5LPEA

Kallikrein-related peptidase 10 complex with zn2+
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
226
structure length
204
Chain Sequence
b'PCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTAAHCGNKPLWARVGDQGEQLRRTTRSVVHPKYRTDEHDLMLLKLARPVVLGPRVRALQLPYRCAQPGDQCQVAGWGTTANKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kallikrein-10
molecule tags Hydrolase
source organism Homo sapiens
publication title Structural basis for the Zn2+ inhibition of the zymogen-like kallikrein-related peptidase 10.
pubmed doi rcsb
total genus 44
structure length 204
sequence length 226
chains with identical sequence B
ec nomenclature ec 3.4.21.-:
pdb deposition date 2016-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5lpeA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5lpeA02
2OBOA 5FBIA 2ULLA 4A5TS 2HNTE 4NIXA 3A85A 2GV6A 5F03A 3E91A 1O3FA 2BY8X 4ESTE 3GYMA 1ZHMA 3SV8A 1RTKA 3QX5H 4ZHMU 2B7DH 1C2EA 4Y8XA 1O31A 4X8VH 2FYRA 2QF3A 4NA7A 2G4UA 2BD8A 2ZFSA 1QTFA 1Y5UT 2AIPA 4JK6A 2BM2A 1A2CH 1K2I1 1NT1A 2P16A 1HAYB 4A1VA 2Z94A 1ANCA 2D2DA 4B71A 4I8LA 3KHVA 1LHFH 3SUFA 1ZJKA 5FPSA 1V2ST 4H4FA 1T8OA 2AS9A 1TNLA 4HFPB 1HAGE 1VZQH 3RP2A 4FUCA 2Z7FE 1HIAB 1CT4E 1G30B 2HPQH 4I7YH 1SGFG 1UK4A 4DVAU 1A3EH 3SW2B 3VB7A 1K21H 3LT3A 3DUXH 5C1XA 1ZMLA 2C8WB 1SB1H 1O2IA 2F9VA 2ZFTA 2CJIA 3H7TA 1BBRK 2O8LA 2BMGB 1OX1A 3U1IB 3TNSA 1W10U 1P3EA 2XWBI 1C1MA 2Y80A 5JBAS 1N6YA 4DW2U 1A7SA 2BX4A 1DANH 3BF6H 1TWXB 2J34A 3MFJA 1CT2E 3ATIA 1QA0A 2QF0A 3S7HB 1ETTH 4K3JA 2BLQA 1GBLA 1P2QA 3EE0B 1S81A 4BAKB 2FOHA 3ZVAA 1P2KA 5F8ZA 1HV7A 3SU5A 4A1XA 2D26C 3ZYDA 2UUYA 1FQ3A 1YPJH 1PPCE 1C5MD 1GJ6A 4ISOA 3CENA 4X8TH 4U01A 1PYTD 1FJSA 3F6UH 1ZHRA 2XYAA 4BTUB 4O3UA 2OC1A 2A7CA 3SJOA 2SGQE 3MWIU 1GGDC 2ZCHP 1KXBA 1GI6A 4KP0A 1BBRE 3GY8A 4X2YA 1ZYOA 4NZLA 5K7RA 3M5MA 2ZEBA 3T27A 1BOQA 1E34B 1PYTC 1YLDA 4ISNA 3DA9B 5E0GA 3BTME 1ELTA 2HWLB 3SJKA 1C1QA 1Q3XA 3ATKA 2CHAB 4ABAA 3SUDA 1EATA 5JBTA 3A8CA 2VU8E 1AB9B 1ARCA 3KNXA 4I8GA 1TIOA 1O3LA 2BDCA 3FAOA 1O5GH 3M3VA 3U9AH 3E6PH 1ZMNA 1UTQA 3A87A 1EAUA 1XUFA 5E2OA 2OCVB 4Y8YA 4Q2KA 5DPAA 4CRFA 3UWIA 3GCTG 1EB2A 1GI3A 1ELBA 3ZZ6A 1BIOA 1ARBA 1O3AA 1QBOA 1XVMA 1ANBA 4FUGA 4BTTB 1GI5A 1MU6B 1SGIB 1MD8A 3HK3B 2XNIA 5FBEA 4X2WA 1GJ4H 1KLTA 4MPXA 3NXPA 4GSOA 3BTWE 2WV4A 1YKTA 2A2QH 3M7TA 1ZTKA 2Y6TA 1V2RT 5E2PA 5C1YA 4X1SU 1GL0E 1CHGA 3SU3A 4X6PA 1IQIA 1NTPA 1QB6A 2OINA 3VFEA 1C9PA 2ZU5A 3K6ZA 4AFSA 3MTYA 4JYVH 2A4OA 5DK1A 1VJAU 5JPMH 1S84A 1MKWH 2BTCE 2SGPE 3TVJB 5A8YA 4AG2A 1SHHB 1OWJA 1DXWA 4RSPA 4BAOB 1DX5M 1EP5A 1W13U 2J92A 2WV5A 2YNAA 4X1RU 1EASA 1H4WA 1L1NA 3SN8A 3ZZ8A 2A45B 2CMYA 1AZ8A 1D3TB 2UUKB 2Q6GA 5C20A 1ORFA 2QGRA 2ZKSA 3PO1B 1TRMA 3KIDU 3Q00A 1W0ZU 1Y3UA 2BHGA 3LKWA 1O3GA 3MOCA 1RS0A 1DWCH 1TPAE 3ZZDA 1MCVA 3EA9A 2VIWA 3ATLA 3SI3H 1O30A 4OS2A 1SGRE 2PV9B 4OGXA 2XCNA 5JDUB 1GDNA 3RM2H 3HKJB 1A0LA 1WSSH 1LPZB 1RRKA 4XSKU 3ATWA 1FY8E 3UWJH 3P8NA 1GBTA 2HNTC 3GY6A 1SGNE 2ZQ2A 2G5VA 3UR9A 2SFAA 1AGJA 1C5TA 2ZP0H 3GY2A 1QURH 3F9GA 1F5KU 3V7TA 1FN6A 2BQ6B 4Y7AA 2CF8H 3GY3A 3ZZ4A 4I8JA 3U8OH 1GWAA 1Z8JB 2QA9E 2W5EA 4GUXA 1FMGA 1W14U 2ZG0H 4TWWA 1BA8B 2FS8A 8KME2 1QHRB 1W7XH 2P93A 2D1JA 1GG6B 4VGCB 4KTCA 3LH3A 1H1BA 1OYTH 4NFEA 3RXPA 4ZKSU 5T3HA 1E37B 4ABJA 1BTUA 1O2UA 1P3CA 1SI5H 3SV9A 1GMCG 4Y71A 3QGNB 2BX3A 3C27B 5I25A 2JH6D 2BD4A 1L1JA 2GCHG 1TQ0B 1BDAA 2FIRH 2Q1JA 3P17H 2ODPA 1A0JA 2XBYA 4O3TA 4AOQA 2FWWA 2PGBB 1GBFA 1O2TA 1KDQB 4MNYA 2F83A 1TPPA 1FUJA 2QV1A 2ZFPH 4AORA 1PPHE 2QY0B 3MMGA 4ISIH 5JBBS 1GCTC 4D7FA 4NA9H 1DITH 5HM9A 3GY5A 2ZGJA 3TJOA 2BVXH 3EAJA 2VB0A 2VIPA 4FUFA 2WPKS 2DE8A 1BJVA 2QXGA 2WPIS 1UVPA 1P2OA 3SNDA 4WMFA 1THPB 1V2MT 2OXSA 5L6NH 2FOMB 1MMJN 4YLUA 3URDA 1ZRKA 1IOEA 1T8LA 2O9QA 1HPGA 3MU8A 3PYHA 1GI2A 1AMHA 2PW8H 3GDUA 1ZLRA 4ZKRU 1T7CA 1XUKA 1NO9H 1C5ZB 2PSXA 1O34A 5T6FA 1AI8H 1QL8A 2UWOA 2GZ9A 3ZZ3A 1GCDA 7GCHF 3KF2A 4ZMAH 2FTMA 1XXFA 1ZRBA 3DFJA 3UNQA 4YZUA 4JZEH 2ZGCA 3LC5A 3F9FA 3SU2A 2AYWA 3FP8E 1TNGA 4CRDA 8LPRA 1OS8A 2FLRH 1ZZZA 4AB9A 1MAXA 1XVOA 1A46H 2VINA 3RXTA 2VWMA 3LDXH 2PKSB 4AN7A 1CGHA 3D49H 2NU0E 2ANWA 3F9HA 1H8DH 1KY9A 4AYYB 5L30H 1EJNA 2ZDLA 1RJXB 1PQ7A 3LIWA 1J8AA 1UK3A 4XBCA 5J4SA 1O2JA 5FCRA 1P04A 1GBCA 1K1LA 1YCPK 5L2ZH 1GCTB 3QDZB 1DLEA 1C5PA 2PWXA 3GYLB 4MQAA 1SLVB 1UO6A 1O2WA 4IC5A 1EZSC 1QL9A 3L6PA 3M5NA 4XBDA 2EI7A 1RTLA 3A7XA 1DY8A 4TYDA 1F92A 1A5HA 4I31A 4DGJA 1TBRH 3GY7A 5HMAA 3N7OA 5TCCA 4HI3A 9LPRA 1QL7A 1OP2A 1DUAA 2HRVA 2K1QA 3ZZAA 3Q76A 1GBJA 3PTBA 1MUEB 3RXLA 4JCNA 2BLWA 1J9CH 2HVXA 3KGPA 3SGQE 1TABE 1VGCC 2RG3A 2GVFA 1W7GH 2EA3A 1H9IE 2P94A 1XM1A 4YM9A 4Z6AH 1SHYA 1VJ9U 1QA7A 5GIBA 1E0FD 1VITF 2QN5T 4WWYA 1TAWA 2R3UA 4H6SB 5EPNA 1CGIE 1PFXC 4INLA 2AEIH 3CS0A 5TCAA 3GCTF 2H5CA 2ANKH 4KELA 5A8ZA 1XKBC 4LOYH 3A8DA 3QO6A 4MPVA 4IN2A 3NK8A 5DP9A 1G3BA 1LPKB 4D7GA 1O35A 3RC6A 3KQBA 3ZVCA 1EZQA 3SJIA 3SUEA 5DP5A 2GD4B 1BBRH 5DGJA 4ABIA 5H4IB 4Q80A 4KGAA 2R2MB 3ZVGA 3QTOH 1QY6A 1YCPH 5HXFA 1C1WH 1MZAA 1MU8B 1DUEA 2BVSH 2C90B 2ZFRH 3SNBA 2Z9GA 2VVUA 2GT7A 2ALVA 4AX9H 3ZVEA 1HAIH 1LVBA 1HUTH 3MI4A 2ZZUH 2PFEA 1MTVA 3A7WA 3BG4B 1P2MA 2HPPH 1MKXH 1N1LA 2FX4A 2Y7XA 2A0QB 2FEQH 1V2QT 3LPRA 1AUJA 3LGWA 3UNRA 1T4UH 1GMDF 1J14A 1C1UH 1K9OE 4H6TA 4F4OC 2FODA 1IHTH 1ABJH 1GDUA 2C8YB 4U2WA 3AASA 2PUXB 2ZIQH 2XC4A 1GBBA 4DURA 5HM2A 3LGTA 1KXCA 2SGDE 3BTGE 3GOVB 1TB6H 2XRCA 2XCFA 5DP6A 3ZV9A 1ESAA 3RDZA 1TGNA 3E3TA 4R8TB 1C5WB 1G32B 1SGTA 1O32A 1TYNA 4NFFA 3GCNA 3CP7A 3WY8A 3PLKA 2C8XB 2WUBA 1FAKH 3MH7A 1TBQH 4WH6A 5AHGH 1HIAA 3O8CA 1HCGA 3E8LA 1UHBB 1DSUA 1AE5A 1GBKA 1TE0A 1SGYE 1S0RA 1HYLA 1QRZA 1O38A 1ZSLA 1DY9A 1O5AB 4WMDA 1YC0A 1NU9A 1F2SE 1EOJA 2JETC 1W2KH 2G8TA 8ESTE 1GJ8B 2GCTB 3RXGA 3PMHB 1TX8A 2BZAA 2QXHA 3RXUA 4MPUA 2NU3E 2QYIA 1K22H 1AWFH 3PROA 2P3UB 6CHAB 1JMOH 4YTAA 3TGIE 3PO1C 1LCYA 1YP9A 2Y7ZA 2ZHEH 1HXFH 4BXWA 3PTNA 1C1VH 3LGYA 1IQMA 1BHXF 2W3IA 2V3OH 3ZZ5A 1P8VC 1GI1A 5J4QA 4FXGH 2V6NA 1BHXB 1V2VT 1NFXA 4K5ZA 3MO3A 1UHBA 2BXTH 1SGQE 4X2XA 3JZ1B 3RXIA 1SVPA 2FTLE 2KAIA 1UVSH 4IN1A 3RXKA 1QJ7B 4BTIB 1V2KT 3A7ZA 1EUFA 2YOLA 3JZ2B 1HAVA 4MPWA 2ZDMA 1LQDB 4AGKA 2NU2E 4O97A 1TBZH 2NU4E 4FVBA 4GCHG 1P12E 1AKSA 1P03A 2FP7B 1F0RA 1C2LA 1CVWH 3S9BA 2THFB 2CV3A 1OPHB 2F9OA 3ODFA 3SBKA 2I6SA 4IS5A 2ZHFH 4TPIZ 4UFFH 5F8TA 1V2WT 1SMFE 3Q77A 3LONA 1BZXE 4SGAE 2GZ7A 1YPHE 1QR3E 3RXMA 2H5DA 1EPTB 1UTJA 2ZO3H 2PKAB 2B9LA 4MLFB 1G36A 4B76A 4BAHB 1EPTC 3BG8A 1LMWB 2WYGA 1C5NH 4YT7H 5AFZH 3T62A 3MYWA 2A31A 4LZ4B 3RXOA 2XWAA 1AFQB 1GMDG 4CH8B 2R0KA 4LZ1H 1IQLA 3TITA 2ZC9H 3RLYH 1FPCH 4TY6A 3HGPA 4ZXYH 4ABFA 3HGNA 1P57B 1E35B 3UREA 1GJBB 2ZPQA 2ODYB 1EX3A 2ZCLP 5DKMA 2Y5HA 3A7YA 1KLIH 1V3XA 4OS5A 1CBWC 1PPGE 5EODA 3I77A 4NG9H 5C2ZA 1HJ8A 1TGCA 1UVOA 1V2UT 2J9NA 1YGCH 2ZU1A 3I78A 1O3EA 2TIOA 4AYVB 1BRUP 2UUFB 3O8RA 1PQ5A 1QBNA 1GI0A 3W95A 1SFIA 3PWBA 1GJCB 2BLVA 3DHKH 3K2UA 1P01A 3SV7A 1O2KA 2P3TB 4B74A 1ELEE 1VCWA 1O3MA 1C2IA 4Y7BA 5FHTA 4K8BA 3S7KB 3EA7A 3D62A 1TGSZ 1T32A 3VGCC 5LPFA 1GBAA 2JKHA 3GICB 1C2KA 2V3HH 1GHZA 1Y3XA 4B1TA 5T6GA 2NWNA 2CN0H 1D9IA 3GDSA 5ESTE 2BLOA 4NSVA 3U98H 3O8DA 1NROH 1DWBH 3QLPH 2TGDA 4GPGA 1TGBA 1EJMA 3MHWU 4U30A 5DP7A 1B0EA 4YLQH 1KXDA 3OYPA 1L2EA 3E1XB 4NZQA 5C3NA 2EI6A 1GDQA 3A86A 3BTDE 1A5IA 3P8FA 1O3OA 1W0YH 1ZPZA 1INCA 1NS3A 3VB5A 2D8WA 1CSOE 1WCZA 4K2YA 1O3PB 5EQSA 1BMLA 2BD9A 4ZHAA 1AQ7A 2CF9H 4PROA 3LGIA 3VGCB 1QQ4A 2R2WU 4Y8ZA 3M36A 1C5QA 1TA2A 1GGDB 1NM6A 1VCPA 2G4TA 2H9EH 1SG8B 4Q7XA 3RXHA 5GWZA 3RXSA 3MU1A 3QTVH 3MU5A 4AB8A 4JYUH 2BD7A 3L33A 3BSQA 1EJAA 1P02A 1RTFB 3DFLA 4GVUA 4WVPE 2VIQA 1Z71A 1IQFA 1CGJE 1ZPBA 1SLUB 2QAAA 2TGAA 1O2XA 2Z9JA 4INKA 1FY4A 3SI4H 5LH8A 3P6ZB 4MVNA 2G52A 3PMAB 3RMMH 1CA0C 2VIOA 1ETRH 1C5SA 1TONA 1YPGH 1O2SA 3KEEA 1MZDA 2F9UA 4X8UH 1GJ9B 1SGFA 1Z1IA 3TIUA 4UFEH 3AW0A 3MU0A 3MNSA 2BQWB 1ZPCA 3FFGA 4DCDA 1C2DA 1U6QA 2WINI 3NUMA 4Y10E 1GL1A 3DT0H 4WY3A 4XE4A 3EDXB 1HAPH 2RA3A 1WTHD 3RMNH 2FOAA 4CRCA 1O3KA 1TFXA 3UUZA 3SZNA 1FIZA 4ZROA 1TNHA 1TA6A 4K1EA 4BNRA 2EI8A 2R9PA 1LHGH 2ZDAH 1VR1H 1UTNA 3M3SA 1FDPA 3STJA 1LPGB 5E0HA 4ZKOU 5PTPA 1S85A 3SJ8A 2JETB 1O36A 3MU4A 1YPKH 3TLOA 1TMTH 3URCA 2CGAA 1C1RA 2XXLA 1C4Y2 1EZXC 1TRYA 4ABEA 3F68H 1IQEA 2BD2A 3P95A 4ZH8A 1ANEA 4OS6A 3RMOH 5ETXA 2R3YA 3SNEA 2TGPZ 4CR9A 2F9BH 3A80A 3SU6A 3ZVFA 1W3CA 1PQ8A 2P3FH 1TALA 2O8WA 3KL6A 4NIWA 1RFNA 1DVAH 1B0FA 4I8HA 3ZZBA 2H9TH 4DY7B 1GMCF 2AIQA 2VWLA 2BDAA 1F7ZA 1B5GH 1SOZA 2GDDA 3B23B 4XFQA 1DE7H 1TX7A 2M5TA 2ZPSA 2C8ZB 1RD3B 4NCYA 1KXFA 3F1SB 1UCYE 1A1RA 4AGJA 4CREA 2AMDA 1EAWA 2A5KA 1KXEA 1YF4A 2A5IA 4B2CA 1G3CA 5EPYA 4UFDH 3B8JA 1F5RA 3O8BA 3VXFH 2SGEE 1GJAB 1O5EH 1AFEH 1C1PA 2Z9LA 1EB1H 1Z8GA 3M3TA 4B73A 1O2GH 1TNIA 2QXIA 2XBVA 2FOGA 1AO5A 1L4DA 1TOMH 3U8RH 1AHTH 1O2QA 4OS1A 2VNTA 5GJ4B 1SQTA 2FDAA 4JZ1A 1Y8TA 1FLEE 3C1KA 3M7UA 1FAXA 1K1JA 1XX9A 4DG4A 1UTOA 4FUBA 1H9HE 3EYDA 1YPHC 6LPRA 3T2NA 2FZZA 3MH4A 1G3EA 1KSNA 1WQSA 4OS7A 5A0BA 5AFYH 3TH4H 3UOPA 1A0HB 5EXLA 1MQ6A 8GCHG 1HAVB 2HOBA 1O2MA 4J1YA 3AAUA 2H6MA 3A7TA 2QXJA 1ZMJA 1P9SA 2AGIX 2B8OH 2H1UA 1S0QA 4ASHA 2RCEA 2PTCE 4Q7YA 7GCHG 1C5OH 3M5LA 3Q3YA 4E7RG 3TH2H 4IMQA 4ISHH 3TK9A 2OBQA 2B5TB 2TBSA 1CA8B 1O2VA 3BN9A 1P2NA 2SNVA 3FP7E 1WTGH 1TPOA 2WPLS 1C5VA 2AH4X 2P8OC 4CBOA 1M9UA 1EQ9A 5FCKA 2GMTB 1MTWA 5CMXH 5FPTA 1OSSA 1T4VH 4SGBE 5DP4A 1LTOA 1LVMA 1HJAC 5GXPA 2ANYA 2F9NA 4X0WU 1TOCB 1Z7KA 2HNTF 1V2LT 1KTTB 3LGVA 2ANMH 2UWLA 4FUIA 2ZDVH 4K1TA 1FY1A 1UCYK 1ABIH 5A8XA 4B2AA 1BMAA 2BD5A 2ZCKP 3ZVBA 3TU7H 2GP9B 3PLBA 3ZZ7A 1AD8H 5EW2H 1IQGA 3CS7A 1H8IH 1OXGA 1FN8A 1GBDA 1ID5H 1VITH 2G00A 1ELFA 2WPJS 2BYAX 2XC0A 3PWCA 3VPKA 2FYQA 4D8NA 1EXFA 1O39A 2FMJA 2WUCA 1DWEH 1H9LB 1S82A 1QGFA 4UD9H 3A8AA 4YOJA 1O3DA 1ZSKA 5CHAC 2ZU4A 3RXDA 4A6LA 4CHAC 1AFQC 3RXCA 1UTMA 2ZGBH 5K0HA 1MD7A 1XUJA 3H5CB 1BTHH 4MDSA 7LPRA 1RIWC 6CHAC 4HGCA 3TNTA 1IQNA 3ELAH 1MTNB 4NA8A 1ZGVA 3M7QA 4XBBA 1O2RA 4WXVA 4Y6DA 6ESTA 5BPEA 1HAZB 2TPIZ 2GV7A 4GCHF 1D6RA 1SSXA 1WBGB 1Q2WA 1O5BB 5EOKA 2ALPA 4ABHA 1GVLA 3PV4A 4TWYA 4U32A 3TK6A 1O37A 5B6OA 3OX7U 2A7JA 1NZQH 3LJOA 4LK4A 3A7VA 3SORA 1FY5A 3G01A 5ABWA 2Y5GA 4NIVA 1BCUH 1IAUA 2W7SA 1BRCE 1DOJA 2B0FA 3OY6U 5TJXA 2WPHS 1S6HA 4XOJA 1JXPA 3FP6E 4UFGH 1NFWA 3ENSB 1C2JA 1BTZA 1XKAC 1AKSB 2ZGHA 1AVWA 1SGDE 1LHEH 4O03A 1DT2A 1O2YA 2VVVA 1BTWA 3ODDA 3HKIB 1BMMH 2V35A 4X6MA 2TRMA 1T31A 4Y76A 3TJNA 3LOXA 1FZZA 2A4GA 2KAIB 2W7UA 2Z3CA 1K1NA 2PKSC 3HATH 1QRXA 5HYOA 1GHVH 1DXPA 1DSTA 4A7IB 1GMHG 3U1JB 4E05H 3GDVA 4FUEA 1O3BA 1DWDH 1HDTH 2F91A 3ZZ9A 5GDSH 1LO6A 1WU1A 1C5UA 2STAE 1EKBB 3TPIZ 3KQEA 4YOGA 1ZJDA 1O2NA 1J16A 1A3BH 5JBCS 4WXIA 1OWIA 1XUIA 2OC0A 1K1MA 4CRBA 1FV9A 1G2MA 1PJPA 3K65B 1ELGA 1OWKA 2AMPA 4UONA 4F49A 2IOTA 1BRAA 3IG6B 1Z8IB 3SGBE 1TMBH 3RUOA 2V0BA 2FESH 4CBNA 1GG6C 2VIDA 1Y5AT 3SHCH 5A2MH 1P11E 3ZV8A 2AMQA 1C1OA 2FI5E 1QJ1B 4JYTA 1GHAG 1RXPA 2Y5FA 3SV2H 1L1GA 1YYY1 4THNH 5A0AE 1BMNH 1BRBE 1BTPA 2CXVA 3Q3KA 1EAIA 2VIVA 5JB9S 1YBWA 1G9IE 2J38A 4RN6A 5C5OA 3RLWH 4CRAA 1O5FH 3D23A 1BB0B 2FO9A 2OD3B 2LPRA 1NN6A 5AF9H 1O3NA 3TJVA 3OY5U 4KTSA 3FZDA 1NPMA 3SJ9A 3SNCA 3K6YA 4IBLH 1VGCB 1DPOA 1TNJA 4X2VA 2ZDKA 1L4ZA 1AZZA 3VEQB 1MBQA 4GLYA 5DJ7A 2GCTC 4JK5A 2F9PA 3Q3XA 1GBHA 1V2OT 1WOFA 1OWHA 4FU7A 1BUIA 2A7HA 2PGQB 3S69A 1O0DH 4K1SA 2YNBA 1Y5BT 2G81E 4UEHH 2GCHF 4VGCC 4OS4A 2ZGXH 2UWPA 3TGKE 1OKXA 2XBWA 3SNAA 4ZAEA 3RM0H 4IW4E 4D9QA 2GDEH 3BTFE 1GI4A 1O5DH 3KN2A 1VITG 3RXRA 3MH6A 1CBWB 1KXAA 1PPEE 1MKWK 3NWUA 1O2PA 2OP9A 1BT7A 1GJDB 2VWOA 1B7XB 1Z8RA 2ILNA 1IQJA 5A0CA 4YESB 2XC5A 3VXEH 1BTYA 1UVUH 2WYJA 1O3CA 2GZ8A 4ZHLU 2SGFE 2ZF0H 2XBXA 1FONA 1OWDA 3A89A 4MNXA 3U8TH 6GCHG 4AZ2B 1G3DA 1N8OC 1NRSH 1W11U 2ZHQH 3E0PB 4FUDA 3SU1A 1PPZA 1JBUH 3BG4C 1SQAA 3LC3A 1C5YB 3T29A 4BAQB 5F6MA 1ESBA 1ZTLA 1CHOG 5IYTA 3P70B 3QZQA 1OYQA 1Z6EA 2VWNA 1BTXA 1CU1A 1MH0A 3VB6A 1J15A 1LVYA 1YM0A 4X1QU 5C1UA 1MTNC 4DIIH 2QCYA 1WYKA 2IN2A 5FPYA 3RXJA 8GCHF 1ZGIA 3GISB 5E8EH 1DM4B 3UQVA 1O2OA 2GGVB 1ACBE 1AY6H 1C1NA 3UTUH 1P0SH 4UE7H 2EC9H 1TMUH 3SQHE 5LPEA 1Z6JH 5LGOA 5I46H 1EAXA 3AVZA 1NRQH 1TRNA 1AN1E 1K1OA 4GHTA 3P8GA 3GY4A 1GJ5H 4FVDA 3MO6A 1C1TA 1ELCA 2Z6BD 1O2ZA 3QGJA 2BOHB 5JB8S 1DDJA 2O8MA 1AVGH 3V0XA 1Y3YA 1HXEH 1SR5C 1PPFE 2ZQ1A 4WMEA 4MNWA 1GHBG 5IDKA 3UR6A 1HB0B 4TPYA 2BDIA 3QUMP 4M7GA 4TY7A 3HPTB 5ESBA 1D3PB 2FX6A 3ESTA 1QCPA 2ZI2H 1GBEA 1GVZA 1SL3A 1WQVH 2A1DB 2PKAA 4DT7B 4AFUA 3QWCH 3KQCA 2P8OB 4FU9A 1EPTA 5GCHF 2JH5D 2P95A 2FS9A 3HK6B 1JRSA 2HALA 3R0FA 1SBWA 1GVKB 3D65E 5LPRA 1XUHA 2OC7A 3U69H 1MTUA 1IHSH 5AVDA 2G5NA 1C4U2 2TGTA 1A5GH 2JH0D 4FUHA 4NIYA 1AUTC 1MCTA 3SU0A 1S83A 1HGTH 2SNWA 4K60A 4BANB 1XXDA 1ZTJA 1NC6A 1AIXH 1F0TA 1SLWB 1QQUA 2BY6X 2FI4E 1F5LA 1JOUB 4CH2B 5GCHG 1BJUA 3FZZA 2ZHDA 5FXLA 1NFYA 2RDLA 4B2BA 1A4WH 1BITA 1TX6A 5EGMA 4X1NU 3V12A 1GJ7B 4RKJB 1FY3A 3M61U 1QB1A 1YPEH 3SV6A 3MO9A 4Y0YE 2ZTXA 4O9VA 3UQOA 1HJAB 2FM2A 2SGAA 4ABBA 3PLPA 1E36B 1KTSB 4K8YA 5T6DA 2ZWLH 1LHCH 1OP8A 2XW9A 2ZNKH 1AWHB 3BTKE 2C3SA 2FOCA 1C2GA 3LH1A 3BTQE 1P06A 3SHAH 1JIMA 3E16B 1HAHH 1YCPM 3GCOA 1D3DB 4IGDA 2FLBH 2IPHA 1ZSJA 4I33A 1GI7B 1HAOH 2BB4A 3TH3H 4NWLA 1O3HA 3IWMA 3BTHE 2VH0A 1JWTA 3QK1A 5DP3A 1V2NT 1Q31A 1N6XA 4ZXXH 1CQQA 3A83A 4GAWA 3SUGA 1V2PT 1MBMA 2BOKA 1N8OB 3TJUA 1A61H 1MKXK 1O33A 5G4BA 4A1TA 3ZYEA 1S5SA 1K1PA 3ZZCA 1XMNB 1G2LA 2QIQA 1ZHPA 4R0IA 1C5RA 3UOUA 1UVTH 4Y11E 4CRGA 1Y3WA 1GPZA 2Z9KA 1LHDH 3RC4A 5L2YH 1P10A 3PMJA 1DS2E 1O2LA 2ESTE 3BTEE 1VCQA 1JIRA 2J4IA 1UTKA 2O8UA 1HNEE 1LVOA 3NCLA 2NU1E 1K28D 4WJG2 4XDEA 1HBTH 2VH6A 4X6NA 2XTTB 2EEKA 1SLXB 2BY7X 4KKDA 3T25A 3MNBA 3SGAE 3GCHB 1UTPA 1QJ6B 1L0ZA 1NRNH 2RA0A 1DFPA 1P05A 1THSH 1YPMH 1V6DA 1BQYA 3T28A 3SQEE 2I6QA 5FX5A 1NESE 3NPSA 3STIA 2W3KA 4WH8A 5A09A 4H42U 1O2HA 1CO7E 1EP6A 1NU7B 3VB3A 1G37A 2ZDNA 2AFQB 2FI3E 2ZPRA 1THRH 2OC8A 2R0LA 5C5NA 5JYIA 2A32A 2J95A 4NWKA 1EOLA 1WUNH 3LGUA 7KMEH 3LJJA 4DIHH 2CHAC 9ESTA 5EU8A 3RMLH 3E0NB 5C67A 3EGKH 2FOBA 4FUJA 4HTCH 2IJOB 2BY9X 2OUAA 2G55A 2AGGX 1QFKH 6GCHF 2UUJB 4LXBH 3V3MA 2FOEA 2GT8A 4HZHA 2A4RA 2GTBA 2BZ6H 1C2FA 3RU4E 1TGTA 1GI9B 1HAXB 4GHQA 1OWEA 1C9TA 4WF8A 3S9AA 4NSYA 4OGYA 4ABGA 5CE1A 4J2YB 1FXYA 4NGAH 1C2HA 3RXAA 4A92A 2GMTC 1TQ7B 1AU8A 1O3IA 1QIXB 1KLJH 1UJ1A 3OU0A 1P09A 1NY22 3BEIB 2A4QA 5FAHA 2A5AA 2F3CE 1W12U 3OSYA 1RIWB 1ELDE 3OTJE 1ELAA 1IQHA 2P59A 3P8OA 1MTSA 2Z9IA 2ZTZA 1SC8U 3NKKA 4BXSA 1SGCA 1C5LH 5E0JA 4X1PU 1NRRH 2HGTH 2OLGA 4MTBA 3SO3A 4D9RA 1F0SA 1ELVA 4JZFH 2VVCA 4FU8A 4X6OA 2OQ5A 4IC6A 1SFQB 1AB9C 3A81A 2O8TA 3W94A 1SQOA 3R3GB 3ZVDA 4I32A 1P9UA 2WPMS 3T5FH 1V2TT 5EXNA 1GHWH 2G51A 3V13A 2PUQH 3T26A 2BVRH 2PLXA 2LNCA 3RU4T 5BRRE 4YOIA 1PQAA 1WAYB 4UDWH 4ZUHA 3K9XB 2AERH 1S6FA 1WV7H 1C5XB 2ZECA 1KIGH 2Z3EA 2ZFQH 2BD3A 2ZU3A 3NZIA 1F0UA 5DO4H 2AGEX 2STBE 3EA8A 4MG3A 1ANDA 3A84A 1AVXA 2Z3DA 2ZU2A 1TPSA 3A82A 2ZHWH 4JZIA 1EZUC 1MAYA 2HLCA 3GCHC 3SU4A 4B75A 5F8XA 2PTNA 1ZOMA 1C4V2 3PM3A 1ZR0A 4KTUA 3S9CA 1C2MA 4CR5A 1MQ5A 2BDYA 2ZTYA 5GPIB 1TNKA 4CHAB 3M5OA 1D3QB 3RXBA 3A88A 2ASUB 5CHAB 4JMYA 3RC5A 4ISLA 3I29A 1UMAH 2ZFFH 1FIWA 1K1IA 7ESTE 4E7NA 1GHXH 1UK2A 1HLTH 3TGJE 3DD2H 1LKAA 5SGAE 5EG4A 1GHBF 1CHOF 4IMZA 3MNXA 2BDBA 1P2JA 3S0NA 3E90B 3M35A 2C4FH 2Y81A 1LDTT 1HJ9A 1LKBA 1CA0B 3AAVA 4DJZB 1QB9A 4Z0KA 3TK5A 2BQ7B 3EQ0H 3UY9A 1KDQA 1DICA 4BAMB 4AG1A 1HFDA 1P2IA 4K69A 2Y82A 1DLKB 5EQQA 3QN7A 2PSYA 1GMHF 5EXMA 4JZDH 1SGPE 1V2JT 3RXVA 2DUCA 1X7AC 2OQUA 3BIVH 3IITA 2DE9A 5EQRA 4Y0ZE 1FNIA 4AFQA 1KYNA 4DOQA 1T8MA 2BDHA 1UCYH 3BV9B 3BEFB 1Z1JA 2BY5X 1QNJA 1J17T 3MH5A 3UIRA 1YPLH 2OTVA 1IQKA 1CE5A 2ODQA 3F9EA 2GKVE 4D76A 3SOSA 3RXQA 1QBVH 1NFUA 3UFAA 1Y3VA 1D4PB 1FI8A 1LQEA 3KQDA 1C1SA 4X8SH 1GBMA 4Q7ZA 1D6WA 1E38B 2VJ1A 2QC2A 1CT0E 1UTLM 5DP8A 1QRWA 3MNCA 5EW1H 1SGEE 4ABDA 4MNVA 2H2ZA 1AE8H 3LU9B 2ZA5A 4YT6H 2H9HA 4YO9A 3ITIA 1PPBH 4ZKNU 2Q6DA 4QT8C 1O5CB 1GI8B 3FANA 2W26A 3A8BA 2J94A 1GHYH 2FPZA 2A2XH 3RXEA 2FXRA 2BXUH 1TLDA 3P92A 3PB1E 3BEUA 2PR3A 2J2UA 3AW1A 1W8BH 1FPHH 1T8NA 1XUGA 4I8KA 3H7OA 1SPJA 1OOKB 3UPEA 1OP0A 3RXFA 2GX4A 1ETSH 3FVFB 1YLCA 3B9FH 5DG6A 3PMBB 1ESTA 2VGCB 4RKOB 3KCGH 4INHA 4AFZA 4E06H 1HRTH 3BTTE 2VGCC 1O3JA 5FX6A 5HGGA 1JRTA 3VB4A 2Q6FA 3QZRA 3ATMA 4Y79A 1NRPH 1GBIA 1SOTA 3L3TA 1RGQA 2C93B 3RU4D 3M37A 2FOFA 1Y59T 4BOHA 2PHBA 3BIUH 2BDGA 1GHAF 3UNSA
chains in the Genus database with same CATH superfamily
2OBOA 5FBIA 2ULLA 4A5TS 2HNTE 5KECA 4NIXA 3A85A 2GV6A 5F03A 2V7QD 3E91A 1O3FA 2BY8X 4ESTE 5KGOA 3GYMA 1ZHMA 3SV8A 1RTKA 3QX5H 4ZHMU 2B7DH 1C2EA 4Y8XA 1O31A 4X8VH 2FYRA 2QF3A 4NA7A 5HKKD 2G4UA 2BD8A 2ZFSA 1QTFA 1Y5UT 2AIPA 4JK6A 2BM2A 1K0HA 1A2CH 5CDFE 1K2I1 1NT1A 2P16A 1HAYB 4A1VA 2Z94A 1ANCA 2D2DA 4B71A 4I8LA 3KHVA 3SZEA 1LHFH 3SUFA 1ZJKA 5FPSA 1V2ST 4H4FA 1T8OA 2AS9A 1TNLA 4HFPB 1HAGE 1VZQH 3RP2A 4FUCA 2Z7FE 1HIAB 1CT4E 1G30B 2HPQH 4I7YH 1SGFG 1UK4A 4DVAU 1A3EH 3SW2B 3VB7A 1K21H 2W6JD 3LT3A 3DUXH 2WV9A 5C1XA 1ZMLA 2C8WB 1SB1H 1O2IA 5T1VA 5C0UA 2F9VA 2ZFTA 2CJIA 3H7TA 1BBRK 2O8LA 2BMGB 1OX1A 3U1IB 3TNSA 1W10U 1P3EA 2XWBI 1C1MA 2Y80A 5JBAS 1N6YA 4DW2U 1A7SA 2BX4A 1DANH 3BF6H 1TWXB 2J34A 3MFJA 1CT2E 3ATIA 1QA0A 2QF0A 3S7HB 1ETTH 4K3JA 2BLQA 1GBLA 1P2QA 3EE0B 1S81A 4BAKB 2FOHA 3ZVAA 1E1RD 1P2KA 5F8ZA 1HV7A 3SU5A 4A1XA 2D26C 3PRBA 2UUYA 3ZYDA 1FQ3A 1YPJH 1PPCE 1C5MD 1GJ6A 4ISOA 3CENA 4X8TH 4U01A 2GJGA 1PYTD 1FJSA 3F6UH 1ZHRA 2XYAA 4BTUB 4O3UA 2OC1A 2A7CA 3SJOA 2SGQE 3MWIU 1GGDC 2ZCHP 1KXBA 1GI6A 4KP0A 1BBRE 3GY8A 4X2YA 4F48B 1ZYOA 4NZLA 5K7RA 3M5MA 3N7DA 4XRNA 2ZEBA 3T27A 1BOQA 1E34B 1H8HD 1PYTC 1YLDA 4ISNA 3DA9B 5E0GA 3BTME 1ELTA 2HWLB 3SJKA 1C1QA 1Q3XA 3ATKA 2CHAB 2EY4C 4ABAA 3SUDA 1EATA 5JBTA 3A8CA 3GS9A 3SYJA 2VU8E 1AB9B 1ARCA 3KNXA 4I8GA 1TIOA 1O3LA 2BDCA 3FAOA 1O5GH 3M3VA 3U9AH 3E6PH 1ZMNA 1UTQA 3A87A 1EAUA 1XUFA 5E2OA 2OCVB 3KYGA 4Q2KA 4Y8YA 5DPAA 4CRFA 3UWIA 3GCTG 1EB2A 1GI3A 1ELBA 3ZZ6A 1BIOA 1ARBA 1O3AA 1QBOA 1XVMA 1ANBA 1H8ED 4FUGA 4BTTB 1GI5A 1MU6B 1SGIB 1MD8A 2WPDD 3HK3B 2XNIA 5FBEA 4X2WA 1GJ4H 1KLTA 4MPXA 3NXPA 4GSOA 3BTWE 2WV4A 1YKTA 2A2QH 3M7TA 1ZTKA 2Y6TA 1V2RT 5E2PA 5C1YA 3F0OA 4X1SU 2WHXA 1GL0E 1CHGA 3SU3A 4X6PA 1IQIA 1NTPA 1QB6A 2OINA 3VFEA 4Z1MD 1C9PA 2ZU5A 3K6ZA 4AFSA 3MTYA 4JYVH 2A4OA 5DK1A 1VJAU 5JPMH 1S84A 1MKWH 1E79D 2BTCE 2SGPE 3N7EA 3TVJB 5A8YA 4AG2A 1SHHB 1OWJA 1DXWA 3PV2A 4RSPA 4BAOB 1DX5M 1EP5A 1W13U 2J98B 2J92A 2WV5A 2YNAA 4X1RU 1EASA 1H4WA 1L1NA 3SN8A 3ZZ8A 2A45B 2CMYA 4HG6A 1AZ8A 1D3TB 2UUKB 2Q6GA 5C20A 1ORFA 2QGRA 2ZKSA 3PO1B 1TRMA 3KIDU 3Q00A 1W0ZU 1Y3UA 2BHGA 2K8IA 3LKWA 1O3GA 3MOCA 1MABB 1RS0A 1DWCH 1TPAE 3ZZDA 1MCVA 4P00A 3EA9A 2VIWA 3ATLA 3SI3H 1O30A 4OS2A 1SGRE 2PV9B 4OGXA 3U28C 2XCNA 5JDUB 1GDNA 3RM2H 3HKJB 1A0LA 1WSSH 1LPZB 1RRKA 4XSKU 3ATWA 1FY8E 3UWJH 3P8NA 1GBTA 2HNTC 3GY6A 1SGNE 2ZQ2A 2G5VA 3UR9A 2SFAA 1AGJA 1C5TA 2ZP0H 3GY2A 1QURH 1SQRA 3F9GA 1F5KU 3V7TA 1FN6A 2BQ6B 4Y7AA 2CF8H 3GY3A 3ZZ4A 4I8JA 3U8OH 1GWAA 1Z8JB 2QA9E 2W5EA 4GUXA 1FMGA 1W14U 2ZG0H 4TWWA 1BA8B 2FS8A 8KME2 1QHRB 4FETA 1W7XH 2P93A 2D1JA 1GG6B 4VGCB 4KTCA 3LH3A 1H1BA 1OYTH 4NFEA 3RXPA 4ZKSU 5T3HA 1E37B 4ABJA 5DSFA 1BTUA 1O2UA 1P3CA 1SI5H 3SV9A 1GMCG 4Y71A 3QGNB 2BX3A 3C27B 5I25A 2JH6D 2BD4A 1L1JA 2GCHG 1TQ0B 1BDAA 2FIRH 2Q1JA 3P17H 2ODPA 1A0JA 2XBYA 4O3TA 4AOQA 2FWWA 2PGBB 1GBFA 3KYFA 1O2TA 1KDQB 4AC9A 4MNYA 2F83A 1TPPA 1FUJA 2QV1A 2ZFPH 4AORA 1PPHE 2QY0B 3MMGA 4ISIH 3FKSD 5JBBS 1GCTC 4D7FA 4NA9H 1DITH 5HM9A 3GY5A 2ZGJA 3TJOA 2BVXH 3EAJA 2VB0A 2VIPA 4FUFA 2WPKS 2DE8A 1BJVA 2QXGA 2WPIS 1UVPA 1P2OA 3SNDA 4WMFA 1THPB 1V2MT 2OXSA 5L6NH 2FOMB 1MMJN 4YLUA 3URDA 1ZRKA 1IOEA 1T8LA 2O9QA 1HPGA 3MU8A 3PYHA 1GI2A 1AMHA 2PW8H 3GDUA 1ZLRA 4ZKRU 1T7CA 1XUKA 1NO9H 1C5ZB 2PSXA 1O34A 5T6FA 1AI8H 1W0KD 1QL8A 2UWOA 2GZ9A 3ZZ3A 1GCDA 7GCHF 3KF2A 4ZMAH 2FTMA 1XXFA 1ZRBA 3DFJA 3UNQA 4YZUA 4JZEH 2ZGCA 3LC5A 3F9FA 3SU2A 2AYWA 3FP8E 1TNGA 4CRDA 8LPRA 1OS8A 2FLRH 1ZZZA 4AB9A 1MAXA 1XVOA 1A46H 2VINA 3RXTA 2VWMA 3LDXH 2PKSB 4AN7A 1CGHA 2JJ1D 3D49H 2NU0E 2ANWA 3F9HA 1H8DH 1KY9A 4AYYB 5L30H 1EJNA 3ZIAD 2L74A 2ZDLA 3OE7D 1RJXB 1PQ7A 3LIWA 1J8AA 1UK3A 4XBCA 5J4SA 1O2JA 5FCRA 1P04A 1GBCA 1K1LA 1YCPK 5L2ZH 1GCTB 3QDZB 1DLEA 1C5PA 2PWXA 3GYLB 2YMSB 1FX0B 4MQAA 1SLVB 1UO6A 1O2WA 4IC5A 1EZSC 1QL9A 2CK3D 3L6PA 3M5NA 4XBDA 2EI7A 1RTLA 3A7XA 1DY8A 4TYDA 1F92A 1A5HA 4I31A 4DGJA 1TBRH 3GY7A 5HMAA 3N7OA 5TCCA 4HI3A 9LPRA 1QL7A 1OP2A 1DUAA 2HRVA 2K1QA 3ZZAA 3Q76A 1GBJA 3PTBA 1MUEB 3RXLA 4JCNA 2BLWA 1J9CH 3DSPA 2HVXA 3UAIC 3KGPA 3SGQE 3PV5A 1TABE 1VGCC 2RG3A 2GVFA 1W7GH 2EA3A 1H9IE 2P94A 1XM1A 4YM9A 4Z6AH 1SHYA 1VJ9U 1QA7A 5GIBA 1E0FD 1VITF 2QN5T 4WWYA 1TAWA 2R3UA 4H6SB 5EPNA 1CGIE 1PFXC 4INLA 2AEIH 3CS0A 5TCAA 3GCTF 2H5CA 2ANKH 2JJ2D 4KELA 4DT4A 5A8ZA 1XKBC 4LOYH 3A8DA 3QO6A 4MPVA 4IN2A 3NK8A 5DP9A 1G3BA 1LPKB 4D7GA 1O35A 3RC6A 3KQBA 3ZVCA 1EZQA 2F43B 3SJIA 3SUEA 5DP5A 2GD4B 1BBRH 2QE7D 5DGJA 4ABIA 5H4IB 4Q80A 4KGAA 2R2MB 3ZVGA 3QTOH 1QY6A 1YCPH 5HXFA 1C1WH 1MZAA 1SKYE 1MU8B 1DUEA 2BVSH 2C90B 2ZFRH 3SNBA 2Z9GA 2VVUA 2GT7A 2ALVA 4AX9H 3ZVEA 1HAIH 1LVBA 1HUTH 3CNRA 3MI4A 2ZZUH 2PFEA 1MTVA 3A7WA 3BG4B 1P2MA 2HPPH 1MKXH 1N1LA 2FX4A 2Y7XA 2A0QB 2FEQH 2J98A 3VG8A 5DN6D 1V2QT 3LPRA 1AUJA 3LGWA 3UNRA 1T4UH 2YMSD 1GMDF 1J14A 1C1UH 1K9OE 4H6TA 4F4OC 2FODA 1IHTH 1ABJH 1GDUA 2C8YB 4U2WA 3AASA 2PUXB 2ZIQH 2XC4A 1GBBA 4DURA 5HM2A 3LGTA 1KXCA 2SGDE 3BTGE 3GOVB 1TB6H 2XRCA 2XCFA 3DCLA 5DP6A 3ZV9A 1ESAA 3RDZA 1TGNA 3E3TA 4R8TB 1C5WB 1G32B 1SGTA 1O32A 1TYNA 4NFFA 3GCNA 3CP7A 3WY8A 3PLKA 2C8XB 2WUBA 1FAKH 3MH7A 1TBQH 4WH6A 2RFKC 5AHGH 1HIAA 3O8CA 1HCGA 3E8LA 1UHBB 1DSUA 1AE5A 1GBKA 1TE0A 1SGYE 3MQKC 1S0RA 1HYLA 1QRZA 1O38A 1ZSLA 1DY9A 1O5AB 4WMDA 1YC0A 1NU9A 1F2SE 1EOJA 2JETC 1W2KH 2G8TA 8ESTE 1GJ8B 2GCTB 3RXGA 3PMHB 1TX8A 2BZAA 2QXHA 3RXUA 4MPUA 2NU3E 2QYIA 1K22H 1AWFH 3PROA 2P3UB 6CHAB 1JMOH 4YTAA 3TGIE 3PO1C 1LCYA 1YP9A 2Y7ZA 2ZHEH 1HXFH 4BXWA 3PTNA 1C1VH 3LGYA 1IQMA 1BHXF 2W3IA 2V3OH 3ZZ5A 1P8VC 1GI1A 5J4QA 4FXGH 2V6NA 1BHXB 1V2VT 1NFXA 4F55A 4K5ZA 3MO3A 1UHBA 2BXTH 1SGQE 4X2XA 3JZ1B 3RXIA 1SVPA 2FTLE 2KAIA 1UVSH 4IN1A 3RXKA 1QJ7B 4BTIB 1V2KT 3A7ZA 1EUFA 2YOLA 3JZ2B 1HAVA 4MPWA 2ZDMA 1LQDB 4AGKA 2NU2E 4O97A 1TBZH 2NU4E 4FVBA 4GCHG 1P12E 1YWUA 1AKSA 1P03A 2FP7B 2QF4A 1F0RA 1C2LA 1CVWH 3S9BA 2THFB 2CV3A 1OPHB 2F9OA 3ODFA 3SBKA 2I6SA 4IS5A 2ZHFH 4TPIZ 4UFFH 5F8TA 1V2WT 1SMFE 3Q77A 3LONA 1BZXE 4SGAE 2GZ7A 1YPHE 1QR3E 5EJZA 3RXMA 2H5DA 1EPTB 1UTJA 2ZO3H 2PKAB 2B9LA 4MLFB 1G36A 4B76A 4BAHB 1EPTC 3BG8A 1LMWB 2WYGA 2WSSD 1C5NH 4YT7H 5AFZH 3T62A 3MYWA 2A31A 4LZ4B 3RXOA 2XWAA 1AFQB 1GMDG 1EFRD 4CH8B 2R0KA 4LZ1H 1IQLA 3OEED 3TITA 2ZC9H 3RLYH 1FPCH 4TY6A 3HGPA 4ZXYH 4ABFA 3HGNA 1P57B 1E35B 3UREA 1GJBB 2ZPQA 2KX4A 2ODYB 1EX3A 2ZCLP 5DKMA 2Y5HA 3A7YA 1KLIH 1V3XA 4OS5A 1CBWC 1PPGE 5EODA 3I77A 4NG9H 5C2ZA 1HJ8A 1TGCA 1UVOA 1V2UT 2J9NA 1YGCH 2ZU1A 3I78A 1O3EA 2TIOA 4RT1A 4AYVB 1BRUP 2UUFB 3O8RA 1PQ5A 1QBNA 1GI0A 3W95A 1SFIA 3PWBA 1GJCB 2BLVA 2KCAA 3DHKH 3K2UA 1P01A 3SV7A 1O2KA 2P3TB 4B74A 1ELEE 1VCWA 1O3MA 1C2IA 4Y7BA 5FHTA 4K8BA 3S7KB 3EA7A 3D62A 1TGSZ 1T32A 3VGCC 5LPFA 1GBAA 2JKHA 2KCPA 3GICB 1C2KA 1GHZA 2V3HH 1Y3XA 3WWBA 4B1TA 1KMHB 5T6GA 2NWNA 2CN0H 1D9IA 3GDSA 5ESTE 2BLOA 4NSVA 3U98H 3O8DA 1NROH 1DWBH 3QLPH 2TGDA 4GPGA 1TGBA 1EJMA 3MHWU 4U30A 5DP7A 1B0EA 4YLQH 5IK2D 1KXDA 3OYPA 4Q63A 1L2EA 3E1XB 4NZQA 5C3NA 2EI6A 2KM0A 1GDQA 3A86A 3BTDE 3F2FA 1A5IA 3P8FA 1O3OA 1W0YH 1ZPZA 1INCA 1NS3A 3VB5A 2D8WA 1CSOE 1WCZA 4K2YA 1O3PB 5EQSA 1BMLA 2BD9A 4ZHAA 1AQ7A 2CF9H 4PROA 4ACAA 3LGIA 3VGCB 1QQ4A 2R2WU 4Y8ZA 3M36A 1C5QA 1TA2A 1GGDB 1NM6A 1VCPA 2G4TA 2H9EH 1SG8B 4Q7XA 3RXHA 5GWZA 3RXSA 3MU1A 3QTVH 3MU5A 4AB8A 4JYUH 2BD7A 3L33A 3BSQA 1EJAA 1P02A 1RTFB 3DFLA 4GVUA 4WVPE 2VIQA 1Z71A 1IQFA 1CGJE 1ZPBA 4B6FA 1SLUB 1BMFD 2QAAA 2TGAA 1O2XA 2Z9JA 4INKA 1FY4A 3SI4H 5LH8A 3P6ZB 4MVNA 2G52A 3PMAB 3RMMH 1CA0C 2VIOA 1ETRH 1C5SA 4XD7D 1TONA 1YPGH 1O2SA 3KEEA 1MZDA 2F9UA 4X8UH 1GJ9B 1SGFA 1Z1IA 3TIUA 5EIYA 4UFEH 3AW0A 3MU0A 3MNSA 2BQWB 1ZPCA 3FFGA 4DCDA 1C2DA 1U6QA 2WINI 3NUMA 4Y10E 1GL1A 3DT0H 4WY3A 4XE4A 3EDXB 1HAPH 2RA3A 1WTHD 3RMNH 2FOAA 4CRCA 1O3KA 1TFXA 3UUZA 3SZNA 1FIZA 4ZROA 2XOKD 1TNHA 1TA6A 4K1EA 4BNRA 2EI8A 2R9PA 1LHGH 2ZDAH 1VR1H 1UTNA 3M3SA 1FDPA 3STJA 1LPGB 5E0HA 4ZKOU 5PTPA 5F53A 3OEHD 1S85A 3SJ8A 2JETB 1O36A 3MU4A 1YPKH 3TLOA 1TMTH 3URCA 4Q4LA 2CGAA 1C1RA 2XXLA 1C4Y2 1EZXC 1TRYA 4ABEA 3F68H 1IQEA 2BD2A 3P95A 4ZH8A 1ANEA 4OS6A 3RMOH 5ETXA 2R3YA 3SNEA 2TGPZ 4CR9A 2F9BH 3A80A 3SU6A 3ZVFA 1W3CA 1PQ8A 2P3FH 4RT0A 1TALA 2O8WA 3KL6A 4NIWA 1RFNA 1DVAH 1B0FA 4I8HA 3ZZBA 2H9TH 4DY7B 1GMCF 2AIQA 2VWLA 2BDAA 1F7ZA 1B5GH 1SOZA 2GDDA 3B23B 4XFQA 1DE7H 1TX7A 2M5TA 2ZPSA 4FOUC 2C8ZB 1RD3B 4NCYA 1KXFA 3F1SB 1UCYE 5C0TA 1A1RA 4AGJA 4CREA 2AMDA 1EAWA 2A5KA 1KXEA 1YF4A 2A5IA 4B2CA 1G3CA 5EPYA 4UFDH 3B8JA 1F5RA 3O8BA 3VXFH 2SGEE 1GJAB 1O5EH 1AFEH 1C1PA 2Z9LA 1EB1H 1Z8GA 3M3TA 4B73A 1O2GH 1TNIA 2QXIA 2XBVA 2FOGA 2L6OA 1AO5A 1L4DA 1TOMH 3U8RH 2F4LA 1AHTH 1O2QA 4OS1A 2KCYA 2VNTA 5GJ4B 1SQTA 2FDAA 4JZ1A 1Y8TA 1FLEE 3C1KA 3M7UA 1FAXA 1K1JA 1XX9A 4DG4A 1UTOA 4FUBA 1H9HE 3EYDA 1YPHC 6LPRA 3T2NA 2FZZA 3MH4A 1G3EA 1KSNA 1WQSA 4OM9A 2PP6A 4OS7A 5AFYH 5A0BA 3TH4H 3UOPA 1A0HB 5EXLA 1MQ6A 8GCHG 1HAVB 2HOBA 1O2MA 4J1YA 3AAUA 2QF5A 2H6MA 3A7TA 2QXJA 1ZMJA 1P9SA 2AGIX 2B8OH 2H1UA 1S0QA 4ASHA 2RCEA 2PTCE 4Q7YA 7GCHG 1C5OH 3M5LA 3Q3YA 4E7RG 3TH2H 4IMQA 4I86A 1WDIA 4ISHH 2OBQA 2B5TB 2TBSA 3TK9A 1CA8B 1O2VA 2J97A 3BN9A 1P2NA 2SNVA 3FP7E 1WTGH 1TPOA 2WPLS 1C5VA 2AH4X 2P8OC 4CBOA 1M9UA 1EQ9A 5FCKA 2GMTB 1MTWA 5CMXH 5FPTA 2JIZD 1OSSA 1T4VH 4SGBE 5DP4A 1LTOA 1LVMA 1HJAC 5GXPA 2ANYA 2F9NA 4X0WU 1TOCB 1Z7KA 2HNTF 1V2LT 1KTTB 3LGVA 2ANMH 2UWLA 4FUIA 2ZDVH 4K1TA 1FY1A 1UCYK 1ABIH 5A8XA 4B2AA 1BMAA 2BD5A 2ZCKP 3ZVBA 3TU7H 2GP9B 3PLBA 3ZZ7A 1AD8H 5EW2H 1IQGA 3CS7A 1H8IH 1OXGA 1FN8A 1GBDA 1ID5H 1VITH 2G00A 1ELFA 2WPJS 2BYAX 2XC0A 3PWCA 3VPKA 2FYQA 4B6EA 4D8NA 1EXFA 1O39A 2FMJA 2WUCA 1DWEH 1H9LB 1S82A 1QGFA 4UD9H 3A8AA 4YOJA 1O3DA 1ZSKA 5CHAC 2ZU4A 3RXDA 4A6LA 4CHAC 1AFQC 3RXCA 1UTMA 2ZGBH 5K0HA 5C94A 1MD7A 1XUJA 3H5CB 1BTHH 4MDSA 7LPRA 1RIWC 6CHAC 4HGCA 3TNTA 1IQNA 3ELAH 1MTNB 4NA8A 1ZGVA 3M7QA 3H09A 4XBBA 1O2RA 4WXVA 4Y6DA 6ESTA 5BPEA 1HAZB 2TPIZ 2GV7A 4GCHF 1D6RA 1SSXA 1WBGB 1Q2WA 1O5BB 5EOKA 2ALPA 4ABHA 1GVLA 3PV4A 4TWYA 4U32A 3TK6A 1O37A 5B6OA 3OX7U 2A7JA 1NZQH 3LJOA 4LK4A 2YMSC 3A7VA 3SORA 1FY5A 3G01A 5ABWA 2Y5GA 4NIVA 1BCUH 1IAUA 2W7SA 1BRCE 1DOJA 2B0FA 3OY6U 5TJXA 2WPHS 1S6HA 4XOJA 1JXPA 3FP6E 4UFGH 1NFWA 3ENSB 3F2GA 1C2JA 1BTZA 1XKAC 1AKSB 2ZGHA 1AVWA 1SGDE 1LHEH 4O03A 1DT2A 1O2YA 2EQNA 2VVVA 1BTWA 4TT3D 3ODDA 3HKIB 1BMMH 2V35A 4X6MA 2TRMA 1T31A 4Y76A 3TJNA 3LOXA 1FZZA 3AK5A 2A4GA 2KAIB 2W7UA 2Z3CA 1K1NA 2PKSC 3HATH 1QRXA 5HYOA 1GHVH 1DXPA 1DSTA 4A7IB 1GMHG 3U1JB 4E05H 3GDVA 4FUEA 1O3BA 1DWDH 1HDTH 2F91A 3ZZ9A 5GDSH 1LO6A 1WU1A 1C5UA 2STAE 1EKBB 3TPIZ 3KQEA 4YOGA 1ZJDA 1O2NA 1J16A 1A3BH 5JBCS 4WXIA 2JDID 1OWIA 1XUIA 2OC0A 1K1MA 4CRBA 1FV9A 1G2MA 1PJPA 3K65B 1ELGA 1OWKA 2AMPA 4UONA 4F49A 2IOTA 1BRAA 3IG6B 1Z8IB 3SGBE 5KEDA 1TMBH 3RUOA 5CHBA 2V0BA 2FESH 4CBNA 1GG6C 2VIDA 1Y5AT 3SHCH 5A2MH 1P11E 3ZV8A 2AMQA 1C1OA 2FI5E 1QJ1B 4JYTA 1GHAG 1RXPA 2Y5FA 3SV2H 1L1GA 1YYY1 4THNH 5A0AE 1BMNH 1BRBE 2VBCA 1BTPA 1VKYA 2CXVA 3OFND 3Q3KA 1EAIA 2VIVA 5JB9S 1YBWA 1G9IE 2J38A 4RN6A 5C5OA 2W6ID 3RLWH 4CRAA 1O5FH 3D23A 1BB0B 2FO9A 2OD3B 2LPRA 1NN6A 5AF9H 1O3NA 3TJVA 3OY5U 4KTSA 3FZDA 1NPMA 3SJ9A 3SNCA 3K6YA 4IBLH 1VGCB 1DPOA 1TNJA 4X2VA 2ZDKA 2OK5A 1L4ZA 1AZZA 3VEQB 1MBQA 4GLYA 5FL7D 3N99A 5DJ7A 2GCTC 4JK5A 2F9PA 3Q3XA 1GBHA 1V2OT 1WOFA 2AHME 1OWHA 4ACBA 4FU7A 1BUIA 2A7HA 2PGQB 3S69A 1O0DH 4K1SA 5B6LA 2YNBA 1Y5BT 2G81E 4UEHH 5HIZA 2GCHF 4VGCC 4OS4A 2ZGXH 2UWPA 3TGKE 1OKXA 2XBWA 3SNAA 4ZAEA 3RM0H 4IW4E 4D9QA 2GDEH 3BTFE 1GI4A 1O5DH 3KN2A 1VITG 3RXRA 3MH6A 1CBWB 1KXAA 1PPEE 1MKWK 3NWUA 1O2PA 2OP9A 1BT7A 1GJDB 2VWOA 1B7XB 1Z8RA 2ILNA 1IQJA 1UW7A 4YESB 5A0CA 2XC5A 3VXEH 1BTYA 1UVUH 2WYJA 1O3CA 2GZ8A 4ZHLU 2SGFE 2HLDD 2ZF0H 2XBXA 1FONA 1OWDA 3A89A 4MNXA 3U8TH 6GCHG 4AZ2B 1G3DA 1N8OC 1NRSH 1W11U 2ZHQH 3E0PB 4FUDA 3SU1A 2IPQX 1PPZA 1JBUH 3BG4C 1SQAA 3LC3A 1C5YB 3T29A 4BAQB 5F6MA 1ESBA 1ZTLA 1CHOG 5IYTA 3P70B 3QZQA 1OYQA 1Z6EA 2VWNA 1BTXA 1CU1A 1MH0A 3VB6A 1J15A 1LVYA 1YM0A 4X1QU 5C1UA 1MTNC 4DIIH 2QCYA 1WYKA 2IN2A 2XNDD 5FPYA 3RXJA 8GCHF 3PRDA 1ZGIA 3GISB 5E8EH 1DM4B 4ZCNA 3UQVA 1O2OA 2GGVB 1ACBE 1AY6H 1C1NA 3UTUH 1P0SH 4UE7H 2EC9H 1TMUH 3SQHE 5LPEA 1Z6JH 5LGOA 5I46H 1EAXA 3AVZA 1NRQH 1TRNA 1AN1E 1K1OA 4GHTA 3P8GA 3GY4A 1GJ5H 4FVDA 3MO6A 1C1TA 1ELCA 2Z6BD 1O2ZA 3QGJA 2BOHB 5JB8S 1DDJA 2O8MA 1AVGH 3V0XA 1Y3YA 1HXEH 1SR5C 1PPFE 2ZQ1A 4WMEA 4MNWA 1GHBG 5IDKA 3UR6A 1HB0B 4TPYA 2BDIA 3QUMP 4M7GA 4TY7A 3HPTB 5ESBA 1D3PB 2FX6A 3ESTA 1QCPA 2ZI2H 1GBEA 1GVZA 1SL3A 2WZQA 1WQVH 2A1DB 2PKAA 4DT7B 4AFUA 3QWCH 3KQCA 2P8OB 4FU9A 1W0JD 1EPTA 5GCHF 2JH5D 2P95A 2FS9A 3HK6B 1JRSA 2HALA 3R0FA 1SBWA 1GVKB 3D65E 5LPRA 1XUHA 2OC7A 3U69H 1MTUA 1IHSH 3WWFA 5AVDA 2G5NA 1C4U2 2TGTA 1NBMD 1A5GH 2JH0D 4FUHA 4NIYA 1AUTC 1MCTA 3SU0A 1S83A 1HGTH 2SNWA 4K60A 4BANB 1XXDA 1ZTJA 1NC6A 1AIXH 1F0TA 1SLWB 1QQUA 2BY6X 2FI4E 1F5LA 1JOUB 4CH2B 5GCHG 1BJUA 3FZZA 2ZHDA 5FXLA 1NFYA 5GNDA 2RDLA 4B2BA 1A4WH 1BITA 1TX6A 5EGMA 4X1NU 3V12A 1GJ7B 4RKJB 1FY3A 3M61U 1QB1A 1YPEH 3SV6A 3MO9A 4Y0YE 2ZTXA 4O9VA 3UQOA 1HJAB 2FM2A 2SGAA 4ABBA 4TSFD 3PLPA 1E36B 1KTSB 4K8YA 2IJD1 2ZWLH 1LHCH 1OP8A 2XW9A 5T6DA 3W1EA 2ZNKH 1AWHB 3BTKE 2C3SA 2FOCA 1C2GA 3LH1A 3BTQE 1P06A 3SHAH 1JIMA 3E16B 1HAHH 1YCPM 3GCOA 1D3DB 4IGDA 2FLBH 2IPHA 1ZSJA 4I33A 1GI7B 1HAOH 2BB4A 2KCOA 3TH3H 4NWLA 1O3HA 3IWMA 3BTHE 2VH0A 1JWTA 3QK1A 5DP3A 1V2NT 1Q31A 1N6XA 4ZXXH 1CQQA 3A83A 4GAWA 3SUGA 1V2PT 1MBMA 2BOKA 1N8OB 3TJUA 1A61H 1MKXK 1O33A 5G4BA 4A1TA 3ZYEA 1S5SA 1K1PA 3ZZCA 1XMNB 1G2LA 2QIQA 1ZHPA 4R0IA 1C5RA 3UOUA 1UVTH 4Y11E 4CRGA 1Y3WA 1GPZA 2Z9KA 1LHDH 3RC4A 5L2YH 3DSOA 1P10A 3PMJA 1DS2E 1O2LA 2ESTE 3BTEE 1VCQA 1JIRA 2KZ4A 2J4IA 1UTKA 2O8UA 3WW7A 1HNEE 1LVOA 3NCLA 2NU1E 1K28D 4WJG2 4XDEA 2HVYB 1E1QD 1HBTH 2VH6A 4X6NA 2XTTB 2EEKA 1SLXB 2BY7X 3NRLA 4KKDA 4ASUD 3T25A 3MNBA 2K0QA 3SGAE 3GCHB 5EJ1A 1UTPA 1QJ6B 1L0ZA 1NRNH 2RA0A 1DFPA 1P05A 1THSH 1YPMH 1V6DA 1BQYA 3T28A 1S6LA 3SQEE 2I6QA 5FX5A 1NESE 3NPSA 3STIA 2W3KA 3OAAD 4WH8A 5A09A 4H42U 1O2HA 1CO7E 1EP6A 1NU7B 3VB3A 1G37A 2ZDNA 2AFQB 2FI3E 3DSGA 2ZPRA 1THRH 2OC8A 2R0LA 5C5NA 5JYIA 2A32A 3FN8A 2J95A 4NWKA 1EOLA 1WUNH 3LGUA 7KMEH 3LJJA 4DIHH 2CHAC 9ESTA 5EU8A 3RMLH 3E0NB 5C67A 3EGKH 2FOBA 4FUJA 4HTCH 2IJOB 2BY9X 2OUAA 2G55A 2AGGX 1QFKH 6GCHF 2UUJB 4LXBH 3V3MA 2FOEA 2GT8A 4HZHA 2A4RA 2GTBA 2BZ6H 1C2FA 3RU4E 1TGTA 1GI9B 1HAXB 3UB0A 4GHQA 1OWEA 1C9TA 2RDEA 4WF8A 4NSYA 4OGYA 3S9AA 4ABGA 4J2YB 5CE1A 1FXYA 4NGAH 2M2AA 1C2HA 3RXAA 4A92A 2GMTC 1TQ7B 1AU8A 1O3IA 1QIXB 3F2HA 1KLJH 1UJ1A 3OU0A 1P09A 1NY22 3BEIB 2A4QA 5FAHA 2A5AA 2F3CE 1W12U 3OSYA 1RIWB 4P02A 1ELDE 3OTJE 1ELAA 1IQHA 2P59A 3P8OA 1MTSA 2Z9IA 2ZTZA 1SC8U 3NKKA 4BXSA 1SGCA 1YY3A 1C5LH 5E0JA 4X1PU 1NRRH 2HGTH 5HIYA 2OLGA 4MTBA 3SO3A 1NBME 4D9RA 1F0SA 1ELVA 4JZFH 2VVCA 4FU8A 4X6OA 2OQ5A 4IC6A 1SFQB 1AB9C 3A81A 1YLNA 2O8TA 3W94A 1SQOA 3EE7A 3R3GB 3ZVDA 4I32A 1P9UA 2WPMS 3T5FH 1V2TT 5EXNA 1GHWH 2G51A 3V13A 2PUQH 3T26A 2BVRH 2PLXA 2LNCA 3RU4T 5BRRE 4YOIA 1PQAA 1WAYB 4UDWH 4ZUHA 3K9XB 2AERH 1S6FA 1WV7H 1C5XB 2ZECA 4YXWD 1KIGH 2Z3EA 2ZFQH 2BD3A 2ZU3A 3NZIA 1F0UA 5DO4H 2AGEX 2STBE 3EA8A 4MG3A 1ANDA 3A84A 1AVXA 5C17A 2Z3DA 2ZU2A 1TPSA 3A82A 2ZHWH 4JZIA 1EZUC 1MAYA 3OTPA 2HLCA 3GCHC 3SU4A 4B75A 5F8XA 2PTNA 4RI0A 1ZOMA 1C4V2 3PM3A 1ZR0A 4KTUA 3S9CA 1C2MA 4CR5A 1MQ5A 2BDYA 2ZTYA 5GPIB 1TNKA 4CHAB 3M5OA 1QZ8A 1D3QB 3RXBA 3A88A 2ASUB 5CHAB 4JMYA 3RC5A 4ISLA 3I29A 1UMAH 2ZFFH 1FIWA 1K1IA 7ESTE 4E7NA 1GHXH 1UK2A 1HLTH 3TGJE 3DD2H 1LKAA 5SGAE 5EG4A 1GHBF 1CHOF 4IMZA 3MNXA 2BDBA 1P2JA 3S0NA 3E90B 3M35A 2C4FH 2Y81A 1LDTT 1HJ9A 1LKBA 1CA0B 3AAVA 1WXRA 4DJZB 1QB9A 4Z0KA 2LP6A 3TK5A 2BQ7B 3EQ0H 3UY9A 1KDQA 1DICA 4BAMB 4AG1A 1HFDA 1P2IA 4K69A 2Y82A 1DLKB 5EQQA 3QN7A 2PSYA 1GMHF 5EXMA 4JZDH 1SGPE 1V2JT 3RXVA 2DUCA 1X7AC 2OQUA 3BIVH 3IITA 2DE9A 5EQRA 4Y0ZE 1FNIA 4AFQA 1KYNA 4DOQA 1T8MA 2BDHA 1UCYH 3BV9B 2KFWA 3FO8D 3BEFB 1Z1JA 2BY5X 1QNJA 1J17T 3MH5A 3UIRA 1YPLH 2OTVA 1IQKA 1CE5A 2ODQA 3F9EA 2GKVE 4D76A 3SOSA 3RXQA 2V3MA 1QBVH 1NFUA 3UFAA 1Y3VA 1D4PB 1FI8A 1LQEA 3KQDA 1C1SA 4X8SH 1GBMA 4Q7ZA 1D6WA 2LELA 5EJLA 1E38B 2VJ1A 2QC2A 2KR7A 1CT0E 1UTLM 5DP8A 1QRWA 3MNCA 4M9FA 5EW1H 1SGEE 4ABDA 4MNVA 2H2ZA 1AE8H 3LU9B 2ZA5A 4YT6H 2H9HA 4YO9A 3ITIA 1PPBH 4ZKNU 2Q6DA 4QT8C 1O5CB 1GI8B 3FANA 1OHHD 2W26A 3A8BA 2J94A 1GHYH 2FPZA 2A2XH 3RXEA 2FXRA 2BXUH 1TLDA 3P92A 3FOAA 3PB1E 3BEUA 2PR3A 2J2UA 3AW1A 1W8BH 1FPHH 1T8NA 1XUGA 4I8KA 3H7OA 1SPJA 1OOKB 3UPEA 1OP0A 3RXFA 2GX4A 1ETSH 3FVFB 1YLCA 3B9FH 5DG6A 3PMBB 1ESTA 2VGCB 4RKOB 1COWD 3KCGH 4INHA 4AFZA 4E06H 1HRTH 3F3BA 3BTTE 2VGCC 1O3JA 5FX6A 5HGGA 1JRTA 3VB4A 2Q6FA 3QZRA 3F0PA 3ATMA 4Y79A 1NRPH 1GBIA 1SOTA 3L3TA 1RGQA 2C93B 3KQ5A 3RU4D 3M37A 2FOFA 1Y59T 2J5UA 4BOHA 2PHBA 3BIUH 2BDGA 1GHAF 3UNSA
chains in the Genus database with same CATH topology
2OBOA 5FBIA 2ULLA 4A5TS 2HNTE 4NIXA 3A85A 2GV6A 5F03A 3E91A 1O3FA 2BY8X 4ESTE 3GYMA 1ZHMA 3SV8A 1RTKA 3QX5H 4ZHMU 2B7DH 1C2EA 4Y8XA 1O31A 4X8VH 2FYRA 2QF3A 4NA7A 2G4UA 2BD8A 2ZFSA 1QTFA 1Y5UT 2AIPA 4JK6A 2BM2A 1A2CH 1K2I1 1NT1A 2P16A 1HAYB 4A1VA 2Z94A 1ANCA 2D2DA 4B71A 4I8LA 3KHVA 1LHFH 3SUFA 1ZJKA 5FPSA 1V2ST 4H4FA 1T8OA 2AS9A 1TNLA 4HFPB 1HAGE 1VZQH 3RP2A 4FUCA 2Z7FE 1HIAB 1CT4E 1G30B 2HPQH 4I7YH 1SGFG 1UK4A 4DVAU 1A3EH 3SW2B 3VB7A 1K21H 3LT3A 3DUXH 5C1XA 1ZMLA 2C8WB 1SB1H 1O2IA 2F9VA 2ZFTA 2CJIA 3H7TA 1BBRK 2O8LA 2BMGB 1OX1A 3U1IB 3TNSA 1W10U 1P3EA 2XWBI 1C1MA 2Y80A 5JBAS 1N6YA 4DW2U 1A7SA 2BX4A 1DANH 3BF6H 1TWXB 2J34A 3MFJA 1CT2E 3ATIA 1QA0A 2QF0A 3S7HB 1ETTH 4K3JA 2BLQA 1GBLA 1P2QA 3EE0B 1S81A 4BAKB 2FOHA 3ZVAA 1P2KA 5F8ZA 1HV7A 3SU5A 4A1XA 2D26C 3ZYDA 2UUYA 1FQ3A 1YPJH 1PPCE 1C5MD 1GJ6A 4ISOA 3CENA 4X8TH 4U01A 1PYTD 1FJSA 3F6UH 1ZHRA 2XYAA 4BTUB 4O3UA 2OC1A 2A7CA 3SJOA 2SGQE 3MWIU 1GGDC 2ZCHP 1KXBA 1GI6A 4KP0A 1BBRE 3GY8A 4X2YA 1ZYOA 4NZLA 5K7RA 3M5MA 2ZEBA 3T27A 1BOQA 1E34B 1PYTC 1YLDA 4ISNA 3DA9B 5E0GA 3BTME 1ELTA 2HWLB 3SJKA 1C1QA 1Q3XA 3ATKA 2CHAB 4ABAA 3SUDA 1EATA 5JBTA 3A8CA 2VU8E 1AB9B 1ARCA 3KNXA 4I8GA 1TIOA 1O3LA 2BDCA 3FAOA 1O5GH 3M3VA 3U9AH 3E6PH 1ZMNA 1UTQA 3A87A 1EAUA 1XUFA 5E2OA 2OCVB 4Y8YA 4Q2KA 5DPAA 4CRFA 3UWIA 3GCTG 1EB2A 1GI3A 1ELBA 3ZZ6A 1BIOA 1ARBA 1O3AA 1QBOA 1XVMA 1ANBA 4FUGA 4BTTB 1GI5A 1MU6B 1SGIB 1MD8A 3HK3B 2XNIA 5FBEA 4X2WA 1GJ4H 1KLTA 4MPXA 3NXPA 4GSOA 3BTWE 2WV4A 1YKTA 2A2QH 3M7TA 1ZTKA 2Y6TA 1V2RT 5E2PA 5C1YA 4X1SU 1GL0E 1CHGA 3SU3A 4X6PA 1IQIA 1NTPA 1QB6A 2OINA 3VFEA 1C9PA 2ZU5A 3K6ZA 4AFSA 3MTYA 4JYVH 2A4OA 5DK1A 1VJAU 5JPMH 1S84A 1MKWH 2BTCE 2SGPE 3TVJB 5A8YA 4AG2A 1SHHB 1OWJA 1DXWA 4RSPA 4BAOB 1DX5M 1EP5A 1W13U 2J92A 2WV5A 2YNAA 4X1RU 1EASA 1H4WA 1L1NA 3SN8A 3ZZ8A 2A45B 2CMYA 1AZ8A 1D3TB 2UUKB 2Q6GA 5C20A 1ORFA 2QGRA 2ZKSA 3PO1B 1TRMA 3KIDU 3Q00A 1W0ZU 1Y3UA 2BHGA 3LKWA 1O3GA 3MOCA 1RS0A 1DWCH 1TPAE 3ZZDA 1MCVA 3EA9A 2VIWA 3ATLA 3SI3H 1O30A 4OS2A 1SGRE 2PV9B 4OGXA 2XCNA 5JDUB 1GDNA 3RM2H 3HKJB 1A0LA 1WSSH 1LPZB 1RRKA 4XSKU 3ATWA 1FY8E 3UWJH 3P8NA 1GBTA 2HNTC 3GY6A 1SGNE 2ZQ2A 2G5VA 3UR9A 2SFAA 1AGJA 1C5TA 2ZP0H 3GY2A 1QURH 3F9GA 1F5KU 3V7TA 1FN6A 2BQ6B 4Y7AA 2CF8H 3GY3A 3ZZ4A 4I8JA 3U8OH 1GWAA 1Z8JB 2QA9E 2W5EA 4GUXA 1FMGA 1W14U 2ZG0H 4TWWA 1BA8B 2FS8A 8KME2 1QHRB 1W7XH 2P93A 2D1JA 1GG6B 4VGCB 4KTCA 3LH3A 1H1BA 1OYTH 4NFEA 3RXPA 4ZKSU 5T3HA 1E37B 4ABJA 1BTUA 1O2UA 1P3CA 1SI5H 3SV9A 1GMCG 4Y71A 3QGNB 2BX3A 3C27B 5I25A 2JH6D 2BD4A 1L1JA 2GCHG 1TQ0B 1BDAA 2FIRH 2Q1JA 3P17H 2ODPA 1A0JA 2XBYA 4O3TA 4AOQA 2FWWA 2PGBB 1GBFA 1O2TA 1KDQB 4MNYA 2F83A 1TPPA 1FUJA 2QV1A 2ZFPH 4AORA 1PPHE 2QY0B 3MMGA 4ISIH 5JBBS 1GCTC 4D7FA 4NA9H 1DITH 5HM9A 3GY5A 2ZGJA 3TJOA 2BVXH 3EAJA 2VB0A 2VIPA 4FUFA 2WPKS 2DE8A 1BJVA 2QXGA 2WPIS 1UVPA 1P2OA 3SNDA 4WMFA 1THPB 1V2MT 2OXSA 5L6NH 2FOMB 1MMJN 4YLUA 3URDA 1ZRKA 1IOEA 1T8LA 2O9QA 1HPGA 3MU8A 3PYHA 1GI2A 1AMHA 2PW8H 3GDUA 1ZLRA 4ZKRU 1T7CA 1XUKA 1NO9H 1C5ZB 2PSXA 1O34A 5T6FA 1AI8H 1QL8A 2UWOA 2GZ9A 3ZZ3A 1GCDA 7GCHF 3KF2A 4ZMAH 2FTMA 1XXFA 1ZRBA 3DFJA 3UNQA 4YZUA 4JZEH 2ZGCA 3LC5A 3F9FA 3SU2A 2AYWA 3FP8E 1TNGA 4CRDA 8LPRA 1OS8A 2FLRH 1ZZZA 4AB9A 1MAXA 1XVOA 1A46H 2VINA 3RXTA 2VWMA 3LDXH 2PKSB 4AN7A 1CGHA 3D49H 2NU0E 2ANWA 3F9HA 1H8DH 1KY9A 4AYYB 5L30H 1EJNA 2ZDLA 1RJXB 1PQ7A 3LIWA 1J8AA 1UK3A 4XBCA 5J4SA 1O2JA 5FCRA 1P04A 1GBCA 1K1LA 1YCPK 5L2ZH 1GCTB 3QDZB 1DLEA 1C5PA 2PWXA 3GYLB 4MQAA 1SLVB 1UO6A 1O2WA 4IC5A 1EZSC 1QL9A 3L6PA 3M5NA 4XBDA 2EI7A 1RTLA 3A7XA 1DY8A 4TYDA 1F92A 1A5HA 4I31A 4DGJA 1TBRH 3GY7A 5HMAA 3N7OA 5TCCA 4HI3A 9LPRA 1QL7A 1OP2A 1DUAA 2HRVA 2K1QA 3ZZAA 3Q76A 1GBJA 3PTBA 1MUEB 3RXLA 4JCNA 2BLWA 1J9CH 2HVXA 3KGPA 3SGQE 1TABE 1VGCC 2RG3A 2GVFA 1W7GH 2EA3A 1H9IE 2P94A 1XM1A 4YM9A 4Z6AH 1SHYA 1VJ9U 1QA7A 5GIBA 1E0FD 1VITF 2QN5T 4WWYA 1TAWA 2R3UA 4H6SB 5EPNA 1CGIE 1PFXC 4INLA 2AEIH 3CS0A 5TCAA 3GCTF 2H5CA 2ANKH 4KELA 5A8ZA 1XKBC 4LOYH 3A8DA 3QO6A 4MPVA 4IN2A 3NK8A 5DP9A 1G3BA 1LPKB 4D7GA 1O35A 3RC6A 3KQBA 3ZVCA 1EZQA 3SJIA 3SUEA 5DP5A 2GD4B 1BBRH 5DGJA 4ABIA 5H4IB 4Q80A 4KGAA 2R2MB 3ZVGA 3QTOH 1QY6A 1YCPH 5HXFA 1C1WH 1MZAA 1MU8B 1DUEA 2BVSH 2C90B 2ZFRH 3SNBA 2Z9GA 2VVUA 2GT7A 2ALVA 4AX9H 3ZVEA 1HAIH 1LVBA 1HUTH 3MI4A 2ZZUH 2PFEA 1MTVA 3A7WA 3BG4B 1P2MA 2HPPH 1MKXH 1N1LA 2FX4A 2Y7XA 2A0QB 2FEQH 1V2QT 3LPRA 1AUJA 3LGWA 3UNRA 1T4UH 1GMDF 1J14A 1C1UH 1K9OE 4H6TA 4F4OC 2FODA 1IHTH 1ABJH 1GDUA 2C8YB 4U2WA 3AASA 2PUXB 2ZIQH 2XC4A 1GBBA 4DURA 5HM2A 3LGTA 1KXCA 2SGDE 3BTGE 3GOVB 1TB6H 2XRCA 2XCFA 5DP6A 3ZV9A 1ESAA 3RDZA 1TGNA 3E3TA 4R8TB 1C5WB 1G32B 1SGTA 1O32A 1TYNA 4NFFA 3GCNA 3CP7A 3WY8A 3PLKA 2C8XB 2WUBA 1FAKH 3MH7A 1TBQH 4WH6A 5AHGH 1HIAA 3O8CA 1HCGA 3E8LA 1UHBB 1DSUA 1AE5A 1GBKA 1TE0A 1SGYE 1S0RA 1HYLA 1QRZA 1O38A 1ZSLA 1DY9A 1O5AB 4WMDA 1YC0A 1NU9A 1F2SE 1EOJA 2JETC 1W2KH 2G8TA 8ESTE 1GJ8B 2GCTB 3RXGA 3PMHB 1TX8A 2BZAA 2QXHA 3RXUA 4MPUA 2NU3E 2QYIA 1K22H 1AWFH 3PROA 2P3UB 6CHAB 1JMOH 4YTAA 3TGIE 3PO1C 1LCYA 1YP9A 2Y7ZA 2ZHEH 1HXFH 4BXWA 3PTNA 1C1VH 3LGYA 1IQMA 1BHXF 2W3IA 2V3OH 3ZZ5A 1P8VC 1GI1A 5J4QA 4FXGH 2V6NA 1BHXB 1V2VT 1NFXA 4K5ZA 3MO3A 1UHBA 2BXTH 1SGQE 4X2XA 3JZ1B 3RXIA 1SVPA 2FTLE 2KAIA 1UVSH 4IN1A 3RXKA 1QJ7B 4BTIB 1V2KT 3A7ZA 1EUFA 2YOLA 3JZ2B 1HAVA 4MPWA 2ZDMA 1LQDB 4AGKA 2NU2E 4O97A 1TBZH 2NU4E 4FVBA 4GCHG 1P12E 1AKSA 1P03A 2FP7B 1F0RA 1C2LA 1CVWH 3S9BA 2THFB 2CV3A 1OPHB 2F9OA 3ODFA 3SBKA 2I6SA 4IS5A 2ZHFH 4TPIZ 4UFFH 5F8TA 1V2WT 1SMFE 3Q77A 3LONA 1BZXE 4SGAE 2GZ7A 1YPHE 1QR3E 3RXMA 2H5DA 1EPTB 1UTJA 2ZO3H 2PKAB 2B9LA 4MLFB 1G36A 4B76A 4BAHB 1EPTC 3BG8A 1LMWB 2WYGA 1C5NH 4YT7H 5AFZH 3T62A 3MYWA 2A31A 4LZ4B 3RXOA 2XWAA 1AFQB 1GMDG 4CH8B 2R0KA 4LZ1H 1IQLA 3TITA 2ZC9H 3RLYH 1FPCH 4TY6A 3HGPA 4ZXYH 4ABFA 3HGNA 1P57B 1E35B 3UREA 1GJBB 2ZPQA 2ODYB 1EX3A 2ZCLP 5DKMA 2Y5HA 3A7YA 1KLIH 1V3XA 4OS5A 1CBWC 1PPGE 5EODA 3I77A 4NG9H 5C2ZA 1HJ8A 1TGCA 1UVOA 1V2UT 2J9NA 1YGCH 2ZU1A 3I78A 1O3EA 2TIOA 4AYVB 1BRUP 2UUFB 3O8RA 1PQ5A 1QBNA 1GI0A 3W95A 1SFIA 3PWBA 1GJCB 2BLVA 3DHKH 3K2UA 1P01A 3SV7A 1O2KA 2P3TB 4B74A 1ELEE 1VCWA 1O3MA 1C2IA 4Y7BA 5FHTA 4K8BA 3S7KB 3EA7A 3D62A 1TGSZ 1T32A 3VGCC 5LPFA 1GBAA 2JKHA 3GICB 1C2KA 2V3HH 1GHZA 1Y3XA 4B1TA 5T6GA 2NWNA 2CN0H 1D9IA 3GDSA 5ESTE 2BLOA 4NSVA 3U98H 3O8DA 1NROH 1DWBH 3QLPH 2TGDA 4GPGA 1TGBA 1EJMA 3MHWU 4U30A 5DP7A 1B0EA 4YLQH 1KXDA 3OYPA 1L2EA 3E1XB 4NZQA 5C3NA 2EI6A 1GDQA 3A86A 3BTDE 1A5IA 3P8FA 1O3OA 1W0YH 1ZPZA 1INCA 1NS3A 3VB5A 2D8WA 1CSOE 1WCZA 4K2YA 1O3PB 5EQSA 1BMLA 2BD9A 4ZHAA 1AQ7A 2CF9H 4PROA 3LGIA 3VGCB 1QQ4A 2R2WU 4Y8ZA 3M36A 1C5QA 1TA2A 1GGDB 1NM6A 1VCPA 2G4TA 2H9EH 1SG8B 4Q7XA 3RXHA 5GWZA 3RXSA 3MU1A 3QTVH 3MU5A 4AB8A 4JYUH 2BD7A 3L33A 3BSQA 1EJAA 1P02A 1RTFB 3DFLA 4GVUA 4WVPE 2VIQA 1Z71A 1IQFA 1CGJE 1ZPBA 1SLUB 2QAAA 2TGAA 1O2XA 2Z9JA 4INKA 1FY4A 3SI4H 5LH8A 3P6ZB 4MVNA 2G52A 3PMAB 3RMMH 1CA0C 2VIOA 1ETRH 1C5SA 1TONA 1YPGH 1O2SA 3KEEA 1MZDA 2F9UA 4X8UH 1GJ9B 1SGFA 1Z1IA 3TIUA 4UFEH 3AW0A 3MU0A 3MNSA 2BQWB 1ZPCA 3FFGA 4DCDA 1C2DA 1U6QA 2WINI 3NUMA 4Y10E 1GL1A 3DT0H 4WY3A 4XE4A 3EDXB 1HAPH 2RA3A 1WTHD 3RMNH 2FOAA 4CRCA 1O3KA 1TFXA 3UUZA 3SZNA 1FIZA 4ZROA 1TNHA 1TA6A 4K1EA 4BNRA 2EI8A 2R9PA 1LHGH 2ZDAH 1VR1H 1UTNA 3M3SA 1FDPA 3STJA 1LPGB 5E0HA 4ZKOU 5PTPA 1S85A 3SJ8A 2JETB 1O36A 3MU4A 1YPKH 3TLOA 1TMTH 3URCA 2CGAA 1C1RA 2XXLA 1C4Y2 1EZXC 1TRYA 4ABEA 3F68H 1IQEA 2BD2A 3P95A 4ZH8A 1ANEA 4OS6A 3RMOH 5ETXA 2R3YA 3SNEA 2TGPZ 4CR9A 2F9BH 3A80A 3SU6A 3ZVFA 1W3CA 1PQ8A 2P3FH 1TALA 2O8WA 3KL6A 4NIWA 1RFNA 1DVAH 1B0FA 4I8HA 3ZZBA 2H9TH 4DY7B 1GMCF 2AIQA 2VWLA 2BDAA 1F7ZA 1B5GH 1SOZA 2GDDA 3B23B 4XFQA 1DE7H 1TX7A 2M5TA 2ZPSA 2C8ZB 1RD3B 4NCYA 1KXFA 3F1SB 1UCYE 1A1RA 4AGJA 4CREA 2AMDA 1EAWA 2A5KA 1KXEA 1YF4A 2A5IA 4B2CA 1G3CA 5EPYA 4UFDH 3B8JA 1F5RA 3O8BA 3VXFH 2SGEE 1GJAB 1O5EH 1AFEH 1C1PA 2Z9LA 1EB1H 1Z8GA 3M3TA 4B73A 1O2GH