4ABEA

Fragments bound to bovine trypsin for the sampl challenge
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Dingo Dataset: A Comprehensive Set of Data for the Sampl Challenge.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords CATIONIC TRYPSIN
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4abeA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4abeA02
5GDSH 5A09A 3MOCA 3C1KA 3A86A 1B0EA 2FOMB 4K1SA 4I8GA 2FTLE 4TWYA 4F4OC 1UVUH 3SJIA 1YPMH 1BJVA 4CR5A 3GY8A 3UNRA 1PFXC 2XBYA 5JBAS 1XXDA 3PTNA 2R0KA 1P9UA 2FOFA 3AAVA 1GBIA 4IBLH 1FJSA 4NSYA 1V6DA 3EAJA 3SI3H 1MCTA 2ZFFH 1O3NA 3PO1B 2FI4E 1BMLA 2ALPA 1GHAF 5F8XA 5BRRE 5I25A 2VGCB 2ZPSA 2ASUB 2ZCHP 1UTLM 3ZVDA 3GY3A 1Z71A 1F5KU 2BD4A 3Q3KA 1EKBB 1P57B 1TOMH 3AW0A 3M7UA 1CHGA 2QXIA 1H8IH 4IN1A 2CXVA 2PKSB 3QGNB 2FOEA 4Z6AH 3BV9B 1CHOG 2R3UA 1K1PA 3LGUA 4AG1A 1Y59T 1Y3UA 3DFLA 1Z1JA 1ELAA 2YNAA 1GG6C 3RU4E 1EXFA 2O8WA 3S0NA 1SGPE 2ZU1A 4FVBA 2ZGBH 3A85A 2XRCA 1UTQA 3RXRA 1NRPH 5FAHA 3E1XB 1D3PB 1Q2WA 2BZAA 1C1TA 1L1GA 1C2GA 2UUYA 2UWLA 1DITH 1UHBB 1UJ1A 2B9LA 3KEEA 1BTWA 2CGAA 5GJ4B 1IQHA 4ZHLU 1HV7A 1KXFA 1PJPA 3VGCB 1B5GH 1EJAA 4NZQA 1C1RA 1A5IA 4FUBA 4O9VA 1S83A 5DKMA 1NRQH 4R0IA 3URCA 4Y8XA 1TBQH 3U8TH 3ATKA 4MLFB 2BD3A 1YCPM 3I78A 2BVXH 1F5LA 3LJOA 5T6GA 3AAUA 1GCTB 1XM1A 1AD8H 1KXAA 4CBNA 1UCYK 4I33A 1QRXA 2AMPA 5EXMA 1RJXB 2DE8A 3ZZ9A 1NZQH 3ZYDA 3SI4H 1OWEA 3V0XA 5GIBA 1EX3A 1QNJA 1V2PT 2PKAA 3MU8A 1G36A 3R0FA 1H9IE 1SOZA 3MU0A 5T6DA 1O3BA 4FUHA 2Q6FA 1GHVH 2BLOA 2ZKSA 1GMHF 3TIUA 1GMDF 3M7TA 2FS8A 5FCRA 2ANKH 1FLEE 4VGCC 5AF9H 1QTFA 1AB9B 3PMBB 2F91A 3TH2H 2WV4A 2QCYA 5A8YA 5BPEA 1P2JA 1PQAA 4UE7H 1Y8TA 3Q3YA 5F8TA 1ZHMA 2XWBI 1MKWH 1P2IA 3BTME 4LXBH 1H9HE 4AG2A 2XNIA 2TGAA 3BEUA 5T3HA 1ZMLA 2PLXA 1UVOA 2GD4B 3ZYEA 2ZU4A 4FUDA 2BOKA 1LTOA 1ANCA 1LPGB 4WH6A 1O2QA 4NIYA 2HALA 2BDBA 1GJ7B 5L6NH 4ZKSU 1HXFH 3UQVA 4MPWA 3NXPA 3BTGE 1ARBA 1ESTA 2WPIS 2OQ5A 1P3EA 1T8OA 1UMAH 1EJNA 2TBSA 3T29A 1DWBH 3SO3A 2G8TA 2Y82A 2HRVA 1CGHA 5DP3A 3RLYH 1NS3A 3NPSA 5ESBA 1EZSC 3PB1E 2BX3A 1SLXB 3A7WA 3IG6B 1EAWA 3LPRA 4YOJA 2VVCA 2JKHA 2LNCA 3BG8A 3E6PH 3SBKA 3UREA 1LVOA 2TGDA 1GGDB 2Z9GA 1V2LT 1C5SA 1YM0A 4DVAU 5AFZH 3VB4A 1DWDH 4YOGA 2PSXA 2BDHA 4DOQA 1P03A 3QO6A 4I7YH 1G3DA 4XBBA 3OYPA 1TOCB 4WH8A 1W7GH 1P2QA 2D1JA 4X8VH 1VR1H 3ZVAA 1F2SE 3VGCC 5JB8S 4BTTB 1U6QA 3A7ZA 1A4WH 4AFSA 2FXRA 2FO9A 3LGVA 5HMAA 1B7XB 1GDQA 1SI5H 5AHGH 1ELTA 4RN6A 2VH0A 3V13A 2GX4A 2FOHA 4ASHA 2TGTA 4XSKU 1N8OC 4ABHA 1CT4E 5JBTA 4K60A 1HIAB 3RXEA 2IJOB 3STIA 3TGKE 1LQDB 4RKJB 1N8OB 2G5NA 3QGJA 3SGAE 3ZV8A 1JIMA 3RU4D 1KLTA 1ZSKA 5HYOA 3WY8A 5CMXH 1SGCA 1W7XH 1TNHA 1T4VH 2EEKA 2HNTF 4UDWH 1TGTA 3RXJA 1OPHB 1O2MA 1W0ZU 3TPIZ 3E91A 1SGQE 4Y10E 5DO4H 4BTUB 1EAIA 3MH5A 3ODFA 1FY1A 3PV4A 2VNTA 1IHTH 4MNYA 2UUKB 2VWLA 4BNRA 1QCPA 1GMCG 4H6TA 2WYJA 5FBEA 4IS5A 1YPKH 2AGEX 5F03A 1G9IE 1GVZA 4JYTA 3P8NA 1T8MA 1YPHE 3O8RA 1DX5M 3MYWA 1XKBC 4YOIA 3H5CB 1SLUB 2J34A 1TNJA 2A7JA 1HCGA 4H42U 4XE4A 1THSH 1P04A 2ZCLP 1MAXA 1TB6H 3U1IB 1O2WA 1GBBA 1A3BH 1O37A 4KTUA 4GSOA 1GBEA 1EB1H 1CT2E 3QTOH 4D76A 1NRRH 2FYRA 2YOLA 5GXPA 1YP9A 1G37A 5A0CA 2O8MA 4RSPA 2ALVA 1C1QA 3PTBA 4CRDA 1NROH 2GCTC 4ESTE 1X7AC 3T5FH 4X1RU 1Z8GA 3ZVFA 1C5UA 1QRZA 4DURA 1BCUH 4JMYA 1BBRK 1C5XB 1GBAA 1K1JA 4AB8A 2VH6A 1BIOA 1J14A 5HM2A 2ZHDA 1S82A 2SGAA 2AMDA 3A7VA 1UVTH 2DE9A 3U9AH 1GI5A 2P3UB 1THRH 1S5SA 2BHGA 3F9FA 3DD2H 3GY7A 1GBFA 4ZHMU 4AN7A 2XW9A 2BY9X 1OX1A 3MFJA 3V3MA 1AUJA 4FUIA 1C2LA 1QGFA 2ZWLH 3MU4A 5EGMA 1UTMA 3IWMA 1ARCA 4F49A 2AYWA 2GCHF 1HAVB 1NTPA 2GKVE 5A8ZA 1AVWA 2FI3E 1TX8A 4WJG2 1TGNA 2ZU3A 3ESTA 1TGSZ 3E90B 5K0HA 1IQNA 2PW8H 4NSVA 3LIWA 1TMTH 4ABEA 2CJIA 3QTVH 5HXFA 1DUEA 1SHYA 2VIDA 2FDAA 3QZRA 4O97A 3ELAH 1GL0E 1O5CB 4AFQA 2IPHA 2G51A 1Z8RA 2A5IA 3I77A 2SNWA 1ELEE 5DP5A 2BDCA 2DUCA 3BTHE 7GCHG 2CHAC 3SHCH 4O3UA 1TMBH 2XBWA 1LO6A 1GJ8B 2G00A 4MPUA 2A1DB 1SFIA 2I6QA 1LKAA 1QBOA 1ESBA 1J16A 1UHBA 2BQWB 3SN8A 1C9PA 1K1OA 1PPEE 5E2OA 2HPQH 3PYHA 2JH0D 1MTNB 3K9XB 1HXEH 4JZFH 5FHTA 2XC4A 1ELBA 2BY7X 2F9NA 3W94A 1DOJA 5GCHF 1V2QT 1AFQC 3UR9A 4Y8ZA 1DDJA 2ZC9H 1J17T 1FXYA 1VZQH 3RLWH 8KME2 1GI9B 2GDEH 2HGTH 2OC0A 3ZV9A 2OC1A 1S0QA 1SGFG 2P95A 2WPMS 1C5OH 1MTUA 2ZA5A 1A1RA 4MG3A 4NG9H 5E0GA 1RRKA 4NA7A 1LVBA 1DT2A 4JK6A 2NU3E 2FTMA 3DFJA 1LCYA 2CF9H 3T62A 4WVPE 1XUIA 1HAPH 3E8LA 1E36B 4MQAA 1K28D 4D9QA 1O3AA 1FAKH 3HKJB 3RC4A 3PO1C 1O2XA 2W3KA 4ZMAH 1ZOMA 1AI8H 1QB6A 2PGBB 1D9IA 5L2ZH 2EI7A 1BMNH 1W12U 1FY3A 1UTJA 3RXQA 1GJ4H 1MD8A 2V35A 3JZ2B 1E38B 5EW2H 1C9TA 1CA8B 1Y5UT 1P0SH 4IC5A 1L1JA 5J4QA 2VIQA 3HK6B 3TH4H 3P8FA 4CRGA 1ZRKA 1BRCE 5ABWA 4XOJA 3RMMH 3FZDA 1C1NA 1ZTKA 3SORA 1GWAA 1KLJH 1V2KT 2VINA 1C5YB 4CRCA 2VVVA 1O36A 2A32A 1WQSA 1Z1IA 2FPZA 2SFAA 1TBZH 2H9EH 4GUXA 1XUHA 3MNXA 1S6FA 1MQ5A 1OWJA 3KQEA 1BRUP 3W95A 4E05H 4M7GA 1ANBA 1GBDA 1DSUA 8LPRA 2VWOA 1FMGA 1DANH 3AVZA 4PROA 4OS5A 3TNTA 3ENSB 1HAHH 1OS8A 2AS9A 3KL6A 2H9TH 2JH6D 5E0JA 1P11E 3UPEA 2GTBA 4QT8C 3T28A 1OP8A 4DGJA 1WYKA 2QXHA 3BN9A 2VIOA 1V2VT 1S81A 2RA0A 4BANB 7KMEH 2ODQA 3SW2B 1DE7H 1QR3E 1OP0A 2BDYA 4ABBA 3LOXA 4Y71A 1SPJA 3SJ9A 1C4V2 1QQ4A 2AH4X 2HNTC 5PTPA 3RDZA 5FX6A 1TPAE 2ZGXH 1W14U 4J2YB 2ZECA 3QWCH 2BQ7B 3VB3A 3Q3XA 1AZZA 5GCHG 5TCCA 1P2NA 4WWYA 1O31A 2O8LA 4TYDA 2Z94A 4E7RG 2OC8A 3OY6U 1IAUA 1O2TA 1E0FD 1JBUH 2R0LA 1ZPBA 1Y3XA 2BD5A 2AFQB 4SGAE 1SG8B 1O2OA 4TY6A 2K1QA 3MNCA 2UWPA 4ABIA 1FUJA 4CHAC 2ODPA 3NZIA 3LT3A 4X2VA 1JMOH 1O3FA 4U01A 1DS2E 1LHGH 1AE5A 3D23A 5A0BA 3A83A 3MU1A 1GHXH 3VB6A 1P05A 2C4FH 4BXWA 1O33A 4RKOB 4NA9H 1DPOA 6CHAC 4I32A 4Y7AA 4I8LA 4Q80A 5ESTE 5C1UA 2O9QA 3GCNA 4WF8A 1GI0A 1CGIE 1O32A 4CRAA 4DT7B 2A2QH 3SNEA 5C1YA 2FP7B 4YT7H 1V2RT 1UTNA 4WY3A 4B74A 3TK9A 1OWDA 5DP8A 5L2YH 2B0FA 1Z8IB 4NFFA 5C1XA 3TJUA 1TMUH 4KGAA 1ZSJA 4YM9A 1TIOA 2ZI2H 5EQRA 3LDXH 3SUFA 2O8UA 1FIZA 4ISHH 2GCTB 3RXMA 3SU3A 2ANWA 5E0HA 2ZDKA 1GDUA 2OCVB 5E8EH 1O3GA 2J2UA 4TWWA 5LPEA 1CO7E 4HTCH 1O2NA 3ZZ6A 2RCEA 1IQMA 3SNAA 1KY9A 1MU8B 1T31A 1S84A 5A0AE 3TNSA 2D2DA 3CP7A 4O3TA 1CA0C 5DP4A 3T27A 3MO9A 3QDZB 1OXGA 1QJ1B 2HWLB 1O3EA 4DW2U 1SLVB 4I8KA 2PR3A 1O0DH 1TGCA 5G4BA 1SVPA 1L4ZA 2ZDNA 1ZHRA 4HZHA 3KN2A 1GL1A 1FQ3A 3EA8A 1VCPA 2Q6GA 1GVKB 1HAYB 1Y3WA 1H9LB 3UR6A 1GI2A 1B0FA 3M61U 2KAIA 4WXIA 1F0UA 1ACBE 3MI4A 1C5LH 1G3EA 1J8AA 2BD9A 3SUDA 3D62A 1HDTH 1C2EA 4BAMB 2A4QA 1RIWB 2F83A 1YC0A 4ABGA 1YKTA 1HUTH 2F9PA 8GCHG 4CH2B 2QN5T 1MKWK 3A7TA 3RXOA 1TRYA 1QB1A 2WINI 2V6NA 1JIRA 1KXEA 4IMQA 4LZ1H 1OWHA 3K6ZA 2FM2A 3B23B 3UY9A 4XDEA 3BG4C 6LPRA 3TJVA 1ZMNA 1ELVA 1MH0A 1P2KA 4B2CA 3GDSA 3ZZ8A 5HM9A 3SJOA 4GLYA 5EOKA 1EP6A 2NWNA 2H6MA 3ZVBA 3LONA 3U69H 2BM2A 5EXNA 1CU1A 1QB9A 5ETXA 1SQOA 1HAVA 5LGOA 1HGTH 2GMTC 3U8OH 4AOQA 3RXSA 2QYIA 3BSQA 4IGDA 3ZZ4A 4OS2A 4GHTA 8GCHF 3SNDA 3K65B 2TPIZ 4WMEA 3BEFB 4X1SU 5FX5A 1PPHE 1YPHC 3UWJH 3F9GA 3CENA 4B2BA 2A4OA 1OOKB 2PFEA 3LGIA 4ZKNU 4Z0KA 2B7DH 1V2ST 1A5HA 2WV5A 1BHXB 4K1TA 3BG4B 2M5TA 4X6MA 3FVFB 2O8TA 3HATH 1GBTA 1NFXA 3QX5H 4Y76A 6ESTA 1C5TA 4ISIH 1D3QB 2QF3A 1ID5H 3BTWE 5F8ZA 3ZZDA 2PGQB 2Y5HA 4ZKRU 7ESTE 3BIVH 2OD3B 1PYTD 1RS0A 5FPYA 1SFQB 1TX6A 1MKXH 3GDUA 3M5OA 3K6YA 3FAOA 1BTZA 2OXSA 2ZNKH 1PPBH 5K7RA 1KXCA 4Q2KA 1QIXB 2B8OH 1V2UT 2ANYA 2STAE 3L33A 2FOAA 3GY5A 1O3HA 2BTCE 2GT8A 5C67A 2ZHEH 3EA9A 2OBOA 1AVXA 2XXLA 2A7HA 4X2XA 1FY8E 1D6WA 3MU5A 1MD7A 1P9SA 2ANMH 1ESAA 2ZU5A 3ATMA 2ZFSA 5GPIB 5J4SA 3M5NA 2FS9A 2FX4A 4OGYA 1C1SA 1A3EH 1UTPA 5JPMH 1NN6A 2F9UA 5LH8A 2ZPQA 5JBBS 1GBCA 1TX7A 3UTUH 2FESH 2WUBA 2OP9A 3SU5A 4JZEH 4BAQB 3S9BA 4TPIZ 1H8DH 1EASA 1PQ5A 1O3LA 1BTUA 1YF4A 2EI6A 2XCFA 4YESB 5I46H 1BRBE 1Z8JB 1MUEB 3MHWU 4UEHH 1L2EA 4INLA 1KIGH 3GISB 4ABDA 1V2WT 2STBE 3SZNA 1ZGIA 5FBIA 1XUGA 4U32A 1SC8U 1O2PA 2UUJB 2BD7A 1FY5A 5JBCS 1C2IA 1XVOA 1GDNA 2XBXA 4D7GA 5EW1H 4FU7A 1YCPK 2H9HA 3ZZ3A 4NA8A 2W5EA 1K1NA 1ZGVA 4X8TH 4UONA 3TK6A 4X1QU 1P2OA 1NY22 2JH5D 2XCNA 3MO3A 1PPZA 3OTJE 1HNEE 1O5GH 1XKAC 4MNVA 1IQLA 2Z9LA 1N6YA 1EPTA 4K8YA 2C90B 1TAWA 1SGIB 3T2NA 3JZ1B 2FOBA 1C2HA 3QZQA 1EUFA 3SV6A 1FIWA 1ETSH 1T32A 2VIPA 3HPTB 3OU0A 4AB9A 3UFAA 3TGIE 2ZIQH 2LPRA 4CRBA 5C3NA 1GHWH 1RD3B 2QIQA 2QV1A 1SBWA 3M37A 1O2RA 4H6SB 1YLDA 1TYNA 5DJ7A 1ZRBA 1TNKA 1K2I1 1TPSA 3SU6A 3F1SB 1C1OA 2BD8A 3RXKA 2G4TA 1C5ZB 1EOLA 1HAIH 4AFUA 1HAZB 2XC0A 3DA9B 1GBMA 2C8XB 3RXIA 3E3TA 3GYLB 3SU2A 2FX6A 2FZZA 2I6SA 1E34B 1AWFH 4CHAB 1E37B 3KCGH 1YPGH 1OYQA 1K9OE 1WOFA 1QL9A 4Y6DA 1LHEH 2W7UA 2BLWA 4A6LA 3RXDA 3PM3A 3MH7A 2HOBA 1BITA 1KDQB 3Q77A 4NZLA 1C1WH 2SGFE 4A7IB 2A31A 2Y80A 2AGGX 1EPTC 1LPKB 1DLEA 2EI8A 4ZROA 2OTVA 2A0QB 1ZTJA 1UVPA 3IITA 1VCQA 1HAOH 1HB0B 3PMHB 3SQEE 2A4GA 5JYIA 1SOTA 3BTDE 1P3CA 4LK4A 1AZ8A 4D8NA 1GI6A 3FP8E 3RMOH 3BF6H 4FVDA 1SGFA 1PPFE 4GCHG 1UTOA 1SGEE 1GMCF 1O39A 4A1XA 1P8VC 3RXBA 4YLUA 4HI3A 2Y6TA 1NU7B 2ZFQH 2ZQ1A 1SSXA 3LC3A 2VJ1A 2ZDMA 1AHTH 2J95A 1ELGA 5EPYA 3SUEA 4JCNA 6CHAB 4CH8B 1WCZA 4B71A 1DLKB 3TK5A 4ABFA 3GDVA 4MTBA 2R2MB 1DVAH 2ZGJA 4FUJA 3ZZ5A 3GCHB 2P16A 6GCHG 4WMDA 5F6MA 1C5VA 1MAYA 1C5WB 4YLQH 4NFEA 3KIDU 4J1YA 3SHAH 2G81E 3CS7A 3MTYA 1MU6B 4OS1A 4B75A 4BXSA 2AIQA 1BHXF 1NFYA 2VIVA 1HBTH 3GICB 3Q00A 1GJBB 1A7SA 2QY0B 3RXFA 1FDPA 1C1VH 1YPJH 4GCHF 1ELFA 1GI8B 1BUIA 3VXEH 2ZDVH 2VB0A 3O8CA 2P3FH 3S9AA 3ZZ7A 4Y0ZE 4A1VA 1LQEA 1CA0B 1HAXB 1OSSA 1O5FH 3T25A 1O5AB 3MNBA 1KTSB 1CGJE 1O2VA 4FUGA 2ZG0H 1VITF 1RXPA 3M7QA 1BTPA 1K22H 1WBGB 3FP7E 1CSOE 3SU1A 3A82A 2PWXA 1F92A 5EU8A 2BZ6H 1O2IA 4IC6A 2ZO3H 3SQHE 1WTGH 3C27B 2ZDLA 5DP7A 1ETTH 1YBWA 2A4RA 1MQ6A 1KYNA 2BXUH 5C2ZA 1LMWB 2BDGA 2XYAA 3MO6A 1DY8A 3E0NB 4DIIH 1QJ6B 1YPLH 1TPOA 4A5TS 3K2UA 4ZUHA 4JYVH 1PPCE 2GV6A 3H7TA 1W3CA 5DPAA 1DICA 3U8RH 1V2NT 3RXGA 1IQIA 3AW1A 1T8LA 1P02A 2F9VA 4GHQA 4UFFH 2P8OC 4Q7YA 1BJUA 1MTVA 1EJMA 4CREA 1QA7A 4IN2A 2HLCA 1O34A 3VB7A 3LGTA 1EQ9A 1TPPA 1LHFH 1NM6A 2Y5GA 1IQFA 1BOQA 3D65E 1YCPH 1GG6B 1EZUC 3QUMP 3HKIB 3MWIU 3H7OA 3QN7A 3UUZA 1K1IA 1GVLA 1TRNA 1G2MA 1WV7H 4U2WA 5JDUB 2GZ8A 2P8OB 1O3DA 2QA9E 1AKSA 4K8BA 5DGJA 2WPJS 2SGQE 2Z9IA 2ZCKP 4ZH8A 5B6OA 1EATA 1WU1A 1JOUB 4H4FA 2ZTXA 3A7XA 3O8DA 1H1BA 1Y3VA 3SNBA 2Z9JA 4Y7BA 1MTSA 3LC5A 1GCDA 2NU1E 1DUAA 1XUFA 2AGIX 4Q7ZA 4K5ZA 1RTKA 1Y5BT 2ZFPH 3TH3H 4MPXA 2Z3DA 5FPSA 3UOUA 1SMFE 3RM2H 1JRSA 1HYLA 8ESTE 4KKDA 1GHBG 4UFGH 1D4PB 1O2LA 5JB9S 1PQ8A 3RXHA 3U1JB 3TJOA 1A61H 1GI1A 2BD2A 1AU8A 4NIVA 4E06H 1KTTB 1ELDE 3SUGA 1O2UA 4NIXA 1C1UH 1UCYH 3A8CA 5IYTA 4ABAA 1O3IA 1OYTH 5DP9A 2FLBH 2AEIH 1TE0A 1ZPZA 3E0PB 1QHRB 4YO9A 3LH3A 3TJNA 5AVDA 3V7TA 1T8NA 2J4IA 2Z3EA 1QA0A 2GCHG 2F9BH 1C4Y2 1D3TB 4GVUA 5A8XA 4ZXXH 4BOHA 1D3DB 3N7OA 1O3CA 1A5GH 2ODYB 1D6RA 2G4UA 2FLRH 3V12A 4ZHAA 1S0RA 3L3TA 4TY7A 1ABJH 1QQUA 4ZXYH 1G3BA 3G01A 2XWAA 5H4IB 4Y0YE 3RXUA 1GPZA 1RTFB 1KLIH 4NWLA 2Y5FA 3SU0A 1AQ7A 1MZDA 1QBNA 2AERH 3RM0H 1ANEA 4U30A 1EOJA 1TA2A 1GMDG 4FUEA 3TVJB 3M3VA 1AVGH 3PMAB 3NUMA 1YPEH 1EPTB 1TBRH 1TGBA 1C5PA 5DG6A 5L30H 2BMGB 2GP9B 3PWCA 1ORFA 4X2WA 1G2LA 3F9HA 1EZQA 1P2MA 2WPKS 5CHAB 7GCHF 1SQAA 1SR5C 1WUNH 3EGKH 4AORA 1SGRE 1J9CH 1M9UA 1QL8A 3BTKE 1C2KA 1LHDH 4OS4A 3S69A 4INHA 9ESTA 4UD9H 1HPGA 1G30B 2IN2A 2JETC 3MMGA 1L4DA 2VVUA 1DM4B 3R3GB 1RGQA 1O2KA 1O3PB 2FEQH 3RXVA 1LKBA 1SGYE 2TGPZ 4XBCA 2BQ6B 3LGYA 5C5NA 2Q1JA 2J94A 1T4UH 1O2GH 1V3XA 3GY6A 2OC7A 1ETRH 3RP2A 1BBRE 2CHAB 1HIAA 1AFQB 1P12E 2BLQA 3ZVCA 5LPFA 1VJ9U 1FONA 1HRTH 3SV2H 2Y7XA 3M3TA 4Y79A 1H4WA 2PSYA 2CV3A 1K1MA 3P17H 3UWIA 5C20A 2PUXB 1QFKH 4KTSA 2OINA 1V2MT 3P8GA 4AYYB 5HGGA 1AMHA 1QBVH 3UNSA 2FWWA 1AY6H 4SGBE 4MPVA 2GZ7A 1G32B 5DK1A 1A46H 1PYTC 1OP2A 2BOHB 1YYY1 1C5MD 2Z7FE 3KGPA 3B8JA 4CR9A 2Z9KA 3QLPH 1OWKA 4X0WU 3SV9A 3PWBA 4K69A 1BBRH 2V3HH 4AZ2B 4D9RA 2PKSC 1O2ZA 1W13U 4DIHH 3U98H 1HAGE 4MVNA 4X1NU 3SU4A 4WXVA 3ZZAA 2BY6X 1AE8H 3BTFE 3M5MA 4AX9H 1A0JA 2ZU2A 1LHCH 2ZDAH 4JZIA 1F0TA 4D7FA 1RTLA 3VB5A 1EB2A 3PLBA 1WQVH 1V2JT 2V0BA 4OGXA 1QRWA 4TPYA 3SGBE 2TRMA 3P8OA 2SNVA 3LKWA 2ZQ2A 5DP6A 1ZYOA 1MMJN 1CVWH 1NRNH 2B5TB 1VGCC 1P06A 4GAWA 1O5BB 3A8AA 3TGJE 3A8DA 2Y7ZA 1VGCB 1GGDC 3BEIB 4E7NA 2PTCE 2HVXA 2A5AA 1EZXC 1TNGA 4HGCA 3RXTA 3OX7U 1C1PA 1IHSH 1LVMA 3LGWA 2SGPE 1Z7KA 2G55A 1O2JA 3B9FH 1TWXB 3UIRA 1Q3XA 1QL7A 1VITG 3ATWA 3A87A 1AN1E 2P93A 1ZPCA 3RXPA 2BB4A 4FU8A 3FZZA 3FANA 7LPRA 4I31A 2WUCA 1XUKA 2UUFB 4BAKB 2GV7A 2ZGCA 3ATLA 2BXTH 3KF2A 3MH6A 4XFQA 1XUJA 4AGKA 1LVYA 1AGJA 4DY7B 1NC6A 1DWCH 2C8WB 2JETB 2NU0E 1IQJA 1TALA 1UCYE 3M36A 1O3JA 1P10A 4K2YA 2C3SA 3TU7H 2G52A 2QGRA 5E2PA 1TA6A 3GY4A 3SOSA 1RIWC 2AMQA 2SGEE 2A45B 4THNH 1E35B 1ZSLA 1AIXH 1F7ZA 1O3OA 1Z6JH 4FUCA 3SGQE 1RFNA 5FXLA 4Y11E 1VITH 4R8TB 1FY4A 1THPB 2IOTA 1C2MA 1HJAC 1GJCB 1IQEA 4VGCB 1GJDB 3F68H 1BZXE 1MKXK 3KQCA 1DSTA 1UK4A 1ZTLA 3S7KB 1ZMJA 1GJ5H 1K21H 2BVRH 4X8UH 1FI8A 2XTTB 3PROA 1J15A 1NT1A 3SV7A 1GHYH 2R2WU 3EA7A 1GJ9B 1FNIA 1L1NA 1TQ7B 2ZHQH 1P09A 3PLKA 3TITA 2BY5X 1GJ6A 1SB1H 1ZJDA 4X2YA 5EQSA 1AKSB 3P6ZB 5TJXA 2D8WA 1O35A 2WPHS 3NWUA 1PPGE 1AB9C 2GT7A 1GCTC 3BTQE 1TFXA 1ZR0A 1O5EH 4Y8YA 2ZF0H 2F3CE 4ISLA 1QJ7B 1VJAU 1MZAA 1Q31A 4X8SH 2F9OA 3A8BA 4BAOB 1BA8B 4I8HA 1BB0B 3FFGA 1LDTT 2Q6DA 5CHAC 4JYUH 1UTKA 1GBHA 2ZZUH 3P70B 3I29A 2R9PA 5TCAA 1MTWA 1GHZA 4MNWA 1W11U 2CN0H 4A1TA 3P92A 4CRFA 1TRMA 2QC2A 3T26A 1C5QA 1O2SA 2D26C 2FYQA 3FP6E 2XC5A 2OBQA 2QF0A 4JK5A 1QURH 2H5CA 2H2ZA 2ZFTA 2NU4E 4ISOA 1CBWC 4X6NA 2ZTYA 1ZZZA 3GCHC 3MH4A 3ZZBA 1HLTH 1W8BH 1BTHH 2CMYA 2H1UA 4ZKOU 1SGTA 2GDDA 3UNQA 3STJA 1DXPA 3PMJA 4IMZA 3SNCA 4BAHB 2RDLA 3BTEE 1O5DH 5C5OA 1TLDA 1C2JA 5A2MH 3A84A 2V3OH 3Q76A 3GYMA 3S9CA 2A2XH 3EDXB 5GWZA 1UVSH 2C8ZB 2P94A 3GCTF 1JRTA 2FOGA 1TNLA 1ELCA 2PUQH 1KXBA 4IW4E 1BMAA 4Q7XA 2G5VA 1ZLRA 4YTAA 1NESE 1BQYA 1NRSH 1OWIA 2HPPH 3F6UH 1F0SA 4LZ4B 1CQQA 2FIRH 4O03A 1C5NH 1O3KA 1GBJA 2J38A 3URDA 2A5KA 2Y81A 1CBWB 1C2FA 1W2KH 4LOYH 3KQBA 3DT0H 1BDAA 2VWMA 2SGDE 2YNBA 1BRAA 4B1TA 1GJAB 3A80A 4ABJA 1OKXA 3TLOA 1SLWB 2C8YB 1WTHD 1SHHB 1GI7B 4NCYA 3DUXH 3KHVA 1NFUA 1F5RA 2WYGA 3GCOA 4JZ1A 2ZHFH 2BX4A 1AO5A 1VCWA 3P95A 1UO6A 2PKAB 1ZJKA 2BY8X 1SL3A 2Z6BD 2FODA 2GGVB 4MNXA 1EAUA 1GBLA 3QK1A 3KNXA 1BMMH 1FPCH 2ZTZA 4X6OA 1Y3YA 2UWOA 2ZHWH 4FU9A 4KP0A 1C4U2 3RXCA 1F0RA 3RXLA 4OS6A 2ESTE 3LJJA 3E16B 3RC5A 4AGJA 5LPRA 4B73A 2R3YA 4DJZB 2Z3CA 4DCDA 9LPRA 3D49H 2W26A 1IOEA 1IQKA 3UOPA 1A2CH 5EQQA 3OSYA 4ISNA 3RU4T 1FPHH 1XVMA 2J9NA 1GHBF 1MBQA 4X1PU 1UK2A 3RC6A 2TIOA 1MCVA 1NU9A 1O2YA 1FN6A 5CE1A 1HJ8A 1V2OT 1AFEH 1DY9A 2RA3A 4INKA 2PHBA 2GZ9A 1ZHPA 4A92A 3GY2A 4HFPB 1W10U 2BYAX 4XBDA 4YZUA 1FN8A 3SV8A 3GOVB 1BTYA 4KELA 4OS7A 2VU8E 4YT6H 1G3CA 2GVFA 3A81A 1K1LA 1INCA 3L6PA 1BTXA 3BTTE 2FI5E 2VIWA 4WMFA 4NWKA 3ATIA 1TQ0B 3RMLH 5FCKA 1S85A 4AFZA 6GCHF 2FOCA 1MTNC 4I8JA 1TONA 5IDKA 4FXGH 1O30A 3ZVGA 2ZP0H 1NFWA 1HJAB 2J92A 2W7SA 1XX9A 1NO9H 1C2DA 2NU2E 2THFB 1IQGA 1JWTA 1FAXA 4ZAEA 2EA3A 3RMNH 3M3SA 2ULLA 3A7YA 3ZVEA 1S6HA 3M35A 5T6FA 2VGCC 5AFYH 1SQTA 3HGNA 2KAIB 1T7CA 1YGCH 3LU9B 1YLCA 1C5RA 4BTIB 3EQ0H 4GPGA 4K3JA 3HK3B 2OQUA 4B2AA 3A88A 1N6XA 3NKKA 3ITIA 3PLPA 1W0YH 1GI3A 1Y5AT 3F9EA 3VEQB 5SGAE 4B76A 2C93B 1WAYB 1V2TT 1GHAG 2H5DA 3LH1A 1KXDA 3GCTG 2WPLS 1XXFA 4NIWA 4X6PA 3RUOA 2BVSH 4DG4A 2PV9B 4UFEH 3NCLA 1FZZA 1KSNA 3OY5U 3HGPA 4JZDH 1KDQA 2EC9H 1DFPA 1ABIH 1N1LA 3S7HB 2HNTE 2P3TB 3EE0B 1AUTC 2AIPA 3DHKH 1DXWA 1DWEH 3NK8A 2A7CA 3M5LA 3MNSA 1Z6EA 3ODDA 1BT7A 4KTCA 1FV9A 4AYVB 1O2HA 1SGNE 3RXAA 2VWNA 5FPTA 2ILNA 5EODA 4NGAH 3AASA 1P01A 2XBVA 2ZGHA 1TABE 4FUFA 2ZEBA 5EPNA 1CHOF 1A0HB 1HFDA 4MDSA 1O3MA 2OUAA 1PQ7A 3SJKA 3SJ8A 1C1MA 3A89A 2BDAA 1AWHB 1L0ZA 1UK3A 1LPZB 5EG4A 1EP5A 1A0LA 3VXFH 4UFDH 2QAAA 2PTNA 1JXPA 2FMJA 2OLGA 3VPKA 2ZPRA 4K1EA 1NPMA 3BIUH 2GMTB 3EYDA 1SGDE 3KQDA 1GI4A 1O38A 3UQOA 2QXJA 1WSSH 5EXLA 3ZZCA 2BDIA 1CT0E 2QXGA 3CS0A 3VFEA 1XMNB 1HJ9A 1EAXA 1GMHG 2CF8H 2BLVA 2ZFRH 2W3IA 1GBKA 4CBOA 1ANDA 1CE5A 3O8BA 2P59A 2RG3A 1TNIA 1QY6A 1MBMA
chains in the Genus database with same CATH superfamily
5GDSH 5A09A 3MOCA 3C1KA 3A86A 1B0EA 2FOMB 4K1SA 4I8GA 2FTLE 4TWYA 4F4OC 1UVUH 3SJIA 1YPMH 1BJVA 4CR5A 3GY8A 3OE7D 1PFXC 2XBYA 3UNRA 5JBAS 3FKSD 1XXDA 3PTNA 2R0KA 1P9UA 2FOFA 2M2AA 3AAVA 1GBIA 4IBLH 1FJSA 4NSYA 1V6DA 3EAJA 3SI3H 1MCTA 2ZFFH 1O3NA 3PO1B 2FI4E 1BMLA 2ALPA 1GHAF 5F8XA 5BRRE 5I25A 2VGCB 2ZPSA 2ASUB 2ZCHP 1UTLM 3ZVDA 3GY3A 1Z71A 1F5KU 2BD4A 3Q3KA 1EKBB 2JDID 1P57B 1TOMH 3AW0A 3M7UA 1CHGA 2QXIA 4RT0A 1H8IH 4IN1A 2CXVA 2PKSB 3QGNB 2FOEA 4Z6AH 3BV9B 1CHOG 2R3UA 1K1PA 3LGUA 4AG1A 1Y59T 1Y3UA 3DFLA 1Z1JA 1ELAA 2YNAA 3F2GA 1GG6C 3RU4E 1EXFA 2O8WA 3S0NA 1SGPE 2ZU1A 4FVBA 2ZGBH 4Z1MD 3A85A 2XRCA 1UTQA 3RXRA 1NRPH 5FAHA 3DSOA 3E1XB 1D3PB 1Q2WA 2BZAA 1C1TA 1L1GA 1C2GA 2UUYA 2UWLA 1DITH 1UHBB 1UJ1A 2B9LA 3KEEA 1BTWA 2CGAA 5GJ4B 1IQHA 4AC9A 4ZHLU 1HV7A 1KXFA 1PJPA 3VGCB 1B5GH 1H8ED 1EJAA 3FN8A 4NZQA 1C1RA 1A5IA 4FUBA 4O9VA 1S83A 5DKMA 1NRQH 4R0IA 3URCA 4Y8XA 1TBQH 2QF5A 3U8TH 3ATKA 4MLFB 2BD3A 1YCPM 3I78A 2BVXH 1F5LA 4Q63A 3LJOA 5T6GA 3AAUA 1GCTB 1XM1A 1AD8H 1KXAA 4CBNA 1UCYK 4I33A 1QRXA 2AMPA 5EXMA 1RJXB 2DE8A 4XD7D 3ZZ9A 1SKYE 5DN6D 3SZEA 1NZQH 3ZYDA 3SI4H 1OWEA 3V0XA 5GIBA 1EX3A 1QNJA 1V2PT 2PKAA 3MU8A 1G36A 3R0FA 1H9IE 1SOZA 3MU0A 5T6DA 1S6LA 1O3BA 4FUHA 2Q6FA 1GHVH 2BLOA 2ZKSA 1GMHF 3TIUA 1GMDF 3M7TA 2FS8A 5FCRA 2AHME 2ANKH 1FLEE 4VGCC 5AF9H 1QTFA 1AB9B 3PMBB 2F91A 3U28C 3TH2H 2L6OA 2WV4A 2QCYA 5A8YA 5BPEA 1P2JA 1PQAA 4UE7H 1Y8TA 3Q3YA 5F8TA 1ZHMA 2XWBI 1MKWH 1P2IA 3BTME 4LXBH 1H9HE 4AG2A 2XNIA 2TGAA 3BEUA 5T3HA 1ZMLA 2PLXA 1UVOA 2GD4B 3ZYEA 2ZU4A 4FUDA 2BOKA 1LTOA 1ANCA 1LPGB 4WH6A 1O2QA 4NIYA 2HALA 2J98B 2PP6A 2BDBA 1GJ7B 5L6NH 4ZKSU 1HXFH 2KR7A 3UQVA 4MPWA 3NXPA 3BTGE 1ARBA 1ESTA 2WPIS 2OQ5A 1P3EA 1T8OA 1UMAH 1EJNA 2TBSA 3T29A 1DWBH 3SO3A 2G8TA 2Y82A 2HRVA 1CGHA 5DP3A 3RLYH 1NS3A 3NPSA 5ESBA 1EZSC 4ACAA 3PB1E 2BX3A 1SLXB 3A7WA 3IG6B 1EAWA 3LPRA 4YOJA 2VVCA 2JKHA 2LNCA 3BG8A 3E6PH 3SBKA 3UREA 1LVOA 2TGDA 1GGDB 2Z9GA 1V2LT 1C5SA 2WPDD 1YM0A 4DVAU 5AFZH 3VB4A 1DWDH 4YOGA 2PSXA 2BDHA 4DOQA 1P03A 3QO6A 4I7YH 1G3DA 4XBBA 3OYPA 1TOCB 4WH8A 1W7GH 1P2QA 2D1JA 4X8VH 1VR1H 3ZVAA 1F2SE 3VGCC 5JB8S 4BTTB 1U6QA 3A7ZA 1A4WH 4AFSA 2FXRA 2FO9A 3LGVA 5HMAA 1B7XB 1GDQA 1SI5H 5AHGH 1ELTA 4RN6A 2VH0A 3V13A 2GX4A 2FOHA 4ASHA 2TGTA 4XSKU 1N8OC 4ABHA 1CT4E 5JBTA 4K60A 1HIAB 3RXEA 2IJOB 3STIA 3TGKE 1LQDB 4RKJB 1N8OB 2G5NA 3QGJA 3SGAE 3ZV8A 1JIMA 3RU4D 1KLTA 1ZSKA 5HYOA 3WY8A 5CMXH 1SGCA 1W7XH 1TNHA 1T4VH 2EEKA 2HNTF 4UDWH 1TGTA 3RXJA 1OPHB 1O2MA 1W0ZU 3TPIZ 3E91A 1SGQE 4Y10E 5DO4H 4BTUB 1EAIA 3MH5A 3ODFA 1FY1A 3PV4A 2VNTA 1IHTH 4MNYA 2UUKB 2VWLA 3UB0A 4BNRA 1QCPA 1GMCG 4H6TA 2WYJA 5FBEA 4IS5A 1YPKH 2AGEX 3OFND 5F03A 1G9IE 1GVZA 1OHHD 3P8NA 4JYTA 1T8MA 1YPHE 5HIZA 3O8RA 1DX5M 3MYWA 1XKBC 4YOIA 3H5CB 1SLUB 2J34A 1TNJA 2A7JA 1HCGA 4H42U 4XE4A 1THSH 1P04A 2ZCLP 1MAXA 1TB6H 3U1IB 1O2WA 1GBBA 1A3BH 1O37A 4KTUA 4GSOA 1GBEA 1EB1H 1CT2E 3QTOH 4D76A 1NRRH 2FYRA 2YOLA 5GXPA 1YP9A 1G37A 5A0CA 2O8MA 4RSPA 2ALVA 1C1QA 4OM9A 3PTBA 4CRDA 1NROH 2GCTC 4ESTE 1X7AC 3T5FH 4X1RU 1Z8GA 3ZVFA 1C5UA 1QRZA 4DURA 1BCUH 4JMYA 1BBRK 1C5XB 1GBAA 1K1JA 4AB8A 1QZ8A 2VH6A 1BIOA 1J14A 5HM2A 3EE7A 2ZHDA 1S82A 2SGAA 2AMDA 3A7VA 4I86A 5DSFA 1UVTH 2DE9A 3U9AH 1GI5A 4TT3D 2P3UB 1THRH 1S5SA 2BHGA 3F9FA 3DD2H 3GY7A 2RFKC 1GBFA 4ZHMU 4AN7A 2QE7D 2XW9A 2BY9X 1OX1A 3MFJA 3V3MA 1AUJA 4FUIA 1C2LA 1QGFA 2ZWLH 3MU4A 5EGMA 1UTMA 3IWMA 1ARCA 4F49A 2AYWA 2GCHF 1HAVB 1NTPA 2GKVE 5A8ZA 1AVWA 2FI3E 1TX8A 4WJG2 1TGNA 2ZU3A 3ESTA 1TGSZ 3E90B 5K0HA 1IQNA 2PW8H 4NSVA 3LIWA 1TMTH 4ABEA 2CJIA 3QTVH 3F2HA 5HXFA 1DUEA 1SHYA 2VIDA 2FDAA 3QZRA 4O97A 3ELAH 1GL0E 1O5CB 4AFQA 2IPHA 2G51A 1Z8RA 2A5IA 3FO8D 2SNWA 3I77A 1ELEE 5DP5A 2BDCA 2DUCA 3BTHE 7GCHG 2CHAC 3SHCH 4O3UA 1TMBH 2XBWA 1LO6A 1GJ8B 2G00A 4MPUA 2A1DB 4M9FA 1SFIA 2I6QA 1LKAA 1QBOA 1ESBA 1J16A 1UHBA 2BQWB 3SN8A 1C9PA 1K1OA 1PPEE 5E2OA 2HPQH 3PYHA 2JH0D 1MTNB 3K9XB 1HXEH 4JZFH 5FHTA 2XC4A 1ELBA 2BY7X 2F9NA 3W94A 1DOJA 5GCHF 1V2QT 1AFQC 3UR9A 4Y8ZA 1DDJA 2ZC9H 1J17T 3PV5A 1YWUA 1FXYA 1VZQH 3RLWH 5FL7D 8KME2 1GI9B 2GDEH 2HGTH 2EY4C 2OC0A 3ZV9A 2OC1A 1S0QA 1SGFG 2P95A 2WPMS 1C5OH 1MTUA 2ZA5A 1A1RA 3PV2A 4MG3A 4NG9H 5E0GA 1RRKA 4NA7A 1LVBA 5HIYA 1DT2A 4JK6A 2NU3E 2FTMA 3DFJA 1LCYA 2CF9H 3T62A 4WVPE 2YMSB 1XUIA 1HAPH 3E8LA 1E36B 4MQAA 1K28D 4D9QA 1O3AA 1FAKH 3HKJB 3RC4A 3PO1C 1O2XA 2W3KA 4ZMAH 1ZOMA 1AI8H 1QB6A 2PGBB 1D9IA 5L2ZH 2EI7A 1BMNH 1W12U 1FY3A 1UTJA 3RXQA 1GJ4H 1MD8A 2V35A 3H09A 3JZ2B 1E38B 2JJ2D 5EW2H 1C9TA 1CA8B 1Y5UT 1P0SH 5C94A 4IC5A 1L1JA 5J4QA 2VIQA 3HK6B 3TH4H 3P8FA 4CRGA 1ZRKA 1BRCE 5ABWA 4XOJA 3RMMH 3FZDA 1C1NA 1ZTKA 3SORA 1GWAA 1KLJH 1V2KT 2VINA 1C5YB 4CRCA 2VVVA 1O36A 2A32A 1WQSA 2J98A 1Z1IA 2FPZA 2SFAA 1TBZH 2H9EH 4GUXA 1XUHA 3MNXA 1S6FA 1MQ5A 1OWJA 3KQEA 1BRUP 3W95A 4E05H 4M7GA 1ANBA 1GBDA 1DSUA 8LPRA 2VWOA 1FMGA 1DANH 3AVZA 4PROA 4OS5A 3TNTA 3ENSB 1HAHH 1OS8A 2AS9A 2F43B 3KL6A 2H9TH 2JH6D 5E0JA 1P11E 3UPEA 2GTBA 4QT8C 3T28A 1OP8A 4DGJA 1WYKA 2QXHA 3BN9A 2VIOA 1V2VT 2KCPA 1S81A 2RA0A 4BANB 7KMEH 2ODQA 3SW2B 1DE7H 3GS9A 1QR3E 1OP0A 2BDYA 4ABBA 3LOXA 4Y71A 1SPJA 3SJ9A 1C4V2 1QQ4A 2AH4X 2HNTC 5PTPA 3RDZA 3OAAD 5FX6A 1TPAE 2ZGXH 1W14U 4J2YB 2ZECA 3QWCH 2BQ7B 5F53A 3VB3A 3Q3XA 1AZZA 5GCHG 1YY3A 5TCCA 1P2NA 4WWYA 1O31A 2O8LA 4TYDA 2Z94A 4E7RG 2OC8A 3OY6U 1IAUA 1O2TA 1E0FD 1JBUH 2R0LA 1ZPBA 1Y3XA 2BD5A 2AFQB 4SGAE 1SG8B 1O2OA 4TY6A 2K1QA 3MNCA 2UWPA 4ABIA 1FUJA 4CHAC 2ODPA 3NZIA 3LT3A 4X2VA 5C0TA 1JMOH 1O3FA 4U01A 1DS2E 1LHGH 1AE5A 3D23A 5A0BA 3A83A 3MU1A 1GHXH 3VB6A 1P05A 2C4FH 4BXWA 1O33A 4RKOB 4NA9H 1DPOA 2KFWA 6CHAC 4I32A 4Y7AA 4I8LA 4Q80A 5ESTE 5C1UA 2O9QA 3GCNA 4WF8A 1GI0A 1CGIE 1O32A 4CRAA 4DT7B 2A2QH 3SNEA 1K0HA 5C1YA 4FOUC 2FP7B 4YT7H 1V2RT 1UTNA 4WY3A 4B74A 3TK9A 1OWDA 5DP8A 5L2YH 2B0FA 1Z8IB 4NFFA 5C1XA 3TJUA 1TMUH 4KGAA 1ZSJA 4YM9A 1TIOA 2ZI2H 5EQRA 3LDXH 3SUFA 2O8UA 1FIZA 4ISHH 2GCTB 3RXMA 3SU3A 2ANWA 5E0HA 2ZDKA 1GDUA 2OCVB 2KZ4A 5E8EH 2WZQA 1O3GA 2J2UA 4TWWA 5LPEA 1CO7E 4HTCH 1O2NA 3ZZ6A 2RCEA 1IQMA 3SNAA 1KY9A 1MU8B 1T31A 1S84A 5A0AE 3TNSA 2D2DA 2WSSD 3CP7A 4O3TA 1CA0C 5DP4A 3T27A 2KCOA 3MO9A 3QDZB 1OXGA 1QJ1B 2HWLB 1O3EA 4DW2U 1SLVB 4I8KA 2PR3A 1O0DH 1TGCA 5G4BA 1SVPA 1L4ZA 2ZDNA 1ZHRA 4HZHA 3KN2A 1GL1A 1FQ3A 3EA8A 1VCPA 2Q6GA 1GVKB 1HAYB 1Y3WA 1H9LB 3UR6A 1GI2A 1B0FA 3M61U 2KAIA 4WXIA 1F0UA 1ACBE 3MI4A 1C5LH 1G3EA 1J8AA 2BD9A 3SUDA 3D62A 1HDTH 1C2EA 4BAMB 2A4QA 1RIWB 2F83A 1YC0A 4ABGA 1YKTA 1HUTH 3N99A 2F9PA 8GCHG 4CH2B 2QN5T 1MKWK 3A7TA 3RXOA 1TRYA 1QB1A 2WINI 2V6NA 1JIRA 1KXEA 4IMQA 4LZ1H 1OWHA 3K6ZA 2FM2A 3B23B 3UY9A 4XDEA 3BG4C 2GJGA 6LPRA 3TJVA 1ZMNA 1ELVA 1MH0A 1P2KA 4B2CA 3GDSA 3ZZ8A 5HM9A 3SJOA 4GLYA 5EOKA 1EP6A 2NWNA 2H6MA 4XRNA 3ZVBA 3LONA 3U69H 2BM2A 5EXNA 1CU1A 1QB9A 5ETXA 1SQOA 1HAVA 5LGOA 1HGTH 2GMTC 3U8OH 4AOQA 3RXSA 2QYIA 3BSQA 4IGDA 3ZZ4A 4OS2A 4GHTA 8GCHF 3SNDA 3K65B 2TPIZ 4WMEA 3BEFB 4X1SU 5FX5A 1PPHE 3DCLA 1YPHC 3UWJH 2KM0A 3F9GA 3CENA 4B2BA 2A4OA 1OOKB 2PFEA 3LGIA 4ZKNU 4Z0KA 2B7DH 1V2ST 1A5HA 2WV5A 1BHXB 4K1TA 3BG4B 2M5TA 4RT1A 3FVFB 4X6MA 2O8TA 3HATH 1GBTA 1NFXA 3QX5H 4Y76A 6ESTA 1C5TA 4ISIH 1D3QB 2QF3A 5T1VA 1ID5H 3BTWE 5F8ZA 3ZZDA 2PGQB 2Y5HA 4ZKRU 7ESTE 3BIVH 2OD3B 1PYTD 1RS0A 5FPYA 1SFQB 1TX6A 1MKXH 3GDUA 3M5OA 3K6YA 3FAOA 1BTZA 2OXSA 2ZNKH 1PPBH 1W0JD 5K7RA 1KXCA 4Q2KA 1QIXB 2B8OH 1V2UT 2ANYA 2STAE 3L33A 2FOAA 3GY5A 1O3HA 2BTCE 2GT8A 5C67A 2ZHEH 3EA9A 2OBOA 1AVXA 2XXLA 2A7HA 4X2XA 1FY8E 1D6WA 3MU5A 1MD7A 1P9SA 2ANMH 1ESAA 2ZU5A 3ATMA 2V3MA 2ZFSA 5GPIB 5J4SA 3M5NA 2FS9A 2FX4A 4OGYA 1C1SA 1A3EH 1UTPA 5JPMH 1NN6A 2F9UA 5LH8A 2ZPQA 5JBBS 1GBCA 1TX7A 3OEHD 2FESH 2WUBA 3UTUH 2OP9A 3SU5A 4P00A 4JZEH 4BAQB 3S9BA 3AK5A 4TPIZ 1H8DH 1EASA 1PQ5A 1O3LA 1BTUA 1YF4A 2EI6A 2XCFA 4YESB 5I46H 1BRBE 1Z8JB 1MUEB 1WDIA 3MHWU 4UEHH 1L2EA 4INLA 5HKKD 1KIGH 3GISB 4ABDA 1V2WT 2STBE 2OK5A 3SZNA 1ZGIA 5FBIA 1XUGA 4U32A 1SC8U 1O2PA 2K0QA 2UUJB 2BD7A 1FY5A 5JBCS 1C2IA 1XVOA 1GDNA 2XBXA 4D7GA 5EW1H 4FU7A 1YCPK 2H9HA 3ZZ3A 4NA8A 1KMHB 2W5EA 1K1NA 1ZGVA 4X8TH 4UONA 3TK6A 4X1QU 1P2OA 1NY22 2JH5D 2XCNA 3MO3A 1PPZA 1COWD 3OTJE 4F48B 1HNEE 1O5GH 1XKAC 2XOKD 2LP6A 4MNVA 1IQLA 1SQRA 2Z9LA 1N6YA 1EPTA 4K8YA 2C90B 2V7QD 1TAWA 1SGIB 3T2NA 3JZ1B 2FOBA 1C2HA 3QZQA 1EUFA 3DSPA 3SV6A 1FIWA 1ETSH 1T32A 2VIPA 3HPTB 3OU0A 4AB9A 3UFAA 1YLNA 3TGIE 2ZIQH 2JJ1D 2LPRA 4CRBA 4YXWD 1GHWH 5C3NA 1RD3B 2QIQA 2QV1A 1SBWA 3M37A 1O2RA 4H6SB 3OEED 1YLDA 1TYNA 5DJ7A 1ZRBA 2WV9A 1TNKA 1K2I1 1TPSA 3SU6A 3F1SB 1C1OA 2BD8A 3RXKA 2G4TA 1C5ZB 1EOLA 1HAIH 4AFUA 1HAZB 2XC0A 3DA9B 1GBMA 2C8XB 3RXIA 3E3TA 3GYLB 3SU2A 2FX6A 2FZZA 2I6SA 1E34B 1AWFH 4CHAB 1E37B 3KCGH 1YPGH 1OYQA 1K9OE 1WOFA 1QL9A 4Y6DA 1LHEH 2W7UA 2BLWA 4A6LA 3RXDA 3PM3A 3MH7A 2HOBA 1BITA 2JIZD 1KDQB 3Q77A 4NZLA 1C1WH 2SGFE 4A7IB 2A31A 2Y80A 2AGGX 1EPTC 1LPKB 1DLEA 2EI8A 1VKYA 4ZROA 2OTVA 2A0QB 1ZTJA 1UVPA 3IITA 1VCQA 1HAOH 1HB0B 3PMHB 3SQEE 2A4GA 5JYIA 1SOTA 3BTDE 1P3CA 4LK4A 1AZ8A 4D8NA 1GI6A 3FP8E 3RMOH 3BF6H 4FVDA 1SGFA 1PPFE 4GCHG 1UTOA 1SGEE 1GMCF 1O39A 4A1XA 1P8VC 3RXBA 4YLUA 4HI3A 2Y6TA 1NU7B 1UW7A 2ZFQH 2ZQ1A 1SSXA 3LC3A 2VJ1A 2ZDMA 1AHTH 2J95A 1ELGA 5EPYA 3SUEA 4JCNA 6CHAB 4CH8B 1WCZA 4B71A 1DLKB 3TK5A 4ABFA 3GDVA 4MTBA 2R2MB 1DVAH 2ZGJA 4FUJA 3ZZ5A 3GCHB 1FX0B 2P16A 6GCHG 4WMDA 5F6MA 1C5VA 1MAYA 1C5WB 4YLQH 4NFEA 3KIDU 4J1YA 3SHAH 2G81E 3CS7A 3MTYA 1MU6B 4OS1A 4B75A 4BXSA 2AIQA 1BHXF 1NFYA 2VIVA 1HBTH 3GICB 3Q00A 1GJBB 1A7SA 2QY0B 3RXFA 1FDPA 1C1VH 1YPJH 2J5UA 4GCHF 1ELFA 1GI8B 1BUIA 3VXEH 3PRDA 2ZDVH 2VB0A 1BMFD 3O8CA 2P3FH 3S9AA 3ZZ7A 4Y0ZE 1H8HD 1LQEA 1CA0B 1HAXB 1OSSA 4A1VA 1O5FH 3T25A 1O5AB 3MNBA 1KTSB 1CGJE 1O2VA 4FUGA 2ZG0H 1VITF 1RXPA 2XNDD 3M7QA 1BTPA 1K22H 1WBGB 3FP7E 3WWFA 1CSOE 3SU1A 3A82A 2PWXA 1F92A 5EU8A 2BZ6H 1O2IA 4IC6A 2ZO3H 3SQHE 1WTGH 3C27B 2ZDLA 5DP7A 1ETTH 1YBWA 3KQ5A 2A4RA 1MQ6A 1KYNA 2BXUH 5C2ZA 1LMWB 2BDGA 2XYAA 3MO6A 1DY8A 3E0NB 4DIIH 1QJ6B 2KCYA 1YPLH 1TPOA 4A5TS 3K2UA 4ZUHA 4JYVH 1PPCE 2GV6A 3H7TA 1W3CA 5DPAA 1DICA 3F3BA 4FETA 3U8RH 1V2NT 3RXGA 1IQIA 3AW1A 1T8LA 1P02A 2F9VA 4GHQA 4UFFH 2P8OC 4Q7YA 1BJUA 3OTPA 1MTVA 1EJMA 4CREA 1QA7A 4IN2A 2HLCA 1O34A 3VB7A 3LGTA 1EQ9A 1TPPA 1LHFH 1NM6A 2Y5GA 1IQFA 1BOQA 3D65E 1YCPH 1GG6B 3WW7A 1EZUC 3QUMP 3HKIB 3MWIU 3H7OA 3QN7A 3UUZA 1K1IA 1GVLA 1TRNA 1G2MA 1WV7H 4U2WA 5JDUB 2GZ8A 2P8OB 1O3DA 2QA9E 3NRLA 1AKSA 4K8BA 5DGJA 2WPJS 2HLDD 5KGOA 2SGQE 2Z9IA 2ZCKP 4ZH8A 5B6OA 3N7EA 1EATA 1WU1A 1JOUB 4H4FA 2ZTXA 3A7XA 3O8DA 1H1BA 1Y3VA 3SNBA 2Z9JA 4Y7BA 1MTSA 2K8IA 3LC5A 1GCDA 4DT4A 2NU1E 1DUAA 1XUFA 2AGIX 4Q7ZA 4K5ZA 1RTKA 1Y5BT 2ZFPH 3TH3H 4MPXA 2Z3DA 5FPSA 3UOUA 1SMFE 3RM2H 1JRSA 1HYLA 8ESTE 4KKDA 1GHBG 4UFGH 1D4PB 4B6EA 1O2LA 3WWBA 5JB9S 1PQ8A 3RXHA 3U1JB 3TJOA 1A61H 1GI1A 2BD2A 1AU8A 4NIVA 4E06H 1KTTB 1ELDE 3SUGA 1O2UA 4NIXA 1C1UH 1UCYH 3A8CA 5IYTA 4ABAA 1O3IA 1OYTH 5DP9A 2FLBH 2AEIH 1TE0A 1ZPZA 3E0PB 1QHRB 4YO9A 3LH3A 3TJNA 5AVDA 3V7TA 5B6LA 1T8NA 2J4IA 2Z3EA 1QA0A 2GCHG 2F9BH 1C4Y2 1D3TB 4GVUA 5A8XA 4ZXXH 4BOHA 1D3DB 3N7OA 1O3CA 1A5GH 2ODYB 3F0OA 1D6RA 2G4UA 2FLRH 3V12A 4ZHAA 1S0RA 3L3TA 4TY7A 1ABJH 4B6FA 1QQUA 4ZXYH 1G3BA 3G01A 2XWAA 5H4IB 2CK3D 4Y0YE 3RXUA 1GPZA 1RTFB 1KLIH 4NWLA 2Y5FA 3SU0A 1AQ7A 1MZDA 1QBNA 2AERH 3RM0H 1ANEA 4U30A 1EOJA 1TA2A 1GMDG 4FUEA 3TVJB 3M3VA 1AVGH 3PMAB 3NUMA 1YPEH 4ZCNA 1EPTB 1WXRA 1TBRH 1TGBA 1C5PA 5DG6A 5L30H 2BMGB 2GP9B 3PWCA 5C17A 1ORFA 4X2WA 1G2LA 3F9HA 1EZQA 1P2MA 2WPKS 5CHAB 7GCHF 1SQAA 1SR5C 1WUNH 3EGKH 4AORA 1SGRE 1J9CH 1M9UA 1QL8A 3BTKE 5GNDA 3N7DA 1C2KA 1LHDH 4OS4A 3S69A 4INHA 9ESTA 4UD9H 1HPGA 1G30B 2IN2A 2JETC 3MMGA 1L4DA 2VVUA 1DM4B 3R3GB 1RGQA 1O2KA 1O3PB 2FEQH 3RXVA 1LKBA 1SGYE 2TGPZ 4XBCA 2BQ6B 3LGYA 2YMSD 5C5NA 2Q1JA 2J94A 1T4UH 1O2GH 1V3XA 3GY6A 2OC7A 1ETRH 3RP2A 1BBRE 2CHAB 5KEDA 1HIAA 1AFQB 1P12E 1NBMD 2BLQA 3ZVCA 5LPFA 1VJ9U 1FONA 1HRTH 3SV2H 2Y7XA 3M3TA 4Y79A 1H4WA 2PSYA 2CV3A 1K1MA 3P17H 5EJZA 3UWIA 3VG8A 5C20A 2PUXB 1QFKH 4KTSA 4RI0A 2OINA 1V2MT 3P8GA 4AYYB 5HGGA 1AMHA 1QBVH 3UNSA 2FWWA 1AY6H 4SGBE 4MPVA 2GZ7A 1G32B 5DK1A 1A46H 1PYTC 1OP2A 2KX4A 2BOHB 1YYY1 1C5MD 2Z7FE 3KGPA 3B8JA 4CR9A 2Z9KA 3QLPH 1OWKA 4X0WU 3SV9A 3PWBA 4K69A 1BBRH 2V3HH 4AZ2B 4D9RA 2PKSC 1O2ZA 1W13U 4DIHH 3U98H 1HAGE 4MVNA 2J97A 4X1NU 3SU4A 4WXVA 3ZZAA 2BY6X 1AE8H 3BTFE 3M5MA 4AX9H 3KYFA 1A0JA 2ZU2A 1LHCH 2ZDAH 4JZIA 1F0TA 4D7FA 1RTLA 3VB5A 1EB2A 3PLBA 1WQVH 1V2JT 2V0BA 4OGXA 1QRWA 4TPYA 2F4LA 3SGBE 2TRMA 3P8OA 2SNVA 3LKWA 2ZQ2A 5DP6A 1ZYOA 1MMJN 1CVWH 1NRNH 2W6JD 2B5TB 1VGCC 1P06A 4GAWA 1O5BB 3A8AA 3TGJE 3A8DA 2Y7ZA 1VGCB 1GGDC 3BEIB 3F2FA 4E7NA 2PTCE 2HVXA 2A5AA 1EZXC 1TNGA 4HGCA 3RXTA 3OX7U 1C1PA 1IHSH 1LVMA 3LGWA 5CHBA 2SGPE 1Z7KA 2G55A 1O2JA 3B9FH 1TWXB 3UIRA 1Q3XA 1QL7A 1VITG 3ATWA 3A87A 1AN1E 2P93A 1ZPCA 3RXPA 5EJLA 2BB4A 4FU8A 3FZZA 3FANA 7LPRA 4I31A 2WUCA 1XUKA 2UUFB 4BAKB 2GV7A 2ZGCA 3ATLA 2BXTH 3KF2A 3MH6A 4XFQA 1XUJA 4AGKA 1LVYA 1AGJA 4DY7B 5KECA 1NC6A 1DWCH 2C8WB 2JETB 2NU0E 1IQJA 1TALA 1UCYE 3M36A 1O3JA 1P10A 4K2YA 2C3SA 3TU7H 2G52A 2QGRA 5E2PA 1TA6A 3GY4A 3SOSA 1RIWC 2AMQA 2SGEE 2A45B 4THNH 1E35B 1ZSLA 1AIXH 1F7ZA 1O3OA 1NBME 1Z6JH 4FUCA 3SGQE 1RFNA 5FXLA 4Y11E 1VITH 4R8TB 1FY4A 1THPB 2IOTA 1C2MA 1HJAC 1GJCB 1IQEA 4VGCB 1GJDB 2EQNA 1BZXE 1MKXK 3F68H 1DSTA 1UK4A 1ZTLA 3KQCA 1ZMJA 3S7KB 1GJ5H 1K21H 2BVRH 4X8UH 1FI8A 2XTTB 3PROA 1J15A 1NT1A 3SV7A 1GHYH 2R2WU 3EA7A 2LELA 1GJ9B 1FNIA 1L1NA 1TQ7B 2ZHQH 1P09A 3PLKA 1E1RD 3TITA 2BY5X 1GJ6A 1SB1H 1ZJDA 4X2YA 5EQSA 1AKSB 3P6ZB 5TJXA 2D8WA 1O35A 5EIYA 2WPHS 3NWUA 1PPGE 1AB9C 2GT7A 1GCTC 3BTQE 1TFXA 1ZR0A 1O5EH 4Y8YA 2ZF0H 2F3CE 4ISLA 1QJ7B 1VJAU 1MZAA 1Q31A 4X8SH 2F9OA 3A8BA 4BAOB 1BA8B 4I8HA 1BB0B 3FFGA 1LDTT 2Q6DA 5CHAC 4JYUH 1UTKA 1GBHA 2ZZUH 3P70B 3I29A 4P02A 2R9PA 5TCAA 1MTWA 1GHZA 4MNWA 4F55A 1W11U 2CN0H 4A1TA 3P92A 4CRFA 1TRMA 2QC2A 3T26A 1C5QA 1O2SA 2D26C 2FYQA 3FP6E 2XC5A 2OBQA 2QF0A 4JK5A 1QURH 2H5CA 2H2ZA 2ZFTA 2NU4E 4ISOA 3KYGA 1CBWC 4X6NA 2ZTYA 1ZZZA 3GCHC 3MH4A 3ZZBA 1HLTH 1W8BH 1BTHH 2CMYA 2H1UA 4ZKOU 1SGTA 2GDDA 3UNQA 3STJA 1DXPA 3PMJA 4IMZA 3SNCA 4BAHB 2RDLA 3BTEE 1O5DH 5C5OA 1TLDA 1C2JA 5A2MH 3A84A 2V3OH 3Q76A 3GYMA 3S9CA 2A2XH 3EDXB 5GWZA 1UVSH 2C8ZB 2P94A 3GCTF 1JRTA 2FOGA 4Q4LA 1TNLA 1ELCA 2PUQH 5C0UA 1KXBA 4IW4E 1BMAA 4Q7XA 2G5VA 1ZLRA 4YTAA 1NESE 1BQYA 1NRSH 1OWIA 2HPPH 3F6UH 1F0SA 4LZ4B 1CQQA 2FIRH 4O03A 1C5NH 1O3KA 4HG6A 3SYJA 1GBJA 2J38A 3URDA 2A5KA 4TSFD 2Y81A 1CBWB 1C2FA 1W2KH 4LOYH 3KQBA 3DT0H 1BDAA 2VWMA 2SGDE 2YNBA 1BRAA 4B1TA 1GJAB 3A80A 4ABJA 1OKXA 3TLOA 1SLWB 2C8YB 1WTHD 1SHHB 1GI7B 4NCYA 3DUXH 3KHVA 1NFUA 1F5RA 2WYGA 3GCOA 4JZ1A 2ZHFH 2BX4A 1AO5A 1VCWA 2RDEA 3P95A 1UO6A 2PKAB 1ZJKA 2BY8X 1SL3A 3UAIC 2Z6BD 2FODA 2GGVB 4MNXA 1EAUA 5EJ1A 1GBLA 3FOAA 3QK1A 3KNXA 1BMMH 1FPCH 2ZTZA 4X6OA 1Y3YA 2UWOA 2ZHWH 4FU9A 4KP0A 1C4U2 3RXCA 1F0RA 5IK2D 2W6ID 3RXLA 4OS6A 2ESTE 3LJJA 3E16B 3RC5A 4AGJA 5LPRA 4B73A 2R3YA 4DJZB 2Z3CA 4DCDA 9LPRA 3D49H 2W26A 1IOEA 1IQKA 3UOPA 1A2CH 5EQQA 3OSYA 4ISNA 3RU4T 1FPHH 1XVMA 2J9NA 1GHBF 1MBQA 4X1PU 1UK2A 3RC6A 2TIOA 2QF4A 1MCVA 1NU9A 1O2YA 1FN6A 5CE1A 3CNRA 1HJ8A 1V2OT 1AFEH 1DY9A 2RA3A 4INKA 2PHBA 2GZ9A 1ZHPA 4A92A 3GY2A 4HFPB 1W10U 2BYAX 4XBDA 2IPQX 4YZUA 1FN8A 3SV8A 3GOVB 1BTYA 2WHXA 4KELA 4OS7A 2VU8E 4YT6H 1G3CA 2GVFA 3A81A 1K1LA 1INCA 3L6PA 1BTXA 3BTTE 2FI5E 2VIWA 4WMFA 4NWKA 3ATIA 1TQ0B 3RMLH 5FCKA 1S85A 4AFZA 6GCHF 2FOCA 1MTNC 4I8JA 1TONA 5IDKA 2VBCA 4FXGH 1O30A 3ZVGA 2ZP0H 1NFWA 1HJAB 2J92A 2W7SA 1XX9A 1NO9H 1C2DA 2NU2E 2THFB 1EFRD 1IQGA 1JWTA 1FAXA 4ZAEA 2EA3A 3RMNH 3M3SA 1E79D 2ULLA 3A7YA 3ZVEA 1S6HA 3M35A 5T6FA 2VGCC 5AFYH 1SQTA 3HGNA 2KAIB 1T7CA 1YGCH 3LU9B 1YLCA 1C5RA 4BTIB 3F0PA 3EQ0H 4GPGA 4K3JA 3HK3B 2OQUA 4B2AA 3PRBA 3A88A 2KCAA 1N6XA 2L74A 3NKKA 3ITIA 3PLPA 1W0YH 2YMSC 1GI3A 2HVYB 1Y5AT 3F9EA 3VEQB 5SGAE 4B76A 3MQKC 2C93B 1WAYB 1V2TT 1GHAG 2H5DA 3LH1A 1KXDA 3GCTG 2IJD1 2WPLS 1XXFA 4NIWA 4X6PA 3RUOA 2BVSH 1MABB 4DG4A 2PV9B 3DSGA 4UFEH 3NCLA 1FZZA 1E1QD 1KSNA 3OY5U 3HGPA 3ZIAD 4JZDH 1KDQA 2EC9H 1DFPA 1ABIH 1N1LA 3S7HB 2HNTE 2P3TB 3EE0B 1AUTC 2AIPA 3DHKH 1DXWA 1DWEH 3NK8A 2A7CA 3M5LA 3MNSA 1Z6EA 3ODDA 1BT7A 4KTCA 1FV9A 4AYVB 1O2HA 1SGNE 3RXAA 2VWNA 5FPTA 2ILNA 5EODA 4NGAH 3AASA 1P01A 2XBVA 2ZGHA 1TABE 4FUFA 2ZEBA 4ACBA 5EPNA 1CHOF 1A0HB 1HFDA 4MDSA 1O3MA 2OUAA 1PQ7A 3SJKA 3SJ8A 1C1MA 3A89A 2BDAA 1AWHB 1L0ZA 1UK3A 1LPZB 5EG4A 1EP5A 1A0LA 3VXFH 4UFDH 2QAAA 3W1EA 2PTNA 1JXPA 2FMJA 2OLGA 3VPKA 2ZPRA 4ASUD 4K1EA 1NPMA 3BIUH 2GMTB 5CDFE 3EYDA 1SGDE 3KQDA 1GI4A 1O38A 3UQOA 2QXJA 1WSSH 5EXLA 3ZZCA 2BDIA 1CT0E 2QXGA 3CS0A 3VFEA 1XMNB 1HJ9A 1EAXA 1GMHG 2CF8H 2BLVA 2ZFRH 2W3IA 1GBKA 4CBOA 1ANDA 1CE5A 3O8BA 2P59A 2RG3A 1TNIA 1QY6A 1W0KD 1MBMA
chains in the Genus database with same CATH topology
5GDSH 5A09A 3MOCA 3C1KA 3A86A 1B0EA 2FOMB 4K1SA 4I8GA 2FTLE 4TWYA 4F4OC 1UVUH 3SJIA 1YPMH 1BJVA 4CR5A 3GY8A 3UNRA 1PFXC 2XBYA 5JBAS 1XXDA 3PTNA 2R0KA 1P9UA 2FOFA 3AAVA 1GBIA 4IBLH 1FJSA 4NSYA 1V6DA 3EAJA 3SI3H 1MCTA 2ZFFH 1O3NA 3PO1B 2FI4E 1BMLA 2ALPA 1GHAF 5F8XA 5BRRE 5I25A 2VGCB 2ZPSA 2ASUB 2ZCHP 1UTLM 3ZVDA 3GY3A 1Z71A 1F5KU 2BD4A 3Q3KA 1EKBB 1P57B 1TOMH 3AW0A 3M7UA 1CHGA 2QXIA 1H8IH 4IN1A 2CXVA 2PKSB 3QGNB 2FOEA 4Z6AH 3BV9B 1CHOG 2R3UA 1K1PA 3LGUA 4AG1A 1Y59T 1Y3UA 3DFLA 1Z1JA 1ELAA 2YNAA 1GG6C 3RU4E 1EXFA 2O8WA 3S0NA 1SGPE 2ZU1A 4FVBA 2ZGBH 3A85A 2XRCA 1UTQA 3RXRA 1NRPH 5FAHA 3E1XB 1D3PB 1Q2WA 2BZAA 1C1TA 1L1GA 1C2GA 2UUYA 2UWLA 1DITH 1UHBB 1UJ1A 2B9LA 3KEEA 1BTWA 2CGAA 5GJ4B 1IQHA 4ZHLU 1HV7A 1KXFA 1PJPA 3VGCB 1B5GH 1EJAA 4NZQA 1C1RA 1A5IA 4FUBA 4O9VA 1S83A 5DKMA 1NRQH 4R0IA 3URCA 4Y8XA 1TBQH 3U8TH 3ATKA 4MLFB 2BD3A 1YCPM 3I78A 2BVXH 1F5LA 3LJOA 5T6GA 3AAUA 1GCTB 1XM1A 1AD8H 1KXAA 4CBNA 1UCYK 4I33A 1QRXA 2AMPA 5EXMA 1RJXB 2DE8A 3ZZ9A 1NZQH 3ZYDA 3SI4H 1OWEA 3V0XA 5GIBA 1EX3A 1QNJA 1V2PT 2PKAA 3MU8A 1G36A 3R0FA 1H9IE 1SOZA 3MU0A 5T6DA 1O3BA 4FUHA 2Q6FA 1GHVH 2BLOA 2ZKSA 1GMHF 3TIUA 1GMDF 3M7TA 2FS8A 5FCRA 2ANKH 1FLEE 4VGCC 5AF9H 1QTFA 1AB9B 3PMBB 2F91A 3TH2H 2WV4A 2QCYA 5A8YA 5BPEA 1P2JA 1PQAA 4UE7H 1Y8TA 3Q3YA 5F8TA 1ZHMA 2XWBI 1MKWH 1P2IA 3BTME 4LXBH 1H9HE 4AG2A 2XNIA 2TGAA 3BEUA 5T3HA 1ZMLA 2PLXA 1UVOA 2GD4B 3ZYEA 2ZU4A 4FUDA 2BOKA 1LTOA 1ANCA 1LPGB 4WH6A 1O2QA 4NIYA 2HALA 2BDBA 1GJ7B 5L6NH 4ZKSU 1HXFH 3UQVA 4MPWA 3NXPA 3BTGE 1ARBA 1ESTA 2WPIS 2OQ5A 1P3EA 1T8OA 1UMAH 1EJNA 2TBSA 3T29A 1DWBH 3SO3A 2G8TA 2Y82A 2HRVA 1CGHA 5DP3A 3RLYH 1NS3A 3NPSA 5ESBA 1EZSC 3PB1E 2BX3A 1SLXB 3A7WA 3IG6B 1EAWA 3LPRA 4YOJA 2VVCA 2JKHA 2LNCA 3BG8A 3E6PH 3SBKA 3UREA 1LVOA 2TGDA 1GGDB 2Z9GA 1V2LT 1C5SA 1YM0A 4DVAU 5AFZH 3VB4A 1DWDH 4YOGA 2PSXA 2BDHA 4DOQA 1P03A 3QO6A 4I7YH 1G3DA 4XBBA 3OYPA 1TOCB 4WH8A 1W7GH 1P2QA 2D1JA 4X8VH 1VR1H 3ZVAA 1F2SE 3VGCC 5JB8S 4BTTB 1U6QA 3A7ZA 1A4WH 4AFSA 2FXRA 2FO9A 3LGVA 5HMAA 1B7XB 1GDQA 1SI5H 5AHGH 1ELTA 4RN6A 2VH0A 3V13A 2GX4A 2FOHA 4ASHA 2TGTA 4XSKU 1N8OC 4ABHA 1CT4E 5JBTA 4K60A 1HIAB 3RXEA 2IJOB 3STIA 3TGKE 1LQDB 4RKJB 1N8OB 2G5NA 3QGJA 3SGAE 3ZV8A 1JIMA 3RU4D 1KLTA 1ZSKA 5HYOA 3WY8A 5CMXH 1SGCA 1W7XH 1TNHA 1T4VH 2EEKA 2HNTF 4UDWH 1TGTA 3RXJA 1OPHB 1O2MA 1W0ZU 3TPIZ 3E91A 1SGQE 4Y10E 5DO4H 4BTUB 1EAIA 3MH5A 3ODFA 1FY1A 3PV4A 2VNTA 1IHTH 4MNYA 2UUKB 2VWLA 4BNRA 1QCPA 1GMCG 4H6TA 2WYJA 5FBEA 4IS5A 1YPKH 2AGEX 5F03A 1G9IE 1GVZA 4JYTA 3P8NA 1T8MA 1YPHE 3O8RA 1DX5M 3MYWA 1XKBC 4YOIA 3H5CB 1SLUB 2J34A 1TNJA 2A7JA 1HCGA 4H42U 4XE4A 1THSH 1P04A 2ZCLP 1MAXA 1TB6H 3U1IB 1O2WA 1GBBA 1A3BH 1O37A 4KTUA 4GSOA 1GBEA 1EB1H 1CT2E 3QTOH 4D76A 1NRRH 2FYRA 2YOLA 5GXPA 1YP9A 1G37A 5A0CA 2O8MA 4RSPA 2ALVA 1C1QA 3PTBA 4CRDA 1NROH 2GCTC 4ESTE 1X7AC 3T5FH 4X1RU 1Z8GA 3ZVFA 1C5UA 1QRZA 4DURA 1BCUH 4JMYA 1BBRK 1C5XB 1GBAA 1K1JA 4AB8A 2VH6A 1BIOA 1J14A 5HM2A 2ZHDA 1S82A 2SGAA 2AMDA 3A7VA 1UVTH 2DE9A 3U9AH 1GI5A 2P3UB 1THRH 1S5SA 2BHGA 3F9FA 3DD2H 3GY7A 1GBFA 4ZHMU 4AN7A 2XW9A 2BY9X 1OX1A 3MFJA 3V3MA 1AUJA 4FUIA 1C2LA 1QGFA 2ZWLH 3MU4A 5EGMA 1UTMA 3IWMA 1ARCA 4F49A 2AYWA 2GCHF 1HAVB 1NTPA 2GKVE 5A8ZA 1AVWA 2FI3E 1TX8A 4WJG2 1TGNA 2ZU3A 3ESTA 1TGSZ 3E90B 5K0HA 1IQNA 2PW8H 4NSVA 3LIWA 1TMTH 4ABEA 2CJIA 3QTVH 5HXFA 1DUEA 1SHYA 2VIDA 2FDAA 3QZRA 4O97A 3ELAH 1GL0E 1O5CB 4AFQA 2IPHA 2G51A 1Z8RA 2A5IA 3I77A 2SNWA 1ELEE 5DP5A 2BDCA 2DUCA 3BTHE 7GCHG 2CHAC 3SHCH 4O3UA 1TMBH 2XBWA 1LO6A 1GJ8B 2G00A 4MPUA 2A1DB 1SFIA 2I6QA 1LKAA 1QBOA 1ESBA 1J16A 1UHBA 2BQWB 3SN8A 1C9PA 1K1OA 1PPEE 5E2OA 2HPQH 3PYHA 2JH0D 1MTNB 3K9XB 1HXEH 4JZFH 5FHTA 2XC4A 1ELBA 2BY7X 2F9NA 3W94A 1DOJA 5GCHF 1V2QT 1AFQC 3UR9A 4Y8ZA 1DDJA 2ZC9H 1J17T 1FXYA 1VZQH 3RLWH 8KME2 1GI9B 2GDEH 2HGTH 2OC0A 3ZV9A 2OC1A 1S0QA 1SGFG 2P95A 2WPMS 1C5OH 1MTUA 2ZA5A 1A1RA 4MG3A 4NG9H 5E0GA 1RRKA 4NA7A 1LVBA 1DT2A 4JK6A 2NU3E 2FTMA 3DFJA 1LCYA 2CF9H 3T62A 4WVPE 1XUIA 1HAPH 3E8LA 1E36B 4MQAA 1K28D 4D9QA 1O3AA 1FAKH 3HKJB 3RC4A 3PO1C 1O2XA 2W3KA 4ZMAH 1ZOMA 1AI8H 1QB6A 2PGBB 1D9IA 5L2ZH 2EI7A 1BMNH 1W12U 1FY3A 1UTJA 3RXQA 1GJ4H 1MD8A 2V35A 3JZ2B 1E38B 5EW2H 1C9TA 1CA8B 1Y5UT 1P0SH 4IC5A 1L1JA 5J4QA 2VIQA 3HK6B 3TH4H 3P8FA 4CRGA 1ZRKA 1BRCE 5ABWA 4XOJA 3RMMH 3FZDA 1C1NA 1ZTKA 3SORA 1GWAA 1KLJH 1V2KT 2VINA 1C5YB 4CRCA 2VVVA 1O36A 2A32A 1WQSA 1Z1IA 2FPZA 2SFAA 1TBZH 2H9EH 4GUXA 1XUHA 3MNXA 1S6FA 1MQ5A 1OWJA 3KQEA 1BRUP 3W95A 4E05H 4M7GA 1ANBA 1GBDA 1DSUA 8LPRA 2VWOA 1FMGA 1DANH 3AVZA 4PROA 4OS5A 3TNTA 3ENSB 1HAHH 1OS8A 2AS9A 3KL6A 2H9TH 2JH6D 5E0JA 1P11E 3UPEA 2GTBA 4QT8C 3T28A 1OP8A 4DGJA 1WYKA 2QXHA 3BN9A 2VIOA 1V2VT 1S81A 2RA0A 4BANB 7KMEH 2ODQA 3SW2B 1DE7H 1QR3E 1OP0A 2BDYA 4ABBA 3LOXA 4Y71A 1SPJA 3SJ9A 1C4V2 1QQ4A 2AH4X 2HNTC 5PTPA 3RDZA 5FX6A 1TPAE 2ZGXH 1W14U 4J2YB 2ZECA 3QWCH 2BQ7B 3VB3A 3Q3XA 1AZZA 5GCHG 5TCCA 1P2NA 4WWYA 1O31A 2O8LA 4TYDA 2Z94A 4E7RG 2OC8A 3OY6U 1IAUA 1O2TA 1E0FD 1JBUH 2R0LA 1ZPBA 1Y3XA 2BD5A 2AFQB 4SGAE 1SG8B 1O2OA 4TY6A 2K1QA 3MNCA 2UWPA 4ABIA 1FUJA 4CHAC 2ODPA 3NZIA 3LT3A 4X2VA 1JMOH 1O3FA 4U01A 1DS2E 1LHGH 1AE5A 3D23A 5A0BA 3A83A 3MU1A 1GHXH 3VB6A 1P05A 2C4FH 4BXWA 1O33A 4RKOB 4NA9H 1DPOA 6CHAC 4I32A 4Y7AA 4I8LA 4Q80A 5ESTE 5C1UA 2O9QA 3GCNA 4WF8A 1GI0A 1CGIE 1O32A 4CRAA 4DT7B 2A2QH 3SNEA 5C1YA 2FP7B 4YT7H 1V2RT 1UTNA 4WY3A 4B74A 3TK9A 1OWDA 5DP8A 5L2YH 2B0FA 1Z8IB 4NFFA 5C1XA 3TJUA 1TMUH 4KGAA 1ZSJA 4YM9A 1TIOA 2ZI2H 5EQRA 3LDXH 3SUFA 2O8UA 1FIZA 4ISHH 2GCTB 3RXMA 3SU3A 2ANWA 5E0HA 2ZDKA 1GDUA 2OCVB 5E8EH 1O3GA 2J2UA 4TWWA 5LPEA 1CO7E 4HTCH 1O2NA 3ZZ6A 2RCEA 1IQMA 3SNAA 1KY9A 1MU8B 1T31A 1S84A 5A0AE 3TNSA 2D2DA 3CP7A 4O3TA 1CA0C 5DP4A 3T27A 3MO9A 3QDZB 1OXGA 1QJ1B 2HWLB 1O3EA 4DW2U 1SLVB 4I8KA 2PR3A 1O0DH 1TGCA 5G4BA 1SVPA 1L4ZA 2ZDNA 1ZHRA 4HZHA 3KN2A 1GL1A 1FQ3A 3EA8A 1VCPA 2Q6GA 1GVKB 1HAYB 1Y3WA 1H9LB 3UR6A 1GI2A 1B0FA 3M61U 2KAIA 4WXIA 1F0UA 1ACBE 3MI4A 1C5LH 1G3EA 1J8AA 2BD9A 3SUDA 3D62A 1HDTH 1C2EA 4BAMB 2A4QA 1RIWB 2F83A 1YC0A 4ABGA 1YKTA 1HUTH 2F9PA 8GCHG 4CH2B 2QN5T 1MKWK 3A7TA 3RXOA 1TRYA 1QB1A 2WINI 2V6NA 1JIRA 1KXEA 4IMQA 4LZ1H 1OWHA 3K6ZA 2FM2A 3B23B 3UY9A 4XDEA 3BG4C 6LPRA 3TJVA 1ZMNA 1ELVA 1MH0A 1P2KA 4B2CA 3GDSA 3ZZ8A 5HM9A 3SJOA 4GLYA 5EOKA 1EP6A 2NWNA 2H6MA 3ZVBA 3LONA 3U69H 2BM2A 5EXNA 1CU1A 1QB9A 5ETXA 1SQOA 1HAVA 5LGOA 1HGTH 2GMTC 3U8OH 4AOQA 3RXSA 2QYIA 3BSQA 4IGDA 3ZZ4A 4OS2A 4GHTA 8GCHF 3SNDA 3K65B 2TPIZ 4WMEA 3BEFB 4X1SU 5FX5A 1PPHE 1YPHC 3UWJH 3F9GA 3CENA 4B2BA 2A4OA 1OOKB 2PFEA 3LGIA 4ZKNU 4Z0KA 2B7DH 1V2ST 1A5HA 2WV5A 1BHXB 4K1TA 3BG4B 2M5TA 4X6MA 3FVFB 2O8TA 3HATH 1GBTA 1NFXA 3QX5H 4Y76A 6ESTA 1C5TA 4ISIH 1D3QB 2QF3A 1ID5H 3BTWE 5F8ZA 3ZZDA 2PGQB 2Y5HA 4ZKRU 7ESTE 3BIVH 2OD3B 1PYTD 1RS0A 5FPYA 1SFQB 1TX6A 1MKXH 3GDUA 3M5OA 3K6YA 3FAOA 1BTZA 2OXSA 2ZNKH 1PPBH 5K7RA 1KXCA 4Q2KA 1QIXB 2B8OH 1V2UT 2ANYA 2STAE 3L33A 2FOAA 3GY5A 1O3HA 2BTCE 2GT8A 5C67A 2ZHEH 3EA9A 2OBOA 1AVXA 2XXLA 2A7HA 4X2XA 1FY8E 1D6WA 3MU5A 1MD7A 1P9SA 2ANMH 1ESAA 2ZU5A 3ATMA 2ZFSA 5GPIB 5J4SA 3M5NA 2FS9A 2FX4A 4OGYA 1C1SA 1A3EH 1UTPA 5JPMH 1NN6A 2F9UA 5LH8A 2ZPQA 5JBBS 1GBCA 1TX7A 3UTUH 2FESH 2WUBA 2OP9A 3SU5A 4JZEH 4BAQB 3S9BA 4TPIZ 1H8DH 1EASA 1PQ5A 1O3LA 1BTUA 1YF4A 2EI6A 2XCFA 4YESB 5I46H 1BRBE 1Z8JB 1MUEB 3MHWU 4UEHH 1L2EA 4INLA 1KIGH 3GISB 4ABDA 1V2WT 2STBE 3SZNA 1ZGIA 5FBIA 1XUGA 4U32A 1SC8U 1O2PA 2UUJB 2BD7A 1FY5A 5JBCS 1C2IA 1XVOA 1GDNA 2XBXA 4D7GA 5EW1H 4FU7A 1YCPK 2H9HA 3ZZ3A 4NA8A 2W5EA 1K1NA 1ZGVA 4X8TH 4UONA 3TK6A 4X1QU 1P2OA 1NY22 2JH5D 2XCNA 3MO3A 1PPZA 3OTJE 1HNEE 1O5GH 1XKAC 4MNVA 1IQLA 2Z9LA 1N6YA 1EPTA 4K8YA 2C90B 1TAWA 1SGIB 3T2NA 3JZ1B 2FOBA 1C2HA 3QZQA 1EUFA 3SV6A 1FIWA 1ETSH 1T32A 2VIPA 3HPTB 3OU0A 4AB9A 3UFAA 3TGIE 2ZIQH 2LPRA 4CRBA 5C3NA 1GHWH 1RD3B 2QIQA 2QV1A 1SBWA 3M37A 1O2RA 4H6SB 1YLDA 1TYNA 5DJ7A 1ZRBA 1TNKA 1K2I1 1TPSA 3SU6A 3F1SB 1C1OA 2BD8A 3RXKA 2G4TA 1C5ZB 1EOLA 1HAIH 4AFUA 1HAZB