2AGGX

Succinyl-aapk-trypsin acyl-enzyme at 1.28 a resolution
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords beta-trypsin
publication title Insights into the serine protease mechanism from atomic resolution structures of trypsin reaction intermediates
pubmed doi rcsb
total genus 52
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2005-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2aggX01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2aggX02
1UHBA 1BT7A 2Z9IA 4JZ1A 1DLEA 1BMLA 3PO1B 5C1YA 3K65B 1NO9H 1ANEA 1YPMH 2KAIB 2WYGA 1C2MA 1QNJA 4MPVA 3ZVAA 1TRMA 3FZDA 4BANB 4FUHA 1HAOH 1JIMA 3GY7A 1QL8A 2BLOA 4H6SB 2XYAA 2QN5T 4R0IA 2ZNKH 1MKWK 1MQ6A 4AYYB 2J4IA 1AVXA 1SBWA 1ZHMA 3PB1E 3A84A 1GBEA 1O2JA 1C1WH 1NT1A 2FESH 2BOKA 2FI5E 1Q3XA 2ZDLA 3SU4A 1O32A 4NA7A 3QK1A 5FAHA 1G36A 1O2UA 1AVGH 4GCHG 2P16A 1K1JA 3A88A 3AAVA 3PM3A 4F4OC 2ZU5A 1A0JA 1ORFA 1AIXH 4Z6AH 1O34A 1UVUH 3ITIA 3RXCA 4CBOA 1QB6A 4KTCA 3ATIA 3M5OA 1B7XB 3N7OA 3RXSA 2BDYA 2TGPZ 2ZU1A 5EXMA 1U6QA 1O3OA 1V2UT 3F9GA 2C8XB 1ELGA 1G30B 1O2ZA 5E0HA 1TNJA 5CMXH 3TH2H 3BV9B 1MAYA 4NG9H 3SNBA 4AG2A 2V0BA 1QJ1B 2Q6DA 3SOSA 4MNXA 7KMEH 1O5FH 4ABAA 1IOEA 4OS4A 2XC5A 2R0KA 1Z6EA 1D3QB 4I8LA 3HGPA 2FPZA 4XBCA 1W13U 4CR9A 1P05A 1OYTH 3E16B 3PMBB 1IQEA 1FIWA 1DITH 2SNVA 4FUIA 1ZTKA 4OGXA 2HWLB 1O5CB 4WMDA 1CGIE 2ZDMA 2O8MA 1PPFE 5TCAA 2G51A 2F9NA 1P03A 3P8OA 1G9IE 4YTAA 3HK6B 1HAIH 4IC5A 4Y7AA 5I25A 1EZXC 1NN6A 1SL3A 4AZ2B 1LVYA 1UHBB 3NCLA 1F5RA 2GT7A 3D49H 1V2VT 3LOXA 4FXGH 3TJNA 1WSSH 3CS0A 5E0JA 3ZZ3A 4BXWA 2ZGJA 2QC2A 5HM2A 3H5CB 2VIQA 1MKXK 4DG4A 4X0WU 4FUEA 1P04A 1DY9A 1O31A 1G2LA 4GHQA 1SGDE 1BBRH 4Q7ZA 4YOGA 4ZUHA 2WUCA 1Y8TA 1EB1H 1PQ5A 1GI0A 3A80A 3ZVBA 5JBCS 1QR3E 1HIAA 2QXGA 1Y59T 1SLWB 3HKJB 2J92A 1SFQB 3VB6A 4MPUA 4MPWA 1Z8IB 1F0RA 1B0EA 1M9UA 4FU9A 3UUZA 1QB1A 4CBNA 2ZP0H 4KTSA 3SORA 1TPPA 2UUFB 4JCNA 3MU1A 4AYVB 4K1SA 1BRAA 5F8TA 4NSVA 4CH8B 4HZHA 1MKXH 1DPOA 3EE0B 1YM0A 5EPNA 3RC6A 1EJAA 5EQSA 1K1LA 5F8ZA 2BD3A 2BD4A 2AFQB 1PYTC 2C93B 1PPHE 5DP3A 2PTNA 5C3NA 4INLA 1T31A 1W2KH 1EP5A 2FOGA 2P95A 5H4IB 4AOQA 4ABJA 1V6DA 2GT8A 2HPQH 2Y5HA 4Q80A 4NIYA 2Z6BD 1SLUB 2CMYA 5AFYH 5FPYA 2VWNA 2FO9A 1IQFA 1K22H 1O3PB 4YOIA 3LKWA 4INHA 1YLDA 5LPEA 1KLIH 2VIWA 4A1TA 4X1RU 3UIRA 1P10A 3DA9B 4B2AA 4WWYA 5T6DA 4B75A 1UCYE 1ANCA 3H7OA 4ESTE 4K2YA 1BTWA 1LHGH 1JWTA 4RKJB 1N6YA 1RTKA 2R2WU 2DE9A 2ZF0H 1AKSA 2GV6A 4AN7A 1BMAA 1TALA 2QCYA 4OS5A 1E34B 1AO5A 1C5SA 2ZFFH 4D9QA 5DP9A 1A0HB 2ZDKA 3FAOA 4GCHF 1HAPH 2WV5A 1DWDH 3EDXB 4IMZA 3P95A 2UUJB 3A81A 4CRCA 1EATA 1O2HA 1MTNB 3V7TA 1C5YB 4MG3A 1O2GH 1J8AA 2F9UA 3P8FA 2BD5A 1HIAB 1VGCB 1AY6H 1G37A 1HAGE 2XBVA 2XC4A 3KL6A 2OQUA 4DY7B 1WTGH 2WPKS 3A7VA 1G3BA 3I29A 3ZVEA 1V2RT 1P02A 1H4WA 1BA8B 4U01A 3RM0H 1QHRB 1LDTT 4XOJA 5F8XA 5LPRA 2FDAA 4UFFH 5DP6A 4I8GA 4A1VA 1KYNA 4TWYA 5FXLA 1X7AC 3AAUA 3KQDA 2B9LA 1GJ5H 2H2ZA 1GJ4H 3ZYEA 1LO6A 3U9AH 4INKA 3TH4H 2YNBA 3T26A 1AFQB 3AW1A 1FY1A 1PJPA 3FP6E 1T8LA 5GWZA 3W94A 4WMFA 2GMTB 1BQYA 1H9HE 5FX6A 1J17T 3IWMA 1UTOA 3DFLA 3GDVA 3SJOA 1C2FA 3SI4H 1ABIH 1CA0C 1ZPCA 3GY6A 2ZPSA 1ARCA 3LGIA 3U8RH 3RXIA 4BOHA 3LH3A 4O3UA 1DFPA 2BY6X 1EX3A 2UUYA 4JK5A 2TGDA 1XVMA 3BG4B 3DFJA 1B0FA 1FAKH 2GKVE 1C5VA 3BEIB 1F5LA 2FXRA 1KXBA 4JZDH 1CHOG 1BDAA 1GMHF 4VGCC 2O8UA 1LKBA 1AKSB 1SSXA 2FOHA 1LHCH 2ZFQH 1O2LA 1Z6JH 3C27B 3RU4D 4B74A 3O8CA 1H8IH 5FPTA 5HYOA 3GY3A 1CT4E 4FU8A 1JXPA 3RXGA 4X1PU 2HPPH 1OSSA 1C2EA 2STBE 1A4WH 3AASA 3MWIU 5DG6A 2PV9B 3ZVCA 3S7KB 2ZHWH 1AN1E 4CRDA 3E1XB 3ZZ6A 1OP8A 1Y3XA 1QBVH 4B73A 2IN2A 1THPB 1UTPA 3LIWA 5EXLA 4ABHA 2ZGCA 1ANDA 1AWFH 4FVBA 3H7TA 1GI7B 2OC8A 2ZWLH 1O2TA 2PKAA 2LPRA 2P93A 2ULLA 3A8BA 3RXJA 1RXPA 3URDA 2PR3A 3BTEE 3FP8E 3TGKE 1WQVH 4YM9A 1JRSA 3SU0A 1D9IA 2OUAA 3KQEA 1RD3B 3BEFB 1YC0A 1LQEA 1ACBE 2PGQB 1D3DB 1FY5A 1G32B 4J2YB 1ZHPA 1LQDB 1ZRKA 2FI4E 2XCFA 2A5AA 3MU4A 2LNCA 4ASHA 1E37B 1EAIA 1VJ9U 2FX4A 3A82A 4YESB 1C1QA 1C4U2 3BIUH 1JIRA 3LU9B 3Q3YA 3URCA 1YKTA 3ZZ5A 3VGCC 3KCGH 1C2IA 1C5WB 3EGKH 2ZCHP 5LH8A 1SQAA 4ZKSU 3PTBA 3SQHE 3SQEE 4AFUA 3EAJA 3TK6A 4YT6H 1CBWC 1T32A 3SHAH 4ISIH 1G2MA 1QQ4A 5F03A 1MTVA 4MQAA 2AH4X 4F49A 4QT8C 3QUMP 4NA9H 3SJ9A 1FDPA 1GBDA 1KXFA 5HM9A 1HAVA 5DP5A 2AMPA 1GBHA 2EA3A 4X2XA 1BTHH 1V2NT 2BDAA 2J34A 1P09A 4CHAC 1GBLA 6GCHF 2AYWA 3EYDA 1GCTB 1O2QA 1S82A 1DT2A 1ELDE 1LHDH 1INCA 2FOFA 4ABGA 1GBKA 1ZZZA 2BD7A 3GISB 1KLJH 1O3GA 1ID5H 3A7YA 2DUCA 4D7GA 5A0AE 1YBWA 1WYKA 4UFDH 1O3MA 1BUIA 4Y6DA 1TNGA 8ESTE 1OWDA 5BRRE 1OX1A 1ZMNA 1K1IA 3HATH 4WF8A 2AMDA 3BTWE 3A8DA 1ZJDA 1O2NA 1GI1A 5B6OA 2PKAB 3FFGA 3A7TA 4GSOA 3RU4E 4B71A 1KDQA 1TGSZ 1QRWA 3NPSA 2Q6FA 5K0HA 1Z8GA 1ESTA 1ELBA 2J95A 1O3JA 5PTPA 1G3DA 1GI9B 1TWXB 1TONA 2ZGBH 2XTTB 3BTDE 2OC0A 4I8JA 1C5UA 1O3FA 2ALPA 3GYLB 2BDHA 5HMAA 1DWEH 1CHOF 3M3VA 2GCHG 5CHAC 3RMMH 2G55A 1A2CH 3Q77A 4A5TS 4WVPE 4AB8A 1T8NA 2ODYB 3S69A 1Y5UT 1KXCA 2Y6TA 1GI6A 1TRYA 4X2WA 1LVMA 3ATLA 1FUJA 1MUEB 1GMCG 4CREA 4TYDA 3QN7A 3TGJE 3AVZA 3SNAA 3SNCA 1CSOE 1LPZB 3UFAA 3UY9A 5EPYA 3RXFA 2ZGXH 1ZGVA 2Y5FA 5DGJA 1Y3UA 1EOLA 4FUBA 3ZZBA 3M3TA 3RXOA 1SGCA 4ZXXH 2ZHQH 1SGQE 2ANMH 2PHBA 1UTNA 2ZPRA 1A1RA 1S5SA 4IN1A 1FQ3A 1NRRH 1HAVB 1GI2A 4PROA 1EXFA 4RN6A 1SLVB 1TYNA 3GCTF 1NFWA 1O37A 2CF9H 4UEHH 3KQBA 1ZPBA 4GVUA 2Y80A 4K8YA 2OC1A 3ZZAA 4DT7B 1NFXA 1IQGA 2HALA 2J2UA 1A61H 7GCHG 2WPHS 1T4VH 1P12E 2ZO3H 1O3DA 3SU1A 2W7UA 3VB7A 4MLFB 1RTFB 2B8OH 1SHHB 1O2WA 3A87A 2Z3CA 2VWMA 2ZCLP 1MCVA 3QX5H 1O33A 1WAYB 5CE1A 2ZIQH 2GCTC 4ZAEA 2HVXA 2CGAA 1DANH 1S83A 1OYQA 2EI6A 1P2JA 3LJJA 3SW2B 1LCYA 1TIOA 3BTQE 2ODQA 1KDQB 1EKBB 3OU0A 3UQVA 4X1QU 2RA0A 1C5ZB 4DVAU 1O5AB 4NGAH 2Z9KA 5EXNA 1THSH 1P3EA 4B76A 1ZMJA 3HGNA 1IQHA 1VITG 4JYUH 1PPZA 1Y3YA 2DE8A 2OCVB 4GPGA 1HJ8A 4BTIB 1IQLA 1C2DA 1N8OC 1RS0A 1E35B 5C2ZA 1ZR0A 2C4FH 3CENA 1HRTH 3ZV8A 1GHBG 5A0BA 1C1TA 2AIPA 1BZXE 2HOBA 1AD8H 1O5BB 1W12U 2G5VA 1WOFA 1K21H 4HI3A 1SHYA 1GBFA 3AW0A 3TVJB 1ZSJA 4K1EA 2UWPA 2FOEA 2BQ6B 1BMNH 1GJ9B 1C1PA 5G4BA 2JETC 1LHFH 4D9RA 1MAXA 2NU0E 2VIOA 2FLRH 2QV1A 1UK4A 2SGAA 4ISHH 4UDWH 1GBJA 1TA2A 1OP2A 2PKSC 3LC3A 4X8SH 3L3TA 4K69A 1C1UH 5C67A 1RGQA 4IS5A 1Y3WA 1HDTH 7ESTE 3MU0A 1PPCE 1ZLRA 2YOLA 1TMTH 2BHGA 2A2QH 2AERH 1A5GH 1AU8A 2A32A 3IG6B 1IAUA 1O2PA 1TA6A 1TPAE 4I7YH 1B5GH 4ZXYH 3GDUA 5E2PA 3ZZDA 2PWXA 1GPZA 2K1QA 3SJ8A 4AORA 1YPEH 4BAQB 2FTMA 3KEEA 1TGTA 1MKWH 3M36A 1V2OT 3A7ZA 1O3IA 1GBAA 1GJ6A 3RUOA 1L1NA 4CH2B 2OINA 3FANA 1AQ7A 1GJCB 2GCHF 4X2VA 1BCUH 3MI4A 3A86A 5JPMH 1C4V2 2A5KA 1DWCH 4Y8XA 1IHSH 1UK3A 2WINI 4Y10E 1Y5BT 1GMCF 5C5NA 4E06H 4X1NU 3P8NA 1Z71A 1TAWA 1ESBA 1SGEE 2WPIS 2GZ7A 1JMOH 1LPKB 2OBOA 4E05H 1S81A 2A4OA 5DP7A 1NY22 1K1OA 1BOQA 4BXSA 3RM2H 4JYTA 1QCPA 2XWAA 2ZCKP 2CJIA 2EEKA 2ZFTA 1O3AA 2Z7FE 1RJXB 6LPRA 3MNSA 3MU5A 2F9PA 2Q6GA 1L1GA 5EQRA 1UCYK 1ZHRA 3F1SB 2ZGHA 1AHTH 1BITA 1C5LH 4ABFA 2R2MB 2GZ9A 2Y81A 1O5EH 1O3NA 3KNXA 4YOJA 4GHTA 7GCHF 1LHEH 3DD2H 3D62A 4BAKB 1EQ9A 1Y3VA 1P9UA 4A92A 3T29A 2VVVA 1TQ7B 1HGTH 3PLKA 3SGAE 2F9VA 1P2KA 1CT2E 4WMEA 1THRH 2A2XH 2Z3DA 1F0SA 3E91A 2BY8X 5EG4A 3E0NB 1FAXA 2GTBA 1SGNE 1O5DH 2QXIA 1XUFA 2ZU2A 1GMDF 3DHKH 2CF8H 5A8XA 3BTHE 1QFKH 2Y7ZA 3A83A 1BRUP 1GGDC 1W3CA 3LH1A 1L4DA 1TQ0B 5DP4A 2ZG0H 1ELCA 2Q1JA 1CGJE 1TFXA 3VGCB 1GHAG 1V2KT 3QO6A 1P3CA 1RRKA 2Z3EA 2ZI2H 1MZAA 2ZKSA 2ZEBA 1VR1H 1CBWB 3MOCA 4JZIA 1D4PB 1GHBF 1P9SA 1YPHE 3SV2H 4AX9H 5E0GA 3TJVA 4ABEA 1O2IA 3U8TH 4MVNA 2FEQH 5GCHG 1BBRE 4CHAB 1HAXB 3UQOA 1NU7B 1O2OA 5T3HA 2ZDAH 2FOAA 1ESAA 4KP0A 4UFEH 2ZQ1A 5L2YH 4E7RG 4Y8ZA 1XM1A 1AMHA 3T25A 1P2MA 3F9EA 1FPHH 1W0YH 4ISLA 3VXFH 1W0ZU 2G52A 4X8VH 1SG8B 3SUDA 1GHVH 2W3IA 3RP2A 3A7XA 1IQMA 4UONA 1DE7H 4Y7BA 5JBTA 4Q7XA 2BLWA 2FOCA 2VNTA 1ZSLA 1OWIA 5GIBA 2OXSA 1HXFH 1UO6A 2HNTC 3EQ0H 5L6NH 2W26A 3ZZ7A 3JZ2B 1TGNA 1S0RA 1FONA 2IPHA 4FU7A 4DCDA 3ODDA 1WQSA 4OS6A 2ZFRH 3P17H 3TK5A 4CR5A 3ZYDA 1EPTC 5EODA 1G3EA 2P59A 2OP9A 1E36B 4X6OA 4K60A 4O9VA 3TLOA 5DJ7A 1CE5A 1GJDB 1P2IA 2FOBA 2ASUB 2VINA 3TIUA 1FY8E 2PW8H 4TPYA 1SGPE 2ZC9H 5A0CA 2VIDA 2ZTYA 1RIWC 5CHAB 1D3PB 1QBOA 3F9FA 4Y0YE 2BX3A 4AGJA 1CVWH 4OS1A 2XXLA 1GVLA 3CP7A 2SFAA 3FVFB 3TK9A 3M37A 5TJXA 2PGBB 2Y5GA 1O2MA 4THNH 2F91A 1GBCA 3TJOA 1ZMLA 2ALVA 1MTWA 1UVPA 2A7CA 7LPRA 1LVBA 3R0FA 3BF6H 5FBEA 1P06A 1QA7A 1TPSA 3GY2A 2BQ7B 4Y8YA 1YCPK 1W14U 3OX7U 2V6NA 5IDKA 2B0FA 1O3HA 1UTLM 5GJ4B 2Z9LA 1W7GH 3KF2A 2BD9A 1DLKB 2ZDNA 4YLUA 2BVRH 1ZOMA 1Z1JA 5J4SA 1HNEE 1HCGA 2AGEX 2WV4A 2ZHEH 2BY7X 3MHWU 4TPIZ 1UVSH 1NC6A 1ELFA 1DDJA 1CO7E 1UTKA 3KQCA 3U1JB 5AHGH 3GY5A 2QXHA 4B2BA 4ZKRU 1SOTA 2J38A 1A7SA 1EP6A 1O2SA 1YCPH 1ELVA 4IN2A 4UFGH 5A2MH 1F0TA 1RFNA 5EQQA 3T2NA 4CRBA 2GCTB 1K28D 1LMWB 1LTOA 4K5ZA 1P57B 5FCRA 1DX5M 4MTBA 1D6WA 1GHAF 1EAWA 1A5HA 4GAWA 3LT3A 3NK8A 1TGBA 4AGKA 3MMGA 3LGYA 1KTTB 1ZSKA 3M5NA 4XBDA 1AB9C 4ZHLU 3K6YA 3KIDU 2W5EA 6CHAC 2G4UA 2HLCA 3LC5A 3Q76A 4DOQA 5FBIA 1N8OB 1TMBH 4HGCA 3RMOH 4JZFH 3PWCA 2BXTH 3UWJH 3OY5U 4WH6A 3QGNB 2EI8A 3F9HA 3L33A 4WY3A 1S85A 1HJAC 1Q2WA 3QTVH 4Y79A 1XXDA 1XX9A 2JETB 1ETTH 1HB0B 4MNYA 3VFEA 1O3KA 3RXQA 3I77A 2NU4E 2FIRH 3NKKA 2D8WA 1HYLA 2G8TA 3PTNA 2PKSB 1S0QA 2I6QA 1K1PA 1XUJA 3MO9A 1HV7A 4OGYA 2BOHB 3UOPA 2BLVA 3V3MA 2OBQA 1A5IA 1A3EH 1YPKH 1O39A 1KXDA 2BD2A 5ESTE 4UE7H 1TX8A 3R3GB 2CHAC 4LZ1H 1VJAU 1SLXB 2EC9H 2VVUA 3K9XB 3GCOA 4ZKOU 3WY8A 2JKHA 2BM2A 3HKIB 4GUXA 3ESTA 1JOUB 1HBTH 3D65E 2R3UA 2XBXA 2BVSH 2SGEE 1GVZA 4D7FA 1FMGA 2C90B 3FP7E 1GHZA 1FNIA 9ESTA 3PLBA 3CS7A 3KN2A 3PMAB 1XUIA 4ZHMU 1OWEA 1GI3A 1GL1A 1NU9A 3M7UA 3RXAA 5JB9S 1UMAH 1UTJA 4Y0ZE 3M61U 3E3TA 1ETSH 1O2VA 2P3TB 3BTFE 1K2I1 3RXTA 3MH5A 2C8YB 1XKAC 1NS3A 4XE4A 5E2OA 2AEIH 3QDZB 4MPXA 1O30A 2V35A 2ZHFH 3M5LA 3M7TA 2PUQH 4O3TA 1QRZA 3P70B 3U69H 2ZFSA 2ODPA 1AVWA 2ESTE 2BXUH 2A4RA 2RDLA 2HNTF 1XXFA 1DWBH 1YGCH 4H4FA 1C9TA 1NFUA 1DSUA 1EAXA 2CV3A 4CRFA 1JRTA 3E90B 1ZTJA 4KKDA 1C1NA 5HXFA 3Q3XA 3QZQA 4NCYA 2EI7A 1EAUA 2J9NA 1SR5C 1EPTA 2FP7B 2OD3B 3PMHB 3S9AA 1J9CH 4AFSA 2C3SA 1O2YA 1HLTH 1SQTA 3QLPH 1C5XB 1C2HA 2YNAA 5GDSH 1CA8B 1ZYOA 4RSPA 5JDUB 3UOUA 3UNRA 3PLPA 3BG8A 1HAZB 5A09A 2VIVA 3BTGE 4MNWA 4R8TB 1OOKB 1VCWA 4NA8A 3RXKA 4ZH8A 2QYIA 2AGIX 2O9QA 1BTPA 2P8OC 1GGDB 2ZZUH 2VWOA 3BEUA 3KGPA 1TABE 3NUMA 1TBZH 4X6MA 1L2EA 2ZPQA 3PROA 2B5TB 1V2LT 4X8UH 3MH6A 5AFZH 3RXBA 3TU7H 2VH6A 1C9PA 1O3CA 4ISNA 3DT0H 5DP8A 2QXJA 4KGAA 1XUKA 2G81E 3RU4T 2ZTXA 3M7QA 2M5TA 1AUJA 1TRNA 1NESE 3GCNA 1FN6A 2IOTA 3BTTE 2TGAA 2BZAA 4RKOB 3SJKA 1FJSA 3SJIA 2D26C 3SV9A 1AWHB 4JZEH 1MH0A 2VWLA 3B23B 3MNBA 4AB9A 1E38B 1TNIA 5ETXA 3GY4A 3O8BA 1GDQA 2GDDA 1VCPA 2JH5D 1DY8A 2F83A 2G00A 2ZDVH 3RXLA 4Q2KA 5T6GA 1N6XA 2SGFE 4O97A 3QGJA 4FUCA 3UR9A 2FS8A 1A0LA 2GX4A 1DUAA 1GBTA 2D2DA 2R9PA 1BTYA 3A8CA 4YT7H 1CQQA 2PSXA 2PUXB 3ATKA 2ANKH 2VVCA 1O2XA 1EPTB 1SI5H 3BSQA 2FLBH 2OTVA 3GYMA 3K2UA 1H9IE 1HAHH 2STAE 1GI5A 1SGFG 1ZJKA 2UUKB 1UK2A 1MD8A 1HAYB 2R3YA 3RC5A 3OSYA 1F7ZA 1NTPA 1C4Y2 2Y82A 1TNHA 2ZECA 1V2ST 1RIWB 2XNIA 4NSYA 1J14A 2VJ1A 1EUFA 2CN0H 2G4TA 3LDXH 5EU8A 2JH0D 1VZQH 1TMUH 4ABIA 1H8DH 2BVXH 1UJ1A 2FOMB 3ENSB 1WBGB 8KME2 1GVKB 2W3KA 1DSTA 1YPJH 1NFYA 1ABJH 3P92A 4HFPB 2VH0A 3ZV9A 3SU6A 1KXEA 2GP9B 5DPAA 5EOKA 1O3LA 1LPGB 1V3XA 2BY9X 1AFEH 3SUGA 5I46H 4ZMAH 2BDBA 2BD8A 3LPRA 1G3CA 1CA0B 1CU1A 1T7CA 2GD4B 3RXUA 1ANBA 5C20A 2ZFPH 1V2TT 1BMMH 1VITH 2CXVA 1ELTA 3U98H 3SNEA 1C1OA 1O5GH 1SGRE 1GI8B 3DUXH 1D6RA 1C5MD 1ELEE 1ETRH 2RCEA 4IGDA 4DURA 2Y7XA 1OKXA 2A7HA 5SGAE 4U30A 1TOMH 3FZZA 1QBNA 1YPGH 2VB0A 2NU3E 4VGCB 2FI3E 1BTZA 1GCTC 1LVOA 1XUHA 3ODFA 2P3UB 1FPCH 3HPTB 3EA7A 1H9LB 1JBUH 2UWOA 1DM4B 2QF3A 5FCKA 2BLQA 1MD7A 1F5KU 1KTSB 3SU3A 2SNWA 1TOCB 2OLGA 1QGFA 1J15A 2WYJA 4LK4A 4WJG2 3GICB 1YLCA 1AZ8A 2GV7A 4X8TH 3K6ZA 2FWWA 2WUBA 3E0PB 4I8HA 1RTLA 1EZUC 3RXPA 1KIGH 1GI4A 1BBRK 1GWAA 4XDEA 1MMJN 4GLYA 4SGBE 3VPKA 1HUTH 1SFIA 5DKMA 2ZU4A 1F92A 1FV9A 1O3BA 3RMNH 1SMFE 1EZSC 3SU5A 4JK6A 3OY6U 1CGHA 1XMNB 2ANWA 2XCNA 2A0QB 4BNRA 5C1XA 3RLWH 1FXYA 1P2QA 2GVFA 1O35A 2QA9E 3SI3H 1AB9B 2BY5X 2ILNA 1YYY1 6CHAB 2FX6A 3UR6A 4BAOB 2D1JA 6ESTA 3SUFA 5JB8S 3O8DA 3SUEA 3OYPA 2O8LA 2FYQA 4YLQH 1HJAB 2W7SA 3UPEA 1FY4A 1XVOA 1QTFA 4B1TA 3A89A 2TPIZ 4AG1A 1T8OA 1V2JT 2A4QA 1UCYH 3RMLH 3I78A 4Y71A 1P01A 1DOJA 1TE0A 3UNQA 4NFEA 1QB9A 1QQUA 1GMHG 4DIIH 2P3FH 1VITF 2TRMA 1TGCA 1C5QA 1QA0A 5JYIA 1OWKA 3MO3A 1HFDA 4BTUB 2BZ6H 2I6SA 1YP9A 2GDEH 1L0ZA 1SGTA 1FI8A 3B9FH 1IQNA 5FHTA 3ZZ4A 4FUDA 1DXPA 1C1MA 1FN8A 1NM6A 3MYWA 3GCHC 2H9HA 2CHAB 5AVDA 2UWLA 3L6PA 1XUGA 2SGPE 2VGCC 2FS9A 1V2WT 1VCQA 1ZRBA 1MQ5A 1PPGE 1C2JA 1GG6C 1FY3A 5GPIB 1SOZA 1NRSH 1SGFA 4K3JA 5FX5A 1S84A 3E6PH 1EJNA 4IMQA 3JZ1B 5JBBS 4WH8A 1GHXH 2VIPA 1QY6A 4BAMB 5DO4H 1QJ7B 5A8YA 5K7RA 3PWBA 1BJVA 3OTJE 2J94A 1Q31A 3ATMA 2R0LA 2BDIA 1GBIA 3BTME 3LJOA 1C2GA 3NWUA 3SV7A 3UTUH 5C1UA 3RXRA 1C5PA 9LPRA 3S9CA 2AMQA 3U1IB 3M5MA 2ZQ2A 2GZ8A 4XFQA 1MCTA 3TJUA 4ABDA 1GJ8B 2ANYA 4D8NA 1ZGIA 1FIZA 8GCHG 2BB4A 3RXMA 4TWWA 2QIQA 4WXIA 4I32A 2FM2A 2V3HH 3O8RA 4DW2U 1V2QT 1C5NH 3BIVH 2PTCE 4IC6A 3RC4A 3SV8A 1Z8RA 1WUNH 2Z9JA 3SGBE 2A1DB 3HK3B 2Z9GA 2SGQE 5L30H 5AF9H 4ABBA 1TB6H 1PYTD 2WPJS 1AI8H 2A7JA 3PO1C 1NRPH 1NPMA 1K1MA 4TY7A 1BRBE 5L2ZH 5DK1A 1ELAA 2PLXA 1YCPM 1C1VH 3VB3A 3V12A 2AGGX 2IJOB 1WU1A 5E8EH 1S6HA 2V3OH 4MNVA 4Z0KA 3V0XA 1MU8B 4FUGA 3MNCA 6GCHG 1H1BA 1SC8U 3RXVA 1GJBB 5ESBA 1GJAB 4Q7YA 5LPFA 1TX7A 4KTUA 4SGAE 1PPBH 1MU6B 4IBLH 3STJA 4NIXA 3ZVGA 3A7WA 1KLTA 5LGOA 2QAAA 2JH6D 3A8AA 1C1SA 3D23A 4OS7A 1TNKA 4ZKNU 4H6TA 1P11E 2P8OB 1OXGA 3S0NA 1HJ9A 3QWCH 1HXEH 2C8ZB 2GGVB 1T4UH 2FTLE 3MNXA 4LOYH 4NWLA 4AFQA 1AUTC 5C5OA 2XC0A 3TGIE 1QL7A 3S7HB 4X1SU 2AS9A 1GJ7B 4Y11E 5F6MA 3SGQE 3T28A 4AFZA 3SBKA 1BB0B 2H1UA 1ARBA 1S6FA 3SZNA 1PQ7A 2B7DH 4ZHAA 3TITA 2HRVA 4A6LA 1PPEE 2PFEA 3S9BA 1SQOA 2HGTH 4FUFA 1FZZA 1D3TB 1QIXB 1TNLA 2XW9A 3Q00A 1P2OA 1DS2E 2TGTA 1KY9A 3ZVDA 1OPHB 5BPEA 1ZPZA 1P8VC 1IQIA 2ZU3A 4K8BA 2BQWB 5EW1H 4ISOA 3F6UH 4YO9A 4B2CA 1ZTLA 3F68H 2H6MA 4HTCH 3MTYA 1O36A 2PSYA 5TCCA 3ZZCA 1PQAA 1Y5AT 4DJZB 1A3BH 2ZTZA 1P0SH 1AZZA 5GCHF 2BDCA 1OP0A 5HGGA 2ZA5A 1C2KA 2NU1E 3PYHA 1FLEE 1C5RA 2BYAX 1SVPA 3RXHA 5T6FA 4K1TA 4X6PA 2XWBI 1EJMA 3QTOH 1Z7KA 2A45B 2RG3A 3GCTG 1EASA 1WTHD 1C1RA 1UTQA 3IITA 3UNSA 1UVTH 3E8LA 3VB5A 1BRCE 4LZ4B 3B8JA 4WXVA 5J4QA 1SGIB 2QF0A 3MH4A 4CRGA 2BX4A 1Z8JB 1C2LA 1GHWH 1LKAA 1K1NA 1DXWA 2RA3A 2QY0B 1GDNA 1EZQA 3BTKE 2F9BH 1AE8H 8GCHF 3UREA 3BN9A 4XSKU 3T5FH 4TY6A 1OWJA 2A4GA 4A7IB 1C5OH 1DICA 2O8WA 1KXAA 1TX6A 1PFXC 1YPLH 4FUJA 2ZHDA 1BIOA 4YZUA 4IW4E 4I33A 2XRCA 4O03A 3SV6A 2OC7A 1TPOA 4X6NA 2SGDE 2FZZA 1NRNH 2TIOA 3GDSA 4M7GA 2XBWA 2H5CA 4MDSA 1TLDA 1F0UA 3GOVB 1NZQH 4U32A 1C5TA 1W11U 3MU8A 1O38A 3LGTA 2HNTE 3ZVFA 2BMGB 3LGVA 1QURH 3G01A 3PV4A 1UTMA 4KELA 5A8ZA 1O3EA 1UVOA 1MBMA 4UD9H 1WV7H 4JMYA 1BHXF 1T8MA 1QRXA 8LPRA 3LGWA 2F9OA 1WCZA 1TBRH 3UWIA 3GY8A 3TNTA 1SGYE 1SPJA 3TH3H 1F2SE 1W8BH 1Z1IA 4Y76A 3C1KA 2WPMS 1NRQH 1MTNC 3M35A 2H9EH 1O2RA 1XKBC 4NIWA 1W7XH 4D76A 4JYVH 1CHGA 2OQ5A 1VGCC 1IQKA 3MFJA 1OS8A 1OWHA 3STIA 5ABWA 2FYRA 1N1LA 1IQJA 1GL0E 1GCDA 3ELAH 3SN8A 4ZROA 4J1YA 2VU8E 1BJUA 1V2PT 3NZIA 3LONA 4BTTB 1GBMA 2BTCE 2QGRA 3TPIZ 2A31A 5EW2H 3V13A 1AE5A 4NIVA 3SU2A 4X2YA 3RXEA 1V2MT 2AIQA 2KAIA 4NZQA 3ATWA 1L1JA 1QL9A 3KHVA 1IHTH 2C8WB 5EGMA 2THFB 1AFQC 1NROH 2P94A 5FPSA 1MTSA 2GMTC 1HPGA 4E7NA 3W95A 1QJ6B 4DGJA 1MTUA 3RXDA 1O0DH 1BTXA 2Z94A 1A46H 4H42U 2NU2E 3GCHB 4FVDA 3P6ZB 4BAHB 5GXPA 2G5NA 2VGCB 2A5IA 4A1XA 1GDUA 1KSNA 3M3SA 3NXPA 4CRAA 1GG6B 1MBQA 2BDGA 3BG4C 1TBQH 2TBSA 3VB4A 4I8KA 4LXBH 3SHCH 4XBBA 3RLYH 4DIHH 1AGJA 4NWKA 1BHXB 5IYTA 3U8OH 1MZDA 2FMJA 1YPHC 4I31A 2NWNA 3RDZA 3EA8A 1E0FD 1GBBA 2F3CE 3MH7A 1J16A 3Q3KA 3MO6A 3QZRA 3PMJA 3SO3A 1EOJA 3ZZ8A 3EA9A 1P2NA 1K9OE 1L4ZA 4NFFA 1O2KA 1CT0E 1DUEA 2H5DA 1EB2A 1PQ8A 4NZLA 1DVAH 1GMDG 1BTUA 3VEQB 4U2WA 3ZZ9A 3T62A 2FODA 4OS2A 5JBAS 3T27A 1W10U 2XBYA 3VXEH 1YF4A 2WPLS 3SNDA 3LGUA 3P8GA 1GHYH 3TNSA 3A85A 2H9TH 2O8TA 1SB1H
chains in the Genus database with same CATH superfamily
1UHBA 1BT7A 2Z9IA 4JZ1A 1DLEA 1BMLA 3PO1B 5C1YA 2M2AA 3K65B 1NO9H 1ANEA 1YPMH 2KAIB 2WYGA 1C2MA 1QNJA 4MPVA 3ZVAA 1TRMA 3FZDA 4BANB 4FUHA 1HAOH 1JIMA 3F2GA 3GY7A 1QL8A 2BLOA 4H6SB 2XYAA 2QN5T 4R0IA 2ZNKH 1MKWK 1MQ6A 4AYYB 2J4IA 1AVXA 1SBWA 1ZHMA 3PB1E 3A84A 1GBEA 1O2JA 1SKYE 1C1WH 1NT1A 2FESH 2BOKA 2FI5E 1Q3XA 2ZDLA 3SU4A 1O32A 4NA7A 3QK1A 5FAHA 1G36A 1O2UA 1AVGH 4GCHG 2P16A 1K1JA 3A88A 3AAVA 3PM3A 4F4OC 2ZU5A 5HIYA 1A0JA 1ORFA 1AIXH 4Z6AH 1O34A 1UVUH 3ITIA 3RXCA 4CBOA 1QB6A 4KTCA 3ATIA 3M5OA 1B7XB 3N7OA 3RXSA 2BDYA 2TGPZ 2ZU1A 5EXMA 1U6QA 1O3OA 1V2UT 3F9GA 2C8XB 1ELGA 1G30B 1O2ZA 5E0HA 1TNJA 5CMXH 3TH2H 3BV9B 1MAYA 4NG9H 3SNBA 4AG2A 2V0BA 1QJ1B 2Q6DA 3SOSA 4MNXA 7KMEH 1O5FH 1YLNA 1IOEA 4OS4A 4ABAA 2XC5A 2R0KA 1Z6EA 1D3QB 3KQ5A 4I8LA 3HGPA 2FPZA 2L6OA 4XBCA 1W13U 3FKSD 4CR9A 1P05A 1OYTH 3E16B 3PMBB 1IQEA 1FIWA 1OHHD 1DITH 2SNVA 4FUIA 1ZTKA 4OGXA 2HWLB 1O5CB 1FX0B 4WMDA 1CGIE 2ZDMA 2O8MA 1PPFE 5TCAA 2G51A 2F9NA 1P03A 3P8OA 1MABB 4ACAA 1G9IE 4YTAA 3HK6B 1HAIH 4IC5A 4Y7AA 5I25A 1EZXC 1NN6A 1SL3A 4AZ2B 1LVYA 1UHBB 3NCLA 1F5RA 2GT7A 3D49H 1V2VT 3LOXA 4FXGH 3TJNA 1WSSH 3CS0A 5E0JA 3ZZ3A 4BXWA 2ZGJA 2QC2A 5HM2A 3H5CB 2VIQA 1MKXK 4DG4A 4X0WU 4FUEA 1P04A 3FOAA 1DY9A 1O31A 5EJ1A 1G2LA 4GHQA 1SGDE 1BBRH 4Q7ZA 4YOGA 4ZUHA 2WUCA 1Y8TA 1EB1H 1PQ5A 1GI0A 3A80A 3ZVBA 5JBCS 1QR3E 1HIAA 2QXGA 1Y59T 1SLWB 3HKJB 2J92A 1SFQB 3VB6A 4MPUA 4MPWA 1Z8IB 1F0RA 1B0EA 1M9UA 4FU9A 3UUZA 2V7QD 1QB1A 4CBNA 2ZP0H 4KTSA 3SORA 1TPPA 2UUFB 4JCNA 3MU1A 4AYVB 4K1SA 1BRAA 5F8TA 4NSVA 4CH8B 4HZHA 1MKXH 1DPOA 3EE0B 1YM0A 5EPNA 3RC6A 2WSSD 1EJAA 5EQSA 1K1LA 5F8ZA 2BD3A 1YY3A 2BD4A 2AFQB 1PYTC 2C93B 1PPHE 4TSFD 5DP3A 2PTNA 5C3NA 4INLA 1T31A 1W2KH 1EP5A 2FOGA 2P95A 5H4IB 4AOQA 4ABJA 1V6DA 2GT8A 2HPQH 2Y5HA 4Q80A 4NIYA 2Z6BD 1SLUB 2CMYA 5AFYH 5HIZA 5FPYA 2VWNA 2FO9A 1IQFA 1K22H 1O3PB 4YOIA 3LKWA 4INHA 1YLDA 5LPEA 1KLIH 2VIWA 4A1TA 4X1RU 3UIRA 1P10A 3DA9B 4B2AA 4WWYA 5T6DA 4B75A 1UCYE 1ANCA 3H7OA 4ESTE 4K2YA 1BTWA 1LHGH 1JWTA 4Z1MD 4RKJB 1N6YA 1RTKA 2R2WU 2DE9A 2ZF0H 3F2FA 1AKSA 2GV6A 4AN7A 1BMAA 1TALA 2QCYA 4OS5A 1E34B 1AO5A 1C5SA 2ZFFH 4D9QA 5DP9A 1A0HB 2ZDKA 3FAOA 4GCHF 1HAPH 2WV5A 1DWDH 3EDXB 4IMZA 3P95A 2UUJB 3A81A 4CRCA 1EATA 1O2HA 1MTNB 3V7TA 1C5YB 4MG3A 1O2GH 1J8AA 2F9UA 3P8FA 2BD5A 1HIAB 1VGCB 1AY6H 2KCOA 1G37A 1HAGE 2XBVA 2XC4A 3KL6A 2OQUA 4DY7B 1WTGH 2WPKS 3A7VA 1G3BA 3I29A 3ZVEA 1V2RT 1P02A 1H4WA 1BA8B 4U01A 3RM0H 1QHRB 1LDTT 4XOJA 5F8XA 5LPRA 2FDAA 4UFFH 5DP6A 4I8GA 4A1VA 1KYNA 4TWYA 5FXLA 1X7AC 3AAUA 3KQDA 2B9LA 1GJ5H 2H2ZA 1GJ4H 3ZYEA 1LO6A 3U9AH 4INKA 3TH4H 2YNBA 3T26A 1AFQB 3AW1A 1FY1A 1PJPA 3FP6E 1T8LA 5GWZA 3W94A 4WMFA 2GMTB 1BQYA 1H9HE 5FX6A 1J17T 3IWMA 1UTOA 3DFLA 3GDVA 3SJOA 1C2FA 3SI4H 1ABIH 1CA0C 1ZPCA 3GY6A 2ZPSA 1ARCA 3LGIA 3U8RH 3F2HA 3RXIA 4RI0A 4BOHA 1E1RD 3LH3A 4O3UA 1DFPA 2BY6X 1EX3A 2UUYA 4JK5A 2TGDA 1XVMA 3BG4B 3DFJA 1B0FA 1FAKH 2GKVE 1C5VA 3BEIB 1F5LA 2FXRA 1KXBA 4JZDH 1CHOG 2GJGA 1BDAA 1GMHF 4VGCC 2O8UA 1LKBA 1AKSB 1SSXA 2FOHA 1LHCH 2ZFQH 1O2LA 1Z6JH 3C27B 3RU4D 4B74A 4YXWD 3O8CA 1H8IH 5FPTA 5HYOA 3GY3A 1CT4E 4FU8A 1JXPA 3RXGA 4X1PU 2HPPH 1OSSA 1C2EA 2STBE 1A4WH 3AASA 3MWIU 5DG6A 2PV9B 3ZVCA 3S7KB 2ZHWH 1AN1E 4CRDA 3E1XB 3ZZ6A 1OP8A 1Y3XA 1QBVH 4B73A 2IN2A 1THPB 1UTPA 3LIWA 5EXLA 4ABHA 2ZGCA 1H8ED 1ANDA 1AWFH 4FVBA 3H7TA 1GI7B 2OC8A 2ZWLH 1O2TA 2PKAA 2LPRA 2P93A 3W1EA 2ULLA 3A8BA 3RXJA 1RXPA 3URDA 2PR3A 3BTEE 3FP8E 3TGKE 1WQVH 4YM9A 1JRSA 3SU0A 1D9IA 2OUAA 3KQEA 1RD3B 3BEFB 1YC0A 1LQEA 1ACBE 2PGQB 1D3DB 1FY5A 1K0HA 1G32B 4J2YB 2KM0A 1ZHPA 1LQDB 1ZRKA 2FI4E 2XCFA 2A5AA 3MU4A 1QZ8A 2K0QA 2LNCA 4ASHA 1E37B 1EAIA 1VJ9U 2FX4A 3A82A 4YESB 1C1QA 1C4U2 3BIUH 1JIRA 3LU9B 3Q3YA 3URCA 1YKTA 3ZZ5A 3VGCC 3KCGH 1C2IA 1C5WB 3EGKH 2ZCHP 5LH8A 1SQAA 4ZKSU 3PTBA 3SQHE 3SQEE 4AFUA 3EAJA 3TK6A 4YT6H 1CBWC 1T32A 3SHAH 4ISIH 1G2MA 1QQ4A 5F03A 1MTVA 4MQAA 2AH4X 4F49A 4QT8C 3QUMP 4NA9H 3SJ9A 1FDPA 2KCAA 1GBDA 1KXFA 5HM9A 1HAVA 5DP5A 2AMPA 1GBHA 4Q4LA 3FN8A 3N99A 2EA3A 4X2XA 1BTHH 1V2NT 2BDAA 2J34A 1P09A 4CHAC 1GBLA 6GCHF 2AYWA 3EYDA 1GCTB 1O2QA 1S82A 1DT2A 1ELDE 1LHDH 1INCA 2FOFA 4ABGA 1GBKA 1ZZZA 2BD7A 3GISB 1KLJH 1O3GA 1ID5H 3A7YA 1H8HD 2DUCA 4D7GA 5A0AE 1YBWA 1WYKA 4UFDH 1O3MA 1BUIA 4Y6DA 1TNGA 8ESTE 1OWDA 5F53A 5BRRE 1OX1A 1ZMNA 1K1IA 3HATH 4WF8A 2AMDA 3BTWE 3A8DA 1ZJDA 1O2NA 1GI1A 5B6OA 2PKAB 1NBMD 3FFGA 3A7TA 4GSOA 3RU4E 4B71A 1KDQA 1TGSZ 1QRWA 2AHME 3NPSA 2JIZD 2Q6FA 5K0HA 1Z8GA 1ESTA 1ELBA 2J95A 1O3JA 5PTPA 1G3DA 1GI9B 1TWXB 1TONA 2ZGBH 2XTTB 3BTDE 2OC0A 4I8JA 1C5UA 1O3FA 2ALPA 3N7DA 3GYLB 2BDHA 3PV5A 5HMAA 1DWEH 1CHOF 3M3VA 2GCHG 5CHAC 3RMMH 2G55A 1A2CH 3Q77A 4A5TS 4WVPE 4AB8A 5C0TA 1T8NA 2KCPA 2ODYB 3S69A 1Y5UT 1KXCA 2Y6TA 1GI6A 1TRYA 4X2WA 1LVMA 3ATLA 1FUJA 1MUEB 2EY4C 1GMCG 4CREA 4TYDA 3QN7A 3TGJE 3AVZA 4XRNA 3SNAA 3SNCA 1CSOE 1LPZB 3UFAA 3UY9A 5EPYA 3RXFA 2ZGXH 1ZGVA 2Y5FA 5DGJA 1Y3UA 1EOLA 4FUBA 3ZZBA 3M3TA 3RXOA 1SGCA 4ZXXH 2ZHQH 1SGQE 2ANMH 2PHBA 1UTNA 2ZPRA 1A1RA 1S5SA 4IN1A 5C0UA 1FQ3A 1NRRH 1HAVB 1GI2A 4PROA 1EFRD 1EXFA 4RN6A 1SLVB 1TYNA 3GCTF 1NFWA 1O37A 2CF9H 2QE7D 4UEHH 3KQBA 1ZPBA 4GVUA 2Y80A 4K8YA 2OC1A 3ZZAA 4DT7B 2HALA 1IQGA 1NFXA 2J2UA 1A61H 7GCHG 2WPHS 1T4VH 1P12E 2ZO3H 1O3DA 3SU1A 2QF4A 2W7UA 3VB7A 4MLFB 1RTFB 2B8OH 1SHHB 1O2WA 3A87A 2Z3CA 2VWMA 2ZCLP 1MCVA 3QX5H 1O33A 1WAYB 5CE1A 2ZIQH 2GCTC 4ZAEA 2HVXA 2CGAA 1DANH 1S83A 1OYQA 2EI6A 1P2JA 3LJJA 3SW2B 1LCYA 1TIOA 3BTQE 2ODQA 1KDQB 1EKBB 3OU0A 3UQVA 4X1QU 2RA0A 1C5ZB 4DVAU 1O5AB 4NGAH 2Z9KA 5EXNA 1THSH 1P3EA 4B76A 1ZMJA 3HGNA 1IQHA 1VITG 4JYUH 1PPZA 1Y3YA 2DE8A 2OCVB 3F3BA 3EE7A 1HJ8A 4GPGA 1IQLA 4BTIB 5EIYA 4ZCNA 1C2DA 1N8OC 1RS0A 1E35B 5C2ZA 1ZR0A 2C4FH 3CENA 1HRTH 3ZV8A 1GHBG 5A0BA 1C1TA 2AIPA 4RT0A 1BZXE 2HOBA 1AD8H 1O5BB 1W12U 2G5VA 1WOFA 1NBME 1K21H 4HI3A 1SHYA 2VBCA 1GBFA 3AW0A 3TVJB 1ZSJA 4K1EA 2UWPA 2FOEA 2BQ6B 1BMNH 1GJ9B 1C1PA 5G4BA 2JETC 1LHFH 4D9RA 1MAXA 2NU0E 2VIOA 2FLRH 2QV1A 1UK4A 2SGAA 4ISHH 4UDWH 1GBJA 1TA2A 1OP2A 2PKSC 2RDEA 3LC3A 4X8SH 3L3TA 4K69A 1C1UH 5C67A 1RGQA 4IS5A 1Y3WA 1HDTH 7ESTE 3MU0A 1PPCE 1ZLRA 2YOLA 1TMTH 2BHGA 2A2QH 2AERH 1A5GH 1AU8A 2A32A 3IG6B 1IAUA 1O2PA 1TA6A 1TPAE 4B6FA 4I7YH 1B5GH 4ZXYH 2HVYB 3GDUA 5E2PA 3ZZDA 2PWXA 1GPZA 2K1QA 3OFND 3SJ8A 4AORA 1YPEH 3CNRA 4BAQB 2FTMA 3KEEA 5FL7D 1TGTA 1MKWH 3M36A 1V2OT 3A7ZA 1O3IA 1GBAA 1GJ6A 3RUOA 1L1NA 4CH2B 2OINA 3FANA 1AQ7A 1GJCB 2GCHF 4X2VA 1BCUH 3MI4A 3A86A 5JPMH 1C4V2 2A5KA 1DWCH 4Y8XA 1IHSH 1UK3A 2WINI 4Y10E 1Y5BT 1GMCF 5C5NA 4E06H 4X1NU 3P8NA 1Z71A 1TAWA 1ESBA 1SGEE 2WPIS 2GZ7A 1JMOH 1LPKB 2OBOA 4E05H 1S81A 2A4OA 3WWFA 2F43B 5DP7A 1NY22 1K1OA 1BOQA 2LELA 4BXSA 3RM2H 4JYTA 1QCPA 2XWAA 5EJZA 2ZCKP 2CJIA 2EEKA 2ZFTA 1O3AA 2Z7FE 1RJXB 6LPRA 3MNSA 3MU5A 2F9PA 2Q6GA 1L1GA 5EQRA 1UCYK 1ZHRA 3F1SB 2ZGHA 1AHTH 1BITA 1C5LH 4ABFA 2R2MB 2GZ9A 2Y81A 1O5EH 1O3NA 3KNXA 4YOJA 4GHTA 7GCHF 1LHEH 3DD2H 3D62A 4BAKB 1EQ9A 1Y3VA 1P9UA 4A92A 3T29A 2VVVA 1TQ7B 1HGTH 3PLKA 3SGAE 2F9VA 1P2KA 1CT2E 4WMEA 1THRH 2A2XH 2Z3DA 1F0SA 3E91A 2BY8X 5EG4A 3E0NB 1FAXA 2GTBA 1SGNE 1O5DH 2QXIA 1XUFA 2ZU2A 1GMDF 3DHKH 2CF8H 5A8XA 3BTHE 1QFKH 2Y7ZA 3A83A 1BRUP 1GGDC 1W3CA 3LH1A 1L4DA 1TQ0B 5DP4A 2ZG0H 1ELCA 2Q1JA 1CGJE 1TFXA 3H09A 3VGCB 1GHAG 1V2KT 3QO6A 1P3CA 1RRKA 2Z3EA 2ZI2H 1MZAA 1KMHB 2ZKSA 2ZEBA 1VR1H 1CBWB 3MOCA 4JZIA 1D4PB 1GHBF 1P9SA 1YPHE 3SV2H 4AX9H 5E0GA 3TJVA 4ABEA 1O2IA 5IK2D 3U8TH 4MVNA 2FEQH 5GCHG 5C94A 1BBRE 4FOUC 4B6EA 4CHAB 1HAXB 3UQOA 1NU7B 1O2OA 5T3HA 2ZDAH 2FOAA 3WW7A 1ESAA 4KP0A 4UFEH 2LP6A 2ZQ1A 5L2YH 4E7RG 4Y8ZA 1XM1A 1AMHA 3T25A 1P2MA 3F9EA 1FPHH 1W0YH 4ISLA 3VXFH 1W0ZU 2G52A 4X8VH 1SG8B 3SUDA 1GHVH 2W3IA 3RP2A 3A7XA 5DN6D 1IQMA 4UONA 1DE7H 4Y7BA 5JBTA 4Q7XA 2BLWA 2FOCA 2VNTA 1ZSLA 1OWIA 5GIBA 2OXSA 2XNDD 1HXFH 1UO6A 2HNTC 3EQ0H 5L6NH 2W26A 3ZZ7A 3JZ2B 1TGNA 1S0RA 1FONA 2IPHA 4FU7A 4DCDA 3ODDA 1WQSA 4OS6A 2ZFRH 3P17H 3TK5A 4CR5A 3ZYDA 1EPTC 5EODA 1G3EA 2OP9A 2P59A 1E36B 4X6OA 4K60A 4O9VA 3TLOA 5DJ7A 1CE5A 1GJDB 1P2IA 2FOBA 2ASUB 2VINA 3TIUA 1FY8E 2PW8H 4TPYA 1SGPE 2ZC9H 4RT1A 5A0CA 2VIDA 2ZTYA 1RIWC 5CHAB 1D3PB 1QBOA 3F9FA 4Y0YE 2BX3A 4AGJA 1CVWH 4OS1A 2XXLA 1GVLA 3CP7A 2SFAA 3FVFB 3TK9A 2KCYA 3M37A 5TJXA 2PGBB 2Y5GA 1O2MA 4THNH 2F91A 1GBCA 3TJOA 1ZMLA 5C17A 2ALVA 1MTWA 2WZQA 1UVPA 2A7CA 7LPRA 1LVBA 3R0FA 3BF6H 5FBEA 1P06A 1QA7A 1TPSA 3GY2A 2L74A 2BQ7B 4Y8YA 1YCPK 1W14U 2J98A 3OX7U 2V6NA 5IDKA 2RFKC 2B0FA 1O3HA 1UTLM 5GJ4B 2Z9LA 1W7GH 3KF2A 4ACBA 2BD9A 1DLKB 2ZDNA 4YLUA 2BVRH 1ZOMA 4OM9A 1Z1JA 4P00A 5J4SA 1HNEE 1HCGA 2AGEX 2WV4A 2ZHEH 2BY7X 3MHWU 4TPIZ 1UVSH 2QF5A 1NC6A 1ELFA 1DDJA 1CO7E 1UTKA 3KQCA 3U1JB 5AHGH 3GY5A 5KECA 2QXHA 4B2BA 4ZKRU 1SOTA 2J38A 1A7SA 1EP6A 1O2SA 1YCPH 1ELVA 4IN2A 5HKKD 4UFGH 5A2MH 1F0TA 1RFNA 5EQQA 3T2NA 4CRBA 2GCTB 1K28D 1LMWB 3UB0A 1LTOA 4K5ZA 1P57B 5FCRA 1DX5M 4MTBA 3DSPA 1D6WA 1GHAF 1EAWA 1A5HA 4GAWA 3LT3A 3NK8A 1TGBA 4AGKA 3MMGA 3LGYA 1KTTB 1ZSKA 3M5NA 4XBDA 5B6LA 1AB9C 4ZHLU 3K6YA 3KIDU 2W5EA 6CHAC 2G4UA 2HLCA 3LC5A 3Q76A 4DOQA 5FBIA 1N8OB 1TMBH 4HGCA 3RMOH 4JZFH 3PWCA 2BXTH 3UWJH 3OY5U 4WH6A 3QGNB 2OK5A 2EI8A 3F9HA 3L33A 4WY3A 1S85A 1HJAC 1Q2WA 3QTVH 4Y79A 1XXDA 3KYGA 4Q63A 1XX9A 2JETB 1ETTH 1HB0B 4MNYA 3VFEA 1O3KA 1YWUA 3RXQA 3I77A 2NU4E 5CHBA 2FIRH 3NKKA 3F0PA 1W0KD 2D8WA 2J98B 2YMSC 1HYLA 2G8TA 3PTNA 2PKSB 1S0QA 2I6QA 1K1PA 1XUJA 3MO9A 1HV7A 4OGYA 2BOHB 3UOPA 2BLVA 3V3MA 2OBQA 1A5IA 1A3EH 1YPKH 1O39A 1KXDA 2BD2A 5ESTE 4UE7H 1TX8A 3R3GB 2CHAC 4LZ1H 1VJAU 1SLXB 2EC9H 2VVUA 3K9XB 3GCOA 4ZKOU 2KX4A 3WY8A 2JKHA 2BM2A 3HKIB 4GUXA 3ESTA 1JOUB 1HBTH 3D65E 2R3UA 2XBXA 2BVSH 2SGEE 1GVZA 4D7FA 1FMGA 2C90B 2W6JD 3FP7E 1GHZA 1FNIA 9ESTA 3PLBA 3CS7A 3KN2A 3PMAB 1XUIA 4ZHMU 1OWEA 3ZIAD 1VKYA 1GI3A 1GL1A 1NU9A 3M7UA 3RXAA 2JDID 1UMAH 5JB9S 1UTJA 4Y0ZE 3M61U 3E3TA 1ETSH 1O2VA 2P3TB 3BTFE 1K2I1 3RXTA 3MH5A 2C8YB 1XKAC 1NS3A 4XE4A 5E2OA 2AEIH 3QDZB 4MPXA 1O30A 2V35A 2ZHFH 3M5LA 2J97A 3M7TA 3AK5A 2PUQH 4O3TA 1QRZA 3P70B 3U69H 2ZFSA 1E1QD 2ODPA 1AVWA 2ESTE 2BXUH 2A4RA 2RDLA 2HNTF 1XXFA 1DWBH 1YGCH 4H4FA 1C9TA 1S6LA 1NFUA 1DSUA 1EAXA 2CV3A 4CRFA 1JRTA 3E90B 1ZTJA 4KKDA 1C1NA 5HXFA 3Q3XA 3QZQA 4NCYA 2EI7A 1EAUA 2J9NA 1SR5C 1EPTA 2WV9A 2FP7B 2OD3B 3PMHB 3S9AA 1J9CH 4AFSA 2C3SA 1O2YA 1HLTH 1SQTA 3QLPH 1C5XB 1C2HA 2YNAA 5GDSH 1CA8B 1ZYOA 4RSPA 5JDUB 3UOUA 3UNRA 3PLPA 3BG8A 1HAZB 5A09A 2VIVA 3BTGE 4MNWA 4R8TB 1OOKB 4XD7D 1VCWA 4NA8A 3RXKA 4ZH8A 2QYIA 4F55A 2AGIX 2O9QA 1BTPA 2P8OC 1GGDB 2JJ1D 5KGOA 2ZZUH 2VWOA 3BEUA 3KGPA 1TABE 3NUMA 3PRDA 1TBZH 4X6MA 1L2EA 2ZPQA 3PROA 2B5TB 1V2LT 4X8UH 3MH6A 5AFZH 3RXBA 3TU7H 1WXRA 2VH6A 1C9PA 1W0JD 1O3CA 4ISNA 3DT0H 5DP8A 5T1VA 2QXJA 4KGAA 1XUKA 2G81E 3RU4T 2ZTXA 4AC9A 3M7QA 2M5TA 1AUJA 1TRNA 1NESE 3SYJA 1WDIA 3GCNA 1FN6A 2IOTA 3BTTE 2TGAA 2BZAA 4RKOB 3SJKA 1FJSA 3SJIA 2D26C 3SV9A 1AWHB 4JZEH 1MH0A 2VWLA 3B23B 3MNBA 4AB9A 1E38B 1TNIA 5ETXA 3GY4A 3O8BA 1GDQA 2GDDA 1VCPA 2JH5D 1DY8A 2F83A 2G00A 2ZDVH 3RXLA 4Q2KA 5T6GA 1N6XA 2SGFE 4O97A 3QGJA 4FUCA 3UR9A 2FS8A 1A0LA 2GX4A 1DUAA 1GBTA 2D2DA 3UAIC 2R9PA 2XOKD 1BTYA 3A8CA 4YT7H 1CQQA 2PSXA 2PUXB 3ATKA 2ANKH 2VVCA 1O2XA 1EPTB 1SI5H 3BSQA 2FLBH 4FETA 2OTVA 3GYMA 3K2UA 1H9IE 1HAHH 2STAE 1GI5A 1SGFG 1ZJKA 2UUKB 1UK2A 1MD8A 1HAYB 2R3YA 3RC5A 3OSYA 1F7ZA 1NTPA 1C4Y2 2Y82A 1TNHA 2ZECA 1V2ST 1RIWB 2XNIA 4NSYA 1J14A 2VJ1A 1EUFA 2CN0H 2G4TA 3LDXH 5EU8A 2JH0D 1VZQH 1TMUH 4ABIA 1H8DH 2BVXH 1UJ1A 2FOMB 3ENSB 1WBGB 8KME2 1GVKB 2W3KA 1DSTA 1YPJH 1NFYA 1ABJH 3P92A 4HFPB 2VH0A 3ZV9A 3SU6A 1KXEA 2GP9B 5DPAA 5EOKA 1O3LA 2F4LA 1LPGB 1V3XA 2BY9X 1AFEH 3SUGA 5I46H 4ZMAH 2BDBA 2BD8A 3LPRA 1G3CA 1CA0B 1CU1A 1T7CA 2GD4B 3RXUA 1ANBA 5C20A 2ZFPH 1V2TT 1BMMH 1VITH 2CXVA 1ELTA 3U98H 5GNDA 1C1OA 3SNEA 1O5GH 1SGRE 1GI8B 3DUXH 1D6RA 1C5MD 1ELEE 1ETRH 2RCEA 4IGDA 4DURA 2Y7XA 1OKXA 2IJD1 4M9FA 2A7HA 5SGAE 4U30A 1TOMH 3FZZA 1QBNA 1YPGH 2VB0A 2NU3E 4VGCB 2FI3E 1BTZA 1GCTC 1LVOA 1XUHA 3ODFA 2P3UB 1FPCH 3HPTB 3EA7A 1H9LB 1JBUH 2UWOA 1DM4B 2QF3A 5FCKA 2BLQA 1MD7A 1F5KU 1KTSB 3SU3A 2SNWA 1TOCB 2OLGA 1QGFA 1J15A 2WYJA 4LK4A 4WJG2 3GICB 1YLCA 1AZ8A 2GV7A 4X8TH 3K6ZA 2FWWA 2WUBA 3E0PB 4I8HA 1RTLA 1EZUC 3RXPA 1KIGH 1GI4A 1BBRK 3GS9A 1GWAA 4XDEA 1MMJN 4GLYA 4SGBE 3VPKA 1HUTH 1SFIA 5DKMA 2ZU4A 1F92A 1FV9A 1O3BA 3RMNH 1SMFE 1EZSC 3SU5A 4JK6A 3OY6U 1CGHA 1XMNB 2ANWA 2XCNA 2A0QB 4BNRA 5C1XA 3RLWH 1FXYA 1P2QA 2GVFA 1O35A 3DSOA 2QA9E 3SI3H 1AB9B 2BY5X 2ILNA 1YYY1 3OAAD 6CHAB 2FX6A 3UR6A 4BAOB 2D1JA 6ESTA 3SUFA 5JB8S 3O8DA 3SUEA 3OYPA 2O8LA 2FYQA 4YLQH 1HJAB 2W7SA 3UPEA 2JJ2D 1FY4A 1XVOA 1QTFA 4B1TA 3A89A 2TPIZ 4AG1A 1T8OA 1V2JT 2A4QA 1UCYH 3RMLH 3I78A 4Y71A 1P01A 1DOJA 1TE0A 3UNQA 4NFEA 1QB9A 1QQUA 1GMHG 4DIIH 2P3FH 1VITF 2TRMA 1TGCA 2YMSB 1C5QA 1QA0A 2WHXA 1OWKA 3MO3A 1HFDA 5JYIA 4BTUB 2BZ6H 1SQRA 2I6SA 1YP9A 2GDEH 1L0ZA 1SGTA 1FI8A 3B9FH 1IQNA 5FHTA 3ZZ4A 4FUDA 1DXPA 4F48B 1C1MA 1FN8A 1NM6A 3MYWA 3GCHC 2H9HA 2CHAB 5AVDA 2UWLA 3L6PA 1XUGA 2SGPE 2VGCC 5EJLA 2FS9A 1V2WT 2HLDD 1VCQA 1ZRBA 1MQ5A 1PPGE 1C2JA 1GG6C 1FY3A 5GPIB 1SOZA 1NRSH 1SGFA 4K3JA 5FX5A 1S84A 3E6PH 1EJNA 4IMQA 3JZ1B 5JBBS 4WH8A 1GHXH 2VIPA 1QY6A 4BAMB 5DO4H 1QJ7B 5A8YA 5K7RA 3PWBA 3SZEA 1BJVA 3OTJE 3PV2A 2J94A 1Q31A 3ATMA 2R0LA 2BDIA 1GBIA 3BTME 3LJOA 1C2GA 3NWUA 3SV7A 3UTUH 5C1UA 3RXRA 1C5PA 9LPRA 3S9CA 2AMQA 3U1IB 3MQKC 3M5MA 2ZQ2A 2GZ8A 4XFQA 1MCTA 3TJUA 4ABDA 1GJ8B 2ANYA 4D8NA 1ZGIA 1FIZA 8GCHG 2BB4A 3RXMA 2PP6A 4TWWA 2QIQA 4WXIA 3KYFA 4I32A 2FM2A 2V3HH 3O8RA 4DW2U 1V2QT 1C5NH 3BIVH 2PTCE 4IC6A 3RC4A 3SV8A 1Z8RA 1WUNH 2Z9JA 3SGBE 2A1DB 3HK3B 5DSFA 2Z9GA 2SGQE 5L30H 5AF9H 4ABBA 1TB6H 1PYTD 2WPJS 1AI8H 4I86A 2A7JA 3PO1C 1NRPH 1NPMA 1K1MA 4TY7A 1BRBE 5L2ZH 5DK1A 1ELAA 2PLXA 1YCPM 1C1VH 3VB3A 3V12A 2AGGX 2IJOB 1WU1A 5E8EH 1S6HA 2V3OH 4MNVA 4Z0KA 3V0XA 1MU8B 4FUGA 3MNCA 6GCHG 1H1BA 1SC8U 3RXVA 1GJBB 5ESBA 1GJAB 4Q7YA 5LPFA 1TX7A 4KTUA 4SGAE 1PPBH 1MU6B 4IBLH 3STJA 4NIXA 3ZVGA 3A7WA 1KLTA 5LGOA 2QAAA 2JH6D 3A8AA 1C1SA 3D23A 4OS7A 1TNKA 4ZKNU 4H6TA 1P11E 2P8OB 1OXGA 3S0NA 1HJ9A 3QWCH 1HXEH 2C8ZB 2GGVB 1T4UH 2FTLE 3MNXA 4LOYH 4NWLA 4AFQA 1AUTC 5C5OA 2XC0A 3TGIE 1QL7A 3S7HB 4X1SU 2AS9A 1GJ7B 4Y11E 5F6MA 3SGQE 3T28A 4AFZA 3SBKA 1BB0B 2H1UA 1ARBA 1S6FA 3SZNA 1PQ7A 2B7DH 3FO8D 4ZHAA 3VG8A 3TITA 2HRVA 4A6LA 1PPEE 2PFEA 3S9BA 1SQOA 2HGTH 4FUFA 1FZZA 1D3TB 1QIXB 1TNLA 2XW9A 2K8IA 3Q00A 1P2OA 1DS2E 2TGTA 1KY9A 3ZVDA 1OPHB 5BPEA 1ZPZA 1P8VC 1IQIA 2ZU3A 4K8BA 2BQWB 5EW1H 4ISOA 3OE7D 1E79D 3F6UH 4YO9A 4B2CA 1ZTLA 3F68H 2H6MA 4HTCH 3MTYA 1O36A 2PSYA 5TCCA 3ZZCA 1PQAA 1Y5AT 4DJZB 1A3BH 2WPDD 2ZTZA 1P0SH 1AZZA 5GCHF 2BDCA 1OP0A 5HGGA 2ZA5A 1C2KA 2NU1E 3PYHA 1FLEE 1C5RA 2BYAX 1SVPA 3RXHA 5T6FA 4K1TA 4X6PA 2XWBI 1EJMA 3QTOH 1Z7KA 2A45B 2RG3A 3GCTG 1EASA 1WTHD 1C1RA 1UTQA 3IITA 3UNSA 1UVTH 3E8LA 3VB5A 1BRCE 4LZ4B 1UW7A 3B8JA 4WXVA 5J4QA 1SGIB 2QF0A 5CDFE 3MH4A 4CRGA 2BX4A 2V3MA 1Z8JB 1C2LA 1GHWH 1LKAA 1K1NA 1DXWA 2RA3A 2QY0B 3N7EA 1GDNA 1EZQA 3BTKE 2F9BH 1AE8H 8GCHF 3UREA 3BN9A 4XSKU 3T5FH 4TY6A 5KEDA 1OWJA 2A4GA 4DT4A 4A7IB 1C5OH 1DICA 2CK3D 2O8WA 1KXAA 2EQNA 1TX6A 1PFXC 1YPLH 4FUJA 2ZHDA 1BIOA 2J5UA 4YZUA 4IW4E 4I33A 2XRCA 3F0OA 4O03A 3SV6A 2OC7A 1TPOA 4X6NA 2SGDE 2FZZA 1NRNH 2TIOA 3GDSA 4M7GA 3WWBA 2XBWA 2H5CA 4MDSA 4ASUD 1TLDA 3DCLA 1F0UA 3GOVB 1NZQH 4U32A 1C5TA 1W11U 3MU8A 1O38A 3LGTA 2HNTE 3NRLA 3ZVFA 2BMGB 3LGVA 1QURH 3G01A 3OEHD 1UTMA 3PV4A 4KELA 4HG6A 5A8ZA 2W6ID 1O3EA 1UVOA 1MBMA 4UD9H 1WV7H 4JMYA 1BHXF 1T8MA 1QRXA 8LPRA 3LGWA 2F9OA 1WCZA 1TBRH 3UWIA 3GY8A 3TNTA 1SGYE 4TT3D 1SPJA 3TH3H 1F2SE 2YMSD 1W8BH 1Z1IA 4Y76A 3C1KA 2WPMS 1NRQH 1MTNC 3M35A 2H9EH 1O2RA 3OTPA 1XKBC 1BMFD 3OEED 4NIWA 1W7XH 4D76A 4JYVH 1CHGA 2OQ5A 1VGCC 1IQKA 3MFJA 1OS8A 1OWHA 3STIA 5ABWA 2FYRA 1N1LA 1IQJA 1GL0E 1GCDA 3ELAH 3SN8A 4ZROA 4J1YA 2VU8E 1BJUA 1V2PT 3NZIA 3LONA 4BTTB 1GBMA 2BTCE 2QGRA 3TPIZ 2A31A 5EW2H 3V13A 1AE5A 4NIVA 3SU2A 4X2YA 3RXEA 1V2MT 2AIQA 2KAIA 4NZQA 3ATWA 1L1JA 1QL9A 3KHVA 1IHTH 2C8WB 2KR7A 5EGMA 2THFB 1AFQC 1NROH 2P94A 5FPSA 1MTSA 2GMTC 3U28C 4P02A 1HPGA 4E7NA 3W95A 1QJ6B 4DGJA 1MTUA 3RXDA 1O0DH 1BTXA 2IPQX 2Z94A 1A46H 4H42U 2NU2E 3GCHB 3PRBA 4FVDA 3P6ZB 4BAHB 5GXPA 2G5NA 2VGCB 2A5IA 4A1XA 1GDUA 1KSNA 3M3SA 3NXPA 4CRAA 1GG6B 1MBQA 2BDGA 3BG4C 2KFWA 1TBQH 2TBSA 3VB4A 4I8KA 4LXBH 3SHCH 4XBBA 3RLYH 4DIHH 1AGJA 4NWKA 1BHXB 5IYTA 3U8OH 1COWD 1MZDA 2FMJA 1YPHC 3DSGA 4I31A 2NWNA 3RDZA 3EA8A 1E0FD 1GBBA 2F3CE 3MH7A 2KZ4A 1J16A 3Q3KA 3MO6A 3QZRA 3PMJA 3SO3A 1EOJA 3ZZ8A 3EA9A 1P2NA 1K9OE 1L4ZA 4NFFA 1O2KA 1CT0E 1DUEA 2H5DA 1EB2A 1PQ8A 4NZLA 1DVAH 1GMDG 1BTUA 3VEQB 4U2WA 3ZZ9A 3T62A 2FODA 4OS2A 5JBAS 3T27A 1W10U 2XBYA 3VXEH 1YF4A 2WPLS 3SNDA 3LGUA 3P8GA 1GHYH 3TNSA 3A85A 2H9TH 2O8TA 1SB1H
chains in the Genus database with same CATH topology
1UHBA 1BT7A 2Z9IA 4JZ1A 1DLEA 1BMLA 3PO1B 5C1YA 3K65B 1NO9H 1ANEA 1YPMH 2KAIB 2WYGA 1C2MA 1QNJA 4MPVA 3ZVAA 1TRMA 3FZDA 4BANB 4FUHA 1HAOH 1JIMA 3GY7A 1QL8A 2BLOA 4H6SB 2XYAA 2QN5T 4R0IA 2ZNKH 1MKWK 1MQ6A 4AYYB 2J4IA 1AVXA 1SBWA 1ZHMA 3PB1E 3A84A 1GBEA 1O2JA 1C1WH 1NT1A 2FESH 2BOKA 2FI5E 1Q3XA 2ZDLA 3SU4A 1O32A 4NA7A 3QK1A 5FAHA 1G36A 1O2UA 1AVGH 4GCHG 2P16A 1K1JA 3A88A 3AAVA 3PM3A 4F4OC 2ZU5A 1A0JA 1ORFA 1AIXH 4Z6AH 1O34A 1UVUH 3ITIA 3RXCA 4CBOA 1QB6A 4KTCA 3ATIA 3M5OA 1B7XB 3N7OA 3RXSA 2BDYA 2TGPZ 2ZU1A 5EXMA 1U6QA 1O3OA 1V2UT 3F9GA 2C8XB 1ELGA 1G30B 1O2ZA 5E0HA 1TNJA 5CMXH 3TH2H 3BV9B 1MAYA 4NG9H 3SNBA 4AG2A 2V0BA 1QJ1B 2Q6DA 3SOSA 4MNXA 7KMEH 1O5FH 4ABAA 1IOEA 4OS4A 2XC5A 2R0KA 1Z6EA 1D3QB 4I8LA 3HGPA 2FPZA 4XBCA 1W13U 4CR9A 1P05A 1OYTH 3E16B 3PMBB 1IQEA 1FIWA 1DITH 2SNVA 4FUIA 1ZTKA 4OGXA 2HWLB 1O5CB 4WMDA 1CGIE 2ZDMA 2O8MA 1PPFE 5TCAA 2G51A 2F9NA 1P03A 3P8OA 1G9IE 4YTAA 3HK6B 1HAIH 4IC5A 4Y7AA 5I25A 1EZXC 1NN6A 1SL3A 4AZ2B 1LVYA 1UHBB 3NCLA 1F5RA 2GT7A 3D49H 1V2VT 3LOXA 4FXGH 3TJNA 1WSSH 3CS0A 5E0JA 3ZZ3A 4BXWA 2ZGJA 2QC2A 5HM2A 3H5CB 2VIQA 1MKXK 4DG4A 4X0WU 4FUEA 1P04A 1DY9A 1O31A 1G2LA 4GHQA 1SGDE 1BBRH 4Q7ZA 4YOGA 4ZUHA 2WUCA 1Y8TA 1EB1H 1PQ5A 1GI0A 3A80A 3ZVBA 5JBCS 1QR3E 1HIAA 2QXGA 1Y59T 1SLWB 3HKJB 2J92A 1SFQB 3VB6A 4MPUA 4MPWA 1Z8IB 1F0RA 1B0EA 1M9UA 4FU9A 3UUZA 1QB1A 4CBNA 2ZP0H 4KTSA 3SORA 1TPPA 2UUFB 4JCNA 3MU1A 4AYVB 4K1SA 1BRAA 5F8TA 4NSVA 4CH8B 4HZHA 1MKXH 1DPOA 3EE0B 1YM0A 5EPNA 3RC6A 1EJAA 5EQSA 1K1LA 5F8ZA 2BD3A 2BD4A 2AFQB 1PYTC 2C93B 1PPHE 5DP3A 2PTNA 5C3NA 4INLA 1T31A 1W2KH 1EP5A 2FOGA 2P95A 5H4IB 4AOQA 4ABJA 1V6DA 2GT8A 2HPQH 2Y5HA 4Q80A 4NIYA 2Z6BD 1SLUB 2CMYA 5AFYH 5FPYA 2VWNA 2FO9A 1IQFA 1K22H 1O3PB 4YOIA 3LKWA 4INHA 1YLDA 5LPEA 1KLIH 2VIWA 4A1TA 4X1RU 3UIRA 1P10A 3DA9B 4B2AA 4WWYA 5T6DA 4B75A 1UCYE 1ANCA 3H7OA 4ESTE 4K2YA 1BTWA 1LHGH 1JWTA 4RKJB 1N6YA 1RTKA 2R2WU 2DE9A 2ZF0H 1AKSA 2GV6A 4AN7A 1BMAA 1TALA 2QCYA 4OS5A 1E34B 1AO5A 1C5SA 2ZFFH 4D9QA 5DP9A 1A0HB 2ZDKA 3FAOA 4GCHF 1HAPH 2WV5A 1DWDH 3EDXB 4IMZA 3P95A 2UUJB 3A81A 4CRCA 1EATA 1O2HA 1MTNB 3V7TA 1C5YB 4MG3A 1O2GH 1J8AA 2F9UA 3P8FA 2BD5A 1HIAB 1VGCB 1AY6H 1G37A 1HAGE 2XBVA 2XC4A 3KL6A 2OQUA 4DY7B 1WTGH 2WPKS 3A7VA 1G3BA 3I29A 3ZVEA 1V2RT 1P02A 1H4WA 1BA8B 4U01A 3RM0H 1QHRB 1LDTT 4XOJA 5F8XA 5LPRA 2FDAA 4UFFH 5DP6A 4I8GA 4A1VA 1KYNA 4TWYA 5FXLA 1X7AC 3AAUA 3KQDA 2B9LA 1GJ5H 2H2ZA 1GJ4H 3ZYEA 1LO6A 3U9AH 4INKA 3TH4H 2YNBA 3T26A 1AFQB 3AW1A 1FY1A 1PJPA 3FP6E 1T8LA 5GWZA 3W94A 4WMFA 2GMTB 1BQYA 1H9HE 5FX6A 1J17T 3IWMA 1UTOA 3DFLA 3GDVA 3SJOA 1C2FA 3SI4H 1ABIH 1CA0C 1ZPCA 3GY6A 2ZPSA 1ARCA 3LGIA 3U8RH 3RXIA 4BOHA 3LH3A 4O3UA 1DFPA 2BY6X 1EX3A 2UUYA 4JK5A 2TGDA 1XVMA 3BG4B 3DFJA 1B0FA 1FAKH 2GKVE 1C5VA 3BEIB 1F5LA 2FXRA 1KXBA 4JZDH 1CHOG 1BDAA 1GMHF 4VGCC 2O8UA 1LKBA 1AKSB 1SSXA 2FOHA 1LHCH 2ZFQH 1O2LA 1Z6JH 3C27B 3RU4D 4B74A 3O8CA 1H8IH 5FPTA 5HYOA 3GY3A 1CT4E 4FU8A 1JXPA 3RXGA 4X1PU 2HPPH 1OSSA 1C2EA 2STBE 1A4WH 3AASA 3MWIU 5DG6A 2PV9B 3ZVCA 3S7KB 2ZHWH 1AN1E 4CRDA 3E1XB 3ZZ6A 1OP8A 1Y3XA 1QBVH 4B73A 2IN2A 1THPB 1UTPA 3LIWA 5EXLA 4ABHA 2ZGCA 1ANDA 1AWFH 4FVBA 3H7TA 1GI7B 2OC8A 2ZWLH 1O2TA 2PKAA 2LPRA 2P93A 2ULLA 3A8BA 3RXJA 1RXPA 3URDA 2PR3A 3BTEE 3FP8E 3TGKE 1WQVH 4YM9A 1JRSA 3SU0A 1D9IA 2OUAA 3KQEA 1RD3B 3BEFB 1YC0A 1LQEA 1ACBE 2PGQB 1D3DB 1FY5A 1G32B 4J2YB 1ZHPA 1LQDB 1ZRKA 2FI4E 2XCFA 2A5AA 3MU4A 2LNCA 4ASHA 1E37B 1EAIA 1VJ9U 2FX4A 3A82A 4YESB 1C1QA 1C4U2 3BIUH 1JIRA 3LU9B 3Q3YA 3URCA 1YKTA 3ZZ5A 3VGCC 3KCGH 1C2IA 1C5WB 3EGKH 2ZCHP 5LH8A 1SQAA 4ZKSU 3PTBA 3SQHE 3SQEE 4AFUA 3EAJA 3TK6A 4YT6H 1CBWC 1T32A 3SHAH 4ISIH 1G2MA 1QQ4A 5F03A 1MTVA 4MQAA 2AH4X 4F49A 4QT8C 3QUMP 4NA9H 3SJ9A 1FDPA 1GBDA 1KXFA 5HM9A 1HAVA 5DP5A 2AMPA 1GBHA 2EA3A 4X2XA 1BTHH 1V2NT 2BDAA 2J34A 1P09A 4CHAC 1GBLA 6GCHF 2AYWA 3EYDA 1GCTB 1O2QA 1S82A 1DT2A 1ELDE 1LHDH 1INCA 2FOFA 4ABGA 1GBKA 1ZZZA 2BD7A 3GISB 1KLJH 1O3GA 1ID5H 3A7YA 2DUCA 4D7GA 5A0AE 1YBWA 1WYKA 4UFDH 1O3MA 1BUIA 4Y6DA 1TNGA 8ESTE 1OWDA 5BRRE 1OX1A 1ZMNA 1K1IA 3HATH 4WF8A 2AMDA 3BTWE 3A8DA 1ZJDA 1O2NA 1GI1A 5B6OA 2PKAB 3FFGA 3A7TA 4GSOA 3RU4E 4B71A 1KDQA 1TGSZ 1QRWA 3NPSA 2Q6FA 5K0HA 1Z8GA 1ESTA 1ELBA 2J95A 1O3JA 5PTPA 1G3DA 1GI9B 1TWXB 1TONA 2ZGBH 2XTTB 3BTDE 2OC0A 4I8JA 1C5UA 1O3FA 2ALPA 3GYLB 2BDHA 5HMAA 1DWEH 1CHOF 3M3VA 2GCHG 5CHAC 3RMMH 2G55A 1A2CH 3Q77A 4A5TS 4WVPE 4AB8A 1T8NA 2ODYB 3S69A 1Y5UT 1KXCA 2Y6TA 1GI6A 1TRYA 4X2WA 1LVMA 3ATLA 1FUJA 1MUEB 1GMCG 4CREA 4TYDA 3QN7A 3TGJE 3AVZA 3SNAA 3SNCA 1CSOE 1LPZB 3UFAA 3UY9A 5EPYA 3RXFA 2ZGXH 1ZGVA 2Y5FA 5DGJA 1Y3UA 1EOLA 4FUBA 3ZZBA 3M3TA 3RXOA 1SGCA 4ZXXH 2ZHQH 1SGQE 2ANMH 2PHBA 1UTNA 2ZPRA 1A1RA 1S5SA 4IN1A 1FQ3A 1NRRH 1HAVB 1GI2A 4PROA 1EXFA 4RN6A 1SLVB 1TYNA 3GCTF 1NFWA 1O37A 2CF9H 4UEHH 3KQBA 1ZPBA 4GVUA 2Y80A 4K8YA 2OC1A 3ZZAA 4DT7B 1NFXA 1IQGA 2HALA 2J2UA 1A61H 7GCHG 2WPHS 1T4VH 1P12E 2ZO3H 1O3DA 3SU1A 2W7UA 3VB7A 4MLFB 1RTFB 2B8OH 1SHHB 1O2WA 3A87A 2Z3CA 2VWMA 2ZCLP 1MCVA 3QX5H 1O33A 1WAYB 5CE1A 2ZIQH 2GCTC 4ZAEA 2HVXA 2CGAA 1DANH 1S83A 1OYQA 2EI6A 1P2JA 3LJJA 3SW2B 1LCYA 1TIOA 3BTQE 2ODQA 1KDQB 1EKBB 3OU0A 3UQVA 4X1QU 2RA0A 1C5ZB 4DVAU 1O5AB 4NGAH 2Z9KA 5EXNA 1THSH 1P3EA 4B76A 1ZMJA 3HGNA 1IQHA 1VITG 4JYUH 1PPZA 1Y3YA 2DE8A 2OCVB 4GPGA 1HJ8A 4BTIB 1IQLA 1C2DA 1N8OC 1RS0A 1E35B 5C2ZA 1ZR0A 2C4FH 3CENA 1HRTH 3ZV8A 1GHBG 5A0BA 1C1TA 2AIPA 1BZXE 2HOBA 1AD8H 1O5BB 1W12U 2G5VA 1WOFA 1K21H 4HI3A 1SHYA 1GBFA 3AW0A 3TVJB 1ZSJA 4K1EA 2UWPA 2FOEA 2BQ6B 1BMNH 1GJ9B 1C1PA 5G4BA 2JETC 1LHFH 4D9RA 1MAXA 2NU0E 2VIOA 2FLRH 2QV1A 1UK4A 2SGAA 4ISHH 4UDWH 1GBJA 1TA2A 1OP2A 2PKSC 3LC3A 4X8SH 3L3TA 4K69A 1C1UH 5C67A 1RGQA 4IS5A 1Y3WA 1HDTH 7ESTE 3MU0A 1PPCE 1ZLRA 2YOLA 1TMTH 2BHGA 2A2QH 2AERH 1A5GH 1AU8A 2A32A 3IG6B 1IAUA 1O2PA 1TA6A 1TPAE 4I7YH 1B5GH 4ZXYH 3GDUA 5E2PA 3ZZDA 2PWXA 1GPZA 2K1QA 3SJ8A 4AORA 1YPEH 4BAQB 2FTMA 3KEEA 1TGTA 1MKWH 3M36A 1V2OT 3A7ZA 1O3IA 1GBAA 1GJ6A 3RUOA 1L1NA 4CH2B 2OINA 3FANA 1AQ7A 1GJCB 2GCHF 4X2VA 1BCUH 3MI4A 3A86A 5JPMH 1C4V2 2A5KA 1DWCH 4Y8XA 1IHSH 1UK3A 2WINI 4Y10E 1Y5BT 1GMCF 5C5NA 4E06H 4X1NU 3P8NA 1Z71A 1TAWA 1ESBA 1SGEE 2WPIS 2GZ7A 1JMOH 1LPKB 2OBOA 4E05H 1S81A 2A4OA 5DP7A 1NY22 1K1OA 1BOQA 4BXSA 3RM2H 4JYTA 1QCPA 2XWAA 2ZCKP 2CJIA 2EEKA 2ZFTA 1O3AA 2Z7FE 1RJXB 6LPRA 3MNSA 3MU5A 2F9PA 2Q6GA 1L1GA 5EQRA 1UCYK 1ZHRA 3F1SB 2ZGHA 1AHTH 1BITA 1C5LH 4ABFA 2R2MB 2GZ9A 2Y81A 1O5EH 1O3NA 3KNXA 4YOJA 4GHTA 7GCHF 1LHEH 3DD2H 3D62A 4BAKB 1EQ9A 1Y3VA 1P9UA 4A92A 3T29A 2VVVA 1TQ7B 1HGTH 3PLKA 3SGAE 2F9VA 1P2KA 1CT2E 4WMEA 1THRH 2A2XH 2Z3DA 1F0SA 3E91A 2BY8X 5EG4A 3E0NB 1FAXA 2GTBA 1SGNE 1O5DH 2QXIA 1XUFA 2ZU2A 1GMDF 3DHKH 2CF8H 5A8XA 3BTHE 1QFKH 2Y7ZA 3A83A 1BRUP 1GGDC 1W3CA 3LH1A 1L4DA 1TQ0B 5DP4A 2ZG0H 1ELCA 2Q1JA 1CGJE 1TFXA 3VGCB 1GHAG 1V2KT 3QO6A 1P3CA 1RRKA 2Z3EA 2ZI2H 1MZAA 2ZKSA 2ZEBA 1VR1H 1CBWB 3MOCA 4JZIA 1D4PB 1GHBF 1P9SA 1YPHE 3SV2H 4AX9H 5E0GA 3TJVA 4ABEA 1O2IA 3U8TH 4MVNA 2FEQH 5GCHG 1BBRE 4CHAB 1HAXB 3UQOA 1NU7B 1O2OA 5T3HA 2ZDAH 2FOAA 1ESAA 4KP0A 4UFEH 2ZQ1A 5L2YH 4E7RG 4Y8ZA 1XM1A 1AMHA 3T25A 1P2MA 3F9EA 1FPHH 1W0YH 4ISLA 3VXFH 1W0ZU 2G52A 4X8VH 1SG8B 3SUDA 1GHVH 2W3IA 3RP2A 3A7XA 1IQMA 4UONA 1DE7H 4Y7BA 5JBTA 4Q7XA 2BLWA 2FOCA 2VNTA 1ZSLA 1OWIA 5GIBA 2OXSA 1HXFH 1UO6A 2HNTC 3EQ0H 5L6NH 2W26A 3ZZ7A 3JZ2B 1TGNA 1S0RA 1FONA 2IPHA 4FU7A 4DCDA 3ODDA 1WQSA 4OS6A 2ZFRH 3P17H 3TK5A 4CR5A 3ZYDA 1EPTC 5EODA 1G3EA 2P59A 2OP9A 1E36B 4X6OA 4K60A 4O9VA 3TLOA 5DJ7A 1CE5A 1GJDB 1P2IA 2FOBA 2ASUB 2VINA 3TIUA 1FY8E 2PW8H 4TPYA 1SGPE 2ZC9H 5A0CA 2VIDA 2ZTYA 1RIWC 5CHAB 1D3PB 1QBOA 3F9FA 4Y0YE 2BX3A 4AGJA 1CVWH 4OS1A 2XXLA 1GVLA 3CP7A 2SFAA 3FVFB 3TK9A 3M37A 5TJXA 2PGBB 2Y5GA 1O2MA 4THNH 2F91A 1GBCA 3TJOA 1ZMLA 2ALVA 1MTWA 1UVPA 2A7CA 7LPRA 1LVBA 3R0FA 3BF6H 5FBEA 1P06A 1QA7A 1TPSA 3GY2A 2BQ7B 4Y8YA 1YCPK 1W14U 3OX7U 2V6NA 5IDKA 2B0FA 1O3HA 1UTLM 5GJ4B 2Z9LA 1W7GH 3KF2A 2BD9A 1DLKB 2ZDNA