5LPEA

Kallikrein-related peptidase 10 complex with zn2+
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
226
structure length
204
Chain Sequence
PCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTAAHCGNKPLWARVGDQGEQLRRTTRSVVHPKYRTDEHDLMLLKLARPVVLGPRVRALQLPYRCAQPGDQCQVAGWGTTANKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kallikrein-10
publication title Structural basis for the Zn2+ inhibition of the zymogen-like kallikrein-related peptidase 10.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 44
structure length 204
sequence length 226
chains with identical sequence B
ec nomenclature ec 3.4.21.-:
pdb deposition date 2016-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5lpeA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5lpeA02
1T8MA 2XCFA 1DLKB 2P94A 2HNTE 3GCHC 3T27A 3DFLA 3PMBB 2BDAA 1DITH 2BXUH 3RXKA 2BDYA 1PPBH 1OP8A 1Z8JB 1XUJA 1TPPA 2ZTYA 4WVPE 2Y82A 1YPJH 3ATMA 2C8XB 1HYLA 1GI5A 6LPRA 3SW2B 2BZ6H 4YZUA 4MPXA 3ZVBA 5DJ7A 4Y0YE 1EZSC 1RIWC 3VB4A 1GHVH 4WY3A 4TPIZ 2BQWB 1NS3A 2XC4A 1L4ZA 2VWNA 4H4FA 4KKDA 4ABFA 2G52A 2SGAA 2BLVA 6ESTA 1GBIA 4D9QA 1RD3B 3RLYH 3OTJE 3DHKH 4NWLA 2ZHQH 2PHBA 1AUTC 4ZHAA 2QA9E 1O0DH 1LVYA 2NU4E 2ALVA 3EAJA 4Y11E 4ABDA 3SNAA 3SU3A 3FVFB 2D1JA 3C27B 5E0GA 1L1NA 3BTQE 1GJ7B 1HLTH 2ULLA 1O5CB 2NU2E 4IS5A 4BAMB 4Y7BA 2PGQB 1Q31A 1EZXC 4XE4A 3AAUA 3U1JB 1O2UA 1Y5BT 3STIA 2PKAB 3QZRA 2ZPSA 4O3TA 4M7GA 1ZGVA 1K2I1 2H6MA 3SJIA 1FY8E 2Q6FA 3E0PB 1IHSH 1IQJA 1AE8H 1C5ZB 1O5FH 5EW1H 1ZJKA 3BTTE 3V7TA 3A8CA 4X8UH 2VWLA 3NPSA 5EPNA 5JDUB 1KXDA 1TA6A 1ZHRA 2STBE 2XW9A 3A88A 3RXFA 1ZRKA 1FPCH 2XNIA 1K22H 5HGGA 5GJ4B 4WJG2 4A1VA 1QTFA 5E0JA 1O3CA 1HIAB 1CVWH 1O3HA 1T8LA 3QGNB 4WH6A 1OXGA 1SGEE 4K1SA 3IITA 1GL1A 1QA7A 1O3IA 4TY7A 4X2YA 4ABEA 2UWPA 1SGFA 3BEUA 3BTGE 5H4IB 1EPTA 1SGCA 2G5NA 1C5TA 3MHWU 4WF8A 3ATWA 1YCPM 2VJ1A 4DIHH 1AE5A 1BJVA 1QR3E 1NN6A 2AGEX 1TGCA 1W11U 1L1GA 3OU0A 2TGTA 3BG8A 3MOCA 2Z3DA 3E16B 1ZOMA 4F4OC 4JZ1A 1BDAA 1NRQH 5A0AE 1OWEA 3D23A 1GDQA 2Y81A 4ABIA 3G01A 3MWIU 3RMOH 1DS2E 3TH3H 1AU8A 1K9OE 4AX9H 5T6DA 1O39A 2ZU1A 1GJAB 1C2GA 3FAOA 1C4V2 3D65E 1V2WT 3FZZA 2BDIA 2JKHA 9LPRA 3L33A 3TH2H 5JBAS 1Y59T 3CP7A 4X6NA 3T29A 1GWAA 4DJZB 2PWXA 1DM4B 5A8YA 1UTPA 1UVSH 4GLYA 4LXBH 2BZAA 4E7NA 2PUXB 1ZRBA 3OY5U 4Y6DA 1GBJA 1YPMH 1P0SH 4Y8ZA 2FWWA 5FPTA 2A4OA 2XWAA 1SQAA 1ZTJA 4O3UA 5EXMA 2ZGJA 4B71A 3W94A 1W14U 1AZ8A 2ZKSA 1KTSB 3A87A 3S7HB 2B9LA 5EGMA 3P8FA 4XSKU 1QHRB 2OP9A 2ZNKH 3A85A 3TNSA 2BMGB 2O9QA 4XFQA 5C1XA 4FU9A 1FMGA 1BTXA 1GCTB 3B8JA 4X8TH 1DWEH 1BZXE 1W13U 2WPKS 4MNXA 1SC8U 4X2VA 4BAHB 5JB8S 1SR5C 2VWMA 1PQ7A 4UD9H 1HJ8A 3PTNA 1YYY1 1AVWA 1BTWA 3TPIZ 2BY6X 1O3AA 3R3GB 3CS7A 4R0IA 5F8ZA 1HAXB 3LGWA 2A5AA 1K1OA 2KAIB 1P11E 1CHGA 1ID5H 2VH6A 1GMCG 1S82A 2ZDAH 3A8BA 1UK4A 3LU9B 2ZCKP 3F6UH 4NZLA 3I29A 4NIXA 1GBHA 3SZNA 1BRBE 2HOBA 3URDA 1WCZA 2HALA 1KXAA 1FY1A 1A61H 2Q6DA 4GVUA 1XVMA 2B7DH 3SGQE 3SJOA 1Z1JA 1MKWK 2OCVB 2FOMB 1JMOH 8LPRA 4E7RG 2QAAA 4OS2A 1PPCE 1K1IA 3KQDA 2EI8A 2UUYA 3S69A 1TNGA 2ZTXA 4U30A 3BEIB 4X6OA 2P8OB 1OWJA 1Y3VA 3OY6U 5CHAB 1LHEH 3T62A 1UHBA 2Z6BD 1UVUH 3H7OA 4K69A 1DWDH 4X1SU 1YPHE 1AFEH 1FXYA 1DXPA 2GMTC 1T4UH 3ZZBA 2BM2A 2QC2A 1HXFH 4JYTA 1V3XA 1ELGA 1O2PA 2FO9A 1V2MT 3UR9A 3K65B 1TE0A 1E0FD 1O3LA 3GISB 1D3TB 1DT2A 1W12U 1CA0C 1TONA 4NIYA 2BQ7B 2J95A 3BV9B 1HGTH 2AERH 5C3NA 5T6FA 3A82A 2QN5T 3OSYA 2ZPRA 1KLIH 2XBVA 3FP8E 1V2JT 2HNTF 1HAZB 5TCAA 2OC7A 3HATH 1C5QA 1D3DB 3GCTF 3O8CA 3AVZA 2A4QA 3BTFE 1C1OA 4E05H 1J9CH 1NY22 1PPZA 1GI2A 2V3HH 2BB4A 3FFGA 4RKJB 2ZU3A 5JB9S 1GBBA 3O8RA 5K0HA 5C5NA 4A6LA 3BG4B 1UMAH 2W3IA 3ZV9A 1RS0A 1DY9A 4ZKRU 1QURH 4A5TS 1DOJA 4B2AA 5J4SA 1SHYA 3GY8A 3M3VA 2TPIZ 1PPGE 1G2LA 1Z8IB 4D7GA 3ZVDA 1AB9B 4ESTE 1F0SA 3P17H 1G3EA 1UCYH 3GCTG 3KGPA 4MVNA 3VGCC 4D7FA 1QFKH 2NU1E 5ESBA 3ZZ3A 2ZFQH 7ESTE 3PO1B 3QGJA 4H6SB 4CR5A 1HRTH 1C1NA 1KSNA 1Y3UA 4THNH 4FUCA 4AFSA 2BQ6B 4WMDA 1TBZH 4VGCB 1MD8A 2G5VA 1JXPA 5ABWA 3GOVB 1CT4E 3ZZ6A 1QL9A 2BX3A 3M5LA 2FPZA 2GCTB 3GY6A 2VIVA 2TGPZ 4I8LA 4Y8YA 4B2BA 3RMLH 5GIBA 3HKIB 1ZPZA 1H1BA 1QNJA 2W5EA 1V2QT 2ZGXH 3ZVAA 4B75A 3R0FA 1YGCH 2BHGA 1VCWA 3BF6H 3T5FH 3SNCA 1AHTH 2CF9H 1W0ZU 4OS7A 1BT7A 2OBQA 5L30H 1P3CA 2ANWA 3UY9A 1HCGA 4I31A 3U9AH 1ABIH 2QXIA 1DY8A 4ISLA 5DGJA 1INCA 1XUFA 2HVXA 4Y76A 4MNVA 2GCHF 3LGYA 2ZQ2A 2FXRA 3QLPH 4I7YH 1ESAA 3E3TA 4HZHA 1CO7E 3RM2H 1L0ZA 1YCPK 4Z0KA 4AN7A 1ZSJA 2G4UA 2NU3E 4LZ1H 2ZGCA 1TPAE 2A7HA 1BQYA 3TU7H 6GCHF 3LPRA 3ATLA 1P12E 1ETRH 1HAOH 1O2YA 1SLXB 2C90B 3TH4H 5T6GA 1BHXF 1G32B 3Q77A 3Q3KA 5EOKA 1ELCA 4ZAEA 4J1YA 3IG6B 4ZXYH 1UVPA 1O3JA 1CHOG 2H2ZA 5DO4H 1TOMH 2WPIS 2ZIQH 1GBEA 3GY5A 4UONA 1P06A 1FZZA 1NO9H 4TYDA 3M7TA 4NWKA 1MKWH 1LHDH 1XXFA 3DA9B 6GCHG 5DP5A 2ZHWH 1SVPA 1Y3XA 4CRCA 3LIWA 2V3OH 3LC5A 4K1EA 1C1TA 3RXLA 3SHCH 1TPSA 1XUIA 3GCNA 3V12A 1BIOA 2ODPA 1C1UH 3QUMP 2BTCE 2R2WU 3KF2A 4ABBA 2QXJA 3SO3A 1MMJN 1W3CA 2D8WA 1JIMA 1GI1A 1LVOA 3A81A 1GJ9B 4XOJA 1UO6A 2PFEA 3GICB 4CHAC 3PLKA 3K6YA 2TBSA 4MLFB 2ZF0H 3ELAH 1NRNH 2ZZUH 2J34A 2QF0A 2AMQA 1ELVA 4FUDA 1FIWA 3F9EA 3TLOA 5SGAE 1DUEA 3HK3B 3TNTA 3TK5A 2SGPE 1IOEA 2OXSA 1LMWB 2VIQA 3F9GA 3LKWA 1QY6A 3QO6A 4Y79A 1TMBH 2I6SA 2TIOA 3IWMA 3E91A 1DE7H 1Z6EA 1C2LA 1C1SA 2GDEH 4YLQH 1FAKH 1P2QA 3RXQA 5HXFA 1ACBE 3GYLB 2ODYB 4Q7YA 3UREA 2ZU2A 3KIDU 3SUEA 3RXVA 1C5XB 5K7RA 1THSH 2AH4X 4TWYA 1ABJH 1TABE 1ELDE 1FY5A 1YF4A 6CHAB 2DE9A 1GJ6A 3GDUA 1VZQH 4X8VH 4AZ2B 4D76A 4JZDH 1UTMA 5L2YH 1CU1A 1AZZA 1C2FA 1KDQB 1O5GH 1DFPA 1CGJE 1QGFA 1S0QA 3PV4A 1EP6A 3UFAA 1ZSKA 3A7ZA 1GHYH 3D62A 2H5CA 2VWOA 3MU1A 4FUEA 4UFDH 1QIXB 4SGAE 3PWCA 4TWWA 1TPOA 2FTMA 4I8GA 1GJCB 3AW1A 2NU0E 1O31A 3UPEA 1F5KU 2BD7A 3EQ0H 3S7KB 1LKBA 1Z7KA 1F0UA 2ZFPH 2FOHA 3ZV8A 1OP0A 3BN9A 1O2ZA 5A0BA 1O2KA 1P2IA 3MYWA 1A4WH 3MTYA 4CR9A 5LGOA 1AFQC 2Y5GA 5C1UA 1GBMA 1P10A 3BTKE 1O2JA 1FONA 4JMYA 1AWHB 1SFIA 1J8AA 2FLRH 2FS8A 2P59A 3BTWE 4ABAA 3GY3A 1K1JA 4ZUHA 3WY8A 1H9LB 4H6TA 2WPHS 5PTPA 1S83A 4A1XA 1TNJA 2CJIA 4ABGA 5F6MA 2J2UA 2WUCA 2ZFSA 1NZQH 4CRBA 2GV7A 4RSPA 2OINA 1BJUA 5EPYA 1C5RA 3QDZB 2A5KA 4K8YA 4INKA 3SQHE 1CA8B 1OOKB 3UWIA 1Y5UT 1VGCC 3UWJH 1YCPH 2BDCA 2GZ9A 1LPZB 3TK9A 1C5UA 1ORFA 1C9PA 1BRAA 2UUFB 1L2EA 4JZEH 1KLJH 3RXEA 2BOKA 2R3YA 4CH2B 1NFXA 1Y3YA 3JZ1B 1VR1H 2ZHEH 1PQ5A 3KL6A 5HM2A 3SUGA 5GPIB 1DWBH 3LGTA 1C1QA 4ZKSU 2QGRA 1O2XA 4HFPB 4NZQA 1O3PB 3M35A 3RUOA 1ZPCA 3MMGA 3LH3A 3M7QA 1C5YB 4TPYA 4AG2A 1SSXA 4K8BA 1CBWC 1C2JA 4FU8A 4XBDA 3F9HA 2IN2A 2ZU4A 1S5SA 2QCYA 3ITIA 4AFZA 1TNKA 1AI8H 2Q6GA 1ZHPA 3UNQA 3PMJA 1OYTH 5E8EH 4YT7H 4K60A 2XXLA 1OWKA 1W8BH 4I32A 4DT7B 5AFZH 2R3UA 1W2KH 2BLOA 2R0LA 2YOLA 3RXIA 1O2QA 5DP6A 3SU6A 1NM6A 1XKBC 1G30B 1UTLM 1ZR0A 2BD8A 1GBAA 2GGVB 1O2GH 2Z9IA 1W10U 3M37A 4NCYA 1MQ6A 3TJVA 1TGBA 3M7UA 4JK6A 3SJ9A 2V0BA 5I25A 3UQOA 1U6QA 3ZZCA 4CBOA 1GG6B 1MU8B 1LQEA 1T8NA 1SGIB 1ZSLA 2P93A 3MFJA 3SI3H 2VGCC 1D6WA 1UK2A 1WQSA 1DX5M 3MH6A 5FAHA 1UTJA 3RM0H 2VU8E 5A09A 1C2EA 2OUAA 2ZDVH 1QB9A 1F92A 1WTHD 1G3DA 2P3TB 3SUFA 1ANDA 1NU7B 1FV9A 5ESTE 4BANB 1GHBF 2EA3A 1MAYA 1E38B 1EPTB 3SV9A 4YO9A 1D9IA 1QRXA 1VJAU 3MNCA 4X6MA 2A4GA 3NUMA 1ZTLA 4KGAA 2UUKB 4YT6H 2Q1JA 1G36A 4ISOA 4X2WA 4AOQA 1GJDB 1O3BA 1WV7H 4U2WA 3K9XB 4ISIH 3TGKE 1QCPA 2F9OA 3KHVA 4FUFA 3SGBE 4ISHH 1WUNH 5LH8A 2O8MA 1FAXA 2C4FH 2SGEE 1ZMNA 2FOGA 4NA9H 3ZVGA 1GHBG 2BYAX 1N6XA 1ANBA 1OWIA 1GBKA 1TNHA 4OGXA 2J4IA 3CENA 1QL8A 2CMYA 1HUTH 1TBRH 1DSUA 1FN8A 1GJ4H 5A2MH 1B0EA 4AFQA 4RKOB 4BXWA 2BD5A 1HAYB 2FOBA 2PKSB 1EJAA 4JYVH 1N1LA 1GHXH 1QRWA 4YOGA 1E36B 2VIWA 4AGJA 2FI4E 1RRKA 1SPJA 2CHAC 1LPGB 3GCHB 3RXTA 5HYOA 1TGSZ 3MU5A 1BUIA 2BDGA 1JIRA 1D3QB 1AQ7A 3RXPA 4MNWA 2ZGHA 5FBIA 1ZMLA 2AYWA 4GPGA 3BTDE 1J16A 1P2KA 1NRPH 1TGTA 4IN1A 1YC0A 3MNBA 1C2IA 1ELFA 1GI4A 2FOCA 2R0KA 4OS4A 1O2MA 1P57B 1EAWA 1QJ6B 2CXVA 2J9NA 4O03A 1S6FA 4WMFA 1W7XH 1GMDF 8KME2 3SNDA 1RTFB 2FOAA 1WU1A 1SGYE 5FXLA 1EAUA 4AB9A 1HB0B 3CS0A 1TRYA 2F3CE 1OSSA 3SJKA 1HXEH 2FYRA 2DUCA 4WMEA 1HAVA 1TX8A 2BD3A 4K5ZA 4FUJA 4Q2KA 1ELTA 4AB8A 1TB6H 2ZC9H 4BAQB 1BMMH 3E6PH 3UR6A 3RXOA 1GMDG 3RC6A 1A3BH 1O5EH 1P9SA 3A80A 1E35B 1YLDA 2PUQH 1V2UT 2XYAA 2BX4A 3L3TA 3P6ZB 1CT2E 1GBTA 4X2XA 1BCUH 3F1SB 3GYMA 4UFGH 1UTOA 2TRMA 2ZU5A 2IPHA 3P8NA 1OWDA 1HJAC 5JBCS 4BTTB 1O2NA 4FUHA 2WINI 2Y80A 1OPHB 1F5RA 7GCHF 4GUXA 1QB1A 1GHZA 1V2RT 3ZZ9A 2C8YB 1DVAH 1BHXB 1QQ4A 3RXCA 4MPUA 3SJ8A 1GVKB 2FESH 5I46H 2G4TA 1WQVH 1Z8RA 2ALPA 1EJNA 2XRCA 1H8IH 3HPTB 1A3EH 1O5AB 1MAXA 1TWXB 4E06H 4XBCA 2R2MB 1TNIA 1O5BB 3T26A 4UFFH 1UHBB 1BB0B 1MQ5A 3RXJA 3A89A 4GSOA 2O8TA 4I8KA 1BBRE 3MU8A 4B1TA 1O3OA 3U98H 1G9IE 2BXTH 2M5TA 1C5NH 3RC4A 1S6HA 3RXUA 2BVSH 2W7SA 1C2DA 1SMFE 2CN0H 3M5MA 1EAIA 1K1PA 1TMUH 2VNTA 1TGNA 1VCPA 1SGFG 2C8ZB 3PROA 1FY4A 3M3TA 4NGAH 5DKMA 5LPEA 1SHHB 3TK6A 4Y71A 1XUKA 3L6PA 1O2IA 3EDXB 3SV8A 1ZPBA 2B0FA 1GI6A 4NA7A 3QTVH 1FQ3A 3S9BA 1UVOA 4MPWA 2P3UB 4MG3A 1JOUB 1CGIE 2FP7B 1GGDC 3EE0B 4OS1A 1NFYA 2F9UA 3F68H 1IQIA 1KXEA 3LONA 1P05A 1SLUB 3Q76A 4ZKNU 1O32A 1MTNC 2W3KA 1SL3A 1ETSH 1LHFH 1X7AC 1GJBB 4MQAA 1YPKH 4NG9H 1LHCH 1F2SE 2FOEA 2QIQA 4GCHF 2EI7A 1IQHA 3KQBA 1MD7A 4A7IB 2UUJB 1K1LA 1LVBA 1QJ7B 1V6DA 1K1MA 3RXMA 3RXAA 2OD3B 3TJNA 1HNEE 1BRUP 3E90B 3RU4D 4H42U 1NESE 1P2NA 2ANMH 1QBOA 1SGRE 1XMNB 1KY9A 3BEFB 1ELAA 1MZAA 4WWYA 1T4VH 3KN2A 3LH1A 3A7XA 3D49H 3MNSA 4NSYA 4B2CA 1PPHE 1Z6JH 1AKSA 2P95A 2ESTE 1ZLRA 1GJ5H 4YLUA 1P8VC 2VVCA 1C5OH 4ISNA 2FEQH 1CQQA 3ZZ8A 2F83A 3KEEA 1TIOA 1HPGA 1AKSB 4MPVA 1WAYB 3RMMH 4DW2U 2JETC 1N8OC 1SGDE 1GI8B 4BNRA 3SV6A 4UFEH 3RXRA 2ZFRH 5AFYH 4OS5A 1IAUA 2A0QB 4AGKA 4ZMAH 5DP9A 1O3FA 3I77A 2SGQE 1GI9B 2W7UA 4PROA 1A1RA 3RXDA 1GDUA 2THFB 3FP7E 1B5GH 3LGUA 1T31A 1LPKB 1C1WH 2ZA5A 2GCHG 3NZIA 1BTUA 2RCEA 2FI5E 2RG3A 1FNIA 3PM3A 4DCDA 3A7WA 1V2PT 1NT1A 3ZZ4A 5HM9A 2BY5X 1EP5A 2LPRA 4WH8A 1C2MA 3UTUH 3QTOH 2HLCA 4ZH8A 3HGNA 2QXHA 3PLPA 3UQVA 1BMLA 3EA9A 1YPGH 2AIPA 2OLGA 5IYTA 5FCRA 5BRRE 2BY9X 1FJSA 2XC5A 1MH0A 2YNAA 4KELA 2G00A 1BMNH 4Y8XA 2GMTB 4NIVA 1UCYE 3BSQA 3URCA 1KXCA 3M61U 1EOJA 1E34B 2A7JA 4JCNA 3GY7A 3SHAH 1OWHA 1LKAA 3MO6A 1CA0B 5FHTA 2VINA 2FS9A 1A5GH 3TIUA 3DT0H 1P02A 5GCHF 4U01A 4BOHA 1BRCE 2IOTA 2SGDE 2F9NA 1SI5H 5C67A 3QK1A 1C5MD 1WYKA 1G2MA 3UNRA 3BTME 1GI0A 3ZZAA 1EAXA 1THRH 5FPSA 3ZZ7A 1GI3A 1ZZZA 1A2CH 1DXWA 4ZROA 4AFUA 4XBBA 1TA2A 4TY6A 2GVFA 1TBQH 2GKVE 4LZ4B 4KTUA 2XCNA 1HAPH 1C5PA 1QA0A 2WV4A 2OTVA 1SOTA 3HGPA 1O2VA 3EYDA 2FI3E 1LHGH 2ZHFH 2BVXH 3S0NA 2RA0A 2Z9JA 4I8HA 4OS6A 1O35A 2OC8A 3U8RH 3TJUA 3VGCB 2BD4A 4HTCH 3DD2H 1O2TA 4D8NA 1OX1A 3SNBA 2WYGA 2GP9B 4A92A 1HJ9A 2A31A 1SGQE 3P92A 1O30A 1NFWA 1RGQA 3LJJA 4KTCA 1MUEB 3RU4T 2G51A 5E2OA 2O8LA 1K21H 2FDAA 3TGIE 1P03A 1EQ9A 1EPTC 2ZDKA 1ARCA 5A8ZA 1XUGA 1SG8B 1J15A 3BTEE 4JK5A 4YOIA 1V2NT 3A7VA 1ESTA 1MCVA 2SFAA 3U8TH 4CRFA 2FX4A 2PR3A 2Z7FE 2FX6A 1H9HE 1YPLH 1O2OA 1TQ7B 1WOFA 1TMTH 3VB3A 1MKXK 4IW4E 4A1TA 2H9TH 2HPPH 9ESTA 4ASHA 1J14A 4CH8B 1MBQA 3KCGH 2H9EH 2PSXA 2GTBA 1BBRK 1AUJA 3S9AA 1A5HA 1P2MA 1YM0A 3C1KA 4XDEA 1EX3A 1W0YH 4YOJA 1FDPA 2FMJA 5GXPA 2AEIH 2P16A 2G81E 3MH5A 1O38A 2GX4A 4UEHH 4R8TB 2ANYA 1M9UA 1Y3WA 1S81A 3MU4A 3RXGA 3T28A 4YM9A 4Y10E 1BA8B 2G8TA 2Y5HA 1HBTH 5G4BA 1CT0E 1WBGB 1BTPA 3ZZ5A 1MTUA 4FXGH 4GHTA 4BAOB 2FLBH 4F49A 4Y0ZE 1G37A 1OYQA 3SBKA 5F03A 5T3HA 2BD9A 4RN6A 1AVXA 2FTLE 1XM1A 1O34A 1XUHA 3PYHA 2PTCE 4IMZA 1EJMA 2JH5D 1WTGH 1GCTC 1ETTH 2Y5FA 5EQRA 2EEKA 1SBWA 1B7XB 1ZYOA 1C2HA 1NTPA 4X1QU 1G3CA 2VIPA 1H9IE 1RTLA 3ESTA 3QX5H 3A8AA 1FY3A 3SU2A 2HGTH 2OC1A 3SQEE 1CSOE 2ZTZA 1HDTH 1JBUH 4K2YA 5DK1A 1O3MA 1DLEA 4CRGA 1GL0E 3W95A 3MH7A 1MTSA 2PKAA 4CHAB 2GT7A 2JH6D 2H5DA 1GVZA 1O3NA 1RFNA 2QY0B 2Z9LA 4ABHA 1E37B 4DIIH 3GDVA 1SFQB 1SQOA 2OBOA 2W26A 3ZYEA 3H7TA 3P95A 1C9TA 1C5LH 5FX5A 3VB6A 1KLTA 1VITF 3A8DA 2V35A 1GHAF 2PW8H 3UUZA 2P3FH 5DP7A 5A0CA 1NC6A 1O3GA 1K28D 1F5LA 1GVLA 2WYJA 2P8OC 4NFFA 1Z71A 3ZVCA 3V13A 2AMDA 1A46H 5C5OA 5CHAC 4DG4A 2GV6A 2PSYA 3M36A 3AASA 1C5SA 2A1DB 1HIAA 1RJXB 2ILNA 1EASA 4CRDA 2EC9H 1LCYA 1W7GH 5GDSH 4DVAU 2Z9KA 1HFDA 2WPLS 1V2VT 4X1RU 3RP2A 3DFJA 2BLWA 1GPZA 1IQGA 1IQEA 1VITG 1FI8A 2PV9B 3ZYDA 1GHAG 5HMAA 3S9CA 5EODA 1PQAA 3PMAB 4WXVA 1MTWA 2YNBA 3OX7U 4AG1A 3HK6B 1LVMA 3MO9A 1TALA 8GCHF 2GZ7A 1DANH 1PYTD 1WSSH 3RU4E 4DOQA 3VB5A 2ZHDA 1T32A 1HAHH 3ATKA 1O3DA 5A8XA 3V3MA 4JZIA 1C5VA 2VVVA 1O2WA 4Q80A 1QQUA 2Y7ZA 2Y7XA 2A7CA 1P04A 2AFQB 4O9VA 5JYIA 1GBLA 3M5OA 1Z8GA 3BG4C 1AGJA 1UTKA 4UE7H 1AFQB 3ENSB 1FLEE 4IC5A 3Q3YA 2F91A 1GBDA 8GCHG 2AIQA 1UCYK 3RDZA 2Z3EA 1AB9C 3FANA 2GT8A 3NCLA 1MKXH 2PLXA 1NPMA 3K2UA 3A7TA 1HAGE 5EXLA 1AO5A 3AW0A 1KXFA 4ZHLU 4X8SH 1C1MA 2DE8A 4LK4A 3PO1C 1TX7A 1TLDA 3HKJB 4NFEA 5C20A 4IN2A 4GHQA 5GWZA 1O2RA 1LQDB 2ZGBH 3NXPA 1BBRH 1PJPA 4VGCC 5LPRA 3LDXH 1EUFA 4LOYH 3ZZDA 1AVGH 1A0HB 1VGCB 2C3SA 4B73A 2GCTC 1RIWB 4WXIA 1BOQA 1V2LT 1MZDA 2TGDA 4IC6A 2NWNA 4NA8A 3TGJE 2O8UA 1DICA 1SLVB 2A4RA 2AGGX 2GD4B 1NU9A 2ZI2H 3H5CB 4BAKB 5EU8A 4MTBA 2XTTB 1ELEE 4AYYB 3PMHB 2ZCHP 2HRVA 1KXBA 1GMCF 2ZFTA 2QV1A 3M5NA 2ZPQA 2TGAA 5L2ZH 2STAE 1NROH 1A5IA 3LGIA 4MDSA 3T2NA 2PTNA 1O5DH 1SGPE 1O3EA 1T8OA 1XVOA 2KAIA 5DP8A 2ZEBA 1EXFA 1HAVB 4Q7XA 1SGNE 1A0JA 1ZHMA 1CBWB 3VXFH 1K1NA 1OS8A 1PQ8A 2XBXA 1TQ0B 2K1QA 4SGBE 1GMHF 2VVUA 3SV2H 1ARBA 1PFXC 2XC0A 1A0LA 3RXSA 2V6NA 2ZP0H 2ZDLA 4FUIA 4B74A 1KIGH 2G55A 2VIDA 4MNYA 1ZTKA 1VITH 5ETXA 1L1JA 4FVBA 1XXDA 1TFXA 2IJOB 4YTAA 2FOFA 1L4DA 5F8TA 1D6RA 1OKXA 1YLCA 3LJOA 3GCOA 1YPHC 3TJOA 1BTHH 2QXGA 4DGJA 1MCTA 1DSTA 7LPRA 2J38A 1C1RA 1F7ZA 1GMHG 1V2ST 3U8OH 1PPEE 2QYIA 1J17T 2H1UA 4DURA 4I33A 2WPMS 5J4QA 2ZCLP 1DDJA 4NIWA 1THPB 4JYUH 7GCHG 3RLWH 1V2KT 2VGCB 3A7YA 1S0RA 1NRRH 2F9PA 2XBYA 3Q3XA 1Y8TA 3VFEA 3QWCH 3EA8A 1EZUC 1NFUA 4ZHMU 3A86A 5CE1A 4FUGA 3SUDA 4BTUB 2OQUA 1QL7A 1RXPA 5DP4A 1BTYA 1UJ1A 1G3BA 2FIRH 3P70B 3SNEA 2Z94A 2AS9A 4FU7A 2GDDA 3MH4A 5IDKA 1JRSA 1SOZA 2H9HA 3NKKA 5F8XA 1ZJDA 2BY7X 3KQCA 4U32A 4B76A 2BVRH 1H8DH 1XKAC 1DWCH 2WV5A 2Y6TA 3K6ZA 2F9VA 1AY6H 3OYPA 2SNVA 1F0TA 1AMHA 1H4WA 1BTZA 2ZO3H 2O8WA 1C1VH 1IHTH 1S84A 1MU6B 2CGAA 1B0FA 4ZKOU 4K1TA 3A83A 2R9PA 5JBTA 5JPMH 2OC0A 3GY2A 1P09A 3MI4A 1GDNA 1GBFA 6CHAC 5E0HA 5BPEA 4X1PU 4BXSA 5DPAA 3LC3A 4KP0A 2EI6A 2Z9GA 4K3JA 1N6YA 3DUXH 3SU4A 2ZWLH 2CHAB 4IMQA 2BOHB 4NSVA 1SB1H 1EB2A 1AWFH 2A45B 3B23B 1TRMA 1KYNA 3SORA 1FIZA 1QRZA 3PTBA 2BD2A 2SNWA 3U69H 2CF8H 3RXHA 4BTIB 2QF3A 3MU0A 4INHA 1YPEH 1EB1H 4AYVB 2BDBA 3SGAE 1P01A 4CRAA 1P2OA 3SI4H 3MO3A 3LOXA 4UDWH 8ESTE 3UOPA 1HV7A 4CBNA 4ABJA 1IQMA 3T25A 2VIOA 4GCHG 5FX6A 1O33A 3VB7A 1MBMA 1TX6A 2RDLA 3ODFA 1C1PA 1JRTA 1TYNA 3F9FA 5L6NH 2Z3CA 2ZG0H 5AVDA 4X0WU 1QBVH 2BLQA 3FZDA 3TVJB 2A2XH 7KMEH 1YKTA 1PPFE 4X1NU 3KQEA 2ZECA 1C2KA 1C5WB 3NK8A 1C4Y2 1DPOA 2RA3A 2AMPA 4KTSA 1P2JA 1CHOF 2ODQA 3UIRA 1FPHH 1LTOA 1QB6A 3ZVEA 1SGTA 4IBLH 1EKBB 5CMXH 2OQ5A 3JZ2B 2ZDNA 4INLA 1GCDA 3BIVH 1XX9A 1HJAB 1QJ1B 2FODA 1EOLA 4DY7B 3EA7A 2A32A 1SQTA 2B5TB 4FUBA 1GJ8B 4JZFH 3E0NB 2VH0A 1ZMJA 2C8WB 5LPFA 1AIXH 2FZZA 1UTNA 1BMAA 4IGDA 1T7CA 3VEQB 3O8DA 1EATA 5DP3A 1TOCB 3SOSA 3TITA 5C2ZA 4ZXXH 2HWLB 1LO6A 1V2TT 1C4U2 1ZGIA 1QBNA 1PYTC 2I6QA 1P3EA 1BITA 2PGBB 3QZQA 3P8GA 1MTVA 1OP2A 3GDSA 5EXNA 4I8JA 3V0XA 5AF9H 3RC5A 1VJ9U 2J92A 4Q7ZA 4D9RA 3ATIA 3STJA 4X6PA 3QN7A 3UNSA 1Q2WA 2D2DA 3M3SA 2JH0D 2AGIX 2WUBA 1S85A 2LNCA 3FP6E 1UK3A 5C1YA 5TJXA 3NWUA 3P8OA 1KTTB 1O2HA 3N7OA 1F0RA 4HGCA 5FPYA 1O2SA 3RXBA 1GBCA 2ZQ1A 1ANCA 3PLBA 3E8LA 1FUJA 2ZFFH 3ODDA 1TAWA 5B6OA 1EZQA 3LT3A 3B9FH 1IQNA 2F9BH 4YESB 2UWOA 1P9UA 1UTQA 5GCHG 4HI3A 3SN8A 2D26C 2FYQA 1GGDB 4QT8C 1VCQA 5EQSA 3E1XB 2A2QH 5DG6A 1HAIH 1GG6C 1MTNB 1YBWA 5TCCA 1ANEA 1NRSH 3SU0A 2HPQH 2XBWA 2VB0A 3Q00A 1TRNA 1V2OT 3SV7A 3BTHE 4AORA 1KDQA 3SU1A 3VPKA 1JWTA 1AD8H 2BY8X 2A5IA 1ELBA 3PB1E 1D3PB 2XWBI 1O37A 5EW2H 1O36A 1CGHA 3VXEH 1O2LA 1FN6A 1IQKA 2GZ8A 4CREA 2WPJS 3BIUH 1A7SA 3LGVA 3ZVFA 4O97A 1Z1IA 5E2PA 5JBBS 1Q3XA 1GHWH 2ANKH 4OGYA 4Y7AA 3UOUA 2CV3A 1RTKA 3I78A 2SGFE 3MNXA 1ESBA 1D4PB 1DUAA 3AAVA 3EGKH 4J2YB 1UVTH 4FVDA 5EQQA 3GY4A 1TNLA 3RMNH 1Y5AT 2ASUB 1LDTT 2B8OH 2HNTC 1IQLA 2J94A 2BDHA 1IQFA 3KNXA 1SLWB 1YP9A 3PWBA 3SU5A 5AHGH 1CE5A 4Z6AH 3A84A 2JETB 2UWLA 3O8BA 4GAWA 1N8OB 2C93B 1AN1E 2PKSC 3U1IB 5FCKA 5EG4A 2FM2A 2ZDMA 5FBEA 1GI7B 1O3KA
chains in the Genus database with same CATH superfamily
1T8MA 2XCFA 1DLKB 2P94A 2HNTE 3GCHC 3T27A 3DFLA 3PMBB 2BDAA 3OEED 1DITH 2BXUH 3RXKA 3H09A 2BDYA 1PPBH 1OP8A 1Z8JB 1XUJA 1TPPA 2ZTYA 4WVPE 2Y82A 1YPJH 3ATMA 2C8XB 1HYLA 1GI5A 6LPRA 3SW2B 2BZ6H 4YZUA 4MPXA 3ZVBA 5B6LA 5DJ7A 4Y0YE 1EZSC 1RIWC 3VB4A 1GHVH 4WY3A 4TPIZ 2BQWB 1NS3A 2XC4A 3VG8A 1L4ZA 2VWNA 4H4FA 4KKDA 4ABFA 2G52A 2SGAA 5IK2D 2BLVA 6ESTA 5CDFE 1GBIA 4D9QA 1RD3B 3RLYH 3OTJE 3DHKH 4NWLA 2ZHQH 2PHBA 1AUTC 4ZHAA 2QA9E 1O0DH 1LVYA 2NU4E 5EIYA 2ALVA 3EAJA 4Y11E 4ABDA 3SNAA 3SU3A 3FVFB 2D1JA 3C27B 5E0GA 1L1NA 3BTQE 1GJ7B 1HLTH 1FX0B 2ULLA 1O5CB 2NU2E 4IS5A 4BAMB 4Y7BA 2PGQB 1Q31A 1EZXC 4XE4A 3AAUA 3U1JB 1O2UA 1YWUA 1Y5BT 3STIA 2PKAB 3QZRA 2ZPSA 4O3TA 4M7GA 1ZGVA 1K2I1 2H6MA 3SJIA 5EJLA 1FY8E 2Q6FA 3E0PB 1IHSH 1IQJA 1AE8H 1C5ZB 1O5FH 5EW1H 1ZJKA 3BTTE 3V7TA 3A8CA 2WHXA 4X8UH 2VWLA 3NPSA 5EPNA 5JDUB 1KXDA 1TA6A 1ZHRA 2L6OA 2STBE 2XW9A 3A88A 3RXFA 1ZRKA 1FPCH 2XNIA 1K22H 2IPQX 5HGGA 2K0QA 5GJ4B 4WJG2 2KR7A 4A1VA 1QTFA 5E0JA 1O3CA 1HIAB 2CK3D 1CVWH 1O3HA 1T8LA 3QGNB 4WH6A 4B6FA 1OXGA 1EFRD 1SGEE 4K1SA 3IITA 1GL1A 1QA7A 1O3IA 4TY7A 4X2YA 4ABEA 2UWPA 1SGFA 3BEUA 3BTGE 5H4IB 1EPTA 1SGCA 2G5NA 1C5TA 3MHWU 4WF8A 3ATWA 2V3MA 1YCPM 2VJ1A 4DIHH 1AE5A 1BJVA 4DT4A 1QR3E 1NN6A 2AGEX 1TGCA 1W11U 1L1GA 3OU0A 2TGTA 3BG8A 4TSFD 3MOCA 2Z3DA 3E16B 2QF5A 1OHHD 1ZOMA 4F4OC 4JZ1A 1BDAA 1NRQH 5A0AE 1OWEA 3D23A 1GDQA 2Y81A 4ABIA 3G01A 3MWIU 3RMOH 1DS2E 3TH3H 1AU8A 1K9OE 4AX9H 5T6DA 1O39A 2ZU1A 1GJAB 1C2GA 3FAOA 1C4V2 3D65E 1V2WT 3FZZA 2BDIA 2JKHA 9LPRA 3L33A 3TH2H 5JBAS 1Y59T 3CP7A 4X6NA 3T29A 1GWAA 4DJZB 2PWXA 1DM4B 5A8YA 1UTPA 1UVSH 4GLYA 4LXBH 2BZAA 4E7NA 2PUXB 4ZCNA 5KECA 1ZRBA 3OY5U 4Y6DA 1GBJA 1YPMH 1P0SH 4Y8ZA 2FWWA 5FPTA 2A4OA 2XWAA 1SQAA 1ZTJA 4O3UA 2J97A 2ZGJA 5EXMA 4B71A 3W94A 4ACBA 1W14U 1AZ8A 2ZKSA 1KTSB 3A87A 3S7HB 2B9LA 5EGMA 3P8FA 4XSKU 1QHRB 2OP9A 2ZNKH 3A85A 3TNSA 2BMGB 2O9QA 4XFQA 5C1XA 4FU9A 1FMGA 1BTXA 1GCTB 3B8JA 4X8TH 1DWEH 1BZXE 1W13U 2WPKS 4MNXA 1SC8U 4X2VA 4BAHB 5JB8S 1SR5C 2VWMA 1PQ7A 4UD9H 1HJ8A 3PTNA 1YYY1 1AVWA 1BTWA 3OFND 3TPIZ 2BY6X 1O3AA 3R3GB 3CS7A 4R0IA 5F8ZA 1HAXB 3LGWA 2VBCA 2A5AA 1K1OA 2YMSB 2KAIB 1P11E 1CHGA 1ID5H 2VH6A 1GMCG 1S82A 2ZDAH 3A8BA 5T1VA 1UK4A 3LU9B 2ZCKP 3F6UH 4NZLA 3I29A 4NIXA 1GBHA 3SZNA 1BRBE 2HOBA 3URDA 1WCZA 2HALA 1KXAA 1FY1A 1A61H 2Q6DA 4GVUA 1XVMA 2B7DH 1K0HA 3SGQE 3SJOA 1Z1JA 1MKWK 2OCVB 2FOMB 1JMOH 8LPRA 4E7RG 2QAAA 4OS2A 1PPCE 1K1IA 3KQDA 2EI8A 2UUYA 3S69A 1TNGA 2ZTXA 4U30A 3BEIB 4X6OA 2P8OB 1OWJA 1Y3VA 3OY6U 5CHAB 1LHEH 3T62A 1UHBA 2Z6BD 1UVUH 3H7OA 4K69A 1DWDH 4X1SU 1YPHE 1AFEH 1FXYA 1DXPA 2GMTC 1T4UH 3ZZBA 2BM2A 2QC2A 1HXFH 4JYTA 1V3XA 1ELGA 1O2PA 2FO9A 1V2MT 3UR9A 3K65B 1TE0A 1E0FD 1O3LA 3GISB 1D3TB 1DT2A 1W12U 1CA0C 1TONA 3OAAD 4NIYA 4P00A 2BQ7B 2J95A 3BV9B 1HGTH 2AERH 5C3NA 5T6FA 3A82A 2QN5T 3OSYA 2ZPRA 1KLIH 2XBVA 3FP8E 1V2JT 2HNTF 1HAZB 5TCAA 2OC7A 3HATH 1C5QA 1D3DB 3GCTF 2KCYA 3O8CA 3AVZA 2A4QA 3BTFE 3WWBA 1C1OA 4E05H 1J9CH 1NY22 1PPZA 1GI2A 2V3HH 2BB4A 3FFGA 4RKJB 2ZU3A 5JB9S 1GBBA 3O8RA 3EE7A 5K0HA 5C5NA 4A6LA 3BG4B 1UMAH 2W3IA 3ZV9A 5C94A 1RS0A 1DY9A 4ZKRU 1QURH 4A5TS 1DOJA 4B2AA 5J4SA 1SHYA 3GY8A 3M3VA 2TPIZ 1PPGE 1G2LA 1Z8IB 4D7GA 3ZVDA 1AB9B 4ESTE 1F0SA 3P17H 1G3EA 1UCYH 3GCTG 3KGPA 4MVNA 3VGCC 4D7FA 1QFKH 2NU1E 5ESBA 3ZZ3A 2ZFQH 7ESTE 3PO1B 3QGJA 4H6SB 4CR5A 1HRTH 1C1NA 1KSNA 1Y3UA 4THNH 4FUCA 4AFSA 2BQ6B 4WMDA 1TBZH 4VGCB 1MD8A 2G5VA 3F0OA 1JXPA 5ABWA 3GOVB 1CT4E 3ZZ6A 1QL9A 2BX3A 3M5LA 2FPZA 2GCTB 3GY6A 2VIVA 2TGPZ 4I8LA 1W0JD 4Y8YA 4B2BA 3RMLH 5GIBA 3HKIB 1ZPZA 1H1BA 1QNJA 2W5EA 1V2QT 2ZGXH 3ZVAA 4B75A 3R0FA 1YGCH 2BHGA 1VCWA 3BF6H 3T5FH 3SNCA 1AHTH 2CF9H 3WW7A 1W0ZU 4OS7A 1BT7A 2OBQA 5L30H 1P3CA 2ANWA 3UY9A 1HCGA 4I31A 3U9AH 1ABIH 2QXIA 1DY8A 4ISLA 3F3BA 5DGJA 2RDEA 3DSOA 1INCA 1XUFA 2HVXA 4Y76A 4MNVA 2GCHF 3LGYA 2ZQ2A 2FXRA 3QLPH 4I7YH 1ESAA 3E3TA 4HZHA 1CO7E 5GNDA 3RM2H 1L0ZA 1YCPK 3KYGA 4Z0KA 4AN7A 1ZSJA 2G4UA 2NU3E 4LZ1H 2ZGCA 1TPAE 2A7HA 1BQYA 3TU7H 6GCHF 3LPRA 3ATLA 1S6LA 1P12E 1ETRH 1HAOH 1O2YA 1SLXB 2C90B 3TH4H 5T6GA 1BHXF 1G32B 3Q77A 3Q3KA 5EOKA 1ELCA 4ZAEA 4J1YA 3IG6B 4ZXYH 1UVPA 1O3JA 1CHOG 2H2ZA 5DO4H 1TOMH 2KCPA 2WPIS 2M2AA 1GBEA 2ZIQH 3GY5A 4UONA 1P06A 1FZZA 1NO9H 2JIZD 3N7EA 4TYDA 3M7TA 4NWKA 1MKWH 1LHDH 1XXFA 3DA9B 6GCHG 5DP5A 2ZHWH 1SVPA 1Y3XA 4CRCA 3LIWA 2V3OH 3LC5A 4K1EA 1C1TA 3RXLA 3SHCH 1TPSA 1XUIA 3GCNA 3V12A 1COWD 1BIOA 2ODPA 1C1UH 3QUMP 2BTCE 2R2WU 3KF2A 2J98B 4ABBA 2QXJA 3SO3A 1MMJN 1W3CA 2D8WA 1JIMA 1GI1A 1LVOA 3A81A 1GJ9B 4XOJA 1UO6A 2PFEA 3GICB 4CHAC 3PLKA 3K6YA 2TBSA 4MLFB 2ZF0H 3U28C 3ELAH 1NRNH 2ZZUH 2J34A 2QF0A 2AMQA 1ELVA 4FUDA 1FIWA 3F9EA 3TLOA 3OE7D 5SGAE 1DUEA 3HK3B 3N99A 3TNTA 3TK5A 2SGPE 1IOEA 2OXSA 1LMWB 2VIQA 3F9GA 3LKWA 1QY6A 3QO6A 4Y79A 1TMBH 2I6SA 2TIOA 3IWMA 3E91A 1DE7H 1Z6EA 1C2LA 1C1SA 2GDEH 4YLQH 1FAKH 1P2QA 3RXQA 5HXFA 1ACBE 3GYLB 2ODYB 4Q7YA 3UREA 2ZU2A 3KIDU 3SUEA 3RXVA 1C5XB 5K7RA 1THSH 2AH4X 4TWYA 1ABJH 1TABE 1ELDE 1FY5A 1YF4A 6CHAB 3OEHD 2DE9A 1GJ6A 3GDUA 1VZQH 4X8VH 4AZ2B 4D76A 4JZDH 1UTMA 5L2YH 1CU1A 1AZZA 1C2FA 1KDQB 1O5GH 1DFPA 1CGJE 1QGFA 1S0QA 3PV4A 1EP6A 3UFAA 1ZSKA 3A7ZA 1GHYH 3D62A 2H5CA 2VWOA 3MU1A 4FUEA 4UFDH 1QIXB 4SGAE 3PWCA 4TWWA 1TPOA 2FTMA 4I8GA 1GJCB 3AW1A 2NU0E 1O31A 3UPEA 1F5KU 2BD7A 3EQ0H 3S7KB 1LKBA 1Z7KA 1F0UA 2ZFPH 2FOHA 3ZV8A 1OP0A 3BN9A 2KCAA 1O2ZA 5A0BA 1O2KA 1P2IA 3MYWA 1A4WH 3MTYA 4CR9A 5LGOA 1AFQC 2Y5GA 5C1UA 1GBMA 1P10A 3BTKE 1O2JA 1FONA 4JMYA 1AWHB 1SFIA 1J8AA 2FLRH 2FS8A 2P59A 3BTWE 4ABAA 3GY3A 1K1JA 4ZUHA 3WY8A 1H9LB 4H6TA 2WPHS 5PTPA 1S83A 4A1XA 1TNJA 4AC9A 2CJIA 4ABGA 5F6MA 2J2UA 2WUCA 2ZFSA 4XD7D 1NZQH 4CRBA 2GV7A 3F2HA 4RSPA 2OINA 1BJUA 5EPYA 1C5RA 3QDZB 2A5KA 4K8YA 4INKA 3SQHE 1CA8B 1OOKB 3UWIA 1Y5UT 1VGCC 5F53A 3UWJH 1YCPH 2BDCA 2GZ9A 1LPZB 3TK9A 1C5UA 5C0UA 1ORFA 1C9PA 2KM0A 1BRAA 2UUFB 1L2EA 4JZEH 1KLJH 3RXEA 3KQ5A 2BOKA 2R3YA 4CH2B 5HIZA 2JJ1D 1NFXA 1Y3YA 1E79D 3JZ1B 1VR1H 2ZHEH 1PQ5A 3KL6A 5HM2A 3SUGA 5GPIB 1DWBH 3LGTA 1C1QA 4ZKSU 2QGRA 1O2XA 4HFPB 4NZQA 1O3PB 3M35A 3RUOA 1ZPCA 3MMGA 3LH3A 3M7QA 2EQNA 1C5YB 4TPYA 4AG2A 1SSXA 4K8BA 1CBWC 1C2JA 4FU8A 4XBDA 3F9HA 2IN2A 2W6ID 2ZU4A 1S5SA 2QCYA 3ITIA 4AFZA 1TNKA 1AI8H 2Q6GA 2QE7D 1ZHPA 3UNQA 3FKSD 1OYTH 3PMJA 5E8EH 4YT7H 4K60A 2XXLA 1OWKA 1W8BH 4I32A 4DT7B 5AFZH 4I86A 2R3UA 1W2KH 2BLOA 2R0LA 2YOLA 3RXIA 2XNDD 1O2QA 5DP6A 3SU6A 1NM6A 1XKBC 1G30B 1UTLM 1ZR0A 2BD8A 1GBAA 2GGVB 1O2GH 2Z9IA 1W10U 3M37A 4NCYA 1MQ6A 3TJVA 1TGBA 3M7UA 4JK6A 3SJ9A 2V0BA 4B6EA 5I25A 3UQOA 1U6QA 3ZZCA 4CBOA 1GG6B 1MU8B 1LQEA 1T8NA 1SGIB 1ZSLA 2P93A 3MFJA 3FN8A 3SI3H 2VGCC 1D6WA 1UK2A 1WQSA 1DX5M 3MH6A 4XRNA 5FAHA 1UTJA 3RM0H 2VU8E 5A09A 1C2EA 2OUAA 2ZDVH 1QB9A 1F92A 1WTHD 1G3DA 2P3TB 3SUFA 1ANDA 1NU7B 1FV9A 5ESTE 4BANB 1GHBF 2EA3A 1MAYA 1E38B 1EPTB 3SV9A 4YO9A 1D9IA 1QRXA 1VJAU 3MNCA 4X6MA 2A4GA 3SYJA 3NUMA 1ZTLA 4KGAA 2UUKB 4YT6H 2Q1JA 1G36A 4ISOA 4X2WA 4AOQA 1WDIA 1GJDB 1O3BA 1WV7H 4U2WA 3K9XB 4ISIH 3TGKE 1QCPA 2F9OA 3KHVA 4FUFA 3SGBE 4ISHH 1WUNH 5LH8A 2O8MA 1FAXA 2C4FH 2SGEE 1ZMNA 2FOGA 4NA9H 3ZVGA 1GHBG 2BYAX 1N6XA 1ANBA 1OWIA 1GBKA 1TNHA 4OGXA 2J4IA 3CENA 1QL8A 2CMYA 1HUTH 1TBRH 1DSUA 1FN8A 1GJ4H 5A2MH 1B0EA 4AFQA 4RKOB 4BXWA 2BD5A 1HAYB 2FOBA 2PKSB 1EJAA 4JYVH 1N1LA 3SZEA 1GHXH 1QRWA 2RFKC 4YOGA 1E36B 2VIWA 4AGJA 2FI4E 1RRKA 1SPJA 2CHAC 1LPGB 3GCHB 3RXTA 3UB0A 5HYOA 1TGSZ 3MU5A 1BUIA 2BDGA 1JIRA 1D3QB 1AQ7A 3RXPA 4MNWA 2ZGHA 5FBIA 1ZMLA 4ASUD 2AYWA 4GPGA 3BTDE 1J16A 1P2KA 1NRPH 1TGTA 4HG6A 1YC0A 4IN1A 3MNBA 1C2IA 1ELFA 1GI4A 2FOCA 2R0KA 4OS4A 1O2MA 1P57B 1EAWA 1QJ6B 2CXVA 2J9NA 4O03A 1S6FA 4WMFA 1W7XH 5C0TA 1GMDF 8KME2 3SNDA 1RTFB 2FOAA 1WU1A 1SGYE 5FXLA 1EAUA 4AB9A 1HB0B 3CS0A 1TRYA 2F3CE 1OSSA 3SJKA 4Q4LA 1HXEH 2FYRA 2DUCA 4WMEA 1HAVA 1TX8A 2BD3A 4K5ZA 4FUJA 4Q2KA 1ELTA 4AB8A 1TB6H 2ZC9H 4BAQB 1BMMH 3E6PH 3UR6A 3RXOA 1GMDG 3RC6A 1A3BH 1O5EH 1P9SA 3A80A 1E35B 3FO8D 1YLDA 2PUQH 1V2UT 2XYAA 2BX4A 3L3TA 3P6ZB 1CT2E 1GBTA 4X2XA 1BCUH 3F1SB 3GYMA 4UFGH 1UTOA 2QF4A 2TRMA 2ZU5A 2IPHA 3P8NA 1OWDA 1HJAC 5JBCS 4BTTB 1O2NA 4FUHA 2WINI 2Y80A 1OPHB 1F5RA 7GCHF 4GUXA 1QB1A 1GHZA 1V2RT 3ZZ9A 2HLDD 2C8YB 1DVAH 1BHXB 1KMHB 1QQ4A 3RXCA 4MPUA 3SJ8A 1GVKB 2FESH 5I46H 2G4TA 1WQVH 1Z8RA 2ALPA 1EJNA 2XRCA 1H8IH 3HPTB 1A3EH 1O5AB 1MAXA 1TWXB 4E06H 4XBCA 2R2MB 1TNIA 1O5BB 3T26A 4UFFH 1UHBB 1BB0B 1MQ5A 3DSPA 3RXJA 3A89A 4GSOA 2O8TA 4I8KA 1BBRE 3MU8A 4B1TA 1O3OA 3U98H 1G9IE 2BXTH 2M5TA 1C5NH 3RC4A 1S6HA 3RXUA 1E1QD 2BVSH 1C2DA 1SMFE 2W7SA 2CN0H 3M5MA 1EAIA 2WPDD 1K1PA 1TMUH 2VNTA 1TGNA 1VCPA 1SGFG 4TT3D 2C8ZB 3PROA 1FY4A 3M3TA 4NGAH 2YMSD 5FL7D 5DKMA 5LPEA 1SHHB 3TK6A 4Y71A 1MABB 1XUKA 3L6PA 1O2IA 3EDXB 3SV8A 1ZPBA 2B0FA 1GI6A 4NA7A 3QTVH 1FQ3A 3S9BA 1UVOA 5DN6D 4MPWA 2P3UB 4MG3A 1JOUB 1CGIE 2FP7B 1GGDC 3EE0B 4OS1A 1NFYA 2F9UA 3F68H 1IQIA 1KXEA 3LONA 1P05A 1SLUB 3Q76A 4ZKNU 1O32A 1MTNC 2W3KA 1SL3A 1ETSH 1LHFH 1X7AC 1GJBB 4MQAA 1YPKH 5CHBA 4NG9H 1LHCH 1F2SE 2FOEA 2QIQA 4GCHF 2EI7A 1IQHA 3KQBA 1MD7A 4A7IB 2UUJB 1K1LA 1LVBA 1QJ7B 1V6DA 3FOAA 3KYFA 1K1MA 3RXMA 3RXAA 2OD3B 3TJNA 4F48B 1HNEE 1BRUP 3E90B 3RU4D 4H42U 1NESE 1P2NA 2ANMH 1QBOA 1SGRE 1XMNB 1KY9A 3BEFB 1ELAA 1MZAA 4WWYA 3ZIAD 1T4VH 3KN2A 3LH1A 3A7XA 3D49H 3MNSA 4NSYA 4B2CA 1PPHE 1Z6JH 1AKSA 2P95A 2ESTE 1ZLRA 1GJ5H 4YLUA 1P8VC 3CNRA 2VVCA 1W0KD 1C5OH 4ISNA 2FEQH 1CQQA 3ZZ8A 2F83A 3KEEA 1TIOA 1HPGA 1AKSB 4MPVA 1WAYB 3RMMH 4DW2U 2JETC 2WSSD 1N8OC 1SGDE 2W6JD 1GI8B 4BNRA 3SV6A 1YLNA 4UFEH 3RXRA 2ZFRH 5AFYH 4OS5A 1IAUA 2A0QB 4AGKA 4ZMAH 5DP9A 1O3FA 3I77A 3PRBA 2SGQE 1GI9B 2W7UA 4PROA 1A1RA 3RXDA 1GDUA 2THFB 3FP7E 1B5GH 3LGUA 1T31A 1LPKB 1C1WH 2ZA5A 2GCHG 3NZIA 1BTUA 2RCEA 2FI5E 2RG3A 4F55A 1FNIA 3PM3A 4DCDA 3A7WA 1V2PT 1NT1A 3ZZ4A 5HM9A 2BY5X 1EP5A 2LPRA 4WH8A 1C2MA 3UTUH 3QTOH 2HLCA 4ZH8A 3HGNA 2QXHA 3PLPA 3UQVA 1BMLA 3EA9A 1YPGH 2AIPA 2OLGA 5IYTA 5FCRA 2OK5A 5BRRE 2BY9X 1FJSA 2XC5A 1MH0A 2YNAA 4KELA 2G00A 1BMNH 4Y8XA 2GMTB 4NIVA 1UCYE 3BSQA 3URCA 1KXCA 3M61U 4RT1A 1EOJA 1E34B 2A7JA 4JCNA 3GY7A 3SHAH 1OWHA 1LKAA 3MO6A 1CA0B 5FHTA 2VINA 2FS9A 1A5GH 3TIUA 3DT0H 2PP6A 1P02A 5GCHF 3W1EA 3PV5A 4U01A 4BOHA 1BRCE 4OM9A 2IOTA 2SGDE 2F9NA 1SI5H 5C67A 3QK1A 3UAIC 1C5MD 1WYKA 1G2MA 3UNRA 3BTME 5EJ1A 1GI0A 3ZZAA 1EAXA 1THRH 5FPSA 3ZZ7A 1GI3A 1ZZZA 1A2CH 1DXWA 4ZROA 4AFUA 4XBBA 1TA2A 4TY6A 1UW7A 2GVFA 1TBQH 1H8HD 2GKVE 4LZ4B 4KTUA 2XCNA 1HAPH 1C5PA 1QA0A 5HIYA 2WV4A 2OTVA 1SOTA 3HGPA 1O2VA 3EYDA 2FI3E 1LHGH 2ZHFH 2BVXH 3S0NA 2RA0A 2Z9JA 4I8HA 4OS6A 1O35A 2OC8A 3U8RH 3TJUA 3VGCB 2BD4A 4HTCH 3DD2H 1O2TA 4D8NA 1OX1A 3SNBA 2WYGA 1NBMD 2GP9B 4A92A 1HJ9A 2A31A 1SGQE 3P92A 1O30A 1NFWA 1RGQA 3LJJA 4KTCA 1MUEB 3RU4T 2G51A 5E2OA 2O8LA 1K21H 2FDAA 3PRDA 3TGIE 1P03A 1EQ9A 1EPTC 2ZDKA 1ARCA 5A8ZA 1XUGA 1SG8B 1J15A 3BTEE 2KX4A 4JK5A 1E1RD 4YOIA 1V2NT 3A7VA 1ESTA 1MCVA 2SFAA 3U8TH 4CRFA 2FX4A 2PR3A 2Z7FE 2FX6A 1H9HE 1YPLH 4FETA 1O2OA 1TQ7B 1WOFA 1TMTH 3VB3A 1MKXK 4IW4E 4A1TA 2H9TH 2HPPH 9ESTA 4ASHA 1J14A 4CH8B 1MBQA 3KCGH 2H9EH 2PSXA 2GTBA 1BBRK 1AUJA 3S9AA 1A5HA 1P2MA 1YM0A 3C1KA 4XDEA 1EX3A 1W0YH 4YOJA 1FDPA 2FMJA 5GXPA 2AEIH 2P16A 2G81E 3MH5A 1O38A 2GX4A 4UEHH 4R8TB 2ANYA 1M9UA 1Y3WA 1S81A 3MU4A 3RXGA 3T28A 4YM9A 4Y10E 1BA8B 2JJ2D 2G8TA 2Y5HA 1HBTH 5G4BA 1CT0E 2F43B 1WBGB 1BTPA 3ZZ5A 1MTUA 4FXGH 4GHTA 4BAOB 2FLBH 4F49A 4Y0ZE 1G37A 1OYQA 3SBKA 5F03A 1QZ8A 2BD9A 4RN6A 5T3HA 1AVXA 2FTLE 1XM1A 1O34A 1XUHA 3PYHA 2PTCE 4IMZA 1EJMA 2JH5D 1WTGH 1GCTC 1ETTH 2Y5FA 5EQRA 2EEKA 1SBWA 3DSGA 1B7XB 1ZYOA 1C2HA 1NTPA 4X1QU 1G3CA 2AHME 2VIPA 1H9IE 1RTLA 3ESTA 3QX5H 3A8AA 1FY3A 3SU2A 2HGTH 2OC1A 3SQEE 2YMSC 1CSOE 2ZTZA 1HDTH 1JBUH 4K2YA 5DK1A 1O3MA 1DLEA 4CRGA 1GL0E 3W95A 3MH7A 1MTSA 2PKAA 4CHAB 2GT7A 2JH6D 2H5DA 1GVZA 1O3NA 1RFNA 2QY0B 2Z9LA 4ABHA 1E37B 4DIIH 3GDVA 1SFQB 1SQOA 2OBOA 2W26A 2K8IA 3ZYEA 3H7TA 3P95A 1C9TA 1C5LH 5FX5A 3VB6A 1KLTA 1VITF 3A8DA 2V35A 1GHAF 2PW8H 3UUZA 2P3FH 5DP7A 5A0CA 1NC6A 1O3GA 1K28D 1F5LA 1GVLA 2WYJA 2P8OC 4NFFA 1Z71A 3ZVCA 3V13A 2AMDA 1A46H 5C5OA 5CHAC 3F0PA 2GV6A 2PSYA 4DG4A 3M36A 1BMFD 3AASA 1C5SA 2A1DB 1HIAA 1RJXB 2ILNA 1EASA 4CRDA 2EC9H 1LCYA 1W7GH 5GDSH 4DVAU 2Z9KA 1HFDA 2WPLS 1V2VT 4X1RU 3RP2A 3DFJA 2BLWA 1GPZA 1IQGA 1IQEA 1VITG 1FI8A 2PV9B 3ZYDA 2F4LA 1GHAG 5HMAA 3S9CA 5EODA 1PQAA 3PMAB 4WXVA 1MTWA 2YNBA 3OX7U 4AG1A 3HK6B 1LVMA 3MO9A 1TALA 8GCHF 2GZ7A 1DANH 1PYTD 1WSSH 3RU4E 4DOQA 3VB5A 2ZHDA 1T32A 1HAHH 3ATKA 1O3DA 5A8XA 3V3MA 4JZIA 1C5VA 2VVVA 1O2WA 4Q80A 1QQUA 2Y7ZA 2Y7XA 2A7CA 1P04A 2AFQB 4O9VA 5JYIA 1GBLA 4RI0A 3M5OA 1Z8GA 3BG4C 1AGJA 1UTKA 4UE7H 1SKYE 2IJD1 1AFQB 3ENSB 1FLEE 4IC5A 3MQKC 3Q3YA 2F91A 1GBDA 8GCHG 2AIQA 1UCYK 3RDZA 2Z3EA 1AB9C 3FANA 2GT8A 3NCLA 1MKXH 2PLXA 1NPMA 3K2UA 3A7TA 1HAGE 5EXLA 1AO5A 3AW0A 1KXFA 4ZHLU 2KFWA 4X8SH 1C1MA 2DE8A 4LK4A 3PO1C 1TX7A 1TLDA 3HKJB 4NFEA 4RT0A 5C20A 3F2FA 4IN2A 4GHQA 5GWZA 1O2RA 1LQDB 2ZGBH 3NXPA 1BBRH 1PJPA 4VGCC 5LPRA 3LDXH 1EUFA 4LOYH 3ZZDA 1AVGH 1A0HB 1VGCB 2C3SA 4B73A 2GCTC 1RIWB 4WXIA 1BOQA 1V2LT 1MZDA 2TGDA 4IC6A 2NWNA 4NA8A 3OTPA 3TGJE 2O8UA 1DICA 1SLVB 2A4RA 2AGGX 2GD4B 1NU9A 2ZI2H 3H5CB 4BAKB 5EU8A 4MTBA 2XTTB 1ELEE 4AYYB 3PMHB 2ZCHP 2HRVA 1KXBA 1GMCF 2ZFTA 2QV1A 3M5NA 2ZPQA 2TGAA 5L2ZH 2STAE 1NROH 3DCLA 2XOKD 1A5IA 3LGIA 4MDSA 3T2NA 2PTNA 1O5DH 1SGPE 1O3EA 1T8OA 1XVOA 2KAIA 5DP8A 2ZEBA 1EXFA 1HAVB 4Q7XA 1SGNE 2WV9A 1A0JA 1ZHMA 1CBWB 3VXFH 1YY3A 1WXRA 1K1NA 1OS8A 1PQ8A 2XBXA 1TQ0B 2K1QA 4SGBE 1GMHF 4FOUC 2VVUA 3SV2H 1ARBA 1PFXC 2XC0A 1A0LA 3RXSA 2V6NA 2ZP0H 2ZDLA 4FUIA 4B74A 1KIGH 2G55A 2VIDA 4MNYA 1ZTKA 1VITH 5ETXA 1L1JA 4FVBA 1XXDA 1TFXA 2IJOB 4Q63A 4YTAA 2FOFA 1L4DA 5F8TA 1D6RA 1OKXA 1YLCA 3LJOA 3GCOA 1YPHC 3TJOA 1BTHH 2QXGA 2J5UA 4DGJA 1MCTA 1DSTA 7LPRA 2J38A 1C1RA 1F7ZA 1GMHG 1V2ST 3U8OH 1PPEE 2QYIA 1J17T 2H1UA 4DURA 4I33A 4YXWD 2WPMS 5J4QA 2ZCLP 1DDJA 4NIWA 1THPB 4JYUH 7GCHG 3RLWH 1V2KT 2VGCB 3A7YA 1S0RA 1NRRH 2F9PA 2XBYA 3Q3XA 1Y8TA 3VFEA 3QWCH 3EA8A 1EZUC 1NFUA 4ZHMU 3A86A 1NBME 5CE1A 4FUGA 3SUDA 3F2GA 4BTUB 2OQUA 3WWFA 1QL7A 3N7DA 1RXPA 4M9FA 5DP4A 1BTYA 1UJ1A 1G3BA 2FIRH 3P70B 3SNEA 2Z94A 2AS9A 4FU7A 2GDDA 3MH4A 5IDKA 1JRSA 1SOZA 2H9HA 3NKKA 5F8XA 4Z1MD 1ZJDA 2BY7X 3KQCA 4U32A 4B76A 5HKKD 2BVRH 1H8DH 1XKAC 1DWCH 2WV5A 2Y6TA 3K6ZA 2F9VA 1AY6H 3OYPA 2SNVA 1F0TA 1AMHA 1H4WA 2LELA 1BTZA 2ZO3H 2O8WA 1C1VH 1IHTH 1S84A 1MU6B 2CGAA 1B0FA 4ZKOU 4K1TA 3A83A 2R9PA 5JBTA 5JPMH 2OC0A 3GY2A 1P09A 3MI4A 1GDNA 1GBFA 6CHAC 5E0HA 1VKYA 2LP6A 5BPEA 4X1PU 4BXSA 5DPAA 3LC3A 4KP0A 2EI6A 2Z9GA 4K3JA 1N6YA 3DUXH 3SU4A 2ZWLH 2CHAB 4IMQA 2BOHB 4NSVA 1SB1H 1EB2A 1AWFH 2A45B 3B23B 1TRMA 1KYNA 3SORA 1FIZA 1QRZA 3PTBA 2BD2A 2SNWA 3U69H 2CF8H 3RXHA 4BTIB 2QF3A 3MU0A 4INHA 1YPEH 1EB1H 4AYVB 2BDBA 3SGAE 1P01A 4CRAA 1P2OA 3SI4H 3MO3A 3LOXA 4UDWH 8ESTE 3UOPA 1HV7A 4CBNA 4ABJA 1IQMA 3T25A 2VIOA 4GCHG 5FX6A 1O33A 3VB7A 4ACAA 1MBMA 1TX6A 2RDLA 3ODFA 1C1PA 1JRTA 1TYNA 3F9FA 5L6NH 2Z3CA 2ZG0H 5AVDA 4X0WU 1QBVH 2BLQA 3FZDA 3TVJB 2A2XH 7KMEH 1YKTA 1PPFE 4X1NU 3KQEA 2ZECA 3PV2A 4P02A 1C2KA 1C5WB 2WZQA 1H8ED 3NK8A 1C4Y2 1DPOA 2RA3A 2AMPA 4KTSA 1P2JA 2GJGA 1CHOF 2ODQA 3UIRA 1FPHH 5C17A 1LTOA 1QB6A 2L74A 3ZVEA 1SGTA 4IBLH 1EKBB 5CMXH 2OQ5A 3JZ2B 2ZDNA 4INLA 1GCDA 3GS9A 3BIVH 5DSFA 1XX9A 1HJAB 1QJ1B 2FODA 1EOLA 4DY7B 3EA7A 2KZ4A 2A32A 1SQTA 2B5TB 4FUBA 1GJ8B 4JZFH 3E0NB 2VH0A 1ZMJA 2V7QD 2C8WB 2JDID 5LPFA 3NRLA 1AIXH 5EJZA 2FZZA 1UTNA 1BMAA 4IGDA 1T7CA 3VEQB 3O8DA 1EATA 5DP3A 1TOCB 3SOSA 2J98A 3TITA 5C2ZA 4ZXXH 2HWLB 1LO6A 1V2TT 1C4U2 1ZGIA 1QBNA 1PYTC 2I6QA 1P3EA 1BITA 2PGBB 3QZQA 3P8GA 1MTVA 1OP2A 3GDSA 5EXNA 4I8JA 3V0XA 5AF9H 3RC5A 1VJ9U 2J92A 4Q7ZA 4D9RA 3ATIA 3STJA 4X6PA 3QN7A 3UNSA 5KGOA 1Q2WA 2D2DA 3M3SA 2JH0D 2AGIX 2WUBA 1S85A 2LNCA 2HVYB 3FP6E 1UK3A 5C1YA 5TJXA 3NWUA 3P8OA 1SQRA 1KTTB 1O2HA 3N7OA 1F0RA 4HGCA 5FPYA 1O2SA 3RXBA 1GBCA 2ZQ1A 1ANCA 3PLBA 3E8LA 1FUJA 2ZFFH 3ODDA 1TAWA 5B6OA 1EZQA 3LT3A 3B9FH 1IQNA 2F9BH 2KCOA 4YESB 2UWOA 1P9UA 1UTQA 5GCHG 4HI3A 3SN8A 2D26C 2FYQA 1GGDB 4QT8C 1VCQA 5EQSA 3E1XB 2A2QH 5DG6A 1HAIH 1GG6C 1MTNB 1YBWA 5TCCA 1ANEA 1NRSH 3SU0A 3AK5A 2HPQH 2XBWA 2VB0A 3Q00A 1TRNA 1V2OT 3SV7A 3BTHE 4AORA 1KDQA 3SU1A 3VPKA 1JWTA 1AD8H 2BY8X 2A5IA 1ELBA 3PB1E 1D3PB 2XWBI 1O37A 5EW2H 1O36A 1CGHA 3VXEH 1O2LA 1FN6A 1IQKA 2GZ8A 4CREA 2WPJS 3BIUH 1A7SA 5KEDA 3LGVA 3ZVFA 4O97A 1Z1IA 5E2PA 5JBBS 1Q3XA 1GHWH 2ANKH 4OGYA 4Y7AA 3UOUA 2CV3A 1RTKA 3I78A 2SGFE 3MNXA 1ESBA 1D4PB 1DUAA 3AAVA 3EGKH 4J2YB 1UVTH 4FVDA 5EQQA 3GY4A 1TNLA 3RMNH 1Y5AT 2ASUB 1LDTT 2B8OH 2HNTC 1IQLA 2J94A 2BDHA 1IQFA 3KNXA 1SLWB 1YP9A 3PWBA 3SU5A 5AHGH 1CE5A 4Z6AH 3A84A 2JETB 2UWLA 3O8BA 4GAWA 1N8OB 2C93B 2EY4C 1AN1E 2PKSC 3U1IB 5FCKA 5EG4A 2FM2A 2ZDMA 5FBEA 1GI7B 1O3KA
chains in the Genus database with same CATH topology
1T8MA 2XCFA 1DLKB 2P94A 2HNTE 3GCHC 3T27A 3DFLA 3PMBB 2BDAA 1DITH 2BXUH 3RXKA 2BDYA 1PPBH 1OP8A 1Z8JB 1XUJA 1TPPA 2ZTYA 4WVPE 2Y82A 1YPJH 3ATMA 2C8XB 1HYLA 1GI5A 6LPRA 3SW2B 2BZ6H 4YZUA 4MPXA 3ZVBA 5DJ7A 4Y0YE 1EZSC 1RIWC 3VB4A 1GHVH 4WY3A 4TPIZ 2BQWB 1NS3A 2XC4A 1L4ZA 2VWNA 4H4FA 4KKDA 4ABFA 2G52A 2SGAA 2BLVA 6ESTA 1GBIA 4D9QA 1RD3B 3RLYH 3OTJE 3DHKH 4NWLA 2ZHQH 2PHBA 1AUTC 4ZHAA 2QA9E 1O0DH 1LVYA 2NU4E 2ALVA 3EAJA 4Y11E 4ABDA 3SNAA 3SU3A 3FVFB 2D1JA 3C27B 5E0GA 1L1NA 3BTQE 1GJ7B 1HLTH 2ULLA 1O5CB 2NU2E 4IS5A 4BAMB 4Y7BA 2PGQB 1Q31A 1EZXC 4XE4A 3AAUA 3U1JB 1O2UA 1Y5BT 3STIA 2PKAB 3QZRA 2ZPSA 4O3TA 4M7GA 1ZGVA 1K2I1 2H6MA 3SJIA 1FY8E 2Q6FA 3E0PB 1IHSH 1IQJA 1AE8H 1C5ZB 1O5FH 5EW1H 1ZJKA 3BTTE 3V7TA 3A8CA 4X8UH 2VWLA 3NPSA 5EPNA 5JDUB 1KXDA 1TA6A 1ZHRA 2STBE 2XW9A 3A88A 3RXFA 1ZRKA 1FPCH 2XNIA 1K22H 5HGGA 5GJ4B 4WJG2 4A1VA 1QTFA 5E0JA 1O3CA 1HIAB 1CVWH 1O3HA 1T8LA 3QGNB 4WH6A 1OXGA 1SGEE 4K1SA 3IITA 1GL1A 1QA7A 1O3IA 4TY7A 4X2YA 4ABEA 2UWPA 1SGFA 3BEUA 3BTGE 5H4IB 1EPTA 1SGCA 2G5NA 1C5TA 3MHWU 4WF8A 3ATWA 1YCPM 2VJ1A 4DIHH 1AE5A 1BJVA 1QR3E 1NN6A 2AGEX 1TGCA 1W11U 1L1GA 3OU0A 2TGTA 3BG8A 3MOCA 2Z3DA 3E16B 1ZOMA 4F4OC 4JZ1A 1BDAA 1NRQH 5A0AE 1OWEA 3D23A 1GDQA 2Y81A 4ABIA 3G01A 3MWIU 3RMOH 1DS2E 3TH3H 1AU8A 1K9OE 4AX9H 5T6DA 1O39A 2ZU1A 1GJAB 1C2GA 3FAOA 1C4V2 3D65E 1V2WT 3FZZA 2BDIA 2JKHA 9LPRA 3L33A 3TH2H 5JBAS 1Y59T 3CP7A 4X6NA 3T29A 1GWAA 4DJZB 2PWXA 1DM4B 5A8YA 1UTPA 1UVSH 4GLYA 4LXBH 2BZAA 4E7NA 2PUXB 1ZRBA 3OY5U 4Y6DA 1GBJA 1YPMH 1P0SH 4Y8ZA 2FWWA 5FPTA 2A4OA 2XWAA 1SQAA 1ZTJA 4O3UA 5EXMA 2ZGJA 4B71A 3W94A 1W14U 1AZ8A 2ZKSA 1KTSB 3A87A 3S7HB 2B9LA 5EGMA 3P8FA 4XSKU 1QHRB 2OP9A 2ZNKH 3A85A 3TNSA 2BMGB 2O9QA 4XFQA 5C1XA 4FU9A 1FMGA 1BTXA 1GCTB 3B8JA 4X8TH 1DWEH 1BZXE 1W13U 2WPKS 4MNXA 1SC8U 4X2VA 4BAHB 5JB8S 1SR5C 2VWMA 1PQ7A 4UD9H 1HJ8A 3PTNA 1YYY1 1AVWA 1BTWA 3TPIZ 2BY6X 1O3AA 3R3GB 3CS7A 4R0IA 5F8ZA 1HAXB 3LGWA 2A5AA 1K1OA 2KAIB 1P11E 1CHGA 1ID5H 2VH6A 1GMCG 1S82A 2ZDAH 3A8BA 1UK4A 3LU9B 2ZCKP 3F6UH 4NZLA 3I29A 4NIXA 1GBHA 3SZNA 1BRBE 2HOBA 3URDA 1WCZA 2HALA 1KXAA 1FY1A 1A61H 2Q6DA 4GVUA 1XVMA 2B7DH 3SGQE 3SJOA 1Z1JA 1MKWK 2OCVB 2FOMB 1JMOH 8LPRA 4E7RG 2QAAA 4OS2A 1PPCE 1K1IA 3KQDA 2EI8A 2UUYA 3S69A 1TNGA 2ZTXA 4U30A 3BEIB 4X6OA 2P8OB 1OWJA 1Y3VA 3OY6U 5CHAB 1LHEH 3T62A 1UHBA 2Z6BD 1UVUH 3H7OA 4K69A 1DWDH 4X1SU 1YPHE 1AFEH 1FXYA 1DXPA 2GMTC 1T4UH 3ZZBA 2BM2A 2QC2A 1HXFH 4JYTA 1V3XA 1ELGA 1O2PA 2FO9A 1V2MT 3UR9A 3K65B 1TE0A 1E0FD 1O3LA 3GISB 1D3TB 1DT2A 1W12U 1CA0C 1TONA 4NIYA 2BQ7B 2J95A 3BV9B 1HGTH 2AERH 5C3NA 5T6FA 3A82A 2QN5T 3OSYA 2ZPRA 1KLIH 2XBVA 3FP8E 1V2JT 2HNTF 1HAZB 5TCAA 2OC7A 3HATH 1C5QA 1D3DB 3GCTF 3O8CA 3AVZA 2A4QA 3BTFE 1C1OA 4E05H 1J9CH 1NY22 1PPZA 1GI2A 2V3HH 2BB4A 3FFGA 4RKJB 2ZU3A 5JB9S 1GBBA 3O8RA 5K0HA 5C5NA 4A6LA 3BG4B 1UMAH 2W3IA 3ZV9A 1RS0A 1DY9A 4ZKRU 1QURH 4A5TS 1DOJA 4B2AA 5J4SA 1SHYA 3GY8A 3M3VA 2TPIZ 1PPGE 1G2LA 1Z8IB 4D7GA 3ZVDA 1AB9B 4ESTE 1F0SA 3P17H 1G3EA 1UCYH 3GCTG 3KGPA 4MVNA 3VGCC 4D7FA 1QFKH 2NU1E 5ESBA 3ZZ3A 2ZFQH 7ESTE 3PO1B 3QGJA 4H6SB 4CR5A 1HRTH 1C1NA 1KSNA 1Y3UA 4THNH 4FUCA 4AFSA 2BQ6B 4WMDA 1TBZH 4VGCB 1MD8A 2G5VA 1JXPA 5ABWA 3GOVB 1CT4E 3ZZ6A 1QL9A 2BX3A 3M5LA 2FPZA 2GCTB 3GY6A 2VIVA 2TGPZ 4I8LA 4Y8YA 4B2BA 3RMLH 5GIBA 3HKIB 1ZPZA 1H1BA 1QNJA 2W5EA 1V2QT 2ZGXH 3ZVAA 4B75A 3R0FA 1YGCH 2BHGA 1VCWA 3BF6H 3T5FH 3SNCA 1AHTH 2CF9H 1W0ZU 4OS7A 1BT7A 2OBQA 5L30H 1P3CA 2ANWA 3UY9A 1HCGA 4I31A 3U9AH 1ABIH 2QXIA 1DY8A 4ISLA 5DGJA 1INCA 1XUFA 2HVXA 4Y76A 4MNVA 2GCHF 3LGYA 2ZQ2A 2FXRA 3QLPH 4I7YH 1ESAA 3E3TA 4HZHA 1CO7E 3RM2H 1L0ZA 1YCPK 4Z0KA 4AN7A 1ZSJA 2G4UA 2NU3E 4LZ1H 2ZGCA 1TPAE 2A7HA 1BQYA 3TU7H 6GCHF 3LPRA 3ATLA 1P12E 1ETRH 1HAOH 1O2YA 1SLXB 2C90B 3TH4H 5T6GA 1BHXF 1G32B 3Q77A 3Q3KA 5EOKA 1ELCA 4ZAEA 4J1YA 3IG6B 4ZXYH 1UVPA 1O3JA 1CHOG 2H2ZA 5DO4H 1TOMH 2WPIS 2ZIQH 1GBEA 3GY5A 4UONA 1P06A 1FZZA 1NO9H 4TYDA 3M7TA 4NWKA 1MKWH 1LHDH 1XXFA 3DA9B 6GCHG 5DP5A 2ZHWH 1SVPA 1Y3XA 4CRCA 3LIWA 2V3OH 3LC5A 4K1EA 1C1TA 3RXLA 3SHCH 1TPSA 1XUIA 3GCNA 3V12A 1BIOA 2ODPA 1C1UH 3QUMP 2BTCE 2R2WU 3KF2A 4ABBA 2QXJA 3SO3A 1MMJN 1W3CA 2D8WA 1JIMA 1GI1A 1LVOA 3A81A 1GJ9B 4XOJA 1UO6A 2PFEA 3GICB 4CHAC 3PLKA 3K6YA 2TBSA 4MLFB 2ZF0H 3ELAH 1NRNH 2ZZUH 2J34A 2QF0A 2AMQA 1ELVA 4FUDA 1FIWA 3F9EA 3TLOA 5SGAE 1DUEA 3HK3B 3TNTA 3TK5A 2SGPE 1IOEA 2OXSA 1LMWB 2VIQA 3F9GA 3LKWA 1QY6A 3QO6A 4Y79A 1TMBH 2I6SA 2TIOA 3IWMA 3E91A 1DE7H 1Z6EA 1C2LA 1C1SA 2GDEH 4YLQH 1FAKH 1P2QA 3RXQA 5HXFA 1ACBE 3GYLB 2ODYB 4Q7YA 3UREA 2ZU2A 3KIDU 3SUEA 3RXVA 1C5XB 5K7RA 1THSH 2AH4X 4TWYA 1ABJH 1TABE 1ELDE 1FY5A 1YF4A 6CHAB 2DE9A 1GJ6A 3GDUA 1VZQH 4X8VH 4AZ2B 4D76A 4JZDH 1UTMA 5L2YH 1CU1A 1AZZA 1C2FA 1KDQB 1O5GH 1DFPA 1CGJE 1QGFA 1S0QA 3PV4A 1EP6A 3UFAA 1ZSKA 3A7ZA 1GHYH 3D62A 2H5CA 2VWOA 3MU1A 4FUEA 4UFDH 1QIXB 4SGAE 3PWCA 4TWWA 1TPOA 2FTMA 4I8GA 1GJCB 3AW1A 2NU0E 1O31A 3UPEA 1F5KU 2BD7A 3EQ0H 3S7KB 1LKBA 1Z7KA 1F0UA 2ZFPH 2FOHA 3ZV8A 1OP0A 3BN9A 1O2ZA 5A0BA 1O2KA 1P2IA 3MYWA 1A4WH 3MTYA 4CR9A 5LGOA 1AFQC 2Y5GA 5C1UA 1GBMA 1P10A 3BTKE 1O2JA 1FONA 4JMYA 1AWHB 1SFIA 1J8AA 2FLRH 2FS8A 2P59A 3BTWE 4ABAA 3GY3A 1K1JA 4ZUHA 3WY8A 1H9LB 4H6TA 2WPHS 5PTPA 1S83A 4A1XA 1TNJA 2CJIA 4ABGA 5F6MA 2J2UA 2WUCA 2ZFSA 1NZQH 4CRBA 2GV7A 4RSPA 2OINA 1BJUA 5EPYA 1C5RA 3QDZB 2A5KA 4K8YA 4INKA 3SQHE 1CA8B 1OOKB 3UWIA 1Y5UT 1VGCC 3UWJH 1YCPH 2BDCA 2GZ9A 1LPZB 3TK9A 1C5UA 1ORFA 1C9PA 1BRAA 2UUFB 1L2EA 4JZEH 1KLJH 3RXEA 2BOKA 2R3YA 4CH2B 1NFXA 1Y3YA 3JZ1B 1VR1H 2ZHEH 1PQ5A 3KL6A 5HM2A 3SUGA 5GPIB 1DWBH 3LGTA 1C1QA 4ZKSU 2QGRA 1O2XA 4HFPB 4NZQA 1O3PB 3M35A 3RUOA 1ZPCA 3MMGA 3LH3A 3M7QA 1C5YB 4TPYA 4AG2A 1SSXA 4K8BA 1CBWC 1C2JA 4FU8A 4XBDA 3F9HA 2IN2A 2ZU4A 1S5SA 2QCYA 3ITIA 4AFZA 1TNKA 1AI8H 2Q6GA 1ZHPA 3UNQA 3PMJA 1OYTH 5E8EH 4YT7H 4K60A 2XXLA 1OWKA 1W8BH 4I32A 4DT7B 5AFZH 2R3UA 1W2KH 2BLOA 2R0LA 2YOLA 3RXIA 1O2QA 5DP6A 3SU6A 1NM6A 1XKBC 1G30B 1UTLM 1ZR0A 2BD8A 1GBAA 2GGVB 1O2GH 2Z9IA 1W10U 3M37A 4NCYA 1MQ6A 3TJVA 1TGBA 3M7UA 4JK6A 3SJ9A 2V0BA 5I25A 3UQOA 1U6QA 3ZZCA 4CBOA 1GG6B 1MU8B 1LQEA 1T8NA 1SGIB 1ZSLA 2P93A 3MFJA 3SI3H 2VGCC 1D6WA 1UK2A 1WQSA 1DX5M 3MH6A 5FAHA 1UTJA 3RM0H 2VU8E 5A09A 1C2EA 2OUAA 2ZDVH 1QB9A 1F92A 1WTHD 1G3DA 2P3TB 3SUFA 1ANDA 1NU7B 1FV9A 5ESTE 4BANB 1GHBF 2EA3A 1MAYA 1E38B 1EPTB 3SV9A 4YO9A 1D9IA 1QRXA 1VJAU 3MNCA 4X6MA 2A4GA 3NUMA 1ZTLA 4KGAA 2UUKB 4YT6H 2Q1JA 1G36A 4ISOA 4X2WA 4AOQA 1GJDB 1O3BA 1WV7H 4U2WA 3K9XB 4ISIH 3TGKE 1QCPA 2F9OA 3KHVA 4FUFA 3SGBE 4ISHH 1WUNH 5LH8A 2O8MA 1FAXA 2C4FH 2SGEE 1ZMNA 2FOGA 4NA9H 3ZVGA 1GHBG 2BYAX 1N6XA 1ANBA 1OWIA 1GBKA 1TNHA 4OGXA 2J4IA 3CENA 1QL8A 2CMYA 1HUTH 1TBRH 1DSUA 1FN8A 1GJ4H 5A2MH 1B0EA 4AFQA 4RKOB 4BXWA 2BD5A 1HAYB 2FOBA 2PKSB 1EJAA 4JYVH 1N1LA 1GHXH 1QRWA 4YOGA 1E36B 2VIWA 4AGJA 2FI4E 1RRKA 1SPJA 2CHAC 1LPGB 3GCHB 3RXTA 5HYOA 1TGSZ 3MU5A 1BUIA 2BDGA 1JIRA 1D3QB 1AQ7A 3RXPA 4MNWA 2ZGHA 5FBIA 1ZMLA 2AYWA 4GPGA 3BTDE 1J16A 1P2KA 1NRPH 1TGTA 4IN1A 1YC0A 3MNBA 1C2IA 1ELFA 1GI4A 2FOCA 2R0KA 4OS4A 1O2MA 1P57B 1EAWA 1QJ6B 2CXVA 2J9NA 4O03A 1S6FA 4WMFA 1W7XH 1GMDF 8KME2 3SNDA 1RTFB 2FOAA 1WU1A 1SGYE 5FXLA 1EAUA 4AB9A 1HB0B 3CS0A 1TRYA 2F3CE 1OSSA 3SJKA 1HXEH 2FYRA 2DUCA 4WMEA 1HAVA 1TX8A 2BD3A 4K5ZA 4FUJA 4Q2KA 1ELTA 4AB8A 1TB6H 2ZC9H 4BAQB 1BMMH 3E6PH 3UR6A 3RXOA 1GMDG 3RC6A 1A3BH 1O5EH 1P9SA 3A80A 1E35B 1YLDA 2PUQH 1V2UT 2XYAA 2BX4A 3L3TA 3P6ZB 1CT2E 1GBTA 4X2XA 1BCUH 3F1SB 3GYMA 4UFGH 1UTOA 2TRMA 2ZU5A 2IPHA 3P8NA 1OWDA 1HJAC 5JBCS 4BTTB 1O2NA 4FUHA 2WINI 2Y80A 1OPHB 1F5RA 7GCHF 4GUXA 1QB1A 1GHZA 1V2RT 3ZZ9A 2C8YB 1DVAH 1BHXB 1QQ4A 3RXCA 4MPUA 3SJ8A 1GVKB 2FESH 5I46H 2G4TA 1WQVH 1Z8RA 2ALPA 1EJNA 2XRCA 1H8IH 3HPTB 1A3EH 1O5AB 1MAXA 1TWXB 4E06H 4XBCA 2R2MB 1TNIA 1O5BB 3T26A 4UFFH 1UHBB 1BB0B 1MQ5A 3RXJA 3A89A 4GSOA 2O8TA 4I8KA 1BBRE 3MU8A 4B1TA 1O3OA 3U98H 1G9IE 2BXTH 2M5TA 1C5NH 3RC4A 1S6HA 3RXUA 2BVSH 2W7SA