2AGGX

Succinyl-aapk-trypsin acyl-enzyme at 1.28 a resolution
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta-trypsin
publication title Insights into the serine protease mechanism from atomic resolution structures of trypsin reaction intermediates
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 52
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2005-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2aggX01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2aggX02
1ESAA 2BHGA 4DVAU 4JK5A 5JB9S 4XBDA 5CHAB 1YPHE 1A3BH 7LPRA 3RXFA 2XBWA 4BXSA 1CU1A 2XRCA 1PJPA 3IWMA 2CN0H 3DHKH 2M5TA 2NU1E 1GCDA 1SGFA 2GV7A 8GCHF 1AN1E 4D7FA 1K22H 1O3HA 4LXBH 1V6DA 3NKKA 1Q3XA 1XKAC 2J9NA 1UHBA 2PSYA 4K1TA 1O2GH 1V2OT 1DUEA 5C3NA 2VGCC 2XC4A 3U69H 3A8AA 4IMZA 1EZSC 1O5FH 1MAYA 1GMDG 1GDQA 3ZVAA 1HLTH 1C1MA 1MKXK 1Z6JH 2FOBA 3A7TA 2Y6TA 1E36B 1NU7B 1BB0B 1K1OA 2A4OA 1NRPH 4BTUB 2OXSA 4TY6A 1A61H 5F03A 3H7OA 1DFPA 1AZZA 3TJVA 3VXEH 4I8JA 1G3CA 2FTLE 2WUBA 2SGDE 2PKSC 3GY2A 4R8TB 1MBQA 4WF8A 3O8DA 2AMQA 3SUGA 1OWDA 4X1NU 3ZZ9A 3ZV8A 1O2TA 5G4BA 1WV7H 2ANKH 2BQWB 4DW2U 1INCA 3SQHE 1HIAA 1CVWH 1GBFA 3ZZ4A 4MPWA 1AQ7A 1BBRE 2BDHA 2BDYA 1MU6B 1SGRE 1NC6A 3EQ0H 1EJMA 3PLBA 3URCA 2FYRA 1RS0A 1UCYH 1AWFH 3MH4A 1EP6A 1THRH 2ZU1A 5TCAA 1AUJA 2PLXA 3QX5H 4KTSA 3SJ8A 3U98H 4YLQH 1BTZA 4GSOA 1W7GH 1Y3VA 2H6MA 1Z8RA 4ZROA 3MH6A 1XUKA 1NESE 1ZHMA 3Q3KA 1GBTA 2BY8X 2GCHF 3KHVA 4JCNA 1O3KA 2VIVA 1J16A 1A0LA 1P11E 1IQFA 2GP9B 3UREA 1ESTA 3PO1B 2P94A 2FOMB 3ITIA 1LTOA 2QAAA 5I46H 1YPGH 4GLYA 1CGJE 2SGQE 1O31A 2FLBH 4ZKNU 1YPLH 2FOHA 3GYLB 2PGBB 2GZ8A 2O8TA 3QN7A 1QGFA 3RC5A 5SGAE 1BHXB 4JYVH 3MNSA 3Q3YA 3VB6A 1C5WB 4NZLA 3UR6A 2PGQB 1PPEE 5A09A 2RG3A 2ANWA 2SGAA 2GMTB 3TU7H 2D8WA 1FQ3A 1Z71A 2ODPA 4DCDA 1SQAA 2BLQA 1GWAA 3LGUA 3T29A 2BY5X 1GBKA 1Y3WA 4JMYA 4KELA 1FPCH 1PYTD 4I31A 4B71A 3P8OA 3JZ2B 3TPIZ 3MYWA 3L33A 2H2ZA 3DFJA 4AFZA 1AO5A 2J4IA 1E0FD 1GCTB 2PKAB 3Q76A 4BAHB 2BDGA 1FXYA 3FZDA 4B74A 2Q1JA 1PPHE 4WMDA 2VIOA 1GBIA 2WPIS 4FUJA 1KLTA 1BIOA 2JETB 2RDLA 4Y0YE 2ASUB 1G2MA 3WY8A 2OLGA 1ETSH 2A7JA 1YGCH 4I8GA 3SJOA 1FJSA 4JYTA 3NXPA 5A8YA 1EOLA 1BHXF 1VITG 1O5GH 1P2JA 5HGGA 1SGCA 1TE0A 1P03A 2A2XH 2OUAA 3A8CA 2ZFRH 1ELCA 2EC9H 1OP0A 1MKWK 1MCTA 2VIPA 4XBBA 3D62A 3TJUA 1AKSB 2A5AA 4GHTA 3D23A 3HGPA 1ZMJA 2ZIQH 1TX7A 1GI1A 4OS7A 1AVWA 1O2PA 2BDBA 4AOQA 1OWKA 1GJCB 2ZPSA 3A85A 2TGAA 1B0EA 1SHYA 4JZDH 3V0XA 4D9QA 5DO4H 3ATMA 1T8LA 3RXGA 3EYDA 3ZZ7A 1V2RT 1Y59T 1WSSH 1D6WA 1SB1H 3RMLH 3AASA 3ZVCA 4OGYA 3SI3H 5AVDA 1ZRKA 2ZHQH 3RP2A 1PPFE 2VWMA 3OY5U 1A5HA 1ZSJA 3NUMA 1KXAA 1CHGA 1V2LT 2BD9A 3ZZ3A 1S6HA 1C1SA 2W26A 1CBWC 1MU8B 1OS8A 2FM2A 1HXFH 4X8TH 1S5SA 4Y0ZE 2QXJA 2H1UA 1O34A 3SOSA 4X1PU 1P05A 2R3UA 1TALA 3GY3A 2ZHEH 1FIWA 1O30A 3P17H 1CO7E 2BY9X 2FX4A 3KL6A 3OX7U 2BX3A 1UVOA 5DG6A 4FXGH 2ZFTA 1G37A 3GDUA 4NFFA 1YCPH 1MCVA 3RXQA 4BAQB 1C5MD 2HNTF 1O2NA 1T4VH 1SQTA 4H42U 4NSVA 4QT8C 7GCHF 1GI0A 1A4WH 2ZI2H 4TWWA 3QTOH 3SU6A 4Q7ZA 1J9CH 2A7HA 3ATWA 1LDTT 2XCFA 2PKAA 4GCHG 3QK1A 1L2EA 2Y5HA 4I32A 2SNWA 2VVCA 1VCQA 1O5EH 3V13A 4I8KA 5EOKA 2F9VA 3PMBB 1S82A 2V3HH 1GBAA 4GVUA 2ZGBH 2QXHA 1B7XB 1ELAA 1RTFB 1GI5A 1BTPA 3S0NA 3A7ZA 3RU4D 1IQIA 2W7SA 6CHAC 3A80A 3VFEA 4MNVA 1PQ8A 1AY6H 4O97A 1KSNA 1GVZA 1P10A 2GTBA 3E90B 2F9OA 5DP6A 1C9TA 1CE5A 3CS0A 5L6NH 4K5ZA 4MNWA 1GMCG 3SORA 1M9UA 3TJNA 4A1VA 4CRFA 1AKSA 2ZDVH 3TK6A 4ABDA 4K8BA 2Y5FA 1ZPCA 4NCYA 1QRWA 4X1RU 1F5KU 4BAMB 1RGQA 4M7GA 3MWIU 4FU8A 1QRZA 1CSOE 2EA3A 4Y76A 2P8OB 2J95A 1LHFH 3LC5A 5C20A 1DWDH 3LPRA 1GCTC 1KLIH 1QCPA 2Y7XA 3SW2B 1SOTA 4GUXA 2GCTB 4AZ2B 4YOIA 2Z9JA 3LOXA 4CR9A 3ATKA 1ZSKA 1BUIA 2RA0A 5FCRA 4OS4A 1MZDA 4WY3A 1TX6A 1SL3A 1MMJN 2ZHDA 3M35A 5GDSH 3F9FA 4IBLH 3RU4E 1C5LH 1T32A 1J17T 2BLOA 3UOPA 4ZXYH 5LPRA 5DGJA 4VGCC 4BAOB 1TGNA 3RC6A 3GCTG 1HYLA 2JH5D 2V35A 3ENSB 3FVFB 1GG6C 3P6ZB 1TQ0B 2AIPA 4HFPB 1CT4E 1YC0A 5A2MH 2Y80A 2C8WB 1MD8A 1YLCA 4CH2B 1DXPA 1F0UA 1C1QA 1ZYOA 2HNTC 1KIGH 4OS1A 4Y71A 1O5AB 1GI4A 1TBQH 1UTOA 1WBGB 2C93B 5ESTE 4CHAC 8KME2 1W11U 4UEHH 1HAOH 4X0WU 2RCEA 3A87A 3A8DA 1SLVB 2ZHFH 1S84A 2W3IA 4WH6A 1H8IH 3A7XA 5DK1A 1F5RA 4J2YB 2TGPZ 1BITA 5E2PA 1GBEA 2XBVA 4A1TA 3DD2H 1DSTA 1O2XA 1SG8B 1ZRBA 2PKSB 1BBRH 2W3KA 5E0GA 1C1PA 1XUGA 2SGPE 4YOJA 1BOQA 1TBRH 1T8NA 1VCPA 1BMLA 4PROA 4IMQA 4YM9A 4WJG2 3ZZ8A 1C5VA 2NU2E 1Y3UA 2XWBI 4D76A 2J92A 1TGCA 4Z6AH 1UK3A 1GBCA 1GGDC 2FDAA 1WCZA 4TYDA 3LH3A 1ZMNA 5T6FA 4NIWA 2Q6DA 1TLDA 1P2IA 3PLKA 1SGYE 1O2IA 3GCHC 1V2QT 2OC0A 2KAIA 3SJKA 1TPOA 2UWPA 4ABJA 1OXGA 1V2ST 2ZGXH 3TIUA 1TX8A 1BRBE 2G81E 3EDXB 1CA0C 3GCNA 3UNQA 2ZU5A 1YBWA 2P3FH 2CXVA 3QO6A 3B9FH 3IG6B 1DDJA 4TY7A 1DY9A 2ZQ2A 3DFLA 3DA9B 1LPZB 4ZKOU 1SR5C 3K9XB 2AS9A 3SUEA 2UUYA 1TOCB 2QV1A 2V6NA 1NPMA 5GPIB 4CBNA 3TH3H 3EA9A 3SHAH 1W12U 1MQ6A 1TNLA 1HUTH 1P2KA 1GJ5H 2QN5T 5E2OA 4ABBA 3RXAA 2G4UA 1OOKB 4ZKRU 4GAWA 2VIWA 1ARCA 3GY6A 3CP7A 1A2CH 4NGAH 1MUEB 3BTDE 4D9RA 3BTTE 2P16A 4JZFH 3SJIA 3ZVEA 3ZYDA 1T31A 1Z6EA 1MTVA 1SC8U 1YF4A 3HKIB 4O03A 5FHTA 1SVPA 4O9VA 1E34B 1SGNE 3FAOA 1DM4B 3S69A 2BVSH 1LMWB 4BANB 5E0JA 1C2IA 2QF0A 2ZQ1A 4BTTB 3RXSA 4A5TS 5LH8A 4NIVA 4H4FA 1A0JA 3OYPA 1ORFA 1ZGVA 1CQQA 5EXLA 2HALA 1WQVH 2ZP0H 5L2ZH 2R2WU 1G3BA 1VJ9U 5F8XA 1V2KT 2R9PA 1AU8A 3BTWE 2JH0D 4H6TA 2GCTC 2VH0A 1EQ9A 1TPSA 4AFUA 1O2MA 3BSQA 1D3DB 1C5TA 2HPPH 1ARBA 2C4FH 2J34A 3SNCA 3UY9A 3RXIA 1HV7A 1S0RA 5LGOA 5EW2H 1WOFA 2QGRA 4NIXA 5HMAA 1BTYA 1IQMA 2TPIZ 3TH4H 3Q77A 1AVGH 1O2RA 1QTFA 2I6QA 2OD3B 3M5LA 1ZJKA 4O3TA 1ZTJA 1EP5A 2FX6A 2GX4A 1XKBC 5F8ZA 1F7ZA 2BY7X 4F4OC 1LHDH 1HFDA 2AERH 1F0SA 1C2FA 1YCPK 1K2I1 2ZU4A 1J15A 1Y5AT 1TAWA 1BQYA 1HAIH 2D2DA 4AX9H 2GGVB 3IITA 4X2XA 3AW0A 5ETXA 9LPRA 2GCHG 3SU2A 3RXCA 4Y10E 5TJXA 2ZPRA 3URDA 2QA9E 4INLA 2C90B 1ELEE 2TGDA 3KQBA 3SHCH 5C2ZA 1ZR0A 1SQOA 5FBEA 5FAHA 4YESB 4KP0A 2BVXH 5K7RA 1K9OE 5EXNA 1KXDA 1XUFA 1ZPBA 1C2DA 1HDTH 4AORA 1N8OC 1C9PA 1TPPA 3M7QA 1O2VA 4X6OA 8ESTE 1Y8TA 3DUXH 1ABIH 3PTNA 1O5CB 3ATIA 1P04A 2VU8E 5AFYH 1UO6A 2EI8A 3TJOA 1RD3B 5DPAA 2CJIA 4Q7XA 3LKWA 1N6XA 4A6LA 2P3TB 5BRRE 1CBWB 1JMOH 1G3DA 1TMBH 2EEKA 3OTJE 1P06A 2HGTH 3PTBA 1BTWA 5A8XA 3JZ1B 3VEQB 1K1PA 1NFWA 5I25A 1ABJH 1FY1A 2FOEA 3NWUA 4CRCA 3SU3A 3QZQA 3TNSA 2B8OH 3E6PH 2VIQA 1C5SA 4LK4A 1H9IE 3UOUA 2BDAA 1L4DA 1EB2A 1C4Y2 4Y7AA 2VIDA 1FAXA 1GJ7B 1GL0E 2QC2A 1D3QB 2R2MB 1KYNA 4JYUH 3S9AA 1EASA 1NRRH 1WTGH 2P3UB 2ZCLP 4WH8A 3VB7A 3I77A 2ZF0H 3K6YA 2FYQA 4X2VA 2JKHA 2P93A 1W10U 4E06H 1WQSA 5A8ZA 1C2GA 4AB8A 1WTHD 2WV5A 1GMHG 2FTMA 2Z9IA 3C1KA 3UPEA 1S83A 4K2YA 3AW1A 2GD4B 3A82A 3MO9A 1BRCE 1HCGA 3UNSA 2FWWA 2GT7A 4DOQA 3E8LA 1HJAC 1G9IE 2ZGCA 3SV7A 1JOUB 1GDNA 1PFXC 5EU8A 3TK9A 6CHAB 5C67A 5EQQA 2BQ6B 2O8UA 2F9UA 3MU4A 2BD3A 3K6ZA 2FOAA 2WPJS 5DP7A 1C5RA 3E3TA 1PQAA 2ZFPH 2PUQH 3SU0A 2FPZA 2Z94A 1O36A 2H5CA 4ISNA 1GI8B 2BX4A 2WINI 4R0IA 5E8EH 5EPNA 1BTHH 1NT1A 2IJOB 1P2QA 2W7UA 4XE4A 3GICB 4I8HA 2O8WA 3ZZAA 4CRAA 4MPVA 3STJA 1DS2E 4AFSA 2ZCHP 2AGEX 1FY3A 3M3SA 5F6MA 4I33A 2OC8A 2NWNA 1EX3A 3RXDA 1Y3XA 1SFIA 1BBRK 3ZYEA 4MQAA 4FVDA 5HYOA 1ZGIA 1W0YH 4X6MA 1GJBB 3HATH 1BRAA 4AGKA 1GJ8B 1W3CA 3A86A 3RXJA 2BB4A 2GKVE 1LCYA 2LPRA 3TGJE 1GMHF 4I8LA 1K1MA 3SU4A 3BIVH 1VR1H 1C1VH 5FX6A 1EUFA 1AIXH 1TMUH 3BTKE 4Y8ZA 4X1QU 4D8NA 4VGCB 4X1SU 1HAGE 2PTNA 1AUTC 1SFQB 5IYTA 4MG3A 1O2OA 4IGDA 1EATA 5J4QA 3GDSA 1YPMH 1GG6B 1TIOA 1FI8A 3KNXA 5T6GA 1YPHC 1A7SA 4B2BA 1K21H 2BD5A 2ZA5A 2XYAA 1HAYB 3NCLA 2FLRH 4MPUA 7GCHG 2BLVA 2SGEE 1Z8IB 3M7TA 4DY7B 3U8TH 1W0ZU 1RIWC 5T3HA 4RSPA 5BPEA 2XC0A 4CHAB 1EPTC 4OGXA 4IC6A 1ZTLA 1QHRB 2AH4X 1YM0A 3KEEA 1C4U2 4XOJA 2YNBA 1VZQH 2XWAA 3U1JB 1H1BA 2BLWA 2FOCA 2ZDKA 1DITH 1F5LA 3LIWA 5HM2A 1O3JA 3SV8A 3MI4A 3T2NA 4ZHLU 1DXWA 3LJJA 4X8VH 4YO9A 2G5VA 2JH6D 2DE9A 1C1OA 1PPCE 5AHGH 1RRKA 2FXRA 1CT0E 1SBWA 3SGQE 1VCWA 3T25A 1TGTA 1KXEA 2FEQH 7ESTE 2VWNA 1P02A 1ELBA 4XDEA 3E0NB 2I6SA 2Z3CA 1GGDB 5C5NA 1JBUH 2AYWA 3HK3B 1ELTA 1UK4A 4INKA 1L1JA 2LNCA 3SUFA 3BF6H 1NRSH 2V0BA 3LH1A 4FUIA 3GCHB 5HM9A 5GJ4B 3P95A 3TITA 1O2HA 1XX9A 1Y5UT 1QURH 1IQHA 4FU7A 2VNTA 1UVPA 4TWYA 2AIQA 3SNEA 5EG4A 3SV6A 1ZHRA 3M61U 1CA0B 1SLWB 1SI5H 1OSSA 5C1UA 2PFEA 1NM6A 1AVXA 5EQRA 2XBYA 2BD2A 4Z0KA 4X8SH 1UTLM 1IQEA 3R0FA 4ZH8A 1QL8A 3A8BA 4CBOA 1O3LA 5EQSA 1O2JA 2FESH 1NY22 3AAVA 3N7OA 1UCYE 2AMPA 1ANDA 1A1RA 1NZQH 2J2UA 5JBAS 1KLJH 1C5UA 4UFGH 1TA6A 1W2KH 2VVVA 3TLOA 4ABIA 4X6NA 1F0RA 3T62A 1QY6A 1GHXH 1GI7B 4NZQA 4YT7H 1EZQA 1RTKA 1RFNA 2ZFQH 1J14A 1HAZB 4NA7A 3OSYA 1V2UT 4XFQA 2VVUA 2XNIA 1Z1IA 3MTYA 3RXKA 4E05H 1DLEA 1L1GA 3P8GA 2AGGX 1FY4A 1O3OA 2UUFB 3M3TA 4CR5A 1EJNA 4ZAEA 1NRQH 1AFEH 4MNXA 1KXFA 5K0HA 2GDEH 1TNGA 1AI8H 2EI7A 1H8DH 1K28D 1NROH 1DWCH 4E7RG 3GY7A 1XVOA 1O3AA 1GL1A 3ZVDA 1T8MA 3KF2A 1DLKB 5C5OA 2XXLA 2TIOA 4CRBA 1IAUA 2XBXA 3HKJB 1Z8JB 3QDZB 3UTUH 2PV9B 2ZKSA 1KTTB 2CF8H 2BD7A 1ZZZA 1XXFA 1UVUH 1HAXB 1TONA 5IDKA 1O32A 3A83A 4ISOA 5CE1A 2EI6A 4DG4A 1GJ6A 2BDIA 1KDQB 2F3CE 5GXPA 2A7CA 5C1XA 1S85A 4ISIH 5DP9A 2F9NA 1C5OH 3RLYH 4GHQA 4BTIB 3MNCA 4UFDH 4AG2A 3A7WA 3UFAA 1K1LA 1TGSZ 1TNKA 2OC7A 1F92A 2ANMH 2BDCA 1QIXB 3RXEA 1BJUA 4UDWH 1XMNB 2ZC9H 2FP7B 1D9IA 3GY4A 1C1WH 3RMOH 3F9GA 3E16B 2BVRH 1V2MT 2ZG0H 2FS9A 3MH5A 2ZECA 1Y5BT 4OS2A 3GY5A 4B73A 4JZIA 3RDZA 4MDSA 3LGIA 2G4TA 2J38A 4XSKU 1N6YA 1N8OB 3GYMA 1QQUA 1PYTC 4FUCA 4ISHH 2VB0A 2HOBA 1PPBH 3PYHA 4AFQA 1HJ8A 4SGAE 1P2MA 4RKOB 4DGJA 1FN6A 2A0QB 1LVOA 3F68H 5FPTA 1AWHB 1LPKB 3QZRA 1FY8E 1P57B 1EOJA 3PLPA 1NO9H 1QJ6B 1ZJDA 4RKJB 2A4QA 1H9LB 1T4UH 1X7AC 5AF9H 2XC5A 1EAUA 2P59A 1LVYA 1O2SA 3MO3A 1JWTA 1N1LA 1NRNH 1TRMA 2YOLA 5B6OA 2C8YB 1HGTH 1GDUA 1MTWA 2GV6A 2W5EA 3I78A 4JK6A 3S9BA 1SLUB 4B76A 1BT7A 3RXHA 3U8RH 2WUCA 1ELFA 1C5ZB 2F83A 2RA3A 1SGFG 1O3FA 2G00A 4ABHA 5LPFA 3T28A 3S9CA 2OBOA 5EW1H 2WPMS 2GZ9A 4MPXA 4KTUA 3VB4A 3EAJA 4CREA 4X6PA 2ZTXA 3W95A 4X8UH 1BZXE 4FUEA 1ELVA 1IHSH 2CHAC 2OP9A 3RXTA 1C1RA 1UJ1A 1A3EH 1A46H 1HJ9A 3ESTA 3PV4A 2UWLA 1ELDE 1YPKH 1ANCA 3NZIA 1IQKA 1ANEA 4GPGA 1O38A 2ZU3A 1W7XH 1V2NT 4LOYH 2PHBA 3A88A 1BTUA 2GVFA 1B5GH 2BM2A 1O3IA 3UR9A 1LHEH 2Y81A 1HJAB 1P8VC 5DJ7A 3G01A 3KN2A 4FU9A 2G8TA 2Y82A 1EZUC 1MTNC 1AZ8A 1YYY1 1L0ZA 2YNAA 3O8BA 1V2JT 1BA8B 5DP8A 2ZU2A 4THNH 2G55A 1KTSB 2SNVA 3BN9A 2PUXB 2BOHB 2VJ1A 2ZEBA 4U30A 3C27B 3LDXH 3SNBA 3A7YA 1YKTA 4HI3A 1KDQA 1EKBB 1QB6A 3UWIA 5L2YH 1OPHB 2Y5GA 1C5XB 1EAWA 1MQ5A 2QXIA 3P70B 1G2LA 1PQ7A 3S7HB 4XBCA 4DJZB 1Z7KA 2HRVA 3W94A 3FP8E 2Z9LA 4OS6A 1TABE 4DIHH 1W14U 1L4ZA 2ANYA 5DP5A 2FIRH 1HRTH 1O3NA 3VGCC 2BZ6H 1IQNA 1GBJA 1DWEH 4D7GA 4Q80A 3MU5A 2A45B 1C5PA 5PTPA 1GBBA 1ID5H 4OS5A 3F6UH 1F2SE 2Z7FE 1GI6A 1UTJA 1QR3E 2AMDA 2BZAA 3UWJH 1V2PT 1P09A 5T6DA 1TB6H 3FZZA 1GJ4H 1MD7A 2XTTB 4HTCH 2OINA 4MVNA 1SOZA 2A4GA 1AGJA 1CGIE 1GBMA 2G5NA 2QCYA 3BG4B 2VWLA 2WPLS 3RLWH 5A0BA 1GI9B 2A5IA 2AEIH 1EAIA 2ZGHA 1GHZA 5EGMA 3F9EA 4WXIA 1FONA 3BIUH 3A84A 1LKAA 1GVKB 4NA8A 2HLCA 1CA8B 5AFZH 1NFYA 2UWOA 4ABAA 4ZHAA 1MAXA 3MNXA 4Q2KA 6GCHF 1JRSA 3VPKA 1NS3A 1FAKH 2ZCKP 4JZEH 4ZKSU 4YTAA 1OP8A 5FBIA 2R0LA 1LKBA 2ZDNA 6ESTA 1NFXA 3SGBE 1ELGA 3RXLA 1ACBE 3MO6A 2FOFA 3HK6B 1MTSA 1RIWB 3BTME 1LQEA 2WPHS 2Y7ZA 2WYGA 1EPTB 1G32B 1UK2A 2BD8A 1RTLA 5JBBS 1P9SA 1UTNA 4AB9A 5J4SA 5JBTA 3UIRA 2CMYA 3SNAA 4ABGA 2FOGA 3T27A 1TQ7B 1P0SH 3SNDA 1HAHH 2R3YA 2SFAA 2ALVA 4FUGA 3SU1A 2ZDLA 1O5BB 1UTPA 1FIZA 5TCCA 1SHHB 1YPJH 1K1NA 2ZGJA 1V2TT 1BRUP 4INHA 1GHVH 1IQLA 2VINA 4K8YA 3RC4A 3RXUA 3FP6E 1ANBA 3SO3A 2DE8A 3MH7A 4A92A 4DIIH 1OYQA 3UQVA 1D4PB 3M3VA 2O8MA 2FI4E 1NN6A 4WVPE 1GBDA 2IN2A 2D26C 3OY6U 3MU8A 2UUJB 1SMFE 5FXLA 2G52A 1YP9A 1TNJA 4MNYA 1NFUA 5A0AE 1FDPA 4BNRA 1C5NH 1BDAA 1XUIA 3PM3A 3PWCA 3BG8A 1L1NA 2FI5E 1IHTH 1LHGH 3DT0H 3ZZ5A 2VWOA 1SGTA 4TPYA 4YLUA 5HXFA 3ZVBA 1GHWH 1DE7H 2A32A 1C2EA 1QA7A 2WV4A 3QTVH 1DX5M 2ZFFH 1GBLA 3LGTA 4WWYA 3K2UA 4HZHA 1DICA 1GHBG 2BYAX 3RM2H 2A2QH 1P12E 3Q00A 3SUDA 1DY8A 3UQOA 3MHWU 2C3SA 1OP2A 3K65B 4ESTE 3QUMP 5ABWA 1GMDF 1RJXB 4X2YA 3RXMA 1OWEA 3BEFB 1Y3YA 3ZV9A 1O3DA 1MZAA 1YCPM 1JIMA 4RN6A 1D6RA 1QB9A 4ABFA 2A5KA 1CGHA 2PTCE 3LONA 4F49A 1BMMH 5DP3A 1HAVB 1OWHA 1O3EA 1G36A 3M5MA 3U9AH 4A1XA 1OKXA 1AE5A 1NTPA 1GHYH 3V7TA 5JBCS 2Z9KA 3KQCA 2BMGB 1P3CA 2C8ZB 2BQ7B 1S81A 1C2MA 2AGIX 1CHOG 1AB9C 1DVAH 2TGTA 3M5NA 3B8JA 1DPOA 1O2LA 1T8OA 1O33A 4FUFA 1TYNA 1AE8H 2ZTZA 1KY9A 5JPMH 4TPIZ 1XXDA 2NU4E 3VB5A 1SGPE 1C1NA 1EPTA 3SN8A 3LGWA 1ZOMA 1C5QA 3LGVA 1QNJA 4NWLA 3MOCA 1GI2A 1ESBA 3GOVB 2J94A 3EGKH 4NIYA 1GHBF 4YOGA 5EXMA 3CS7A 3AVZA 4IN1A 3ZZ6A 3L6PA 2Z3EA 2QXGA 2ALPA 3BG4C 4ISLA 4Y79A 3OU0A 3STIA 1QFKH 4MLFB 1QJ1B 3M5OA 3QWCH 4NWKA 1EZXC 1EAXA 3A81A 4I7YH 1HBTH 3BTHE 4BXWA 1WYKA 3U8OH 2O8LA 1CT2E 4IC5A 1XUHA 2WYJA 2B0FA 1JXPA 3L3TA 5JB8S 3QGJA 5CHAC 1O2ZA 4IS5A 5LPEA 1QBVH 1XM1A 3SV2H 1O2WA 2VH6A 3A7VA 2FS8A 4K60A 9ESTA 2BY6X 3SGAE 1UTMA 2PSXA 3SBKA 3PWBA 3LJOA 2ZO3H 1GVLA 1O39A 3TNTA 1CHOF 2HNTE 1THPB 2H9TH 1ZMLA 2Q6GA 3RXVA 2STAE 3TK5A 3QLPH 3BTGE 1OWIA 2P95A 5L30H 3M37A 3SU5A 4UONA 1WUNH 3NPSA 3MU0A 3T26A 3ODFA 3P92A 1SGIB 3MNBA 4K3JA 1QL9A 1H9HE 3TH2H 5CMXH 4AYYB 1Z8GA 1G30B 1SGEE 1ZPZA 3E1XB 4Q7YA 1A0HB 3M7UA 1WAYB 2IPHA 3PMHB 5JYIA 5JDUB 4B2AA 1AD8H 2H5DA 1DWBH 2Z3DA 1QQ4A 5FPSA 2TRMA 2TBSA 4K1EA 4JZ1A 1C2HA 5A0CA 1DUAA 4AN7A 1YPEH 1HAVA 1K1JA 2CV3A 4LZ1H 2H9EH 1SLXB 1TRNA 3BEUA 1OYTH 1QA0A 1E38B 3RXRA 3ZZDA 3RUOA 1PQ5A 1LHCH 4AYVB 1T7CA 3BTQE 2PR3A 4KTCA 1TFXA 1VITF 2OC1A 3T5FH 1GHAG 3LU9B 1XVMA 2CHAB 4DT7B 1O3BA 2F91A 3HGNA 2Z6BD 4UD9H 2F9BH 1FUJA 1YLDA 3PB1E 1AFQB 1KXBA 3MMGA 3EA8A 2OBQA 1BMNH 3ODDA 3GDVA 1QRXA 4AGJA 2FZZA 3V12A 4UE7H 3KGPA 1U6QA 1FZZA 1A5IA 5F8TA 1MTNB 2HWLB 3PO1C 1O2UA 3Q3XA 2FI3E 2R0KA 1V2VT 1BJVA 1O35A 1MKXH 2HPQH 1MTUA 2ILNA 5C1YA 1AMHA 1O3GA 2BTCE 1EJAA 8LPRA 2NU3E 1C2JA 1XUJA 4Y8YA 4K1SA 1UMAH 1FLEE 1BCUH 1TMTH 1ZHPA 5FX5A 1EXFA 3B23B 3SJ9A 4NFEA 1DOJA 2GZ7A 4A7IB 1NU9A 1O5DH 2OQ5A 2KAIB 4IN2A 2GMTC 3S7KB 3VGCB 1VGCB 2A4RA 1LPGB 3A89A 1C2LA 1Q31A 1GHAF 1ZTKA 2SGFE 3LGYA 3KIDU 3HPTB 2BXTH 3RXPA 1G3EA 3VB3A 3RMNH 1FNIA 1UTKA 2K1QA 1VJAU 1TOMH 3FANA 4NG9H 2ZPQA 4O3UA 3BV9B 1EB1H 2IOTA 1O3MA 3TGIE 1D3PB 2PWXA 1QJ7B 1MH0A 3ZZCA 1IQGA 1S0QA 2QYIA 4LZ4B 1B0FA 3TGKE 1P2OA 1PPGE 1PPZA 4YZUA 3AAUA 1C4V2 4KGAA 1FN8A 2OCVB 4GCHF 3H5CB 2JETC 4ZXXH 2D1JA 1V3XA 4UFEH 1FY5A 1SSXA 2ZHWH 2BXUH 4UFFH 4ZHMU 4B2CA 2XCNA 1OWJA 4ASHA 4Y6DA 1TNHA 3H7TA 2ODYB 1BMAA 4AG1A 1HNEE 4J1YA 4SGBE 4FUBA 3ZVGA 4WMEA 1WU1A 4NSYA 2GT8A 1UCYK 4FUDA 4WMFA 1GJAB 2ZTYA 1ETTH 1W8BH 3SQEE 4CH8B 1LQDB 2NU0E 2B9LA 5FCKA 3LC3A 1RXPA 1FMGA 2A31A 1DANH 1LVMA 2UUKB 4ZMAH 1LVBA 1GMCF 2VGCB 1UTQA 3P8NA 4B75A 3O8CA 2B7DH 3PMJA 3FFGA 4YT6H 1FPHH 3UUZA 2ZZUH 1ZSLA 5GCHG 2Z9GA 3GY8A 1DSUA 1SGDE 1O2YA 3F1SB 1TRYA 1E37B 1C1UH 1JRTA 4X2WA 3RXBA 3ELAH 2XW9A 1F0TA 5ESBA 3P8FA 1C5YB 4K69A 1Q2WA 3RU4T 1TA2A 4ABEA 3GCOA 4NA9H 3SV9A 1SGQE 3LT3A 3RMMH 3E91A 3CENA 1O3CA 4U2WA 4Y11E 4B1TA 4H6SB 1GJ9B 2ESTE 1HXEH 2GDDA 4U01A 2B5TB 4HGCA 4E7NA 1GJDB 3RXOA 2BOKA 4CRDA 1THSH 1TNIA 1UHBB 2F9PA 4U32A 1C2KA 2HVXA 2OTVA 2THFB 3O8RA 3GCTF 1IOEA 4CRGA 4ZUHA 2ZWLH 1MKWH 4WXVA 1ETRH 1V2WT 1AFQC 3M36A 5EPYA 3BEIB 1H4WA 3QGNB 3ATLA 3SZNA 3SI4H 3R3GB 5GIBA 2A1DB 1C1TA 2FMJA 1S6FA 1P01A 3I29A 1Z1JA 1OX1A 3BTFE 1HPGA 6LPRA 3GISB 3RM0H 5GCHF 3PROA 1AHTH 1IQJA 1O3PB 1BTXA 3KCGH 2ZNKH 3EE0B 3KQEA 5FPYA 1SPJA 1O0DH 1TGBA 3V3MA 6GCHG 5GWZA 2OQUA 4Y8XA 1GI3A 2STBE 1FV9A 2FODA 3D65E 1HIAB 1ZLRA 2ULLA 4MTBA 2C8XB 1E35B 1QL7A 2Q6FA 1HAPH 3U1IB 3ZZBA 8GCHG 1W13U 4KKDA 2PW8H 1KXCA 1O2KA 1AB9B 3UNRA 2CF9H 1GBHA 4FUHA 2QF3A 4Y7BA 1TBZH 4BAKB 3F9HA 3D49H 3TVJB 1P3EA 1VGCC 1TPAE 2WPKS 3E0PB 1P9UA 2CGAA 2O9QA 3BTEE 2QY0B 2H9HA 2ZDMA 4DURA 2QIQA 3ZVFA 1JIRA 1K1IA 1O2QA 3NK8A 1LO6A 4IW4E 2P8OC 1P2NA 3MFJA 1GPZA 1O37A 2BD4A 2ZFSA 2V3OH 3KQDA 1MBMA 2ZDAH 1UVTH 2AFQB 1QB1A 1J8AA 1D3TB 3FP7E 1VITH 1QBNA 3PMAB 3EA7A 5H4IB 1A5GH 2DUCA 7KMEH 2FO9A 1UVSH 2G51A 1DT2A 1TWXB 4FVBA 5DKMA 1HB0B 3VXFH 2ODQA 3MU1A 4BOHA 5E0HA 5DP4A 5EODA 1QBOA
chains in the Genus database with same CATH superfamily
1ESAA 2BHGA 4DVAU 4JK5A 5JB9S 4XBDA 5CHAB 1YPHE 1A3BH 4F55A 7LPRA 3RXFA 2XBWA 4BXSA 1CU1A 2XRCA 1PJPA 3IWMA 2CN0H 3DHKH 2M5TA 2NU1E 1GCDA 1SGFA 2GV7A 8GCHF 1AN1E 1FX0B 2QE7D 4D7FA 1K22H 1O3HA 4LXBH 1V6DA 3NKKA 1Q3XA 1XKAC 2J9NA 1UHBA 2PSYA 4ASUD 4K1TA 1O2GH 1V2OT 5EJZA 1DUEA 5C3NA 2VGCC 2XC4A 3NRLA 3OEED 3U69H 3A8AA 4IMZA 1EZSC 1O5FH 1MAYA 1GMDG 1GDQA 3ZVAA 1HLTH 1C1MA 1MKXK 1Z6JH 2FOBA 3A7TA 4FETA 2Y6TA 1E36B 1NU7B 1BB0B 1K1OA 2A4OA 1NRPH 4BTUB 2OXSA 4TY6A 1A61H 5F03A 3H7OA 1DFPA 1AZZA 3TJVA 3VXEH 4I8JA 1G3CA 2FTLE 2WUBA 2SGDE 2PKSC 3GY2A 4R8TB 1MBQA 4WF8A 3FN8A 3F3BA 3O8DA 2AMQA 3SUGA 1OWDA 4X1NU 3ZZ9A 3ZV8A 1O2TA 5G4BA 1WV7H 2ANKH 2BQWB 4DW2U 1INCA 3SQHE 1HIAA 1CVWH 1GBFA 3ZZ4A 2JJ2D 4MPWA 1K0HA 1AQ7A 1BBRE 2BDHA 3U28C 2BDYA 1MU6B 1SGRE 1NC6A 3EQ0H 1EJMA 3PLBA 3URCA 2FYRA 1RS0A 1UCYH 1AWFH 3MH4A 1EP6A 1THRH 2ZU1A 5TCAA 1AUJA 2PLXA 3QX5H 4KTSA 3SJ8A 3U98H 4YLQH 1BTZA 4GSOA 1W7GH 1Y3VA 2H6MA 1Z8RA 4ZROA 3MH6A 1XUKA 1NESE 1ZHMA 3Q3KA 1GBTA 2BY8X 2GCHF 3KHVA 4JCNA 1O3KA 2VIVA 1J16A 1A0LA 1P11E 1IQFA 2GP9B 3UREA 1ESTA 3PO1B 3KQ5A 2P94A 2FOMB 3ITIA 1LTOA 2QAAA 5I46H 1YPGH 4GLYA 1CGJE 2SGQE 1O31A 2FLBH 4ZKNU 1YPLH 1S6LA 2FOHA 3GYLB 2PGBB 2GZ8A 2O8TA 3QN7A 1QGFA 3RC5A 5SGAE 1BHXB 4JYVH 3MNSA 3Q3YA 3VB6A 1C5WB 4NZLA 3UR6A 2PGQB 1PPEE 5A09A 2RG3A 2ANWA 3H09A 2SGAA 2GMTB 3TU7H 2D8WA 1FQ3A 1Z71A 2ODPA 4DCDA 1SQAA 2BLQA 1GWAA 3LGUA 3T29A 2BY5X 1GBKA 1Y3WA 4JMYA 4KELA 1FPCH 1PYTD 4I31A 4B71A 3P8OA 5EIYA 3JZ2B 3TPIZ 3MYWA 3L33A 2H2ZA 3DFJA 4AFZA 1AO5A 2J4IA 1E0FD 1GCTB 2PKAB 3Q76A 4BAHB 2HLDD 2BDGA 1FXYA 3FZDA 4B74A 2Q1JA 1PPHE 4WMDA 2VIOA 1GBIA 2WPIS 4FUJA 1KLTA 1BIOA 2JETB 2RDLA 4Y0YE 2ASUB 1G2MA 5C94A 3WY8A 2OLGA 1ETSH 2A7JA 2L74A 1YGCH 4I8GA 3SJOA 1FJSA 4JYTA 3NXPA 5A8YA 1EOLA 1BHXF 1VITG 1O5GH 1P2JA 5HGGA 1SGCA 1TE0A 1P03A 2A2XH 2OUAA 3A8CA 2ZFRH 1ELCA 2EC9H 1OP0A 2YMSC 1MKWK 1MCTA 2VIPA 4XBBA 3D62A 3TJUA 1AKSB 2A5AA 4GHTA 1EFRD 3D23A 3HGPA 1ZMJA 3KYGA 2ZIQH 1TX7A 4Z1MD 1GI1A 4OS7A 1AVWA 1O2PA 2BDBA 4AOQA 2KX4A 1OWKA 1GJCB 2ZPSA 3A85A 2TGAA 1B0EA 1SHYA 4JZDH 3V0XA 4D9QA 5DO4H 3ATMA 1T8LA 3RXGA 3EYDA 3N7DA 3ZZ7A 1V2RT 1Y59T 1WSSH 1D6WA 3F2HA 1SB1H 3RMLH 3AASA 3ZVCA 4OGYA 3SI3H 5AVDA 1ZRKA 2ZHQH 3RP2A 1PPFE 2VWMA 3OY5U 1A5HA 1ZSJA 3NUMA 1KXAA 1CHGA 1V2LT 2KZ4A 2BD9A 3ZZ3A 1S6HA 1C1SA 2W26A 1CBWC 1MU8B 1OS8A 2FM2A 1HXFH 4X8TH 1S5SA 4Y0ZE 2QXJA 2H1UA 1O34A 3SOSA 4X1PU 1P05A 2R3UA 1TALA 3GY3A 2ZHEH 1FIWA 1O30A 3P17H 1CO7E 2BY9X 2FX4A 3KL6A 3OX7U 2BX3A 1UVOA 5DG6A 4FXGH 2ZFTA 1G37A 3GDUA 4NFFA 1YCPH 1MCVA 3RXQA 4BAQB 1C5MD 2HNTF 1O2NA 1T4VH 1SQTA 4H42U 4NSVA 4QT8C 7GCHF 1GI0A 1A4WH 2ZI2H 5HKKD 4TWWA 3QTOH 3SU6A 4Q7ZA 1J9CH 2A7HA 3ATWA 1LDTT 2XCFA 2PKAA 4GCHG 3QK1A 1L2EA 2Y5HA 4I32A 1W0KD 3DCLA 2SNWA 2VVCA 1VCQA 1O5EH 3V13A 4I8KA 5EOKA 2F9VA 3PMBB 1S82A 2V3HH 1GBAA 4GVUA 2ZGBH 2QXHA 1B7XB 1ELAA 1RTFB 1GI5A 1BTPA 1YLNA 3S0NA 3A7ZA 3RU4D 1IQIA 2W7SA 6CHAC 3A80A 3VFEA 4MNVA 1PQ8A 1AY6H 4O97A 1KSNA 3PRBA 1GVZA 1P10A 1UW7A 2GTBA 3E90B 2F9OA 5DP6A 1C9TA 1CE5A 3CS0A 5L6NH 4K5ZA 4MNWA 1GMCG 3SORA 1M9UA 3TJNA 4A1VA 4CRFA 3DSOA 1AKSA 2ZDVH 3TK6A 4ABDA 4K8BA 2Y5FA 4M9FA 1ZPCA 4NCYA 1QRWA 4X1RU 1F5KU 4BAMB 1RGQA 4M7GA 3F2FA 3MWIU 4FU8A 1COWD 1QRZA 1CSOE 2EA3A 4Y76A 2P8OB 2J95A 1LHFH 3LC5A 5C20A 1DWDH 3LPRA 1GCTC 1KLIH 5C0TA 1QCPA 2Y7XA 3SW2B 1SOTA 4GUXA 4Q63A 2OK5A 2GCTB 4AZ2B 4YOIA 2Z9JA 3LOXA 4CR9A 3ATKA 1ZSKA 1BUIA 2RA0A 5FCRA 4OS4A 1MZDA 4WY3A 1TX6A 1SL3A 1MMJN 2ZHDA 3M35A 5GDSH 3F9FA 4IBLH 3RU4E 1C5LH 1T32A 1J17T 2BLOA 3UOPA 4ZXYH 5LPRA 5DGJA 4VGCC 4BAOB 1TGNA 3RC6A 1QZ8A 3GCTG 1HYLA 2JH5D 2V35A 3ENSB 3FVFB 1GG6C 3P6ZB 2JJ1D 1TQ0B 2AIPA 4HFPB 1CT4E 1YC0A 5A2MH 2Y80A 2C8WB 1MD8A 3PV5A 1YLCA 4CH2B 4RI0A 2LP6A 1DXPA 1F0UA 1C1QA 1ZYOA 2HNTC 1KIGH 4OS1A 4Y71A 1O5AB 1GI4A 1TBQH 1UTOA 1WBGB 2C93B 5ESTE 4CHAC 8KME2 1W11U 4UEHH 1HAOH 4X0WU 2RCEA 3A87A 3A8DA 1SLVB 2ZHFH 1S84A 2W3IA 3OE7D 4WH6A 1H8IH 3A7XA 5DK1A 1F5RA 4J2YB 2TGPZ 1BITA 5E2PA 1GBEA 2XBVA 4A1TA 4YXWD 3DD2H 1DSTA 1O2XA 1SG8B 1ZRBA 2PKSB 1BBRH 2W3KA 5E0GA 1C1PA 1XUGA 2SGPE 4YOJA 1BOQA 1TBRH 1T8NA 1VCPA 1BMLA 4PROA 5C17A 4IMQA 4YM9A 4WJG2 3ZZ8A 1C5VA 2NU2E 1Y3UA 2XWBI 4D76A 2J92A 1TGCA 4Z6AH 1UK3A 1GBCA 1GGDC 2FDAA 1WCZA 4TYDA 3LH3A 1ZMNA 5T6FA 4NIWA 2Q6DA 1TLDA 1P2IA 3PLKA 1SGYE 1O2IA 3GCHC 1V2QT 2OC0A 2KAIA 3SJKA 1TPOA 2UWPA 4ABJA 1OXGA 1V2ST 2ZGXH 3TIUA 1TX8A 1BRBE 2G81E 3EDXB 1CA0C 3GCNA 3UNQA 2ZU5A 1YBWA 2P3FH 2CXVA 3QO6A 3B9FH 2L6OA 3IG6B 1DDJA 4TSFD 4TY7A 1DY9A 2ZQ2A 3DFLA 3DA9B 1NBMD 1LPZB 4ZKOU 1SR5C 3K9XB 2AS9A 3SUEA 2UUYA 1TOCB 2QV1A 2V6NA 1NPMA 5GPIB 4CBNA 5HIYA 3TH3H 2WSSD 3EA9A 3SHAH 1W12U 1MQ6A 1TNLA 1HUTH 1P2KA 1GJ5H 2QN5T 5E2OA 4ABBA 4P00A 2G4UA 1OOKB 3RXAA 4ZKRU 4GAWA 2VIWA 1ARCA 3GY6A 3CP7A 1A2CH 4NGAH 1MUEB 3BTDE 4D9RA 3BTTE 2P16A 4JZFH 3SJIA 3ZVEA 3ZYDA 2YMSD 5KECA 1T31A 1Z6EA 1MTVA 1SC8U 1YF4A 3HKIB 4O03A 5FHTA 1SVPA 4O9VA 1E34B 1SGNE 3FAOA 1DM4B 3S69A 2BVSH 2V3MA 1LMWB 4BANB 5E0JA 1C2IA 2QF0A 2ZQ1A 4BTTB 3RXSA 4A5TS 5LH8A 4NIVA 4H4FA 1A0JA 4FOUC 3OYPA 1ORFA 1ZGVA 1CQQA 5EXLA 2HALA 1WQVH 2ZP0H 5L2ZH 2R2WU 1G3BA 1VJ9U 5F8XA 1V2KT 2R9PA 1AU8A 3BTWE 2JH0D 4H6TA 2GCTC 2VH0A 1EQ9A 1TPSA 4AFUA 1O2MA 3BSQA 1D3DB 1C5TA 2HPPH 3ZIAD 1ARBA 2C4FH 2J34A 3SNCA 3UY9A 3RXIA 1HV7A 1S0RA 5LGOA 5EW2H 1WOFA 2QGRA 4NIXA 5HMAA 1BTYA 1IQMA 2TPIZ 3TH4H 2XNDD 3Q77A 1AVGH 1O2RA 1QTFA 2I6QA 1YY3A 2OD3B 3M5LA 1ZJKA 4O3TA 1ZTJA 1EP5A 2FX6A 2GX4A 1XKBC 5F8ZA 2YMSB 1F7ZA 2BY7X 4F4OC 1LHDH 1HFDA 2AERH 1F0SA 1C2FA 1YCPK 1K2I1 2ZU4A 1J15A 1Y5AT 1TAWA 1BQYA 1HAIH 2D2DA 4AX9H 2GGVB 3IITA 4X2XA 3AW0A 5ETXA 9LPRA 2GCHG 3SU2A 3RXCA 4Y10E 5TJXA 2ZPRA 3URDA 2QA9E 4INLA 2C90B 1ELEE 2TGDA 3KQBA 3SHCH 5C2ZA 1ZR0A 1SQOA 5FBEA 3OFND 5FAHA 4YESB 4KP0A 2BVXH 5K7RA 1K9OE 5EXNA 1KXDA 1XUFA 1ZPBA 1C2DA 1HDTH 4ACAA 1N8OC 4AORA 1C9PA 1TPPA 3M7QA 1O2VA 4X6OA 8ESTE 1Y8TA 3DUXH 1ABIH 3PTNA 1O5CB 3ATIA 1P04A 2VU8E 5AFYH 1UO6A 2EI8A 3TJOA 1RD3B 5HIZA 5DPAA 2CJIA 5EJ1A 4Q7XA 3LKWA 1N6XA 4A6LA 2P3TB 5BRRE 1CBWB 1JMOH 1G3DA 1TMBH 2EEKA 3OTJE 1P06A 2HGTH 3PTBA 1BTWA 5A8XA 3JZ1B 3VEQB 1K1PA 1NFWA 5I25A 1ABJH 1FY1A 2FOEA 3NWUA 4CRCA 5C0UA 3SU3A 3QZQA 3TNSA 2B8OH 3E6PH 2VIQA 5B6LA 1C5SA 4LK4A 1H9IE 3UOUA 2BDAA 1L4DA 1EB2A 1C4Y2 4Y7AA 2VIDA 1FAXA 1GJ7B 1GL0E 2QC2A 1D3QB 2R2MB 1KYNA 4JYUH 3S9AA 1EASA 1NRRH 1WTGH 2P3UB 2ZCLP 4WH8A 3VB7A 3I77A 2ZF0H 3K6YA 2FYQA 3N7EA 2RFKC 4X2VA 2JKHA 5CDFE 2P93A 1W10U 4E06H 1WQSA 5A8ZA 1C2GA 4AB8A 1WTHD 2WV5A 1KMHB 3FOAA 1GMHG 2FTMA 2Z9IA 3C1KA 3UPEA 1S83A 1WXRA 4K2YA 3AW1A 2GD4B 3A82A 3MO9A 1BRCE 1HCGA 3UNSA 2FWWA 2GT7A 3SYJA 4DOQA 3E8LA 1HJAC 1G9IE 2ZGCA 3SV7A 1JOUB 1GDNA 1PFXC 5EU8A 3TK9A 6CHAB 5C67A 5EQQA 2BQ6B 2O8UA 2F9UA 3MU4A 2BD3A 3K6ZA 2FOAA 2WPJS 5DP7A 1C5RA 3E3TA 1PQAA 2ZFPH 2PUQH 3SU0A 2FPZA 2Z94A 1O36A 2H5CA 2IPQX 4ISNA 1GI8B 2BX4A 2WINI 4R0IA 5E8EH 5EPNA 1BTHH 1NT1A 2IJOB 1P2QA 2W7UA 4XE4A 3GICB 4I8HA 2O8WA 3ZZAA 4CRAA 4MPVA 3STJA 1DS2E 4AFSA 1SQRA 2ZCHP 2AGEX 1FY3A 3M3SA 5F6MA 4I33A 2OC8A 2NWNA 1EX3A 3RXDA 1Y3XA 1SFIA 1BBRK 3ZYEA 4MQAA 4FVDA 5HYOA 1ZGIA 1W0YH 4X6MA 1GJBB 3HATH 1BRAA 4AGKA 1GJ8B 1W3CA 3A86A 3RXJA 2BB4A 2GKVE 1LCYA 2LPRA 3TGJE 1GMHF 4I8LA 1K1MA 3SU4A 5IK2D 3BIVH 2W6ID 1VR1H 1E79D 1C1VH 5FX6A 1EUFA 1AIXH 3PRDA 1TMUH 3BTKE 4Y8ZA 4X1QU 4D8NA 4Q4LA 4VGCB 1HAGE 2PTNA 4X1SU 1AUTC 1SFQB 5IYTA 4MG3A 1O2OA 4IGDA 1EATA 5J4QA 3GDSA 1YPMH 1GG6B 1TIOA 1FI8A 3KNXA 5T6GA 1YPHC 1A7SA 4B2BA 1K21H 2BD5A 2ZA5A 2XYAA 1HAYB 3NCLA 2FLRH 4MPUA 7GCHG 2BLVA 2SGEE 1Z8IB 3M7TA 4DY7B 3U8TH 1W0ZU 1RIWC 5T3HA 4RSPA 5BPEA 2XC0A 2JDID 4CHAB 1EPTC 4OGXA 4IC6A 1ZTLA 1QHRB 2AH4X 1YM0A 3KEEA 1C4U2 4XOJA 2YNBA 1VZQH 2XWAA 3U1JB 1H1BA 2BLWA 2FOCA 2ZDKA 1DITH 1F5LA 3LIWA 5HM2A 1O3JA 3SV8A 3MI4A 3T2NA 4ZHLU 1DXWA 3LJJA 4X8VH 4YO9A 2G5VA 2JH6D 2DE9A 1C1OA 2VBCA 1PPCE 5AHGH 1RRKA 2FXRA 1CT0E 1SBWA 3SGQE 1VCWA 3T25A 1TGTA 1KXEA 2FEQH 7ESTE 2VWNA 1P02A 1ELBA 4XDEA 3E0NB 2I6SA 2J5UA 2Z3CA 1GGDB 5C5NA 1JBUH 2AYWA 3HK3B 1ELTA 1UK4A 4INKA 1L1JA 2LNCA 3SUFA 3BF6H 1NRSH 2V0BA 3LH1A 4FUIA 3GCHB 5HM9A 5GJ4B 3P95A 3TITA 1O2HA 1XX9A 3MQKC 1Y5UT 1QURH 1IQHA 3F0PA 4FU7A 2VNTA 1UVPA 3F2GA 4TWYA 2AIQA 3SNEA 5EG4A 3SV6A 1ZHRA 2XOKD 3M61U 1CA0B 1SLWB 1SI5H 1OSSA 5C1UA 2PFEA 1NM6A 1AVXA 5EQRA 2XBYA 2BD2A 4Z0KA 4X8SH 1UTLM 1IQEA 3R0FA 4ZH8A 1QL8A 3A8BA 4CBOA 1O3LA 5EQSA 1O2JA 2FESH 1NY22 3AAVA 3N7OA 3OAAD 1UCYE 2AMPA 1ANDA 1A1RA 1NZQH 2J2UA 5JBAS 1KLJH 1C5UA 4UFGH 1TA6A 1W2KH 2VVVA 3TLOA 4ABIA 4X6NA 1F0RA 2CK3D 3T62A 1QY6A 1GHXH 1GI7B 4NZQA 4YT7H 1EZQA 1RTKA 1RFNA 2ZFQH 1J14A 1HAZB 4NA7A 3OSYA 1V2UT 4XFQA 2VVUA 2XNIA 1Z1IA 3MTYA 3RXKA 4E05H 1DLEA 1L1GA 3P8GA 2AGGX 1FY4A 1O3OA 2UUFB 3M3TA 4TT3D 1EJNA 4ZAEA 4CR5A 1NRQH 1AFEH 4MNXA 1KXFA 5K0HA 2GDEH 1TNGA 2K0QA 1AI8H 2EI7A 1H8DH 1K28D 1NROH 1DWCH 4E7RG 3GY7A 1XVOA 1O3AA 1GL1A 3ZVDA 1T8MA 3KF2A 1DLKB 5C5OA 2XXLA 2TIOA 4CRBA 1IAUA 2XBXA 3HKJB 1Z8JB 3QDZB 3UTUH 2PV9B 2ZKSA 1KTTB 2CF8H 2BD7A 1ZZZA 1XXFA 1UVUH 1HAXB 1TONA 5IDKA 1O32A 3A83A 4ISOA 5CE1A 2EI6A 4DG4A 1GJ6A 2BDIA 1KDQB 2F3CE 5GXPA 2A7CA 5C1XA 1S85A 4ISIH 5DP9A 2F9NA 1C5OH 3RLYH 4GHQA 4BTIB 3MNCA 4UFDH 4AG2A 3A7WA 3UFAA 1K1LA 1TGSZ 1TNKA 2OC7A 1F92A 2ANMH 2BDCA 1QIXB 3RXEA 1BJUA 4UDWH 1XMNB 2ZC9H 2FP7B 1D9IA 3GY4A 1C1WH 3RMOH 3F9GA 3E16B 2BVRH 1V2MT 2ZG0H 2FS9A 3MH5A 2ZECA 1Y5BT 4OS2A 3GY5A 4B73A 4JZIA 3RDZA 4MDSA 3LGIA 2G4TA 2J38A 4XSKU 1N6YA 4RT1A 1N8OB 3GYMA 1QQUA 1PYTC 4FUCA 4ISHH 2VB0A 2HOBA 3FKSD 1PPBH 3PYHA 4AFQA 1HJ8A 5F53A 4SGAE 1P2MA 4I86A 4RKOB 4DGJA 1FN6A 2A0QB 1H8HD 1LVOA 3F68H 5FPTA 1AWHB 1LPKB 3QZRA 1FY8E 1P57B 1EOJA 3PLPA 1NO9H 1QJ6B 1ZJDA 4RKJB 2A4QA 1H9LB 1T4UH 1X7AC 5AF9H 2XC5A 1EAUA 2P59A 1LVYA 1O2SA 3MO3A 1JWTA 1N1LA 1NRNH 1TRMA 2YOLA 5B6OA 2C8YB 1HGTH 1GDUA 1MTWA 2GV6A 2W5EA 3I78A 4JK6A 3S9BA 1SLUB 4B76A 1BT7A 3RXHA 3U8RH 2WUCA 1ELFA 1C5ZB 2F83A 2RA3A 1SGFG 1O3FA 2G00A 4ABHA 5LPFA 3T28A 3S9CA 2OBOA 5EW1H 2WPMS 2GZ9A 4MPXA 4F48B 4KTUA 3VB4A 3EAJA 4XRNA 3WWFA 4CREA 4X6PA 2ZTXA 3W95A 4X8UH 1BZXE 4FUEA 1ELVA 1IHSH 2CHAC 2OP9A 3RXTA 1C1RA 1UJ1A 1A3EH 1A46H 1HJ9A 3ESTA 3PV4A 2UWLA 1ELDE 1YPKH 1ANCA 3NZIA 1IQKA 1ANEA 4GPGA 1O38A 2ZU3A 1W7XH 1V2NT 2K8IA 4LOYH 2PHBA 3A88A 1BTUA 2GVFA 1B5GH 2BM2A 1O3IA 3UR9A 1LHEH 2Y81A 1HJAB 1P8VC 3OEHD 5DJ7A 3G01A 3KN2A 4FU9A 2G8TA 2Y82A 1EZUC 1MTNC 1AZ8A 1YYY1 3DSPA 1L0ZA 2YNAA 3O8BA 1V2JT 1BA8B 5DP8A 2ZU2A 4THNH 2G55A 1KTSB 2SNVA 3BN9A 2PUXB 2BOHB 2RDEA 2VJ1A 2ZEBA 4U30A 3C27B 3LDXH 3SNBA 3A7YA 1YKTA 3DSGA 4HI3A 1KDQA 1EKBB 1QB6A 3UWIA 5L2YH 1OPHB 2Y5GA 1C5XB 1EAWA 1MQ5A 2QXIA 3P70B 2HVYB 1G2LA 1PQ7A 3VG8A 4XBCA 3S7HB 4DJZB 1Z7KA 2HRVA 3W94A 3FP8E 2Z9LA 4OS6A 1TABE 4DIHH 1W14U 4P02A 1L4ZA 2ANYA 5DP5A 2FIRH 1HRTH 1O3NA 3VGCC 2BZ6H 1IQNA 1GBJA 1DWEH 4D7GA 4Q80A 3MU5A 1NBME 2A45B 1C5PA 5PTPA 3WW7A 1GBBA 1ID5H 4OS5A 3F6UH 2QF4A 1F2SE 2Z7FE 1GI6A 1UTJA 1QR3E 2AMDA 2BZAA 2WPDD 3UWJH 1V2PT 1P09A 5T6DA 1TB6H 3FZZA 1GJ4H 1MD7A 2XTTB 4HTCH 2OINA 4MVNA 1SOZA 2A4GA 1AGJA 1CGIE 1GBMA 2G5NA 2QCYA 3BG4B 2VWLA 2WPLS 3RLWH 5A0BA 1GI9B 2A5IA 2AEIH 1EAIA 2ZGHA 1GHZA 5EGMA 3F9EA 4WXIA 1FONA 3BIUH 3A84A 1LKAA 1GVKB 4NA8A 2HLCA 1CA8B 5AFZH 1NFYA 2UWOA 4ABAA 4ZHAA 1MAXA 3MNXA 4Q2KA 6GCHF 1JRSA 3VPKA 1NS3A 1FAKH 2ZCKP 3OTPA 4JZEH 4ZKSU 4YTAA 1OP8A 5FBIA 2R0LA 1LKBA 2ZDNA 6ESTA 1NFXA 3PV2A 3SGBE 1ELGA 3RXLA 1ACBE 3MO6A 2FOFA 3HK6B 1MTSA 1RIWB 3BTME 1LQEA 2WPHS 2Y7ZA 2WYGA 1EPTB 1G32B 1UK2A 2BD8A 1RTLA 5JBBS 5T1VA 1P9SA 1UTNA 4AB9A 5J4SA 2KCOA 5JBTA 3UIRA 2CMYA 3SNAA 4ABGA 2FOGA 3T27A 1TQ7B 1P0SH 3SNDA 1HAHH 2R3YA 2SFAA 2ALVA 2EQNA 4FUGA 3SU1A 2ZDLA 1O5BB 1UTPA 1FIZA 5TCCA 3AK5A 1SHHB 1YPJH 1K1NA 1MABB 5EJLA 2ZGJA 1V2TT 1BRUP 4INHA 1GHVH 1IQLA 2VINA 4K8YA 3RC4A 3RXUA 3FP6E 1ANBA 3SO3A 2DE8A 3MH7A 4A92A 4B6FA 4DIIH 3UAIC 1OYQA 3UQVA 1D4PB 3M3VA 2O8MA 2FI4E 1NN6A 4WVPE 1GBDA 2IN2A 2D26C 3OY6U 3MU8A 2UUJB 3KYFA 1SMFE 2GJGA 5FXLA 2G52A 3CNRA 1YP9A 1TNJA 4MNYA 1NFUA 5A0AE 1FDPA 2AHME 4BNRA 1C5NH 1BDAA 1XUIA 3PM3A 3PWCA 3BG8A 1L1NA 2FI5E 1IHTH 1LHGH 3DT0H 3ZZ5A 2VWOA 1SGTA 4TPYA 4YLUA 5HXFA 3ZVBA 1GHWH 1DE7H 2A32A 1C2EA 1QA7A 2WV4A 3QTVH 1DX5M 2ZFFH 1YWUA 1GBLA 3LGTA 4WWYA 3K2UA 4HZHA 1DICA 1GHBG 2BYAX 3RM2H 2A2QH 1P12E 3Q00A 3SUDA 1DY8A 3UQOA 5KEDA 3MHWU 2C3SA 1OP2A 3K65B 4ESTE 3QUMP 5ABWA 1GMDF 1RJXB 4X2YA 3RXMA 1OWEA 3BEFB 1Y3YA 3ZV9A 1O3DA 1MZAA 1YCPM 1JIMA 1W0JD 4RN6A 1D6RA 1QB9A 4ABFA 2A5KA 1CGHA 2PTCE 3LONA 4F49A 1BMMH 5DP3A 1HAVB 1OWHA 1O3EA 1G36A 3M5MA 3U9AH 4A1XA 1OKXA 1AE5A 1NTPA 1GHYH 3V7TA 5JBCS 2Z9KA 3KQCA 2BMGB 1P3CA 2C8ZB 2BQ7B 1S81A 1C2MA 2AGIX 1CHOG 1AB9C 1DVAH 2TGTA 3M5NA 3B8JA 1DPOA 1O2LA 1T8OA 1O33A 4FUFA 1TYNA 1AE8H 2ZTZA 1KY9A 5JPMH 4TPIZ 1XXDA 2NU4E 3VB5A 1SGPE 1C1NA 1EPTA 3SN8A 3LGWA 1ZOMA 1C5QA 3LGVA 1QNJA 4NWLA 3MOCA 1GI2A 1ESBA 3GOVB 2J94A 3EGKH 4NIYA 1GHBF 4YOGA 5EXMA 3CS7A 3AVZA 4IN1A 3ZZ6A 3L6PA 2Z3EA 2QXGA 2ALPA 3BG4C 4ISLA 1H8ED 4Y79A 3OU0A 3STIA 1QFKH 4MLFB 1QJ1B 4ACBA 3M5OA 3QWCH 4NWKA 5FL7D 1EZXC 1EAXA 3A81A 4I7YH 1HBTH 2KCAA 3BTHE 4BXWA 1WYKA 3U8OH 2O8LA 1CT2E 4IC5A 1XUHA 2WYJA 2B0FA 1JXPA 3L3TA 3W1EA 5JB8S 3QGJA 5CHAC 1O2ZA 4IS5A 5LPEA 1QBVH 1XM1A 3SV2H 1O2WA 2VH6A 3A7VA 2FS8A 4K60A 9ESTA 2BY6X 3SGAE 1UTMA 2PSXA 3SBKA 3PWBA 3LJOA 2ZO3H 1GVLA 1O39A 3TNTA 2QF5A 1CHOF 2HNTE 1THPB 2H9TH 1ZMLA 2J98B 2F43B 2Q6GA 3RXVA 2STAE 3TK5A 3QLPH 3BTGE 1OWIA 2P95A 1E1RD 5L30H 3M37A 3SU5A 4UONA 2EY4C 1WUNH 3NPSA 3MU0A 3T26A 3ODFA 3P92A 1SGIB 3MNBA 4K3JA 1QL9A 1H9HE 3TH2H 5CMXH 4AYYB 1Z8GA 1G30B 1SGEE 1ZPZA 2V7QD 3E1XB 4Q7YA 1A0HB 3M7UA 1WAYB 2IPHA 3PMHB 4DT4A 5JDUB 4B2AA 5JYIA 1AD8H 2H5DA 1DWBH 2Z3DA 1QQ4A 5FPSA 2TRMA 2TBSA 4K1EA 4JZ1A 5KGOA 1C2HA 5A0CA 1DUAA 4AN7A 1YPEH 1HAVA 1K1JA 2CV3A 4LZ1H 2H9EH 1SLXB 1TRNA 3BEUA 1OYTH 1QA0A 1E38B 3RXRA 3ZZDA 3RUOA 1PQ5A 5DN6D 1LHCH 4AYVB 1T7CA 3BTQE 2PR3A 4KTCA 1TFXA 1SKYE 1VITF 2KFWA 2OC1A 3FO8D 3T5FH 1GHAG 3LU9B 1XVMA 2CHAB 4DT7B 1O3BA 2F91A 5DSFA 3HGNA 2Z6BD 4UD9H 2F9BH 1FUJA 1YLDA 3PB1E 1AFQB 1KXBA 3MMGA 3EA8A 2OBQA 1BMNH 3ODDA 2M2AA 1QRXA 3GDVA 4AGJA 2FZZA 3V12A 4UE7H 3KGPA 1U6QA 1FZZA 1A5IA 5F8TA 1MTNB 2HWLB 3PO1C 1O2UA 3Q3XA 2FI3E 3UB0A 3WWBA 2R0KA 1V2VT 1BJVA 1O35A 1MKXH 2HPQH 1MTUA 2ILNA 5C1YA 1AMHA 1O3GA 2BTCE 1EJAA 8LPRA 2NU3E 1C2JA 1XUJA 4Y8YA 4K1SA 1UMAH 1FLEE 1BCUH 1TMTH 1ZHPA 5FX5A 1EXFA 3B23B 3SJ9A 4NFEA 1DOJA 2GZ7A 4A7IB 2WHXA 1NU9A 1O5DH 2J97A 2KAIB 2OQ5A 4AC9A 4IN2A 2GMTC 3S7KB 3VGCB 1VGCB 2KCYA 2A4RA 1LPGB 3A89A 1C2LA 1Q31A 1GHAF 1ZTKA 2SGFE 3LGYA 3KIDU 3HPTB 2BXTH 3RXPA 1G3EA 3VB3A 3RMNH 2J98A 1FNIA 1UTKA 2K1QA 1VJAU 1TOMH 3FANA 4NG9H 2ZPQA 4O3UA 3BV9B 1EB1H 2IOTA 1O3MA 3TGIE 1D3PB 2PWXA 1QJ7B 1MH0A 3ZZCA 1IQGA 1S0QA 2QYIA 3F0OA 4LZ4B 1B0FA 3TGKE 1P2OA 1PPGE 4RT0A 1PPZA 4YZUA 2KM0A 3AAUA 1C4V2 4KGAA 1FN8A 2OCVB 4GCHF 3H5CB 2JETC 4ZXXH 2D1JA 1V3XA 4UFEH 1FY5A 1SSXA 2ZHWH 2BXUH 4UFFH 1E1QD 4ZHMU 4B2CA 2XCNA 1BMFD 1OWJA 4ASHA 4Y6DA 1TNHA 3H7TA 4HG6A 2ODYB 1BMAA 4AG1A 1HNEE 4J1YA 4SGBE 4FUBA 3ZVGA 2IJD1 2WZQA 4WMEA 1WU1A 4NSYA 2GT8A 1UCYK 4FUDA 4WMFA 1GJAB 2ZTYA 2KR7A 1ETTH 1W8BH 3SQEE 4CH8B 2JIZD 1LQDB 2NU0E 2B9LA 5FCKA 3LC3A 1RXPA 3EE7A 1FMGA 2A31A 1DANH 1LVMA 2UUKB 4ZMAH 1LVBA 1GMCF 1WDIA 2VGCB 1UTQA 3P8NA 4B75A 3O8CA 2B7DH 3PMJA 3FFGA 4YT6H 1FPHH 3UUZA 2ZZUH 1ZSLA 5GCHG 2Z9GA 3GY8A 1DSUA 1SGDE 1O2YA 3F1SB 1TRYA 1E37B 2W6JD 1C1UH 1JRTA 4X2WA 3RXBA 3ELAH 3GS9A 2XW9A 1F0TA 5ESBA 3P8FA 3N99A 1C5YB 4K69A 1Q2WA 3RU4T 1OHHD 1TA2A 4ABEA 3GCOA 4NA9H 3SV9A 1SGQE 3LT3A 3RMMH 3E91A 3CENA 1O3CA 4U2WA 4Y11E 4B1TA 4H6SB 1GJ9B 2ESTE 1HXEH 2GDDA 4U01A 2B5TB 4HGCA 1VKYA 4E7NA 1GJDB 3RXOA 2LELA 2BOKA 4CRDA 1THSH 1TNIA 1UHBB 2F9PA 4U32A 1C2KA 2HVXA 2OTVA 2THFB 3O8RA 3GCTF 1IOEA 4CRGA 4ZUHA 2ZWLH 1MKWH 4WXVA 1ETRH 1V2WT 1AFQC 2WV9A 3M36A 5EPYA 3BEIB 1H4WA 3QGNB 3ATLA 3SZNA 3SI4H 3R3GB 5GIBA 2A1DB 1C1TA 2FMJA 1S6FA 1P01A 3I29A 1Z1JA 1OX1A 3BTFE 1HPGA 6LPRA 4B6EA 3GISB 3RM0H 5GCHF 3PROA 1AHTH 1IQJA 1O3PB 1BTXA 3KCGH 2ZNKH 3EE0B 3KQEA 5FPYA 1SPJA 1O0DH 1TGBA 3V3MA 6GCHG 5GWZA 2OQUA 4Y8XA 1GI3A 2STBE 1FV9A 2FODA 3D65E 1HIAB 1ZLRA 2ULLA 5GNDA 4MTBA 4ZCNA 2C8XB 1E35B 1QL7A 2Q6FA 1HAPH 3U1IB 3ZZBA 8GCHG 1W13U 4KKDA 2PW8H 1KXCA 1O2KA 1AB9B 3UNRA 2CF9H 1GBHA 4FUHA 2QF3A 4Y7BA 1TBZH 4BAKB 3F9HA 3D49H 3TVJB 1P3EA 1VGCC 1TPAE 2WPKS 3E0PB 1P9UA 2CGAA 2O9QA 3BTEE 2QY0B 2H9HA 2ZDMA 4DURA 2QIQA 3ZVFA 4OM9A 1JIRA 1K1IA 1O2QA 3NK8A 1LO6A 4IW4E 2P8OC 1P2NA 3MFJA 1GPZA 1O37A 2BD4A 5CHBA 2ZFSA 2V3OH 3KQDA 1MBMA 2ZDAH 1UVTH 2AFQB 1QB1A 1J8AA 1D3TB 3FP7E 1VITH 1QBNA 3PMAB 3EA7A 5H4IB 1A5GH 2DUCA 2KCPA 7KMEH 2FO9A 1UVSH 4XD7D 2PP6A 2G51A 1DT2A 1TWXB 3SZEA 4FVBA 5DKMA 1HB0B 3VXFH 2ODQA 3MU1A 2F4LA 4BOHA 5E0HA 5DP4A 5EODA 1QBOA
chains in the Genus database with same CATH topology
1ESAA 2BHGA 4DVAU 4JK5A 5JB9S 4XBDA 5CHAB 1YPHE 1A3BH 7LPRA 3RXFA 2XBWA 4BXSA 1CU1A 2XRCA 1PJPA 3IWMA 2CN0H 3DHKH 2M5TA 2NU1E 1GCDA 1SGFA 2GV7A 8GCHF 1AN1E 4D7FA 1K22H 1O3HA 4LXBH 1V6DA 3NKKA 1Q3XA 1XKAC 2J9NA 1UHBA 2PSYA 4K1TA 1O2GH 1V2OT 1DUEA 5C3NA 2VGCC 2XC4A 3U69H 3A8AA 4IMZA 1EZSC 1O5FH 1MAYA 1GMDG 1GDQA 3ZVAA 1HLTH 1C1MA 1MKXK 1Z6JH 2FOBA 3A7TA 2Y6TA 1E36B 1NU7B 1BB0B 1K1OA 2A4OA 1NRPH 4BTUB 2OXSA 4TY6A 1A61H 5F03A 3H7OA 1DFPA 1AZZA 3TJVA 3VXEH 4I8JA 1G3CA 2FTLE 2WUBA 2SGDE 2PKSC 3GY2A 4R8TB 1MBQA 4WF8A 3O8DA 2AMQA 3SUGA 1OWDA 4X1NU 3ZZ9A 3ZV8A 1O2TA 5G4BA 1WV7H 2ANKH 2BQWB 4DW2U 1INCA 3SQHE 1HIAA 1CVWH 1GBFA 3ZZ4A 4MPWA 1AQ7A 1BBRE 2BDHA 2BDYA 1MU6B 1SGRE 1NC6A 3EQ0H 1EJMA 3PLBA 3URCA 2FYRA 1RS0A 1UCYH 1AWFH 3MH4A 1EP6A 1THRH 2ZU1A 5TCAA 1AUJA 2PLXA 3QX5H 4KTSA 3SJ8A 3U98H 4YLQH 1BTZA 4GSOA 1W7GH 1Y3VA 2H6MA 1Z8RA 4ZROA 3MH6A 1XUKA 1NESE 1ZHMA 3Q3KA 1GBTA 2BY8X 2GCHF 3KHVA 4JCNA 1O3KA 2VIVA 1J16A 1A0LA 1P11E 1IQFA 2GP9B 3UREA 1ESTA 3PO1B 2P94A 2FOMB 3ITIA 1LTOA 2QAAA 5I46H 1YPGH 4GLYA 1CGJE 2SGQE 1O31A 2FLBH 4ZKNU 1YPLH 2FOHA 3GYLB 2PGBB 2GZ8A 2O8TA 3QN7A 1QGFA 3RC5A 5SGAE 1BHXB 4JYVH 3MNSA 3Q3YA 3VB6A 1C5WB 4NZLA 3UR6A 2PGQB 1PPEE 5A09A 2RG3A 2ANWA 2SGAA 2GMTB 3TU7H 2D8WA 1FQ3A 1Z71A 2ODPA 4DCDA 1SQAA 2BLQA 1GWAA 3LGUA 3T29A 2BY5X 1GBKA 1Y3WA 4JMYA 4KELA 1FPCH 1PYTD 4I31A 4B71A 3P8OA 3JZ2B 3TPIZ 3MYWA 3L33A 2H2ZA 3DFJA 4AFZA 1AO5A 2J4IA 1E0FD 1GCTB 2PKAB 3Q76A 4BAHB 2BDGA 1FXYA 3FZDA 4B74A 2Q1JA 1PPHE 4WMDA 2VIOA 1GBIA 2WPIS 4FUJA 1KLTA 1BIOA 2JETB 2RDLA 4Y0YE 2ASUB 1G2MA 3WY8A 2OLGA 1ETSH 2A7JA 1YGCH 4I8GA 3SJOA 1FJSA 4JYTA 3NXPA 5A8YA 1EOLA 1BHXF 1VITG 1O5GH 1P2JA 5HGGA 1SGCA 1TE0A 1P03A 2A2XH 2OUAA 3A8CA 2ZFRH 1ELCA 2EC9H 1OP0A 1MKWK 1MCTA 2VIPA 4XBBA 3D62A 3TJUA 1AKSB 2A5AA 4GHTA 3D23A 3HGPA 1ZMJA 2ZIQH 1TX7A 1GI1A 4OS7A 1AVWA 1O2PA 2BDBA 4AOQA 1OWKA 1GJCB 2ZPSA 3A85A 2TGAA 1B0EA 1SHYA 4JZDH 3V0XA 4D9QA 5DO4H 3ATMA 1T8LA 3RXGA 3EYDA 3ZZ7A 1V2RT 1Y59T 1WSSH 1D6WA 1SB1H 3RMLH 3AASA 3ZVCA 4OGYA 3SI3H 5AVDA 1ZRKA 2ZHQH 3RP2A 1PPFE 2VWMA 3OY5U 1A5HA 1ZSJA 3NUMA 1KXAA 1CHGA 1V2LT 2BD9A 3ZZ3A 1S6HA 1C1SA 2W26A 1CBWC 1MU8B 1OS8A 2FM2A 1HXFH 4X8TH 1S5SA 4Y0ZE 2QXJA 2H1UA 1O34A 3SOSA 4X1PU 1P05A 2R3UA 1TALA 3GY3A 2ZHEH 1FIWA 1O30A 3P17H 1CO7E 2BY9X 2FX4A 3KL6A 3OX7U 2BX3A 1UVOA 5DG6A 4FXGH 2ZFTA 1G37A 3GDUA 4NFFA 1YCPH 1MCVA 3RXQA 4BAQB 1C5MD 2HNTF 1O2NA 1T4VH 1SQTA 4H42U 4NSVA 4QT8C 7GCHF 1GI0A 1A4WH 2ZI2H 4TWWA 3QTOH 3SU6A 4Q7ZA 1J9CH 2A7HA 3ATWA 1LDTT 2XCFA 2PKAA 4GCHG 3QK1A 1L2EA 2Y5HA 4I32A 2SNWA 2VVCA 1VCQA 1O5EH 3V13A 4I8KA 5EOKA 2F9VA 3PMBB 1S82A 2V3HH 1GBAA 4GVUA 2ZGBH 2QXHA 1B7XB 1ELAA 1RTFB 1GI5A 1BTPA 3S0NA 3A7ZA 3RU4D 1IQIA 2W7SA 6CHAC 3A80A 3VFEA 4MNVA 1PQ8A 1AY6H 4O97A 1KSNA 1GVZA 1P10A 2GTBA 3E90B 2F9OA 5DP6A 1C9TA 1CE5A 3CS0A 5L6NH 4K5ZA 4MNWA 1GMCG 3SORA 1M9UA 3TJNA 4A1VA 4CRFA 1AKSA 2ZDVH 3TK6A 4ABDA 4K8BA 2Y5FA 1ZPCA 4NCYA 1QRWA 4X1RU 1F5KU 4BAMB 1RGQA 4M7GA 3MWIU 4FU8A 1QRZA 1CSOE 2EA3A 4Y76A 2P8OB 2J95A 1LHFH 3LC5A 5C20A 1DWDH 3LPRA 1GCTC 1KLIH 1QCPA 2Y7XA 3SW2B 1SOTA 4GUXA 2GCTB 4AZ2B 4YOIA 2Z9JA 3LOXA 4CR9A 3ATKA 1ZSKA 1BUIA 2RA0A 5FCRA 4OS4A 1MZDA 4WY3A 1TX6A 1SL3A 1MMJN 2ZHDA 3M35A 5GDSH 3F9FA 4IBLH 3RU4E 1C5LH 1T32A 1J17T 2BLOA 3UOPA 4ZXYH 5LPRA 5DGJA 4VGCC 4BAOB 1TGNA 3RC6A 3GCTG 1HYLA 2JH5D 2V35A 3ENSB 3FVFB 1GG6C 3P6ZB 1TQ0B 2AIPA 4HFPB 1CT4E 1YC0A 5A2MH 2Y80A 2C8WB 1MD8A 1YLCA 4CH2B 1DXPA 1F0UA 1C1QA 1ZYOA 2HNTC 1KIGH 4OS1A 4Y71A 1O5AB 1GI4A 1TBQH 1UTOA 1WBGB 2C93B 5ESTE 4CHAC 8KME2 1W11U 4UEHH 1HAOH 4X0WU 2RCEA 3A87A 3A8DA 1SLVB 2ZHFH 1S84A 2W3IA 4WH6A 1H8IH 3A7XA 5DK1A 1F5RA 4J2YB 2TGPZ 1BITA 5E2PA 1GBEA 2XBVA 4A1TA 3DD2H 1DSTA 1O2XA 1SG8B 1ZRBA 2PKSB 1BBRH 2W3KA 5E0GA 1C1PA 1XUGA 2SGPE 4YOJA 1BOQA 1TBRH 1T8NA 1VCPA 1BMLA 4PROA 4IMQA 4YM9A 4WJG2 3ZZ8A 1C5VA 2NU2E 1Y3UA 2XWBI 4D76A 2J92A 1TGCA 4Z6AH 1UK3A 1GBCA 1GGDC 2FDAA 1WCZA 4TYDA 3LH3A 1ZMNA 5T6FA 4NIWA 2Q6DA 1TLDA 1P2IA 3PLKA 1SGYE 1O2IA 3GCHC 1V2QT 2OC0A 2KAIA 3SJKA 1TPOA 2UWPA 4ABJA 1OXGA 1V2ST 2ZGXH 3TIUA 1TX8A 1BRBE 2G81E 3EDXB 1CA0C 3GCNA 3UNQA 2ZU5A 1YBWA 2P3FH 2CXVA 3QO6A 3B9FH 3IG6B 1DDJA 4TY7A 1DY9A 2ZQ2A 3DFLA 3DA9B 1LPZB 4ZKOU 1SR5C 3K9XB 2AS9A 3SUEA 2UUYA 1TOCB 2QV1A 2V6NA 1NPMA 5GPIB 4CBNA 3TH3H 3EA9A 3SHAH 1W12U 1MQ6A 1TNLA 1HUTH 1P2KA 1GJ5H 2QN5T 5E2OA 4ABBA 3RXAA 2G4UA 1OOKB 4ZKRU 4GAWA 2VIWA 1ARCA 3GY6A 3CP7A 1A2CH 4NGAH 1MUEB 3BTDE 4D9RA 3BTTE 2P16A 4JZFH 3SJIA 3ZVEA 3ZYDA 1T31A 1Z6EA 1MTVA 1SC8U 1YF4A 3HKIB 4O03A 5FHTA 1SVPA 4O9VA 1E34B 1SGNE 3FAOA 1DM4B 3S69A 2BVSH 1LMWB 4BANB 5E0JA 1C2IA 2QF0A 2ZQ1A 4BTTB 3RXSA 4A5TS 5LH8A 4NIVA 4H4FA 1A0JA 3OYPA 1ORFA 1ZGVA 1CQQA 5EXLA 2HALA 1WQVH 2ZP0H 5L2ZH 2R2WU 1G3BA 1VJ9U 5F8XA 1V2KT 2R9PA 1AU8A 3BTWE 2JH0D 4H6TA 2GCTC 2VH0A 1EQ9A 1TPSA 4AFUA 1O2MA 3BSQA 1D3DB 1C5TA 2HPPH 1ARBA 2C4FH 2J34A 3SNCA 3UY9A 3RXIA 1HV7A 1S0RA 5LGOA 5EW2H 1WOFA 2QGRA 4NIXA 5HMAA 1BTYA 1IQMA 2TPIZ 3TH4H 3Q77A 1AVGH 1O2RA 1QTFA 2I6QA 2OD3B 3M5LA 1ZJKA 4O3TA 1ZTJA 1EP5A 2FX6A 2GX4A 1XKBC 5F8ZA 1F7ZA 2BY7X 4F4OC 1LHDH 1HFDA 2AERH 1F0SA 1C2FA 1YCPK 1K2I1 2ZU4A 1J15A 1Y5AT 1TAWA 1BQYA 1HAIH 2D2DA 4AX9H 2GGVB 3IITA 4X2XA 3AW0A 5ETXA 9LPRA 2GCHG 3SU2A 3RXCA 4Y10E 5TJXA 2ZPRA 3URDA 2QA9E 4INLA 2C90B 1ELEE 2TGDA 3KQBA 3SHCH 5C2ZA 1ZR0A 1SQOA 5FBEA 5FAHA 4YESB 4KP0A 2BVXH 5K7RA 1K9OE 5EXNA 1KXDA 1XUFA 1ZPBA 1C2DA 1HDTH 4AORA 1N8OC 1C9PA 1TPPA 3M7QA 1O2VA 4X6OA 8ESTE 1Y8TA 3DUXH 1ABIH 3PTNA 1O5CB 3ATIA 1P04A 2VU8E 5AFYH 1UO6A 2EI8A 3TJOA 1RD3B 5DPAA 2CJIA 4Q7XA 3LKWA 1N6XA 4A6LA 2P3TB 5BRRE 1CBWB 1JMOH 1G3DA 1TMBH 2EEKA 3OTJE 1P06A 2HGTH 3PTBA 1BTWA 5A8XA 3JZ1B 3VEQB 1K1PA 1NFWA 5I25A 1ABJH 1FY1A 2FOEA 3NWUA 4CRCA 3SU3A 3QZQA 3TNSA 2B8OH 3E6PH 2VIQA 1C5SA 4LK4A 1H9IE 3UOUA 2BDAA 1L4DA 1EB2A 1C4Y2 4Y7AA 2VIDA 1FAXA 1GJ7B 1GL0E 2QC2A 1D3QB 2R2MB 1KYNA 4JYUH 3S9AA 1EASA 1NRRH 1WTGH 2P3UB 2ZCLP 4WH8A 3VB7A 3I77A 2ZF0H 3K6YA 2FYQA 4X2VA 2JKHA 2P93A 1W10U 4E06H 1WQSA 5A8ZA 1C2GA 4AB8A 1WTHD 2WV5A 1GMHG 2FTMA 2Z9IA 3C1KA 3UPEA 1S83A 4K2YA 3AW1A 2GD4B 3A82A 3MO9A 1BRCE 1HCGA 3UNSA 2FWWA 2GT7A 4DOQA 3E8LA 1HJAC 1G9IE 2ZGCA 3SV7A 1JOUB 1GDNA 1PFXC 5EU8A 3TK9A 6CHAB 5C67A 5EQQA 2BQ6B 2O8UA 2F9UA 3MU4A 2BD3A 3K6ZA 2FOAA 2WPJS 5DP7A 1C5RA 3E3TA 1PQAA 2ZFPH 2PUQH 3SU0A 2FPZA 2Z94A 1O36A 2H5CA 4ISNA 1GI8B 2BX4A 2WINI 4R0IA 5E8EH 5EPNA 1BTHH 1NT1A 2IJOB 1P2QA 2W7UA 4XE4A 3GICB 4I8HA 2O8WA 3ZZAA 4CRAA 4MPVA 3STJA 1DS2E 4AFSA 2ZCHP 2AGEX 1FY3A 3M3SA 5F6MA 4I33A 2OC8A 2NWNA 1EX3A 3RXDA 1Y3XA 1SFIA 1BBRK 3ZYEA 4MQAA 4FVDA 5HYOA 1ZGIA 1W0YH 4X6MA 1GJBB 3HATH 1BRAA 4AGKA 1GJ8B 1W3CA 3A86A 3RXJA 2BB4A 2GKVE 1LCYA 2LPRA 3TGJE 1GMHF 4I8LA 1K1MA 3SU4A 3BIVH 1VR1H 1C1VH 5FX6A 1EUFA 1AIXH 1TMUH 3BTKE 4Y8ZA 4X1QU 4D8NA 4VGCB 4X1SU 1HAGE 2PTNA 1AUTC 1SFQB 5IYTA 4MG3A 1O2OA 4IGDA 1EATA 5J4QA 3GDSA 1YPMH 1GG6B 1TIOA 1FI8A 3KNXA 5T6GA 1YPHC 1A7SA 4B2BA 1K21H 2BD5A 2ZA5A 2XYAA 1HAYB 3NCLA 2FLRH 4MPUA 7GCHG 2BLVA 2SGEE 1Z8IB 3M7TA 4DY7B 3U8TH 1W0ZU 1RIWC 5T3HA 4RSPA 5BPEA 2XC0A 4CHAB 1EPTC 4OGXA 4IC6A 1ZTLA 1QHRB 2AH4X 1YM0A 3KEEA 1C4U2 4XOJA 2YNBA 1VZQH 2XWAA 3U1JB 1H1BA 2BLWA 2FOCA 2ZDKA 1DITH 1F5LA 3LIWA 5HM2A 1O3JA 3SV8A 3MI4A 3T2NA 4ZHLU 1DXWA 3LJJA 4X8VH 4YO9A 2G5VA 2JH6D 2DE9A 1C1OA 1PPCE 5AHGH 1RRKA 2FXRA 1CT0E 1SBWA 3SGQE 1VCWA 3T25A 1TGTA 1KXEA 2FEQH 7ESTE 2VWNA 1P02A 1ELBA 4XDEA 3E0NB 2I6SA 2Z3CA 1GGDB 5C5NA 1JBUH 2AYWA 3HK3B 1ELTA 1UK4A 4INKA 1L1JA 2LNCA 3SUFA 3BF6H 1NRSH 2V0BA 3LH1A 4FUIA 3GCHB 5HM9A 5GJ4B 3P95A 3TITA 1O2HA 1XX9A 1Y5UT 1QURH 1IQHA 4FU7A 2VNTA 1UVPA 4TWYA 2AIQA 3SNEA 5EG4A 3SV6A 1ZHRA 3M61U 1CA0B 1SLWB 1SI5H 1OSSA 5C1UA 2PFEA 1NM6A 1AVXA 5EQRA 2XBYA 2BD2A 4Z0KA 4X8SH 1UTLM 1IQEA 3R0FA 4ZH8A 1QL8A 3A8BA 4CBOA 1O3LA 5EQSA 1O2JA 2FESH 1NY22 3AAVA 3N7OA 1UCYE 2AMPA 1ANDA 1A1RA 1NZQH 2J2UA 5JBAS 1KLJH 1C5UA 4UFGH 1TA6A 1W2KH 2VVVA 3TLOA 4ABIA 4X6NA 1F0RA 3T62A