4ABEA

Fragments bound to bovine trypsin for the sampl challenge
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CATIONIC TRYPSIN
publication title The Dingo Dataset: A Comprehensive Set of Data for the Sampl Challenge.
pubmed doi rcsb
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4abeA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4abeA02
1GBBA 3M7UA 5BRRE 3ODDA 5EQRA 4HZHA 1F0SA 1BHXB 2ESTE 5DJ7A 1AB9B 1AE5A 1QJ7B 2FOBA 3GICB 1VITH 3UWJH 2R2WU 3LGUA 2XCFA 4O03A 1FMGA 1RXPA 5EOKA 4BXWA 2W5EA 1JIRA 2A5KA 2WPMS 1D4PB 3P8GA 2O9QA 3M3VA 2BLOA 3OY5U 1P3CA 1V2MT 3GISB 5HM9A 3E3TA 1FY5A 5TCCA 5LPEA 3GDSA 3M5MA 2CHAC 2F9OA 3ITIA 1TMUH 2AMQA 2FYQA 3BG4B 3RP2A 2F9PA 2RA3A 4I8LA 4ABDA 3OY6U 1SHHB 6CHAC 4XBDA 5CMXH 4X2WA 1UCYK 2PKSB 4UFDH 2PV9B 3HGPA 1YM0A 3TIUA 1EAXA 3RLYH 4FXGH 4A6LA 2BXUH 1V2RT 4AORA 1PPCE 1J8AA 3AW1A 4ISOA 4GUXA 3Q77A 3LH3A 2BVSH 2HRVA 1S5SA 2TGDA 1TGNA 2C3SA 1GBIA 1HAVB 1OWHA 3RXEA 1SSXA 5C1UA 1GI2A 3F9GA 1G37A 1TNIA 1RTFB 1EQ9A 1WUNH 3ATLA 1AMHA 2ZEBA 2G00A 2EA3A 1O0DH 4X8VH 4NIWA 1FN6A 2FOFA 3E16B 1O3PB 1O2GH 3EA7A 2V3OH 1K1PA 3MO6A 5DP4A 3F9EA 3RXOA 5DP9A 1A5IA 3ZZAA 2F9VA 4I8HA 2W3KA 4U2WA 3C27B 2OTVA 1MD8A 1A4WH 2QXGA 3BTTE 4CH2B 3ZV9A 4NA7A 4U01A 1SB1H 6GCHG 3MU4A 2UUYA 3P6ZB 4FUCA 3O8DA 1TIOA 2A7JA 4AX9H 4JYVH 3RMLH 2OINA 2TIOA 2OXSA 3MO9A 1GBTA 1O5GH 2VH6A 1P03A 3OYPA 4J1YA 3SUFA 3D49H 4INKA 1GL0E 2PSXA 4AZ2B 2ZDLA 1A0HB 2ZPQA 1ZPCA 4CRAA 1DSUA 4E7RG 2ODPA 4FU9A 1P2MA 4ZKNU 5DG6A 1QHRB 2ZC9H 2XWAA 2GZ9A 3PV4A 4ABIA 3ZZDA 1SLWB 1C5YB 5EG4A 2BOKA 4WMFA 4X2VA 3NPSA 3JZ2B 4CRDA 4DIHH 1BTHH 2BDAA 4Y8XA 1V2UT 1HDTH 1GMHG 1Q2WA 3O8RA 1DWEH 1AIXH 1V3XA 3UIRA 4B73A 1L2EA 1B5GH 3ZV8A 5EODA 2SGPE 3P8NA 2ZO3H 1H9HE 4ABEA 1TYNA 2ZTXA 1HAIH 3RXKA 1UK2A 3GY7A 3VGCC 1BMAA 5C2ZA 2BY7X 1PPZA 1KIGH 1K1IA 1MQ5A 1HAYB 1HJ9A 2A4RA 1UVTH 3O8BA 2A2XH 1AWFH 4DVAU 2ZFFH 3E6PH 4H6TA 1NFXA 2GCHG 4ZAEA 3RC4A 1AO5A 2BOHB 3A7WA 4Y6DA 1D6RA 4CR5A 5FXLA 4B2BA 4WH6A 2FI5E 1O2NA 1FPCH 1QY6A 4K5ZA 3DD2H 1BBRK 1LQDB 5E8EH 3RC5A 1ZYOA 3S9BA 2PKAA 4E7NA 1TNGA 3K65B 1MBQA 1IAUA 3E8LA 4I8KA 2ILNA 1UTOA 1GHYH 4ISHH 1ZOMA 1A3BH 3DFLA 3TH3H 2BDGA 2SFAA 2XRCA 2CF8H 1F7ZA 1C1NA 2TRMA 1EJAA 3LGVA 4MNWA 1FIZA 3EDXB 1WQSA 1CU1A 2QIQA 3RXBA 3RMOH 1DM4B 1O3AA 1Z7KA 3SGBE 3NZIA 1A46H 1EPTB 1GJ5H 7KMEH 1TB6H 1CQQA 4GSOA 1W3CA 1ARBA 5L2ZH 4X1PU 3GCOA 3DHKH 1Z71A 1YCPK 4YESB 2STBE 5C1XA 1ETSH 4BAOB 1ARCA 1ZHRA 4K1SA 4ZUHA 3A84A 4Y7AA 1GL1A 1HJAC 1Y8TA 1HB0B 4FUHA 4AFQA 4DW2U 2CXVA 2Q1JA 3AASA 3ESTA 4UFFH 3URDA 3LGYA 1MTWA 4WF8A 1AZZA 1C1OA 3L33A 1G30B 4NGAH 2WYJA 3BV9B 5JB9S 3RXMA 1GI9B 3QX5H 2F9UA 1HCGA 2UWLA 4NWKA 3H5CB 2OLGA 1P2NA 3UQOA 1CO7E 2ZCHP 2FIRH 4ZH8A 1C5VA 2Z3DA 1E38B 2O8LA 1XUJA 3UR6A 1C1SA 1WCZA 1ZSLA 1BHXF 4I31A 1QL8A 2P59A 2BDHA 4X0WU 1YC0A 2UWOA 3LC5A 4BOHA 1KXEA 4Q80A 2W7UA 2ZIQH 1DDJA 1V6DA 4B71A 1L4ZA 4Y7BA 4XDEA 4BAMB 2XC4A 1BTYA 1C5NH 1E0FD 3GCTF 3TPIZ 3PTNA 4BTUB 3SJ9A 2FTMA 1O3CA 5JB8S 3RLWH 5HGGA 1QQUA 1ELVA 2PFEA 1T4VH 1GI4A 3KF2A 4GHQA 2ZGJA 1ANDA 3BTHE 5EQQA 3BIVH 2SGFE 1GCTC 1C1WH 4VGCB 1TA2A 2WPJS 1AGJA 5J4QA 1DLEA 1H8DH 1NRRH 4ZXXH 1P02A 4WWYA 1MKXK 3FVFB 1HRTH 1B7XB 2W3IA 4ASHA 4JZEH 2BHGA 4I7YH 2VJ1A 5GPIB 8KME2 1FNIA 2GCTB 1FPHH 5ETXA 1ID5H 1SVPA 1Y3WA 3RXTA 4HGCA 3SU4A 3NKKA 1NFWA 2ZWLH 1UTMA 1Z8JB 1ABIH 2QAAA 1FAKH 4K1TA 3BF6H 4IMZA 1DUEA 1EAWA 3KN2A 3ZZ3A 1JMOH 2P8OB 3KQEA 2FTLE 1HAVA 2VIVA 5PTPA 1J9CH 1G3DA 1O39A 2F3CE 1S84A 1RIWC 2FX4A 1WBGB 2UUJB 4Y76A 2C93B 2AMDA 1GJBB 4GCHG 3ZVFA 1GG6B 2WV5A 3F9FA 3FAOA 1GHVH 1RTLA 3MNBA 2WPKS 1YPEH 3PB1E 3U8RH 4MPUA 1C2GA 1GVZA 1ELDE 1BDAA 1KXFA 2R0LA 1GMCF 4FUGA 1IQLA 1QB6A 2ZPSA 3QDZB 2PSYA 1YF4A 1C1UH 1SPJA 1GMCG 1T32A 5FBIA 2ZZUH 1NN6A 2ZU5A 1Y59T 1T8OA 4OGYA 1ZHPA 1MCVA 1LO6A 2FMJA 3LT3A 1GBCA 1GJAB 1A3EH 2ZGHA 3OTJE 4BNRA 3HK6B 2FM2A 6CHAB 2F9BH 1RD3B 1IHTH 9LPRA 1C2LA 1K9OE 2OUAA 1FDPA 5I46H 2H9EH 1DUAA 5FCKA 1FJSA 5TJXA 4NZQA 4D76A 3RXGA 4GHTA 4GLYA 3ZVGA 4B2CA 1F5RA 3VEQB 3M37A 4NFEA 4UEHH 1NS3A 3ZVAA 2VVCA 1P01A 1BT7A 1C1RA 3P70B 3T2NA 2VWNA 1OXGA 1ELBA 1KLTA 1HXEH 1UK3A 3B23B 1AVXA 1EZXC 1ZSKA 2H9HA 2PGQB 1XUKA 1BTWA 2HALA 2NWNA 1K2I1 1DPOA 5DKMA 3VXEH 1C4U2 3TJUA 2WPLS 4JZ1A 2P3UB 2Y5FA 4XE4A 5A09A 1DY8A 2AIQA 1O5FH 4B76A 1BA8B 1ZZZA 2F91A 2OP9A 1E36B 1ZRBA 1C4V2 4X8SH 1GDUA 1TRYA 1C5UA 1TBQH 1ZJKA 1OWIA 3T62A 1WV7H 1RRKA 5CE1A 3L3TA 2R3UA 2A4OA 1MU6B 5HM2A 3V3MA 4FUJA 1S83A 1KYNA 3A82A 1EZSC 4Z0KA 1QA0A 2GT8A 1NRNH 4OGXA 1D3PB 3QK1A 1AKSB 3RM0H 1QL7A 2QF0A 3SI4H 4XOJA 2QC2A 2BX4A 1ZTKA 1B0EA 1FY3A 1C2IA 3BTWE 3EGKH 3M3TA 5LPFA 1QBVH 4TPIZ 4YLUA 1QIXB 2H2ZA 5CHAC 2AGEX 3SQHE 2OBOA 3A7VA 3PROA 1F0UA 1DWDH 3FZDA 3K9XB 5FX5A 1DXWA 2RG3A 2ZG0H 4HFPB 3SUEA 1ELFA 3SHCH 1ZTJA 1WOFA 1C2FA 2FX6A 2JH0D 1BMMH 1P8VC 1K1NA 3NK8A 5AVDA 4OS4A 3ZZ9A 3SGQE 1P2OA 3QTVH 2HOBA 4ABJA 5DP6A 2O8UA 2V3HH 3A80A 3W94A 5FPTA 2GT7A 2IPHA 1O3MA 4O9VA 3SV6A 1EAUA 5E0GA 2QXIA 2QA9E 3M3SA 2ODQA 2AIPA 3OU0A 1XVMA 3VGCB 1O35A 1V2QT 2ZNKH 4X1RU 3A7YA 4I8GA 2EEKA 3LPRA 1HPGA 1O2VA 1FY1A 1GBAA 3KEEA 3IG6B 1O2QA 4UONA 1H4WA 4ABAA 4YT6H 3PM3A 1DANH 4A1XA 3SW2B 1Y3YA 1SGPE 2H1UA 1UTKA 3UOPA 3ATIA 3SJIA 2Z9LA 1DOJA 2P3TB 3QGNB 1P3EA 4CR9A 2SGEE 2NU1E 1OWDA 2VWLA 3MU0A 2Y80A 1BOQA 1V2PT 1CE5A 1TNJA 1SL3A 1GHAF 2A32A 1L1JA 3PMBB 3S9AA 3UPEA 4X6NA 2ZU1A 3PYHA 5I25A 3BSQA 4YT7H 1GBDA 2P3FH 4ABGA 2XBVA 4FUFA 1GHAG 1C5OH 1C2JA 1C5RA 1O37A 2WINI 1YPGH 2BY5X 3A8DA 3GY8A 1GJ8B 3RXAA 4IBLH 1XX9A 1L4DA 3AVZA 3CENA 3PO1B 2FI4E 4CBNA 3M36A 2BVRH 1OS8A 1QRZA 3SI3H 5FCRA 3E0PB 2BVXH 3SNCA 2VINA 4WXIA 1XXFA 5C5OA 1HIAA 4E06H 1C2KA 1EOLA 4MPXA 1CT2E 2Y82A 3RXUA 2JKHA 4F49A 4MTBA 4D9QA 1G2MA 3BTEE 2H5DA 4X1QU 1BRUP 3LDXH 1ELAA 2ZECA 2FP7B 4O3UA 1S81A 1SBWA 2XCNA 3Q3KA 1TMBH 1HYLA 1LQEA 3V12A 5G4BA 2GDEH 1TFXA 1A2CH 1JBUH 1UTJA 1O5BB 3STJA 1W0ZU 1M9UA 1WTHD 3SNDA 4B2AA 1GCDA 3STIA 1Y3XA 2A5AA 1AHTH 1DICA 1G3BA 2I6SA 4R0IA 4AYVB 1MTNC 2QN5T 2UUKB 1O2YA 1MMJN 3GOVB 4MG3A 5A8XA 3R3GB 2GMTC 1A1RA 1MKWH 1SQOA 1O3HA 2ZF0H 3ELAH 1LVOA 1FAXA 4X8TH 1ETRH 1OP0A 2SGAA 1EOJA 1C5LH 3LOXA 4DG4A 1C2HA 3KL6A 1MD7A 2AS9A 1WQVH 3SV8A 1NU9A 2UWPA 2QXHA 3UNSA 1IQIA 1CGIE 4JZDH 1GI1A 1UHBB 1FY4A 1AI8H 4U32A 2ZDKA 3BTQE 1ANEA 2BLQA 6GCHF 3Q00A 3T28A 4NWLA 7ESTE 4NIYA 1PQAA 4CHAB 1S0RA 1RTKA 1MTVA 5EQSA 3F1SB 1NZQH 1UTQA 1TNKA 1K22H 2ZI2H 2ZA5A 2FOCA 1X7AC 2QY0B 1O2PA 1SGYE 3LIWA 1MAXA 1GJ6A 3MOCA 1C1MA 1GBKA 2F83A 5L2YH 2G51A 1UCYE 1PPBH 4ISIH 4Y71A 5H4IB 3NUMA 3HGNA 2OC1A 1PQ5A 2Y6TA 3A7TA 3PWCA 2QYIA 1SGNE 5JBBS 3MHWU 1E35B 1GBLA 3MH5A 8GCHG 2ZCKP 1PPHE 4RKOB 4IN1A 1GJDB 2HPPH 1TBRH 6LPRA 2GZ7A 3NXPA 1O32A 2AYWA 4ESTE 1TONA 1GBEA 2Y5HA 3RU4D 1EZQA 1GMHF 2Z3EA 1VZQH 1GMDF 1A61H 3TNTA 3A89A 2PHBA 1SGFG 1GMDG 3P95A 2R9PA 1HNEE 3VB6A 1HJ8A 1TNLA 4AYYB 3BTKE 3GY4A 1Y5BT 2QF3A 1J15A 1BJUA 1T4UH 2GZ8A 5EPYA 4NZLA 1DLKB 3DUXH 5E0HA 1EAIA 2GCHF 8ESTE 1ZSJA 4AN7A 1AUJA 1F5LA 1H9LB 3CS7A 3R0FA 1LVYA 3A86A 3TITA 1YLCA 5C67A 1H9IE 4UDWH 2JH6D 2SNWA 1GJCB 2VGCC 2ZU2A 4H6SB 2XYAA 2ZHWH 2FOMB 5LGOA 1PQ7A 1YPKH 4MLFB 4Q7YA 1NC6A 4KTCA 4A1VA 2J38A 1N8OC 1TABE 2BQ7B 2IN2A 3D23A 2VIPA 1C5WB 3F9HA 2FXRA 2H6MA 3ZZCA 2WPIS 2Z9JA 3A88A 3I78A 1OYTH 3UUZA 1H1BA 1HGTH 1RJXB 1QR3E 1CVWH 1ETTH 1C2DA 1P9UA 2Z7FE 3VB5A 1K1MA 2OBQA 1AD8H 4X1SU 4NIVA 3QUMP 1NRSH 5AHGH 1BTPA 1AY6H 3PLBA 1VGCB 1C5MD 4YTAA 3GYMA 4MPVA 1AFEH 4OS6A 3MNCA 1U6QA 1SQAA 3GCHB 3RXRA 3TNSA 2A45B 2O8MA 5JBAS 2V6NA 4NIXA 1GHWH 2ALPA 4R8TB 3ZYDA 1EJNA 3LC3A 4BAHB 2Z9GA 1HAZB 1TOMH 1TNHA 2RA0A 3MYWA 2XXLA 5GJ4B 3RXQA 3C1KA 3GDVA 3ATWA 1AB9C 1WSSH 2PTNA 4DY7B 2XBYA 2GV7A 3ZZ7A 3EA9A 3T27A 1W2KH 1AU8A 1O3LA 4ISLA 3FP8E 1TX6A 2W7SA 1SGTA 4NG9H 1EJMA 3ZVDA 5LH8A 4CBOA 1YGCH 5A0BA 2BD7A 4J2YB 3EA8A 2FOAA 2BLVA 3GDUA 1LKAA 1GBMA 2A0QB 1C2MA 2XNIA 1CHOF 5T3HA 2KAIB 5ABWA 2H9TH 3ZZ8A 4BXSA 5EXNA 1BBRE 2FS8A 3UFAA 1EB2A 1CHOG 4OS2A 1T8NA 1O2UA 3MH6A 2PKSC 1GWAA 3SU5A 1IQHA 1TPPA 3G01A 4FU8A 2Q6DA 2ANMH 2PWXA 3O8CA 5JPMH 1A0LA 3VPKA 1FV9A 1EXFA 1MBMA 1THRH 4IC6A 2VVUA 3GY2A 4AFZA 1SR5C 2ZGBH 3W95A 2BD3A 2ZHEH 3UY9A 4CREA 2FYRA 1FIWA 2BD5A 4GVUA 1TGTA 1UVSH 2FEQH 1IQNA 1TQ7B 1WU1A 2SGQE 3FZZA 1P09A 2C8YB 2WPHS 4ABFA 3E90B 2I6QA 1ESTA 1CT4E 2XTTB 3RMMH 1RFNA 1FUJA 4K60A 4FVBA 4Y8YA 2ZGXH 3I29A 4Y79A 1EASA 5AF9H 4INHA 3SU1A 1CA0B 1VJAU 3H7OA 4X1NU 2ZTYA 2ZFPH 4ZKSU 3NCLA 1BRAA 1ESBA 3ZYEA 1TE0A 4YOGA 4X6PA 1OKXA 1ZGIA 1F2SE 3FP7E 1SLVB 3MNSA 1SG8B 1F0RA 1LHGH 1QGFA 1VITF 3BG8A 1O3KA 3PWBA 3K6YA 1TPAE 2DE9A 4X2XA 2YNBA 3P17H 1TQ0B 1VITG 2PR3A 2JETC 1TBZH 3ZVEA 1G3EA 1XUIA 3MU1A 4DCDA 4MNXA 1YPLH 1F5KU 5GCHG 4INLA 1UMAH 2BQWB 1CBWB 3M61U 2ZDAH 3RXHA 2ZP0H 1FY8E 4YO9A 4GCHF 1T8LA 1VCQA 2VWOA 3IWMA 5DPAA 4JZFH 4KELA 2PTCE 2C90B 2JH5D 1GBJA 3MI4A 2Q6FA 3ZZBA 1BITA 4Q2KA 3U8OH 1P11E 2ASUB 3TK9A 4JYUH 3E0NB 2LNCA 3HATH 2FDAA 1LVBA 2BY9X 3SUDA 1NU7B 1S85A 1O34A 1XMNB 1Z1JA 1P2JA 3TGJE 2C8WB 5ESBA 1UHBA 2XW9A 1MU8B 1ELTA 2PW8H 3BN9A 1IQKA 5F03A 4CH8B 2NU4E 2GKVE 4QT8C 2WUCA 2CHAB 4K3JA 1ZPZA 1C5TA 1OWKA 2A4QA 4D7GA 4Z6AH 2G5VA 1PFXC 4A5TS 4H4FA 2ZFRH 1DVAH 3TVJB 3N7OA 4I32A 3MMGA 1UK4A 1ZMLA 1KSNA 1SGRE 1WTGH 1PYTD 1ELCA 1BZXE 4SGBE 2EI7A 2O8TA 3A87A 1F92A 1OP2A 3Q76A 1KXDA 1RS0A 1GJ4H 4WVPE 1AWHB 5EXMA 2Z9IA 2ZHDA 1OOKB 5GXPA 5C1YA 1YPJH 3TLOA 1D3QB 1TOCB 5EW2H 4JCNA 1K28D 2VU8E 1W0YH 1T7CA 1AE8H 1VCWA 3BTDE 3TK5A 2ZDNA 1PJPA 2XBXA 1O2OA 1KDQB 5E0JA 1C1VH 1SMFE 1ZGVA 3SV9A 3M35A 4Y0YE 1QB9A 3LH1A 3RMNH 4JK6A 1W12U 4MQAA 3AAUA 3FFGA 2P95A 2SGDE 1QA7A 3KNXA 1D3DB 3SJOA 5SGAE 2B0FA 1LKBA 2QV1A 2AH4X 3SQEE 2PUQH 2CN0H 3GCNA 3RXFA 5FHTA 1ZMJA 1EB1H 1ZRKA 2J2UA 4KGAA 1V2TT 1QNJA 2WUBA 1BUIA 3BEFB 3QZQA 1J17T 1TX8A 2ALVA 1RGQA 3RU4E 1HAGE 3RXDA 3U1JB 3RXJA 2OC8A 2Y81A 3MU5A 3TK6A 1IQFA 1O2HA 5EGMA 3ENSB 2J34A 3H7TA 3UQVA 3KHVA 3UOUA 1TALA 2A4GA 4I33A 3LU9B 3NWUA 1HXFH 2B8OH 3ATKA 2HWLB 1LPGB 1O3IA 2HNTF 1OWJA 3UTUH 4YLQH 3S7HB 1HUTH 5HMAA 2FOHA 5IDKA 3SBKA 4UFGH 1SFQB 1DFPA 2K1QA 4KKDA 4X6OA 5FAHA 3IITA 9ESTA 1D6WA 3LJOA 2PUXB 1T31A 3M5OA 1SGEE 4ZKOU 3M5NA 3SOSA 3VB7A 2BDYA 2LPRA 1YYY1 3TH4H 1IOEA 3ATMA 4XBCA 3TGKE 5DP8A 4TWYA 2VB0A 4K69A 3RXVA 1LPKB 1EPTA 2VH0A 1EP5A 5DGJA 5JDUB 1YPMH 1LHFH 4I8JA 4WMDA 5ESTE 3GY6A 4WMEA 1SGQE 1TGCA 1JIMA 1UTLM 2CV3A 1K1JA 2UUFB 3T26A 2VGCB 1TMTH 4Y8ZA 4K8YA 1BRBE 3B8JA 4OS7A 1LTOA 3SV7A 1QBNA 3VXFH 2G8TA 4GAWA 1E37B 3UNRA 1KXCA 3MNXA 1ZJDA 4XBBA 2KAIA 5EU8A 2XC5A 1NRQH 1OPHB 1YPHE 1S0QA 1V2JT 2ZFSA 2D1JA 1QBOA 5JBTA 2GCTC 3ZVBA 1YKTA 3UNQA 1C4Y2 1A7SA 1JWTA 4K2YA 3TH2H 1C2EA 2A1DB 4Q7XA 1ACBE 1INCA 4XFQA 3E91A 1SGDE 1Q31A 1GI5A 3TGIE 1DY9A 2ANWA 1HFDA 5T6DA 2OC7A 4CRGA 4OS5A 1YP9A 1IQEA 1UCYH 1BMNH 1CSOE 2D2DA 2VIDA 2Z94A 5BPEA 3BIUH 3A81A 4RKJB 2P8OC 3GY3A 1JOUB 1KXBA 1O2TA 1XKBC 3A8AA 4FUBA 1Y3UA 2HGTH 1BTZA 2VIWA 4Y0ZE 1LMWB 2ODYB 1GG6C 1SFIA 4O97A 2FESH 2FZZA 1O2ZA 1G2LA 2VWMA 1V2ST 1EX3A 1TGBA 1G9IE 5HXFA 4WY3A 1HJAB 1NFUA 2B7DH 1HAOH 1P05A 5C3NA 1GI3A 4NCYA 5DP3A 4AG2A 1J16A 2Z6BD 3HK3B 1DITH 4CRFA 1WAYB 1KTTB 3LJJA 4UE7H 4X6MA 2AFQB 2HVXA 1QQ4A 5A0CA 4D8NA 3A83A 1C9TA 4O3TA 3MTYA 1P04A 4D7FA 4AOQA 2QGRA 1LPZB 1AN1E 1O36A 2AMPA 1AZ8A 3RXCA 3SNAA 3LGWA 1W11U 2V0BA 1K1LA 1C5PA 2ZU4A 2BD2A 1S82A 1OP8A 1T8MA 2FI3E 2V35A 2PGBB 5FX6A 4THNH 2VNTA 1CA8B 3SORA 1GDNA 2GP9B 1G36A 3LKWA 1YBWA 1GI7B 3FP6E 3JZ1B 3MH4A 3SV2H 4B1TA 1FN8A 3A7XA 2Y7ZA 1C5SA 1GJ9B 5A2MH 1TAWA 2ZPRA 3RC6A 1UTNA 2BDIA 2ANYA 2G55A 3PTBA 1GCTB 3EAJA 1BRCE 2Y5GA 4A1TA 1DWBH 1TWXB 1C5ZB 1MKWK 4A7IB 4B75A 2R2MB 1QL9A 1THPB 4BTTB 4UD9H 5E2PA 2G5NA 8GCHF 1SLXB 2BM2A 2DUCA 3Q3XA 4MDSA 1AFQC 1CGJE 1QTFA 1MZDA 1XVOA 4PROA 3MO3A 2ZDVH 2A2QH 3SJ8A 5JYIA 3K2UA 3LONA 1P2KA 1QFKH 2JETB 5C5NA 1PPEE 1SGCA 2G81E 1KTSB 2M5TA 4X8UH 1P12E 3U8TH 5JBCS 1O2WA 5E2OA 1HAPH 1YPHC 3K6ZA 3B9FH 1SGFA 3QTOH 4BANB 2BB4A 4NA8A 1N6XA 1GHBF 3UREA 1RIWB 5LPRA 4M7GA 3WY8A 2GD4B 1OWEA 1KDQA 5T6GA 1O5DH 1XUGA 1GHBG 3LGIA 1O38A 4IW4E 1ELGA 2RCEA 3QN7A 5EPNA 3U1IB 1BBRH 1Z6JH 1A5GH 1LHEH 1G3CA 2AERH 2BQ6B 1FLEE 2QXJA 1O3GA 1TRNA 2GX4A 1W14U 1DXPA 2HLCA 1P9SA 2Y7XA 4FUDA 4U30A 4X2YA 4IN2A 1GDQA 4OS1A 3PLPA 1NPMA 2YNAA 4YOIA 1NESE 3KQBA 2C4FH 3F6UH 3SNEA 1O3EA 1ZPBA 1GJ7B 2GDDA 1JXPA 4AGKA 2OQUA 4A92A 5IYTA 4FVDA 1SOZA 3QZRA 1AKSA 1GGDC 1SLUB 1QRXA 3LGTA 2TBSA 3U69H 1ZLRA 2FOEA 4IS5A 4YZUA 4MNVA 2BY6X 1DWCH 1HAHH 1IQGA 4Y10E 4FUIA 4DJZB 4NSYA 2A31A 1BCUH 1ELEE 1MTSA 1YCPH 2DE8A 8LPRA 2O8WA 2BTCE 1HBTH 4YOJA 2ZCLP 3EE0B 4KTUA 2BY8X 1O33A 2ZU3A 1BB0B 1NROH 3E1XB 1SQTA 1ANCA 1SOTA 1LHCH 1S6HA 2BZ6H 4SGAE 4GPGA 2BD9A 1FXYA 1UVUH 4ZROA 5A8YA 3QWCH 3PO1C 4LXBH 1UJ1A 2ZTZA 2FLRH 3TJNA 4AB9A 1Y3VA 2FPZA 1B0FA 2BD4A 2QCYA 3ZZ4A 2BX3A 3RXLA 1KXAA 1LVMA 1YCPM 2SNVA 1GHZA 4D9RA 1ANBA 2THFB 1UTPA 4TYDA 1O3BA 3PMJA 3SGAE 2ZGCA 4JK5A 1CHGA 2VIQA 4ZMAH 3VB3A 1VCPA 2FS9A 5AFZH 3OX7U 1TLDA 3GY5A 3OSYA 3BG4C 1O2RA 1DS2E 1ESAA 1EKBB 4DIIH 3HKIB 4IMQA 3PMAB 1Z6EA 2J92A 5CHAB 1UVPA 5K0HA 1TA6A 2P94A 1N6YA 3ZVCA 2C8XB 2R3YA 3MFJA 3SO3A 1BTXA 4FUEA 1TGSZ 2ANKH 5A8ZA 1ORFA 4K1EA 3KIDU 1Z8IB 1ZR0A 2WYGA 2HNTE 5T6FA 4IC5A 1GVLA 1JRTA 4BAQB 1AVWA 2FWWA 5DO4H 3RM2H 4BTIB 2C8ZB 1NM6A 1MKXH 5DK1A 3KGPA 6ESTA 1YLDA 3RXPA 4F4OC 3P8FA 4KTSA 1NTPA 3DA9B 5GDSH 2OQ5A 1DX5M 1DE7H 3SU6A 1TPSA 3EYDA 1V2OT 3V0XA 1IHSH 2BDBA 1DT2A 4LK4A 1O2MA 2VIOA 1D9IA 3A85A 1HIAB 1PYTC 1QRWA 3F68H 3HKJB 1AUTC 2BYAX 1A0JA 3ZZ6A 2XBWA 1QB1A 5L6NH 4B74A 2Q6GA 4Q7ZA 4RN6A 4DT7B 1C1TA 4Y11E 1QJ1B 3MWIU 3U98H 4CHAC 1O2XA 2P93A 1MH0A 3TJOA 2J94A 1O3DA 2AEIH 3ODFA 1GVKB 3P8OA 3GCTG 4ISNA 4WJG2 1O5AB 1W10U 1NT1A 2ZQ2A 4NFFA 4LOYH 5GCHF 3BEIB 3M5LA 4DURA 2J9NA 1EATA 1EUFA 1VJ9U 3T29A 3MU8A 2EC9H 1O2IA 1W13U 1L1NA 5FPSA 1C1QA 2FLBH 1BMLA 4MNYA 1V2LT 3T25A 5F6MA 1ZHMA 3M7QA 1MUEB 3Q3YA 7GCHF 3SN8A 2BLWA 2Z9KA 4AG1A 1O2KA 4CRBA 2CJIA 4IGDA 7GCHG 2STAE 2B9LA 2H5CA 4ABBA 1GI8B 2VVVA 4RSPA 3URCA 2J95A 1K1OA 1W7XH 5AFYH 3SHAH 1LDTT 3I77A 2R0KA 3S69A 3TJVA 2ZKSA 4MVNA 1MAYA 3DFJA 3VB4A 1O3FA 2IOTA 1PPFE 1NFYA 3PLKA 5F8TA 3S0NA 3KCGH 4E05H 1G32B 1SGIB 5EW1H 1PQ8A 1J14A 3QGJA 1Z8RA 1L0ZA 3SU3A 5GIBA 3V7TA 1FONA 2AGIX 4AFUA 3S9CA 1A5HA 1D3TB 3SNBA 1TRMA 5J4SA 1ABJH 3BTME 3SU0A 4LZ1H 1W8BH 1EZUC 7LPRA 3HPTB 2ZHFH 4XSKU 1K21H 3A8BA 1BIOA 1V2VT 5FBEA 4YM9A 1MTNB 1AQ7A 1JRSA 3CS0A 4TWWA 2IJOB 1GBHA 3VFEA 1DSTA 1O5EH 2GMTB 1LCYA 2BDCA 1O31A 3UR9A 2OD3B 2G4UA 1O3OA 3SU2A 1O3NA 2FODA 5HYOA 3A7ZA 2HNTC 5L30H 2ULLA 3MH7A 2XC0A 2ZHQH 2ZDMA 1QURH 1GI6A 3AAVA 1Q3XA 1BQYA 1C5XB 3D62A 4ZHLU 1KLJH 1VGCC 2J4IA 1FI8A 3PMHB 2OCVB 2Z3CA 5B6OA 1MTUA 2CGAA 1O2SA 2BZAA 1O2LA 3GCHC 2A7CA 4H42U 4WH8A 2NU3E 1N1LA 1NY22 1EPTC 2TGPZ 1IQMA 1KLIH 2TGTA 2GGVB 5F8ZA 1XM1A 4ZHAA 1MQ6A 2BD8A 2A5IA 4MPWA 3EQ0H 3FANA 4AB8A 3SJKA 1EP6A 1O30A 1SC8U 1TPOA 3RXSA 1XUHA 2CMYA 1F0TA 2ZFQH 3RU4T 1P0SH 3D65E 4NA9H 4K8BA 1AFQB 2OC0A 4WXVA 1E34B 5TCAA 2P16A 1UO6A 1L1GA 2G52A 3CP7A 5K7RA 2W26A 3ZZ5A 1GI0A 2WV4A 2ZFTA 2PKAB 3BEUA 3DT0H 1QCPA 2G4TA 2HPQH 3QO6A 2B5TB 3TU7H 2D8WA 4KP0A 5FPYA 2A7HA 2YOLA 1FZZA 1GBFA 1THSH 2BMGB 2TPIZ 1MZAA 1H8IH 2GTBA 2F9NA 1OX1A 1Y5UT 3L6PA 2GVFA 5DP7A 1P2QA 1VR1H 4TY6A 1HV7A 1UVOA 1NRPH 1P06A 1Y5AT 1BJVA 1NO9H 1FQ3A 1KY9A 4HI3A 1GHXH 1OYQA 4JMYA 1GPZA 1ZTLA 4ABHA 2ZQ1A 2NU2E 2TGAA 2AGGX 3GYLB 5A0AE 4AFSA 3UWIA 1Z1IA 5C20A 1Z8GA 3S7KB 3P92A 1CT0E 4DGJA 3M7TA 4LZ4B 1ZMNA 4NSVA 5EXLA 1SHYA 1XXDA 1HLTH 4FU7A 3RUOA 3SZNA 1CGHA 4DOQA 1O2JA 2D26C 4UFEH 4ZXYH 1P10A 1N8OB 1O3JA 3BTFE 4JZIA 1V2NT 5F8XA 4VGCC 3QLPH 2RDLA 1CA0C 2FOGA 1GGDB 1SI5H 3KQCA 4AGJA 1C9PA 2EI6A 1MCTA 1S6FA 4TY7A 1V2WT 2CF9H 1LHDH 3RXIA 3V13A 1WYKA 1W7GH 3AW0A 1PPGE 4ZKRU 4TPYA 1C1PA 1XUFA 4ZHMU 1P2IA 1QJ6B 5GWZA 4JYTA 2XWBI 1OSSA 1BTUA 2FO9A 3RDZA 1IQJA 2GV6A 1O5CB 3A8CA 4HTCH 1TX7A 1V2KT 2PLXA 1HAXB 3U9AH 3T5FH 4CRCA 4BAKB 2BXTH 1AVGH 1C5QA 3SUGA 3KQDA 1CBWC 2NU0E 3BTGE 1P57B 1XKAC 2EI8A 5DP5A
chains in the Genus database with same CATH superfamily
1GBBA 3M7UA 5BRRE 3ODDA 3KQ5A 4HZHA 1F0SA 1BHXB 2ESTE 5DJ7A 5EQRA 1AB9B 1AE5A 1QJ7B 2FOBA 3GICB 1VITH 3UWJH 2R2WU 3LGUA 2XCFA 4O03A 1FMGA 1RXPA 2F4LA 5EOKA 4BXWA 2W5EA 1JIRA 2A5KA 2WPMS 1D4PB 3P8GA 2O9QA 3M3VA 2BLOA 5DSFA 3OY5U 1P3CA 1V2MT 3GISB 5HM9A 3E3TA 1FY5A 5TCCA 5LPEA 3GDSA 3M5MA 2CHAC 2F9OA 3ITIA 4RI0A 1TMUH 3F2FA 2AMQA 2FYQA 3BG4B 3RP2A 2F9PA 2RA3A 4I8LA 4ABDA 3OY6U 1SHHB 6CHAC 4XBDA 5CMXH 4X2WA 1UCYK 2PKSB 4UFDH 2PV9B 3HGPA 2RDEA 1YM0A 3TIUA 1EAXA 3RLYH 4FXGH 2WV9A 4A6LA 2BXUH 1V2RT 4AORA 1PPCE 1J8AA 3AW1A 4ISOA 4GUXA 3Q77A 3LH3A 2BVSH 2HRVA 1S5SA 2TGDA 1TGNA 2C3SA 4XD7D 1GBIA 1HAVB 1OWHA 3RXEA 1SSXA 5C1UA 1GI2A 3F9GA 1G37A 1TNIA 1RTFB 1EQ9A 1WUNH 3ATLA 1AMHA 2ZEBA 2G00A 2EA3A 1O0DH 4X8VH 4NIWA 2XOKD 1FN6A 2FOFA 3E16B 1O3PB 1O2GH 3EA7A 2J98A 2V3OH 1K1PA 3MO6A 5DP4A 3F9EA 3RXOA 5DP9A 1A5IA 3ZZAA 2F9VA 4I8HA 2W3KA 4U2WA 3C27B 2OTVA 1MD8A 1A4WH 2QXGA 2KM0A 3BTTE 3OE7D 4CH2B 3ZV9A 4NA7A 4U01A 1SB1H 6GCHG 3MU4A 2UUYA 3P6ZB 4FUCA 2W6ID 3O8DA 1TIOA 2A7JA 4AX9H 4JYVH 3RMLH 2OINA 2TIOA 2OXSA 3MO9A 1GBTA 1O5GH 2VH6A 1P03A 3OYPA 4J1YA 3SUFA 3D49H 4INKA 1GL0E 2PSXA 4AZ2B 2ZDLA 1A0HB 2ZPQA 1ZPCA 4CRAA 1DSUA 4E7RG 2ODPA 4FU9A 1P2MA 4ZKNU 5DG6A 1QHRB 2ZC9H 2XWAA 2GZ9A 3PV4A 4ABIA 3ZZDA 3SZEA 1SLWB 1C5YB 5EG4A 2BOKA 4WMFA 4X2VA 1S6LA 3NPSA 3JZ2B 3F3BA 4CRDA 4DIHH 1BTHH 2BDAA 4Y8XA 1V2UT 4RT1A 1HDTH 1GMHG 2KCPA 1Q2WA 3O8RA 1DWEH 1AIXH 1V3XA 3UIRA 4B73A 1L2EA 1B5GH 2QE7D 3ZV8A 5EODA 2SGPE 3P8NA 2ZO3H 1H9HE 4ABEA 1TYNA 2ZTXA 1HAIH 3RXKA 1UK2A 3GY7A 3VGCC 1BMAA 5C2ZA 5C0UA 3CNRA 2BY7X 1PPZA 4FETA 1KIGH 1K1IA 1MQ5A 1HAYB 1HJ9A 2A4RA 1UVTH 3O8BA 2A2XH 1AWFH 4DVAU 2ZFFH 3E6PH 4H6TA 1NFXA 2GCHG 4ZAEA 3RC4A 1AO5A 2BOHB 3A7WA 4Y6DA 1D6RA 4CR5A 5FXLA 4B2BA 4WH6A 3F0PA 2FI5E 1O2NA 1FPCH 1QY6A 4K5ZA 3DD2H 1BBRK 1LQDB 5E8EH 3RC5A 1ZYOA 3S9BA 2PKAA 4E7NA 1TNGA 3K65B 1MBQA 1IAUA 3E8LA 4I8KA 2ILNA 1UTOA 1GHYH 4ISHH 1ZOMA 1A3BH 3DFLA 3TH3H 2BDGA 2SFAA 2XRCA 2CF8H 1F7ZA 3FKSD 3N7EA 1C1NA 2TRMA 1EJAA 3LGVA 4MNWA 1FIZA 3EDXB 1WQSA 1CU1A 2QIQA 3RXBA 3RMOH 1DM4B 1O3AA 1Z7KA 3SGBE 4F55A 3NZIA 1A46H 1EPTB 1GJ5H 7KMEH 1TB6H 1CQQA 4GSOA 1W3CA 1ARBA 5B6LA 5L2ZH 4X1PU 3GCOA 3DHKH 1Z71A 1YCPK 2YMSB 4YESB 2STBE 5C1XA 1ETSH 4BAOB 1ARCA 1ZHRA 4K1SA 4ZUHA 3DSGA 3A84A 4Y7AA 1GL1A 1HJAC 1Y8TA 1HB0B 4FUHA 4AFQA 4DW2U 2CXVA 2Q1JA 3AASA 2W6JD 3ESTA 4UFFH 3URDA 3LGYA 1MTWA 4WF8A 1AZZA 1C1OA 3L33A 1G30B 4NGAH 2WYJA 3BV9B 5JB9S 3RXMA 1GI9B 3QX5H 2F9UA 1HCGA 2UWLA 4NWKA 3H5CB 1P2NA 2OLGA 3UQOA 1CO7E 2ZCHP 2FIRH 4ZH8A 1C5VA 2Z3DA 1E38B 2O8LA 1XUJA 3UR6A 1C1SA 1WCZA 1ZSLA 1BHXF 4I31A 1QL8A 2P59A 2BDHA 4X0WU 1YC0A 2UWOA 3LC5A 4BOHA 1KXEA 4Q80A 2W7UA 2ZIQH 1DDJA 1V6DA 4B71A 1L4ZA 4Y7BA 4XDEA 4BAMB 2XC4A 1BTYA 1C5NH 1E0FD 3GCTF 3TPIZ 3PTNA 4BTUB 3SJ9A 2FTMA 1O3CA 5JB8S 3RLWH 5HGGA 1QQUA 1ELVA 2PFEA 1T4VH 1GI4A 3KF2A 3OAAD 4GHQA 2ZGJA 1ANDA 3BTHE 5EQQA 3BIVH 2SGFE 1GCTC 1C1WH 4VGCB 1TA2A 5C0TA 2WPJS 1AGJA 5J4QA 1DLEA 1H8DH 1NRRH 4ZXXH 1P02A 4WWYA 1MKXK 3FVFB 1HRTH 1B7XB 2W3IA 4ASHA 1FX0B 4JZEH 2BHGA 4I7YH 2VJ1A 5GPIB 8KME2 1FNIA 2IJD1 2GCTB 2HLDD 1FPHH 5ETXA 1UW7A 1ID5H 1SVPA 1Y3WA 3RXTA 4HGCA 3SU4A 3NKKA 1NFWA 2ZWLH 1UTMA 1Z8JB 1ABIH 2QAAA 1FAKH 4K1TA 4AC9A 3BF6H 4IMZA 1DUEA 1EAWA 3KN2A 3ZZ3A 1JMOH 2P8OB 3KQEA 2FTLE 1HAVA 2VIVA 5PTPA 1J9CH 1G3DA 1O39A 2F3CE 1S84A 1RIWC 2FX4A 1WBGB 2UUJB 3OTPA 2C93B 2AMDA 1GJBB 4GCHG 3ZVFA 1GG6B 2WV5A 3F9FA 3FAOA 1GHVH 1RTLA 3MNBA 2WPKS 1YPEH 3PB1E 3U8RH 4MPUA 2JDID 1C2GA 1GVZA 3EE7A 1ELDE 1BDAA 1KXFA 2R0LA 1GMCF 4FUGA 1IQLA 1QB6A 2ZPSA 3QDZB 2PSYA 1YF4A 1C1UH 2K8IA 1SPJA 1GMCG 1T32A 5FBIA 2ZZUH 1YY3A 1NN6A 2ZU5A 3U28C 1Y59T 1T8OA 4OGYA 1ZHPA 1W0KD 2LELA 1MCVA 1LO6A 2FMJA 3LT3A 1GBCA 1GJAB 1A3EH 2ZGHA 3OTJE 4BNRA 3HK6B 2FM2A 6CHAB 2F9BH 1RD3B 1IHTH 9LPRA 1C2LA 1K9OE 2OUAA 1FDPA 1E1RD 2H9EH 5I46H 1DUAA 5FCKA 1FJSA 5TJXA 4NZQA 4D76A 3RXGA 4GHTA 4GLYA 3ZVGA 4B2CA 1F5RA 3VEQB 3M37A 4NFEA 4UEHH 1NS3A 3ZVAA 2VVCA 1P01A 1BT7A 1C1RA 3P70B 3T2NA 2VWNA 1OXGA 1ELBA 1KLTA 1HXEH 1UK3A 3B23B 1AVXA 1EZXC 1ZSKA 2H9HA 2PGQB 1XUKA 2KCAA 1BTWA 2HALA 2NWNA 5T1VA 1K2I1 1DPOA 5DKMA 3VXEH 1C4U2 3TJUA 2WPLS 4JZ1A 2P3UB 2Y5FA 4XE4A 5A09A 1DY8A 2AIQA 1O5FH 2WHXA 4B76A 1BA8B 1ZZZA 2F91A 2OP9A 1E36B 1ZRBA 1C4V2 4X8SH 1GDUA 1TRYA 1C5UA 1TBQH 1ZJKA 1OWIA 3T62A 1WV7H 1RRKA 5CE1A 3L3TA 2R3UA 2A4OA 1MU6B 5HM2A 3V3MA 4FUJA 1S83A 1KYNA 3A82A 1EZSC 4Z0KA 1QA0A 2GT8A 1NRNH 4OGXA 1D3PB 3QK1A 1AKSB 3RM0H 1QL7A 2QF0A 3SI4H 4XOJA 2QC2A 2BX4A 1ZTKA 1B0EA 1FY3A 1C2IA 3BTWE 3EGKH 3M3TA 5LPFA 1QBVH 4TPIZ 4YLUA 1QIXB 2H2ZA 5CHAC 2AGEX 3SQHE 2OBOA 3A7VA 3PROA 1F0UA 1DWDH 3FZDA 3K9XB 5FX5A 1DXWA 2RG3A 2ZG0H 4HFPB 3SUEA 1ELFA 3SHCH 1ZTJA 1WOFA 1C2FA 2FX6A 2JH0D 1BMMH 1P8VC 1K1NA 3NK8A 5AVDA 4OS4A 3ZZ9A 3SGQE 1P2OA 3QTVH 2HOBA 4ABJA 5DP6A 2O8UA 2V3HH 3A80A 3W94A 3AK5A 5FPTA 2GT7A 2IPHA 1O3MA 4O9VA 3SV6A 3WWBA 1EAUA 5E0GA 2QXIA 2QA9E 3M3SA 2ODQA 2AIPA 3OU0A 1XVMA 3VGCB 1O35A 1V2QT 2ZNKH 4X1RU 3A7YA 4I8GA 2EEKA 3LPRA 1HPGA 1O2VA 1FY1A 1GBAA 3KEEA 4ZCNA 3F2HA 3IG6B 1O2QA 4UONA 1H4WA 4ABAA 4YT6H 3PM3A 1DANH 4A1XA 3SW2B 1Y3YA 1SGPE 2H1UA 1UTKA 3UOPA 3ATIA 3SJIA 2Z9LA 3PRBA 1DOJA 2P3TB 3QGNB 1P3EA 4CR9A 2SGEE 2NU1E 1OWDA 2VWLA 3MU0A 2Y80A 2HVYB 1BOQA 1V2PT 1CE5A 1TNJA 1SL3A 1GHAF 2A32A 1L1JA 3PMBB 3S9AA 3UPEA 4X6NA 2ZU1A 3PYHA 5I25A 3BSQA 4YT7H 1GBDA 2P3FH 4ABGA 2XBVA 4FUFA 1GHAG 1C5OH 1C2JA 1C5RA 1O37A 2WINI 2YMSD 1YPGH 2BY5X 3A8DA 3GY8A 1GJ8B 3RXAA 4IBLH 1XX9A 1L4DA 3AVZA 3CENA 3PO1B 2FI4E 4CBNA 3M36A 1COWD 2BVRH 1OS8A 1QRZA 3SI3H 5FCRA 3E0PB 2BVXH 3SNCA 2VINA 4WXIA 5IK2D 1XXFA 5C5OA 1HIAA 4E06H 1C2KA 1EOLA 4MPXA 1CT2E 2Y82A 3RXUA 2JKHA 4F49A 4MTBA 4D9QA 1G2MA 3BTEE 2H5DA 4X1QU 1BRUP 3LDXH 1ELAA 3H09A 2ZECA 2KCYA 2FP7B 4O3UA 1S81A 1SBWA 2XCNA 3Q3KA 1TMBH 1HYLA 1LQEA 3V12A 5G4BA 2GDEH 1TFXA 1A2CH 1JBUH 1UTJA 1O5BB 3STJA 1W0ZU 1M9UA 1WTHD 3SNDA 4B2AA 1GCDA 3STIA 1Y3XA 2A5AA 1AHTH 1DICA 1G3BA 2I6SA 4R0IA 4AYVB 1MTNC 2QN5T 4FOUC 2UUKB 1O2YA 1MMJN 3GOVB 4MG3A 5A8XA 3R3GB 2GMTC 1A1RA 1MKWH 1SQOA 1O3HA 2ZF0H 3ELAH 1LVOA 1FAXA 4X8TH 1ETRH 1OP0A 2SGAA 1EOJA 1C5LH 3LOXA 4DG4A 1C2HA 2V7QD 3KL6A 1MD7A 2AS9A 1WQVH 3SV8A 1NU9A 2KZ4A 2UWPA 2QXHA 3UNSA 1IQIA 1CGIE 4JZDH 1GI1A 1UHBB 1FY4A 1AI8H 4U32A 2ZDKA 3BTQE 1ANEA 2BLQA 6GCHF 3Q00A 3T28A 4NWLA 7ESTE 4NIYA 1PQAA 4CHAB 1S0RA 1RTKA 1MTVA 2KCOA 5EQSA 3F1SB 1NZQH 1UTQA 1TNKA 5GNDA 1K22H 3OEED 2ZI2H 2ZA5A 2FOCA 1X7AC 2QY0B 3WW7A 1O2PA 1SGYE 3LIWA 1MAXA 1GJ6A 3MOCA 3WWFA 1C1MA 1GBKA 2F83A 5L2YH 2G51A 1UCYE 1PPBH 4ISIH 4Y71A 5H4IB 3NUMA 3HGNA 2OC1A 1PQ5A 2Y6TA 3A7TA 3PWCA 2QYIA 1SGNE 5JBBS 3MHWU 1E35B 1GBLA 3MH5A 8GCHG 2ZCKP 1PPHE 4RKOB 4IN1A 1GJDB 2HPPH 1TBRH 6LPRA 2GZ7A 3NXPA 1O32A 2AYWA 4ESTE 1TONA 1GBEA 2Y5HA 3RU4D 1EZQA 1GMHF 2Z3EA 3DSOA 2GJGA 1VZQH 1GMDF 1A61H 3TNTA 3A89A 2PHBA 2KR7A 1SGFG 1GMDG 3P95A 2R9PA 1HNEE 3VB6A 1HJ8A 4DT4A 1TNLA 4AYYB 3BTKE 3GY4A 1Y5BT 2QF3A 1J15A 1BJUA 1T4UH 2GZ8A 2PP6A 4NZLA 5EPYA 1DLKB 3DUXH 5E0HA 1EAIA 2GCHF 8ESTE 1ZSJA 4AN7A 1AUJA 1F5LA 1H9LB 3CS7A 3R0FA 1LVYA 3A86A 3TITA 1YLCA 5C67A 1H9IE 4UDWH 2JH6D 2SNWA 1GJCB 2VGCC 2ZU2A 4H6SB 2XYAA 2ZHWH 2FOMB 5LGOA 1PQ7A 1YPKH 4MLFB 4Q7YA 1NC6A 4KTCA 2JIZD 4A1VA 2J38A 1N8OC 1TABE 2BQ7B 2IN2A 3D23A 5HKKD 2VIPA 1C5WB 3F9HA 2FXRA 2H6MA 3ZZCA 2WPIS 2Z9JA 3A88A 3I78A 1OYTH 3UUZA 3N99A 1H1BA 1HGTH 1RJXB 1QR3E 1CVWH 1ETTH 4F48B 1C2DA 1P9UA 2Z7FE 3VB5A 1K1MA 2OBQA 1AD8H 4X1SU 4NIVA 3QUMP 1NRSH 5AHGH 1BTPA 1AY6H 3PLBA 1VGCB 1C5MD 4YTAA 3GYMA 4MPVA 1AFEH 4OS6A 3MNCA 1U6QA 1SQAA 3GCHB 3RXRA 3TNSA 2A45B 2O8MA 5JBAS 2V6NA 4NIXA 1GHWH 2ALPA 4R8TB 3ZYDA 1EJNA 3LC3A 4BAHB 2Z9GA 1HAZB 1TOMH 1TNHA 2RA0A 3MYWA 2XXLA 5GJ4B 3RXQA 3C1KA 3GDVA 3ATWA 1AB9C 1WSSH 2PTNA 4DY7B 3GS9A 2XBYA 2GV7A 3ZZ7A 3EA9A 3T27A 1W2KH 1AU8A 1O3LA 4ISLA 4Q4LA 3FP8E 1TX6A 2W7SA 1SGTA 4NG9H 1EJMA 3ZVDA 5LH8A 4CBOA 1YGCH 5A0BA 2BD7A 4J2YB 3EA8A 2FOAA 2BLVA 3GDUA 1LKAA 1GBMA 2A0QB 1C2MA 2XNIA 1CHOF 5T3HA 2KAIB 5ABWA 2H9TH 3ZZ8A 4BXSA 5EXNA 1BBRE 2FS8A 3UFAA 1EB2A 1CHOG 4OS2A 1T8NA 1O2UA 3MH6A 2PKSC 1GWAA 3PV2A 3SU5A 1IQHA 1TPPA 3G01A 4FU8A 4RT0A 2Q6DA 2ANMH 2PWXA 3O8CA 5JPMH 1A0LA 3VPKA 1FV9A 4ASUD 1EXFA 1MBMA 1THRH 2KFWA 4IC6A 2VVUA 3GY2A 4AFZA 1SR5C 2ZGBH 3W95A 2BD3A 2ZHEH 3UY9A 4CREA 2FYRA 1FIWA 2BD5A 4GVUA 1TGTA 1UVSH 2FEQH 1IQNA 1TQ7B 1WU1A 2SGQE 3FZZA 1P09A 2C8YB 2WPHS 4ABFA 3E90B 2I6QA 1ESTA 1CT4E 2XTTB 3DSPA 3RMMH 1RFNA 1FUJA 2WPDD 4K60A 4FVBA 4Y8YA 2ZGXH 3I29A 4Y79A 1EASA 5AF9H 4INHA 3SU1A 1CA0B 1VJAU 3FO8D 3H7OA 3UB0A 4X1NU 2ZTYA 2ZFPH 4ZKSU 3NCLA 1BRAA 1ESBA 3ZYEA 1TE0A 4YOGA 4X6PA 1OKXA 1ZGIA 1F2SE 3FP7E 1SLVB 3MNSA 1SG8B 1F0RA 1LHGH 1QGFA 1VITF 3BG8A 1O3KA 2J5UA 3PWBA 3K6YA 1TPAE 2DE9A 4X2XA 2YNBA 3P17H 1TQ0B 1VITG 2PR3A 2JETC 1TBZH 3ZVEA 1G3EA 1XUIA 3MU1A 4DCDA 4MNXA 1YPLH 1F5KU 5GCHG 4INLA 1UMAH 2BQWB 1CBWB 3M61U 2ZDAH 3RXHA 2ZP0H 1FY8E 4YO9A 4GCHF 1T8LA 1VCQA 2VWOA 3IWMA 5DPAA 4JZFH 4KELA 2PTCE 2C90B 3PV5A 2JH5D 1GBJA 3MI4A 2Q6FA 3ZZBA 1BITA 4Q2KA 3U8OH 1P11E 2ASUB 3TK9A 4JYUH 3E0NB 2LNCA 2K0QA 3HATH 2FDAA 1LVBA 2BY9X 3SUDA 1NU7B 1S85A 3N7DA 1O34A 1XMNB 1Z1JA 1P2JA 3TGJE 1WXRA 2C8WB 5ESBA 1UHBA 2XW9A 1MU8B 1ELTA 2PW8H 3BN9A 1IQKA 2J98B 5F03A 2NU4E 4CH8B 2GKVE 4QT8C 2WUCA 2CHAB 4K3JA 1ZPZA 1C5TA 3FOAA 1OWKA 2A4QA 4D7GA 4Z6AH 2G5VA 1PFXC 4A5TS 4H4FA 2ZFRH 1DVAH 3TVJB 3N7OA 4I32A 3MMGA 1UK4A 1ZMLA 1KSNA 1SGRE 1WTGH 5HIYA 1PYTD 1ELCA 1BZXE 4SGBE 2EI7A 2O8TA 1OHHD 3A87A 1F92A 1OP2A 3Q76A 1KXDA 1RS0A 1GJ4H 4WVPE 1AWHB 5EXMA 2Z9IA 2ZHDA 1OOKB 5GXPA 5C1YA 1YPJH 3TLOA 1D3QB 1TOCB 5EW2H 4JCNA 1K28D 2VU8E 1W0YH 1T7CA 1AE8H 1VCWA 3BTDE 3TK5A 2ZDNA 1PJPA 2XBXA 1O2OA 1KDQB 5E0JA 5EJLA 1C1VH 1SMFE 1ZGVA 3SV9A 1H8HD 3M35A 4Y0YE 1QB9A 3LH1A 3RMNH 4JK6A 1W12U 4MQAA 3AAUA 3FFGA 2P95A 2SGDE 1QA7A 3KNXA 1D3DB 3KYGA 3SJOA 5SGAE 2B0FA 1LKBA 2QV1A 2AH4X 3SQEE 2PUQH 2CN0H 3GCNA 3RXFA 5FHTA 1ZMJA 1EB1H 1ZRKA 2J2UA 4KGAA 3NRLA 1V2TT 1QNJA 2WUBA 1BUIA 3BEFB 3QZQA 1J17T 1TX8A 1SQRA 2ALVA 3KYFA 1RGQA 3RU4E 1HAGE 3RXDA 3U1JB 3RXJA 2OC8A 2Y81A 2YMSC 3MU5A 3TK6A 1IQFA 1O2HA 5EGMA 3ENSB 2J34A 3H7TA 3UQVA 3KHVA 3UOUA 1TALA 2A4GA 4I33A 3LU9B 3NWUA 1HXFH 2B8OH 3ATKA 2HWLB 1LPGB 1O3IA 2HNTF 1OWJA 3UTUH 4YLQH 4B6EA 3S7HB 1HUTH 5HMAA 2FOHA 5IDKA 3SBKA 4UFGH 1SFQB 1DFPA 1YWUA 2K1QA 4KKDA 4X6OA 5FAHA 3IITA 9ESTA 1D6WA 3LJOA 2PUXB 1T31A 3M5OA 1SGEE 4ZKOU 3M5NA 3SOSA 3VB7A 2BDYA 2LPRA 1YYY1 3TH4H 1IOEA 3ATMA 4XBCA 3TGKE 5DP8A 4TWYA 3OEHD 1WDIA 2VB0A 4K69A 3RXVA 1LPKB 1EPTA 3DCLA 2VH0A 1EP5A 5DGJA 5JDUB 1YPMH 1LHFH 4I8JA 4WMDA 5CHBA 5ESTE 3GY6A 1SKYE 4WMEA 1SGQE 1TGCA 1JIMA 1UTLM 2CV3A 1K1JA 2UUFB 3T26A 2VGCB 1TMTH 4Y8ZA 4K8YA 2WSSD 1BRBE 3B8JA 4OS7A 1LTOA 3SV7A 1QBNA 3VXFH 2G8TA 4GAWA 1E37B 3UNRA 1KXCA 3MNXA 1ZJDA 4XBBA 2KAIA 5EU8A 2XC5A 1NRQH 1OPHB 1YPHE 4P00A 1S0QA 1V2JT 2ZFSA 2D1JA 1QBOA 5JBTA 2GCTC 3ZVBA 1YKTA 1KMHB 1C4Y2 3UNQA 1A7SA 1JWTA 4K2YA 3TH2H 1C2EA 2A1DB 4Q7XA 1ACBE 1INCA 4XFQA 3E91A 1SGDE 1Q31A 1GI5A 3TGIE 1DY9A 2ANWA 1HFDA 5T6DA 2OC7A 4CRGA 2RFKC 4OS5A 1YP9A 1IQEA 1UCYH 1BMNH 1CSOE 2D2DA 5F53A 2VIDA 2Z94A 5BPEA 3BIUH 4YXWD 3A81A 4RKJB 2P8OC 3GY3A 1JOUB 1KXBA 1O2TA 1XKBC 3A8AA 4FUBA 1Y3UA 2HGTH 1BTZA 2VIWA 4Y0ZE 1LMWB 2ODYB 2CK3D 1GG6C 1SFIA 4O97A 2FESH 4B6FA 2FZZA 1O2ZA 1G2LA 2VWMA 1V2ST 1EX3A 1TGBA 1G9IE 5HXFA 4WY3A 1HJAB 1NFUA 2B7DH 1HAOH 1P05A 5C3NA 1GI3A 4NCYA 5DP3A 4AG2A 1J16A 2Z6BD 1H8ED 3PRDA 3HK3B 5CDFE 1DITH 4CRFA 1WAYB 1KTTB 3LJJA 4UE7H 4X6MA 2AFQB 2HVXA 1QQ4A 5A0CA 4D8NA 3A83A 3VG8A 1C9TA 4O3TA 3MTYA 1P04A 2WZQA 4D7FA 4AOQA 2QGRA 2F43B 1LPZB 1AN1E 1O36A 2AMPA 1AZ8A 3RXCA 3SNAA 3LGWA 2EQNA 1W11U 2V0BA 1K1LA 1C5PA 2ZU4A 2BD2A 1S82A 1OP8A 1T8MA 5KECA 5KEDA 2FI3E 2V35A 2PGBB 5FX6A 4THNH 2VNTA 1CA8B 3SORA 1GDNA 2GP9B 1G36A 3LKWA 1YBWA 1GI7B 3FP6E 3JZ1B 3MH4A 3SV2H 4B1TA 1FN8A 3A7XA 2Y7ZA 1C5SA 1GJ9B 5A2MH 1TAWA 2ZPRA 3RC6A 1UTNA 3SYJA 2BDIA 2ANYA 2G55A 3PTBA 4OM9A 1GCTB 3EAJA 1BRCE 2Y5GA 4A1TA 1DWBH 1TWXB 1C5ZB 1MKWK 4A7IB 4B75A 2R2MB 3W1EA 1QL9A 4M9FA 1THPB 5FL7D 4BTTB 4UD9H 5E2PA 2G5NA 8GCHF 1SLXB 2BM2A 2DUCA 3Q3XA 4MDSA 1AFQC 1CGJE 1QTFA 1MZDA 1XVOA 4PROA 3MO3A 2ZDVH 2A2QH 3SJ8A 5JYIA 3K2UA 3LONA 1P2KA 1QFKH 2JETB 5C5NA 1PPEE 1SGCA 2G81E 1KTSB 2M5TA 4X8UH 1P12E 3U8TH 5JBCS 1O2WA 5E2OA 1HAPH 1YPHC 3K6ZA 3B9FH 1SGFA 3QTOH 4BANB 2BB4A 4NA8A 2QF4A 1N6XA 1GHBF 3UREA 1RIWB 5LPRA 2LP6A 4M7GA 3WY8A 2GD4B 1OWEA 1KDQA 5KGOA 5T6GA 1O5DH 1XUGA 1GHBG 3LGIA 1O38A 4IW4E 1ELGA 2RCEA 3QN7A 1YLNA 4TT3D 5EPNA 3U1IB 1BBRH 1Z6JH 2L6OA 1A5GH 1LHEH 1G3CA 2AERH 2BQ6B 2QF5A 1FLEE 2QXJA 1O3GA 1TRNA 2GX4A 1W14U 1DXPA 2HLCA 1P9SA 2Y7XA 1VKYA 4FUDA 4U30A 4X2YA 4IN2A 1GDQA 4OS1A 3PLPA 1NBMD 1NPMA 2YNAA 5EJZA 4YOIA 1NESE 3KQBA 2C4FH 3F6UH 4HG6A 3SNEA 1O3EA 1ZPBA 1GJ7B 2GDDA 1JXPA 4AGKA 2OQUA 4A92A 5IYTA 4FVDA 1SOZA 4I86A 3QZRA 1AKSA 1GGDC 1SLUB 1QRXA 3LGTA 2TBSA 3U69H 1ZLRA 2FOEA 4IS5A 4YZUA 4MNVA 2BY6X 1DWCH 1HAHH 1IQGA 4Y10E 4FUIA 1W0JD 4DJZB 1K0HA 4NSYA 2A31A 3UAIC 1BCUH 1ELEE 1MTSA 1YCPH 2DE8A 8LPRA 2O8WA 2BTCE 1HBTH 4YOJA 2ZCLP 3EE0B 4KTUA 2BY8X 1O33A 2ZU3A 1BB0B 1NROH 5HIZA 3E1XB 1SQTA 1ANCA 1SOTA 1LHCH 1S6HA 2BZ6H 4SGAE 4GPGA 2BD9A 1FXYA 1UVUH 4ZROA 5A8YA 5C94A 3QWCH 3PO1C 4LXBH 1UJ1A 2ZTZA 2FLRH 3TJNA 4AB9A 1Y3VA 2FPZA 1B0FA 2BD4A 2QCYA 3ZZ4A 2BX3A 3RXLA 1KXAA 1LVMA 1YCPM 2SNVA 1GHZA 4D9RA 1ANBA 2THFB 1UTPA 4TYDA 1O3BA 3PMJA 3SGAE 2JJ2D 2ZGCA 4JK5A 1CHGA 2VIQA 4ZMAH 3VB3A 1VCPA 2FS9A 5AFZH 3OX7U 1TLDA 3GY5A 3OSYA 3BG4C 1O2RA 1DS2E 1ESAA 1EKBB 4DIIH 3HKIB 4IMQA 3PMAB 1Z6EA 2J92A 5CHAB 1UVPA 3FN8A 5K0HA 1TA6A 2P94A 1N6YA 3ZVCA 2C8XB 2R3YA 3MFJA 3SO3A 1BTXA 4FUEA 1TGSZ 2ANKH 5A8ZA 1ORFA 4K1EA 3KIDU 1Z8IB 4ACAA 1ZR0A 2WYGA 2HNTE 5T6FA 4IC5A 4ACBA 2J97A 1GVLA 1JRTA 4BAQB 1AVWA 2FWWA 5DO4H 3RM2H 4BTIB 2C8ZB 1NM6A 1MKXH 5DK1A 3KGPA 1EFRD 1YLDA 3RXPA 4F4OC 6ESTA 3P8FA 4KTSA 2OK5A 1NTPA 3DA9B 5GDSH 2OQ5A 1DX5M 2EY4C 1DE7H 3SU6A 1TPSA 3EYDA 1V2OT 3V0XA 1IHSH 3F0OA 2BDBA 1DT2A 4LK4A 1O2MA 2VIOA 1D9IA 3A85A 1HIAB 1PYTC 1QRWA 3F2GA 3F68H 3HKJB 1AUTC 2BYAX 1A0JA 3ZZ6A 2XBWA 1QB1A 4Z1MD 5L6NH 4B74A 2Q6GA 4Q7ZA 4RN6A 4DT7B 1C1TA 4Y11E 1QJ1B 3MWIU 3U98H 4CHAC 1O2XA 2P93A 1MH0A 3TJOA 2J94A 1O3DA 2AEIH 3ODFA 1GVKB 3P8OA 3GCTG 4ISNA 4WJG2 1O5AB 1W10U 1NT1A 2ZQ2A 4NFFA 4LOYH 5GCHF 3BEIB 3M5LA 4DURA 2J9NA 1EATA 1EUFA 1VJ9U 3T29A 3MU8A 2EC9H 1O2IA 1W13U 1L1NA 5FPSA 1C1QA 2FLBH 2V3MA 1BMLA 3MQKC 4MNYA 1V2LT 3T25A 5F6MA 1ZHMA 3M7QA 1MUEB 3Q3YA 7GCHF 3SN8A 2BLWA 1E1QD 2Z9KA 4AG1A 1O2KA 4CRBA 2CJIA 4IGDA 7GCHG 2STAE 2B9LA 2H5CA 4ABBA 2M2AA 1GI8B 2VVVA 4RSPA 3URCA 2J95A 1K1OA 1W7XH 5AFYH 3SHAH 1LDTT 3I77A 2R0KA 4P02A 3S69A 3TJVA 2ZKSA 4MVNA 1MAYA 3DFJA 3VB4A 1O3FA 2IOTA 1PPFE 1NFYA 3PLKA 5F8TA 3S0NA 3KCGH 4E05H 1G32B 1SGIB 5EW1H 1PQ8A 1J14A 2KX4A 3QGJA 1Z8RA 1L0ZA 3SU3A 5GIBA 3V7TA 1FONA 2AGIX 4AFUA 3S9CA 1A5HA 1D3TB 3SNBA 1TRMA 5J4SA 1ABJH 3BTME 3SU0A 4LZ1H 1W8BH 1EZUC 7LPRA 3HPTB 2ZHFH 4XSKU 1K21H 3A8BA 1BIOA 1V2VT 4Q63A 5FBEA 4YM9A 1MTNB 1MABB 1AQ7A 1JRSA 1QZ8A 3CS0A 4TWWA 2IJOB 1GBHA 3VFEA 1DSTA 1O5EH 2GMTB 2VBCA 1LCYA 2BDCA 1O31A 3UR9A 2OD3B 2G4UA 1O3OA 3SU2A 1O3NA 2FODA 5HYOA 2AHME 3A7ZA 2HNTC 5L30H 2ULLA 3MH7A 2XC0A 2ZHQH 2ZDMA 3ZIAD 1QURH 1GI6A 3AAVA 1Q3XA 1BQYA 1C5XB 3D62A 4ZHLU 1KLJH 1VGCC 2J4IA 1FI8A 3PMHB 1E79D 2OCVB 2Z3CA 5B6OA 1MTUA 2CGAA 1O2SA 2BZAA 1O2LA 3GCHC 2A7CA 4H42U 4WH8A 2NU3E 1N1LA 1NY22 1EPTC 2TGPZ 1IQMA 1KLIH 2TGTA 2GGVB 5F8ZA 1XM1A 5EIYA 4ZHAA 1MQ6A 2BD8A 2JJ1D 2A5IA 4MPWA 3EQ0H 3FANA 4AB8A 3SJKA 1EP6A 1O30A 1SC8U 1TPOA 3RXSA 1XUHA 2CMYA 1BMFD 1F0TA 2ZFQH 3RU4T 1P0SH 3D65E 4NA9H 4K8BA 1AFQB 2OC0A 4WXVA 1E34B 2L74A 5TCAA 2P16A 1UO6A 1L1GA 2G52A 3CP7A 5K7RA 2W26A 3ZZ5A 1GI0A 2WV4A 2ZFTA 2PKAB 3BEUA 3DT0H 1QCPA 2G4TA 2HPQH 3QO6A 2B5TB 3TU7H 2D8WA 4KP0A 5FPYA 2A7HA 2YOLA 1FZZA 1GBFA 1THSH 2BMGB 2TPIZ 1MZAA 1H8IH 2GTBA 2F9NA 1OX1A 1Y5UT 3L6PA 2GVFA 5DP7A 1P2QA 1VR1H 4TY6A 1HV7A 1UVOA 1NRPH 1NBME 1P06A 1Y5AT 1BJVA 1NO9H 1FQ3A 4Y76A 1KY9A 4HI3A 1GHXH 1OYQA 4JMYA 1GPZA 1ZTLA 4TSFD 4ABHA 2ZQ1A 3OFND 2NU2E 2TGAA 2AGGX 3GYLB 2XNDD 5A0AE 4AFSA 3UWIA 1Z1IA 5C20A 1Z8GA 5DN6D 3S7KB 3P92A 1CT0E 4DGJA 3M7TA 4LZ4B 1ZMNA 4NSVA 5EXLA 1SHYA 1XXDA 5C17A 1HLTH 4FU7A 3RUOA 3SZNA 1CGHA 4DOQA 1O2JA 2D26C 4UFEH 4ZXYH 1P10A 5EJ1A 1N8OB 1O3JA 3BTFE 4JZIA 1V2NT 5F8XA 4VGCC 3QLPH 2RDLA 1CA0C 2FOGA 1GGDB 1SI5H 3KQCA 4AGJA 1C9PA 2EI6A 1MCTA 1S6FA 4TY7A 1V2WT 2CF9H 1LHDH 3RXIA 3V13A 1WYKA 1W7GH 3AW0A 1PPGE 4ZKRU 4TPYA 1C1PA 1XUFA 4XRNA 4ZHMU 1P2IA 1QJ6B 5GWZA 4JYTA 2XWBI 1OSSA 1BTUA 2FO9A 3RDZA 1IQJA 2GV6A 1O5CB 3A8CA 4HTCH 1TX7A 1V2KT 2PLXA 1HAXB 3U9AH 2IPQX 3T5FH 4CRCA 4BAKB 2BXTH 1AVGH 1C5QA 3SUGA 3KQDA 1CBWC 2NU0E 3BTGE 1P57B 1XKAC 2EI8A 5DP5A
chains in the Genus database with same CATH topology
1GBBA 3M7UA 5BRRE 3ODDA 5EQRA 4HZHA 1F0SA 1BHXB 2ESTE 5DJ7A 1AB9B 1AE5A 1QJ7B 2FOBA 3GICB 1VITH 3UWJH 2R2WU 3LGUA 2XCFA 4O03A 1FMGA 1RXPA 5EOKA 4BXWA 2W5EA 1JIRA 2A5KA 2WPMS 1D4PB 3P8GA 2O9QA 3M3VA 2BLOA 3OY5U 1P3CA 1V2MT 3GISB 5HM9A 3E3TA 1FY5A 5TCCA 5LPEA 3GDSA 3M5MA 2CHAC 2F9OA 3ITIA 1TMUH 2AMQA 2FYQA 3BG4B 3RP2A 2F9PA 2RA3A 4I8LA 4ABDA 3OY6U 1SHHB 6CHAC 4XBDA 5CMXH 4X2WA 1UCYK 2PKSB 4UFDH 2PV9B 3HGPA 1YM0A 3TIUA 1EAXA 3RLYH 4FXGH 4A6LA 2BXUH 1V2RT 4AORA 1PPCE 1J8AA 3AW1A 4ISOA 4GUXA 3Q77A 3LH3A 2BVSH 2HRVA 1S5SA 2TGDA 1TGNA 2C3SA 1GBIA 1HAVB 1OWHA 3RXEA 1SSXA 5C1UA 1GI2A 3F9GA 1G37A 1TNIA 1RTFB 1EQ9A 1WUNH 3ATLA 1AMHA 2ZEBA 2G00A 2EA3A 1O0DH 4X8VH 4NIWA 1FN6A 2FOFA 3E16B 1O3PB 1O2GH 3EA7A 2V3OH 1K1PA 3MO6A 5DP4A 3F9EA 3RXOA 5DP9A 1A5IA 3ZZAA 2F9VA 4I8HA 2W3KA 4U2WA 3C27B 2OTVA 1MD8A 1A4WH 2QXGA 3BTTE 4CH2B 3ZV9A 4NA7A 4U01A 1SB1H 6GCHG 3MU4A 2UUYA 3P6ZB 4FUCA 3O8DA 1TIOA 2A7JA 4AX9H 4JYVH 3RMLH 2OINA 2TIOA 2OXSA 3MO9A 1GBTA 1O5GH 2VH6A 1P03A 3OYPA 4J1YA 3SUFA 3D49H 4INKA 1GL0E 2PSXA 4AZ2B 2ZDLA 1A0HB 2ZPQA 1ZPCA 4CRAA 1DSUA 4E7RG 2ODPA 4FU9A 1P2MA 4ZKNU 5DG6A 1QHRB 2ZC9H 2XWAA 2GZ9A 3PV4A 4ABIA 3ZZDA 1SLWB 1C5YB 5EG4A 2BOKA 4WMFA 4X2VA 3NPSA 3JZ2B 4CRDA 4DIHH 1BTHH 2BDAA 4Y8XA 1V2UT 1HDTH 1GMHG 1Q2WA 3O8RA 1DWEH 1AIXH 1V3XA 3UIRA 4B73A 1L2EA 1B5GH 3ZV8A 5EODA 2SGPE 3P8NA 2ZO3H 1H9HE 4ABEA 1TYNA 2ZTXA 1HAIH 3RXKA 1UK2A 3GY7A 3VGCC 1BMAA 5C2ZA 2BY7X 1PPZA 1KIGH 1K1IA 1MQ5A 1HAYB 1HJ9A 2A4RA 1UVTH 3O8BA 2A2XH 1AWFH 4DVAU 2ZFFH 3E6PH 4H6TA 1NFXA 2GCHG 4ZAEA 3RC4A 1AO5A 2BOHB 3A7WA 4Y6DA 1D6RA 4CR5A 5FXLA 4B2BA 4WH6A 2FI5E 1O2NA 1FPCH 1QY6A 4K5ZA 3DD2H 1BBRK 1LQDB 5E8EH 3RC5A 1ZYOA 3S9BA 2PKAA 4E7NA 1TNGA 3K65B 1MBQA 1IAUA 3E8LA 4I8KA 2ILNA 1UTOA 1GHYH 4ISHH 1ZOMA 1A3BH 3DFLA 3TH3H 2BDGA 2SFAA 2XRCA 2CF8H 1F7ZA 1C1NA 2TRMA 1EJAA 3LGVA 4MNWA 1FIZA 3EDXB 1WQSA 1CU1A 2QIQA 3RXBA 3RMOH 1DM4B 1O3AA 1Z7KA 3SGBE 3NZIA 1A46H 1EPTB 1GJ5H 7KMEH 1TB6H 1CQQA 4GSOA 1W3CA 1ARBA 5L2ZH 4X1PU 3GCOA 3DHKH 1Z71A 1YCPK 4YESB 2STBE 5C1XA 1ETSH 4BAOB 1ARCA 1ZHRA 4K1SA 4ZUHA 3A84A 4Y7AA 1GL1A 1HJAC 1Y8TA 1HB0B 4FUHA 4AFQA 4DW2U 2CXVA 2Q1JA 3AASA 3ESTA 4UFFH 3URDA 3LGYA 1MTWA 4WF8A 1AZZA 1C1OA 3L33A 1G30B 4NGAH 2WYJA 3BV9B 5JB9S 3RXMA 1GI9B 3QX5H 2F9UA 1HCGA 2UWLA 4NWKA 3H5CB 2OLGA 1P2NA 3UQOA 1CO7E 2ZCHP 2FIRH 4ZH8A 1C5VA 2Z3DA 1E38B 2O8LA 1XUJA 3UR6A 1C1SA 1WCZA 1ZSLA 1BHXF 4I31A 1QL8A 2P59A 2BDHA 4X0WU 1YC0A 2UWOA 3LC5A 4BOHA 1KXEA 4Q80A 2W7UA 2ZIQH 1DDJA 1V6DA 4B71A 1L4ZA 4Y7BA 4XDEA 4BAMB 2XC4A 1BTYA 1C5NH 1E0FD 3GCTF 3TPIZ 3PTNA 4BTUB 3SJ9A 2FTMA 1O3CA 5JB8S 3RLWH 5HGGA 1QQUA 1ELVA 2PFEA 1T4VH 1GI4A 3KF2A 4GHQA 2ZGJA 1ANDA 3BTHE 5EQQA 3BIVH 2SGFE 1GCTC 1C1WH 4VGCB 1TA2A 2WPJS 1AGJA 5J4QA 1DLEA 1H8DH 1NRRH 4ZXXH 1P02A 4WWYA 1MKXK 3FVFB 1HRTH 1B7XB 2W3IA 4ASHA 4JZEH 2BHGA 4I7YH 2VJ1A 5GPIB 8KME2 1FNIA 2GCTB 1FPHH 5ETXA 1ID5H 1SVPA 1Y3WA 3RXTA 4HGCA 3SU4A 3NKKA 1NFWA 2ZWLH 1UTMA 1Z8JB 1ABIH 2QAAA 1FAKH 4K1TA 3BF6H 4IMZA 1DUEA 1EAWA 3KN2A 3ZZ3A 1JMOH 2P8OB 3KQEA 2FTLE 1HAVA 2VIVA 5PTPA 1J9CH 1G3DA 1O39A 2F3CE 1S84A 1RIWC 2FX4A 1WBGB 2UUJB 4Y76A 2C93B 2AMDA 1GJBB 4GCHG 3ZVFA 1GG6B 2WV5A 3F9FA 3FAOA 1GHVH 1RTLA 3MNBA 2WPKS 1YPEH 3PB1E 3U8RH 4MPUA 1C2GA 1GVZA 1ELDE 1BDAA 1KXFA 2R0LA 1GMCF 4FUGA 1IQLA 1QB6A 2ZPSA 3QDZB 2PSYA 1YF4A 1C1UH 1SPJA 1GMCG 1T32A 5FBIA 2ZZUH 1NN6A 2ZU5A 1Y59T 1T8OA 4OGYA 1ZHPA 1MCVA 1LO6A 2FMJA 3LT3A 1GBCA 1GJAB 1A3EH 2ZGHA 3OTJE 4BNRA 3HK6B 2FM2A 6CHAB 2F9BH 1RD3B 1IHTH 9LPRA 1C2LA 1K9OE 2OUAA 1FDPA 5I46H 2H9EH 1DUAA 5FCKA 1FJSA 5TJXA 4NZQA 4D76A 3RXGA 4GHTA 4GLYA 3ZVGA 4B2CA 1F5RA 3VEQB 3M37A 4NFEA 4UEHH 1NS3A 3ZVAA 2VVCA 1P01A 1BT7A 1C1RA 3P70B 3T2NA 2VWNA 1OXGA 1ELBA 1KLTA 1HXEH 1UK3A 3B23B 1AVXA 1EZXC 1ZSKA 2H9HA 2PGQB 1XUKA 1BTWA 2HALA 2NWNA 1K2I1 1DPOA 5DKMA 3VXEH 1C4U2 3TJUA 2WPLS 4JZ1A 2P3UB 2Y5FA 4XE4A 5A09A 1DY8A 2AIQA 1O5FH 4B76A 1BA8B 1ZZZA 2F91A 2OP9A 1E36B 1ZRBA 1C4V2 4X8SH 1GDUA 1TRYA 1C5UA 1TBQH 1ZJKA 1OWIA 3T62A 1WV7H 1RRKA 5CE1A 3L3TA 2R3UA 2A4OA 1MU6B 5HM2A 3V3MA 4FUJA 1S83A 1KYNA 3A82A 1EZSC 4Z0KA 1QA0A 2GT8A 1NRNH 4OGXA 1D3PB 3QK1A 1AKSB 3RM0H 1QL7A 2QF0A 3SI4H 4XOJA 2QC2A 2BX4A 1ZTKA 1B0EA 1FY3A 1C2IA 3BTWE 3EGKH 3M3TA 5LPFA 1QBVH 4TPIZ 4YLUA 1QIXB 2H2ZA 5CHAC 2AGEX 3SQHE 2OBOA 3A7VA 3PROA 1F0UA 1DWDH 3FZDA 3K9XB 5FX5A 1DXWA 2RG3A 2ZG0H 4HFPB 3SUEA 1ELFA 3SHCH 1ZTJA 1WOFA 1C2FA 2FX6A 2JH0D 1BMMH 1P8VC 1K1NA 3NK8A 5AVDA 4OS4A 3ZZ9A 3SGQE 1P2OA 3QTVH 2HOBA 4ABJA 5DP6A 2O8UA 2V3HH 3A80A 3W94A 5FPTA 2GT7A 2IPHA 1O3MA 4O9VA 3SV6A 1EAUA 5E0GA 2QXIA 2QA9E 3M3SA 2ODQA 2AIPA 3OU0A 1XVMA 3VGCB 1O35A 1V2QT 2ZNKH 4X1RU 3A7YA 4I8GA 2EEKA 3LPRA 1HPGA 1O2VA 1FY1A 1GBAA 3KEEA 3IG6B 1O2QA 4UONA 1H4WA 4ABAA 4YT6H 3PM3A 1DANH 4A1XA 3SW2B 1Y3YA 1SGPE 2H1UA 1UTKA 3UOPA 3ATIA 3SJIA 2Z9LA 1DOJA 2P3TB 3QGNB 1P3EA 4CR9A 2SGEE 2NU1E 1OWDA 2VWLA 3MU0A 2Y80A 1BOQA 1V2PT 1CE5A 1TNJA 1SL3A 1GHAF 2A32A 1L1JA 3PMBB 3S9AA 3UPEA 4X6NA 2ZU1A 3PYHA 5I25A 3BSQA 4YT7H 1GBDA 2P3FH 4ABGA 2XBVA 4FUFA 1GHAG 1C5OH 1C2JA 1C5RA 1O37A 2WINI 1YPGH 2BY5X 3A8DA 3GY8A 1GJ8B 3RXAA 4IBLH 1XX9A 1L4DA 3AVZA 3CENA 3PO1B 2FI4E 4CBNA 3M36A 2BVRH 1OS8A 1QRZA 3SI3H 5FCRA 3E0PB 2BVXH 3SNCA 2VINA 4WXIA 1XXFA 5C5OA 1HIAA 4E06H 1C2KA 1EOLA 4MPXA 1CT2E 2Y82A 3RXUA 2JKHA 4F49A 4MTBA 4D9QA 1G2MA 3BTEE 2H5DA 4X1QU 1BRUP 3LDXH 1ELAA 2ZECA 2FP7B 4O3UA 1S81A 1SBWA 2XCNA 3Q3KA 1TMBH 1HYLA 1LQEA 3V12A 5G4BA 2GDEH 1TFXA 1A2CH 1JBUH 1UTJA 1O5BB 3STJA 1W0ZU 1M9UA 1WTHD 3SNDA 4B2AA 1GCDA 3STIA 1Y3XA 2A5AA 1AHTH 1DICA 1G3BA 2I6SA 4R0IA 4AYVB 1MTNC 2QN5T 2UUKB 1O2YA 1MMJN 3GOVB 4MG3A 5A8XA 3R3GB 2GMTC 1A1RA 1MKWH 1SQOA 1O3HA 2ZF0H 3ELAH 1LVOA 1FAXA 4X8TH 1ETRH 1OP0A 2SGAA 1EOJA 1C5LH 3LOXA 4DG4A 1C2HA 3KL6A 1MD7A 2AS9A 1WQVH 3SV8A 1NU9A 2UWPA 2QXHA 3UNSA 1IQIA 1CGIE 4JZDH 1GI1A 1UHBB 1FY4A 1AI8H 4U32A 2ZDKA 3BTQE 1ANEA 2BLQA 6GCHF 3Q00A 3T28A 4NWLA 7ESTE 4NIYA 1PQAA 4CHAB 1S0RA 1RTKA 1MTVA 5EQSA 3F1SB 1NZQH 1UTQA 1TNKA 1K22H 2ZI2H 2ZA5A 2FOCA 1X7AC 2QY0B 1O2PA 1SGYE 3LIWA 1MAXA 1GJ6A 3MOCA 1C1MA 1GBKA 2F83A 5L2YH 2G51A 1UCYE 1PPBH 4ISIH 4Y71A 5H4IB 3NUMA 3HGNA 2OC1A 1PQ5A 2Y6TA 3A7TA 3PWCA 2QYIA 1SGNE 5JBBS 3MHWU 1E35B 1GBLA 3MH5A 8GCHG 2ZCKP 1PPHE 4RKOB 4IN1A 1GJDB 2HPPH 1TBRH 6LPRA 2GZ7A 3NXPA 1O32A 2AYWA 4ESTE 1TONA 1GBEA 2Y5HA 3RU4D 1EZQA 1GMHF 2Z3EA 1VZQH 1GMDF 1A61H 3TNTA 3A89A 2PHBA 1SGFG 1GMDG 3P95A 2R9PA 1HNEE 3VB6A 1HJ8A 1TNLA 4AYYB 3BTKE 3GY4A 1Y5BT 2QF3A 1J15A 1BJUA 1T4UH 2GZ8A 5EPYA 4NZLA 1DLKB 3DUXH 5E0HA 1EAIA 2GCHF 8ESTE 1ZSJA 4AN7A 1AUJA 1F5LA 1H9LB 3CS7A 3R0FA 1LVYA 3A86A 3TITA 1YLCA 5C67A 1H9IE 4UDWH 2JH6D 2SNWA 1GJCB 2VGCC 2ZU2A 4H6SB 2XYAA 2ZHWH 2FOMB 5LGOA 1PQ7A 1YPKH 4MLFB 4Q7YA 1NC6A 4KTCA 4A1VA 2J38A 1N8OC 1TABE 2BQ7B 2IN2A 3D23A 2VIPA 1C5WB 3F9HA 2FXRA 2H6MA 3ZZCA 2WPIS 2Z9JA 3A88A 3I78A 1OYTH 3UUZA 1H1BA 1HGTH 1RJXB 1QR3E 1CVWH 1ETTH 1C2DA 1P9UA 2Z7FE 3VB5A 1K1MA 2OBQA 1AD8H 4X1SU 4NIVA 3QUMP 1NRSH 5AHGH 1BTPA 1AY6H 3PLBA 1VGCB 1C5MD 4YTAA 3GYMA 4MPVA 1AFEH 4OS6A 3MNCA 1U6QA 1SQAA 3GCHB 3RXRA 3TNSA 2A45B 2O8MA 5JBAS 2V6NA 4NIXA 1GHWH 2ALPA 4R8TB 3ZYDA 1EJNA 3LC3A 4BAHB 2Z9GA 1HAZB 1TOMH 1TNHA 2RA0A 3MYWA 2XXLA 5GJ4B 3RXQA 3C1KA 3GDVA 3ATWA 1AB9C 1WSSH 2PTNA 4DY7B 2XBYA 2GV7A 3ZZ7A 3EA9A 3T27A 1W2KH 1AU8A 1O3LA 4ISLA 3FP8E 1TX6A 2W7SA 1SGTA 4NG9H 1EJMA 3ZVDA 5LH8A 4CBOA 1YGCH 5A0BA 2BD7A 4J2YB 3EA8A 2FOAA 2BLVA 3GDUA 1LKAA 1GBMA 2A0QB 1C2MA 2XNIA 1CHOF 5T3HA 2KAIB 5ABWA 2H9TH 3ZZ8A 4BXSA 5EXNA 1BBRE 2FS8A 3UFAA 1EB2A 1CHOG 4OS2A 1T8NA 1O2UA 3MH6A 2PKSC 1GWAA 3SU5A 1IQHA 1TPPA 3G01A 4FU8A 2Q6DA 2ANMH 2PWXA 3O8CA 5JPMH 1A0LA 3VPKA 1FV9A 1EXFA 1MBMA 1THRH 4IC6A 2VVUA 3GY2A 4AFZA 1SR5C 2ZGBH 3W95A 2BD3A 2ZHEH 3UY9A 4CREA 2FYRA 1FIWA 2BD5A 4GVUA 1TGTA 1UVSH 2FEQH 1IQNA 1TQ7B 1WU1A 2SGQE 3FZZA 1P09A 2C8YB 2WPHS 4ABFA 3E90B 2I6QA 1ESTA 1CT4E 2XTTB 3RMMH 1RFNA 1FUJA 4K60A 4FVBA 4Y8YA 2ZGXH 3I29A 4Y79A <