5LPEA

Kallikrein-related peptidase 10 complex with zn2+
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
226
structure length
204
Chain Sequence
PCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTAAHCGNKPLWARVGDQGEQLRRTTRSVVHPKYRTDEHDLMLLKLARPVVLGPRVRALQLPYRCAQPGDQCQVAGWGTTANKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Kallikrein-10
publication title Structural basis for the Zn2+ inhibition of the zymogen-like kallikrein-related peptidase 10.
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 204
sequence length 226
chains with identical sequence B
ec nomenclature ec 3.4.21.-:
pdb deposition date 2016-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5lpeA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5lpeA02
1A5IA 1UTOA 1EAXA 1EJMA 2OBQA 1TE0A 2V6NA 1AB9C 1O39A 2R0LA 4H6SB 3BTKE 3RLWH 4A5TS 3RXQA 4NGAH 4YT7H 1RIWB 4K8YA 2BDCA 4K3JA 4ABFA 1FIWA 1TMUH 1QL9A 3BEIB 3PV4A 1PQ5A 1BMAA 4K2YA 2ANKH 1SLXB 1G2MA 3RXUA 2EA3A 1X7AC 1BMMH 1SG8B 3ENSB 1E38B 2QV1A 3VB6A 1C5QA 1V2RT 1CE5A 1S81A 2SGPE 2P8OB 4NZLA 1GBAA 2Q6FA 3U69H 1V2ST 1GVKB 1OP8A 4CH2B 1GL0E 2ZFTA 1FDPA 1V2OT 3ZZ4A 1TPPA 3GYLB 1BCUH 3L6PA 2UUFB 2AMDA 3AW0A 1YPKH 1HIAB 1SL3A 4IGDA 1Z8RA 4O97A 2FOFA 2QA9E 2QIQA 5F8TA 3T27A 1QB1A 2WV5A 1P3EA 1IHSH 1RGQA 1ANDA 2BLQA 4Z0KA 1TNIA 3GCNA 2XBXA 2HWLB 1SHHB 2I6SA 3MTYA 1EATA 1AFQC 2SGQE 5HXFA 4X1NU 2A7HA 1A5GH 4X6NA 1YYY1 1VGCC 1SQAA 1P11E 2CMYA 3TK5A 1O3FA 2WYGA 1O3EA 1SBWA 1WUNH 2AS9A 1SVPA 2B0FA 2OD3B 4ISNA 2BY5X 1T32A 3SW2B 1KXAA 1A0HB 5DG6A 1WYKA 3QN7A 1TX8A 5DP8A 1GBMA 1P2OA 2XXLA 3SUDA 2OP9A 1JBUH 4IMZA 1GCTC 4UONA 2FX4A 3LGIA 3S69A 1C1VH 2WV4A 2FOAA 4JZFH 1P12E 3ZZ3A 1L0ZA 2VGCB 7GCHG 4ZAEA 4LXBH 2P3FH 5FXLA 2XCNA 2FM2A 1GI4A 5FCRA 1N6XA 1T8OA 3SGAE 4MPVA 4JYTA 1L2EA 1YCPM 3BN9A 4BAOB 4BTUB 1TBQH 5C1UA 2Z9LA 1O0DH 3QX5H 2BLOA 4NIYA 4AOQA 3SV6A 2ZFQH 2WPKS 3FP7E 2ZG0H 2BD9A 1C9PA 2ZDKA 1O3AA 4I8JA 4VGCB 3M7QA 3W95A 3UOUA 3VB4A 1ZTJA 1DXPA 5C20A 2NWNA 3P17H 1VITF 4FXGH 1J8AA 2IOTA 1ZGIA 2OTVA 5PTPA 1BA8B 1ZRBA 1GI3A 1GJAB 3PO1B 1TALA 2ZGBH 3SU5A 1VJ9U 1GHWH 2BTCE 5B6OA 2TBSA 3RXOA 2BVRH 2H9TH 4LOYH 4K69A 2QXGA 4XSKU 2ZHEH 4ZKOU 1LVMA 2A5KA 5F8XA 2VINA 4UDWH 1ZR0A 3DFJA 1AUTC 3LOXA 1D6WA 2G00A 2FLBH 3WY8A 1LMWB 1UO6A 2FLRH 3OY6U 3ATIA 2FO9A 1LVBA 1LHDH 1MTWA 3O8RA 1EASA 4ZXYH 4K1TA 1H9IE 1QB9A 3MNCA 1UVPA 2Z94A 3EGKH 2WUCA 5A8XA 2F9UA 4WMEA 3QZQA 3HATH 1SGCA 5FBEA 3T26A 3T25A 3BTME 2DE9A 3A7ZA 4F49A 2BHGA 4ABDA 2BY6X 1ZSLA 3TH3H 1F0UA 4KP0A 2ZU1A 1FXYA 1ZMLA 2BQ7B 2HLCA 6CHAC 3P8GA 1O2XA 1HJAB 4FUCA 3RXEA 3MU0A 5L2YH 1Z6JH 2RA0A 1CSOE 1A61H 5ESBA 5AFYH 1CGHA 1L1NA 2O8TA 1C1MA 1SC8U 3LGYA 2GTBA 1CQQA 2QYIA 5C1YA 1UTLM 1HV7A 1P2JA 1FZZA 1HAXB 2CHAC 3DD2H 4HFPB 1GG6C 2BZ6H 1WV7H 1GBHA 2ALVA 5GPIB 2Y5FA 4LZ4B 4FUHA 3TJNA 3TNSA 1IOEA 2ZDNA 3QWCH 5EQSA 2JETB 3VXFH 1OWEA 8LPRA 3MH6A 2AMPA 3BIVH 5JBCS 1ZPCA 2W7SA 2HNTC 1SQTA 1O3MA 2ANWA 1C5YB 1MU6B 3A87A 2WINI 1GHVH 1PPGE 1SMFE 4ABHA 2GP9B 3A81A 3GY8A 4AORA 2BD7A 1FLEE 2Z9IA 4Z6AH 5HM2A 1C2HA 1C5VA 1TPOA 2BQ6B 1MZAA 3A7TA 2O8WA 3VB5A 1DWBH 1B7XB 1C4U2 3F9EA 1O33A 2A4QA 1P8VC 3IITA 5DP6A 3HGNA 1TRMA 3STJA 1RTLA 1P57B 3I78A 2Y5GA 2W3IA 1GBLA 1KIGH 2J94A 1AQ7A 3M5MA 4YOIA 3URDA 1DICA 3HPTB 2C4FH 1IQNA 3JZ2B 1SFIA 2ZGCA 4DGJA 3ATWA 1MUEB 1O5EH 2HPQH 4ABBA 1CT2E 4U01A 1O2GH 1MMJN 2GCTB 4UFDH 1KLIH 1YPJH 1GBJA 3STIA 3AAUA 1HAOH 1MQ5A 1DOJA 1INCA 3AASA 1W10U 4CH8B 4TWYA 1C5WB 2BX3A 4X2YA 2GD4B 1HXFH 4ABAA 3TITA 2FOEA 3HK3B 1BTXA 4B1TA 5JB8S 3SI3H 1HYLA 1K1MA 2PTNA 2QXHA 1DDJA 3LH3A 2ZC9H 4BANB 2FI3E 2BY8X 2J9NA 3MH4A 5GWZA 1Q2WA 2P3TB 4TY6A 1CGJE 1GBIA 4X1PU 1IQEA 1Z1IA 1GBTA 3P95A 4CREA 5E2PA 3O8CA 4MNVA 1EB2A 2ZDMA 5LPFA 2UWLA 1B5GH 4Y8YA 4BAQB 4DCDA 5F6MA 1JRSA 2ZTXA 1O3KA 1IQIA 3ZZ8A 1EOJA 1TNLA 2ZF0H 3ZVBA 1LHCH 1O3NA 1U6QA 1HRTH 2FOCA 1Q3XA 1LVYA 2B8OH 3V3MA 1JWTA 2H2ZA 3AAVA 1GCDA 5F8ZA 2GMTB 4X8TH 1C1OA 1NU9A 1ZRKA 1ETTH 1GDUA 5LPEA 4UFFH 3PLBA 3A8BA 3SJIA 2XCFA 3MI4A 1TOMH 1DVAH 3M5LA 2Y7ZA 3UTUH 1QURH 1O2HA 2BB4A 1GI6A 1T4UH 4BAHB 3ESTA 2GGVB 5JDUB 1LQDB 2OCVB 7ESTE 1UHBA 1P0SH 2ZECA 3H7TA 5EG4A 2VWNA 3SV9A 1QL8A 1MTUA 1SI5H 2V3OH 2PGQB 1K1NA 1O31A 4MLFB 4B71A 1J15A 3BTEE 1O3BA 1DFPA 4RN6A 1ETSH 1TYNA 3E16B 1AGJA 3K65B 4K60A 1UTNA 4ABGA 1KXFA 1M9UA 2ZKSA 1Z8GA 3BEUA 1CT0E 2XWAA 5EODA 3EAJA 1ELGA 2YNBA 1QY6A 3A8DA 2XW9A 1G3BA 3FVFB 4X1RU 1T8MA 1OKXA 2PHBA 1GMDF 2P3UB 2FODA 4NIVA 1EPTC 1KDQA 1S85A 2VWMA 4BNRA 4ISIH 1PPHE 2FP7B 1W0ZU 3BTGE 1NC6A 3D65E 2C90B 2BDHA 3VB7A 3UQOA 1GHAG 1C5RA 4WMFA 1OWKA 2FIRH 1ZZZA 1N8OC 5AFZH 1SGQE 1GBBA 1UMAH 1O3DA 1DWDH 1TMBH 2AGEX 5A0BA 2Z3DA 3SUGA 1O3IA 1E34B 1FY8E 2TGDA 2XWBI 2ZIQH 1NRQH 1QIXB 3C1KA 5K7RA 3LGUA 1BT7A 1ZMNA 1FN6A 1C5MD 1VITH 1DPOA 2BY9X 5GXPA 1CGIE 3VPKA 2O8MA 3RXGA 3TGKE 3E8LA 2G4TA 4NG9H 1FI8A 3GDVA 3MO6A 2CJIA 1E36B 2FZZA 3F9FA 2D1JA 1GMHF 1GHBF 3E90B 5A09A 1SGFG 5EPYA 4SGBE 3GCTG 1RJXB 1ESTA 1LKAA 5ESTE 4YO9A 3IWMA 1GHZA 3A85A 3TK9A 1BQYA 5FAHA 1OYQA 3ODFA 3EDXB 5SGAE 1XXDA 3RXVA 3M36A 4Y71A 2BDIA 1O2IA 4DVAU 5LGOA 1JIMA 3V13A 1ELVA 1F7ZA 2BM2A 1V3XA 1S82A 4IW4E 4TPIZ 3K6ZA 3RXBA 1XXFA 3LC5A 4IN1A 4OS2A 4NFFA 2ZDAH 1MTNC 1O3CA 8GCHG 1CA8B 1LKBA 2OXSA 1Z71A 1H1BA 1O2PA 3DUXH 3MNXA 1OSSA 1IQFA 4CRAA 1AIXH 4JCNA 1PPBH 4ZHLU 4Y76A 1NRRH 2C8ZB 3RM2H 3ZV9A 2F9VA 3RLYH 1D9IA 4TYDA 2BDYA 2ALPA 6GCHF 2ODYB 1SPJA 2BY7X 3B8JA 1TNHA 1UHBB 4FUFA 1UK3A 1BRBE 2XNIA 2A0QB 2GDEH 4XFQA 5ETXA 1QL7A 3U8OH 1GWAA 3TGIE 1ABIH 5GJ4B 4ISOA 1WOFA 2BXUH 1AU8A 3IG6B 5CHAB 3PYHA 1G3DA 1OP0A 1C1PA 3RDZA 2ILNA 1QQ4A 1BBRK 2ZCHP 3A8AA 2NU1E 1ANEA 5A0CA 4IBLH 3SNDA 1MH0A 2F9NA 3PWBA 2ZPSA 2SGEE 4JYVH 3A7XA 1KDQB 5DP4A 2BLWA 4ZHAA 4SGAE 2TPIZ 3MH5A 3PM3A 4U2WA 4AG2A 2ULLA 1HCGA 1ELFA 6ESTA 2WUBA 1VCWA 5EW1H 2A1DB 1VZQH 3MYWA 4CHAB 2JH0D 4NIXA 2G8TA 2UUJB 4Y0YE 3ZYDA 3RMOH 3KEEA 2ODQA 4BAMB 2VIDA 1GI2A 3SNEA 2ZO3H 5T3HA 1W8BH 4MTBA 1XUJA 1XVMA 2CXVA 3TK6A 1PQ7A 1ZYOA 3FZZA 4AFZA 4JZDH 3BTWE 1FNIA 1TOCB 3AW1A 3RMNH 4E06H 1V2UT 2BD8A 4GLYA 1A7SA 1HAVA 2A2XH 2AYWA 4JZIA 3ZVGA 1QA7A 1SGEE 3GDSA 4OS5A 1EZXC 1W12U 5E0HA 2J95A 1BDAA 4HGCA 1MCVA 1ZPBA 1RFNA 2NU2E 1CA0B 1C1NA 1V2WT 2PSYA 1EXFA 3NCLA 3RXCA 1CBWC 1TA6A 2VVCA 5GCHF 4KTCA 5FCKA 1CVWH 4ZKNU 3BTDE 3GY5A 1C5XB 1NFUA 1C2IA 2FOBA 1O5DH 2AIPA 3GDUA 1V2QT 1TBRH 3F9HA 1S84A 4YLQH 4ESTE 4B2AA 4Y79A 4TWWA 2RCEA 4JZ1A 4U32A 3T2NA 2GDDA 4RKOB 2PKSC 1GI7B 4CRBA 3RXPA 1CU1A 1O38A 4A7IB 2OINA 2ANMH 1AI8H 2JH6D 1TX6A 1O37A 1LPKB 5EGMA 1F5KU 1OYTH 1Y5AT 3CS7A 3S7HB 1DY9A 1O3JA 3ZZ5A 1GL1A 5DP3A 4AFQA 1XUFA 4TY7A 1EZSC 2FOGA 4X6MA 3S7KB 4OS7A 1SGDE 1T4VH 3SNBA 1ZJKA 1LTOA 3R0FA 2VNTA 1HLTH 1ABJH 1ANCA 2ASUB 2UWPA 1F0TA 1Y8TA 1MAXA 1ZHPA 3P6ZB 3E0PB 1AHTH 1O5FH 5G4BA 1BBRH 1UVSH 1WU1A 1Y3YA 1GMHG 1GHBG 1HAZB 1HPGA 2C3SA 4AN7A 1TGSZ 2V35A 5T6DA 3GY6A 5JPMH 1BUIA 1GGDB 1SLWB 1D3TB 1O3LA 1BRCE 3Q00A 4TPYA 3Q3KA 1PQ8A 2XBYA 4MNYA 1A2CH 1K1PA 1F5RA 1LHEH 3SNAA 1LHFH 1FY5A 2ZHFH 3GY3A 3ODDA 1MAYA 3A83A 1OWDA 2WPLS 1SGIB 2F9OA 4ZUHA 1W7GH 2VWOA 1O3OA 2BD2A 3MMGA 3KQBA 4E7RG 1V2KT 1P03A 4XOJA 1NFYA 1YPEH 1C4Y2 1GBCA 2SGAA 3AVZA 3UNSA 3ATKA 3SN8A 2ESTE 3GCOA 1QJ1B 3TH2H 1HAIH 4NA9H 2P94A 3M7TA 3ZVCA 1YPHC 1GJBB 2VH0A 4JYUH 3KHVA 2ZPQA 3QDZB 1NU7B 1O2QA 3LT3A 1P02A 5HMAA 1K22H 2GT8A 4FUIA 4XBDA 3RXMA 4Y7BA 1LCYA 3U98H 2XC0A 1G30B 6GCHG 1OX1A 1W14U 1O2JA 2ZGJA 1K2I1 1HAVB 4WY3A 4XBCA 4B75A 3ZZCA 2C8WB 2PUXB 2PWXA 2PLXA 1C1WH 5C3NA 4DT7B 3SHCH 1FIZA 4ABEA 4A92A 1C5ZB 1AE8H 2CGAA 2Y81A 4YTAA 3UR6A 2AERH 3CENA 3VGCB 2JKHA 1UTQA 4WMDA 3QTOH 1O2MA 1A46H 4XBBA 4CRDA 2FS8A 4AG1A 3A84A 1IQGA 1C2LA 1TGBA 1TNJA 1BZXE 1HAHH 2A45B 3A82A 3M7UA 1Y3XA 1Y5BT 3NKKA 4Y11E 1TNKA 1YGCH 4UD9H 4B2CA 3ZZAA 2QC2A 2WYJA 3KNXA 3B9FH 2NU3E 3UFAA 1XUKA 2V3HH 4XE4A 1A0LA 2ZHQH 1GBEA 3RUOA 2H5DA 4WXIA 2ZHWH 3KQEA 1RXPA 4Q80A 3SGQE 3NXPA 3ZVAA 3L3TA 4GCHF 1HXEH 4GHQA 1AUJA 4GPGA 1QBOA 2FYQA 4FUDA 2ZU3A 3UUZA 1MTVA 1WTHD 4R8TB 2W3KA 2Y80A 1Y3VA 4H42U 1EJNA 1FY1A 3GY2A 4MPXA 3T5FH 2QY0B 2BD3A 2QAAA 1OWHA 7LPRA 2H6MA 2QN5T 1FQ3A 2BQWB 1C1UH 2YOLA 1QRWA 3BG4C 3RM0H 1T31A 2XTTB 3GCHC 3SU6A 1EB1H 1SLVB 2VWLA 1V2VT 4ZHMU 4X1SU 1O2RA 1AKSA 3SGBE 1NTPA 1EZUC 2VIPA 1D3PB 3OY5U 4FU9A 3MU5A 3DHKH 3OYPA 2A2QH 5TCAA 2VVUA 3TVJB 1S6HA 1DSUA 1Y3WA 2BMGB 1XMNB 1S83A 1Z7KA 1HAPH 1FPCH 3KN2A 1C5OH 9LPRA 4ASHA 4I8KA 1O34A 4Y7AA 1NRNH 3A86A 2HVXA 5AVDA 5HM9A 5E0JA 1E37B 1ZLRA 4JK5A 2BDAA 2TIOA 3GOVB 2G5VA 3MFJA 1AB9B 1C1SA 2Q6DA 2AFQB 3TNTA 1YPGH 5A8YA 1ZGVA 2P95A 1TB6H 2HNTF 1A1RA 3SZNA 1RIWC 1GMCF 4IMQA 1IQLA 1F5LA 3NWUA 3LONA 4WH6A 2CF8H 4MNXA 2GKVE 2A4OA 1CHOF 1G2LA 3O8DA 2GCHF 2ZFFH 3QGJA 3SJOA 1GI0A 1S5SA 1FPHH 3H7OA 2P8OC 2OQUA 1UTPA 4B76A 2G81E 2B9LA 1BJUA 1UCYE 3RU4T 1KY9A 5F03A 3KQDA 2J34A 2ZU4A 3SORA 4H6TA 1H9LB 2G55A 4X6OA 1EZQA 1GHYH 3U1IB 1O2YA 1O2SA 1O5GH 1TGTA 2NU4E 1KXBA 2SFAA 3M61U 1A4WH 2PFEA 1TMTH 1ID5H 4GVUA 2VJ1A 2PSXA 2XRCA 4CRFA 1K1LA 4FU8A 4OS1A 1QB6A 1VITG 1YPMH 1AFQB 3UY9A 3OTJE 1OWJA 1YLDA 2CN0H 1B0EA 1LPGB 3UNRA 2Z9GA 1O5CB 1WTGH 4AYVB 1H9HE 1QQUA 1VGCB 3RXHA 1BJVA 1SGYE 4ZKRU 2Z9JA 5DGJA 2C93B 3FFGA 3MO3A 3GY4A 1LVOA 1K28D 3LKWA 1AMHA 1XUHA 3MH7A 1C9TA 2O9QA 4HZHA 4WVPE 5AHGH 2O8LA 5C5OA 3SU3A 4ABIA 1D3QB 3SBKA 2V0BA 3SI4H 4Q7XA 4UFEH 2J4IA 2VIOA 4JZEH 4K5ZA 1PPCE 1UK2A 2A5IA 1KTTB 1QJ6B 1GCTB 1O32A 1JRTA 2H9HA 4YM9A 2G5NA 4D8NA 3GYMA 2FESH 1T7CA 3D62A 2W26A 4NA8A 2A7CA 2VGCC 2HPPH 4YLUA 3KL6A 1D4PB 2ZQ2A 1TRYA 1D3DB 1HB0B 5A0AE 1UJ1A 2F3CE 2EC9H 3SV8A 4U30A 3U9AH 3ZZDA 2GZ8A 1O2ZA 3ITIA 2VIWA 1O3HA 1TQ7B 1TRNA 3QTVH 4MNWA 3T29A 2STBE 4NWKA 3SUEA 1WQSA 4DG4A 2C8XB 1O2LA 2OBOA 4VGCC 2Y5HA 2F9BH 2PGBB 1AKSB 1YPHE 2BLVA 2GV6A 4GHTA 2QGRA 5L2ZH 1ELTA 2FTMA 2ANYA 1QRXA 1ELDE 4JMYA 4MG3A 1QR3E 3E0NB 3TGJE 2BOKA 2FEQH 2LPRA 1Y5UT 1WCZA 1ZTKA 5TJXA 4MPUA 1FN8A 3PO1C 3PLPA 4CRGA 5E2OA 1ACBE 3G01A 2QXIA 2Z3EA 3E6PH 1DWCH 1A3BH 3QK1A 1GJ7B 2XYAA 3DA9B 3BSQA 4WXVA 2H9EH 3Q76A 1EKBB 4ZROA 3SUFA 4BTIB 1NRPH 1DE7H 3FAOA 2DUCA 4OS6A 1H8DH 1DLKB 5J4QA 2B5TB 1GPZA 2GVFA 3ELAH 1F0SA 2Q6GA 5DP7A 4O03A 1DM4B 2B7DH 3SV7A 3UWJH 4I8GA 4AGKA 3TIUA 4X1QU 5CE1A 2I6QA 1TONA 5T6GA 7GCHF 4ZKSU 3EQ0H 3F68H 1QFKH 4IN2A 3EA9A 1NFXA 3V7TA 3DT0H 1BTYA 4X8UH 5K0HA 4BAKB 1V2NT 4BOHA 2BD4A 1YM0A 1F92A 1NM6A 4O9VA 5FX5A 3M3TA 5EQRA 4OGXA 3MU4A 3LU9B 1C2MA 1P2KA 3PMAB 1D6RA 3SU1A 2C8YB 4Y8ZA 2A4RA 6CHAB 4E05H 2ZZUH 5L30H 3NZIA 3P8FA 1HJAC 2OQ5A 1H4WA 5EXMA 1HJ9A 3GISB 1TX7A 1C2EA 5EOKA 2AIQA 4NWLA 3RMLH 1NRSH 1C5PA 1VJAU 2UUKB 3Q3YA 2WPMS 2CHAB 3K2UA 1GG6B 2A32A 3A88A 3N7OA 1OWIA 1CHGA 3UQVA 3FZDA 3LGWA 2JETC 3ZVFA 4I33A 2FX6A 2AGIX 3M3SA 1LDTT 5DO4H 1GJ9B 2VU8E 1GJ8B 3F1SB 1HFDA 3ZZBA 1KSNA 4ABJA 5LH8A 4NSYA 1UVOA 3DFLA 3PTNA 4KELA 2GCHG 1C2KA 4CR5A 1DANH 4BXWA 3BG8A 1ZOMA 1P04A 7KMEH 4GAWA 2ZFRH 1DLEA 3KCGH 3RXDA 5TCCA 1AVWA 2G51A 3T62A 1UTMA 5ABWA 2Z7FE 2R0KA 5I46H 4OS4A 2J2UA 2QXJA 1P2NA 1TQ0B 5EU8A 2P16A 1LHGH 1WSSH 4J2YB 1FV9A 1YP9A 1IHTH 4A1TA 2LNCA 1F2SE 1DUEA 1KLJH 2HRVA 1C2DA 3D23A 1W2KH 4Q7YA 1EPTA 4A1VA 1HAYB 1TNGA 1OP2A 1ARCA 4BTTB 2PUQH 3TJUA 4FUEA 1GDQA 3QGNB 1IQJA 2R3YA 1THSH 2ZCLP 4LK4A 1MQ6A 1IQHA 2GCTC 5IDKA 4RSPA 1P05A 1DUAA 1MD8A 2XC5A 1RS0A 1UTJA 4KKDA 1NROH 2RA3A 2D26C 1JMOH 1NESE 1ELCA 1QHRB 4B74A 4YOJA 5JBAS 4K8BA 1KLTA 3LDXH 5FPYA 1SQOA 1TGCA 3M5NA 3PMHB 4I32A 2KAIA 1EQ9A 2BVSH 1QBVH 1HGTH 1TLDA 3LPRA 3UPEA 1SFQB 3URCA 4AB9A 1C2FA 6LPRA 3PMBB 1MD7A 5JBTA 4D7GA 2Z6BD 5E0GA 1O2WA 1EUFA 2RG3A 1BOQA 1FMGA 3E3TA 1H8IH 1GJ6A 1SGPE 1RD3B 2ZI2H 1EAIA 2STAE 4UEHH 1ELBA 4D76A 2VVVA 3ZZ9A 4CBNA 1EOLA 3L33A 1DS2E 4FUJA 1NS3A 2GZ7A 1ZHRA 1GJ4H 1K1JA 4NSVA 1G9IE 1V2TT 1C2GA 5C5NA 1GMDG 1PJPA 3I77A 4DIHH 2BDBA 1SHYA 1Z8IB 3ZV8A 1PQAA 1FJSA 1AVGH 1V2LT 2GMTC 1Q31A 5GIBA 1NY22 1BTUA 2FI5E 2IJOB 5BPEA 4R0IA 1W11U 3UOPA 1GVLA 3VFEA 4DOQA 1GI5A 3OX7U 2FXRA 1J14A 2P93A 4X6PA 3TJVA 1P3CA 2QCYA 4GUXA 4IC6A 3LIWA 3RXIA 1DXWA 3EYDA 1UTKA 3V12A 3M3VA 3M5OA 1K9OE 4DW2U 2NU0E 4F4OC 4INKA 5FBIA 3MWIU 4NA7A 4I7YH 3TPIZ 1WAYB 2VIVA 1O2VA 4INLA 3SQHE 4HI3A 5FHTA 3SOSA 1GBDA 4X2WA 4MPWA 3U8RH 1AD8H 4UFGH 3BEFB 4FVDA 5GDSH 1O5BB 3B23B 1TAWA 2D2DA 4ZH8A 1O36A 1WBGB 1AFEH 4NCYA 4MDSA 2FYRA 2HALA 3MU1A 3SJ9A 4E7NA 1HDTH 2ZDLA 2P59A 3VB3A 2ZTZA 2AMQA 2ZGXH 1NO9H 2G4UA 2PV9B 1YCPH 1EJAA 3A7YA 3BIUH 3MHWU 4MVNA 5H4IB 4Y8XA 2BDGA 1BTHH 1EAUA 1L1JA 1EPTB 2AEIH 2UWOA 2JH5D 4HTCH 5BRRE 3LJJA 1AWHB 3RMMH 3UIRA 4MQAA 1O2TA 1EAWA 1N8OB 1LO6A 1A5HA 4JK6A 1PPZA 3PROA 5DK1A 4ZMAH 1GHXH 4UE7H 2OC0A 1B0FA 2THFB 2WPJS 4WJG2 1A0JA 4YT6H 3ATLA 1K21H 2ZNKH 1QGFA 1P2IA 1PPEE 3SJ8A 3ZZ6A 5C67A 1E0FD 1XKAC 1AZ8A 1L4ZA 3RU4E 3RXJA 1BIOA 1XUGA 2KAIB 1KXEA 3H5CB 5IYTA 4FVBA 1SB1H 1QBNA 3KF2A 4ZXXH 3S9BA 4YOGA 3RC5A 2EI8A 3TJOA 2ZHDA 1ELEE 2XC4A 3F9GA 5A8ZA 1QNJA 1VCPA 3JZ1B 1MZDA 1Z8JB 1TIOA 3R3GB 5A2MH 3SHAH 3HK6B 1TWXB 1OS8A 3BF6H 2GV7A 4AFSA 1N1LA 2J92A 2W7UA 3QZRA 3W94A 2OUAA 2ZPRA 1DSTA 4YESB 1YKTA 2ZU2A 2AH4X 3HKJB 1P9UA 2ZFPH 3E1XB 2FS9A 2OLGA 3SQEE 5CMXH 4X8VH 3BTFE 3QUMP 3LH1A 1NPMA 5EQQA 1BTPA 1G3CA 1PYTD 3SU2A 1QRZA 4WF8A 1AN1E 1MKXK 5JB9S 1ORFA 1SOZA 1GHAF 3ATMA 3VXEH 1NZQH 3EE0B 3PB1E 3V0XA 1XVOA 2BOHB 1MTNB 1UVTH 3RXKA 1C1RA 1THRH 2PR3A 1CO7E 4BXSA 4Q2KA 3NUMA 2BYAX 1SLUB 2Y6TA 1YLCA 2TRMA 1V2PT 4LZ1H 2GX4A 1KYNA 5I25A 1FAKH 1C5UA 2J38A 3M37A 2UUYA 1ANBA 3RXFA 1FY3A 3P8OA 1QTFA 2FDAA 1IQMA 1ARBA 1BB0B 2ZA5A 1QJ7B 4X2VA 4WWYA 2GZ9A 3GCTF 1G3EA 2ODPA 2BD5A 1AVXA 3KQCA 2Y7XA 3TH4H 5CHAC 2PW8H 4Y10E 4B73A 5J4SA 2ZDVH 1ESAA 4Q7ZA 1TFXA 4NZQA 1MTSA 1ZSKA 2HGTH 3BTQE 5HGGA 3KGPA 2M5TA 1XX9A 3MNSA 1V6DA 1WQVH 2RDLA 5GCHG 1MU8B 4DIIH 3OSYA 5C1XA 1GJ5H 1GJDB 2ZCKP 3PLKA 1C5LH 3PTBA 1GJCB 4WH8A 3T28A 3SNCA 8GCHF 4CHAC 2DE8A 2ZEBA 3FP8E 2SNWA 4B2BA 1BHXF 1LPZB 1SGNE 1KXCA 1P2MA 1FAXA 1HAGE 2AGGX 2TGAA 3RU4D 1UVUH 2H1UA 3VEQB 1LQEA 4A1XA 4AX9H 1FY4A 1C1QA 1FUJA 1BMNH 1N6YA 1BRUP 2F83A 1EP6A 3UR9A 3A7WA 5FPSA 5E8EH 1W0YH 3RXAA 1YBWA 3I29A 1W3CA 1AWFH 1S6FA 1J9CH 1W13U 3ZYEA 1UCYK 1ZPZA 3BTHE 3UREA 3SV2H 2FI4E 3P8NA 3O8BA 5T6FA 1AE5A 1SGFA 3P70B 2QF3A 2EEKA 4NFEA 5C2ZA 5EPNA 1P06A 1CA0C 2ZGHA 2Z9KA 1V2JT 2TGPZ 1V2MT 1HUTH 1TGNA 1S0RA 4CBOA 4Y6DA 3A80A 2HOBA 5EXLA 4I31A 1OXGA 2SGFE 2VIQA 1CBWB 1QCPA 1MKXH 1G37A 3MU8A 3Q3XA 8ESTE 1GBFA 2IPHA 1XUIA 1GI1A 4FUBA 2ZQ1A 4NIWA 1TABE 1P10A 1F0RA 2ZP0H 2YNAA 2O8UA 3RP2A 3F6UH 1O2NA 2Q1JA 2IN2A 1ETRH 1ZMJA 1ZSJA 1TPSA 2PKSB 3SU4A 2ZWLH 2PKAA 4AZ2B 2EI7A 2PTCE 1P9SA 1SGTA 3TLOA 1IQKA 2F91A 1MCTA 2Z3CA 2SGDE 1O5AB 1SOTA 1VCQA 1THPB 4FU7A 1L4DA 2SNVA 3BV9B 2TGTA 1S0QA 1KTSB 1J16A 5JBBS 1ESBA 1P09A 3GY7A 3NPSA 3S9AA 3QO6A 1C5TA 3ZVDA 1UK4A 4A6LA 1JIRA 1PYTC 4AYYB 1PPFE 1NN6A 4O3TA 4J1YA 1DWEH 1L1GA 3Q77A 4CR9A 4D7FA 2R2MB 3UWIA 2FTLE 3EA8A 1G32B 1HBTH 1DY8A 1EP5A 5EXNA 1GGDC 1TA2A 1AY6H 4IS5A 3EA7A 1NFWA 4I8LA 3A7VA 2K1QA 2OC7A 2R9PA 1O2KA 3FP6E 1YPLH 3CP7A 1ZJDA 1VR1H 2A31A 3LJOA 5LPRA 1IAUA 2FMJA 2ZU5A 2W5EA 1XM1A 1TPAE 4ISLA 2VB0A 1O30A 4ISHH 4QT8C 3PWCA 3UNQA 2WPIS 3KIDU 4D9RA 3SO3A 2BVXH 2F9PA 1MKWK 2H5CA 3ZVEA 5EW2H 4I8HA 1O35A 2XBVA 5DJ7A 1BTZA 1AZZA 1O2OA 2QF0A 2BZAA 5DP9A 4H4FA 3D49H 3RC4A 1G36A 1K1IA 2A7JA 2Y82A 3OU0A 4GCHG 1UCYH 2R2WU 4YZUA 1O3GA 3C27B 2VH6A 1Y59T 1DITH 1E35B 3FANA 2GT7A 1C5NH 4PROA 4XDEA 1GI9B 3A89A 1KXDA 2D8WA 2CF9H 1T8NA 4FUGA 2OC1A 3S9CA 1HIAA 1P01A 3RXTA 1EX3A 1CT4E 2FOMB 5HYOA 3RXRA 3RC6A 1XKBC 3VGCC 3U1JB 1AO5A 3RXSA 1P2QA 4GSOA 1ELAA 3E91A 1GI8B 3SU0A 2A5AA 2CV3A 3MNBA 1Z1JA 3GICB 3SJKA 5FX6A 4M7GA 2HNTE 4D9QA 1HJ8A 3M35A 8KME2 4DJZB 1MBQA 1T8LA 3MO9A 1FONA 2G52A 4DY7B 2ZTYA 2OC8A 1RRKA 2XBWA 3A8CA 4RKJB 4CRCA 2FPZA 4KTUA 1OOKB 2R3UA 3U8TH 4INHA 1TBZH 2PKAB 1BHXB 3PMJA 5JYIA 4AB8A 1NT1A 1HNEE 1GMCG 3LC3A 1DX5M 1SGRE 1C5SA 1C4V2 1CHOG 3CS0A 1ZTLA 1BITA 1Z6EA 1BTWA 1RTFB 4OGYA 5DPAA 1YC0A 3P92A 2BXTH 2EI6A 1O3PB 1C1TA 2BX4A 1QA0A 5FPTA 1C2JA 4X8SH 4K1SA 4Y0ZE 3ZZ7A 3K6YA 1OPHB 2WPHS 1W7XH 4AGJA 1J17T 2FWWA 4AFUA 3K9XB 3HGPA 3TU7H 5AF9H 3BG4B 1DT2A 3GCHB 1ZHMA 4KTSA 3LGTA 1MBMA 2A4GA 4K1EA 3S0NA 5DP5A 9ESTA 1BRAA 5L6NH 1GVZA 4DURA 1RTKA 1BMLA 1JXPA 1BBRE 1YF4A 4KGAA 1SR5C 1YCPK 3LGVA 1O2UA 4O3UA 1SSXA 1K1OA 1GBKA 4X0WU 1A3EH 2ZFSA 4X2XA 3QLPH 3BTTE 5DKMA 1GDNA 2FOHA 3RXLA 1Y3UA 3NK8A 1JOUB 1MKWH 3HKIB 4IC5A 4THNH 3MOCA 1PFXC
chains in the Genus database with same CATH superfamily
1A5IA 1UTOA 1EAXA 1EJMA 2OBQA 1TE0A 2V6NA 1AB9C 1O39A 2R0LA 4H6SB 3BTKE 3RLWH 4A5TS 3RXQA 4NGAH 4YT7H 1RIWB 4K8YA 2BDCA 4K3JA 4ABFA 2HVYB 2XOKD 1FIWA 1TMUH 1QL9A 3BEIB 3PV4A 1PQ5A 1BMAA 3N99A 4K2YA 2ANKH 1SLXB 1G2MA 3RXUA 2EA3A 1X7AC 1BMMH 1SG8B 3ENSB 1E38B 2QV1A 3VB6A 3CNRA 1C5QA 1V2RT 3DCLA 3FN8A 1CE5A 1S81A 2SGPE 2P8OB 3KQ5A 4NZLA 1GBAA 2Q6FA 3U69H 1V2ST 1GVKB 4P00A 1OP8A 4CH2B 1GL0E 2ZFTA 1FDPA 2EY4C 1V2OT 3ZZ4A 1TPPA 3GYLB 1BCUH 3L6PA 2UUFB 2AMDA 3AW0A 1YPKH 3OE7D 1HIAB 1SL3A 4IGDA 1Z8RA 4FETA 2FOFA 2QA9E 4O97A 2QIQA 1W0KD 5F8TA 3T27A 1QB1A 2WV5A 1P3EA 1IHSH 1RGQA 1ANDA 2BLQA 4Z0KA 1TNIA 1VKYA 3GCNA 2XBXA 2HWLB 1SHHB 2I6SA 3MTYA 1EATA 1AFQC 2SGQE 5HXFA 4X1NU 2A7HA 1A5GH 2RDEA 1YYY1 4X6NA 1VGCC 1SQAA 1P11E 2CMYA 3TK5A 1O3FA 2WYGA 1O3EA 1SBWA 2YMSD 1WUNH 2AS9A 1SVPA 2B0FA 2JJ1D 2OD3B 4ISNA 2BY5X 1T32A 3SW2B 1KXAA 1A0HB 1SKYE 5DG6A 1WYKA 3QN7A 1TX8A 3F0PA 5DP8A 1GBMA 1P2OA 2XXLA 3SUDA 2OP9A 1JBUH 4IMZA 1GCTC 4UONA 2FX4A 3LGIA 4ZCNA 3S69A 1C1VH 2WV4A 2FOAA 4JZFH 1P12E 3ZZ3A 1L0ZA 2VGCB 7GCHG 4ZAEA 4LXBH 2P3FH 5FXLA 2XCNA 2FM2A 1GI4A 5FCRA 1N6XA 1T8OA 3SGAE 4MPVA 4ASUD 4JYTA 1L2EA 1YCPM 3BN9A 4BAOB 4BTUB 1TBQH 5C1UA 2Z9LA 1O0DH 3QX5H 2BLOA 4NIYA 4AOQA 3SV6A 2ZFQH 2WPKS 3FP7E 2ZG0H 2BD9A 1C9PA 2ZDKA 1NBME 1O3AA 4I8JA 4VGCB 3M7QA 3W95A 3UOUA 3VB4A 1OHHD 1ZTJA 1DXPA 5C20A 2NWNA 3P17H 1VITF 4FXGH 1J8AA 2IOTA 1ZGIA 2OTVA 5PTPA 1BA8B 1ZRBA 1GI3A 1GJAB 3PO1B 1E79D 1TALA 2ZGBH 3SU5A 1VJ9U 1GHWH 2BTCE 5B6OA 5EIYA 2TBSA 3RXOA 2BVRH 2H9TH 4LOYH 4K69A 2QXGA 4XSKU 2ZHEH 4ZKOU 1LVMA 2A5KA 5F8XA 2VINA 4UDWH 1ZR0A 3DFJA 1AUTC 3LOXA 1D6WA 3F2FA 2G00A 2FLBH 3WY8A 1LMWB 1UO6A 2FLRH 3OY6U 2WV9A 3ATIA 2FO9A 1LVBA 1LHDH 1MTWA 3O8RA 1EASA 4ZXYH 4K1TA 1H9IE 1QB9A 3MNCA 1UVPA 2Z94A 3EGKH 2WUCA 5A8XA 2F9UA 4WMEA 3QZQA 3HATH 1SGCA 5FBEA 3T26A 4ACBA 3T25A 3BTME 2DE9A 3A7ZA 4F49A 2BHGA 4ABDA 2BY6X 1ZSLA 3TH3H 1F0UA 2M2AA 4KP0A 2ZU1A 1FXYA 1ZMLA 2BQ7B 2HLCA 5HKKD 6CHAC 3P8GA 1O2XA 1HJAB 4FUCA 3RXEA 3MU0A 5L2YH 1Z6JH 2RA0A 1CSOE 1A61H 5ESBA 5AFYH 1CGHA 1L1NA 2O8TA 1C1MA 1SC8U 1W0JD 3LGYA 2GTBA 1CQQA 2QYIA 5C1YA 1UTLM 1HV7A 1P2JA 1FZZA 1HAXB 3AK5A 2CHAC 3DD2H 4HFPB 1GG6C 2BZ6H 1WV7H 1GBHA 2ALVA 5GPIB 2Y5FA 4LZ4B 4FUHA 3TJNA 3TNSA 1IOEA 2ZDNA 3QWCH 5EQSA 2JETB 3VXFH 1OWEA 8LPRA 3MH6A 2AMPA 3BIVH 5JBCS 1ZPCA 2W7SA 2HNTC 1SQTA 1O3MA 2ANWA 1C5YB 1MU6B 3A87A 2WINI 1GHVH 1PPGE 1SMFE 4ABHA 2GP9B 3A81A 3GY8A 4AORA 2BD7A 1FLEE 2Z9IA 4Z6AH 5HM2A 1C2HA 1NBMD 1C5VA 1TPOA 2BQ6B 1MZAA 3A7TA 2O8WA 3VB5A 1DWBH 1B7XB 1C4U2 3F9EA 1O33A 2A4QA 1P8VC 3IITA 5DP6A 3HGNA 4RT0A 1TRMA 3STJA 1RTLA 2YMSC 1P57B 3I78A 2Y5GA 2W3IA 1GBLA 1KIGH 2J94A 1AQ7A 3M5MA 4YOIA 3URDA 1DICA 3HPTB 2C4FH 1IQNA 3JZ2B 1SFIA 2ZGCA 4DGJA 3ATWA 1MUEB 1O5EH 2HPQH 4ABBA 1CT2E 4U01A 1O2GH 1MMJN 2GCTB 4UFDH 1KLIH 1YPJH 1GBJA 3STIA 4YXWD 3AAUA 1HAOH 1MQ5A 1DOJA 1INCA 3AASA 1W10U 4CH8B 4TWYA 1C5WB 2BX3A 4X2YA 2GD4B 1HXFH 4ABAA 3TITA 2FOEA 3HK3B 1BTXA 4B1TA 5JB8S 3SI3H 1HYLA 1K1MA 2PTNA 2QXHA 1DDJA 4TSFD 3LH3A 2ZC9H 4BANB 2FI3E 2BY8X 2J9NA 3MH4A 5GWZA 1Q2WA 2P3TB 4TY6A 1CGJE 4I86A 1GBIA 4X1PU 1IQEA 1Z1IA 1GBTA 3P95A 4CREA 3F0OA 5E2PA 3O8CA 4MNVA 1EB2A 2ZDMA 3DSOA 5LPFA 2UWLA 1B5GH 4Y8YA 4BAQB 4DCDA 5F6MA 1JRSA 2ZTXA 1O3KA 1IQIA 3ZZ8A 1EOJA 1TNLA 2ZF0H 3ZVBA 1LHCH 1O3NA 1U6QA 1HRTH 2FOCA 1Q3XA 1LVYA 2B8OH 3V3MA 1JWTA 2H2ZA 3AAVA 1GCDA 5F8ZA 2GMTB 4X8TH 1C1OA 1NU9A 1ZRKA 1ETTH 1GDUA 5LPEA 4UFFH 3PLBA 3A8BA 3SJIA 2XCFA 3MI4A 1TOMH 1DVAH 3M5LA 2Y7ZA 3UTUH 2KM0A 1QURH 4XD7D 3H09A 1O2HA 2BB4A 1GI6A 1T4UH 3N7EA 4BAHB 3ESTA 2GGVB 5JDUB 1LQDB 2OCVB 7ESTE 1UHBA 1P0SH 1S6LA 2ZECA 3H7TA 2VWNA 5EG4A 3SV9A 1QL8A 3F2HA 1MTUA 1SI5H 2V3OH 2PGQB 1K1NA 1YY3A 1O31A 4MLFB 4B71A 1J15A 3BTEE 1O3BA 1DFPA 4RN6A 1ETSH 1TYNA 3E16B 1AGJA 3K65B 4K60A 1UTNA 4ABGA 1KXFA 1M9UA 2ZKSA 1Z8GA 3BEUA 1CT0E 2XWAA 5EODA 2KZ4A 3EAJA 1ELGA 2YNBA 1QY6A 3A8DA 2XW9A 1G3BA 1FX0B 3FVFB 4X1RU 1T8MA 1OKXA 2PHBA 1GMDF 2P3UB 2FODA 4NIVA 1EPTC 1KDQA 1S85A 2VWMA 4BNRA 4ISIH 1PPHE 2FP7B 1W0ZU 3BTGE 1NC6A 3D65E 2C90B 2BDHA 3VB7A 3UQOA 1GHAG 1C5RA 2JJ2D 4WMFA 1OWKA 2FIRH 1ZZZA 1N8OC 5AFZH 1SGQE 1GBBA 2XNDD 1UMAH 1O3DA 1DWDH 1TMBH 2AGEX 5A0BA 2Z3DA 3SUGA 2CK3D 1O3IA 1E34B 1FY8E 2TGDA 2XWBI 2ZIQH 1NRQH 1QIXB 3C1KA 5K7RA 3LGUA 1BT7A 1ZMNA 1FN6A 1C5MD 1VITH 1DPOA 2BY9X 5GXPA 1CGIE 3VPKA 2O8MA 3FO8D 3RXGA 3TGKE 3E8LA 2G4TA 4NG9H 1FI8A 3GDVA 3MO6A 2IPQX 2CJIA 1E36B 2FZZA 3F9FA 2D1JA 1GMHF 1GHBF 3E90B 5A09A 1SGFG 5EPYA 4SGBE 3GCTG 1RJXB 1ESTA 1LKAA 5ESTE 4YO9A 3IWMA 1GHZA 3A85A 3TK9A 1BQYA 5FAHA 1OYQA 3ODFA 3EDXB 5SGAE 1XXDA 3RXVA 3M36A 4Y71A 2BDIA 1O2IA 4DVAU 5LGOA 4Z1MD 1JIMA 3V13A 1ELVA 1F7ZA 2BM2A 1V3XA 1S82A 4IW4E 4TPIZ 3K6ZA 3RXBA 1XXFA 3LC5A 4IN1A 4OS2A 4NFFA 3OEED 2ZDAH 1MTNC 1O3CA 8GCHG 1CA8B 1LKBA 2OXSA 1Z71A 1H1BA 1O2PA 3DUXH 3MNXA 1OSSA 1IQFA 4CRAA 1AIXH 4JCNA 1PPBH 4ZHLU 4Y76A 1NRRH 2C8ZB 3RM2H 3ZV9A 3OAAD 2F9VA 3RLYH 1D9IA 4TYDA 2BDYA 2ALPA 4ACAA 6GCHF 2ODYB 1SPJA 2BY7X 3B8JA 1TNHA 1UHBB 2WSSD 4FUFA 1UK3A 1BRBE 2XNIA 2A0QB 2GDEH 4XFQA 5ETXA 1QL7A 3U8OH 1GWAA 3TGIE 1ABIH 5GJ4B 4ISOA 1WOFA 2BXUH 1AU8A 3IG6B 2F43B 5CHAB 3PYHA 1G3DA 1OP0A 1C1PA 3RDZA 2ILNA 3OTPA 1QQ4A 1BBRK 2ZCHP 3A8AA 2KCOA 4RT1A 2NU1E 1ANEA 1SQRA 5A0CA 4IBLH 3SNDA 1MH0A 2F9NA 3PWBA 2ZPSA 5EJ1A 2SGEE 4JYVH 3A7XA 1KDQB 5DP4A 2BLWA 4ZHAA 4SGAE 2TPIZ 3MH5A 3PM3A 4U2WA 4AG2A 2ULLA 1HCGA 1ELFA 6ESTA 2WUBA 1VCWA 5DSFA 5EW1H 2A1DB 1VZQH 3MYWA 4CHAB 2JH0D 2L74A 4NIXA 2G8TA 2UUJB 4Y0YE 3ZYDA 3RMOH 3KEEA 1K0HA 2ODQA 4BAMB 2VIDA 1GI2A 3SNEA 2ZO3H 5T3HA 1W8BH 2J97A 4MTBA 1XUJA 1XVMA 2CXVA 3TK6A 1PQ7A 1ZYOA 3FZZA 4AFZA 4JZDH 3BTWE 1FNIA 1TOCB 3AW1A 3RMNH 4E06H 1V2UT 2BD8A 4GLYA 1A7SA 1HAVA 2A2XH 2AYWA 4JZIA 3ZVGA 1QA7A 1SGEE 3GDSA 4OS5A 1EZXC 1W12U 5E0HA 4Q63A 2J95A 1BDAA 4HGCA 1MCVA 1ZPBA 2W6JD 1RFNA 2NU2E 1CA0B 1C1NA 1V2WT 2PSYA 1EXFA 3NCLA 3RXCA 1CBWC 1TA6A 2VVCA 5GCHF 4KTCA 5FCKA 1CVWH 4ZKNU 3BTDE 3GY5A 1C5XB 1NFUA 3PV5A 1C2IA 2FOBA 1O5DH 2AIPA 3GDUA 1V2QT 1TBRH 3F9HA 1S84A 4YLQH 4ESTE 4B2AA 4Y79A 4TWWA 2RCEA 4JZ1A 4U32A 3T2NA 2GDDA 4RKOB 2PKSC 1GI7B 4CRBA 3RXPA 1CU1A 1O38A 4A7IB 2OINA 2ANMH 1AI8H 2JH6D 1TX6A 1O37A 1H8HD 1LPKB 5EGMA 1F5KU 1OYTH 1Y5AT 3CS7A 3S7HB 1DY9A 1O3JA 3ZZ5A 1GL1A 5DP3A 4AFQA 1XUFA 4TY7A 1EZSC 2FOGA 4X6MA 3S7KB 4OS7A 1SGDE 1T4VH 3SNBA 1ZJKA 1LTOA 3R0FA 2VNTA 1HLTH 1ABJH 1ANCA 2ASUB 2UWPA 1F0TA 1Y8TA 1MAXA 1ZHPA 3P6ZB 3E0PB 1UW7A 1AHTH 1O5FH 5G4BA 1BBRH 1UVSH 1WU1A 1Y3YA 1GMHG 1GHBG 1HAZB 1HPGA 2C3SA 4AN7A 1TGSZ 2V35A 5T6DA 3GY6A 5JPMH 1BUIA 1GGDB 1SLWB 1D3TB 1O3LA 1BRCE 3Q00A 4TPYA 3Q3KA 1PQ8A 2XBYA 4MNYA 1A2CH 1K1PA 1F5RA 1LHEH 3SNAA 1LHFH 1FY5A 2ZHFH 3GY3A 3ODDA 1MAYA 3A83A 1OWDA 2WPLS 1SGIB 2F9OA 4ZUHA 1W7GH 2VWOA 1O3OA 2BD2A 3MMGA 3KQBA 4E7RG 1V2KT 1P03A 4XOJA 1NFYA 1YPEH 1C4Y2 1GBCA 2SGAA 5KGOA 3AVZA 3UNSA 3ATKA 3SN8A 2ESTE 3GCOA 1QJ1B 3TH2H 1HAIH 4NA9H 2P94A 3M7TA 3ZVCA 1YPHC 1GJBB 2VH0A 4JYUH 3KHVA 2ZPQA 3QDZB 1NU7B 1O2QA 3LT3A 1P02A 5HMAA 1K22H 2GT8A 4FUIA 4XBDA 3RXMA 4Y7BA 1LCYA 3U98H 2XC0A 1G30B 3UAIC 6GCHG 1OX1A 1W14U 1O2JA 2ZGJA 1K2I1 1HAVB 4WY3A 4XBCA 4B75A 3ZZCA 2C8WB 2PUXB 2PWXA 2PLXA 1C1WH 5C3NA 4DT7B 3SHCH 1FIZA 4ABEA 4A92A 1C5ZB 1AE8H 2CGAA 2Y81A 4YTAA 3UR6A 4DT4A 2AERH 3CENA 3VGCB 2JKHA 1UTQA 4WMDA 3QTOH 1O2MA 1A46H 4XBBA 4CRDA 2FS8A 4AG1A 3A84A 4OM9A 1IQGA 1C2LA 5C0TA 1TGBA 1TNJA 1BZXE 1HAHH 2A45B 3A82A 3M7UA 1Y3XA 1Y5BT 3NKKA 4Y11E 1TNKA 1YGCH 4UD9H 4B2CA 2V3MA 4F55A 3PRDA 3ZZAA 2QC2A 2WYJA 3KNXA 3B9FH 2NU3E 3UFAA 1XUKA 2V3HH 4XE4A 1A0LA 2ZHQH 1GBEA 3RUOA 2H5DA 4WXIA 2ZHWH 3KQEA 1RXPA 4Q80A 3SGQE 3NXPA 3ZVAA 3L3TA 2OK5A 4GCHF 1HXEH 4GHQA 1AUJA 4GPGA 1QBOA 2FYQA 4FUDA 2ZU3A 3UUZA 1MTVA 1WTHD 4R8TB 2W3KA 2Y80A 1Y3VA 4H42U 1EJNA 1FY1A 3GY2A 4MPXA 3T5FH 2QY0B 2BD3A 2QAAA 1OWHA 7LPRA 2H6MA 2QN5T 1FQ3A 2BQWB 3U28C 1C1UH 2YOLA 1QRWA 3BG4C 3RM0H 1T31A 2XTTB 3GCHC 3SU6A 1EB1H 1SLVB 2VWLA 1V2VT 4ZHMU 4X1SU 1O2RA 1AKSA 3SGBE 1NTPA 1EZUC 2VIPA 1D3PB 3OY5U 4FU9A 3MU5A 3DHKH 3OYPA 2A2QH 5TCAA 2VVUA 3TVJB 1S6HA 1DSUA 1Y3WA 2BMGB 1XMNB 1S83A 1Z7KA 1HAPH 1FPCH 3KN2A 2KR7A 1C5OH 9LPRA 4ASHA 4I8KA 1O34A 4Y7AA 1NRNH 3A86A 2HVXA 5AVDA 5HM9A 5E0JA 1E37B 1ZLRA 4JK5A 2BDAA 2TIOA 3GOVB 2PP6A 2G5VA 4P02A 2HLDD 3MFJA 1AB9B 1C1SA 2Q6DA 2AFQB 3TNTA 1YPGH 5A8YA 1ZGVA 2P95A 1TB6H 2HNTF 1A1RA 3SZNA 1RIWC 1GMCF 4IMQA 1IQLA 1F5LA 3NWUA 3LONA 4WH6A 2CF8H 4MNXA 2GKVE 2A4OA 1CHOF 1G2LA 3O8DA 2GCHF 2ZFFH 3QGJA 3SJOA 1WXRA 1GI0A 1S5SA 1FPHH 3H7OA 2P8OC 2OQUA 1UTPA 4B76A 2G81E 2B9LA 1BJUA 1UCYE 3RU4T 1KY9A 5F03A 3KQDA 2J34A 2ZU4A 3SORA 4H6TA 1H9LB 2G55A 4X6OA 1EZQA 1GHYH 3U1IB 1O2YA 1O2SA 1O5GH 1TGTA 2NU4E 1KXBA 2SFAA 3M61U 1A4WH 2PFEA 1TMTH 1ID5H 4GVUA 2VJ1A 2PSXA 2XRCA 4CRFA 1K1LA 4FU8A 4OS1A 3KYFA 1QB6A 2WHXA 1VITG 1YPMH 1AFQB 3UY9A 3OTJE 1OWJA 1YLDA 2CN0H 1B0EA 1LPGB 3UNRA 2Z9GA 1O5CB 1WTGH 2VBCA 4AYVB 1H9HE 1QQUA 1VGCB 3RXHA 1BJVA 1SGYE 4ZKRU 2Z9JA 5DGJA 2C93B 3FFGA 3MO3A 3GY4A 1LVOA 1K28D 3LKWA 1AMHA 1XUHA 3MH7A 5HIZA 1C9TA 2O9QA 4HZHA 4WVPE 5AHGH 2O8LA 5FL7D 5C5OA 3SU3A 1D3QB 4ABIA 3SBKA 2V0BA 3SI4H 3SYJA 4Q7XA 4UFEH 2J4IA 2VIOA 4JZEH 4K5ZA 1PPCE 1UK2A 2A5IA 1KTTB 1QJ6B 1GCTB 1O32A 1JRTA 2H9HA 4YM9A 2G5NA 4D8NA 3GYMA 2FESH 1T7CA 3D62A 2W26A 4NA8A 2A7CA 2VGCC 2HPPH 4YLUA 3KL6A 1D4PB 2ZQ2A 1TRYA 1D3DB 1HB0B 5A0AE 1UJ1A 2F3CE 2EC9H 3SV8A 4U30A 3U9AH 3ZZDA 2GZ8A 1O2ZA 3ITIA 2VIWA 1O3HA 1TQ7B 1TRNA 3QTVH 4MNWA 3T29A 2STBE 4NWKA 3SUEA 1WQSA 5IK2D 4DG4A 2C8XB 1O2LA 2OBOA 4VGCC 2Y5HA 2F9BH 2PGBB 1YLNA 1AKSB 1YPHE 2BLVA 2GV6A 4GHTA 2QGRA 5L2ZH 1ELTA 2FTMA 2ANYA 1QRXA 1ELDE 2W6ID 4JMYA 4MG3A 1QR3E 3E0NB 3TGJE 2BOKA 2FEQH 2LPRA 1Y5UT 1WCZA 1ZTKA 5TJXA 4MPUA 1FN8A 3PO1C 3PLPA 4CRGA 2J98A 5E2OA 1ACBE 3G01A 2QXIA 2Z3EA 3E6PH 1DWCH 1A3BH 3QK1A 1GJ7B 2XYAA 3DA9B 3BSQA 4WXVA 2H9EH 3Q76A 1EKBB 4ZROA 3SUFA 4BTIB 1NRPH 1DE7H 3FAOA 2DUCA 4OS6A 1H8DH 1DLKB 5J4QA 2B5TB 2QE7D 1GPZA 2GVFA 3ELAH 5T1VA 1F0SA 2Q6GA 5DP7A 4O03A 1DM4B 2B7DH 3SV7A 3UWJH 4I8GA 4AGKA 3TIUA 4X1QU 5CE1A 5CHBA 2I6QA 1TONA 5T6GA 3EE7A 7GCHF 4ZKSU 3EQ0H 3F68H 1QFKH 4IN2A 3EA9A 1NFXA 3V7TA 3DT0H 1BTYA 4X8UH 5K0HA 4BAKB 1V2NT 4BOHA 2BD4A 1YM0A 1F92A 1NM6A 4O9VA 5FX5A 3M3TA 5EQRA 4OGXA 3MU4A 3LU9B 1C2MA 1P2KA 3PMAB 1D6RA 2K0QA 3SU1A 2C8YB 4Y8ZA 2A4RA 6CHAB 4E05H 2ZZUH 5L30H 3NZIA 3P8FA 1HJAC 2OQ5A 1H4WA 5EXMA 1HJ9A 3GISB 1TX7A 3F3BA 1C2EA 5EOKA 2AIQA 4NWLA 3RMLH 1H8ED 1NRSH 1C5PA 1VJAU 2UUKB 3Q3YA 2WPMS 2CHAB 3K2UA 1GG6B 2A32A 3A88A 3N7OA 1OWIA 1CHGA 3UQVA 3FZDA 3LGWA 2JETC 3ZVFA 4I33A 2FX6A 2AGIX 3M3SA 1LDTT 5DO4H 1GJ9B 2VU8E 1GJ8B 3F1SB 1HFDA 3ZZBA 1KSNA 4ABJA 5LH8A 4NSYA 1UVOA 3DFLA 3PTNA 4KELA 2GCHG 1EFRD 1C2KA 4CR5A 1DANH 4BXWA 3BG8A 1ZOMA 1P04A 7KMEH 4GAWA 2ZFRH 1DLEA 3KCGH 5F53A 3RXDA 5TCCA 1AVWA 2G51A 3T62A 1UTMA 5ABWA 2Z7FE 4RI0A 2R0KA 5I46H 4OS4A 2J2UA 2QXJA 2YMSB 1P2NA 1TQ0B 5EU8A 2P16A 1LHGH 1WSSH 4J2YB 1FV9A 1YP9A 1IHTH 4A1TA 1F2SE 2LNCA 1DUEA 1KLJH 2HRVA 1C2DA 3D23A 1W2KH 4Q7YA 1EPTA 4A1VA 1HAYB 1TNGA 1OP2A 1ARCA 4BTTB 1YWUA 2PUQH 3TJUA 4FUEA 1GDQA 2J98B 3QGNB 1IQJA 2R3YA 1THSH 2ZCLP 4LK4A 1MQ6A 1IQHA 2GCTC 5IDKA 4RSPA 1P05A 1DUAA 1MD8A 2XC5A 1RS0A 1UTJA 4KKDA 1NROH 2RA3A 2D26C 1JMOH 1NESE 1ELCA 1QHRB 4B74A 4YOJA 5JBAS 4K8BA 4FOUC 5GNDA 1KLTA 3LDXH 5FPYA 1SQOA 1TGCA 3M5NA 3PMHB 4I32A 2KAIA 1EQ9A 2BVSH 1QBVH 1HGTH 1TLDA 3LPRA 3N7DA 1SFQB 3UPEA 3KYGA 3URCA 4AB9A 1C2FA 6LPRA 3PMBB 4AC9A 1MD7A 2KCPA 5JBTA 3UB0A 4D7GA 2Z6BD 5E0GA 3PV2A 1O2WA 1EUFA 2RG3A 1BOQA 1FMGA 3E3TA 1H8IH 1GJ6A 1SGPE 1RD3B 2ZI2H 1EAIA 2STAE 4UEHH 1ELBA 5C94A 4D76A 2VVVA 3ZZ9A 4CBNA 1EOLA 3L33A 1DS2E 4FUJA 1NS3A 2GZ7A 1ZHRA 1GJ4H 1K1JA 4NSVA 1G9IE 1V2TT 1C2GA 5C5NA 1GMDG 1PJPA 3I77A 4DIHH 2BDBA 1SHYA 1Z8IB 3ZV8A 1PQAA 1FJSA 1AVGH 1V2LT 2GMTC 1Q31A 5GIBA 1NY22 1BTUA 2FI5E 2IJOB 5BPEA 4R0IA 1W11U 3UOPA 1GVLA 3VFEA 4DOQA 2KCAA 1GI5A 3OX7U 2FXRA 1J14A 2P93A 4X6PA 3TJVA 1P3CA 2QCYA 2JDID 4GUXA 4IC6A 3LIWA 3RXIA 1DXWA 3EYDA 1UTKA 3V12A 3M3VA 3M5OA 1K9OE 4DW2U 2NU0E 4F4OC 4INKA 5FBIA 3MWIU 4NA7A 4I7YH 4TT3D 3TPIZ 1COWD 1WAYB 2VIVA 1O2VA 4INLA 3SQHE 4HI3A 5FHTA 3SOSA 1GBDA 4X2WA 4MPWA 5DN6D 3U8RH 1AD8H 4UFGH 2LP6A 3BEFB 4FVDA 5GDSH 1O5BB 3B23B 1TAWA 2D2DA 4ZH8A 1O36A 1WBGB 1AFEH 4NCYA 4MDSA 2FYRA 2HALA 3MU1A 3SJ9A 4E7NA 1HDTH 2ZDLA 2P59A 3VB3A 3ZIAD 2ZTZA 2AMQA 2ZGXH 1NO9H 2G4UA 2PV9B 1YCPH 1EJAA 3A7YA 3BIUH 3MHWU 2V7QD 4MVNA 5H4IB 4Y8XA 2BDGA 1BTHH 1EAUA 1L1JA 1EPTB 2AEIH 2UWOA 2JH5D 3WWBA 4HTCH 5BRRE 5KECA 3LJJA 1AWHB 3RMMH 3UIRA 4MQAA 1O2TA 1EAWA 1N8OB 1LO6A 1A5HA 4JK6A 3WWFA 1PPZA 3PROA 5DK1A 4ZMAH 1GHXH 4UE7H 2OC0A 1B0FA 2THFB 2WPJS 4WJG2 1A0JA 4YT6H 3ATLA 1K21H 2ZNKH 1QGFA 3FKSD 1P2IA 1PPEE 3SJ8A 3ZZ6A 5C67A 1E0FD 1XKAC 1AZ8A 1L4ZA 3RU4E 3RXJA 1BIOA 1XUGA 2KAIB 1KXEA 3H5CB 5IYTA 4FVBA 1SB1H 1QBNA 3KF2A 4ZXXH 3S9BA 1WDIA 4YOGA 3RC5A 2EI8A 3TJOA 2ZHDA 4Q4LA 1ELEE 2XC4A 3F9GA 5A8ZA 1QNJA 3PRBA 1VCPA 3JZ1B 1MZDA 1Z8JB 1TIOA 3R3GB 5A2MH 3SHAH 3HK6B 1TWXB 1OS8A 3BF6H 2GV7A 4AFSA 1N1LA 2J92A 3W1EA 2W7UA 3QZRA 3W94A 2OUAA 2ZPRA 1DSTA 4YESB 1YKTA 2ZU2A 2AH4X 3HKJB 1P9UA 2ZFPH 3E1XB 2FS9A 2OLGA 3SQEE 3OEHD 5CMXH 4X8VH 3BTFE 3QUMP 3LH1A 1NPMA 5EQQA 1BTPA 1G3CA 1PYTD 3SU2A 1QRZA 4WF8A 1AN1E 1MKXK 5JB9S 5C0UA 1ORFA 1SOZA 1GHAF 3ATMA 3VXEH 1NZQH 3EE0B 3PB1E 3V0XA 1XVOA 2WZQA 2BOHB 1MTNB 1UVTH 3RXKA 1C1RA 1THRH 2PR3A 1CO7E 4BXSA 4Q2KA 3NUMA 2BYAX 1SLUB 2Y6TA 2QF5A 1YLCA 2TRMA 1V2PT 4LZ1H 1E1RD 2GX4A 1KYNA 3WW7A 1FAKH 5I25A 1C5UA 5EJZA 2J38A 3M37A 2UUYA 1ANBA 3RXFA 1FY3A 3P8OA 1QTFA 2FDAA 1IQMA 1ARBA 1BB0B 5B6LA 3OFND 2ZA5A 1QJ7B 4X2VA 4WWYA 2GZ9A 3GCTF 1BMFD 1G3EA 2ODPA 2BD5A 1AVXA 3KQCA 2Y7XA 3TH4H 5CHAC 2PW8H 4Y10E 4B73A 2JIZD 5J4SA 2ZDVH 1ESAA 4Q7ZA 1TFXA 4NZQA 4XRNA 1MTSA 1ZSKA 2HGTH 3BTQE 5HGGA 3KGPA 2M5TA 5C17A 1XX9A 3MNSA 1V6DA 1WQVH 2RDLA 5GCHG 1MU8B 4DIIH 3OSYA 5C1XA 1GJ5H 1GJDB 2ZCKP 3PLKA 1C5LH 3PTBA 1GJCB 4WH8A 3T28A 3SNCA 8GCHF 4CHAC 2DE8A 2ZEBA 3FP8E 2SNWA 4B2BA 1QZ8A 1BHXF 1LPZB 1SGNE 1KXCA 1P2MA 1FAXA 1HAGE 2AGGX 3FOAA 2TGAA 3RU4D 1UVUH 1MABB 2H1UA 3VEQB 1LQEA 4A1XA 4AX9H 1FY4A 1C1QA 1FUJA 1BMNH 1N6YA 1BRUP 2F83A 1EP6A 3UR9A 3A7WA 5FPSA 5E8EH 1W0YH 3RXAA 1YBWA 3I29A 1W3CA 1AWFH 1S6FA 1J9CH 2J5UA 1W13U 3ZYEA 1UCYK 1ZPZA 3BTHE 3UREA 3SV2H 2FI4E 3P8NA 3O8BA 5T6FA 1AE5A 3VG8A 3SZEA 1SGFA 3P70B 2QF3A 2EEKA 4NFEA 5C2ZA 5EPNA 1P06A 1CA0C 2ZGHA 2Z9KA 1V2JT 2TGPZ 1V2MT 1HUTH 1TGNA 1S0RA 4CBOA 4Y6DA 3A80A 2HOBA 5EXLA 4I31A 1OXGA 2SGFE 2VIQA 1CBWB 1QCPA 1MKXH 1G37A 2QF4A 3MU8A 3Q3XA 8ESTE 1GBFA 2IPHA 1XUIA 1GI1A 4FUBA 2ZQ1A 4NIWA 1TABE 1P10A 1F0RA 2ZP0H 2YNAA 2O8UA 3RP2A 3F6UH 1O2NA 2Q1JA 2IN2A 1ETRH 1ZMJA 1ZSJA 1TPSA 2KX4A 2PKSB 3SU4A 2ZWLH 2PKAA 4AZ2B 2EI7A 2PTCE 1P9SA 1SGTA 3TLOA 1IQKA 2F91A 1MCTA 2Z3CA 2SGDE 1O5AB 1SOTA 1VCQA 3F2GA 1THPB 4FU7A 1L4DA 2SNVA 3BV9B 2TGTA 1S0QA 1KTSB 1J16A 5JBBS 1ESBA 1P09A 3GY7A 4M9FA 3NPSA 3NRLA 3S9AA 3QO6A 1C5TA 3ZVDA 1UK4A 4A6LA 1JIRA 1PYTC 4AYYB 1PPFE 5KEDA 1NN6A 4O3TA 2K8IA 4J1YA 1DWEH 1L1GA 2KCYA 3Q77A 4CR9A 4D7FA 2R2MB 3UWIA 2FTLE 3EA8A 1G32B 1HBTH 1DY8A 1EP5A 5EXNA 1GGDC 1TA2A 1AY6H 4IS5A 3EA7A 1NFWA 4I8LA 3A7VA 2K1QA 2OC7A 3GS9A 2R9PA 1O2KA 3FP6E 1YPLH 3CP7A 1ZJDA 3DSPA 1VR1H 2A31A 3LJOA 5LPRA 1IAUA 2FMJA 2ZU5A 2W5EA 1XM1A 1TPAE 4ISLA 2LELA 2VB0A 1O30A 4ISHH 3MQKC 4QT8C 3PWCA 3UNQA 2WPIS 3KIDU 4D9RA 3SO3A 2BVXH 2F9PA 1MKWK 2H5CA 3ZVEA 5EW2H 4I8HA 1O35A 2XBVA 5DJ7A 1BTZA 1AZZA 1O2OA 2QF0A 2BZAA 5DP9A 4H4FA 3D49H 3RC4A 1G36A 1K1IA 2A7JA 2Y82A 3OU0A 4GCHG 1UCYH 2R2WU 4HG6A 4YZUA 1O3GA 3C27B 2VH6A 1Y59T 1DITH 1E35B 3FANA 2GT7A 1C5NH 4PROA 4XDEA 1GI9B 3A89A 2IJD1 2AHME 1KXDA 3DSGA 2D8WA 2CF9H 1T8NA 4FUGA 2OC1A 3S9CA 1HIAA 1P01A 3RXTA 1EX3A 1CT4E 2FOMB 5HYOA 3RXRA 3RC6A 1XKBC 3VGCC 3U1JB 1AO5A 3RXSA 1P2QA 4GSOA 1ELAA 3E91A 1GI8B 3SU0A 2A5AA 2CV3A 3MNBA 1Z1JA 3GICB 3SJKA 5FX6A 4M7GA 2HNTE 2KFWA 4D9QA 1HJ8A 3M35A 8KME2 4DJZB 4B6EA 1MBQA 1T8LA 3MO9A 1FONA 2G52A 4DY7B 2ZTYA 2OC8A 1RRKA 2XBWA 2GJGA 3A8CA 4RKJB 4CRCA 2FPZA 4KTUA 1OOKB 2R3UA 3U8TH 4INHA 1TBZH 2PKAB 1BHXB 3PMJA 5JYIA 4AB8A 1NT1A 1HNEE 1GMCG 3LC3A 4B6FA 1DX5M 1SGRE 1C5SA 2F4LA 1C4V2 1CHOG 3CS0A 1ZTLA 1BITA 2RFKC 1Z6EA 1BTWA 1RTFB 4OGYA 5DPAA 1YC0A 3P92A 2BXTH 2EI6A 1O3PB 1C1TA 2BX4A 1E1QD 1QA0A 5FPTA 4F48B 1C2JA 4X8SH 4K1SA 4Y0ZE 3ZZ7A 3K6YA 1OPHB 2WPHS 1W7XH 4AGJA 1J17T 2FWWA 4AFUA 3K9XB 3HGPA 3TU7H 5AF9H 3BG4B 1DT2A 3GCHB 1ZHMA 1KMHB 3LGTA 4KTSA 1MBMA 2A4GA 4K1EA 3S0NA 5HIYA 5DP5A 9ESTA 1BRAA 5L6NH 1GVZA 4DURA 1RTKA 1BMLA 1JXPA 2EQNA 1BBRE 1YF4A 4KGAA 1SR5C 1YCPK 3LGVA 1O2UA 4O3UA 1SSXA 2L6OA 5CDFE 1K1OA 1GBKA 4X0WU 1A3EH 2ZFSA 4X2XA 3QLPH 2WPDD 3BTTE 5DKMA 1GDNA 2FOHA 3RXLA 1Y3UA 3NK8A 5EJLA 1JOUB 1MKWH 3HKIB 4IC5A 4THNH 3MOCA 1PFXC
chains in the Genus database with same CATH topology
1A5IA 1UTOA 1EAXA 1EJMA 2OBQA 1TE0A 2V6NA 1AB9C 1O39A 2R0LA 4H6SB 3BTKE 3RLWH 4A5TS 3RXQA 4NGAH 4YT7H 1RIWB 4K8YA 2BDCA 4K3JA 4ABFA 1FIWA 1TMUH 1QL9A 3BEIB 3PV4A 1PQ5A 1BMAA 4K2YA 2ANKH 1SLXB 1G2MA 3RXUA 2EA3A 1X7AC 1BMMH 1SG8B 3ENSB 1E38B 2QV1A 3VB6A 1C5QA 1V2RT 1CE5A 1S81A 2SGPE 2P8OB 4NZLA 1GBAA 2Q6FA 3U69H 1V2ST 1GVKB 1OP8A 4CH2B 1GL0E 2ZFTA 1FDPA 1V2OT 3ZZ4A 1TPPA 3GYLB 1BCUH 3L6PA 2UUFB 2AMDA 3AW0A 1YPKH 1HIAB 1SL3A 4IGDA 1Z8RA 4O97A 2FOFA 2QA9E 2QIQA 5F8TA 3T27A 1QB1A 2WV5A 1P3EA 1IHSH 1RGQA 1ANDA 2BLQA 4Z0KA 1TNIA 3GCNA 2XBXA 2HWLB 1SHHB 2I6SA 3MTYA 1EATA 1AFQC 2SGQE 5HXFA 4X1NU 2A7HA 1A5GH 4X6NA 1YYY1 1VGCC 1SQAA 1P11E 2CMYA 3TK5A 1O3FA 2WYGA 1O3EA 1SBWA 1WUNH 2AS9A 1SVPA 2B0FA 2OD3B 4ISNA 2BY5X 1T32A 3SW2B 1KXAA 1A0HB 5DG6A 1WYKA 3QN7A 1TX8A 5DP8A 1GBMA 1P2OA 2XXLA 3SUDA 2OP9A 1JBUH 4IMZA 1GCTC 4UONA 2FX4A 3LGIA 3S69A 1C1VH 2WV4A 2FOAA 4JZFH 1P12E 3ZZ3A 1L0ZA 2VGCB 7GCHG 4ZAEA 4LXBH 2P3FH 5FXLA 2XCNA 2FM2A 1GI4A 5FCRA 1N6XA 1T8OA 3SGAE 4MPVA 4JYTA 1L2EA 1YCPM 3BN9A 4BAOB 4BTUB 1TBQH 5C1UA 2Z9LA 1O0DH 3QX5H 2BLOA 4NIYA 4AOQA 3SV6A 2ZFQH 2WPKS 3FP7E 2ZG0H 2BD9A 1C9PA 2ZDKA 1O3AA 4I8JA 4VGCB 3M7QA 3W95A 3UOUA 3VB4A 1ZTJA 1DXPA 5C20A 2NWNA 3P17H 1VITF 4FXGH 1J8AA 2IOTA 1ZGIA 2OTVA 5PTPA 1BA8B 1ZRBA 1GI3A 1GJAB 3PO1B 1TALA 2ZGBH 3SU5A 1VJ9U 1GHWH 2BTCE 5B6OA 2TBSA 3RXOA 2BVRH 2H9TH 4LOYH 4K69A 2QXGA 4XSKU 2ZHEH 4ZKOU 1LVMA 2A5KA 5F8XA 2VINA 4UDWH 1ZR0A 3DFJA 1AUTC 3LOXA 1D6WA 2G00A 2FLBH 3WY8A 1LMWB 1UO6A 2FLRH 3OY6U 3ATIA 2FO9A 1LVBA 1LHDH 1MTWA 3O8RA 1EASA 4ZXYH 4K1TA 1H9IE 1QB9A 3MNCA 1UVPA 2Z94A 3EGKH 2WUCA 5A8XA 2F9UA 4WMEA 3QZQA 3HATH 1SGCA 5FBEA 3T26A 3T25A 3BTME 2DE9A 3A7ZA 4F49A 2BHGA 4ABDA 2BY6X 1ZSLA 3TH3H 1F0UA 4KP0A 2ZU1A 1FXYA 1ZMLA 2BQ7B 2HLCA 6CHAC 3P8GA 1O2XA 1HJAB 4FUCA 3RXEA 3MU0A 5L2YH 1Z6JH 2RA0A 1CSOE 1A61H 5ESBA 5AFYH 1CGHA 1L1NA 2O8TA 1C1MA 1SC8U 3LGYA 2GTBA 1CQQA 2QYIA 5C1YA 1UTLM 1HV7A 1P2JA 1FZZA 1HAXB 2CHAC 3DD2H 4HFPB 1GG6C 2BZ6H 1WV7H 1GBHA 2ALVA 5GPIB 2Y5FA 4LZ4B 4FUHA 3TJNA 3TNSA 1IOEA 2ZDNA 3QWCH 5EQSA 2JETB 3VXFH 1OWEA 8LPRA 3MH6A 2AMPA 3BIVH 5JBCS 1ZPCA 2W7SA 2HNTC 1SQTA 1O3MA 2ANWA 1C5YB 1MU6B 3A87A 2WINI 1GHVH 1PPGE 1SMFE 4ABHA 2GP9B 3A81A 3GY8A 4AORA 2BD7A 1FLEE 2Z9IA 4Z6AH 5HM2A 1C2HA 1C5VA 1TPOA 2BQ6B 1MZAA 3A7TA 2O8WA 3VB5A 1DWBH 1B7XB 1C4U2 3F9EA 1O33A 2A4QA 1P8VC 3IITA 5DP6A 3HGNA 1TRMA 3STJA 1RTLA 1P57B 3I78A 2Y5GA 2W3IA 1GBLA 1KIGH 2J94A 1AQ7A 3M5MA 4YOIA 3URDA 1DICA 3HPTB 2C4FH 1IQNA 3JZ2B 1SFIA 2ZGCA 4DGJA 3ATWA 1MUEB 1O5EH 2HPQH 4ABBA 1CT2E 4U01A 1O2GH 1MMJN 2GCTB 4UFDH 1KLIH 1YPJH 1GBJA 3STIA 3AAUA 1HAOH 1MQ5A 1DOJA 1INCA 3AASA 1W10U 4CH8B 4TWYA 1C5WB 2BX3A 4X2YA 2GD4B 1HXFH 4ABAA 3TITA 2FOEA 3HK3B 1BTXA 4B1TA 5JB8S 3SI3H 1HYLA 1K1MA 2PTNA 2QXHA 1DDJA 3LH3A 2ZC9H 4BANB 2FI3E 2BY8X 2J9NA 3MH4A 5GWZA 1Q2WA 2P3TB 4TY6A 1CGJE 1GBIA 4X1PU 1IQEA 1Z1IA 1GBTA 3P95A 4CREA 5E2PA 3O8CA 4MNVA 1EB2A 2ZDMA 5LPFA 2UWLA 1B5GH 4Y8YA 4BAQB 4DCDA 5F6MA 1JRSA 2ZTXA 1O3KA 1IQIA 3ZZ8A 1EOJA 1TNLA 2ZF0H 3ZVBA 1LHCH 1O3NA 1U6QA 1HRTH 2FOCA 1Q3XA 1LVYA 2B8OH 3V3MA 1JWTA 2H2ZA 3AAVA 1GCDA 5F8ZA 2GMTB 4X8TH 1C1OA 1NU9A 1ZRKA 1ETTH 1GDUA 5LPEA 4UFFH 3PLBA 3A8BA 3SJIA 2XCFA 3MI4A 1TOMH 1DVAH 3M5LA 2Y7ZA 3UTUH 1QURH 1O2HA 2BB4A 1GI6A 1T4UH 4BAHB 3ESTA 2GGVB 5JDUB 1LQDB 2OCVB 7ESTE 1UHBA 1P0SH 2ZECA 3H7TA 5EG4A 2VWNA 3SV9A 1QL8A 1MTUA 1SI5H 2V3OH 2PGQB 1K1NA 1O31A 4MLFB 4B71A 1J15A 3BTEE 1O3BA 1DFPA 4RN6A 1ETSH 1TYNA 3E16B 1AGJA 3K65B 4K60A 1UTNA 4ABGA 1KXFA 1M9UA 2ZKSA 1Z8GA 3BEUA 1CT0E 2XWAA 5EODA 3EAJA 1ELGA 2YNBA 1QY6A 3A8DA 2XW9A 1G3BA 3FVFB 4X1RU 1T8MA 1OKXA 2PHBA 1GMDF 2P3UB 2FODA 4NIVA 1EPTC 1KDQA 1S85A 2VWMA 4BNRA 4ISIH 1PPHE 2FP7B 1W0ZU 3BTGE 1NC6A 3D65E 2C90B 2BDHA 3VB7A 3UQOA 1GHAG 1C5RA 4WMFA 1OWKA 2FIRH 1ZZZA 1N8OC 5AFZH 1SGQE 1GBBA 1UMAH 1O3DA 1DWDH 1TMBH 2AGEX 5A0BA 2Z3DA 3SUGA 1O3IA 1E34B 1FY8E 2TGDA 2XWBI 2ZIQH 1NRQH 1QIXB 3C1KA 5K7RA 3LGUA 1BT7A 1ZMNA 1FN6A 1C5MD 1VITH 1DPOA 2BY9X 5GXPA 1CGIE 3VPKA 2O8MA 3RXGA 3TGKE 3E8LA 2G4TA 4NG9H 1FI8A 3GDVA 3MO6A 2CJIA 1E36B 2FZZA 3F9FA 2D1JA 1GMHF 1GHBF 3E90B 5A09A 1SGFG 5EPYA 4SGBE 3GCTG 1RJXB 1ESTA 1LKAA 5ESTE 4YO9A 3IWMA 1GHZA 3A85A 3TK9A 1BQYA 5FAHA 1OYQA 3ODFA 3EDXB 5SGAE 1XXDA 3RXVA 3M36A 4Y71A 2BDIA 1O2IA 4DVAU 5LGOA 1JIMA 3V13A 1ELVA 1F7ZA 2BM2A 1V3XA 1S82A 4IW4E 4TPIZ 3K6ZA 3RXBA 1XXFA 3LC5A 4IN1A 4OS2A 4NFFA 2ZDAH 1MTNC 1O3CA 8GCHG 1CA8B 1LKBA 2OXSA 1Z71A 1H1BA 1O2PA 3DUXH 3MNXA 1OSSA 1IQFA 4CRAA 1AIXH 4JCNA 1PPBH 4ZHLU 4Y76A 1NRRH 2C8ZB 3RM2H 3ZV9A 2F9VA 3RLYH 1D9IA 4TYDA 2BDYA 2ALPA 6GCHF 2ODYB 1SPJA 2BY7X 3B8JA 1TNHA 1UHBB 4FUFA 1UK3A 1BRBE 2XNIA 2A0QB 2GDEH 4XFQA 5ETXA 1QL7A 3U8OH 1GWAA 3TGIE 1ABIH 5GJ4B 4ISOA 1WOFA 2BXUH 1AU8A 3IG6B 5CHAB 3PYHA 1G3DA 1OP0A 1C1PA 3RDZA 2ILNA 1QQ4A 1BBRK 2ZCHP 3A8AA 2NU1E 1ANEA 5A0CA 4IBLH 3SNDA 1MH0A 2F9NA 3PWBA 2ZPSA 2SGEE 4JYVH 3A7XA 1KDQB 5DP4A 2BLWA 4ZHAA 4SGAE 2TPIZ 3MH5A 3PM3A 4U2WA 4AG2A 2ULLA 1HCGA 1ELFA 6ESTA 2WUBA 1VCWA 5EW1H 2A1DB 1VZQH 3MYWA 4CHAB 2JH0D 4NIXA 2G8TA 2UUJB 4Y0YE 3ZYDA 3RMOH 3KEEA 2ODQA 4BAMB 2VIDA 1GI2A 3SNEA 2ZO3H 5T3HA 1W8BH 4MTBA 1XUJA 1XVMA 2CXVA 3TK6A 1PQ7A 1ZYOA 3FZZA 4AFZA 4JZDH 3BTWE 1FNIA 1TOCB 3AW1A 3RMNH 4E06H 1V2UT 2BD8A 4GLYA 1A7SA 1HAVA 2A2XH 2AYWA 4JZIA 3ZVGA 1QA7A 1SGEE 3GDSA 4OS5A 1EZXC 1W12U 5E0HA 2J95A 1BDAA 4HGCA 1MCVA 1ZPBA 1RFNA 2NU2E 1CA0B 1C1NA 1V2WT 2PSYA 1EXFA 3NCLA 3RXCA 1CBWC 1TA6A 2VVCA 5GCHF 4KTCA 5FCKA 1CVWH 4ZKNU 3BTDE 3GY5A 1C5XB 1NFUA 1C2IA 2FOBA 1O5DH 2AIPA 3GDUA 1V2QT 1TBRH 3F9HA 1S84A 4YLQH 4ESTE 4B2AA 4Y79A 4TWWA 2RCEA 4JZ1A 4U32A 3T2NA 2GDDA 4RKOB 2PKSC 1GI7B 4CRBA 3RXPA 1CU1A 1O38A 4A7IB 2OINA 2ANMH 1AI8H 2JH6D 1TX6A 1O37A 1LPKB 5EGMA 1F5KU 1OYTH 1Y5AT 3CS7A 3S7HB 1DY9A 1O3JA 3ZZ5A 1GL1A 5DP3A 4AFQA 1XUFA 4TY7A 1EZSC 2FOGA 4X6MA 3S7KB 4OS7A 1SGDE 1T4VH 3SNBA 1ZJKA 1LTOA 3R0FA 2VNTA 1HLTH 1ABJH 1ANCA 2ASUB 2UWPA 1F0TA 1Y8TA 1MAXA 1ZHPA 3P6ZB 3E0PB 1AHTH 1O5FH 5G4BA 1BBRH 1UVSH 1WU1A 1Y3YA 1GMHG 1GHBG 1HAZB 1HPGA 2C3SA 4AN7A 1TGSZ 2V35A 5T6DA 3GY6A 5JPMH 1BUIA 1GGDB 1SLWB 1D3TB 1O3LA 1BRCE 3Q00A 4TPYA 3Q3KA 1PQ8A 2XBYA 4MNYA 1A2CH 1K1PA 1F5RA 1LHEH 3SNAA 1LHFH 1FY5A 2ZHFH 3GY3A 3ODDA 1MAYA 3A83A 1OWDA 2WPLS 1SGIB 2F9OA 4ZUHA 1W7GH 2VWOA 1O3OA 2BD2A 3MMGA 3KQBA 4E7RG 1V2KT 1P03A 4XOJA 1NFYA 1YPEH 1C4Y2 1GBCA 2SGAA 3AVZA 3UNSA 3ATKA 3SN8A 2ESTE 3GCOA 1QJ1B 3TH2H 1HAIH 4NA9H 2P94A 3M7TA 3ZVCA 1YPHC 1GJBB 2VH0A 4JYUH 3KHVA 2ZPQA 3QDZB 1NU7B 1O2QA 3LT3A 1P02A 5HMAA 1K22H 2GT8A 4FUIA 4XBDA 3RXMA 4Y7BA 1LCYA 3U98H 2XC0A 1G30B 6GCHG 1OX1A 1W14U 1O2JA 2ZGJA 1K2I1 1HAVB 4WY3A 4XBCA 4B75A 3ZZCA 2C8WB 2PUXB 2PWXA 2PLXA 1C1WH 5C3NA 4DT7B 3SHCH 1FIZA 4ABEA 4A92A 1C5ZB 1AE8H 2CGAA 2Y81A 4YTAA 3UR6A 2AERH 3CENA 3VGCB 2JKHA 1UTQA 4WMDA 3QTOH 1O2MA 1A46H 4XBBA 4CRDA 2FS8A 4AG1A 3A84A 1IQGA 1C2LA 1TGBA 1TNJA 1BZXE 1HAHH 2A45B 3A82A 3M7UA 1Y3XA 1Y5BT 3NKKA 4Y11E 1TNKA 1YGCH 4UD9H 4B2CA 3ZZAA 2QC2A 2WYJA 3KNXA 3B9FH 2NU3E 3UFAA 1XUKA 2V3HH 4XE4A 1A0LA 2ZHQH 1GBEA 3RUOA 2H5DA 4WXIA 2ZHWH 3KQEA 1RXPA 4Q80A 3SGQE 3NXPA 3ZVAA 3L3TA 4GCHF 1HXEH 4GHQA 1AUJA 4GPGA 1QBOA 2FYQA 4FUDA 2ZU3A 3UUZA 1MTVA 1WTHD 4R8TB 2W3KA 2Y80A 1Y3VA 4H42U 1EJNA 1FY1A 3GY2A 4MPXA 3T5FH 2QY0B 2BD3A 2QAAA 1OWHA 7LPRA 2H6MA 2QN5T 1FQ3A 2BQWB 1C1UH 2YOLA 1QRWA 3BG4C 3RM0H 1T31A 2XTTB 3GCHC 3SU6A 1EB1H 1SLVB 2VWLA 1V2VT 4ZHMU 4X1SU 1O2RA 1AKSA 3SGBE 1NTPA 1EZUC 2VIPA 1D3PB 3OY5U 4FU9A 3MU5A 3DHKH 3OYPA 2A2QH 5TCAA 2VVUA 3TVJB 1S6HA 1DSUA 1Y3WA 2BMGB 1XMNB 1S83A 1Z7KA 1HAPH 1FPCH 3KN2A 1C5OH 9LPRA 4ASHA 4I8KA 1O34A 4Y7AA 1NRNH 3A86A 2HVXA 5AVDA 5HM9A 5E0JA 1E37B 1ZLRA 4JK5A 2BDAA 2TIOA 3GOVB 2G5VA 3MFJA 1AB9B 1C1SA 2Q6DA 2AFQB 3TNTA 1YPGH 5A8YA 1ZGVA 2P95A 1TB6H 2HNTF 1A1RA 3SZNA 1RIWC 1GMCF 4IMQA 1IQLA 1F5LA 3NWUA 3LONA 4WH6A 2CF8H 4MNXA 2GKVE 2A4OA 1CHOF 1G2LA 3O8DA 2GCHF 2ZFFH 3QGJA 3SJOA 1GI0A