A 1CVWH 6ESTA 5H4IB 4RSPA 1A3BH 4A1XA 4Y8ZA 1T8MA 4BXSA 5C2ZA 2ZTXA 4E05H 4ZXXH 4Y8XA 3AW0A 2PSXA 3KQEA 2W3KA 3G01A 3U8RH 2QC2A 3EA9A 1VJAU 3RXRA 2FOAA 1CBWC 1Z1JA 5TCCA 4YESB 1F92A 3RXTA 1LDTT 4ZHLU 1AZZA 1HAVA 1GCDA 1GCTC 2G81E 1SI5H 1ZSLA 3MNCA 5C1YA 1NFWA 2XXLA 1GHAG 1GJ4H 1BZXE 3PM3A 1NS3A 1BA8B 1VITH 3MO3A 1O2NA 1EUFA 1ARCA 4YO9A 6GCHF 4B2CA 4Q7XA 2C3SA 3RXHA 2H5CA 4FUFA 2VINA 4TPIZ 3UNSA 1YPHC 3LH1A 4UFEH 2A5IA 3A7WA 3QGNB 1H9LB 2OC7A 3EDXB 1MKXK 1FAXA 3B23B 1BCUH 1O5BB 1LVYA 1C5TA 1ESAA 1TNLA 4RKOB 4CHAC 1M9UA 1FNIA 2FYQA 3TIUA 2PV9B 3UTUH 4AFUA 4O97A 3H7OA 5A8XA 2XBYA 2ZDKA 3BTWE 1MCTA 2F9UA 4WF8A 3RLYH 3GICB 4E7NA 5HXFA 1BOQA 2G52A 4I8GA 3LGUA 4UFFH 3F9HA 2SGFE 1AI8H 1ZR0A 4NIVA 1CQQA 1AUTC 1SGIB 1SG8B 4R0IA 1V2VT 3T26A 1P57B 1C5YB 2AMQA 2WPIS 3K6ZA 1HPGA 4IGDA 1SGPE 3KHVA 2A5KA 2QAAA 1EPTB 4GCHF 1SLUB 1H4WA 4DIHH 5EXLA 1O37A 2V3HH 1E36B 3DUXH 4I8LA 1O2LA 4BTIB 2ZHDA 3M5OA 1PPHE 1TNJA 2BD9A 1S83A 5GJ4B 1NRPH 1AKSA 4BOHA 5LGOA 1SGFA 1SR5C 5DJ7A 3E0PB 4K8BA 2R0KA 1CHOF 3GDVA 4BANB 1CGJE 2SGAA 3ZV9A 2XC4A 1AZ8A 2ZDLA 2W7UA 2CV3A 2UUFB 2P3TB 1T7CA 6CHAB 1BHXF 3CS0A 2G4TA 2AS9A 2XWBI 1C5LH 1F2SE 7GCHG 5JYIA 3GYMA 2P16A 3STJA 1Z8RA 2AGEX 1AE8H 1LHFH 3CENA 1O3AA 3DT0H 4IC6A 2Q1JA 3MU0A 2ZZUH 3T25A 1O3KA 1OWIA 3H7TA 3P70B 1YPGH 3OSYA 1C2GA 1VCPA 1K21H 3E3TA 4AFSA 5SGAE 2FS8A 5LPRA 5DP3A 1O3MA 3GCNA 1VR1H 1O2PA 1RS0A 2BVRH 2C8YB 1O5AB 3NUMA 4CH8B 2HNTE 4FU9A 2DE9A 1YM0A 2EC9H 2WYGA 2GMTC 1EZSC 2FLBH 3RU4T 3LGTA 2HLCA 2ILNA 1SQAA 1IQFA 1OXGA 3FZDA 3E91A 1O32A 2ZHEH 3H5CB 1F0SA 2JETC 1OSSA 1XUGA 3E8LA 4Z6AH 3MNSA 1O3GA 3UQOA 1XKAC 2B7DH 1QNJA 2G8TA 2BD3A 1TGCA 3MU5A 3SU5A 1NROH 1Q2WA 1ANCA 1O2IA 2EI8A 3M37A 1G9IE 4X0WU 2WPKS 2Z9KA 1XVMA 2W26A 4UFDH 2C8WB 5L2ZH 3Q76A 1J9CH 1ELBA 1O3NA 3Q00A 4YOJA 3S9BA 1JOUB 1TYNA 3F1SB 1GDUA 3SV9A 1UVSH 5FBEA 3SNBA 3A87A 2BX3A 1OP0A 1TGSZ 1G3DA 5JBBS 1NM6A 1O3BA 1UTPA 3LIWA 2CN0H 4AX9H 4Y7AA 4F4OC 4A1VA 2M5TA 3SQEE 3B9FH 4B75A 2A7HA 2ANKH 1GJCB 4AORA 3MNBA 1CGIE 1Y3XA 1D9IA 3BTTE 1ETRH 1Z8IB 1ZRBA 2HNTF 1IHSH 3M7UA 1C9TA 2AEIH 3SHCH 1TNGA 1FUJA 1IQLA 3QK1A 3BTHE 2VGCB 4YTAA 5J4QA 2HOBA 2WYJA 1DXWA 3SI4H 1QURH 2Y6TA 4AFQA 1FY3A 3EA8A 4AFZA 1O2JA 2A45B 1C9PA 4TY6A 2F9NA 1TMUH 2BTCE 1AWHB 3A7VA 4E06H 1D6WA 2ZCHP 1P11E 1HAVB 1V2KT 1WU1A 2UUKB 1W3CA 1GI7B 2Y7XA 3FFGA 1Z8JB 1L1GA 3M5LA 3GYLB 1DDJA 1NRNH 4LZ1H 4WH8A 4OS7A 1FY8E 2XNIA 3SU6A 5A09A 3RMMH 9LPRA 1QIXB 2VVCA 2QXHA 3P92A 1PQ8A 1ETSH 2FI4E 5EQRA 3C27B 4GPGA 5JPMH 2ZDVH 1A7SA 1UCYK 5FCRA 2ZFRH 3TJNA 2P59A 3M36A 1LVMA 2AYWA 1LHEH 3BEFB 1C5XB 3P8NA 3BG4C 4UONA 2D1JA 3LDXH 2ANWA 2OQUA 3UOPA 2VIPA 5IDKA 3AASA 1HAOH 1KTTB 1V2WT 1Q3XA 1YCPM 1ZTLA 5F8ZA 2GGVB 2THFB 2QA9E 3E6PH 4CBOA 4M7GA 2ZDNA 4MPVA 2I6SA 2VIVA 1GHBF 2ZHQH 1FIZA 1Y5UT 4X6PA 1CA8B 1W0YH 4UFGH 1O5FH 2AERH 3OYPA 5E0GA 3AVZA 2ZPRA 1T32A 2WUCA 1SGTA 1RXPA 1ELCA 1FMGA 1GG6C 4QT8C 1T8LA 1MD8A 1Y3VA 1BRCE 5HYOA 3O8DA 4NA7A 1TLDA 2Z9IA 4ZROA 4NIYA 1AKSB 4X1NU 4OS5A 3A8BA 3A84A 2BLVA 4AYVB 1NTPA 4CRCA 1C2FA 1GBFA 3MNXA 2O9QA 1N1LA 1ZTJA 3U8OH 2FX4A 4ZMAH 2A4GA 3RLWH 1O3IA 1RGQA 1QB1A 3ATLA 4ZH8A 4TYDA 2I6QA 4D7FA 1HGTH 3GY7A 4MNWA 2O8LA 1Y3YA 1BB0B 1LCYA 3EQ0H 1VCQA 1ABJH 4IMQA 2UWLA 1A4WH 4WMFA 1UK4A 2PTCE 2OC1A 5GDSH 1DWCH 3M3VA 1O2MA 4U01A 3SJIA 4VGCC 3ZVFA 4E7RG 5C5OA 1CGHA 4BNRA 1TX6A 3K65B 1G3CA 2NU3E 3S9AA 2JH5D 5T6GA 1GBLA 1GVZA 1PJPA 5PTPA 1Z6EA 2WINI 3MWIU 5JDUB 2BDHA 3ITIA 1A3EH 1QB9A 3U1IB 1IOEA 1IHTH 3S7HB 3LU9B 2P93A 1UTMA 1W12U 2ANMH 4IC5A 3W94A 1TMBH 1DE7H 5DK1A 4I31A 1P3CA 2BDBA 3F9FA 3GY8A 1O3CA 3PMHB 1GMCF 4Y0ZE 1Z8GA 1DY8A 3RXVA 1C1RA 2PLXA 1JRTA 1UO6A 1KIGH 1VITF 1P03A 1ELVA 2ZU4A 4JYTA 4ESTE 3BTEE 3SV2H 1NRSH 3GCOA 2J9NA 2ZGJA 1UTQA 1QQ4A 1BT7A 3URDA 1XUKA 1ZOMA 3S9CA 3HKIB 1C1UH 2G00A 1BTPA 3RXJA 1GHYH 4WWYA 5T6DA 2ZC9H 4AZ2B 1DLEA 3PV4A 5HM2A 1DS2E 1Z6JH 3QO6A 3RXGA 5A0AE 5FHTA 1C4Y2 3ZVBA 4IS5A 1GVLA 4FUBA 1HJ8A 1LPZB 1O2UA 1ZPCA 1O2VA 3PTBA 1BIOA 2C90B 1ZHRA 2WUBA 3P8FA 4NZQA 1NO9H 2OQ5A 1MKXH 4AG2A 2CMYA 2ESTE 5DP5A 1FDPA 1FQ3A 3AAVA 2A1DB 4IW4E 4ASHA 1SBWA 1DANH 2BY7X 3RXEA 3UFAA 1KTSB 1HFDA 1LPKB 2H9EH 1SSXA 1O33A 2QGRA 2Y80A 3DHKH 2HWLB 2BD7A 1G36A 1RIWC 1TNIA 1F7ZA 4X8SH 1MKWK 9ESTA 4IN1A 4DG4A 2BQ6B 1B5GH 1O2WA 2XRCA 1Y3UA 2J34A 1O2XA 2HPPH 5DP9A 2A7CA 3RC5A 2BLWA 1QL7A 1SGYE 1P2MA 4TY7A 1LO6A 2TPIZ 3UNRA 1JRSA 1O2GH 1NESE 4GCHG 1PPGE 4ZHAA 3U98H 5EXMA 5DP6A 4NG9H 3V13A 3ODFA 3BG8A 3VB6A 1W10U 1P09A 5AVDA 1C5RA 2Q6GA 2ZWLH 3SNAA 2ZHFH 4MNXA 4A1TA 1HAHH 4K8YA 1W7GH 1CHOG 3MU4A 3V7TA 2PKSC 1XXFA 5FPYA 3LJJA 2A2QH 2OBOA 1EB1H 1L2EA 2OUAA 2VIWA 2ZA5A 3A81A 3KGPA 1QY6A 3T5FH 2VVUA 1O2HA 1TPPA 4WJG2 1SGEE 4Y10E 1C2JA 2ZU3A 2ZI2H 1TGNA 2TGTA 1MTNC 2ZFFH 4NA9H 1WUNH 3PROA 4CRFA 1TIOA 3LT3A 1KXAA 1A2CH 1ARBA 1AB9B 1QJ6B 2SFAA 3LKWA 3PYHA 1QBNA 1GDQA 2GX4A 1L1JA 2PUQH 1T8NA 1UVTH 4X2YA 1RJXB 2P3UB 3BIVH 4LXBH 1EAXA 2UWPA 4JZEH 1K9OE 1QA7A 1T31A 5AFZH 1J16A 1O3JA 4KGAA 2IOTA 1MTVA 2H5DA 4X8VH 2IN2A 2V6NA 4DVAU 2G51A 4X8UH 3SUDA 3TLOA 1IQKA 1L0ZA 2FS9A 1DT2A 1PQ5A 3SNDA 2XC5A 4XE4A 1BJVA 2ZFSA 1JXPA 4CR5A 3CS7A 1SGFG 2OXSA 5GCHF 1AD8H 1OWDA 3P8OA 1Y5BT 1O3DA 2ZFQH 1FN8A 2ZQ1A 3A82A 1WV7H 1ZHMA 2RA3A 1EB2A 1AFQC 4JK5A 3P8GA 4Y79A 4X1QU 2NWNA 1QA0A 1CBWB 4CRDA 2B5TB 2BOKA 1L4DA 3PMJA 2FOCA 2GVFA 4O3UA 2QF3A 1CE5A 3E1XB 5FX5A 3ZZ8A 1W8BH 4U2WA 1GCTB 1YCPH 2D26C 2GKVE 1P02A 2WPMS 3LGIA 3SUGA 4K1TA 3T62A 3ZZ3A 5CHAC 3DFLA 2GV7A 1V2QT 4OS4A 3MFJA 1SC8U 3KL6A 4ZKNU 4ABBA 1RTLA 1V2RT 2SGPE 4HZHA 1A5GH 1SPJA 4XFQA 2G55A 1KLJH 1FZZA 1BRAA 4I8KA 2ZF0H 3BEUA 1TA6A 3C1KA 3M7QA 1O2RA 1ZZZA 1GBTA 2C8ZB 1QRWA 2NU1E 1SGCA 1EXFA 4CHAB 3ESTA 1ZYOA 2Z7FE 1OOKB 5DP4A 5E0JA 3PLBA 1KXEA 5GWZA 1C2HA 1HNEE 4WH6A 1ZMJA 1HLTH 2BM2A 3BTKE 1OWKA 4GVUA 2Y5GA 1J17T 4UDWH 1AY6H 2Y5HA 4Q7YA 1O2ZA 1GJDB 2FEQH 4X6MA 3GDSA 1RTFB 2FOMB 1AVXA 3FP8E 8GCHG 1C5ZB 5JBTA 2J95A 3WY8A 1GI1A 2ZDMA 1C1PA 1MD7A 3SHAH 2A4QA 1OWEA 1O5EH 2A4OA 1P06A 2JKHA 3ENSB 3KQDA 3M5MA 4WY3A 1ZGVA 1ELGA 1Z7KA 3RMNH 2OTVA 3ZZ4A 2ODQA 3UNQA 4ZUHA 4DT7B 3NPSA 2FOFA 5JB9S 1SGQE 2ZGBH 1FY4A 3HATH 4B71A 1UTOA 3V3MA 2BDGA 1G2LA 4K3JA 1V2MT 1YKTA 1UCYH 3T28A 1TWXB 4DURA 1K1LA 3O8BA 1HAYB 4YOIA 3MYWA 3P95A 1YGCH 4JK6A 3V0XA 3BIUH 2QXIA 4Y8YA 2FXRA 2DE8A 1OS8A 2BDIA 3UIRA 1NT1A 1BQYA 4K1EA 2GDEH 1OP2A 3VGCB 1LQEA 2VNTA 2V35A 1GL1A 1XMNB 3MH4A 4WVPE 3L3TA 3Q3XA 1GHBG 3D49H 2QV1A 3UR6A 4X1SU 1TQ0B 1VCWA 3NCLA 2ALVA 1SL3A 1NFYA 2FM2A 3F9EA 2ZGXH 1PPFE 1LQDB 1V6DA 2WPJS 1QB6A 2BD2A 4GAWA 1DWDH 2VH6A 1ID5H 1GBAA 2F9VA 1AFEH 2VIQA 2VWNA 1J8AA 1IAUA 1UVUH 1V2NT 2FYRA 1Z1IA 1LVBA 3KQCA 2H2ZA 2BD5A 1DM4B 1UVOA 3A7XA 4AB8A 2BDYA 2JETB 5JBAS 2IPHA 5EQQA 1QL9A 3SU3A 1GMHF 2C93B 1V2LT 1YPMH 1OKXA 3ZVAA 1VJ9U 1B0EA 3OU0A 2G5VA 5EW1H 2XWAA 1TRNA 3QUMP 3EE0B 2TIOA 3N7OA 2RG3A 1O2KA 3RXPA 1GBJA 3RU4E 1GMDF 3LGWA 3ATMA 2FLRH 4B2BA 2OLGA 2CF8H 1H8DH 1OPHB 1TPOA 1YCPK 2FPZA 5TJXA 3LC3A 1P9SA 1IQMA 5EPNA 1CA0C 4JZ1A 2RCEA 1TPAE 1KYNA 2UWOA 3BTQE 3NKKA 3K9XB 1JWTA 1INCA 1GJ8B 1MAYA 2Q6FA 2NU4E 2ALPA 3VB4A 1ESBA 4NSYA 5HMAA 1HAIH 4B74A 4MLFB 2ANYA 2ZTYA 4YT7H 1U6QA 3MO9A 1C2LA 3D62A 2AIPA 2JH0D 2UUYA 1JMOH 1TRMA 2GZ9A 1SB1H 3GY5A 5A0BA 1WAYB 5E2PA 1A5HA 1WCZA 2FWWA 3LONA 2XTTB 1C1TA 5ETXA 2AGGX 3A83A 3MOCA 4I8JA 1GBEA 3ZZ9A 1GMCG 1V2PT 1HCGA 1C1WH 3NXPA 2J94A 1VITG 3ZVCA 2ZU2A 1GBKA 2H6MA 2AIQA 1ELDE 4H6SB 4JMYA 2ZIQH 1EKBB 4HFPB 2BVSH 5K7RA 1HAPH 4X8TH 5EW2H 1MH0A 3HK3B 4Z0KA 1BRUP 2WV5A 5FAHA 1EAIA 1F5RA 4MNYA 4B2AA 4DY7B 4ABFA 4X1RU 3PO1C 3JZ2B 8GCHF 2TGAA 1C5WB 1O3LA 1GI5A 4SGBE 3RMLH 4K69A 1DITH 1LMWB 2C8XB 4ABEA 1RRKA 1O3OA 1TBQH 1GJ7B 3SU0A 4CRGA 1P9UA 4BAKB 2XBVA 1MTSA 1QL8A 4WMDA 1AO5A 2BDAA 3S69A 1MAXA 2FTMA 3LOXA 1S0RA 2CXVA 3RP2A 3SGAE 2EEKA 4A5TS 3A8AA 3B8JA 3BG4B 2Z9JA 1TALA 3M35A 1C1SA 4FUCA 5FX6A 2BHGA 5HM9A 2CHAC 1MKWH 1B0FA 3SV6A 1ZSKA 1DVAH 3ZVDA 2XCNA 2VWMA 3QTOH 1MQ6A 3TH2H 1P8VC 2BZ6H 4WXIA 4B1TA 4YLUA 4BXWA 3Q77A 1KDQA 4ZAEA 1E37B 1WQSA 3A8DA 2DUCA 3R0FA 5EGMA 1Z71A 1O0DH 1N8OC 1DFPA 1TGTA 3A7ZA 4D7GA 1SLVB 2TGDA 4FUIA 3VXEH 3K6YA 3SI3H 4A6LA 4JCNA 1SOZA 1VGCC 3T29A 1D3PB 2BLQA 2FOGA 1MBMA 4Q7ZA 1C2KA 2J4IA 1GG6B 2BOHB 2PGQB 3SU4A 1AIXH 1GBCA 5CMXH 1P10A 2XYAA 2BY9X 2XCFA 4INHA 2AMDA 4XDEA 3RC6A 2R3YA 1C5PA 2QXGA 1PPZA 1ZLRA 1ESTA 1NY22 2J38A 3GCTG 2GCTC 4XBDA 3IG6B 3RC4A 1ANEA 5DKMA 5E2OA 1NFUA 1P2NA 3MMGA 2P8OC 5C1XA 3RU4D 2ZPQA 1ELAA 5GIBA 3EYDA 1AHTH 1O3FA 3VXFH 1QR3E 1NC6A 1LKAA 1SGRE 3M3SA 1GHWH 3GCHC 1YPEH 3LGYA 2EI6A 4TPYA 2BQWB 2VIOA 1E34B 3SW2B 3U1JB 1OX1A 2BLOA 1BBRK 1PPCE 3TPIZ 1TRYA 4MNVA 2F83A 4VGCB 1A0JA 1QRXA 3GOVB 2RA0A 2H9TH 4ABGA 3M5NA 3SQHE 1T4UH 2Z3CA 5A2MH 4J2YB 1BRBE 1FY5A 1GL0E 2VJ1A 2F9PA 1W2KH 1SMFE 5GCHG 2ZPSA 4MDSA 3HGPA 4JZFH 2OC8A 5BPEA 4O9VA 1GBMA 3QZRA 3BTGE 2BVXH 2HPQH 2SNWA 1HBTH 1B7XB 1GI4A 4UD9H 2PTNA 3PLPA 1FPCH 1O2SA 2H1UA 5T3HA 2HNTC 4ZKRU 1F0RA 1MUEB 4JZDH 1ZPBA 1GGDC 2ZGCA 2SNVA 4AGJA 3CP7A 4ISLA 1WYKA 3HGNA 3MHWU 1A5IA 2W5EA 1H8IH 2LNCA 1FAKH 1C5SA 4UEHH 1TOCB 3KIDU 3RM2H 1ZGIA 2RDLA 1SLWB 3A8CA 1MQ5A 2BX4A 2BMGB 2CGAA 5BRRE 3M7TA 2TBSA 3MO6A 1BTYA 4Y7BA 5F03A 1RTKA 1YF4A 2Z9GA 1AE5A 1C5MD 3FVFB 4NA8A 1O31A 5K0HA 5T6FA 2BY6X 1BDAA 1V2UT 4JYUH 4YZUA 1SQTA 4NSVA 4FXGH 5DO4H 3FZZA 5EPYA 3LGVA 4GHTA 1V2ST 2ZQ2A 2LPRA 2FMJA 3SJKA 4K2YA 3QGJA 2C4FH 1RIWB 1FPHH 3TU7H 2W7SA 1FONA 1DLKB 1GBHA 4X6OA 1PPBH 2GD4B 1LHGH 1SFIA 2GP9B 4AGKA 1BJUA 2ZO3H 4I32A 4IBLH 3ATWA 3KNXA 2NU2E 5L30H 4Y71A 1WSSH 1UK3A 2GTBA 1F0UA 4DIIH 4MPUA 2ZNKH 5G4BA 3MH7A 1C2EA 3UWIA 1K28D 1EAWA 1DX5M 3QX5H 1O2TA 1EOJA 4MPXA 3ZZ6A 1QFKH 3TJVA 3U69H 4D9QA 3ZZ7A 4XSKU 2FESH 2PUXB 3BF6H 7LPRA 3K2UA 2H9HA 5A0CA 4FU7A 7KMEH 1W7XH 1HJAC 3OTJE 1E35B 1XXDA 2BZAA 3QZQA 2B0FA 2A7JA 4BTUB 4YLQH 1V3XA 2BQ7B 2J2UA 1DWBH 2FOEA 1SGDE 3NZIA 3MH6A 2PKSB 1GWAA 4ISOA 3EAJA 1HJ9A 3GCTF 2Y5FA 1GHZA 4NGAH 5FPSA 3RXLA 2R9PA 1MZDA 3OY6U 3F68H 1IQIA 1ZJDA 5F8TA 1QBVH 1QRZA 5LPFA 4BAOB 3STIA 5I46H 3TJUA 1WTGH 1BMAA 1MTNB 1O5CB 4XBCA 1FXYA 1NU7B 3RXQA 1ANDA 5L6NH 3IITA 3SZNA 2GDDA 3GY6A 1AGJA 1OWJA 3DA9B 3QN7A 1TQ7B 3GDUA 1P01A 1O35A 1THPB 1CO7E 1CT4E 1KLIH 3R3GB 1T8OA 5C1UA 3TJOA 3E90B 3HKJB 4ZKSU 4HI3A 2HVXA 1GVKB 1GBBA 3RXIA 1NFXA 1MU6B 1KDQB 1KXBA 1FI8A 1Y3WA 1EJNA 1JIRA 3BEIB 4I33A 1QJ1B 4X1PU 1GBIA 1LHDH 3PB1E 4XBBA 3VB3A 1NRRH 2PKAB 3LPRA 5DPAA 3SU2A 1OYQA 2Z3DA 1BITA 4MQAA 2BYAX 1F5KU 2BD8A 2ZHWH 1H1BA 1S5SA 1N6YA 2GT7A 4Y11E 4LZ4B 1ORFA 2ZECA 3SO3A 2A5AA 5LH8A 2PW8H 5AFYH 1GMHG 2A4RA 2FX6A 4AN7A 1S82A 1AFQB 1NZQH 4ABIA 3ELAH 1GJAB 3RXUA 3P17H 3UQVA 1YPLH 5EODA 2FI5E 1GMDG 2F3CE 4U32A 4ZKOU 1O39A 1SOTA 1C1QA 5FPTA 3BTDE 1ZMNA 3SN8A 4KKDA 3LH3A 1TE0A 1MU8B 4LOYH 2SGEE 3AAUA 3SORA 5CHAB 1N6XA 2FIRH 2ZP0H 1FLEE 1DPOA 1EOLA 2CF9H 1HAXB 2B9LA 1FY1A 1PYTD 2PR3A 2VU8E 3T27A 3RXBA 3ZZAA 4F49A 2Z94A 1K1IA 1P2JA 1ZSJA 3GY3A 2BXUH 3SOSA 3U8TH 1YYY1 1GPZA 1K1NA 3A7TA 1YLDA 4BAMB 1D3QB 4BAHB 4WXVA 3RDZA 1K1MA 4GHQA 4SGAE 3RXDA 1P2OA 2TRMA 1IQNA 2EA3A 1SHHB 2FOBA 2BD4A 5DGJA 1EZXC 4NFEA 1C5VA 3TGKE 1GJ5H 5EQSA 1O38A 4FU8A 2QN5T 3V12A 4OGYA 4NFFA 1TGBA 2P3FH 2XBXA 1P12E 5IYTA 2YNBA 1P3EA 2ZFPH 6LPRA 1T4VH 4HGCA 1HIAA 1S85A 2BY5X 3SU1A 3ZV8A 1DY9A 1O5DH 4ISNA 1D6RA 1KXCA 3FP6E 1FIWA 1C2IA 5GXPA 2OCVB 3Q3YA 4H4FA 4OS6A 1F5LA 2ASUB 1OP8A 2GT8A 2KAIB 2F9BH 2ZDAH 4UE7H 3ZZBA 5A8ZA 3DFJA 1DSUA 5LPEA 1G3EA 4R8TB 3M61U 1LKBA 4GLYA 4AG1A 1IQJA 1TOMH 1MBQA 5C3NA 1XUHA 2O8TA 1LTOA 4CRBA 1EAUA 3SGBE 1TBZH 2GCHF 2OC0A 2B8OH 3VPKA 1UJ1A 2QYIA 2FO9A 1NN6A 4NIXA 1EPTC 3UPEA 4JYVH 1C2DA 3EA7A 1K2I1 3MTYA 3ATKA 3A85A 4DOQA 1G3BA 1KSNA 3PTNA 3L33A 2V3OH 2XW9A 2CJIA 2PWXA 2BB4A 3UREA 2R2MB 3LC5A 3T2NA 8ESTE 3NWUA 1HAZB 1PYTC 2YOLA 1ZTKA 1G37A 1A0HB 1C5UA 1EP6A 2W3IA 3SJ8A 1V2TT 4BTTB 5C67A 3RMOH 5JB8S 2ZCLP 6CHAC 1TNHA 2BDCA 2PSYA 1MTUA 4KELA 1GHVH 1G32B 1XUIA 1HXEH 1FV9A 1SQOA 5FCKA 2Y7ZA 3UOUA 1XX9A 1BUIA 1C1OA 1ELFA 5DP8A 3TVJB 3VGCC 2FTLE 1ETTH 1A46H 4YM9A 2R2WU 1KXFA 1JIMA 2GMTB 3SJ9A 1ACBE 1WTHD 1GI0A 4ABAA 1GJBB 5EG4A 3A80A
chains in the Genus database with same CATH superfamily
3LJOA 1XVOA 2QF0A 4YT6H 4ISIH 2FZZA 3QDZB 1CT0E 1E38B 5A8YA 2OD3B 5HGGA 3D65E 1S0QA 4MTBA 1GI9B 4X2VA 1H9IE 1HYLA 2PGBB 5E8EH 3HK6B 3MU8A 2QE7D 2Z9LA 1TNKA 1CSOE 3ATIA 3VB7A 1O5GH 4YOGA 1ABIH 1GDNA 2FP7B 1VZQH 4PROA 3F9GA 3ODDA 1QJ7B 3H09A 4FUGA 3SJOA 1C2MA 5KEDA 1X7AC 1ZHPA 5FBIA 1K1OA 2O8UA 3A7YA 3TNSA 4THNH 4MPWA 1CA0B 2QY0B 3N7DA 1BBRH 4ZXYH 1S81A 1TAWA 2ODPA 1TFXA 1GJ9B 3RXCA 1UHBA 1BTUA 4KTCA 3BV9B 3D23A 3KF2A 3ZVEA 1EQ9A 1TPSA 1AN1E 3I78A 2IJOB 1O2QA 2WV4A 1AUJA 1PPEE 1GHAF 2G4UA 1YBWA 4NWLA 3N7EA 1EJAA 3ZZCA 2WPLS 1P2KA 4OS2A 1MZAA 1DUEA 1NPMA 1ANBA 2SGDE 1XM1A 4X2WA 3RXAA 3UWJH 2HGTH 8KME2 4MG3A 4Y6DA 2JH6D 5ESTE 3IWMA 1S6FA 4FUHA 1L4ZA 1CU1A 4F48B 1O2YA 1UVPA 2P94A 4WMEA 3SNEA 2ZEBA 1COWD 4NIWA 3U9AH 4CBNA 3TH4H 1AMHA 1XUJA 1YP9A 2GV6A 1PFXC 1BMLA 2VGCC 1CT2E 3SBKA 1UK2A 3PO1B 5B6OA 1O36A 2A0QB 1MTWA 4I7YH 3RM0H 1UTKA 4IMZA 4TWWA 5B6LA 4H6TA 1K1PA 5E0HA 1GJ6A 2ODYB 1THSH 1G30B 1TA2A 2VWOA 4FUEA 4X6NA 1S84A 1ZMLA 3S7KB 3RXOA 5FXLA 3SUEA 2ZTZA 3EGKH 1HXFH 3PWBA 5EOKA 3GY2A 1AQ7A 1V2OT 1P04A 5EJ1A 1A61H 1C5OH 1SFQB 1A0LA 2STAE 4AYYB 1A1RA 4XOJA 1C5NH 2Y81A 1GI8B 1IQEA 3OX7U 1AWFH 5T1VA 2R3UA 3FANA 4Q80A 3I29A 1WQVH 3FAOA 1BTXA 3URCA 2CHAB 3O8RA 1C4V2 2FI3E 3A89A 1TABE 1KXDA 1UTNA 2VB0A 3PMAB 2R0LA 2VIDA 3MH5A 3UR9A 2P95A 3SUFA 1HB0B 5C5NA 1FN6A 4KTSA 1D3DB 1W14U 3E16B 1BHXB 1N8OB 3ZYEA 2Y82A 1OYTH 1HIAB 1EX3A 2ZCKP 4TWYA 2AH4X 4OS1A 1CHGA 3I77A 1E1RD 1GHXH 2HALA 2PKAA 5HIZA 7GCHF 8LPRA 4D8NA 2J92A 3UY9A 1YPKH 5L2YH 1O3HA 1VGCB 4KP0A 2GZ7A 1TMTH 1GBDA 1EASA 5DG6A 3KEEA 5DSFA 1GI2A 1K22H 1WOFA 5JBCS 1WXRA 3RXMA 3QWCH 4OGXA 3GISB 4NZLA 1O3EA 2GCTB 2NU0E 4ABJA 2OP9A 1TONA 3GY4A 3QLPH 1L1NA 1WBGB 5C20A 1EP5A 3MI4A 1O34A 1LVOA 2VWLA 4ABHA 3BSQA 1C1NA 1OHHD 4BAQB 2QIQA 2P8OB 3TITA 1HV7A 4A7IB 1O2OA 2A31A 1RFNA 1FJSA 1LHCH 4FVBA 3RXSA 1RD3B 5AF9H 1TX7A 4JZIA 3TNTA 2TGPZ 3GCHB 3F6UH 1P05A 4NWKA 5EXNA 1J14A 1YPHE 4I8HA 4RKJB 2BY8X 3M3TA 3DSPA 3BTME 1KLTA 2ZU5A 2XBWA 3TGIE 2ZGHA 4FUDA 1C4U2 1THRH 1Y5AT 2STBE 1QQUA 1ZRKA 1KY9A 1QTFA 4K60A 4CH2B 1E0FD 4U30A 1BMNH 1EATA 2PFEA 1EZUC 4INKA 2ZKSA 2Q6DA 1UMAH 1G2MA 3KN2A 4DGJA 1D4PB 4CREA 3SNCA 4Y0YE 3BN9A 5CE1A 4Y76A 2OBQA 2K8IA 3A86A 3W95A 2KZ4A 4DJZB 1C1VH 5AHGH 1YC0A 1TX8A 2G5NA 3RUOA 1MCVA 3VEQB 4GSOA 1UCYE 2XNDD 3E0NB 2FOHA 2UUJB 3TK6A 2KCOA 2JJ2D 2QCYA 1GGDB 1C5QA 1NRQH 2KAIA 4AB9A 2VH0A 3A88A 4GUXA 4A92A 3ZZ5A 4K1SA 5ABWA 3TK5A 1P2QA 2AGIX 4MVNA 3TH3H 3PWCA 1DSTA 4IN2A 1TBRH 1O3PB 1UHBB 3P6ZB 2WHXA 1EPTA 1NU9A 2FODA 1C1MA 4D9RA 1H9HE 3SV7A 1QBOA 4X2XA 6GCHG 1ELTA 5DP7A 3HPTB 5F8XA 3VFEA 1DICA 1ZJKA 2ZFTA 3FKSD 4B73A 2J98A 1SGNE 5ESBA 1K1JA 1DWEH 3KCGH 4FVDA 4INLA 1QHRB 4LK4A 1XKBC 2FDAA 2HRVA 1AVWA 1BMMH 1GI3A 1S6HA 2V0BA 1EJMA 5EU8A 2WPHS 2ZU1A 1MMJN 3FP7E 5I25A 1IQHA 3RXKA 1QCPA 1P2IA 2O8MA 3O8CA 1YPJH 2ZG0H 1DOJA 5F6MA 4ABDA 2BXTH 1Y8TA 3DD2H 4ISHH 1SLXB 2QXJA 4FUJA 2ULLA 1SVPA 2D8WA 1W0ZU 1HJAB 2Z6BD 2XC0A 3Q3KA 1OWHA 2K1QA 1TB6H 4B76A 2GCHG 4K5ZA 1J15A 1GI6A 2GZ8A 1YLCA 1LPGB 2F9OA 1AU8A 2AMPA 1BBRE 1F0TA 1AVGH 1PQ7A 4J1YA 1IQGA 4ZHMU 3KYFA 4O3TA 5DN6D 3OY5U 1DUAA 1V2JT 3SGQE 4DCDA 1ZPZA 2KM0A 2AFQB 2A2XH 1Y59T 2A32A 3BTFE 2F91A 1XUFA 1BTZA 3S0NA 3TK9A 7ESTE 1BTWA 4NCYA 4RN6A 1W13U 1HAGE 4D76A 3ZYDA 2YNAA 3L6PA 4AOQA 2Z3EA 1UTJA 4DW2U 2OINA 3NK8A 3JZ1B 2D2DA 4B6FA 1SHYA 2WZQA 1EZQA 2PHBA 1HDTH 3PV5A 4Q2KA 4CRAA 1QGFA 2KCYA 2O8WA 1W11U 4KTUA 1AB9C 4O03A 1JBUH 2IPQX 1Q31A 1D3TB 2SGQE 1O30A 3ZVGA 1HUTH 5TCAA 3ZZDA 3QTVH 5J4SA 3VB5A 4CR9A 1ELEE 3PLKA 1PQAA 5GPIB 3RXFA 3SV8A 1DXPA 3KQBA 3MU1A 1P0SH 1UTLM 4HTCH 4H42U 2VVVA 3AW1A 1HRTH 3UUZA 3PMBB 3TGJE 1BTHH 2EI7A 3KYGA 1CVWH 6ESTA 5H4IB 4RSPA 1A3BH 4A1XA 4Y8ZA 1T8MA 4BXSA 5C2ZA 2ZTXA 4E05H 4ZXXH 4Y8XA 3AW0A 2PSXA 3KQEA 2W3KA 3G01A 3U8RH 2QC2A 3EA9A 1VJAU 3RXRA 2FOAA 1CBWC 1Z1JA 5TCCA 4YESB 1F92A 3RXTA 1LDTT 4ZHLU 2IJD1 1AZZA 1HAVA 1GCDA 1GCTC 2G81E 1SI5H 1ZSLA 3MNCA 5C1YA 1NFWA 2XXLA 1GHAG 1GJ4H 1BZXE 4ASUD 3PM3A 1NS3A 1BA8B 1VITH 3MO3A 1O2NA 1EUFA 1ARCA 4YO9A 6GCHF 2W6JD 4B2CA 4Q7XA 2C3SA 3RXHA 2H5CA 4FUFA 2VINA 4TPIZ 3UNSA 1YPHC 3LH1A 4UFEH 2A5IA 3A7WA 3QGNB 1H9LB 2OC7A 3EDXB 1MKXK 1FAXA 3B23B 1BCUH 1O5BB 1LVYA 1C5TA 3OAAD 1ESAA 1TNLA 4RKOB 4CHAC 1M9UA 1FNIA 2FYQA 3TIUA 2PV9B 3UTUH 4AFUA 4O97A 3H7OA 5A8XA 2XBYA 2ZDKA 3BTWE 1MCTA 2F9UA 4WF8A 3RLYH 3GICB 3OTPA 3PV2A 4E7NA 5HXFA 1BOQA 2G52A 4I8GA 3LGUA 4UFFH 3F9HA 2SGFE 1AI8H 1ZR0A 1W0KD 4NIVA 1CQQA 1AUTC 1SGIB 1SG8B 4R0IA 1V2VT 5HKKD 3OE7D 3T26A 1P57B 1C5YB 2AMQA 2WPIS 3K6ZA 1HPGA 3EE7A 4IGDA 1SGPE 3KHVA 2A5KA 5FL7D 2QAAA 1EPTB 4GCHF 1SLUB 1H4WA 4DIHH 5EXLA 1O37A 2L74A 2V3HH 1E36B 3DUXH 4I8LA 1O2LA 4BTIB 2ZHDA 2PP6A 3M5OA 1PPHE 1TNJA 2BD9A 1S83A 5GJ4B 1NRPH 1AKSA 4BOHA 5LGOA 1SGFA 1SR5C 5DJ7A 3E0PB 4K8BA 2R0KA 1CHOF 3GDVA 4BANB 1CGJE 2SGAA 3VG8A 3NRLA 3ZV9A 2XC4A 1AZ8A 2CK3D 2ZDLA 2W7UA 2CV3A 2EY4C 2P3TB 2UUFB 1T7CA 2XOKD 6CHAB 1BHXF 3CS0A 2G4TA 2AS9A 2XWBI 1C5LH 1F2SE 7GCHG 5JYIA 3GYMA 2P16A 3STJA 1Z8RA 2AGEX 1AE8H 1LHFH 3CENA 1O3AA 3DT0H 4IC6A 2Q1JA 3MU0A 3WW7A 4XRNA 2ZZUH 3T25A 1O3KA 1OWIA 3H7TA 3P70B 1YPGH 3OSYA 1C2GA 2YMSB 1EFRD 1VCPA 1K21H 3E3TA 4AFSA 5SGAE 2FS8A 5LPRA 5DP3A 1O3MA 3GCNA 1VR1H 1O2PA 1RS0A 2BVRH 2C8YB 1O5AB 3NUMA 2VBCA 4CH8B 2HNTE 4FU9A 4P02A 2DE9A 1YM0A 2EC9H 2WYGA 3DSOA 2GMTC 1EZSC 2FLBH 3RU4T 3LGTA 2HLCA 2ILNA 1SQAA 1IQFA 1OXGA 3FZDA 3E91A 1O32A 2ZHEH 3H5CB 1F0SA 2JETC 1OSSA 1XUGA 3E8LA 4Z6AH 3MNSA 1O3GA 3UQOA 1XKAC 2B7DH 1QNJA 2G8TA 2BD3A 1TGCA 3MU5A 3SU5A 1NROH 1Q2WA 1ANCA 1O2IA 2EI8A 3M37A 1G9IE 4X0WU 2WPKS 2Z9KA 1XVMA 2W26A 4UFDH 2C8WB 5L2ZH 3Q76A 1J9CH 1ELBA 1O3NA 3Q00A 4YOJA 3S9BA 1JOUB 1TYNA 3F1SB 1GDUA 3SV9A 1UVSH 5FBEA 3SNBA 3A87A 2BX3A 1OP0A 1TGSZ 1G3DA 5JBBS 1NM6A 1O3BA 1UTPA 3LIWA 2CN0H 4AX9H 4Y7AA 4F4OC 4A1VA 2M5TA 3SQEE 3B9FH 4B75A 2A7HA 2ANKH 1GJCB 4AORA 3MNBA 1CGIE 1Y3XA 1D9IA 3BTTE 1ETRH 1Z8IB 1ZRBA 1MABB 2HNTF 1IHSH 3M7UA 1C9TA 2AEIH 3SHCH 1TNGA 1FUJA 1IQLA 3QK1A 3BTHE 2VGCB 4YTAA 4RT1A 5J4QA 2HOBA 2WYJA 1DXWA 3SI4H 1QURH 2Y6TA 4AFQA 1FY3A 3EA8A 4AFZA 4I86A 1O2JA 5C94A 2A45B 1C9PA 4TY6A 2F9NA 1TMUH 2BTCE 1AWHB 3A7VA 4E06H 1D6WA 2ZCHP 1P11E 1HAVB 1V2KT 1WU1A 2UUKB 1W3CA 1GI7B 4ZCNA 2Y7XA 3FFGA 1Z8JB 1L1GA 3M5LA 3GYLB 1DDJA 1NRNH 4LZ1H 4WH8A 4OS7A 1FY8E 2XNIA 3SU6A 5A09A 3RMMH 9LPRA 1K0HA 1QIXB 2VVCA 2QXHA 3P92A 5KGOA 1PQ8A 1ETSH 2FI4E 5EQRA 3SZEA 3C27B 4GPGA 5JPMH 2ZDVH 1A7SA 1UCYK 5FCRA 2ZFRH 3TJNA 2P59A 3M36A 1LVMA 2AYWA 1LHEH 3BEFB 1C5XB 3P8NA 3BG4C 4UONA 2D1JA 3LDXH 2ANWA 2OQUA 3UOPA 2VIPA 5IDKA 3AASA 1HAOH 1KTTB 1V2WT 1Q3XA 1YCPM 1ZTLA 5F8ZA 2GGVB 2THFB 2QA9E 3E6PH 3AK5A 4CBOA 4M7GA 2ZDNA 4MPVA 2I6SA 2VIVA 1GHBF 2ZHQH 1FIZA 1Y5UT 4X6PA 2KCAA 1CA8B 1W0YH 4UFGH 1O5FH 2AERH 3OYPA 5E0GA 3AVZA 2ZPRA 1T32A 2WUCA 1SGTA 4Z1MD 1RXPA 1W0JD 1ELCA 1FMGA 1GG6C 4QT8C 1T8LA 1MD8A 1Y3VA 1BRCE 5HYOA 3O8DA 4NA7A 1TLDA 2Z9IA 4ZROA 4NIYA 1AKSB 4X1NU 4OS5A 3A8BA 3A84A 2BLVA 4AYVB 1NTPA 4CRCA 1C2FA 1GBFA 3MNXA 2O9QA 1N1LA 1ZTJA 3U8OH 2FX4A 4ZMAH 2A4GA 3KQ5A 1O3IA 1RGQA 3RLWH 1QB1A 3ATLA 4ZH8A 4TYDA 2I6QA 4D7FA 1HGTH 3GY7A 4MNWA 2O8LA 1Y3YA 1BB0B 1LCYA 3EQ0H 1VCQA 1ABJH 4IMQA 2UWLA 1A4WH 4WMFA 1UK4A 2PTCE 2OC1A 5GDSH 1DWCH 3M3VA 1O2MA 2WV9A 4U01A 3SJIA 4VGCC 3ZVFA 4E7RG 5C5OA 1CGHA 4BNRA 1TX6A 3K65B 1G3CA 2NU3E 3S9AA 2JH5D 5T6GA 1GBLA 1GVZA 1PJPA 5PTPA 1Z6EA 2WINI 3MWIU 5JDUB 4RI0A 2BDHA 3ITIA 1A3EH 1QB9A 3U1IB 1IOEA 1IHTH 3S7HB 3LU9B 2P93A 1UTMA 1W12U 2ANMH 4IC5A 3W94A 1TMBH 1DE7H 5DK1A 4I31A 1P3CA 2BDBA 3F9FA 3GY8A 1O3CA 3PMHB 1GMCF 4Y0ZE 1Z8GA 1DY8A 3RXVA 1C1RA 1SQRA 1JRTA 2PLXA 1UO6A 1KIGH 1VITF 1P03A 1ELVA 2ZU4A 4JYTA 4ESTE 3BTEE 3SV2H 1NRSH 3GCOA 2J9NA 2ZGJA 1UTQA 1QQ4A 1BT7A 3URDA 1XUKA 1ZOMA 3S9CA 3MQKC 3HKIB 1C1UH 2G00A 1BTPA 3RXJA 1GHYH 4WWYA 4P00A 5T6DA 2ZC9H 4AZ2B 1DLEA 3PV4A 5HM2A 1DS2E 1Z6JH 3QO6A 3RXGA 4B6EA 5FHTA 5A0AE 1C4Y2 3ZVBA 1FX0B 4IS5A 4DT4A 1GVLA 4FUBA 1HJ8A 1LPZB 1O2UA 1ZPCA 1O2VA 3PTBA 1BIOA 2C90B 1ZHRA 2WUBA 3P8FA 2RDEA 4NZQA 1NO9H 2OQ5A 1MKXH 4AG2A 2CMYA 2ESTE 5DP5A 1FDPA 1FQ3A 3AAVA 2A1DB 4IW4E 4ASHA 1SBWA 1DANH 2BY7X 3RXEA 3F2FA 3UFAA 1KTSB 1HFDA 1LPKB 2H9EH 1SSXA 1O33A 2QGRA 2Y80A 3DHKH 2HWLB 2BD7A 1G36A 1RIWC 1TNIA 1F7ZA 4X8SH 1MKWK 9ESTA 4IN1A 4DG4A 2BQ6B 5GNDA 1B5GH 1O2WA 2XRCA 1Y3UA 2J34A 1O2XA 2L6OA 2HPPH 5DP9A 2A7CA 3RC5A 2BLWA 1QL7A 1SGYE 1P2MA 3GS9A 4TY7A 1LO6A 2TPIZ 3UNRA 1JRSA 3FN8A 1O2GH 1QZ8A 1NESE 4GCHG 1YWUA 1PPGE 4ZHAA 3U98H 5EXMA 5DP6A 4NG9H 3V13A 3ODFA 2JDID 3BG8A 3VB6A 1W10U 1P09A 5AVDA 1C5RA 2Q6GA 2ZWLH 5CHBA 3SNAA 2ZHFH 4MNXA 2WSSD 2V3MA 4A1TA 1HAHH 4K8YA 1W7GH 1CHOG 3MU4A 3V7TA 2PKSC 1XXFA 5FPYA 3LJJA 2A2QH 2OBOA 1EB1H 1L2EA 2OUAA 2VIWA 2ZA5A 3A81A 3KGPA 1QY6A 3T5FH 2VVUA 1O2HA 1TPPA 4WJG2 1SGEE 4Y10E 1C2JA 2ZU3A 2ZI2H 1TGNA 2TGTA 1MTNC 2ZFFH 4NA9H 1WUNH 3PROA 4CRFA 1TIOA 3LT3A 1KXAA 1A2CH 1ARBA 1AB9B 1QJ6B 2SFAA 3LKWA 3PYHA 1QBNA 1GDQA 2GX4A 1L1JA 2PUQH 1T8NA 1UVTH 2QF4A 4X2YA 1RJXB 2P3UB 3BIVH 2M2AA 1EAXA 4LXBH 2UWPA 4JZEH 1K9OE 1QA7A 1T31A 5AFZH 1J16A 1O3JA 4KGAA 2IOTA 1MTVA 2H5DA 4X8VH 2IN2A 2V6NA 4OM9A 4DVAU 2G51A 4X8UH 3SUDA 3TLOA 1IQKA 1L0ZA 2FS9A 5HIYA 1DT2A 1PQ5A 3SNDA 2XC5A 3FOAA 4XE4A 1BJVA 2ZFSA 1JXPA 4CR5A 3CS7A 1SGFG 2OXSA 5GCHF 1AD8H 1OWDA 3P8OA 1Y5BT 1O3DA 2ZFQH 3FO8D 1FN8A 2ZQ1A 3A82A 1WV7H 1ZHMA 2RA3A 1EB2A 1AFQC 4JK5A 3P8GA 4Y79A 4X1QU 2NWNA 1QA0A 1CBWB 4CRDA 2B5TB 3F2HA 2BOKA 1L4DA 3PMJA 4TSFD 2FOCA 2GVFA 4O3UA 2QF3A 1CE5A 3E1XB 5FX5A 3ZZ8A 1W8BH 4U2WA 1GCTB 1YCPH 2D26C 2GKVE 1P02A 2WPMS 3LGIA 3SUGA 4K1TA 3T62A 3ZZ3A 5CHAC 3DFLA 2GV7A 1V2QT 4OS4A 3MFJA 1SC8U 3KL6A 4ZKNU 4ABBA 1RTLA 1V2RT 2SGPE 4HZHA 1A5GH 1E79D 1SPJA 2F4LA 4XFQA 2G55A 1KLJH 1FZZA 1BRAA 2W6ID 4I8KA 2ZF0H 3BEUA 1TA6A 3C1KA 3M7QA 1O2RA 1ZZZA 1GBTA 2C8ZB 4ACAA 1QRWA 2NU1E 1SGCA 1EXFA 4CHAB 3ESTA 1ZYOA 2Z7FE 1OOKB 5F53A 5DP4A 5E0JA 3PLBA 1KXEA 5GWZA 1C2HA 1HNEE 4WH6A 1ZMJA 1HLTH 2BM2A 3BTKE 1OWKA 4GVUA 1H8HD 2Y5GA 1J17T 4UDWH 1AY6H 2Y5HA 4Q7YA 1O2ZA 1GJDB 2FEQH 4X6MA 3GDSA 2KR7A 5EJZA 2J97A 1RTFB 2FOMB 1AVXA 5EJLA 3FP8E 8GCHG 1KMHB 1C5ZB 5JBTA 2EQNA 2J95A 3WY8A 1GI1A 2ZDMA 1C1PA 1MD7A 3SHAH 2A4QA 1OWEA 1O5EH 2A4OA 1P06A 2JKHA 2KCPA 3ENSB 3KQDA 3M5MA 3OFND 4WY3A 1ZGVA 1ELGA 1Z7KA 3RMNH 2OTVA 3ZZ4A 2ODQA 3UNQA 4ZUHA 4DT7B 3NPSA 2FOFA 5JB9S 1SGQE 2ZGBH 1FY4A 3HATH 4B71A 1UTOA 3V3MA 2BDGA 1WDIA 1G2LA 4K3JA 1V2MT 1YKTA 1UCYH 3T28A 3W1EA 1TWXB 4DURA 1K1LA 3O8BA 1HAYB 1BMFD 4YOIA 1S6LA 3MYWA 3P95A 1YGCH 4JK6A 3V0XA 1NBME 3BIUH 2QXIA 4Y8YA 2FXRA 2DE8A 1OS8A 2BDIA 3UIRA 1NT1A 1BQYA 4K1EA 2GDEH 1OP2A 2QF5A 3VGCB 1LQEA 2VNTA 2V35A 1GL1A 1XMNB 3MH4A 4WVPE 3L3TA 3Q3XA 1GHBG 3D49H 2QV1A 3UR6A 4X1SU 1TQ0B 1VCWA 3NCLA 2ALVA 2GJGA 1SL3A 1NFYA 2FM2A 3F9EA 2ZGXH 1PPFE 1LQDB 1V6DA 2WPJS 1QB6A 2BD2A 4GAWA 1DWDH 2VH6A 1ID5H 1GBAA 2F9VA 1AFEH 2VIQA 2VWNA 1J8AA 1IAUA 1UVUH 1V2NT 2FYRA 1Z1IA 1LVBA 3KQCA 2H2ZA 2BD5A 1DM4B 1UVOA 3A7XA 4AB8A 2BDYA 2JETB 5JBAS 2IPHA 5EQQA 1YY3A 1QL9A 3SU3A 1GMHF 2C93B 1V2LT 1YPMH 5KECA 1OKXA 3ZVAA 1VJ9U 1B0EA 3OU0A 4AC9A 2G5VA 4RT0A 5EW1H 2XWAA 1TRNA 3QUMP 3EE0B 2TIOA 3N7OA 2RG3A 1O2KA 3RXPA 1GBJA 3RU4E 1GMDF 3LGWA 3ATMA 2FLRH 4B2BA 2CF8H 2OLGA 1H8DH 1OPHB 1TPOA 1YCPK 1UW7A 2FPZA 5TJXA 3LC3A 1P9SA 1IQMA 5EPNA 1CA0C 4JZ1A 2RCEA 1TPAE 1KYNA 2UWOA 3BTQE 3NKKA 3K9XB 1JWTA 1INCA 1GJ8B 1MAYA 2Q6FA 4HG6A 2NU4E 2ALPA 3VB4A 1ESBA 4NSYA 5HMAA 1HAIH 4B74A 4MLFB 2ANYA 2ZTYA 4YT7H 1U6QA 3MO9A 1C2LA 3D62A 2AIPA 2JH0D 2UUYA 1JMOH 1TRMA 2GZ9A 1SB1H 3GY5A 5A0BA 1WAYB 4FETA 3F0OA 5E2PA 1A5HA 1WCZA 2FWWA 3LONA 2XTTB 2RFKC 1C1TA 5ETXA 2AGGX 2J5UA 3A83A 3MOCA 4I8JA 1GBEA 3ZZ9A 1GMCG 1V2PT 1HCGA 1C1WH 3NXPA 2J94A 1VITG 3ZVCA 2ZU2A 1GBKA 2H6MA 2AIQA 1ELDE 4H6SB 4JMYA 2ZIQH 1EKBB 4HFPB 2BVSH 5K7RA 1HAPH 4X8TH 5EW2H 2JJ1D 2LELA 1MH0A 3HK3B 4Z0KA 1BRUP 2WV5A 5FAHA 1EAIA 1F5RA 4MNYA 4B2AA 4DY7B 4ABFA 4X1RU 3PO1C 3JZ2B 8GCHF 2TGAA 1C5WB 1O3LA 1GI5A 4SGBE 3RMLH 4K69A 1DITH 1LMWB 2C8XB 4F55A 4ABEA 1RRKA 1O3OA 1TBQH 1GJ7B 3SU0A 2OK5A 4CRGA 1P9UA 4BAKB 2XBVA 1MTSA 1QL8A 4WMDA 1AO5A 2BDAA 4M9FA 3S69A 1MAXA 2FTMA 3LOXA 1S0RA 2CXVA 3RP2A 3SGAE 2EEKA 1NBMD 4A5TS 3A8AA 3B8JA 3BG4B 2Z9JA 1TALA 5IK2D 3M35A 1C1SA 4FUCA 5FX6A 2BHGA 5HM9A 2CHAC 1MKWH 1B0FA 3SV6A 1ZSKA 1DVAH 3ZVDA 2XCNA 2WPDD 2VWMA 3QTOH 1MQ6A 3TH2H 5EIYA 1P8VC 2BZ6H 2F43B 4WXIA 4B1TA 4YLUA 4BXWA 3Q77A 1KDQA 4ZAEA 1E37B 1WQSA 3A8DA 2DUCA 3R0FA 5EGMA 1Z71A 1O0DH 1N8OC 1DFPA 1TGTA 3A7ZA 4D7GA 1SLVB 2TGDA 4FUIA 3VXEH 3K6YA 3SI3H 4A6LA 2JIZD 4JCNA 3F0PA 1SOZA 1VGCC 4ACBA 3T29A 1D3PB 2BLQA 2FOGA 1MBMA 4Q7ZA 1C2KA 2J4IA 1GG6B 2BOHB 2PGQB 3SU4A 1AIXH 1GBCA 5CMXH 1P10A 2XYAA 2BY9X 2XCFA 4INHA 5CDFE 2AMDA 4XDEA 3RC6A 2R3YA 1C5PA 2QXGA 1PPZA 2K0QA 1ZLRA 1ESTA 1NY22 2J38A 3GCTG 2GCTC 4XBDA 3IG6B 3RC4A 1E1QD 1ANEA 5DKMA 5E2OA 1NFUA 1P2NA 3MMGA 3ZIAD 2P8OC 5C1XA 3RU4D 2ZPQA 1ELAA 5GIBA 3EYDA 1AHTH 1O3FA 3VXFH 1QR3E 1NC6A 1LKAA 1SGRE 3F3BA 3M3SA 4Q63A 1GHWH 3GCHC 1YPEH 3LGYA 2EI6A 4TPYA 2BQWB 2VIOA 1E34B 3SW2B 3U1JB 1OX1A 2BLOA 1BBRK 1PPCE 3TPIZ 1TRYA 4MNVA 2F83A 4VGCB 1A0JA 3PRDA 1QRXA 3GOVB 2RA0A 2H9TH 3UAIC 4ABGA 3M5NA 3SQHE 1VKYA 1T4UH 2Z3CA 5A2MH 4J2YB 1BRBE 1FY5A 1GL0E 2VJ1A 5C0TA 2F9PA 1W2KH 1SMFE 5GCHG 2ZPSA 4MDSA 3HGPA 4JZFH 2OC8A 5BPEA 4O9VA 1GBMA 3QZRA 3BTGE 2AHME 2BVXH 5C0UA 2HPQH 2SNWA 1HBTH 1B7XB 1YLNA 1GI4A 4UD9H 2PTNA 3PLPA 1FPCH 1O2SA 2H1UA 5T3HA 2HNTC 4ZKRU 1F0RA 1MUEB 4JZDH 1ZPBA 1GGDC 2ZGCA 2SNVA 3N99A 3U28C 3CP7A 4AGJA 4ISLA 1WYKA 3HGNA 3MHWU 1SKYE 1A5IA 2W5EA 1H8IH 2LNCA 1FAKH 1C5SA 4UEHH 1TOCB 3KIDU 3RM2H 1ZGIA 2RDLA 1SLWB 3A8CA 1MQ5A 2BX4A 2BMGB 2CGAA 5BRRE 3M7TA 2TBSA 3MO6A 1BTYA 4Y7BA 5F03A 1RTKA 1YF4A 2Z9GA 1AE5A 1C5MD 2HLDD 3FVFB 4NA8A 1O31A 5K0HA 5T6FA 2BY6X 1BDAA 1V2UT 3UB0A 4JYUH 4YZUA 1SQTA 4NSVA 4FXGH 4XD7D 5DO4H 3FZZA 5EPYA 3LGVA 4GHTA 1V2ST 2ZQ2A 3CNRA 2LPRA 2FMJA 3SJKA 4K2YA 3QGJA 2V7QD 2C4FH 1RIWB 1FPHH 4FOUC 3TU7H 2W7SA 1FONA 1DLKB 1GBHA 4X6OA 1PPBH 2GD4B 1LHGH 1SFIA 2GP9B 4AGKA 1BJUA 2ZO3H 4I32A 4IBLH 3ATWA 3KNXA 2NU2E 5L30H 4Y71A 1WSSH 1UK3A 2GTBA 1F0UA 4DIIH 4MPUA 2ZNKH 5G4BA 3MH7A 1C2EA 3UWIA 1K28D 1EAWA 1DX5M 3QX5H 1O2TA 1EOJA 4MPXA 2KX4A 3ZZ6A 1QFKH 3TJVA 3U69H 4D9QA 3ZZ7A 4XSKU 2FESH 2PUXB 3BF6H 7LPRA 3K2UA 2H9HA 5A0CA 4FU7A 7KMEH 1W7XH 1HJAC 3OTJE 1E35B 1XXDA 2BZAA 3QZQA 2B0FA 2A7JA 4BTUB 4YLQH 1V3XA 2BQ7B 2J2UA 1DWBH 2FOEA 1SGDE 3NZIA 3MH6A 2PKSB 1GWAA 4ISOA 3EAJA 1HJ9A 3GCTF 2Y5FA 1GHZA 4NGAH 5FPSA 3RXLA 2R9PA 1MZDA 3OY6U 3F68H 1IQIA 1ZJDA 5F8TA 1QBVH 1QRZA 3OEED 5LPFA 4BAOB 3STIA 5I46H 3TJUA 1WTGH 1BMAA 1MTNB 1O5CB 4XBCA 1FXYA 1NU7B 3RXQA 1ANDA 5L6NH 3IITA 3SZNA 2GDDA 3GY6A 1AGJA 1OWJA 3DA9B 3QN7A 1TQ7B 3GDUA 1P01A 1O35A 1THPB 1CO7E 1CT4E 1KLIH 3R3GB 1T8OA 5C1UA 3TJOA 3E90B 3HKJB 4ZKSU 4HI3A 2HVXA 1GVKB 1GBBA 3RXIA 1NFXA 1MU6B 1KDQB 1KXBA 1FI8A 1Y3WA 1EJNA 1JIRA 3BEIB 4I33A 1QJ1B 4X1PU 1GBIA 1LHDH 3PB1E 4XBBA 3VB3A 1NRRH 2PKAB 3LPRA 3PRBA 5DPAA 3SU2A 1OYQA 2Z3DA 1BITA 4MQAA 2BYAX 1F5KU 2BD8A 2ZHWH 1H1BA 1S5SA 1N6YA 2GT7A 4Y11E 4LZ4B 1ORFA 2ZECA 3SO3A 2A5AA 5LH8A 2PW8H 5AFYH 1GMHG 2A4RA 2FX6A 4AN7A 3WWBA 1S82A 1AFQB 1NZQH 4ABIA 3ELAH 1GJAB 3RXUA 3P17H 3UQVA 1YPLH 5EODA 2FI5E 3WWFA 1GMDG 2F3CE 4U32A 2LP6A 4ZKOU 1O39A 1SOTA 1C1QA 5FPTA 3BTDE 1ZMNA 3SN8A 4KKDA 3DSGA 3LH3A 1TE0A 1MU8B 4LOYH 2SGEE 4Q4LA 3AAUA 3SORA 5CHAB 1N6XA 2FIRH 2ZP0H 1FLEE 1DPOA 1EOLA 2CF9H 1HAXB 2B9LA 1FY1A 1PYTD 2PR3A 4TT3D 2VU8E 3T27A 3RXBA 3ZZAA 4F49A 2Z94A 1K1IA 1P2JA 1ZSJA 3GY3A 2BXUH 3SOSA 3U8TH 1YYY1 1GPZA 1K1NA 3A7TA 1YLDA 4BAMB 1D3QB 4BAHB 4WXVA 3RDZA 1K1MA 4GHQA 4SGAE 3RXDA 1P2OA 2TRMA 1IQNA 2EA3A 1SHHB 2FOBA 2BD4A 5DGJA 1EZXC 4NFEA 1C5VA 2YMSD 3TGKE 1GJ5H 5EQSA 1O38A 4FU8A 2QN5T 1H8ED 4OGYA 3V12A 2HVYB 4NFFA 1TGBA 2P3FH 2XBXA 1P12E 5IYTA 2YNBA 5C17A 1P3EA 2ZFPH 6LPRA 1T4VH 4HGCA 1HIAA 3SYJA 1S85A 2BY5X 3SU1A 3ZV8A 1DY9A 1O5DH 4ISNA 1D6RA 1KXCA 3FP6E 1FIWA 1C2IA 5GXPA 2OCVB 3Q3YA 4H4FA 4OS6A 1F5LA 2ASUB 1OP8A 2GT8A 2KAIB 2F9BH 2ZDAH 4UE7H 3ZZBA 5A8ZA 3DFJA 1DSUA 4YXWD 5LPEA 1G3EA 4R8TB 3M61U 1LKBA 4GLYA 4AG1A 1IQJA 1TOMH 1MBQA 5C3NA 1XUHA 2O8TA 1LTOA 4CRBA 1EAUA 3F2GA 3SGBE 1TBZH 2GCHF 2OC0A 2B8OH 3VPKA 1UJ1A 2QYIA 2FO9A 1NN6A 4NIXA 1EPTC 3UPEA 4JYVH 1C2DA 3EA7A 1K2I1 3MTYA 3ATKA 3A85A 4DOQA 1G3BA 1KSNA 3PTNA 3L33A 2V3OH 2XW9A 2KFWA 2CJIA 2PWXA 2BB4A 2J98B 3UREA 2R2MB 3LC5A 3T2NA 8ESTE 3NWUA 1HAZB 1PYTC 2YOLA 1ZTKA 1G37A 1A0HB 1C5UA 1EP6A 2W3IA 3SJ8A 1V2TT 4BTTB 5C67A 3RMOH 5JB8S 2ZCLP 6CHAC 1TNHA 2BDCA 2PSYA 1MTUA 4KELA 1GHVH 1G32B 1XUIA 1HXEH 1FV9A 1SQOA 5FCKA 2Y7ZA 3UOUA 1XX9A 1BUIA 1C1OA 1ELFA 5DP8A 3TVJB 3VGCC 3DCLA 2FTLE 3OEHD 1ETTH 1A46H 4YM9A 2R2WU 1KXFA 1JIMA 2GMTB 3SJ9A 1ACBE 2YMSC 1WTHD 1GI0A 4ABAA 1GJBB 5EG4A 3A80A
chains in the Genus database with same CATH topology
3LJOA 1XVOA 2QF0A 4YT6H 4ISIH 2FZZA 3QDZB 1CT0E 1E38B 5A8YA 2OD3B 5HGGA 3D65E 1S0QA 4MTBA 1GI9B 4X2VA 1H9IE 1HYLA 2PGBB 5E8EH 3HK6B 3MU8A 2Z9LA 1TNKA 1CSOE 3ATIA 3VB7A 1O5GH 4YOGA 1ABIH 1GDNA 2FP7B 1VZQH 4PROA 3F9GA 3ODDA 1QJ7B 4FUGA 3SJOA 1C2MA 1X7AC 1ZHPA 5FBIA 1K1OA 2O8UA 3A7YA 3TNSA 4THNH 4MPWA 1CA0B 2QY0B 1BBRH 4ZXYH 1S81A 1TAWA 2ODPA 1TFXA 1GJ9B 3RXCA 1UHBA 1BTUA 4KTCA 3BV9B 3D23A 3KF2A 3ZVEA 1EQ9A 1TPSA 1AN1E 3I78A 2IJOB 1O2QA 2WV4A 1AUJA 1PPEE 1GHAF 2G4UA 1YBWA 4NWLA 1EJAA 3ZZCA 2WPLS 1P2KA 4OS2A 1MZAA 1DUEA 1NPMA 1ANBA 2SGDE 1XM1A 4X2WA 3RXAA 3UWJH 2HGTH 8KME2 4MG3A 4Y6DA 2JH6D 5ESTE 3IWMA 1S6FA 4FUHA 1L4ZA 1CU1A 1O2YA 1UVPA 2P94A 4WMEA 3SNEA 2ZEBA 4NIWA 3U9AH 4CBNA 3TH4H 1AMHA 1XUJA 1YP9A 2GV6A 1PFXC 1BMLA 2VGCC 1CT2E 3SBKA 1UK2A 3PO1B 5B6OA 1O36A 2A0QB 1MTWA 4I7YH 3RM0H 1UTKA 4IMZA 4TWWA 4H6TA 1K1PA 5E0HA 1GJ6A 2ODYB 1THSH 1G30B 1TA2A 2VWOA 4FUEA 4X6NA 1S84A 1ZMLA 3S7KB 3RXOA 5FXLA 3SUEA 2ZTZA 3EGKH 1HXFH 3PWBA 5EOKA 3GY2A 1AQ7A 1V2OT 1P04A 1A61H 1C5OH 1SFQB 1A0LA 2STAE 4AYYB 1A1RA 4XOJA 1C5NH 2Y81A 1GI8B 1IQEA 3OX7U 1AWFH 2R3UA 3FANA 4Q80A 3I29A 1WQVH 3FAOA 1BTXA 3URCA 2CHAB 3O8RA 1C4V2 2FI3E 3A89A 1TABE 1KXDA 1UTNA 2VB0A 3PMAB 2R0LA 2VIDA 3MH5A 3UR9A 2P95A 3SUFA 1HB0B 5C5NA 1FN6A 4KTSA 1D3DB 1W14U 3E16B 1BHXB 1N8OB 3ZYEA 2Y82A 1OYTH 1HIAB 1EX3A 2ZCKP 4TWYA 2AH4X 4OS1A 1CHGA 3I77A 1GHXH 2HALA 2PKAA 7GCHF 8LPRA 4D8NA 2J92A 3UY9A 1YPKH 5L2YH 1O3HA 1VGCB 4KP0A 2GZ7A 1TMTH 1GBDA 1EASA 5DG6A 3KEEA 1GI2A 1K22H 1WOFA 5JBCS 3RXMA 3QWCH 4OGXA 3GISB 4NZLA 1O3EA 2GCTB 2NU0E 4ABJA 2OP9A 1TONA 3GY4A 3QLPH 1L1NA 1WBGB 5C20A 1EP5A 3MI4A 1O34A 1LVOA 2VWLA 4ABHA 3BSQA 1C1NA 4BAQB 2QIQA 2P8OB 3TITA 1HV7A 4A7IB 1O2OA 2A31A 1RFNA 1FJSA 1LHCH 4FVBA 3RXSA 1RD3B 5AF9H 1TX7A 4JZIA 3TNTA 2TGPZ 3GCHB 3F6UH 1P05A 4NWKA 5EXNA 1J14A 1YPHE 4I8HA 4RKJB 2BY8X 3M3TA 3BTME 1KLTA 2ZU5A 2XBWA 3TGIE 2ZGHA 4FUDA 1C4U2 1THRH 1Y5AT 2STBE 1QQUA 1ZRKA 1KY9A 1QTFA 4K60A 4CH2B 1E0FD 4U30A 1BMNH 1EATA 2PFEA 1EZUC 4INKA 2ZKSA 2Q6DA 1UMAH 1G2MA 3KN2A 4DGJA 1D4PB 4CREA 3SNCA 4Y0YE 3BN9A 5CE1A 4Y76A 2OBQA 3A86A 3W95A 4DJZB 1C1VH 5AHGH 1YC0A 1TX8A 2G5NA 3RUOA 1MCVA 3VEQB 4GSOA 1UCYE 3E0NB 3TK6A 2FOHA 2UUJB 2QCYA 1GGDB 1C5QA 1NRQH 2KAIA 4AB9A 2VH0A 3A88A 4GUXA 4A92A 3ZZ5A 4K1SA 5ABWA 3TK5A 1P2QA 2AGIX 4MVNA 3TH3H 3PWCA 1DSTA 4IN2A 1TBRH 1O3PB 1UHBB 3P6ZB 1EPTA 1NU9A 2FODA 1C1MA 4D9RA 1H9HE 3SV7A 1QBOA 4X2XA 6GCHG 1ELTA 5DP7A 3HPTB 5F8XA 3VFEA 1DICA 1ZJKA 2ZFTA 4B73A 1SGNE 5ESBA 1K1JA 1DWEH 3KCGH 4FVDA 4INLA 1QHRB 4LK4A 1XKBC 2FDAA 2HRVA 1AVWA 1BMMH 1GI3A 1S6HA 2V0BA 1EJMA 5EU8A 2WPHS 2ZU1A 1MMJN 3FP7E 5I25A 1IQHA 3RXKA 1QCPA 1P2IA 2O8MA 3O8CA 1YPJH 2ZG0H 1DOJA 5F6MA 4ABDA 2BXTH 1Y8TA 3DD2H 4ISHH 1SLXB 2QXJA 4FUJA 2ULLA 1SVPA 2D8WA 1W0ZU 1HJAB 2Z6BD 2XC0A 3Q3KA 1OWHA 2K1QA 1TB6H 4B76A 2GCHG 4K5ZA 1J15A 1GI6A 2GZ8A 1YLCA 1LPGB 2F9OA 1AU8A 2AMPA 1BBRE 1F0TA 1AVGH 1PQ7A 4J1YA 1IQGA 4ZHMU 4O3TA 3OY5U 1DUAA 1V2JT 3SGQE 4DCDA 1ZPZA 2AFQB 2A2XH 1Y59T 2A32A 3BTFE 2F91A 1XUFA 1BTZA 3S0NA 3TK9A 7ESTE 1BTWA 4NCYA 4RN6A 1W13U 1HAGE 4D76A 3ZYDA 2YNAA 3L6PA 4AOQA 2Z3EA 1UTJA 4DW2U 2OINA 3NK8A 3JZ1B 2D2DA 1SHYA 1EZQA 2PHBA 1HDTH 4Q2KA 4CRAA 1QGFA 2O8WA 1W11U 4KTUA 1AB9C 4O03A 1JBUH 1Q31A 1D3TB 2SGQE 1O30A 3ZVGA 1HUTH 5TCAA 3ZZDA 3QTVH 5J4SA 3VB5A 4CR9A 1ELEE 3PLKA 1PQAA 5GPIB 3RXFA 3SV8A 1DXPA 3KQBA 3MU1A 1P0SH 1UTLM 4HTCH 4H42U 2VVVA 3AW1A 1HRTH 3UUZA 3PMBB 3TGJE 1BTHH 2EI7A 1CVWH 6ESTA 5H4IB 4RSPA 1A3BH 4A1XA 4Y8ZA 1T8MA 4BXSA 5C2ZA 2ZTXA 4E05H 4ZXXH 4Y8XA 3AW0A 2PSXA 3KQEA 2W3KA 3G01A 3U8RH 2QC2A 3EA9A 1VJAU 3RXRA 2FOAA 1CBWC 1Z1JA 5TCCA 4YESB 1F92A 3RXTA 1LDTT 4ZHLU 1AZZA 1HAVA 1GCDA 1GCTC 2G81E 1SI5H 1ZSLA 3MNCA 5C1YA 1NFWA 2XXLA 1GHAG 1GJ4H 1BZXE 3PM3A 1NS3A 1BA8B 1VITH 3MO3A 1O2NA 1EUFA 1ARCA 4YO9A 6GCHF 4B2CA 4Q7XA 2C3SA 3RXHA 2H5CA 4FUFA 2VINA 4TPIZ 3UNSA 1YPHC 3LH1A 4UFEH 2A5IA 3A7WA 3QGNB 1H9LB 2OC7A 3EDXB 1MKXK 1FAXA 3B23B 1BCUH 1O5BB 1LVYA 1C5TA 1ESAA 1TNLA 4RKOB 4CHAC 1M9UA 1FNIA 2FYQA 3TIUA 2PV9B 3UTUH 4AFUA 4O97A 3H7OA 5A8XA 2XBYA 2ZDKA 3BTWE 1MCTA 2F9UA 4WF8A 3RLYH 3GICB 4E7NA 5HXFA 1BOQA 2G52A 4I8GA 3LGUA 4UFFH 3F9HA 2SGFE 1AI8H 1ZR0A 4NIVA 1CQQA 1AUTC 1SGIB 1SG8B 4R0IA 1V2VT 3T26A 1P57B 1C5YB 2AMQA 2WPIS 3K6ZA 1HPGA 4IGDA 1SGPE 3KHVA 2A5KA 2QAAA 1EPTB 4GCHF 1SLUB 1H4WA 4DIHH 5EXLA 1O37A 2V3HH 1E36B 3DUXH 4I8LA 1O2LA 4BTIB 2ZHDA 3M5OA 1PPHE 1TNJA 2BD9A 1S83A 5GJ4B 1NRPH 1AKSA 4BOHA 5LGOA 1SGFA 1SR5C 5DJ7A 3E0PB 4K8BA 2R0KA 1CHOF 3GDVA 4BANB 1CGJE 2SGAA 3ZV9A 2XC4A 1AZ8A 2ZDLA 2W7UA 2CV3A 2UUFB 2P3TB 1T7CA 6CHAB 1BHXF 3CS0A 2G4TA 2AS9A 2XWBI 1C5LH 1F2SE 7GCHG 5JYIA 3GYMA 2P16A 3STJA 1Z8RA 2AGEX 1AE8H 1LHFH 3CENA 1O3AA 3DT0H 4IC6A 2Q1JA 3MU0A 2ZZUH 3T25A 1O3KA 1OWIA 3H7TA 3P70B 1YPGH 3OSYA 1C2GA 1VCPA 1K21H 3E3TA 4AFSA 5SGAE 2FS8A 5LPRA 5DP3A 1O3MA 3GCNA 1VR1H 1O2PA 1RS0A 2BVRH 2C8YB 1O5AB 3NUMA 4CH8B 2HNTE 4FU9A 2DE9A 1YM0A 2EC9H 2WYGA 2GMTC 1EZSC 2FLBH 3RU4T 3LGTA 2HLCA 2ILNA 1SQAA 1IQFA 1OXGA 3FZDA 3E91A 1O32A 2ZHEH 3H5CB 1F0SA 2JETC 1OSSA 1XUGA 3E8LA 4Z6AH 3MNSA 1O3GA 3UQOA 1XKAC 2B7DH 1QNJA 2G8TA 2BD3A 1TGCA 3MU5A 3SU5A 1NROH 1Q2WA 1ANCA 1O2IA 2EI8A 3M37A 1G9IE 4X0WU 2WPKS 2Z9KA 1XVMA 2W26A 4UFDH 2C8WB 5L2ZH 3Q76A 1J9CH 1ELBA 1O3NA 3Q00A 4YOJA 3S9BA 1JOUB 1TYNA 3F1SB 1GDUA 3SV9A 1UVSH 5FBEA 3SNBA 3A87A 2BX3A 1OP0A 1TGSZ 1G3DA 5JBBS 1NM6A 1O3BA 1UTPA 3LIWA 2CN0H 4AX9H 4Y7AA 4F4OC 4A1VA 2M5TA 3SQEE 3B9FH 4B75A 2A7HA 2ANKH 1GJCB 4AORA 3MNBA 1CGIE 1Y3XA 1D9IA 3BTTE 1ETRH 1Z8IB 1ZRBA 2HNTF 1IHSH 3M7UA 1C9TA 2AEIH 3SHCH 1TNGA 1FUJA 1IQLA 3QK1A 3BTHE 2VGCB 4YTAA 5J4QA 2HOBA 2WYJA 1DXWA 3SI4H 1QURH 2Y6TA 4AFQA 1FY3A 3EA8A 4AFZA 1O2JA 2A45B 1C9PA 4TY6A 2F9NA 1TMUH 2BTCE 1AWHB 3A7VA 4E06H 1D6WA 2ZCHP 1P11E 1HAVB 1V2KT 1WU1A 2UUKB 1W3CA 1GI7B 2Y7XA 3FFGA 1Z8JB 1L1GA 3M5LA 3GYLB 1DDJA 1NRNH 4LZ1H 4WH8A 4OS7A 1FY8E 2XNIA 3SU6A 5A09A 3RMMH 9LPRA 1QIXB 2VVCA 2QXHA 3P92A 1PQ8A 1ETSH 2FI4E 5EQRA 3C27B 4GPGA 5JPMH 2ZDVH 1A7SA 1UCYK 5FCRA 2ZFRH 3TJNA 2P59A 3M36A 1LVMA 2AYWA 1LHEH 3BEFB 1C5XB 3P8NA 3BG4C 4UONA 2D1JA 3LDXH 2ANWA 2OQUA 3UOPA 2VIPA 5IDKA 3AASA 1HAOH 1KTTB 1V2WT 1Q3XA 1YCPM 1ZTLA 5F8ZA 2GGVB 2THFB 2QA9E 3E6PH 4CBOA 4M7GA 2ZDNA 4MPVA 2I6SA 2VIVA 1GHBF 2ZHQH 1FIZA 1Y5UT 4X6PA 1CA8B 1W0YH 4UFGH 1O5FH 2AERH 3OYPA 5E0GA 3AVZA 2ZPRA 1T32A 2WUCA 1SGTA 1RXPA 1ELCA 1FMGA 1GG6C 4QT8C 1T8LA 1MD8A 1Y3VA 1BRCE 5HYOA 3O8DA 4NA7A 1TLDA 2Z9IA 4ZROA 4NIYA 1AKSB 4X1NU 4OS5A 3A8BA 3A84A 2BLVA 4AYVB 1NTPA 4CRCA 1C2FA 1GBFA 3MNXA 2O9QA 1N1LA 1ZTJA 3U8OH 2FX4A 4ZMAH 2A4GA 3RLWH 1O3IA 1RGQA 1QB1A 3ATLA 4ZH8A 4TYDA 2I6QA 4D7FA 1HGTH 3GY7A 4MNWA 2O8LA 1Y3YA 1BB0B 1LCYA 3EQ0H 1VCQA 1ABJH 4IMQA 2UWLA 1A4WH 4WMFA 1UK4A 2PTCE 2OC1A 5GDSH 1DWCH 3M3VA 1O2MA 4U01A 3SJIA 4VGCC 3ZVFA 4E7RG 5C5OA 1CGHA 4BNRA 1TX6A 3K65B 1G3CA 2NU3E 3S9AA 2JH5D 5T6GA 1GBLA 1GVZA 1PJPA 5PTPA 1Z6EA 2WINI 3MWIU 5JDUB 2BDHA 3ITIA 1A3EH 1QB9A 3U1IB 1IOEA 1IHTH 3S7HB 3LU9B 2P93A 1UTMA 1W12U 2ANMH 4IC5A 3W94A 1TMBH 1DE7H 5DK1A 4I31A 1P3CA 2BDBA 3F9FA 3GY8A 1O3CA 3PMHB 1GMCF 4Y0ZE 1Z8GA 1DY8A 3RXVA 1C1RA 2PLXA 1JRTA 1UO6A 1KIGH 1VITF 1P03A 1ELVA 2ZU4A 4JYTA 4ESTE 3BTEE 3SV2H 1NRSH 3GCOA 2J9NA 2ZGJA 1UTQA 1QQ4A 1BT7A 3URDA 1XUKA 1ZOMA 3S9CA 3HKIB 1C1UH 2G00A 1BTPA 3RXJA 1GHYH 4WWYA 5T6DA 2ZC9H 4AZ2B 1DLEA 3PV4A 5HM2A 1DS2E 1Z6JH 3QO6A 3RXGA 5A0AE 5FHTA 1C4Y2 3ZVBA 4IS5A 1GVLA 4FUBA 1HJ8A 1LPZB 1O2UA 1ZPCA 1O2VA 3PTBA 1BIOA 2C90B 1ZHRA 2WUBA 3P8FA 4NZQA 1NO9H 2OQ5A 1MKXH 4AG2A 2CMYA 2ESTE 5DP5A 1FDPA 1FQ3A 3AAVA 2A1DB 4IW4E 4ASHA 1SBWA 1DANH 2BY7X 3RXEA 3UFAA 1KTSB 1HFDA 1LPKB 2H9EH 1SSXA 1O33A 2QGRA 2Y80A 3DHKH 2HWLB 2BD7A 1G36A 1RIWC 1TNIA 1F7ZA 4X8SH 1MKWK 9ESTA 4IN1A 4DG4A 2BQ6B 1B5GH 1O2WA 2XRCA 1Y3UA 2J34A 1O2XA 2HPPH 5DP9A 2A7CA 3RC5A 2BLWA 1QL7A 1SGYE 1P2MA 4TY7A 1LO6A 2TPIZ 3UNRA 1JRSA 1O2GH 1NESE 4GCHG 1PPGE 4ZHAA 3U98H 5EXMA 5DP6A 4NG9H