5LPEA

Kallikrein-related peptidase 10 complex with zn2+
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
226
structure length
204
Chain Sequence
PCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTAAHCGNKPLWARVGDQGEQLRRTTRSVVHPKYRTDEHDLMLLKLARPVVLGPRVRALQLPYRCAQPGDQCQVAGWGTTANKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kallikrein-10
publication title Structural basis for the Zn2+ inhibition of the zymogen-like kallikrein-related peptidase 10.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 44
structure length 204
sequence length 226
chains with identical sequence B
ec nomenclature ec 3.4.21.-:
pdb deposition date 2016-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5lpeA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5lpeA02
1O5BB 4ZKRU 2BLOA 1YGCH 4R8TB 9LPRA 3QWCH 2FOAA 5L2YH 4Y8XA 1O2XA 1NO9H 1SMFE 3DD2H 1T8NA 4ABAA 3SJIA 1HUTH 2IJOB 2ZDLA 4F4OC 1UK4A 1UTKA 2VJ1A 1MU6B 3MH5A 1PQ5A 1MTUA 1P9SA 3SHAH 1NFXA 2UWOA 1O2MA 1MKXK 3JZ1B 1GPZA 4WMFA 1OPHB 3SW2B 1SQOA 2A7HA 4X1RU 4ABEA 2BDBA 1SFQB 4X8VH 1C2EA 1THRH 2BMGB 3M5MA 2CHAB 4ISLA 4A6LA 2HWLB 4TY6A 4H42U 2BD9A 1G30B 1ETSH 1W8BH 3QN7A 1P12E 3RU4D 2XNIA 3QZQA 4UFFH 3P92A 1G2LA 1QL8A 1ELDE 2AMQA 4MNYA 3RMLH 1GCTB 1O36A 4Y8ZA 2BD7A 1HPGA 1O2GH 4Y7BA 4VGCB 1Q2WA 2EC9H 4TYDA 2BTCE 3MNCA 1ZHMA 1SQTA 4ZKOU 1W2KH 2FOMB 1O3BA 1SOTA 4Y76A 4DJZB 3RM2H 4X1SU 1KLTA 1MAYA 1EOLA 2UUFB 1P57B 1L0ZA 2BY6X 4X2YA 9ESTA 4I7YH 1TFXA 1BOQA 4WF8A 1C4Y2 1EB2A 1OWJA 1BCUH 3SZNA 4FUCA 1KXEA 2VVVA 1P2NA 1OXGA 1GJCB 5FPTA 1DLKB 1P02A 2QIQA 1FNIA 3H5CB 3AW0A 3FFGA 1CVWH 1LHDH 3N7OA 1SGTA 3VGCB 1XM1A 1FY8E 1WCZA 2A5IA 2GDDA 1K1LA 2SNVA 1QR3E 3A7XA 1DWDH 2QY0B 2VINA 2THFB 1TMBH 1ZR0A 3KQBA 5EODA 1SBWA 2LNCA 2ZCLP 4A1TA 5C2ZA 3BN9A 2GT8A 4JK5A 1MQ6A 2NU0E 2TGTA 3SGAE 4ESTE 1MAXA 2F9UA 3F9EA 4I8LA 1O3OA 1W7GH 1K21H 1F7ZA 4RKJB 5GPIB 1HV7A 3GDSA 3TJVA 2STAE 2UWLA 2PFEA 1GHAF 1YC0A 2Z3EA 2ZECA 2OC8A 4HFPB 4PROA 3GCTG 2OD3B 2Z3CA 2NU3E 4YZUA 1EKBB 3CENA 4YO9A 1ZMNA 3U8RH 3F9GA 2UUKB 3MMGA 3MU0A 1QBVH 1LKBA 2FM2A 2ZFSA 4Y10E 1ZTKA 2BQ7B 1P2IA 2B7DH 1P2QA 1JBUH 2PR3A 1CHOG 2A7JA 3QGNB 1EJAA 3UOPA 1LHGH 1P3CA 2Y5GA 4GUXA 4YOIA 4INHA 1A5IA 1Y3UA 1C1WH 1ANCA 3UTUH 3A7TA 1P04A 3SO3A 5PTPA 2BD3A 5GWZA 4GHTA 5DPAA 3SU3A 2Y5FA 3SNAA 1NY22 5LH8A 1C2IA 2H9HA 3RUOA 4U32A 3A7WA 1CBWC 1D9IA 3D65E 3T28A 2FLBH 2BY9X 2FX6A 1EP6A 2ZCKP 3GY3A 1GI4A 2VIOA 4JK6A 1LVBA 4DY7B 2BXTH 5CHAB 1YP9A 2VIPA 3DUXH 1O2PA 4KTCA 2XW9A 4A1XA 3ZVBA 1SI5H 3EA9A 1C4V2 1FQ3A 1DANH 2ZDKA 3KGPA 4ABBA 3E16B 3QUMP 2J92A 3MU1A 3LJJA 3T62A 3DHKH 3ZVFA 3W95A 4ABDA 1L2EA 1W3CA 2JETC 3QTVH 5FPYA 5HYOA 3S9CA 1P2KA 2QXGA 5IDKA 3GY4A 4K1EA 2HOBA 1GBAA 2G4TA 4DW2U 1NRSH 1C2LA 8LPRA 1QB1A 1TMTH 3CS0A 1W10U 3HGNA 1PYTD 1O3DA 2A45B 1GBBA 1NRPH 3GY2A 3U98H 2O8LA 2GMTC 2HALA 1J14A 4O03A 4D7GA 4RSPA 1LHEH 4UFGH 1ZRBA 3A88A 1IQIA 4SGBE 5E8EH 1NC6A 4XBBA 2FPZA 5JBAS 4MPVA 2NU4E 2XBXA 1Z6JH 1EAIA 4FXGH 1Y59T 2QGRA 1MMJN 5HXFA 3RXJA 1TNLA 4IC6A 1QHRB 4X6MA 4AORA 1ANEA 3ZZDA 4MLFB 4JZDH 2PGQB 1VGCB 1XUHA 1BMAA 4AYYB 3UNQA 2PKSC 1C2KA 3O8RA 1HBTH 1MUEB 3P8GA 1LVYA 2BY8X 1FIWA 2BD4A 1GL1A 2W7UA 2ZFRH 2FZZA 1O3IA 2IOTA 4CHAB 4INLA 1PPCE 2Z6BD 1TPPA 3ATWA 5DGJA 1KXFA 1DSTA 5A2MH 2XBVA 3GCOA 1KLIH 1E37B 4XSKU 1C5VA 2GV7A 3S0NA 4ZHAA 1ZTJA 1HJAB 1O5FH 4LZ4B 1O3AA 3A80A 2DUCA 5GJ4B 1SQAA 1LQEA 3BEUA 2AGEX 1XVOA 3O8DA 2GCHF 4B71A 5JBTA 3A86A 2FESH 3LOXA 1MU8B 2J94A 1FN6A 2FI4E 1QL9A 4B74A 3QDZB 1J9CH 2K1QA 1C2FA 1SGFA 1GBFA 2ZDVH 3AASA 1GGDC 4BAOB 1C5WB 3NUMA 1C1QA 4Y0ZE 4AG1A 1AI8H 1ESTA 2YNAA 4Q2KA 1XKBC 1FDPA 2PSXA 1BZXE 2RCEA 4DIHH 2Z94A 2BVXH 4LXBH 1C2HA 3PTBA 3GDVA 3VB7A 1TQ7B 1ZHPA 1BJUA 1M9UA 1ELTA 4FUGA 2FS9A 1RIWB 2AMPA 3M61U 3LH1A 2OXSA 1CGJE 1ZTLA 1GBIA 4CBNA 2F91A 4WMDA 4D9QA 1BIOA 1TAWA 1DUAA 4H6TA 1TGBA 3ZYDA 2ANYA 3TNTA 2C4FH 2BLVA 4KP0A 4YLQH 5C1YA 2H9TH 2FYQA 2BVRH 5FBEA 4JCNA 1OWIA 2SGQE 1MZAA 1QCPA 5F8ZA 4NIVA 3U8TH 1DLEA 3EGKH 3PO1C 2A2XH 2ZC9H 5DP4A 4DCDA 2GGVB 1EZXC 1IHSH 2UUYA 3GYMA 3C27B 3L3TA 2QV1A 5T3HA 2AGGX 1O2IA 3UPEA 1TLDA 2IN2A 1WUNH 1AZZA 1LPKB 1JIMA 2CXVA 3UR9A 5C1UA 4JZIA 1AB9C 2R3YA 4X8SH 2O8WA 1AU8A 1O2RA 1O37A 2OQUA 1ABJH 5HMAA 1O2NA 3Q00A 3HKIB 4K60A 2PKAB 4AFUA 4Y71A 1EAXA 2OTVA 2HNTC 2ZDAH 1HRTH 3R3GB 1ZRKA 2ZA5A 3NK8A 1GMDF 2GT7A 5FAHA 1TABE 2ZU4A 4AGJA 2O8TA 3S7HB 1PFXC 1HIAB 1O2SA 1MD7A 1V2KT 3F6UH 1U6QA 1TNHA 2R2WU 3A7VA 4AYVB 2EI7A 1CT0E 5GCHF 1G36A 2G4UA 2WPLS 5BRRE 2TRMA 3F9HA 2ZHDA 2PGBB 1IQJA 1W14U 1TPSA 1G2MA 2ZFQH 4AG2A 1UTNA 2CMYA 1TNIA 4MNXA 1ZPZA 1DITH 5L30H 1P10A 1CA0B 1O3EA 1EB1H 1OSSA 2FIRH 2GCHG 1TBRH 3RXMA 2TBSA 3TLOA 3EDXB 3HPTB 3RM0H 1Y5BT 1TA2A 1Y3WA 3O8CA 2VVCA 5E2PA 1RRKA 2A4RA 1BMNH 2GV6A 1P03A 2AEIH 2P59A 3DFJA 4UONA 1OS8A 3BTKE 1HCGA 1Z71A 2CGAA 2ZHFH 3LJOA 3MH7A 2PKAA 4NA8A 1BB0B 1MTSA 4NA9H 4NZQA 1GJ6A 4K8BA 3SGQE 4CR5A 3BSQA 2Z9KA 4D76A 1QY6A 3K2UA 5EQSA 5J4SA 1HXEH 2OBOA 3K6ZA 2C8ZB 2Q6FA 4MNWA 7LPRA 3OSYA 3M5LA 5HM2A 2ZU3A 1CA8B 3MNBA 2HNTE 4MQAA 1HIAA 1NESE 1O2VA 1YCPM 3MFJA 1BTPA 1OWEA 3SBKA 3QZRA 1NRQH 1YPJH 3Q76A 3QTOH 2GKVE 1UTQA 2FXRA 2AERH 5AF9H 1O5EH 1W7XH 1HJ9A 2EEKA 1X7AC 3S7KB 2VWOA 4WJG2 2FOEA 3RLWH 4X2XA 4CRBA 1H9LB 2C8XB 1O30A 2OC7A 2SGDE 2ZTYA 4JZEH 3RDZA 2Y82A 3SV8A 3B9FH 4XOJA 3TK5A 2GD4B 3KEEA 1BRUP 4K69A 3BTQE 1KDQB 1C5SA 5FCRA 1E34B 2XWBI 2PTNA 1YCPH 1HYLA 1O2QA 4MPWA 1B0EA 4D8NA 1MCVA 4ISHH 2H9EH 1Z8JB 4CRAA 2WV5A 1T4UH 1VJ9U 3TNSA 1ZZZA 1JOUB 1C1MA 4R0IA 1H9IE 2M5TA 5A0CA 1ANBA 4HI3A 4LOYH 1O5AB 1O3KA 2SGEE 5EPNA 1TIOA 3STIA 3RXRA 1RTFB 3FZDA 1O31A 3A8AA 1GMDG 1SSXA 1ESAA 2FDAA 2ZHWH 1NS3A 3P17H 3SU6A 7ESTE 1YPGH 1TNKA 1LMWB 2PLXA 1JRSA 2ZTXA 3RXSA 1AIXH 2SGFE 1AMHA 3RU4T 1OYTH 4BANB 4ABHA 1YPMH 2Z9IA 3E8LA 5BPEA 4WH8A 4X1QU 3UWIA 2ESTE 4K8YA 1UTPA 3RXAA 2PUXB 5AFYH 2JETB 5GCHG 1SLUB 2YNBA 5GIBA 2A5AA 3FANA 2OQ5A 1KXDA 1THPB 2ZQ1A 1SPJA 4AB8A 2P3UB 4CRFA 1S0RA 2C93B 4WVPE 1CQQA 1AVXA 1GBJA 3GYLB 2Q6DA 1SL3A 1C5LH 2FOFA 4FUFA 4TWWA 2WUCA 1TPOA 1O2ZA 5T6DA 1KDQA 3FP7E 1E35B 2AIQA 1SLVB 2GMTB 5EQRA 3A7YA 1SGCA 2Z3DA 3EA8A 3KHVA 3A82A 1AO5A 1UK2A 1V2VT 2VB0A 1T8OA 3LGTA 1SHYA 4JZFH 2BDAA 3P8NA 3G01A 4ZXYH 1E0FD 3MU4A 1TRMA 1VR1H 4YT6H 2BHGA 1O3HA 3DT0H 3BF6H 4X6OA 5EW1H 3KQEA 3T27A 2KAIB 1NFWA 1C1TA 3TJUA 1AY6H 3UNRA 4A1VA 4MPUA 1HAGE 1CU1A 3BEFB 3L6PA 3TK6A 1ANDA 5ESTE 5C5NA 2GZ7A 1A3EH 1BQYA 5DO4H 3DA9B 1DM4B 2BOHB 1C5MD 1HB0B 2PV9B 2B5TB 3SHCH 1ZSKA 2A7CA 1JRTA 4DOQA 2WPKS 1BITA 2OLGA 2FYRA 1FY3A 2G52A 3UFAA 1FAKH 1ETRH 4OS1A 2F9PA 3NCLA 1GWAA 4BAQB 3BTDE 2OINA 3IG6B 1WTGH 3V7TA 1C1NA 2ANWA 1K9OE 3OTJE 5GDSH 1HAPH 3KF2A 3VB6A 1VCWA 3ODFA 3WY8A 2I6SA 5DP5A 2AMDA 2XBYA 1GGDB 1IAUA 1E36B 2CJIA 2QF3A 1V2PT 1YPHE 1O2OA 3VXEH 1PPFE 3MTYA 1P2MA 3GOVB 3MOCA 2J2UA 1UK3A 1AE8H 1K1MA 3LT3A 4ISIH 2NU2E 3ZYEA 2KAIA 4XBDA 5F03A 1HAVB 1B5GH 4U30A 5CE1A 1ESBA 1C2MA 4RN6A 1KXAA 4UEHH 3MO3A 4DT7B 5FPSA 1N6YA 1MTNC 1VJAU 1NTPA 1UCYK 4YLUA 1ID5H 3A7ZA 4AN7A 4GLYA 4X8UH 2ZHQH 4H4FA 2A5KA 3A89A 2RG3A 4H6SB 1Z7KA 2D26C 3PO1B 4GVUA 2JKHA 1AVGH 1QBOA 3GY7A 1WQSA 5DP9A 2HVXA 1NRRH 1GMHF 3SV7A 4AGKA 1ZOMA 4NSYA 3CP7A 4ZH8A 1H1BA 2B8OH 1DICA 1QQUA 3M3VA 1VITF 3KNXA 4NWLA 5J4QA 1MKXH 3RXEA 1DT2A 4CH8B 1S85A 3EA7A 1O2UA 4J2YB 4K1SA 3TVJB 1SHHB 3ZVCA 1N6XA 3NZIA 2P8OC 1O3PB 1UMAH 2STBE 2ZGHA 4IN1A 2ZDMA 1K1JA 1JIRA 4U01A 4YOJA 1INCA 1UJ1A 1DSUA 1F92A 1BTYA 2RA3A 1DFPA 4GSOA 1GBEA 2V0BA 1V2MT 1TONA 1QA0A 3GDUA 1O3JA 3MYWA 2ZQ2A 1NZQH 2W7SA 2W5EA 1P09A 4UD9H 4YM9A 2BZ6H 1TMUH 1LHCH 1O2YA 1S0QA 3M35A 1HAVA 1GHYH 1KXCA 1TGTA 2ZPSA 2O8MA 1DOJA 3M7QA 3ZVDA 1GL0E 3CS7A 4K3JA 1FY1A 4O97A 1ZYOA 1C4U2 1HAZB 5A0AE 3SUGA 2WPHS 1O2HA 1Y5UT 4Y6DA 1AKSB 2QF0A 1BTZA 3SU2A 1O0DH 4ISOA 4IMZA 1KLJH 3ODDA 1ZJDA 4AOQA 3U8OH 1D3PB 1VCQA 5FHTA 1C5PA 1IOEA 1YPEH 2H1UA 2H6MA 1CGHA 3SJ9A 4TY7A 2Q6GA 2BLQA 4X2VA 3U9AH 3F68H 3ZZ7A 1AFQC 5IYTA 1Z1IA 2GCTB 1WU1A 2BDCA 3FZZA 2ZTZA 1J17T 4ZROA 2BDGA 1C1SA 2ZI2H 3S69A 1F0SA 3B23B 1HLTH 2ULLA 3TGJE 2XC5A 3SI3H 1XVMA 5T6FA 3RXPA 1FLEE 2TPIZ 1OP0A 1GJAB 1PPGE 4X6NA 5JBCS 2F9BH 5H4IB 1GJ4H 1BTWA 1BBRE 3PMJA 4SGAE 1S6HA 4CREA 1HAXB 1C5ZB 1MD8A 3B8JA 1FI8A 1LHFH 1TNGA 2V35A 1GBHA 1IQGA 1A7SA 3EYDA 1L1NA 4E7NA 1KY9A 1V2ST 5FCKA 1GI7B 1V2JT 4AFZA 1A2CH 1NM6A 4BTIB 5L2ZH 4LK4A 1EZQA 3GCNA 4ZUHA 2R2MB 3RMMH 3E90B 4XE4A 1ELVA 1ACBE 1O3CA 4AFSA 2BZAA 1YPLH 5LPEA 2XTTB 3PLBA 3KN2A 2JH5D 1AKSA 3SQHE 2XBWA 2EA3A 5TCAA 1W12U 1IQHA 3LGWA 3QGJA 3PYHA 3QO6A 3M36A 4AX9H 4DGJA 1O5GH 2HPQH 5AHGH 2GX4A 1GBKA 4HGCA 2GVFA 1P2JA 2WV4A 4TWYA 3KQCA 1BMMH 3UNSA 1GMHG 4MPXA 1GBMA 4Y7AA 2AYWA 1XUGA 1P8VC 1C5UA 1GHWH 1BTXA 1P3EA 4A7IB 1VITG 2H5DA 3UWJH 1SGYE 4D7FA 2XYAA 2VWLA 1ZPBA 3M5NA 4X6PA 4BTUB 1A0HB 1C9PA 3ATLA 4YOGA 1C2JA 4JZ1A 3ZZ8A 2Z7FE 5G4BA 5K0HA 1EATA 1G3CA 1TB6H 3VB4A 3E6PH 1GJ5H 1EUFA 1AVWA 1GI2A 4BTTB 2EI6A 4O9VA 1C1UH 3GY8A 4FUHA 1DY8A 3JZ2B 2I6QA 3LGVA 3T2NA 2BDIA 3M7UA 3SU1A 1CO7E 1WTHD 1SGDE 2VIVA 3TJNA 2ZGBH 5FBIA 3QLPH 1HDTH 2FI3E 4JMYA 5F8TA 1N8OC 1C5RA 4NWKA 1DUEA 3ZV9A 2FOCA 3U1JB 5B6OA 5JDUB 2J4IA 1ABIH 3PM3A 1LPZB 2NWNA 2FMJA 5LGOA 2SGAA 4A5TS 1HGTH 1GBCA 3GCHC 3BG8A 4YTAA 3SJOA 2F83A 1WYKA 1PQ7A 4JYTA 1DXPA 1LDTT 1PPEE 3NWUA 1MKWK 1RGQA 1MBMA 3TITA 3SNBA 3ZVEA 2V6NA 3GISB 1K1NA 1CE5A 3PTNA 3D62A 4X1PU 1SGIB 1F2SE 4OS6A 1C1OA 2J38A 5AVDA 2CV3A 3OU0A 4WWYA 2ZEBA 2FODA 1B0FA 4E05H 3I29A 3A8CA 4B1TA 1QL7A 1V2OT 2PTCE 2TGAA 2HPPH 2VNTA 1QFKH 3M37A 2JH6D 1GI3A 3RMNH 2QXJA 2P3FH 1ELEE 1IQMA 4E06H 3HK6B 1AQ7A 1IQNA 3T5FH 2AGIX 1RFNA 1TX6A 1TNJA 4ZKNU 3BTEE 3BG4C 1NU7B 2P93A 3OX7U 4XDEA 4Z0KA 1SVPA 2SGPE 1PQAA 1WV7H 1GVLA 2VWMA 3TGKE 4MTBA 3SUEA 1OWHA 2FLRH 4I8JA 5EXMA 3LC3A 2O8UA 3Q3YA 2CF9H 1FPCH 1ZMLA 2W26A 4I8GA 2QN5T 2Y7XA 1D3QB 1TGNA 1J16A 1A5HA 3ZZCA 4BNRA 2ZIQH 4WY3A 3SGBE 1DY9A 4GCHF 3GY5A 3P8OA 4MVNA 4B73A 1TQ0B 4RKOB 2VVUA 3UQVA 2J34A 1C5QA 3BV9B 3MO9A 3ENSB 1Y5AT 1Q3XA 2FOHA 1O3FA 1G3DA 4INKA 1UVSH 1ZLRA 1D6RA 2A2QH 1UVOA 1PJPA 4KTUA 4FUIA 4NG9H 5I25A 2ZNKH 3URDA 1OYQA 1EAUA 2G8TA 1OWKA 1GI9B 2Y81A 5DK1A 1S84A 4KELA 5LPRA 3SU4A 2PHBA 3A87A 5DP3A 1FZZA 4UE7H 1FY4A 1O5DH 2XXLA 3ATKA 2ZGXH 1GJ9B 1GBTA 1LQDB 4FVBA 1ELAA 3RXBA 1JXPA 1O5CB 4IN2A 1H9HE 3RP2A 3KL6A 1C2DA 1SOZA 2AS9A 4Y0YE 1AUJA 1S81A 3RXCA 1IQKA 4THNH 2FP7B 1IQLA 1DE7H 5JB8S 1ZGIA 3S9BA 4J1YA 1GI8B 1AGJA 2F9OA 3BIUH 3RMOH 2OCVB 3ZV8A 4FU7A 4WMEA 3ZZ4A 2C3SA 1GHZA 1MBQA 1RD3B 2CN0H 2G55A 1TWXB 1MTNB 1RIWC 1QA7A 7GCHF 5EU8A 4B76A 1SFIA 2ZGCA 1DPOA 4ZKSU 2A32A 4ABJA 2OUAA 3Q3XA 1O2WA 4ZHLU 1AWHB 1EASA 1XX9A 3RLYH 5DKMA 3VPKA 1WAYB 3IITA 3MI4A 3VXFH 1CBWB 4JYUH 2WPIS 3RC6A 1T31A 1C2GA 4CR9A 3PLKA 1CHGA 3EQ0H 1K1IA 5C5OA 1BJVA 4TPYA 3P8FA 4F49A 1GJ7B 8KME2 2D1JA 1XXDA 1NFUA 2XCFA 3RC5A 3T25A 2OP9A 1G3BA 2UUJB 2F9NA 1HJ8A 1L1GA 2RDLA 1P9UA 1EZUC 1MQ5A 4NSVA 1S83A 5T6GA 5CMXH 4X2WA 2AIPA 5JYIA 1V2LT 4B75A 1QJ1B 3V12A 1T8LA 1T32A 2ODYB 1SGNE 1QJ7B 3IWMA 4UFEH 1QBNA 3PWBA 1DX5M 1A46H 4X0WU 1QRWA 1C5NH 1FUJA 2ZPQA 2ANKH 4O3TA 1YPHC 1FPHH 3F9FA 1UVTH 1O3MA 4OGYA 1BHXB 1AZ8A 1YLDA 1W13U 1O2JA 2ZU5A 1BBRH 1ETTH 4KGAA 1LKAA 3LU9B 2QXIA 5C1XA 1F5LA 4XFQA 1FONA 1V6DA 2VWNA 3FP8E 3SV6A 2BQWB 5FXLA 2BXUH 3LPRA 2PWXA 1Z8IB 2FX4A 1TGSZ 4GHQA 4KTSA 1EP5A 2ZFPH 1KIGH 3LKWA 4ASHA 2IPHA 1EPTC 2ZHEH 1G32B 2VH6A 1GVZA 3AW1A 3SUFA 1BA8B 2WYJA 1SG8B 3HGPA 1AFQB 5EW2H 2OC1A 2ZFTA 3SNDA 1QTFA 1TOMH 4MG3A 5EXLA 2A0QB 1SGRE 3ATMA 1GBLA 2A4OA 2ZU1A 2PKSB 4GCHG 1XUKA 1OP2A 3PMHB 1A4WH 2ZO3H 1GCDA 1C1VH 4X8TH 5A09A 1HNEE 1N1LA 1CT2E 2BQ6B 1NPMA 1Y8TA 1C5XB 2VIDA 2FEQH 3BTHE 3MO6A 1FAXA 4IW4E 1YBWA 1CA0C 4ABIA 1AN1E 1UVPA 4Y79A 2AH4X 4GAWA 5A8ZA 1F5RA 1CGIE 4X1NU 3U1IB 5A8YA 2QCYA 3QX5H 1FXYA 3C1KA 1GMCG 2G51A 3ZZ5A 3Q77A 3MNXA 1Y3VA 3S9AA 1K28D 4IC5A 2W3IA 4YT7H 1V2RT 3PWCA 3KQDA 4Y11E 3AVZA 3OY5U 1OKXA 1ARCA 1S82A 1P05A 3M3TA 4AB9A 2TGDA 4NFEA 1UHBB 4I33A 1QNJA 1GJDB 3MNSA 3BTGE 1J8AA 1S6FA 2V3HH 3SI4H 1KSNA 1IQEA 2ZPRA 1UTLM 2ZG0H 4B2BA 3RXQA 2BB4A 4BXWA 1RTKA 2P16A 3SN8A 1K2I1 2DE8A 4OS4A 3NKKA 2BLWA 3ZVAA 7GCHG 1MCTA 5ESBA 2VIQA 3TGIE 1SLXB 1BUIA 1F0TA 1NROH 3MU5A 2QC2A 1RS0A 5HGGA 1E38B 5C3NA 1T8MA 1SB1H 2ILNA 1D3TB 5EPYA 3SU5A 1NN6A 3VB3A 1GHBF 4BAKB 2BD8A 1GHVH 4K1TA 1YLCA 3NPSA 4ZHMU 3LGIA 1DWCH 3GICB 4FUDA 4NIWA 3GY6A 1OOKB 3QK1A 2BX4A 4HZHA 4B2CA 5A0BA 4DIIH 4K5ZA 4GPGA 2HNTF 1L1JA 3BEIB 1TRYA 1O2LA 3FP6E 1NRNH 1ZMJA 6CHAC 2XC0A 4BXSA 4NA7A 3LGUA 4FUBA 5E0HA 3TK9A 3P6ZB 3TH2H 2GTBA 1S5SA 1ZSJA 5EQQA 1D6WA 1TBQH 1GG6C 3P70B 3P95A 4WXVA 3LC5A 3URCA 2WUBA 3TIUA 2VGCC 3E3TA 1YM0A 3RXUA 4AFQA 8ESTE 2XC4A 1N8OB 1UHBA 5L6NH 2O9QA 3L33A 2NU1E 1DS2E 1AB9B 3SOSA 1O3NA 1XUIA 2Y7ZA 3PROA 2H2ZA 2FTLE 1ORFA 2C90B 3GCHB 3RXKA 1O35A 3PLPA 3PMAB 5TJXA 3SNCA 6LPRA 2Z9GA 2ZU2A 3VFEA 3BTFE 1QQ4A 2WINI 1AHTH 2G5VA 3HK3B 1SGEE 1AFEH 1ELBA 1TPAE 5FX5A 2R9PA 2GZ9A 4CRCA 4XBCA 2Q1JA 3M5OA 3ZZ9A 4Q7XA 2A4QA 1P2OA 4NZLA 8GCHF 1GBDA 2ODPA 4I32A 1T7CA 5GXPA 1OWDA 3SQEE 1C5YB 2J95A 1ZHRA 5EG4A 1T4VH 2OC0A 2OBQA 1WSSH 4IS5A 4ZAEA 4OS5A 3TH3H 2ANMH 1UTMA 1HAIH 6ESTA 2CHAC 1TX7A 1THSH 1UTOA 1LVMA 1DDJA 1W0ZU 2ZZUH 2F3CE 3FVFB 1GDNA 4LZ1H 4OS7A 1CSOE 4WH6A 1BRBE 1GCTC 3MHWU 3AAUA 1C1RA 3I78A 3BG4B 3K65B 1HAYB 4VGCC 5EGMA 1UO6A 1ELFA 4Y8YA 5FX6A 1XMNB 4BOHA 1IQFA 5JBBS 2G5NA 1OX1A 2A1DB 3T29A 1TRNA 2BM2A 2GDEH 3SUDA 1KTSB 2FOBA 4NIYA 1P06A 5K7RA 3D49H 4TPIZ 2ASUB 1FIZA 2F9VA 6GCHF 3ZVGA 3K6YA 1Z6EA 2C8WB 2QYIA 3FAOA 3D23A 1GI1A 1FY5A 3A85A 4Q7YA 2BD5A 2ZDNA 1EJMA 2B0FA 2QXHA 1GHBG 1VITH 1K1OA 2FI5E 3EAJA 3SV2H 3F1SB 1Z8GA 1ZJKA 3VGCC 1H8IH 2TGPZ 2P94A 1GHAG 1C5TA 2FOGA 1BTUA 1G37A 1GHXH 4NGAH 1B7XB 2V3OH 3RC4A 1QGFA 4CH2B 3ZZAA 1TA6A 1HAHH 1QJ6B 1NT1A 2QAAA 1A5GH 1BDAA 5TCCA 2R0KA 2VIWA 1BRAA 1GJ8B 1WBGB 4DURA 3UY9A 1O3GA 3UQOA 5C67A 3A8DA 1RJXB 1ARBA 1SC8U 3NXPA 2QA9E 1UCYH 1XUFA 1V2QT 4FU8A 1EJNA 3KIDU 2GZ8A 1KTTB 5EOKA 1PPHE 1JMOH 3BTME 1IHTH 3STJA 5ABWA 1SGFG 1BMLA 4JYVH 3O8BA 2R3UA 2WPMS 3UOUA 3V13A 2B9LA 2BY5X 2Y6TA 4DG4A 1A3BH 3AAVA 5DP6A 1LO6A 2C8YB 1XKAC 1C9TA 5DG6A 1MZDA 3A84A 4CRGA 3UR6A 1A0LA 3RXVA 1TE0A 1H8DH 3TJOA 1F0UA 2WYGA 3ATIA 4NIXA 5E0JA 3U69H 4DVAU 1D4PB 4BAMB 5E0GA 1KYNA 1MTWA 2HGTH 3I77A 1K22H 1GDQA 3RXDA 3SV9A 1YKTA 5SGAE 2D2DA 4O3UA 4FUJA 2BY7X 4MNVA 5E2OA 3TU7H 1AD8H 1AE5A 2BX3A 1EQ9A 2G00A 3MU8A 5EXNA 2P95A 1Y3XA 3UUZA 1LCYA 1FV9A 4Q80A 5F6MA 3TPIZ 1AWFH 2BYAX 3SJ8A 8GCHG 5LPFA 4IBLH 2G81E 2FS8A 3RU4E 1OP8A 2PUQH 3A81A 1EAWA 1QB9A 3T26A 3LIWA 1BRCE 1FN8A 2FWWA 1YCPK 1V2WT 1GI0A 4UDWH 1GI6A 3V3MA 1QB6A 5I46H 4OS2A 4M7GA 5CHAC 2SNWA 3KCGH 4BAHB 1XXFA 1O3LA 2BD2A 1V3XA 3ZZ6A 1LTOA 4ZXXH 5ETXA 5DP8A 1UTJA 1MH0A 3RXOA 2J9NA 2ZF0H 3M3SA 1J15A 3SORA 3EE0B 3HATH 2SFAA 1EXFA 3ELAH 3LDXH 2HRVA 1NU9A 1ZPCA 1O2TA 1NFYA 1PPBH 1QIXB 1H4WA 2XRCA 3HKJB 3UREA 2XCNA 2Z9LA 2ZP0H 2DE9A 1F0RA 1G3EA 1Q31A 1V2TT 4A92A 2H5CA 2ZCHP 3R0FA 2Y80A 1DWBH 2ZGJA 3K9XB 3LGYA 1Y3YA 5HM9A 4ABFA 5DP7A 2ZWLH 4HTCH 4CBOA 4NFFA 1ELGA 1YYY1 1EPTB 2AFQB 6GCHG 3SJKA 1EOJA 1KXBA 3E1XB 2TIOA 1MTVA 3PB1E 1LPGB 4Q7ZA 1RXPA 1V2NT 1VCPA 1SGPE 4QT8C 1ZGVA 3OYPA 4IMQA 1C1PA 4UFDH 3A83A 3M7TA 1TBZH 3UIRA 3V0XA 1BBRK 1PYTC 2JH0D 1EZSC 1VGCC 4Z6AH 2RA0A 2GCTC 1O2KA 3DFLA 3LONA 4FVDA 1RTLA 3Q3KA 3RXLA 1V2UT 2GP9B 1ZSLA 2EI8A 1O38A 2YOLA 4ZMAH 4CHAC 3SU0A 3A8BA 1SGQE 4B2AA 3E0NB 2ZKSA 2FTMA 4FU9A 1AUTC 1PPZA 1GJBB 1P11E 7KMEH 1SR5C 1A0JA 4MDSA 1XUJA 2BOKA 3W94A 3ITIA 1HJAC 1LVOA 3RXTA 1FMGA 3RXHA 2R0LA 1PQ8A 3MWIU 3ZZBA 5DJ7A 1JWTA 1O39A 1VZQH 1F5KU 4IGDA 1GMCF 4U2WA 1HXFH 2A31A 3PMBB 2HLCA 5JB9S 3RXFA 1TYNA 2ZFFH 2XWAA 1EPTA 3RXGA 1P01A 1UVUH 3E91A 1BT7A 4CRDA 1TX8A 1L4ZA 1A61H 1W0YH 4AZ2B 1EX3A 1FJSA 3VEQB 5JPMH 1DVAH 1HFDA 5F8XA 2PSYA 3VB5A 1D3DB 1W11U 1Z1JA 2BDYA 4I31A 1TALA 2VU8E 1QRXA 1C5OH 4I8HA 1P0SH 3H7TA 3TH4H 3OY6U 3PV4A 1SLWB 1DWEH 1G9IE 3MH6A 4OGXA 1QURH 4YESB 1A1RA 6CHAB 1YPKH 2FO9A 2WPJS 2P3TB 1BTHH 2ALVA 1O32A 1K1PA 4D9RA 2BVSH 3BTWE 2Y5HA 2D8WA 2ALPA 1HAOH 1ELCA 1CT4E 4FUEA 4I8KA 4ABGA 1BHXF 1YF4A 4ISNA 3LH3A 1GG6B 4E7RG 1WOFA 1TGCA 3MH4A 2A4GA 2BDHA 3BIVH 4K2YA 5AFZH 3GCTF 1L4DA 2VGCB 1O33A 5C20A 1Z8RA 1GDUA 1MKWH 2LPRA 2PW8H 1WQVH 3E0PB 3ESTA 1UCYE 3H7OA 5A8XA 3ZZ3A 2W3KA 3RXIA 4WXIA 4KKDA 4NCYA 2P8OB 2VH0A 1CHOF 2Z9JA 2UWPA 3SNEA 1DXWA 1QRZA 3BTTE 1TOCB 2CF8H 1GVKB 1O34A 2ODQA 1GI5A
chains in the Genus database with same CATH superfamily
1O5BB 4ZKRU 2BLOA 1YGCH 4R8TB 9LPRA 3QWCH 2FOAA 5L2YH 4Y8XA 1O2XA 1NO9H 1SMFE 3DD2H 1T8NA 4ABAA 3SJIA 1HUTH 2IJOB 2ZDLA 4F4OC 1UK4A 2KCAA 1UTKA 2VJ1A 3GS9A 1MU6B 1SQRA 1PQ5A 3MH5A 1MTUA 1P9SA 3SHAH 4ACAA 1NFXA 2UWOA 1O2MA 1MKXK 3JZ1B 1GPZA 4WMFA 1OPHB 3SW2B 1SQOA 2A7HA 4X1RU 4ABEA 2BDBA 1SFQB 4X8VH 1C2EA 1THRH 2BMGB 3M5MA 2CHAB 4ISLA 4A6LA 2HWLB 4TY6A 4H42U 2BD9A 1G30B 1ETSH 1W8BH 2W6ID 1P12E 3QN7A 3RU4D 2XNIA 3W1EA 3QZQA 4UFFH 3P92A 1G2LA 1QL8A 4XD7D 1ELDE 2AMQA 4MNYA 3RMLH 1GCTB 1O36A 4Y8ZA 2BD7A 1HPGA 1O2GH 4Y7BA 4VGCB 1Q2WA 2EC9H 4TYDA 2BTCE 3MNCA 1W0JD 1ZHMA 1SQTA 4ZKOU 1W2KH 2FOMB 1O3BA 1SOTA 4Y76A 4DJZB 3RM2H 4X1SU 1KLTA 1MAYA 1EOLA 2UUFB 1P57B 1L0ZA 2BY6X 4X2YA 9ESTA 4I7YH 1TFXA 1BOQA 4WF8A 1C4Y2 1EB2A 1H8HD 1OWJA 1BCUH 3SZNA 4FUCA 1KXEA 2VVVA 1P2NA 1OXGA 1GJCB 5FPTA 1DLKB 1P02A 2QIQA 1FNIA 2LP6A 3H5CB 3AW0A 3FFGA 1CVWH 1LHDH 2KM0A 3N7OA 1SGTA 3VGCB 1XM1A 1FY8E 1WCZA 2A5IA 2GDDA 1K1LA 2SNVA 1QR3E 5DN6D 3A7XA 1DWDH 2QY0B 2VINA 2THFB 1TMBH 1ZR0A 3KQBA 5EODA 1SBWA 2LNCA 2V3MA 2ZCLP 4A1TA 5C2ZA 3BN9A 2GT8A 4JK5A 1MQ6A 2NU0E 2TGTA 3SGAE 4ESTE 1MAXA 2F9UA 3F9EA 4I8LA 1O3OA 1W7GH 1K21H 1F7ZA 4RKJB 5GPIB 1HV7A 3N99A 1OHHD 3GDSA 3TJVA 2STAE 2UWLA 2PFEA 1GHAF 1YC0A 2Z3EA 2ZECA 2OC8A 3WWFA 4HFPB 4PROA 3GCTG 2OD3B 2Z3CA 2NU3E 4YZUA 1EKBB 3CENA 4YO9A 1ZMNA 3U8RH 3F9GA 2UUKB 3MMGA 3MU0A 1QBVH 1LKBA 2FM2A 2ZFSA 4Y10E 1ZTKA 2BQ7B 1P2IA 2B7DH 1P2QA 1JBUH 2PR3A 1CHOG 2A7JA 3QGNB 1EJAA 3UOPA 1LHGH 1P3CA 2Y5GA 4GUXA 4YOIA 4INHA 1A5IA 2CK3D 1Y3UA 1C1WH 1ANCA 3UTUH 3A7TA 1P04A 3SO3A 5PTPA 2BD3A 5GWZA 4GHTA 4FOUC 5DPAA 3SU3A 2Y5FA 3SNAA 1NY22 5LH8A 1C2IA 2H9HA 3RUOA 4U32A 3A7WA 1CBWC 1D9IA 3D65E 3T28A 2FLBH 2BY9X 2FX6A 1EP6A 2WPDD 2ZCKP 3GY3A 1GI4A 2VIOA 4JK6A 1LVBA 4DY7B 2BXTH 5CHAB 1YP9A 2VIPA 3DUXH 1O2PA 4KTCA 2XW9A 4A1XA 3ZVBA 1SI5H 3EA9A 1C4V2 1FQ3A 1DANH 2ZDKA 3KGPA 4ABBA 3E16B 3QUMP 2J92A 3MU1A 3LJJA 3T62A 3DHKH 3ZVFA 3W95A 4ABDA 1L2EA 1W3CA 2JETC 3QTVH 5FPYA 5HYOA 3S9CA 1P2KA 2QXGA 5IDKA 3GY4A 4K1EA 2HOBA 2PP6A 1GBAA 2G4TA 4DW2U 1NRSH 1C2LA 8LPRA 1QB1A 1TMTH 3CS0A 3FO8D 1W10U 3HGNA 1PYTD 1O3DA 2A45B 1GBBA 1NRPH 3GY2A 3U98H 2O8LA 2GMTC 2HALA 1J14A 4O03A 4D7GA 4RSPA 1LHEH 4UFGH 1ZRBA 5KECA 3A88A 1IQIA 4SGBE 5E8EH 1NC6A 4XBBA 2FPZA 5JBAS 4MPVA 2NU4E 2XBXA 1E79D 1Z6JH 1EAIA 4FXGH 1Y59T 2QGRA 1MMJN 5HXFA 3RXJA 1TNLA 4IC6A 1QHRB 4X6MA 4AORA 1ANEA 3ZZDA 4MLFB 4JZDH 2PGQB 1VGCB 3DSGA 1XUHA 1BMAA 4AYYB 3UNQA 2PKSC 1C2KA 3O8RA 1HBTH 1MUEB 3P8GA 1LVYA 2BY8X 1FIWA 2BD4A 1GL1A 2W7UA 2ZFRH 2FZZA 1O3IA 2IOTA 4CHAB 4INLA 1PPCE 2Z6BD 1TPPA 3ATWA 5DGJA 1KXFA 1DSTA 5A2MH 2XBVA 3GCOA 1KLIH 1E37B 4XSKU 1C5VA 2GV7A 3S0NA 1W0KD 4ZHAA 1ZTJA 1HJAB 2V7QD 1O5FH 4LZ4B 1O3AA 3A80A 2DUCA 5GJ4B 1SQAA 1LQEA 3BEUA 2QF4A 2AGEX 1XVOA 3N7EA 3O8DA 2GCHF 5HIZA 4B71A 5JBTA 3A86A 2FESH 3LOXA 1MU8B 2J94A 1FN6A 1WDIA 2FI4E 1QL9A 4B74A 3QDZB 1J9CH 2K1QA 1C2FA 1SGFA 1GBFA 2ZDVH 3AASA 1GGDC 4BAOB 1C5WB 3NUMA 1C1QA 4Y0ZE 4AG1A 1AI8H 1ESTA 2YNAA 4Q2KA 1XKBC 1FDPA 2PSXA 1BZXE 2RCEA 4DIHH 2Z94A 2BVXH 4LXBH 1C2HA 3PTBA 3GDVA 3VB7A 1TQ7B 1ZHPA 2YMSD 1BJUA 1M9UA 1ELTA 4FUGA 5C17A 2FS9A 1RIWB 2AMPA 3M61U 3WW7A 3LH1A 2OXSA 1CGJE 1ZTLA 1GBIA 5F53A 4CBNA 2F91A 4WMDA 4D9QA 1BIOA 1TAWA 1DUAA 4H6TA 1TGBA 3ZYDA 2ANYA 3TNTA 2C4FH 2BLVA 4KP0A 4YLQH 5C1YA 2H9TH 2FYQA 2BVRH 5FBEA 4JCNA 4RI0A 1OWIA 2SGQE 1MZAA 1QCPA 5F8ZA 4NIVA 3U8TH 1DLEA 3EGKH 3PO1C 2A2XH 2W6JD 2ZC9H 5DP4A 4DCDA 3N7DA 2EY4C 2GGVB 1EZXC 1IHSH 2UUYA 3GYMA 3C27B 4OM9A 3L3TA 2QV1A 5T3HA 2AGGX 2EQNA 1O2IA 3UPEA 1TLDA 2IN2A 1WUNH 1AZZA 1LPKB 1JIMA 2CXVA 3UR9A 5C1UA 4JZIA 1AB9C 2R3YA 4X8SH 2O8WA 1AU8A 1O2RA 1O37A 2OQUA 1ABJH 4XRNA 5HMAA 1O2NA 3Q00A 3HKIB 1MABB 4K60A 2PKAB 4AFUA 4Y71A 1EAXA 4RT1A 2OTVA 2HNTC 2ZDAH 1HRTH 3R3GB 1ZRKA 2ZA5A 3F3BA 3NK8A 1GMDF 2GT7A 5FAHA 1TABE 2ZU4A 4AGJA 2O8TA 3S7HB 1PFXC 1UW7A 1HIAB 1O2SA 1MD7A 1V2KT 3F6UH 1U6QA 1TNHA 2R2WU 3A7VA 4AYVB 2EI7A 1CT0E 5GCHF 1G36A 1QZ8A 2G4UA 2WPLS 5BRRE 2TRMA 3F9HA 2ZHDA 2PGBB 1IQJA 1W14U 1TPSA 1G2MA 2ZFQH 4AG2A 1UTNA 2CMYA 1TNIA 4MNXA 1ZPZA 1DITH 5L30H 1P10A 1CA0B 1O3EA 1EB1H 1OSSA 2FIRH 2GCHG 1TBRH 3PV5A 3RXMA 2TBSA 3TLOA 3EDXB 3HPTB 3RM0H 1Y5BT 1TA2A 1Y3WA 3O8CA 2VVCA 5E2PA 1RRKA 2A4RA 1BMNH 2GV6A 1P03A 2AEIH 2P59A 3DFJA 4UONA 1OS8A 3BTKE 1HCGA 3U28C 1Z71A 2CGAA 2ZHFH 3LJOA 3MH7A 2PKAA 4NA8A 1BB0B 1MTSA 4NA9H 4NZQA 1GJ6A 4K8BA 3SGQE 4CR5A 3BSQA 2Z9KA 4D76A 1QY6A 3K2UA 5EQSA 5J4SA 1HXEH 2OBOA 3K6ZA 2C8ZB 2Q6FA 4MNWA 7LPRA 3OSYA 3M5LA 5HM2A 2ZU3A 1CA8B 3MNBA 2HNTE 4MQAA 1HIAA 1NESE 1O2VA 1YCPM 3UAIC 3MFJA 1BTPA 1OWEA 3SBKA 3QZRA 1NRQH 1YPJH 3Q76A 3QTOH 2GKVE 3VG8A 1UTQA 2FXRA 2AERH 5AF9H 1O5EH 1W7XH 1HJ9A 2EEKA 1X7AC 3S7KB 2VWOA 4WJG2 3OAAD 2FOEA 3RLWH 4X2XA 1BMFD 4CRBA 1H9LB 3ZIAD 2C8XB 1O30A 2OC7A 2SGDE 2ZTYA 4JZEH 3RDZA 2Y82A 3SV8A 3B9FH 4XOJA 3TK5A 3DCLA 2GD4B 3KEEA 1BRUP 4K69A 3BTQE 1KDQB 1C5SA 5FCRA 1E34B 2XWBI 2PTNA 1YCPH 1HYLA 1O2QA 4MPWA 1B0EA 4D8NA 1MCVA 4ISHH 2H9EH 2AHME 1Z8JB 4CRAA 2WV5A 1T4UH 1VJ9U 3TNSA 3WWBA 1ZZZA 1JOUB 1C1MA 4R0IA 1H9IE 2M5TA 5A0CA 1ANBA 4HI3A 4LOYH 1O5AB 1O3KA 2SGEE 5EPNA 1TIOA 3STIA 3RXRA 1RTFB 3FZDA 1O31A 3A8AA 1GMDG 1SSXA 1ESAA 2FDAA 2ZHWH 1NS3A 3P17H 3SU6A 7ESTE 1YPGH 1TNKA 1LMWB 2PLXA 1JRSA 2ZTXA 3RXSA 1AIXH 2SGFE 1AMHA 3RU4T 1OYTH 4BANB 4ABHA 1YPMH 2Z9IA 3E8LA 5BPEA 4WH8A 4X1QU 3UWIA 2ESTE 4K8YA 1UTPA 3RXAA 2PUXB 5AFYH 2JETB 5GCHG 1SLUB 2YNBA 5GIBA 2A5AA 2KCPA 3FANA 2OQ5A 1KXDA 1THPB 2ZQ1A 1SPJA 4AB8A 2P3UB 4CRFA 1S0RA 3AK5A 2C93B 4WVPE 1CQQA 1AVXA 1GBJA 2QF5A 3GYLB 2Q6DA 1SL3A 1C5LH 1FX0B 2FOFA 3PV2A 4FUFA 4TWWA 2WUCA 1TPOA 1O2ZA 5T6DA 1KDQA 3FP7E 1E35B 2AIQA 1SLVB 2GMTB 5EQRA 3A7YA 1SGCA 2Z3DA 3EA8A 3KHVA 3A82A 1AO5A 1UK2A 1V2VT 2VB0A 2KCYA 1T8OA 3LGTA 1SHYA 4JZFH 2BDAA 3P8NA 3G01A 1COWD 4ZXYH 1E0FD 3MU4A 1TRMA 3H09A 1VR1H 4YT6H 2BHGA 1O3HA 2F4LA 3DT0H 3BF6H 4X6OA 5EW1H 3KQEA 3T27A 2KAIB 1NFWA 1C1TA 3TJUA 2VBCA 1AY6H 3UNRA 4A1VA 4MPUA 1HAGE 1CU1A 3BEFB 3L6PA 3TK6A 1ANDA 5ESTE 5C5NA 2GZ7A 1A3EH 1BQYA 5DO4H 3DA9B 1DM4B 2BOHB 1C5MD 1HB0B 2PV9B 2B5TB 3SHCH 1ZSKA 2A7CA 1JRTA 4DOQA 2WPKS 1BITA 2OLGA 2FYRA 1FY3A 2G52A 3UFAA 1FAKH 1ETRH 4OS1A 2F9PA 3NCLA 1GWAA 4BAQB 3BTDE 2OINA 3IG6B 1WTGH 3V7TA 1C1NA 2ANWA 1K9OE 3OTJE 5GDSH 3NRLA 1HAPH 3KF2A 3VB6A 1VCWA 3ODFA 3WY8A 2I6SA 5DP5A 2AMDA 2XBYA 1GGDB 1IAUA 1E36B 2XNDD 2CJIA 2QF3A 1V2PT 1YPHE 1O2OA 3VXEH 1PPFE 3MTYA 1P2MA 3GOVB 3MOCA 2J2UA 1UK3A 1AE8H 1K1MA 3LT3A 1YLNA 4ISIH 2NU2E 3ZYEA 2KAIA 4XBDA 5F03A 1HAVB 1B5GH 4U30A 5CE1A 1ESBA 1C2MA 4RN6A 1KXAA 4UEHH 3MO3A 4DT7B 1E1QD 5FPSA 1N6YA 1MTNC 1VJAU 1NTPA 1UCYK 4YLUA 1ID5H 3A7ZA 4AN7A 4GLYA 1E1RD 4X8UH 2ZHQH 4H4FA 2A5KA 3A89A 2RG3A 4H6SB 1Z7KA 2D26C 5KGOA 3PO1B 4GVUA 2JKHA 1AVGH 1QBOA 3GY7A 2K8IA 1WQSA 5DP9A 2HVXA 1NRRH 1GMHF 3SV7A 4AGKA 1ZOMA 4NSYA 3CP7A 4ZH8A 1H1BA 2B8OH 1DICA 1QQUA 3M3VA 1VITF 3KNXA 2JDID 4NWLA 5J4QA 1MKXH 3RXEA 1DT2A 4CH8B 1S85A 3EA7A 1O2UA 4J2YB 4K1SA 3TVJB 1SHHB 3ZVCA 1N6XA 3NZIA 2P8OC 1O3PB 1UMAH 2STBE 2ZGHA 4IN1A 2ZDMA 4I86A 1K1JA 1JIRA 4U01A 4YOJA 1INCA 1UJ1A 1DSUA 1F92A 1BTYA 2RA3A 1DFPA 4GSOA 1GBEA 2V0BA 1V2MT 1TONA 1QA0A 3GDUA 1O3JA 3MYWA 2ZQ2A 1NZQH 2W7SA 2W5EA 1P09A 4UD9H 4YM9A 2BZ6H 1TMUH 1LHCH 1O2YA 1S0QA 3M35A 1HAVA 1GHYH 1KXCA 1TGTA 2ZPSA 3CNRA 2O8MA 1DOJA 3M7QA 3ZVDA 1GL0E 3CS7A 4K3JA 1FY1A 4O97A 1ZYOA 1C4U2 1HAZB 5A0AE 3SUGA 2WPHS 4HG6A 1O2HA 1Y5UT 4Y6DA 1AKSB 2QF0A 1BTZA 3SU2A 1O0DH 4ISOA 4IMZA 1KLJH 3ODDA 1ZJDA 4AOQA 3U8OH 1D3PB 1VCQA 5FHTA 1C5PA 1IOEA 1YPEH 2H1UA 2H6MA 1CGHA 3SJ9A 4TY7A 2Q6GA 2BLQA 4X2VA 3U9AH 3F68H 3ZZ7A 1AFQC 5IYTA 1Z1IA 2GCTB 1WU1A 2BDCA 3FZZA 2ZTZA 1J17T 4ZROA 2BDGA 1C1SA 2ZI2H 3S69A 1F0SA 3B23B 1HLTH 2ULLA 3TGJE 2XC5A 2IJD1 3SI3H 1XVMA 5T6FA 3RXPA 4F55A 1FLEE 2TPIZ 1OP0A 1GJAB 1PPGE 4X6NA 5JBCS 4TT3D 2F9BH 5H4IB 1GJ4H 1BTWA 1BBRE 3PMJA 4SGAE 1S6HA 4CREA 1HAXB 1C5ZB 1MD8A 3B8JA 1FI8A 1LHFH 1TNGA 2V35A 1GBHA 1IQGA 1A7SA 3EYDA 1L1NA 4E7NA 1KY9A 1V2ST 5FCKA 3UB0A 1GI7B 1V2JT 4AFZA 1A2CH 1NM6A 4BTIB 5L2ZH 4LK4A 1EZQA 3GCNA 4ZUHA 2R2MB 3RMMH 3E90B 4XE4A 1ELVA 1ACBE 1O3CA 4AFSA 2BZAA 4ZCNA 1YPLH 5LPEA 2XTTB 3PLBA 3KN2A 2JH5D 1AKSA 3SQHE 2XBWA 2EA3A 2RFKC 5TCAA 1W12U 1IQHA 3LGWA 3QGJA 3PYHA 3QO6A 3M36A 4AX9H 4DGJA 1O5GH 2HPQH 5AHGH 2GX4A 1GBKA 4HGCA 4RT0A 2GVFA 1P2JA 2WV4A 4TWYA 3KQCA 1BMMH 3UNSA 1GMHG 4MPXA 1GBMA 4Y7AA 2AYWA 1XUGA 1P8VC 1C5UA 1GHWH 2IPQX 1BTXA 1P3EA 4A7IB 1VITG 2HLDD 2H5DA 3UWJH 1SGYE 4D7FA 2XYAA 2VWLA 1ZPBA 3M5NA 4X6PA 4BTUB 2J97A 1A0HB 1C9PA 3ATLA 4YOGA 1C2JA 1NBME 4JZ1A 3ZZ8A 2YMSB 2Z7FE 5G4BA 5K0HA 1EATA 1G3CA 1TB6H 3VB4A 2KR7A 3E6PH 1GJ5H 1EUFA 1AVWA 1GI2A 4BTTB 2EI6A 4O9VA 1C1UH 3SZEA 3GY8A 2JIZD 4FUHA 1YY3A 1DY8A 3JZ2B 2I6QA 3LGVA 3T2NA 2BDIA 3M7UA 3SU1A 1CO7E 1WTHD 1SGDE 2VIVA 3TJNA 2ZGBH 5FBIA 3QLPH 1HDTH 2FI3E 4JMYA 5F8TA 1N8OC 1C5RA 4NWKA 1DUEA 3ZV9A 2FOCA 3U1JB 5B6OA 5JDUB 2J4IA 1ABIH 3PM3A 1LPZB 2NWNA 2FMJA 5LGOA 2SGAA 3FOAA 1HGTH 4A5TS 1GBCA 3GCHC 3BG8A 3OFND 4YTAA 3SJOA 2F83A 1WYKA 1PQ7A 4JYTA 1DXPA 1LDTT 1PPEE 3NWUA 1MKWK 1RGQA 1MBMA 3TITA 3SNBA 3ZVEA 2V6NA 3GISB 1K1NA 1CE5A 3PTNA 3D62A 4Q63A 1SGIB 4X1PU 1F2SE 4OS6A 1C1OA 2J38A 5AVDA 1EFRD 2CV3A 3OU0A 4WWYA 4YXWD 2ZEBA 2FODA 1B0FA 3DSOA 4E05H 3I29A 3A8CA 4B1TA 1QL7A 1V2OT 2PTCE 2TGAA 2HPPH 2VNTA 1QFKH 3M37A 2JH6D 1GI3A 3RMNH 2QXJA 2P3FH 1ELEE 1IQMA 4E06H 3HK6B 1AQ7A 1IQNA 3T5FH 2AGIX 1RFNA 1TX6A 1TNJA 4ZKNU 3BTEE 3BG4C 1NU7B 2P93A 3OX7U 4XDEA 4Z0KA 1SVPA 2SGPE 1PQAA 1WV7H 1GVLA 2VWMA 3TGKE 4MTBA 3SUEA 1OWHA 2FLRH 4I8JA 5EXMA 3LC3A 2O8UA 3Q3YA 4TSFD 1S6LA 2CF9H 1FPCH 1ZMLA 2W26A 4I8GA 2QN5T 2Y7XA 1D3QB 1TGNA 1J16A 1A5HA 3ZZCA 4BNRA 2ZIQH 4WY3A 3SGBE 1DY9A 3FN8A 4GCHF 3GY5A 3P8OA 4MVNA 4B73A 1TQ0B 4RKOB 2VVUA 3UQVA 2J34A 1C5QA 3BV9B 3MO9A 2J5UA 3ENSB 1Y5AT 1Q3XA 2FOHA 1O3FA 1G3DA 4INKA 1UVSH 1ZLRA 1D6RA 2A2QH 1UVOA 1PJPA 4KTUA 4FUIA 4NG9H 5I25A 2ZNKH 3URDA 1OYQA 1EAUA 2G8TA 1OWKA 4DT4A 1GI9B 2Y81A 5DK1A 1S84A 4KELA 5LPRA 3SU4A 2PHBA 3A87A 2JJ1D 5DP3A 1FZZA 4UE7H 1FY4A 1O5DH 2XXLA 3ATKA 2ZGXH 1GJ9B 1GBTA 1LQDB 4FVBA 1ELAA 3RXBA 1JXPA 1O5CB 4IN2A 1H9HE 3RP2A 3KL6A 1C2DA 1SOZA 2AS9A 4Y0YE 1AUJA 3OEHD 1S81A 3RXCA 1IQKA 4THNH 2FP7B 1IQLA 1DE7H 5JB8S 1ZGIA 3S9BA 5KEDA 4J1YA 1GI8B 1AGJA 2F9OA 3BIUH 3RMOH 2OCVB 3ZV8A 4FU7A 4WMEA 3ZZ4A 2C3SA 1GHZA 1MBQA 1RD3B 2CN0H 2G55A 1TWXB 1MTNB 5T1VA 1RIWC 1QA7A 7GCHF 5EU8A 4B76A 1SFIA 2ZGCA 1DPOA 4ZKSU 2A32A 4ABJA 2OUAA 3Q3XA 1O2WA 2KX4A 4ZHLU 1AWHB 1EASA 1XX9A 3RLYH 5DKMA 3VPKA 1WAYB 3IITA 3MI4A 4F48B 3VXFH 1CBWB 4JYUH 2WPIS 3RC6A 1T31A 1C2GA 3F0PA 4CR9A 3PLKA 1CHGA 3EQ0H 1K1IA 5C5OA 1VKYA 1BJVA 4TPYA 3KYGA 3P8FA 5CHBA 4F49A 1GJ7B 8KME2 2D1JA 1XXDA 1NFUA 2XCFA 3RC5A 3T25A 2OP9A 1G3BA 2UUJB 2F9NA 1HJ8A 1L1GA 2RDLA 1P9UA 1EZUC 1MQ5A 4NSVA 1S83A 5T6GA 5CMXH 4X2WA 2AIPA 5JYIA 1V2LT 4B75A 1QJ1B 4M9FA 3V12A 1T8LA 1T32A 2RDEA 2ODYB 1SGNE 1QJ7B 3IWMA 4UFEH 1QBNA 2WZQA 1DX5M 1A46H 3PWBA 4X0WU 1QRWA 1C5NH 1FUJA 2ZPQA 2ANKH 4O3TA 1YPHC 1FPHH 3F9FA 1UVTH 1O3MA 4OGYA 1BHXB 1AZ8A 1NBMD 1YLDA 2F43B 1W13U 1O2JA 2ZU5A 1BBRH 1ETTH 4KGAA 1LKAA 3LU9B 2QXIA 5C1XA 1F5LA 4XFQA 1FONA 1V6DA 2VWNA 3FP8E 3SV6A 2BQWB 5FXLA 2BXUH 3LPRA 2PWXA 1Z8IB 2FX4A 1TGSZ 4GHQA 4KTSA 2L74A 1EP5A 2ZFPH 1KIGH 3LKWA 4ASHA 2IPHA 1EPTC 2ZHEH 1G32B 3EE7A 2VH6A 1GVZA 3AW1A 3SUFA 1BA8B 2WYJA 1SG8B 3F2HA 3HGPA 1AFQB 4FETA 5EW2H 2OC1A 2ZFTA 3SNDA 1QTFA 1TOMH 4MG3A 5EXLA 2A0QB 1SGRE 3ATMA 1GBLA 2A4OA 2ZU1A 2PKSB 4GCHG 1XUKA 1OP2A 3PMHB 1A4WH 2ZO3H 1GCDA 1C1VH 4X8TH 5A09A 1HNEE 1N1LA 1CT2E 2BQ6B 1NPMA 1Y8TA 1C5XB 2VIDA 2FEQH 3BTHE 3MO6A 1FAXA 4IW4E 2XOKD 1YBWA 1CA0C 4ABIA 1AN1E 1UVPA 4Y79A 2AH4X 4GAWA 5A8ZA 1F5RA 1CGIE 4X1NU 3U1IB 5A8YA 2QCYA 3QX5H 1FXYA 3C1KA 1GMCG 2G51A 3ZZ5A 3Q77A 3MNXA 1Y3VA 3S9AA 1K28D 4ASUD 4IC5A 2W3IA 4YT7H 1V2RT 3PWCA 3KQDA 4Y11E 3AVZA 3OY5U 1OKXA 1ARCA 1S82A 1P05A 3M3TA 4AB9A 2OK5A 2TGDA 4NFEA 1UHBB 4I33A 1QNJA 1GJDB 3MNSA 3BTGE 1J8AA 1S6FA 2V3HH 3SI4H 4AC9A 1KSNA 1IQEA 2ZPRA 1UTLM 2ZG0H 4B2BA 3RXQA 2BB4A 4BXWA 1RTKA 2P16A 3SN8A 1K2I1 2DE8A 4OS4A 3NKKA 2BLWA 3ZVAA 7GCHG 1MCTA 5ESBA 2M2AA 2VIQA 3TGIE 1SLXB 1BUIA 1F0TA 1NROH 3MU5A 2QC2A 1RS0A 5HGGA 1E38B 5C3NA 1T8MA 1SB1H 2ILNA 1D3TB 2KCOA 5EPYA 3SU5A 1NN6A 3VB3A 1GHBF 4BAKB 2BD8A 1GHVH 4K1TA 1YLCA 3NPSA 4ZHMU 3LGIA 1DWCH 3GICB 4FUDA 4NIWA 3GY6A 1OOKB 3QK1A 2BX4A 4HZHA 4B2CA 5A0BA 4DIIH 4K5ZA 4GPGA 2HNTF 1L1JA 3BEIB 1TRYA 1O2LA 3FP6E 2QE7D 1NRNH 1ZMJA 5EJLA 6CHAC 2XC0A 4BXSA 4NA7A 3LGUA 4FUBA 5E0HA 3TK9A 3P6ZB 3TH2H 2GTBA 1S5SA 1ZSJA 5EQQA 1D6WA 2K0QA 5EIYA 2WV9A 1TBQH 1GG6C 3P70B 3P95A 4WXVA 3LC5A 3URCA 2WUBA 3TIUA 2VGCC 3E3TA 1YM0A 3RXUA 4AFQA 8ESTE 2XC4A 1N8OB 1UHBA 5L6NH 2O9QA 3L33A 2NU1E 1DS2E 5C0UA 1AB9B 3SOSA 1O3NA 1XUIA 2Y7ZA 3PROA 2H2ZA 2FTLE 3PRDA 1ORFA 2C90B 3GCHB 3RXKA 1O35A 3PLPA 3PMAB 5TJXA 3SNCA 6LPRA 2Z9GA 2ZU2A 3VFEA 3BTFE 1QQ4A 2WINI 1AHTH 2G5VA 1YWUA 3HK3B 1SGEE 1AFEH 1ELBA 1TPAE 5FX5A 2R9PA 2GZ9A 4CRCA 4XBCA 2Q1JA 3M5OA 3DSPA 3ZZ9A 1KMHB 2A4QA 1P2OA 4Q7XA 4NZLA 8GCHF 1GBDA 2ODPA 4I32A 1T7CA 2LELA 4ACBA 5GXPA 1OWDA 3SQEE 1C5YB 2J95A 1ZHRA 5EG4A 1T4VH 2OC0A 2OBQA 1WSSH 4IS5A 4ZAEA 4OS5A 3TH3H 2ANMH 1UTMA 1HAIH 1WXRA 6ESTA 2CHAC 1TX7A 1THSH 1UTOA 1LVMA 1DDJA 1W0ZU 2ZZUH 2F3CE 3FVFB 1GDNA 4LZ1H 4OS7A 1CSOE 4WH6A 5C94A 1BRBE 1GCTC 3MHWU 3AAUA 1C1RA 5FL7D 4P02A 3I78A 3BG4B 3K65B 1HAYB 4VGCC 5EGMA 1UO6A 1ELFA 1SKYE 4Y8YA 5FX6A 1XMNB 4BOHA 1IQFA 5JBBS 2G5NA 1OX1A 2A1DB 3T29A 1TRNA 2BM2A 2GDEH 3SUDA 1KTSB 2FOBA 4B6FA 4NIYA 5EJ1A 1P06A 3OEED 5K7RA 3D49H 4TPIZ 2ASUB 1FIZA 2F9VA 6GCHF 3ZVGA 3K6YA 1Z6EA 2WSSD 2C8WB 2QYIA 3FAOA 3D23A 1GI1A 1FY5A 2HVYB 3A85A 4Q7YA 2BD5A 2ZDNA 1EJMA 2B0FA 2QXHA 1GHBG 1VITH 5B6LA 1K1OA 2FI5E 3EAJA 3SV2H 3F1SB 1Z8GA 1ZJKA 3VGCC 1H8IH 2TGPZ 2P94A 1GHAG 1C5TA 2FOGA 1BTUA 1G37A 1GHXH 4NGAH 1B7XB 2V3OH 3RC4A 1QGFA 4CH2B 3ZZAA 1TA6A 1HAHH 1QJ6B 1NT1A 2QAAA 5CDFE 1A5GH 1BDAA 5TCCA 2R0KA 2VIWA 1BRAA 1GJ8B 3FKSD 1WBGB 4DURA 3UY9A 1O3GA 3UQOA 5C67A 2KZ4A 3A8DA 1RJXB 1ARBA 1SC8U 3NXPA 2QA9E 1UCYH 1XUFA 1V2QT 4FU8A 1EJNA 3KIDU 2GZ8A 1KTTB 5EOKA 1PPHE 3PRBA 1JMOH 3BTME 1IHTH 3STJA 2WHXA 5ABWA 1SGFG 1BMLA 4JYVH 3O8BA 5C0TA 2R3UA 2WPMS 3UOUA 3V13A 2B9LA 2BY5X 2Y6TA 4DG4A 1A3BH 3AAVA 5DP6A 1LO6A 2C8YB 1XKAC 1C9TA 5DG6A 1MZDA 3A84A 4CRGA 3UR6A 1A0LA 3RXVA 1TE0A 1H8DH 3TJOA 1F0UA 2WYGA 3ATIA 4NIXA 5E0JA 3U69H 4DVAU 1D4PB 4BAMB 5E0GA 1KYNA 1MTWA 2HGTH 3I77A 5HIYA 1K22H 3OTPA 1GDQA 3RXDA 3SV9A 1K0HA 1YKTA 5SGAE 2D2DA 4O3UA 4FUJA 2BY7X 4MNVA 5E2OA 3TU7H 1AD8H 1AE5A 2BX3A 1EQ9A 2G00A 3MU8A 5EXNA 2P95A 1Y3XA 3UUZA 1LCYA 1FV9A 3F2FA 4Q80A 5F6MA 3TPIZ 1AWFH 2BYAX 3SJ8A 8GCHG 5LPFA 4IBLH 2G81E 2FS8A 3RU4E 1OP8A 2PUQH 3A81A 1EAWA 1QB9A 3T26A 3LIWA 1BRCE 1FN8A 4P00A 2FWWA 1YCPK 1V2WT 1GI0A 4UDWH 1GI6A 3V3MA 1QB6A 5I46H 4OS2A 4M7GA 5CHAC 2SNWA 3KCGH 4BAHB 1XXFA 1O3LA 2BD2A 1V3XA 3ZZ6A 1LTOA 4ZXXH 5ETXA 5DP8A 1UTJA 1MH0A 3RXOA 2J9NA 2ZF0H 3M3SA 1J15A 3SORA 3EE0B 3HATH 2SFAA 1EXFA 3ELAH 3LDXH 2HRVA 1NU9A 1ZPCA 1O2TA 1NFYA 1PPBH 1QIXB 1H4WA 2XRCA 3HKJB 3UREA 2XCNA 2Z9LA 2ZP0H 2DE9A 1F0RA 1G3EA 1Q31A 1V2TT 4A92A 3KYFA 2H5CA 5DSFA 2ZCHP 3R0FA 2Y80A 5GNDA 1DWBH 2ZGJA 3K9XB 3LGYA 1Y3YA 5HM9A 4ABFA 5DP7A 2ZWLH 4HTCH 4CBOA 4NFFA 1ELGA 1YYY1 3F0OA 1EPTB 5HKKD 2AFQB 6GCHG 3SJKA 1EOJA 1KXBA 3E1XB 2TIOA 1MTVA 3PB1E 1LPGB 4Q7ZA 1RXPA 1V2NT 1VCPA 1SGPE 4QT8C 1H8ED 1ZGVA 2JJ2D 3OYPA 4IMQA 1C1PA 3OE7D 4UFDH 3A83A 3M7TA 1TBZH 3UIRA 3V0XA 5EJZA 1BBRK 1PYTC 2JH0D 1EZSC 1VGCC 4Z6AH 2RA0A 2GCTC 1O2KA 3DFLA 3LONA 4FVDA 1RTLA 3Q3KA 3RXLA 1V2UT 2GP9B 1ZSLA 2EI8A 1O38A 2YOLA 3SYJA 4ZMAH 4CHAC 3SU0A 3A8BA 1SGQE 4B2AA 3E0NB 2ZKSA 2FTMA 4FU9A 1AUTC 1PPZA 1GJBB 1P11E 7KMEH 1SR5C 1A0JA 4MDSA 1XUJA 2BOKA 3W94A 4B6EA 3ITIA 1HJAC 1LVOA 2KFWA 3RXTA 2L6OA 1FMGA 3RXHA 2R0LA 3KQ5A 1PQ8A 3MWIU 3ZZBA 5DJ7A 1JWTA 1O39A 1VZQH 1F5KU 4IGDA 1GMCF 4U2WA 1HXFH 2A31A 2J98B 3PMBB 2HLCA 5JB9S 3RXFA 1TYNA 2ZFFH 2XWAA 1EPTA 3RXGA 1P01A 1UVUH 3E91A 1BT7A 4CRDA 1TX8A 1L4ZA 1A61H 1W0YH 4AZ2B 1EX3A 1FJSA 3VEQB 5JPMH 1DVAH 1HFDA 4Z1MD 5F8XA 2PSYA 3VB5A 1D3DB 1W11U 1Z1JA 2BDYA 4I31A 5IK2D 1TALA 2VU8E 1QRXA 1C5OH 4I8HA 1P0SH 3H7TA 3TH4H 3OY6U 3PV4A 1SLWB 1DWEH 1G9IE 3MH6A 4OGXA 1QURH 4Q4LA 4YESB 1A1RA 6CHAB 1YPKH 2FO9A 2WPJS 2P3TB 1BTHH 2ALVA 1O32A 1K1PA 4D9RA 2BVSH 3BTWE 2Y5HA 2D8WA 2ALPA 1HAOH 1ELCA 1CT4E 4FUEA 4I8KA 4ABGA 1BHXF 1YF4A 4ISNA 3LH3A 1GG6B 4E7RG 1WOFA 1TGCA 3MH4A 3MQKC 3F2GA 2A4GA 2BDHA 3BIVH 4K2YA 5AFZH 3GCTF 1L4DA 2VGCB 1O33A 2YMSC 1Z8RA 1GDUA 1MKWH 2LPRA 5C20A 2PW8H 1WQVH 3E0PB 3ESTA 1UCYE 3H7OA 5A8XA 2GJGA 3ZZ3A 2W3KA 3RXIA 4WXIA 4KKDA 4NCYA 2P8OB 2VH0A 1CHOF 2Z9JA 2UWPA 3SNEA 1DXWA 1QRZA 3BTTE 1TOCB 2J98A 2CF8H 1GVKB 1O34A 2ODQA 1GI5A
chains in the Genus database with same CATH topology
1O5BB 4ZKRU 2BLOA 1YGCH 4R8TB 9LPRA 3QWCH 2FOAA 5L2YH 4Y8XA 1O2XA 1NO9H 1SMFE 3DD2H 1T8NA 4ABAA 3SJIA 1HUTH 2IJOB 2ZDLA 4F4OC 1UK4A 1UTKA 2VJ1A 1MU6B 3MH5A 1PQ5A 1MTUA 1P9SA 3SHAH 1NFXA 2UWOA 1O2MA 1MKXK 3JZ1B 1GPZA 4WMFA 1OPHB 3SW2B 1SQOA 2A7HA 4X1RU 4ABEA 2BDBA 1SFQB 4X8VH 1C2EA 1THRH 2BMGB 3M5MA 2CHAB 4ISLA 4A6LA 2HWLB 4TY6A 4H42U 2BD9A 1G30B 1ETSH 1W8BH 3QN7A 1P12E 3RU4D 2XNIA 3QZQA 4UFFH 3P92A 1G2LA 1QL8A 1ELDE 2AMQA 4MNYA 3RMLH 1GCTB 1O36A 4Y8ZA 2BD7A 1HPGA 1O2GH 4Y7BA 4VGCB 1Q2WA 2EC9H 4TYDA 2BTCE 3MNCA 1ZHMA 1SQTA 4ZKOU 1W2KH 2FOMB 1O3BA 1SOTA 4Y76A 4DJZB 3RM2H 4X1SU 1KLTA 1MAYA 1EOLA 2UUFB 1P57B 1L0ZA 2BY6X 4X2YA 9ESTA 4I7YH 1TFXA 1BOQA 4WF8A 1C4Y2 1EB2A 1OWJA 1BCUH 3SZNA 4FUCA 1KXEA 2VVVA 1P2NA 1OXGA 1GJCB 5FPTA 1DLKB 1P02A 2QIQA 1FNIA 3H5CB 3AW0A 3FFGA 1CVWH 1LHDH 3N7OA 1SGTA 3VGCB 1XM1A 1FY8E 1WCZA 2A5IA 2GDDA 1K1LA 2SNVA 1QR3E 3A7XA 1DWDH 2QY0B 2VINA 2THFB 1TMBH 1ZR0A 3KQBA 5EODA 1SBWA 2LNCA 2ZCLP 4A1TA 5C2ZA 3BN9A 2GT8A 4JK5A 1MQ6A 2NU0E 2TGTA 3SGAE 4ESTE 1MAXA 2F9UA 3F9EA 4I8LA 1O3OA 1W7GH 1K21H 1F7ZA 4RKJB 5GPIB 1HV7A 3GDSA 3TJVA 2STAE 2UWLA 2PFEA 1GHAF 1YC0A 2Z3EA 2ZECA 2OC8A 4HFPB 4PROA 3GCTG 2OD3B 2Z3CA 2NU3E 4YZUA 1EKBB 3CENA 4YO9A 1ZMNA 3U8RH 3F9GA 2UUKB 3MMGA 3MU0A 1QBVH 1LKBA 2FM2A 2ZFSA 4Y10E 1ZTKA 2BQ7B 1P2IA 2B7DH 1P2QA 1JBUH 2PR3A 1CHOG 2A7JA 3QGNB 1EJAA 3UOPA 1LHGH 1P3CA 2Y5GA 4GUXA 4YOIA 4INHA 1A5IA 1Y3UA 1C1WH 1ANCA 3UTUH 3A7TA 1P04A 3SO3A 5PTPA 2BD3A 5GWZA 4GHTA 5DPAA 3SU3A 2Y5FA 3SNAA 1NY22 5LH8A 1C2IA 2H9HA 3RUOA 4U32A 3A7WA 1CBWC 1D9IA 3D65E 3T28A 2FLBH 2BY9X 2FX6A 1EP6A 2ZCKP 3GY3A 1GI4A 2VIOA 4JK6A 1LVBA 4DY7B 2BXTH 5CHAB 1YP9A 2VIPA 3DUXH 1O2PA 4KTCA 2XW9A 4A1XA 3ZVBA 1SI5H 3EA9A 1C4V2 1FQ3A 1DANH 2ZDKA 3KGPA 4ABBA 3E16B 3QUMP 2J92A 3MU1A 3LJJA 3T62A 3DHKH 3ZVFA 3W95A 4ABDA 1L2EA 1W3CA 2JETC 3QTVH 5FPYA 5HYOA 3S9CA 1P2KA 2QXGA 5IDKA 3GY4A 4K1EA 2HOBA 1GBAA 2G4TA 4DW2U 1NRSH 1C2LA 8LPRA 1QB1A 1TMTH 3CS0A 1W10U 3HGNA 1PYTD 1O3DA 2A45B 1GBBA 1NRPH 3GY2A 3U98H 2O8LA 2GMTC 2HALA 1J14A 4O03A 4D7GA 4RSPA 1LHEH 4UFGH 1ZRBA 3A88A 1IQIA 4SGBE 5E8EH 1NC6A 4XBBA 2FPZA 5JBAS 4MPVA 2NU4E 2XBXA 1Z6JH 1EAIA 4FXGH 1Y59T 2QGRA 1MMJN 5HXFA 3RXJA 1TNLA 4IC6A 1QHRB 4X6MA 4AORA 1ANEA 3ZZDA 4MLFB 4JZDH 2PGQB 1VGCB 1XUHA 1BMAA 4AYYB 3UNQA 2PKSC 1C2KA 3O8RA 1HBTH 1MUEB 3P8GA 1LVYA 2BY8X 1FIWA 2BD4A 1GL1A 2W7UA 2ZFRH 2FZZA 1O3IA 2IOTA 4CHAB 4INLA 1PPCE 2Z6BD 1TPPA 3ATWA 5DGJA 1KXFA 1DSTA 5A2MH 2XBVA 3GCOA 1KLIH 1E37B 4XSKU 1C5VA 2GV7A 3S0NA 4ZHAA 1ZTJA 1HJAB 1O5FH 4LZ4B 1O3AA 3A80A 2DUCA 5GJ4B 1SQAA 1LQEA 3BEUA 2AGEX 1XVOA 3O8DA 2GCHF 4B71A 5JBTA 3A86A 2FESH 3LOXA 1MU8B 2J94A 1FN6A 2FI4E 1QL9A 4B74A 3QDZB 1J9CH 2K1QA 1C2FA 1SGFA 1GBFA 2ZDVH 3AASA 1GGDC 4BAOB 1C5WB 3NUMA 1C1QA 4Y0ZE 4AG1A 1AI8H 1ESTA 2YNAA 4Q2KA 1XKBC 1FDPA 2PSXA 1BZXE 2RCEA 4DIHH 2Z94A 2BVXH 4LXBH 1C2HA 3PTBA 3GDVA 3VB7A 1TQ7B 1ZHPA 1BJUA 1M9UA 1ELTA 4FUGA 2FS9A 1RIWB 2AMPA 3M61U 3LH1A 2OXSA 1CGJE 1ZTLA 1GBIA 4CBNA 2F91A 4WMDA 4D9QA 1BIOA 1TAWA 1DUAA 4H6TA 1TGBA 3ZYDA 2ANYA 3TNTA 2C4FH 2BLVA 4KP0A 4YLQH 5C1YA 2H9TH 2FYQA 2BVRH 5FBEA 4JCNA 1OWIA 2SGQE 1MZAA 1QCPA 5F8ZA 4NIVA 3U8TH 1DLEA 3EGKH 3PO1C 2A2XH 2ZC9H 5DP4A 4DCDA 2GGVB 1EZXC 1IHSH 2UUYA 3GYMA 3C27B 3L3TA 2QV1A 5T3HA 2AGGX 1O2IA 3UPEA 1TLDA 2IN2A 1WUNH 1AZZA 1LPKB 1JIMA 2CXVA 3UR9A 5C1UA 4JZIA 1AB9C 2R3YA 4X8SH 2O8WA 1AU8A 1O2RA 1O37A 2OQUA 1ABJH 5HMAA 1O2NA 3Q00A 3HKIB 4K60A 2PKAB 4AFUA 4Y71A 1EAXA 2OTVA 2HNTC 2ZDAH 1HRTH 3R3GB 1ZRKA 2ZA5A 3NK8A 1GMDF 2GT7A 5FAHA 1TABE 2ZU4A 4AGJA 2O8TA 3S7HB 1PFXC 1HIAB 1O2SA 1MD7A 1V2KT 3F6UH 1U6QA 1TNHA 2R2WU 3A7VA 4AYVB 2EI7A 1CT0E 5GCHF 1G36A 2G4UA 2WPLS 5BRRE 2TRMA 3F9HA 2ZHDA 2PGBB 1IQJA 1W14U 1TPSA 1G2MA 2ZFQH 4AG2A 1UTNA 2CMYA 1TNIA 4MNXA 1ZPZA 1DITH 5L30H 1P10A 1CA0B 1O3EA 1EB1H 1OSSA 2FIRH 2GCHG 1TBRH 3RXMA 2TBSA 3TLOA 3EDXB 3HPTB 3RM0H 1Y5BT 1TA2A 1Y3WA 3O8CA 2VVCA 5E2PA 1RRKA 2A4RA 1BMNH 2GV6A 1P03A 2AEIH 2P59A 3DFJA 4UONA 1OS8A 3BTKE 1HCGA 1Z71A 2CGAA 2ZHFH 3LJOA 3MH7A 2PKAA 4NA8A 1BB0B 1MTSA 4NA9H 4NZQA 1GJ6A 4K8BA 3SGQE 4CR5A 3BSQA 2Z9KA 4D76A 1QY6A 3K2UA 5EQSA 5J4SA 1HXEH 2OBOA 3K6ZA 2C8ZB 2Q6FA 4MNWA 7LPRA 3OSYA 3M5LA 5HM2A 2ZU3A 1CA8B 3MNBA 2HNTE 4MQAA 1HIAA 1NESE 1O2VA 1YCPM 3MFJA 1BTPA 1OWEA 3SBKA 3QZRA 1NRQH 1YPJH 3Q76A 3QTOH 2GKVE 1UTQA 2FXRA 2AERH 5AF9H 1O5EH 1W7XH 1HJ9A 2EEKA 1X7AC 3S7KB 2VWOA 4WJG2 2FOEA 3RLWH 4X2XA 4CRBA 1H9LB 2C8XB 1O30A 2OC7A 2SGDE 2ZTYA 4JZEH 3RDZA 2Y82A 3SV8A 3B9FH 4XOJA 3TK5A 2GD4B 3KEEA 1BRUP 4K69A 3BTQE 1KDQB 1C5SA 5FCRA 1E34B 2XWBI 2PTNA 1YCPH 1HYLA 1O2QA 4MPWA 1B0EA 4D8NA 1MCVA 4ISHH 2H9EH 1Z8JB 4CRAA 2WV5A 1T4UH 1VJ9U 3TNSA 1ZZZA 1JOUB 1C1MA 4R0IA 1H9IE 2M5TA 5A0CA 1ANBA 4HI3A 4LOYH 1O5AB 1O3KA 2SGEE 5EPNA 1TIOA 3STIA 3RXRA 1RTFB 3FZDA 1O31A 3A8AA 1GMDG 1SSXA 1ESAA 2FDAA 2ZHWH 1NS3A 3P17H 3SU6A 7ESTE 1YPGH 1TNKA 1LMWB 2PLXA 1JRSA 2ZTXA 3RXSA 1AIXH 2SGFE 1AMHA 3RU4T 1OYTH 4BANB 4ABHA 1YPMH 2Z9IA 3E8LA 5BPEA 4WH8A 4X1QU 3UWIA 2ESTE 4K8YA 1UTPA 3RXAA 2PUXB 5AFYH 2JETB 5GCHG 1SLUB 2YNBA 5GIBA 2A5AA 3FANA 2OQ5A 1KXDA 1THPB 2ZQ1A 1SPJA 4AB8A 2P3UB 4CRFA 1S0RA 2C93B 4WVPE 1CQQA 1AVXA 1GBJA 3GYLB 2Q6DA 1SL3A 1C5LH 2FOFA 4FUFA 4TWWA 2WUCA 1TPOA 1O2ZA 5T6DA 1KDQA 3FP7E 1E35B 2AIQA 1SLVB 2GMTB 5EQRA 3A7YA 1SGCA 2Z3DA 3EA8A 3KHVA 3A82A 1AO5A 1UK2A 1V2VT 2VB0A 1T8OA 3LGTA 1SHYA 4JZFH 2BDAA 3P8NA 3G01A 4ZXYH 1E0FD 3MU4A 1TRMA 1VR1H 4YT6H 2BHGA 1O3HA 3DT0H 3BF6H 4X6OA 5EW1H 3KQEA 3T27A 2KAIB 1NFWA 1C1TA 3TJUA 1AY6H 3UNRA 4A1VA 4MPUA 1HAGE 1CU1A 3BEFB 3L6PA 3TK6A 1ANDA 5ESTE 5C5NA 2GZ7A 1A3EH 1BQYA 5DO4H 3DA9B 1DM4B 2BOHB 1C5MD 1HB0B 2PV9B 2B5TB 3SHCH 1ZSKA 2A7CA 1JRTA 4DOQA 2WPKS 1BITA 2OLGA 2FYRA 1FY3A 2G52A 3UFAA 1FAKH 1ETRH 4OS1A 2F9PA 3NCLA 1GWAA 4BAQB 3BTDE 2OINA 3IG6B 1WTGH 3V7TA 1C1NA 2ANWA 1K9OE 3OTJE 5GDSH 1HAPH 3KF2A 3VB6A 1VCWA 3ODFA 3WY8A 2I6SA 5DP5A 2AMDA 2XBYA 1GGDB 1IAUA 1E36B 2CJIA 2QF3A 1V2PT 1YPHE 1O2OA 3VXEH 1PPFE 3MTYA 1P2MA 3GOVB 3MOCA 2J2UA 1UK3A 1AE8H 1K1MA 3LT3A 4ISIH 2NU2E 3ZYEA 2KAIA 4XBDA 5F03A 1HAVB 1B5GH 4U30A 5CE1A 1ESBA 1C2MA 4RN6A 1KXAA 4UEHH 3MO3A 4DT7B 5FPSA 1N6YA 1MTNC 1VJAU 1NTPA 1UCYK 4YLUA 1ID5H 3A7ZA 4AN7A 4GLYA 4X8UH 2ZHQH 4H4FA 2A5KA 3A89A 2RG3A 4H6SB 1Z7KA 2D26C 3PO1B 4GVUA 2JKHA 1AVGH 1QBOA 3GY7A 1WQSA 5DP9A 2HVXA 1NRRH 1GMHF 3SV7A 4AGKA 1ZOMA 4NSYA 3CP7A 4ZH8A 1H1BA 2B8OH 1DICA 1QQUA 3M3VA 1VITF 3KNXA 4NWLA 5J4QA 1MKXH 3RXEA 1DT2A 4CH8B 1S85A 3EA7A 1O2UA 4J2YB 4K1SA 3TVJB 1SHHB 3ZVCA 1N6XA 3NZIA 2P8OC 1O3PB 1UMAH 2STBE 2ZGHA 4IN1A 2ZDMA 1K1JA 1JIRA 4U01A 4YOJA 1INCA 1UJ1A 1DSUA 1F92A 1BTYA 2RA3A 1DFPA 4GSOA 1GBEA 2V0BA 1V2MT 1TONA 1QA0A 3GDUA 1O3JA 3MYWA 2ZQ2A 1NZQH 2W7SA 2W5EA 1P09A 4UD9H 4YM9A 2BZ6H 1TMUH 1LHCH 1O2YA 1S0QA 3M35A 1HAVA 1GHYH 1KXCA 1TGTA 2ZPSA 2O8MA 1DOJA 3M7QA 3ZVDA 1GL0E 3CS7A 4K3JA 1FY1A 4O97A 1ZYOA 1C4U2 1HAZB 5A0AE 3SUGA 2WPHS 1O2HA 1Y5UT 4Y6DA 1AKSB 2QF0A 1BTZA 3SU2A 1O0DH 4ISOA 4IMZA 1KLJH 3ODDA 1ZJDA 4AOQA 3U8OH 1D3PB 1VCQA 5FHTA 1C5PA 1IOEA 1YPEH 2H1UA 2H6MA 1CGHA 3SJ9A 4TY7A 2Q6GA 2BLQA 4X2VA 3U9AH 3F68H 3ZZ7A 1AFQC 5IYTA 1Z1IA 2GCTB 1WU1A 2BDCA 3FZZA 2ZTZA 1J17T 4ZROA 2BDGA 1C1SA 2ZI2H 3S69A 1F0SA 3B23B 1HLTH 2ULLA 3TGJE 2XC5A 3SI3H 1XVMA 5T6FA 3RXPA 1FLEE 2TPIZ 1OP0A 1GJAB 1PPGE 4X6NA 5JBCS 2F9BH 5H4IB 1GJ4H 1BTWA 1BBRE 3PMJA 4SGAE 1S6HA 4CREA 1HAXB 1C5ZB 1MD8A 3B8JA 1FI8A 1LHFH 1TNGA 2V35A 1GBHA 1IQGA 1A7SA 3EYDA 1L1NA 4E7NA 1KY9A 1V2ST 5FCKA 1GI7B 1V2JT 4AFZA 1A2CH 1NM6A 4BTIB 5L2ZH 4LK4A 1EZQA 3GCNA 4ZUHA 2R2MB 3RMMH 3E90B 4XE4A 1ELVA 1ACBE 1O3CA 4AFSA 2BZAA 1YPLH 5LPEA 2XTTB 3PLBA 3KN2A 2JH5D 1AKSA 3SQHE 2XBWA 2EA3A 5TCAA 1W12U 1IQHA 3LGWA 3QGJA 3PYHA 3QO6A 3M36A 4AX9H 4DGJA 1O5GH 2HPQH 5AHGH 2GX4A 1GBKA 4HGCA 2GVFA 1P2JA 2WV4A 4TWYA 3KQCA 1BMMH 3UNSA 1GMHG 4MPXA 1GBMA 4Y7AA 2AYWA 1XUGA 1P8VC 1C5UA 1GHWH 1BTXA 1P3EA 4A7IB 1VITG 2H5DA 3UWJH 1SGYE 4D7FA