2AH4X

Guanidinobenzoyl-trypsin acyl-enzyme at 1.13 a resolution
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into the serine protease mechanism from atomic resolution structures of trypsin reaction intermediates
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords beta-trypsin
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2005-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ah4X01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ah4X02
1KYNA 2AGEX 1A2CH 1XXFA 1BTZA 3ZZ4A 1FAXA 2O8MA 2DUCA 3VEQB 2RCEA 3IWMA 4Q7XA 1HAOH 1LVOA 1GI3A 2ZU4A 3QTOH 3H7OA 3A8DA 5A09A 1T32A 1TQ0B 5CMXH 1TBQH 3KQCA 1C5UA 3PTNA 5GCHG 3ZVCA 3SV6A 2G5NA 2FI5E 3QZRA 3RXHA 1SGCA 2Y5HA 4CRBA 2ANKH 2P94A 4DCDA 3ITIA 2FS8A 2ANWA 2AERH 2Y81A 2Z94A 1OS8A 4H42U 1UTLM 2RG3A 3EE0B 1HUTH 4O9VA 1SGDE 2ULLA 3A86A 2BLVA 2BVSH 2TIOA 4Y8YA 1INCA 1ANCA 1FIWA 1MTNC 2ZIQH 2ZQ2A 3FANA 1PQ5A 1H9LB 1TRMA 5GPIB 1MCTA 3CP7A 5F8ZA 1WU1A 4NGAH 1XVMA 1QR3E 2AEIH 1GI4A 1EJAA 1UTPA 1MTSA 4FU8A 4I32A 1KDQA 1ZTLA 1KLJH 1C1OA 1UTMA 3SNAA 4K60A 2PGBB 5AVDA 5F8XA 1LPKB 2Z3EA 1P12E 1EZSC 1V2UT 4JYVH 1DXPA 3URDA 1FXYA 4MNVA 3RMLH 1FJSA 1CGHA 3ZZ6A 1C5XB 2C8XB 3PYHA 1RRKA 3LGTA 1D3QB 1HFDA 1O0DH 4KP0A 1TOCB 1C2LA 1NN6A 1NRQH 3I29A 1O39A 4ZROA 1GBLA 1V2KT 2V3OH 4WVPE 4WH8A 5EQRA 2ZCLP 2HOBA 1S0RA 1Y3XA 5L2YH 1GBJA 3SNDA 2TPIZ 1MKWH 3TJOA 2TGDA 2XBYA 2GCHF 3UWJH 3AASA 5LPEA 3FP8E 1QIXB 1EPTC 1GGDC 3GCHB 1O2JA 2GZ7A 3A88A 1O2OA 4FUGA 1OYTH 1UO6A 1AVGH 3LGIA 1C9PA 1A1RA 1T8MA 4INHA 4NA9H 1IQJA 2Z9LA 2A45B 4ISNA 1ANDA 2CXVA 3P6ZB 1EP6A 2VWOA 1GCDA 1DICA 2XC0A 1EB2A 5C3NA 3OY6U 2VINA 3A89A 3RXQA 2FOGA 1DX5M 3TIUA 1NU7B 1HAVA 3ODFA 3NXPA 2WINI 3ZZ8A 3Q00A 1F0UA 1O3NA 4O3UA 3SI4H 3SZNA 1CT4E 2ZTZA 1Y3UA 1TMTH 2BD7A 2BY9X 3ZVFA 3QX5H 1ZLRA 2W5EA 3BG4C 5C67A 1P57B 1YPKH 4AGJA 1TAWA 1YPEH 3BTTE 4ZHAA 1MZDA 1O3FA 3Q76A 4NZQA 4D9QA 4VGCC 1MTVA 3A81A 3W94A 3L3TA 2EEKA 3LDXH 4CRDA 3SQEE 3A7VA 1YPLH 1XXDA 1LQEA 2SGQE 3NK8A 2VIPA 1TX6A 2BY5X 1TNLA 1V2LT 3H5CB 3ZVAA 1K1MA 3PLBA 2PGQB 1AZZA 3EAJA 2PLXA 1C1TA 1C1UH 1Z1JA 1ZTJA 1ELEE 2F83A 3SV7A 3RXTA 2CF9H 2V35A 1NZQH 2XYAA 1FDPA 3E90B 8KME2 1CA8B 1BRAA 3QLPH 2OLGA 1UCYK 2G4TA 3SORA 2OUAA 1RD3B 3BTKE 4XFQA 1O38A 2PSYA 4Y0ZE 2VGCB 1OYQA 4Y6DA 4BAKB 1DLEA 2O8LA 4UFFH 3PMJA 1WQVH 1OSSA 4M7GA 2PKAB 1CT0E 1A5HA 1MAXA 1WOFA 1BB0B 1C5RA 1Z71A 2A7CA 3B23B 3D49H 4FUHA 4IS5A 2ZWLH 3P70B 4E7RG 3KEEA 2J2UA 1Z6EA 1LDTT 2F3CE 1DLKB 1HV7A 2A2QH 1BT7A 4F4OC 6CHAB 4KTSA 1C2KA 3S7KB 4B2BA 3LOXA 1SG8B 1VITF 1DSTA 2A5KA 2BYAX 1UVPA 4UFEH 5GIBA 3AVZA 1W11U 1DWBH 1KLIH 1NFWA 3M7UA 1OWDA 6CHAC 2G81E 4ABBA 1BZXE 5FX5A 1O2NA 1FNIA 4X2WA 3SN8A 3SO3A 2XWAA 1CQQA 3ZVGA 4Y10E 1MAYA 1ZSKA 2OC0A 4DVAU 3SU5A 4K8BA 3SGQE 1GHWH 4Y76A 3RXVA 4ZHLU 3GOVB 5C5OA 2F9PA 4KGAA 4CRGA 4X2YA 1HDTH 5EXLA 4DG4A 4I8KA 1GI8B 3LKWA 8ESTE 5EXMA 2GDEH 1HAVB 1EATA 1A46H 2ZNKH 2FM2A 4GLYA 3T29A 2ZFSA 2SFAA 4AG1A 1BMAA 1O3JA 1VJ9U 2J92A 1NFUA 2XBVA 3RXOA 2GMTC 1S0QA 2FPZA 1PPEE 2AFQB 4X1QU 1XKAC 1MU8B 4DY7B 2BXTH 4J1YA 1JBUH 2HRVA 1ZR0A 1X7AC 2KAIB 3G01A 3E16B 3R3GB 2GVFA 3MNCA 3GY6A 1VZQH 2R2MB 1TB6H 1C2IA 1YPHC 1W7XH 2V6NA 2FIRH 4Y0YE 2BOHB 1C5PA 1GMHG 3M7QA 5EG4A 1XUGA 1BRCE 1AKSB 1GCTC 2VIVA 4KTUA 1O3DA 1CO7E 3DFLA 4GPGA 1YPMH 2BVXH 3VXEH 1IQGA 1GG6C 3S9AA 2FDAA 3UOPA 3MU5A 2OINA 1CA0C 3F1SB 2Q6GA 3PM3A 2BB4A 2YOLA 3QUMP 4UEHH 3ZZ9A 1ANBA 1AQ7A 1P2IA 1YC0A 2FOMB 1LVBA 4E05H 4BAOB 1FIZA 1ZZZA 1VITG 1SOZA 3TLOA 1EPTA 5HM2A 1W8BH 2WPKS 1H9HE 3M3TA 8LPRA 3RXUA 3MH4A 3RXKA 1RTFB 4CH8B 3LH1A 1FN6A 3STIA 1HB0B 1FN8A 1BTWA 2BD4A 2QCYA 2OP9A 2UUFB 3RXDA 1FPCH 1PPBH 4INKA 4X6NA 1O3KA 1UJ1A 1O3PB 4YLQH 3RXAA 1C9TA 4FUFA 1LHEH 3RC4A 2ZU2A 2QIQA 1DY9A 1SGQE 1O31A 1SGIB 3QWCH 1GI9B 1JIMA 2QXIA 4Y8XA 3RC6A 4IC5A 1F92A 1FUJA 2G52A 3O8DA 4B71A 2ALVA 5DG6A 1TA6A 2FOCA 2W3IA 4TPIZ 1EUFA 1SQOA 4ABJA 1OOKB 5FX6A 4BTTB 1GVZA 1DVAH 1B5GH 1O37A 2FESH 1ACBE 1YPHE 4DW2U 2WPJS 3MNXA 2H6MA 1D6WA 2ANYA 2ZGBH 2P3UB 4Y8ZA 1O5BB 2R2WU 4BAQB 3ZVBA 3QGNB 5FBEA 1SFQB 1J16A 1SLVB 4K5ZA 1KDQB 2FS9A 4ISLA 5E8EH 5FPYA 3OYPA 3F68H 1A3EH 1DANH 4MPVA 4WF8A 2ZEBA 2F9VA 3V3MA 5LH8A 2BDIA 3RXRA 1KXFA 2QF3A 2AH4X 5HXFA 4RKJB 3SUFA 2THFB 1P2JA 3KQEA 1VR1H 3SUEA 2GDDA 2WV5A 5FXLA 1NT1A 2WPIS 4X2VA 3M5LA 1TNHA 1P05A 1SHYA 7KMEH 4D7FA 1OWHA 1MTUA 5TCCA 1EZQA 4JZ1A 1EZUC 3ZZCA 3WY8A 1ANEA 1C5ZB 1AUJA 3NKKA 3RM0H 1SSXA 1LMWB 2HPQH 1O2KA 3I77A 5EQQA 2ZFTA 3U8RH 4NA7A 3T5FH 1ZGVA 4NIWA 1P8VC 4NCYA 1BHXF 1ELGA 1C1QA 2H2ZA 1C5OH 1L4ZA 3BTME 1IHTH 3K2UA 1SLUB 2A7JA 1F2SE 2BD5A 3PMAB 2VU8E 2GMTB 3UWIA 3A7YA 2ZDLA 1SL3A 7GCHG 1NS3A 1TNIA 3GY3A 2PWXA 3BF6H 4Q2KA 4WXIA 2GCHG 3HK6B 3VB3A 1MD8A 4IMZA 3SNEA 3UY9A 4LZ4B 5ETXA 4WMDA 1ELCA 4DIHH 2WPLS 1BJUA 3PWCA 1UVOA 3T62A 1AIXH 5HYOA 2BM2A 2P3FH 4JZFH 1O5AB 3FFGA 1HXEH 2CV3A 2SGEE 1SMFE 5E2OA 1H4WA 4CBOA 2WPMS 1UVUH 2CF8H 1J15A 1J9CH 2VWNA 1BCUH 3NCLA 1UCYE 4I8HA 2ZDAH 3GY2A 1JXPA 4U30A 2JETC 4ZXXH 4K3JA 3ZZAA 1O2LA 4CHAC 2P93A 3SU4A 1TALA 3GISB 4QT8C 3MU0A 1FY1A 1TGSZ 1GBEA 1S6HA 3M5NA 1C2MA 1AUTC 3M3VA 2A1DB 3SOSA 1O5FH 2FOHA 5EW2H 1AWFH 1Q2WA 3BV9B 4AFZA 1O2ZA 2XC5A 5DP6A 1WBGB 3F9GA 1PPHE 4K69A 5ESBA 2V3HH 4YT7H 1LPGB 2GZ8A 2ZF0H 2GTBA 3P17H 1GI7B 3RXPA 1BBRK 1D3DB 1A4WH 1DM4B 1QRXA 2VVUA 4HGCA 5H4IB 1OWEA 3SI3H 3TJVA 1EOJA 1PJPA 3VFEA 1V2NT 4DIIH 1HJAC 2JH0D 4GHTA 3TH2H 2ANMH 3S9CA 4I8JA 2WUCA 3RP2A 2HVXA 3U1IB 5F6MA 4BTUB 1P2KA 4X1PU 1WUNH 1TBZH 3RXEA 1UVSH 4I8LA 1F0TA 4K1EA 5A8ZA 3A87A 3DT0H 1GHVH 1F5KU 1GGDB 1EPTB 1EX3A 1GJ6A 1DITH 3E0NB 3Q77A 2LPRA 1C5TA 1FV9A 2W26A 2WV4A 3PROA 5JPMH 1GJ5H 2PUQH 3M5OA 1SR5C 1WSSH 4X1NU 1QL8A 3U69H 4JYUH 4UE7H 1HGTH 2P59A 1Q3XA 1YM0A 4FU9A 1PFXC 3FVFB 1NC6A 1S81A 1NRSH 5J4QA 1O36A 2NU4E 3RXCA 1E0FD 3OTJE 2B0FA 1TGBA 3V12A 3K6YA 1TBRH 3O8BA 3RM2H 1GI6A 1GBFA 1NTPA 1QA0A 3MO6A 1TFXA 2ZECA 2ZP0H 4CRCA 1OWKA 4DOQA 4Z6AH 4R0IA 3KL6A 4A7IB 2ZCKP 1VGCB 1HAHH 3TNSA 2H9HA 1GBHA 4AFUA 5EPNA 1Z6JH 1AZ8A 3RMMH 4NIXA 1ABJH 1O3GA 1FMGA 1JMOH 3EGKH 1ELFA 1E35B 3EQ0H 3LGYA 4YT6H 1A5IA 4U2WA 1GMCG 3W95A 1EAIA 5DP7A 1HLTH 2BOKA 1O5CB 2GX4A 1TX7A 2AMDA 5CHAC 1GBBA 2G5VA 2Z3CA 3QGJA 1WTHD 1ZMJA 4YOJA 1TQ7B 2JKHA 2NWNA 4ABFA 1CHOG 4FUDA 2AMPA 5F8TA 2ZFQH 3E0PB 4AB9A 1CE5A 2F9BH 3URCA 1HAZB 1ARBA 1O3BA 1H1BA 3PMHB 2XCNA 1EASA 1P01A 2ZTYA 1DUAA 2UWLA 2LNCA 2OC8A 4OGXA 5FPTA 2XCFA 3UTUH 2CHAC 2R0LA 3MWIU 3QO6A 3CENA 4B73A 4Z0KA 2WYJA 4TWYA 4OS5A 1EKBB 3SU1A 1TRNA 5JBBS 2A5IA 8GCHF 1S82A 1UCYH 3RXFA 1DPOA 1IOEA 1GJAB 1L1NA 2OBQA 4JMYA 4IC6A 5AHGH 3STJA 1QNJA 1W14U 4AGKA 3ATKA 1BMLA 1S6FA 1K21H 5EODA 6GCHG 2BMGB 4JCNA 5FCKA 4B2AA 2C90B 5K7RA 3HKJB 4SGAE 4X1RU 1HIAB 5I46H 3UNSA 4GSOA 3DD2H 2Z6BD 2PKSB 3ENSB 1O3HA 1GCTB 2P8OB 3AAVA 3OX7U 1V2WT 3MH6A 2ZG0H 2O9QA 2G8TA 3SV9A 4A6LA 2P3TB 1RFNA 4LK4A 1ID5H 2CJIA 1E36B 3BIUH 3TVJB 3DUXH 2XTTB 2GCTB 1MU6B 2OXSA 3MHWU 4D76A 3LONA 1D3TB 5BRRE 3H7TA 2SGAA 1H8DH 1C2FA 2GD4B 3GY4A 1ZHPA 1BTHH 1P9SA 4D8NA 1BTXA 4ASHA 2VH6A 1O3OA 3A7WA 1ZJDA 3MI4A 4F49A 1IAUA 1ZGIA 4BNRA 4X8SH 2PSXA 5ESTE 4U32A 3SNBA 2G55A 4A5TS 5EU8A 4THNH 2P16A 1O2WA 4INLA 2BLWA 3PLPA 5C20A 1HCGA 1AB9C 3P8OA 1YPJH 1LTOA 1DOJA 4NSYA 5DO4H 2AGGX 1HAIH 2ZGXH 2FOFA 1YPGH 3NZIA 1AO5A 3T25A 4WY3A 2XW9A 1AFQB 2H5CA 1HAXB 1VJAU 1O2UA 1SGTA 4CR5A 5GDSH 1SGNE 7LPRA 1A0LA 1V2OT 3D65E 2B8OH 3BTQE 1K22H 1TPAE 4YO9A 2Y7XA 1DDJA 5SGAE 4XBDA 1P02A 3ZV8A 2C8YB 3LT3A 5LPRA 5A0BA 2ZO3H 1GHAF 3MU4A 4MG3A 1H8IH 5DJ7A 2RDLA 4KELA 2EI7A 2Q1JA 2D26C 4I8GA 1BMNH 3RU4T 4OS1A 2A4OA 2BDYA 3K65B 3LH3A 4ZKRU 1GJ7B 2VB0A 3A7ZA 1Y5BT 4RSPA 2FODA 5HMAA 3GY7A 5LGOA 3GDVA 2EC9H 3S7HB 5E2PA 3BTHE 3TH3H 1GPZA 1O3EA 2F9NA 3L6PA 2K1QA 1SGFG 1AB9B 1O5DH 1Y59T 2XC4A 2JH5D 4H6SB 2HNTF 1ZHRA 3KCGH 1C5MD 2EA3A 3K6ZA 1LHCH 4ZAEA 1PPCE 1ZYOA 1C5WB 3S69A 1WV7H 4CRAA 4DGJA 3F9FA 1LQDB 2VWMA 1HNEE 5PTPA 1HAGE 4LZ1H 1T8OA 5IDKA 1K1JA 4Y79A 3GCTF 1EZXC 1HJ9A 2WPHS 4ABHA 2HLCA 9ESTA 3PLKA 1SLXB 5EQSA 1VGCC 1PPFE 3Q3KA 1CBWC 2FX4A 5I25A 2TGTA 4DT7B 1SB1H 2P95A 4GCHG 1YLDA 1XVOA 2R0KA 2Y7ZA 2ZQ1A 8GCHG 2A4GA 2P8OC 1WAYB 2SNWA 4NZLA 2GV7A 2XXLA 3VB4A 3MTYA 1XUIA 4IMQA 2UUYA 1O30A 2PTCE 1FZZA 1O2GH 2C4FH 1YLCA 1SBWA 4IGDA 1DWCH 1TRYA 1SOTA 1ESBA 5LPFA 4E7NA 3EYDA 1IQFA 2ZDNA 3MMGA 4YLUA 4KKDA 1ELTA 1TOMH 2DE8A 4WH6A 4ABGA 2GT8A 1LKBA 2GV6A 1TMBH 2J9NA 3UNQA 3AW0A 1C5SA 2FOAA 1TX8A 2C3SA 3AW1A 5T6GA 1QQ4A 3IITA 4JK5A 1C5NH 3TGJE 2CHAB 2VIWA 3ZV9A 2ZI2H 5JBTA 2IPHA 1GDNA 1ELAA 2BQ7B 1O2YA 1ZMLA 2SGPE 1GVLA 2BDCA 3SQHE 2STAE 5T3HA 4AOQA 1GMCF 4PROA 1BITA 1QBVH 1RJXB 2PW8H 3QZQA 1K2I1 1GJ9B 1MBQA 4NG9H 4BXSA 1C1NA 3HPTB 1GL1A 1PPGE 3GCOA 1Z8JB 4XOJA 3MNBA 1EB1H 2VVCA 2ILNA 1RS0A 3ZVEA 1UK3A 3UNRA 5E0GA 2PKSC 2QXGA 1C2GA 1TYNA 4OS6A 7ESTE 1O3AA 3M37A 1KXCA 2NU1E 4CR9A 2IN2A 3TGIE 2ZC9H 1T7CA 1G2LA 1GBDA 1YF4A 1PYTD 3M7TA 2BD9A 4A1XA 2BZAA 2NU0E 2Q6DA 2ZHWH 3EA8A 4K1SA 1NU9A 2UWOA 3UQOA 3SUDA 2QN5T 1JRSA 3U8TH 1GBKA 2ASUB 4XSKU 1QL9A 1ELDE 1O2SA 2Z9KA 1G30B 2O8WA 4AZ2B 1G3CA 1E38B 1JIRA 2J38A 4H4FA 1QL7A 1MKWK 2WYGA 3QDZB 1FY3A 1XUHA 3ZZDA 1Y3WA 3RXJA 1VCWA 1ZTKA 1Z8IB 2O8UA 4X8UH 1H9IE 4FUEA 3SHCH 3BG4B 1GHBG 4B75A 2AYWA 3SNCA 1C1PA 2GGVB 2V0BA 1MCVA 2J94A 4LXBH 3ELAH 5FCRA 3P8FA 4WXVA 3TK9A 3QN7A 1M9UA 3A85A 1TPOA 4ABIA 1AFEH 1QTFA 1EP5A 1KLTA 2C8ZB 1THPB 3RU4E 2JETB 2STBE 3UR9A 1BUIA 3ZYEA 5A2MH 3SBKA 3RMOH 1KTTB 5T6FA 3HK3B 1SQTA 2GP9B 5C1UA 4GVUA 1W2KH 3EDXB 1ZPZA 1Y3YA 3PTBA 3A7TA 2UWPA 3LPRA 2QC2A 4K1TA 1HIAA 4J2YB 4IBLH 1UHBB 3Q3XA 1KXEA 2ZKSA 4Y71A 1O3MA 1F0SA 1TMUH 1T8LA 2FOEA 1ZOMA 3UREA 1SGPE 1VCQA 1ZRBA 3LC5A 2PKAA 4BAHB 3C1KA 4X1SU 1GBMA 1RTKA 2FMJA 4MTBA 1O2HA 2Y6TA 1CBWB 3RUOA 1K1NA 2QXJA 2ZGHA 1W0ZU 4Q7ZA 4H6TA 1Q31A 4NA8A 3E91A 2BDBA 4U01A 2OQUA 1CSOE 1P03A 1TPPA 2C93B 3A82A 1O35A 2Z3DA 1XKBC 4BANB 3F9HA 3JZ2B 1ORFA 1NO9H 3Q3YA 5C2ZA 1TGTA 5A8YA 3LJJA 1HPGA 3BTEE 4AG2A 4FVDA 3RXIA 1CHOF 3AAUA 3SUGA 3IG6B 4ISHH 1HAYB 2FOBA 2BDHA 1DS2E 4ZXYH 1P04A 5A0AE 5AFYH 1O2RA 2BZ6H 3NPSA 3CS0A 1BHXB 5GWZA 1B0EA 4MVNA 5JYIA 3GY8A 4MPWA 2QGRA 1GMDF 3MO3A 3U98H 1L2EA 1MKXK 1TNGA 2ZDVH 2J34A 1MKXH 4DURA 1P3EA 3PMBB 4Y11E 4JK6A 1FY5A 1TONA 1V2JT 5JDUB 3U8OH 2H9EH 1Z7KA 5L6NH 3SW2B 5DPAA 2AS9A 3SJIA 2QV1A 3BEUA 2A7HA 5J4SA 5DGJA 1KXBA 5L30H 1QHRB 2I6SA 3PB1E 4XDEA 3UPEA 1GJBB 2VH0A 2ZPSA 1O33A 1QFKH 1C5YB 1ZMNA 1W13U 4YM9A 1YYY1 4WMEA 1YP9A 4A1TA 4GHQA 1YCPH 1QA7A 3LGVA 1QB6A 3A7XA 1T8NA 1ZSJA 2BLOA 4JZEH 4ZKOU 4I7YH 2B9LA 1KXAA 3GYLB 1CU1A 4MNYA 2FI3E 5JB9S 4TY7A 4AFQA 4Y7AA 1K1OA 2SGFE 2XBWA 1GHXH 4HZHA 1OXGA 5ABWA 1XM1A 1TE0A 1Z1IA 2D1JA 1PYTC 1A7SA 3NWUA 3P95A 1T4VH 1G2MA 1Y8TA 2C8WB 2HNTC 3SU3A 3ATMA 4B74A 1GWAA 1TPSA 2VIDA 2D8WA 1U6QA 5FPSA 3HGNA 1XMNB 2IOTA 3FAOA 1ZSLA 3TK6A 4BOHA 3MU8A 1GHBF 1AKSA 4CRFA 3TK5A 5FBIA 1XX9A 2VJ1A 4NSVA 3RU4D 3R0FA 1CHGA 1UTKA 1XUKA 1L4DA 2FTMA 4LOYH 3KIDU 1V6DA 3VB6A 1W3CA 2FI4E 1AY6H 1T31A 1ETSH 1IQNA 3KQBA 1C4U2 1UHBA 2ESTE 5TCAA 2ZHEH 3HATH 1UTOA 2Y5GA 5CE1A 1UK2A 1O32A 2A4RA 1EJNA 1GI1A 1SGEE 2H1UA 2OC1A 1PQAA 2EI8A 2PTNA 4B76A 4ABDA 1OP0A 4K8YA 3PO1B 2ZA5A 2A0QB 1ETTH 1VITH 1QRWA 4NIYA 4ZH8A 1F5LA 2FZZA 3E3TA 3SJ8A 2BXUH 4I33A 2OC7A 1HAPH 4X6OA 3SU0A 5B6OA 1GJCB 1G9IE 2OTVA 1HBTH 4JZDH 1IQHA 1C5QA 4AX9H 4BTIB 1GMDG 2AMQA 3DA9B 1N6XA 1K1PA 5E0HA 1OP2A 4AYVB 1AI8H 3ZZ5A 1UTQA 3RXBA 1ELBA 1BQYA 3N7OA 2BD2A 3LU9B 2BQWB 2QA9E 1GBTA 4ZMAH 4GAWA 4HI3A 2ZGJA 1GMHF 4NFFA 1LPZB 1NY22 2AGIX 3PO1C 2XWBI 1G3DA 4XBBA 5F03A 3CS7A 1O3IA 4B2CA 1HYLA 7GCHF 2GT7A 4A92A 3BEIB 3BTGE 1FI8A 1ABIH 1GBIA 1QB1A 2KAIA 1OX1A 2OD3B 3C27B 3T27A 3U1JB 2FTLE 3VPKA 1GBCA 3KGPA 2ZU1A 1GG6B 1BRBE 1OWIA 4FXGH 1GI5A 2ZU3A 2ZHQH 5IYTA 1F5RA 1V2RT 2D2DA 1C1MA 4ZHMU 1TLDA 3GCNA 4ZKNU 2ZTXA 1V2VT 3ESTA 3HGPA 1GL0E 1J17T 4TYDA 1BMMH 3VXFH 1S85A 2BX3A 1LCYA 4TY6A 1CGIE 2F91A 1IHSH 3TGKE 1O3LA 4AFSA 1CA0B 1WYKA 2HNTE 4NIVA 3RXMA 1BTYA 4BXWA 3S9BA 3E6PH 2ZPRA 3KN2A 1P3CA 1K1LA 3B9FH 1SC8U 4X0WU 5JB8S 5G4BA 4X6MA 1G3BA 1O2IA 1OPHB 2ODPA 3A84A 1V3XA 3O8RA 1BTPA 2BTCE 3MU1A 1WTGH 1DFPA 3F6UH 1BBRE 1S84A 2ALPA 1IQKA 1T4UH 2HGTH 1GJ4H 2PR3A 1P2OA 5A0CA 1GI2A 2BY7X 3GICB 1W0YH 4UONA 1UTNA 1BTUA 1Y5AT 4UDWH 1THSH 4AYYB 1EXFA 3UFAA 1F0RA 2OCVB 4O03A 2PUXB 3MH5A 5HM9A 4Q7YA 2HPPH 1CVWH 3SHAH 2ZDMA 3VGCC 1EQ9A 1HRTH 3V7TA 1FAKH 1MTNB 4CH2B 2Z7FE 1D6RA 4YOIA 1MUEB 3M35A 1C5LH 2BVRH 2CGAA 1ZJKA 4X6PA 1A0JA 1G32B 3T28A 1PQ8A 3BG8A 5DP4A 2H9TH 1CGJE 1DY8A 2I6QA 1K28D 1G3EA 2UUJB 2Z9IA 1GJ8B 2F9UA 5DK1A 2QY0B 2G4UA 1B7XB 3L33A 4RN6A 4DJZB 1DWDH 4ESTE 3P8NA 2B7DH 3TNTA 1SQAA 2TGAA 3SV2H 5FAHA 3EA7A 2ODQA 2ZHFH 1BA8B 3SJOA 1O5EH 2FXRA 2QYIA 3KF2A 1P09A 1P2MA 1Y3VA 3F9EA 1DT2A 1ZPBA 1HXFH 1NROH 3M61U 3FZZA 4ISOA 4TPYA 4I31A 3TITA 3DHKH 4OS4A 1FY8E 3M5MA 2A32A 6LPRA 2FX6A 2ZU5A 1NPMA 2ZFFH 1O2PA 2AIQA 2FO9A 3A8AA 4XBCA 1GVKB 5DP5A 3PV4A 2FLRH 3ZZ7A 1QJ7B 1FY4A 1J8AA 3TJUA 1A0HB 2Y80A 1BDAA 2ODYB 4ZUHA 5DP9A 1NM6A 1N8OC 3A80A 1P2QA 3K9XB 2QF0A 4IN1A 4NWKA 5EPYA 1G36A 1KIGH 1FQ3A 1SLWB 1TA2A 2BQ6B 5EXNA 4OS2A 1YCPM 4TWWA 1C2JA 2OBOA 2SGDE 3BTFE 2FP7B 3ZYDA 1Y5UT 2TBSA 2FEQH 3E8LA 4FUIA 1V2PT 1ARCA 2GCTC 4OGYA 1N8OB 3MH7A 1AWHB 4Q80A 1RGQA 4R8TB 2J4IA 3ZZ3A 2W7SA 2PHBA 3RXGA 1BOQA 1YKTA 4AN7A 5GJ4B 3T26A 1IQMA 3SJ9A 3ATWA 1JWTA 4BAMB 2Y5FA 1QJ6B 4GCHF 4CHAB 1AMHA 4HFPB 3BIVH 2CN0H 1S83A 9LPRA 1N6YA 1HJ8A 4X2XA 4FVBA 1SGRE 2VIOA 3NUMA 3DFJA 1ETRH 3UQVA 1UK4A 1SVPA 2R3YA 1TNJA 3GCTG 2R3UA 1C1RA 1UMAH 3HKIB 3GDSA 1GI0A 4MDSA 3OY5U 2YNAA 4RKOB 2VVVA 2BD3A 2QXHA 1N1LA 1L0ZA 1RIWB 1C1WH 4NFEA 2YNBA 1QQUA 3MYWA 5C5NA 2NU3E 1RTLA 3LJOA 1C2DA 1AD8H 3LIWA 1GDQA 1QBNA 4FU7A 2DE9A 1AVXA 4WWYA 1NFXA 1NRPH 1O34A 1QRZA 3D62A 4YZUA 2G00A 3MFJA 1RXPA 4FUBA 3PWBA 3RXLA 4YTAA 3BTDE 3UUZA 1KSNA 5DP3A 1V2MT 1SFIA 3M3SA 3E1XB 1AHTH 1GHZA 4OS7A 4MLFB 2VGCC 3UIRA 3A8BA 1AE5A 4WJG2 4IW4E 1NFYA 5T6DA 4A1VA 1SPJA 4UD9H 1IQIA 1J14A 1MH0A 2Z9JA 4XE4A 2ZZUH 1LVYA 3GYMA 1D4PB 1NRNH 3ATIA 1C2HA 2JH6D 1BIOA 3GDUA 2ZDKA 2Y82A 4CBNA 1YCPK 1QJ1B 1MD7A 2CMYA 3FP7E 5C1XA 1AE8H 1V2TT 1ELVA 1LHFH 2BHGA 1EAUA 1F7ZA 1MMJN 1YBWA 4YOGA 3UOUA 5GCHF 3KNXA 1BBRH 3QK1A 1OWJA 4MNWA 2ZFPH 2TRMA 1Z8GA 1THRH 4YESB 4AB8A 1K1IA 1UTJA 3BN9A 3V13A 3MNSA 2BY8X 4MPXA 1P11E 2ZGCA 1MQ5A 5JBCS 2W3KA 2BD8A 4SGBE 3SGBE 2PV9B 1OKXA 2ZCHP 1XUJA 1O2MA 3P92A 3M36A 3SJKA 1XUFA 4KTCA 1AN1E 5HGGA 5K0HA 1QY6A 1O5GH 4CREA 3SV8A 1NRRH 1W12U 1MBMA 1GDUA 1SI5H 4MNXA 3RLWH 1LO6A 1P2NA 1D3PB 1TGCA 4IN2A 4K2YA 5TJXA 2G51A 2FWWA 1YGCH 1S5SA 2A5AA 1DUEA 1C4Y2 5AF9H 5DP8A 1AFQC 3BTWE 1K9OE 1O2QA 2BX4A 3U9AH 1W10U 1HJAB 1A3BH 5C1YA 3TU7H 3LC3A 2B5TB 4O97A 1FPHH 1GJDB 1EOLA 3OSYA 3FP6E 1RIWC 1MQ6A 2AIPA 2EI6A 3ATLA 1TABE 1UVTH 4UFGH 1QCPA 2RA0A 1V2QT 1OP8A 1IQLA 2XRCA 1LHDH 6ESTA 1EJMA 5AFZH 1AGJA 1CT2E 3GY5A 2FLBH 5BPEA 1SHHB 2HWLB 1VCPA 1Z8RA 4O3TA 1BRUP 3A83A 3ZZBA 1P9UA 3LGUA 2VWLA 1WCZA 5EW1H 3FZDA 1KY9A 1L1GA 3EA9A 1G37A 1FONA 1TNKA 2ZFRH 3ZVDA 1B0FA 3QTVH 1O3CA 1DWEH 5FHTA 1JRTA 1LVMA 3KQDA 1C4V2 6GCHF 1KXDA 4D7GA 3KHVA 3RC5A 2A4QA 3I78A 4MPUA 1P0SH 1ZPCA 1ZRKA 3V0XA 3UR6A 3A8CA 2BY6X 2FYRA 2IJOB 1EAXA 3SGAE 3TPIZ 4D9RA 1NESE 1DE7H 1O2VA 1C1VH 1A61H 3BSQA 3VB7A 2O8TA 2GZ9A 2W7UA 1KTSB 3SU2A 2PFEA 3BEFB 1ZHMA 3P8GA 3RXSA 1W7GH 3JZ1B 3B8JA 4ABAA 1O2XA 2XBXA 5JBAS 2H5DA 1QBOA 1SGFA 3SU6A 1C1SA 2XNIA 4Y7BA 1L1JA 5E0JA 5DKMA 1WQSA 3MOCA 4VGCB 1IQEA 3OU0A 1LKAA 2BDAA 2ZPQA 2VIQA 5CHAB 4WMFA 3TH4H 1ESTA 3O8CA 1C5VA 1P06A 5EGMA 4X8VH 4MQAA 1GHAG 1O2TA 1DXWA 1ESAA 1PQ7A 2HALA 2J95A 1C2EA 1MTWA 2Q6FA 4E06H 4AORA 3LGWA 1E37B 3RLYH 2BLQA 4ZKSU 1AVWA 4FUCA 5EOKA 3ODDA 1BJVA 4ABEA 5GXPA 1PPZA 1MZAA 4NWLA 2Z9GA 2OQ5A 4HTCH 2BDGA 5A8XA 1DSUA 3TJNA 1E34B 5L2ZH 2NU2E 1JOUB 2FYQA 4GUXA 4JYTA 1AU8A 1TIOA 3GCHC 3S0NA 2M5TA 3RDZA 2A2XH 2R9PA 2A31A 1QURH 1A5GH 1TWXB 2WUBA 3T2NA 3VB5A 1GHYH 3D23A 2F9OA 4B1TA 2SNVA 2TGPZ 2UUKB 2RA3A 1V2ST 2QAAA 4ISIH 4UFDH 1GBAA 1P10A 1TGNA 3RMNH 3VGCB 4X8TH 2ZHDA 1QGFA 1LHGH 2VNTA 4JZIA 1QB9A 1EAWA 1SGYE 1D9IA 1FLEE 3MO9A 4FUJA 2GKVE
chains in the Genus database with same CATH superfamily
1KYNA 2AGEX 1A2CH 1XXFA 3F2HA 1BTZA 3ZZ4A 2WSSD 2K8IA 1FAXA 2O8MA 2DUCA 3VEQB 2RCEA 3GS9A 3IWMA 4Q7XA 1HAOH 1LVOA 1GI3A 2ZU4A 3QTOH 3H7OA 3A8DA 5A09A 1T32A 1TQ0B 2JJ1D 5CMXH 1TBQH 3KQCA 1C5UA 3PTNA 5GCHG 3ZVCA 3SV6A 2G5NA 2FI5E 3QZRA 3RXHA 1SGCA 2Y5HA 4CRBA 2ANKH 2P94A 4DCDA 3ITIA 2FS8A 2ANWA 2AERH 2Y81A 2Z94A 1OS8A 4H42U 1UTLM 2RG3A 3EE0B 1HUTH 4O9VA 1SGDE 2ULLA 3A86A 2BLVA 2BVSH 2TIOA 4Y8YA 1INCA 1ANCA 1FIWA 1MTNC 2ZIQH 2ZQ2A 3FANA 1COWD 1PQ5A 1H9LB 1TRMA 4YXWD 5GPIB 1MCTA 3CP7A 4F48B 5F8ZA 3F2GA 1WU1A 4NGAH 1XVMA 2IJD1 1QR3E 2AEIH 1GI4A 1EJAA 1UTPA 1MTSA 4FU8A 4I32A 1KDQA 1ZTLA 1KLJH 1C1OA 4XRNA 1UTMA 3SNAA 4K60A 2W6ID 2PGBB 5AVDA 5F8XA 1LPKB 2Z3EA 1P12E 1EZSC 1V2UT 4JYVH 1DXPA 2XNDD 3URDA 1FXYA 4MNVA 3RMLH 1FJSA 1CGHA 3ZZ6A 1C5XB 2C8XB 3PYHA 1RRKA 2QE7D 3LGTA 1D3QB 1HFDA 1O0DH 4KP0A 1TOCB 1C2LA 1NN6A 1NRQH 3I29A 1O39A 4ZROA 1GBLA 1V2KT 2V3OH 4WVPE 4WH8A 5EQRA 2ZCLP 2HOBA 1S0RA 1Y3XA 5L2YH 1GBJA 3SNDA 2TPIZ 1MKWH 3TJOA 2TGDA 2XBYA 2GCHF 3UWJH 1OHHD 3AASA 4I86A 5LPEA 3FP8E 1QIXB 1EPTC 1GGDC 3GCHB 1O2JA 2GZ7A 3A88A 1O2OA 4FUGA 1OYTH 1UO6A 1AVGH 3LGIA 1C9PA 1A1RA 1T8MA 4INHA 4NA9H 1IQJA 2Z9LA 2A45B 4ISNA 1ANDA 2JDID 2CXVA 3P6ZB 1EP6A 2KZ4A 1GCDA 2VWOA 1DICA 2XC0A 1EB2A 5C3NA 3OY6U 2VINA 3A89A 3RXQA 5CHBA 2FOGA 1DX5M 3TIUA 1NU7B 1HAVA 3ODFA 3NXPA 2WINI 3ZZ8A 3Q00A 1F0UA 1O3NA 4O3UA 3SI4H 3SZNA 1CT4E 2ZTZA 1Y3UA 1TMTH 2BD7A 1E1QD 2BY9X 3ZVFA 3QX5H 1ZLRA 2W5EA 3BG4C 5C67A 1P57B 1YPKH 4AGJA 1TAWA 1YPEH 3BTTE 4ZHAA 1MZDA 1O3FA 3Q76A 4NZQA 4D9QA 4VGCC 1MTVA 3A81A 3W94A 3L3TA 3KQ5A 2EEKA 3LDXH 4CRDA 3SQEE 3A7VA 1YPLH 1XXDA 1LQEA 2SGQE 3NK8A 2VIPA 1TX6A 2BY5X 1TNLA 1V2LT 3H5CB 3ZVAA 1K1MA 3PLBA 2PGQB 1AZZA 3EAJA 2PLXA 1C1TA 1C1UH 1Z1JA 1ZTJA 1ELEE 2F83A 3SV7A 3RXTA 2CF9H 2V35A 1NZQH 2XYAA 1FDPA 3E90B 8KME2 1CA8B 1BRAA 3QLPH 2OLGA 1UCYK 2G4TA 3SORA 4HG6A 2OUAA 1RD3B 3BTKE 4XFQA 5EJZA 2WZQA 1O38A 2PSYA 4Y0ZE 2VGCB 1OYQA 4Y6DA 4BAKB 1DLEA 2O8LA 4UFFH 3PMJA 3F0OA 1WQVH 1OSSA 4M7GA 2PKAB 1CT0E 1A5HA 1MAXA 1WOFA 1BB0B 1C5RA 1Z71A 2A7CA 3B23B 3D49H 4FUHA 4IS5A 5C0UA 2ZWLH 3P70B 4E7RG 3KEEA 2J2UA 1Z6EA 1LDTT 2F3CE 1DLKB 1HV7A 2A2QH 1BT7A 4F4OC 6CHAB 4KTSA 1C2KA 3S7KB 4B2BA 3LOXA 1SG8B 3F3BA 1VITF 1DSTA 2A5KA 2BYAX 1UVPA 4UFEH 5GIBA 3AVZA 1W11U 1DWBH 1KLIH 1NFWA 3M7UA 1OWDA 6CHAC 2G81E 4ABBA 1BZXE 5FX5A 1O2NA 1FNIA 4X2WA 3SN8A 2L74A 3SO3A 2XWAA 1CQQA 3ZVGA 4Y10E 1MAYA 1ZSKA 2OC0A 4DVAU 4FETA 3SU5A 4K8BA 3SGQE 1GHWH 4Y76A 3RXVA 4ZHLU 3GOVB 5C5OA 2F9PA 4KGAA 4CRGA 2XOKD 4X2YA 1HDTH 5EXLA 4DG4A 1H8ED 4I8KA 1GI8B 3LKWA 8ESTE 5EXMA 2GDEH 1HAVB 1EATA 1A46H 2ZNKH 2FM2A 4GLYA 3T29A 2ZFSA 2SFAA 4AG1A 1BMAA 1O3JA 1VJ9U 2J92A 1NFUA 2XBVA 3RXOA 2GMTC 1S0QA 2FPZA 1PPEE 2AFQB 4X1QU 1XKAC 1MU8B 5C0TA 4DY7B 2BXTH 4J1YA 1JBUH 2HRVA 1MABB 1ZR0A 1X7AC 2KAIB 3G01A 3E16B 3R3GB 2GVFA 3MNCA 3GY6A 1BMFD 1VZQH 2R2MB 1TB6H 1C2IA 1YPHC 1W7XH 2V6NA 2FIRH 4Y0YE 2BOHB 1C5PA 1GMHG 3M7QA 5EG4A 1XUGA 1BRCE 1AKSB 1GCTC 2VIVA 4KTUA 1O3DA 1CO7E 3DFLA 4GPGA 1YPMH 2BVXH 3VXEH 1IQGA 1GG6C 3S9AA 2FDAA 3UOPA 3MU5A 2OINA 1CA0C 3F1SB 2Q6GA 3OE7D 1E1RD 3PM3A 2BB4A 2YOLA 3QUMP 4UEHH 3ZZ9A 1ANBA 1AQ7A 1P2IA 1YC0A 2FOMB 1LVBA 4E05H 4BAOB 1FIZA 1ZZZA 1VITG 1SOZA 3TLOA 1EPTA 5HM2A 1W8BH 2WPKS 1H9HE 3M3TA 8LPRA 3RXUA 3MH4A 3RXKA 1RTFB 4CH8B 3LH1A 1FN6A 3STIA 1HB0B 1FN8A 1BTWA 2BD4A 2QCYA 2OP9A 2UUFB 3RXDA 2JIZD 1FPCH 1PPBH 4INKA 5KECA 4X6NA 1O3KA 1UJ1A 1O3PB 4YLQH 3RXAA 4ZCNA 1C9TA 4FUFA 1LHEH 3RC4A 2ZU2A 2QIQA 1DY9A 3ZIAD 1SGQE 1O31A 1SGIB 3QWCH 1GI9B 1JIMA 2QXIA 4Y8XA 3RC6A 4IC5A 1F92A 1FUJA 2G52A 3O8DA 3DSPA 4B71A 2ALVA 5DG6A 3KYGA 1TA6A 2FOCA 2W3IA 4TPIZ 1EUFA 1SQOA 4ABJA 1OOKB 5FX6A 4BTTB 1GVZA 4TT3D 3OTPA 1DVAH 1B5GH 1O37A 2HVYB 2FESH 1ACBE 1YPHE 4DW2U 2WPJS 3MNXA 2H6MA 1D6WA 2ANYA 2ZGBH 2QF5A 2P3UB 4Y8ZA 1O5BB 2R2WU 4BAQB 1S6LA 3ZVBA 2W6JD 3QGNB 5FBEA 1SFQB 1J16A 1SLVB 4K5ZA 1KDQB 2FS9A 4ISLA 5E8EH 5FPYA 3SYJA 3OYPA 3F68H 1A3EH 1DANH 4MPVA 4WF8A 2ZEBA 2F9VA 3V3MA 5LH8A 2BDIA 3RXRA 1KXFA 2QF3A 2AH4X 5HXFA 4RKJB 3SUFA 2THFB 1P2JA 3KQEA 3FKSD 1VR1H 3SUEA 2GDDA 2WV5A 5FXLA 1NT1A 2WPIS 4X2VA 3M5LA 1TNHA 1P05A 1SHYA 7KMEH 4D7FA 1OWHA 5EIYA 1MTUA 5TCCA 1EZQA 4JZ1A 1EZUC 3ZZCA 3WY8A 1ANEA 1C5ZB 1AUJA 3NKKA 3RM0H 1SSXA 1LMWB 2HPQH 1O2KA 3I77A 5EQQA 2ZFTA 3U8RH 2HLDD 4NA7A 3T5FH 1ZGVA 4NIWA 1P8VC 4NCYA 1BHXF 1ELGA 1C1QA 2H2ZA 1C5OH 1L4ZA 3BTME 1IHTH 3K2UA 1SLUB 2A7JA 1F2SE 2BD5A 3PMAB 2VU8E 2GMTB 3UWIA 3A7YA 2ZDLA 1SL3A 7GCHG 1NS3A 1TNIA 3GY3A 2PWXA 3BF6H 4Q2KA 4WXIA 2GCHG 3HK6B 3VB3A 1MD8A 4IMZA 3SNEA 3UY9A 4LZ4B 5ETXA 4WMDA 1ELCA 4DIHH 2WPLS 1BJUA 3PWCA 1UVOA 3T62A 1AIXH 5HYOA 2BM2A 2P3FH 4JZFH 1O5AB 3FFGA 1HXEH 2CV3A 2SGEE 1UW7A 1SMFE 5E2OA 1H4WA 4CBOA 2WPMS 1UVUH 2EQNA 2CF8H 1VKYA 1J15A 1J9CH 2VWNA 1BCUH 3NCLA 1UCYE 4I8HA 2ZDAH 3GY2A 1JXPA 4U30A 2JETC 4ZXXH 4K3JA 1SQRA 3ZZAA 1O2LA 4CHAC 2P93A 3SU4A 1TALA 3GISB 4QT8C 3MU0A 1FY1A 1TGSZ 1GBEA 1S6HA 3M5NA 1C2MA 1AUTC 3M3VA 2A1DB 3SOSA 1O5FH 2FOHA 5EW2H 1AWFH 1Q2WA 3BV9B 4AFZA 1O2ZA 2XC5A 5DP6A 1WBGB 3F9GA 1E79D 1PPHE 4K69A 5ESBA 2V3HH 4YT7H 4B6EA 1LPGB 2GZ8A 2ZF0H 2GTBA 3P17H 1GI7B 3RXPA 1BBRK 1D3DB 1A4WH 1DM4B 1QRXA 2VVUA 4HGCA 5H4IB 1OWEA 3SI3H 3TJVA 5HKKD 1EOJA 3SZEA 1PJPA 3VFEA 1V2NT 4DIIH 1HJAC 2JH0D 4GHTA 3TH2H 2ANMH 3S9CA 4I8JA 3PV5A 2WUCA 3RP2A 2HVXA 3U1IB 5F6MA 4BTUB 1P2KA 2YMSB 1WUNH 4X1PU 1TBZH 3RXEA 1UVSH 4I8LA 1F0TA 2KCAA 4K1EA 5A8ZA 3A87A 3DT0H 1GHVH 3NRLA 2KR7A 1F5KU 1GGDB 1EPTB 1EX3A 2V3MA 1GJ6A 1DITH 3E0NB 3Q77A 2LPRA 1C5TA 1FV9A 2W26A 2WV4A 3PROA 5JPMH 1GJ5H 2PUQH 3OEED 3M5OA 1SR5C 1WSSH 4X1NU 1QL8A 3U69H 4JYUH 4UE7H 1HGTH 2P59A 1Q3XA 1YM0A 4FU9A 1PFXC 3FVFB 1NC6A 1S81A 1NRSH 5J4QA 1O36A 2NU4E 3RXCA 1E0FD 3OTJE 2B0FA 1TGBA 3V12A 3K6YA 1TBRH 3H09A 3O8BA 3RM2H 1GI6A 1GBFA 1NTPA 1QA0A 3MO6A 1TFXA 2ZECA 2ZP0H 4CRCA 1OWKA 4DOQA 4Z6AH 4R0IA 3KL6A 4A7IB 4Q4LA 2ZCKP 1VGCB 1HAHH 3TNSA 2H9HA 1GBHA 4AFUA 5EPNA 1Z6JH 1AZ8A 3RMMH 4NIXA 1ABJH 1O3GA 1FMGA 1JMOH 3EGKH 1ELFA 1E35B 3EQ0H 3LGYA 4YT6H 1A5IA 4U2WA 1GMCG 3W95A 1EAIA 3DSGA 3AK5A 5DP7A 1HLTH 2BOKA 1O5CB 2GX4A 1TX7A 2AMDA 5CHAC 1GBBA 2G5VA 2Z3CA 3QGJA 2KCYA 1WTHD 1ZMJA 4YOJA 4FOUC 1TQ7B 2JKHA 2NWNA 4ABFA 1CHOG 4FUDA 2AMPA 5F8TA 2ZFQH 3E0PB 2J98A 1CE5A 2F9BH 4AB9A 3URCA 1HAZB 1ARBA 1O3BA 1H1BA 3PMHB 2XCNA 1EASA 1P01A 2ZTYA 1DUAA 2UWLA 2LNCA 2OC8A 4OGXA 5FPTA 2XCFA 3UTUH 2CHAC 2R0LA 3MWIU 3QO6A 3CENA 4B73A 4Z0KA 2WYJA 4TWYA 4OS5A 1EKBB 3SU1A 1TRNA 5JBBS 2A5IA 8GCHF 1S82A 1UCYH 3RXFA 1DPOA 1IOEA 1GJAB 1L1NA 2OBQA 4JMYA 4IC6A 5AHGH 3STJA 1QNJA 1W14U 4AGKA 3ATKA 1BMLA 1S6FA 1K21H 5EODA 6GCHG 2BMGB 4JCNA 5FCKA 4B2AA 2C90B 5K7RA 3HKJB 4SGAE 4X1RU 1HIAB 5I46H 3UNSA 4GSOA 3DD2H 2Z6BD 1NBMD 2PKSB 3ENSB 1O3HA 1GCTB 2P8OB 3AAVA 3OX7U 1V2WT 2WPDD 3MH6A 2ZG0H 2O9QA 2G8TA 3SV9A 4A6LA 2P3TB 1RFNA 4LK4A 1ID5H 2CJIA 1E36B 3BIUH 3TVJB 3DUXH 2XTTB 2GCTB 1MU6B 2OXSA 3MHWU 4D76A 3LONA 5GNDA 1D3TB 5BRRE 3H7TA 2SGAA 2YMSC 1H8DH 1C2FA 2GD4B 3GY4A 5KEDA 1ZHPA 1BTHH 1P9SA 4D8NA 2QF4A 1BTXA 4ASHA 2VH6A 1O3OA 3A7WA 1ZJDA 3MI4A 4F49A 1IAUA 1ZGIA 4BNRA 4X8SH 2PSXA 5ESTE 4U32A 3SNBA 2G55A 4RT1A 4A5TS 5B6LA 5EU8A 4THNH 2P16A 1O2WA 4INLA 2BLWA 3PLPA 5C20A 1HCGA 1AB9C 3P8OA 1YPJH 1LTOA 1DOJA 4NSYA 5DO4H 2AGGX 3PV2A 1HAIH 2ZGXH 2FOFA 1YPGH 3NZIA 1AO5A 4OM9A 3T25A 4WY3A 2XW9A 1AFQB 2H5CA 1HAXB 1VJAU 1O2UA 1SGTA 4CR5A 5GDSH 1SGNE 7LPRA 1A0LA 1V2OT 3D65E 2B8OH 3BTQE 1K22H 1TPAE 4RT0A 2EY4C 4YO9A 2Y7XA 1DDJA 5SGAE 4XBDA 1P02A 3ZV8A 2C8YB 3LT3A 5LPRA 4Q63A 3DSOA 5A0BA 2ZO3H 1GHAF 3MU4A 4MG3A 1H8IH 5DJ7A 2RDLA 4KELA 2EI7A 2RDEA 2Q1JA 2D26C 4I8GA 1BMNH 3RU4T 4OS1A 2WHXA 2A4OA 4M9FA 2BDYA 3K65B 3LH3A 4ZKRU 1GJ7B 2VB0A 3A7ZA 1Y5BT 4RSPA 2FODA 5HMAA 3GY7A 5LGOA 3GDVA 4TSFD 1W0JD 2EC9H 3S7HB 5E2PA 3BTHE 3TH3H 1GPZA 1O3EA 2F43B 2F9NA 3L6PA 2K1QA 1SGFG 1AB9B 1O5DH 1Y59T 2LELA 2XC4A 2K0QA 2JH5D 4H6SB 2HNTF 1ZHRA 3KCGH 1C5MD 2EA3A 3K6ZA 1LHCH 4ZAEA 1PPCE 1ZYOA 1C5WB 3S69A 1WV7H 4CRAA 4DGJA 3F9FA 1LQDB 2VWMA 1HNEE 5PTPA 1HAGE 4LZ1H 1T8OA 5IDKA 1K1JA 4Y79A 3GCTF 1EZXC 1HJ9A 2WPHS 4ABHA 2HLCA 9ESTA 3PLKA 2YMSD 1SLXB 5EQSA 1VGCC 1PPFE 3Q3KA 1CBWC 2FX4A 5HIYA 5I25A 2TGTA 1WDIA 4DT7B 1SB1H 2P95A 4GCHG 1YLDA 1XVOA 2R0KA 2Y7ZA 2ZQ1A 8GCHG 2A4GA 2P8OC 1WAYB 2SNWA 4NZLA 2GV7A 2XXLA 3VB4A 3MTYA 1XUIA 4IMQA 2UUYA 1O30A 2PTCE 1FZZA 1O2GH 2C4FH 1YLCA 1SBWA 4IGDA 1DWCH 1TRYA 1SOTA 1ESBA 5LPFA 4E7NA 3EYDA 1IQFA 2ZDNA 3MMGA 4YLUA 4KKDA 1ELTA 1TOMH 2DE8A 4WH6A 4ABGA 2GT8A 1LKBA 2GV6A 1TMBH 2J9NA 3UNQA 3AW0A 1C5SA 2FOAA 1TX8A 2C3SA 3AW1A 5T6GA 1QQ4A 3IITA 4JK5A 1C5NH 3TGJE 2CHAB 2VIWA 3ZV9A 2ZI2H 5JBTA 2IPHA 1GDNA 1ELAA 2BQ7B 1O2YA 1ZMLA 2SGPE 1GVLA 2BDCA 3SQHE 2STAE 5T3HA 4AOQA 1GMCF 4PROA 1BITA 1QBVH 1RJXB 2PW8H 3QZQA 1K2I1 1GJ9B 1EFRD 1MBQA 4NG9H 4BXSA 1C1NA 3HPTB 1GL1A 1PPGE 3GCOA 1Z8JB 4XOJA 3MNBA 1EB1H 2VVCA 2ILNA 1RS0A 3ZVEA 1UK3A 3UNRA 5E0GA 2PKSC 2QXGA 1C2GA 1TYNA 4OS6A 7ESTE 1O3AA 3M37A 1KXCA 2NU1E 4CR9A 2IN2A 3TGIE 2ZC9H 2JJ2D 4ASUD 1T7CA 2V7QD 1G2LA 1GBDA 1YF4A 1PYTD 3M7TA 2BD9A 4A1XA 2BZAA 2NU0E 2Q6DA 2ZHWH 3EA8A 4K1SA 1NU9A 2UWOA 4AC9A 3UQOA 3SUDA 2QN5T 1JRSA 3U8TH 1GBKA 2ASUB 4XSKU 1QL9A 1ELDE 1O2SA 2Z9KA 1G30B 2O8WA 4AZ2B 1G3CA 1E38B 1JIRA 2J38A 4H4FA 1QL7A 1MKWK 2WYGA 3QDZB 1FY3A 1XUHA 3ZZDA 1Y3WA 3RXJA 1VCWA 1ZTKA 1Z8IB 2O8UA 4X8UH 2J98B 1H9IE 4FUEA 3SHCH 3BG4B 1GHBG 4B75A 2AYWA 3SNCA 1C1PA 2GGVB 2V0BA 1MCVA 2J94A 4LXBH 3ELAH 5FCRA 3P8FA 4WXVA 3TK9A 3QN7A 1M9UA 3A85A 1TPOA 4ABIA 1AFEH 1QTFA 1EP5A 1KLTA 2C8ZB 1THPB 3RU4E 1YWUA 2JETB 2STBE 3N7EA 1BUIA 3UR9A 3ZYEA 5A2MH 3SBKA 3RMOH 1KTTB 5T6FA 3HK3B 1SQTA 2GP9B 5C1UA 4GVUA 1W2KH 3EDXB 1ZPZA 1Y3YA 3PTBA 3A7TA 2UWPA 3LPRA 2QC2A 4K1TA 1HIAA 4J2YB 1YLNA 4IBLH 1UHBB 3Q3XA 1KXEA 2ZKSA 4Y71A 1O3MA 1F0SA 1TMUH 1T8LA 2FOEA 1ZOMA 3UREA 1SGPE 1VCQA 1ZRBA 3LC5A 2PKAA 4BAHB 3C1KA 4X1SU 1GBMA 1RTKA 2FMJA 4MTBA 1O2HA 2Y6TA 1CBWB 3RUOA 1K1NA 2QXJA 2ZGHA 1W0ZU 4Q7ZA 4H6TA 1Q31A 4NA8A 3E91A 2BDBA 4U01A 2OQUA 1CSOE 1P03A 1TPPA 2C93B 3A82A 3N99A 1O35A 2Z3DA 1XKBC 4BANB 3F9HA 3JZ2B 1ORFA 1NO9H 3Q3YA 5C2ZA 1TGTA 5A8YA 2J5UA 3OEHD 3LJJA 3WWFA 1HPGA 3BTEE 4AG2A 4FVDA 3RXIA 1CHOF 3AAUA 1FX0B 3SUGA 3IG6B 3FN8A 5DSFA 4ISHH 1HAYB 3MQKC 2FOBA 2BDHA 1DS2E 4ZXYH 1P04A 5A0AE 5AFYH 2KX4A 1O2RA 2BZ6H 3NPSA 3CS0A 1BHXB 5GWZA 1B0EA 3N7DA 4MVNA 3GY8A 5JYIA 4MPWA 2QGRA 1GMDF 3MO3A 3U98H 1L2EA 1MKXK 1TNGA 2ZDVH 2J34A 1MKXH 4DURA 1P3EA 3PMBB 4Y11E 4JK6A 1FY5A 1TONA 1V2JT 5JDUB 3U8OH 2H9EH 1Z7KA 5L6NH 3SW2B 5DPAA 2AS9A 3SJIA 2QV1A 3BEUA 2A7HA 5J4SA 5DGJA 1KXBA 5L30H 1QHRB 2I6SA 3PB1E 4XDEA 3UPEA 1GJBB 2VH0A 2ZPSA 1O33A 1QFKH 1C5YB 1ZMNA 1W13U 4YM9A 1YYY1 4WMEA 1YP9A 4A1TA 4GHQA 1YCPH 1QA7A 3LGVA 2CK3D 1QB6A 3A7XA 1T8NA 1ZSJA 1NBME 2BLOA 4JZEH 4ZKOU 4I7YH 2B9LA 1KXAA 3GYLB 1CU1A 4MNYA 2FI3E 5JB9S 4TY7A 4AFQA 4Y7AA 1K1OA 2SGFE 2XBWA 1GHXH 4HZHA 1OXGA 5ABWA 1XM1A 1TE0A 1Z1IA 4P02A 2D1JA 1PYTC 1A7SA 3NWUA 3P95A 1T4VH 1G2MA 1Y8TA 2C8WB 2HNTC 2KCPA 3SU3A 3ATMA 4B74A 1GWAA 1TPSA 2WV9A 2D8WA 2VIDA 1U6QA 5FPSA 3HGNA 1XMNB 2IOTA 3FAOA 1ZSLA 3TK6A 4BOHA 3MU8A 1GHBF 1AKSA 4CRFA 3TK5A 5FBIA 1XX9A 2VJ1A 4NSVA 3RU4D 2GJGA 3R0FA 1CHGA 1UTKA 1XUKA 1L4DA 2FTMA 4LOYH 3KIDU 1V6DA 3VB6A 1W3CA 2FI4E 1AY6H 1T31A 1ETSH 1IQNA 3KQBA 1C4U2 1UHBA 2ESTE 5T1VA 5TCAA 3VG8A 2ZHEH 3HATH 1UTOA 2Y5GA 3FOAA 5CE1A 1UK2A 1O32A 2A4RA 1EJNA 1GI1A 1SGEE 2H1UA 2OC1A 1PQAA 2EI8A 2PTNA 2IPQX 4B76A 4ABDA 1OP0A 4K8YA 3PO1B 2ZA5A 2A0QB 1ETTH 1VITH 1QRWA 4NIYA 4ZH8A 1F5LA 2FZZA 3E3TA 3SJ8A 2BXUH 4I33A 2AHME 2OC7A 1HAPH 4X6OA 3SU0A 5B6OA 1GJCB 1G9IE 2OTVA 5FL7D 1HBTH 4JZDH 1IQHA 1C5QA 4AX9H 4BTIB 1GMDG 2AMQA 3DA9B 3FO8D 1N6XA 1K1PA 5E0HA 4ACBA 1OP2A 4AYVB 1AI8H 3ZZ5A 1UTQA 3RXBA 1ELBA 1BQYA 3N7OA 2BD2A 3LU9B 2BQWB 2QA9E 1GBTA 4ZMAH 4GAWA 4HI3A 2ZGJA 1GMHF 4NFFA 2VBCA 1LPZB 1NY22 2AGIX 3PO1C 2XWBI 1G3DA 4XBBA 5F03A 3CS7A 1O3IA 4B2CA 1HYLA 7GCHF 2GT7A 4A92A 3BEIB 3BTGE 1FI8A 1ABIH 1GBIA 1QB1A 2KAIA 1OX1A 2OD3B 3C27B 3T27A 3U1JB 2FTLE 3VPKA 1GBCA 3KGPA 2ZU1A 3UB0A 1GG6B 1BRBE 1OWIA 4FXGH 1GI5A 2ZU3A 2ZHQH 5IYTA 1F5RA 1V2RT 2D2DA 1C1MA 4ZHMU 1TLDA 3KYFA 3GCNA 4ZKNU 2PP6A 2ZTXA 1V2VT 3ESTA 3HGPA 1GL0E 1J17T 4TYDA 1BMMH 3VXFH 1S85A 2BX3A 1LCYA 4TY6A 1CGIE 2F91A 2L6OA 1IHSH 3TGKE 1O3LA 4AFSA 1CA0B 1WYKA 1YY3A 2HNTE 4NIVA 3RXMA 1BTYA 4BXWA 3S9BA 3E6PH 2ZPRA 3KN2A 1P3CA 1K1LA 3B9FH 1SC8U 4X0WU 5JB8S 5G4BA 4X6MA 1G3BA 1O2IA 1OPHB 2ODPA 3A84A 1V3XA 3O8RA 1BTPA 2BTCE 2KFWA 3MU1A 1WTGH 1DFPA 3F6UH 1BBRE 1S84A 2ALPA 1IQKA 1T4UH 3F0PA 2HGTH 1GJ4H 2PR3A 1P2OA 5A0CA 5DN6D 1GI2A 2BY7X 3GICB 1W0YH 4UONA 1UTNA 1BTUA 1Y5AT 4UDWH 1THSH 4AYYB 1EXFA 3UFAA 1F0RA 2OCVB 4O03A 2PUXB 3MH5A 5HM9A 4Q7YA 2HPPH 1CVWH 2OK5A 3SHAH 2ZDMA 3CNRA 3VGCC 1EQ9A 1HRTH 3V7TA 1FAKH 1MTNB 4CH2B 2Z7FE 3WWBA 3PRBA 1D6RA 4YOIA 1MUEB 3M35A 1C5LH 2BVRH 2CGAA 1ZJKA 4X6PA 1A0JA 1G32B 3T28A 1PQ8A 3BG8A 5DP4A 3UAIC 2H9TH 1CGJE 1DY8A 2I6QA 1K28D 1G3EA 4Z1MD 2UUJB 2Z9IA 1GJ8B 2F9UA 5DK1A 2QY0B 2G4UA 1B7XB 3L33A 4RN6A 4DJZB 1DWDH 4ESTE 3P8NA 2B7DH 3TNTA 1SQAA 4ACAA 2TGAA 3SV2H 5FAHA 3EA7A 2ODQA 2ZHFH 1BA8B 3SJOA 1O5EH 2FXRA 1QZ8A 2QYIA 3KF2A 1P09A 1P2MA 2KM0A 1Y3VA 3F9EA 1DT2A 1ZPBA 1HXFH 1NROH 3M61U 3FZZA 4ISOA 4TPYA 4I31A 3TITA 3DHKH 4OS4A 1FY8E 3M5MA 2A32A 6LPRA 2FX6A 2ZU5A 1NPMA 2ZFFH 1O2PA 2AIQA 2FO9A 3A8AA 4XBCA 1GVKB 5DP5A 3PV4A 2FLRH 3ZZ7A 1QJ7B 1FY4A 1J8AA 4F55A 3TJUA 1A0HB 2Y80A 1BDAA 2ODYB 4ZUHA 5DP9A 1NM6A 1N8OC 3A80A 1P2QA 3K9XB 2QF0A 4IN1A 4NWKA 5EPYA 1G36A 1KIGH 1FQ3A 1SLWB 1TA2A 2BQ6B 5EXNA 4OS2A 1YCPM 4TWWA 1C2JA 2OBOA 2SGDE 3BTFE 2FP7B 3ZYDA 1Y5UT 2TBSA 2FEQH 3E8LA 4FUIA 1V2PT 1ARCA 1H8HD 2GCTC 4OGYA 1N8OB 3MH7A 1AWHB 4Q80A 1RGQA 4R8TB 1WXRA 2J4IA 3ZZ3A 2W7SA 2PHBA 3RXGA 1BOQA 1YKTA 4AN7A 5GJ4B 3T26A 1IQMA 3SJ9A 3ATWA 1JWTA 4BAMB 2Y5FA 1QJ6B 4GCHF 4CHAB 1AMHA 4HFPB 3BIVH 2CN0H 1S83A 9LPRA 1N6YA 1HJ8A 4X2XA 4FVBA 1SGRE 2VIOA 3NUMA 3DFJA 1ETRH 3UQVA 1UK4A 1SVPA 2R3YA 3U28C 1TNJA 3GCTG 2R3UA 1C1RA 1UMAH 3HKIB 3GDSA 1GI0A 4MDSA 3OY5U 2YNAA 4RKOB 2VVVA 2BD3A 2QXHA 1N1LA 3DCLA 1L0ZA 1RIWB 1C1WH 4NFEA 2YNBA 1QQUA 3MYWA 5C5NA 2NU3E 1RTLA 3LJOA 1C2DA 1AD8H 3LIWA 1GDQA 1QBNA 4FU7A 2DE9A 1AVXA 4WWYA 1NFXA 1NRPH 1O34A 1QRZA 3D62A 4YZUA 5HIZA 2G00A 3MFJA 1RXPA 4FUBA 3PWBA 3RXLA 4YTAA 3BTDE 3UUZA 1KSNA 5DP3A 1V2MT 3OFND 1SFIA 3M3SA 3E1XB 1AHTH 1GHZA 4OS7A 4MLFB 2VGCC 3PRDA 3UIRA 3A8BA 1AE5A 4WJG2 4IW4E 1NFYA 5T6DA 4A1VA 1SPJA 4UD9H 1IQIA 3OAAD 1J14A 1MH0A 2Z9JA 4XE4A 2ZZUH 1LVYA 3GYMA 1D4PB 1NRNH 3ATIA 1C2HA 2JH6D 1BIOA 3GDUA 2ZDKA 2Y82A 4CBNA 1YCPK 4P00A 1QJ1B 1MD7A 2RFKC 2CMYA 3FP7E 5C1XA 1AE8H 1V2TT 1ELVA 1LHFH 2BHGA 1EAUA 1F7ZA 3EE7A 1MMJN 1YBWA 4YOGA 3UOUA 5GCHF 3KNXA 1BBRH 3QK1A 5IK2D 1OWJA 4MNWA 2ZFPH 2TRMA 1Z8GA 1THRH 4YESB 4AB8A 1K1IA 1UTJA 3BN9A 3V13A 3MNSA 2BY8X 4MPXA 1P11E 2ZGCA 1MQ5A 5JBCS 2W3KA 2BD8A 4SGBE 3SGBE 2PV9B 1OKXA 2ZCHP 1XUJA 1O2MA 3P92A 3M36A 3SJKA 1XUFA 4KTCA 1AN1E 5HGGA 5K0HA 1QY6A 1O5GH 4CREA 3SV8A 1NRRH 1W12U 1MBMA 1GDUA 1SI5H 4MNXA 3RLWH 1LO6A 1P2NA 1D3PB 1TGCA 4IN2A 4K2YA 5TJXA 2G51A 2FWWA 4XD7D 1YGCH 1S5SA 2A5AA 2F4LA 3F2FA 1DUEA 1K0HA 1C4Y2 5AF9H 5DP8A 1AFQC 3BTWE 4RI0A 1K9OE 1O2QA 2BX4A 3U9AH 1W10U 1HJAB 1A3BH 5C1YA 3TU7H 3LC3A 2B5TB 4B6FA 4O97A 1FPHH 1GJDB 1EOLA 3OSYA 3FP6E 1RIWC 3WW7A 1MQ6A 2AIPA 2EI6A 3ATLA 5EJ1A 1TABE 1UVTH 4UFGH 1QCPA 2RA0A 1V2QT 1OP8A 1IQLA 2XRCA 1LHDH 6ESTA 1EJMA 5AFZH 1AGJA 1CT2E 3GY5A 2FLBH 5BPEA 1SHHB 2HWLB 1VCPA 1Z8RA 4O3TA 1BRUP 3A83A 3ZZBA 1P9UA 3LGUA 5C17A 1WCZA 2VWLA 5EW1H 3FZDA 1KY9A 1L1GA 3EA9A 1G37A 1FONA 1TNKA 2ZFRH 3ZVDA 1B0FA 3QTVH 1O3CA 1DWEH 5FHTA 1JRTA 1LVMA 3KQDA 1C4V2 6GCHF 1KXDA 4D7GA 5F53A 3KHVA 3RC5A 2A4QA 2J97A 3I78A 4MPUA 1P0SH 1ZPCA 1ZRKA 3V0XA 1KMHB 3UR6A 1W0KD 3A8CA 2BY6X 2IJOB 2FYRA 1EAXA 3SGAE 3TPIZ 4D9RA 1NESE 1DE7H 1O2VA 1C1VH 1A61H 3BSQA 4DT4A 3VB7A 2O8TA 2GZ9A 2W7UA 1KTSB 2LP6A 3SU2A 2PFEA 5CDFE 3BEFB 1ZHMA 3P8GA 3RXSA 1W7GH 3JZ1B 3B8JA 4ABAA 1O2XA 2XBXA 5JBAS 2H5DA 1QBOA 1SGFA 3SU6A 1C1SA 2XNIA 4Y7BA 1L1JA 5E0JA 5DKMA 1WQSA 3MOCA 4VGCB 1IQEA 3OU0A 1LKAA 2BDAA 2KCOA 2ZPQA 2VIQA 5CHAB 4WMFA 3TH4H 1ESTA 3W1EA 3O8CA 1C5VA 1P06A 5EGMA 4X8VH 2M2AA 4MQAA 1GHAG 1O2TA 1DXWA 1ESAA 2HALA 1PQ7A 2J95A 1C2EA 1MTWA 2Q6FA 4E06H 4AORA 3LGWA 1E37B 5KGOA 5C94A 3RLYH 2BLQA 4ZKSU 1AVWA 4FUCA 5EOKA 3ODDA 1BJVA 4ABEA 5GXPA 1PPZA 1MZAA 4NWLA 2Z9GA 2OQ5A 4HTCH 2BDGA 5A8XA 1DSUA 3TJNA 1E34B 5L2ZH 2NU2E 1JOUB 2FYQA 4GUXA 4JYTA 1AU8A 1TIOA 3GCHC 3S0NA 1SKYE 2M5TA 3RDZA 2A2XH 2R9PA 2A31A 1QURH 1A5GH 1TWXB 2WUBA 3T2NA 3VB5A 1GHYH 3D23A 2F9OA 4B1TA 2SNVA 2TGPZ 2UUKB 2RA3A 1V2ST 2QAAA 4ISIH 4UFDH 1GBAA 1P10A 1TGNA 3RMNH 3VGCB 4X8TH 2ZHDA 1QGFA 1LHGH 2VNTA 4JZIA 1QB9A 1EAWA 1SGYE 1D9IA 1FLEE 3MO9A 5EJLA 4FUJA 2GKVE
chains in the Genus database with same CATH topology
1KYNA 2AGEX 1A2CH 1XXFA 1BTZA 3ZZ4A 1FAXA 2O8MA 2DUCA 3VEQB 2RCEA 3IWMA 4Q7XA 1HAOH 1LVOA 1GI3A 2ZU4A 3QTOH 3H7OA 3A8DA 5A09A 1T32A 1TQ0B 5CMXH 1TBQH 3KQCA 1C5UA 3PTNA 5GCHG 3ZVCA 3SV6A 2G5NA 2FI5E 3QZRA 3RXHA 1SGCA 2Y5HA 4CRBA 2ANKH 2P94A 4DCDA 3ITIA 2FS8A 2ANWA 2AERH 2Y81A 2Z94A 1OS8A 4H42U 1UTLM 2RG3A 3EE0B 1HUTH 4O9VA 1SGDE 2ULLA 3A86A 2BLVA 2BVSH 2TIOA 4Y8YA 1INCA 1ANCA 1FIWA 1MTNC 2ZIQH 2ZQ2A 3FANA 1PQ5A 1H9LB 1TRMA 5GPIB 1MCTA 3CP7A 5F8ZA 1WU1A 4NGAH 1XVMA 1QR3E 2AEIH 1GI4A 1EJAA 1UTPA 1MTSA 4FU8A 4I32A 1KDQA 1ZTLA 1KLJH 1C1OA 1UTMA 3SNAA 4K60A 2PGBB 5AVDA 5F8XA 1LPKB 2Z3EA 1P12E 1EZSC 1V2UT 4JYVH 1DXPA 3URDA 1FXYA 4MNVA 3RMLH 1FJSA 1CGHA 3ZZ6A 1C5XB 2C8XB 3PYHA 1RRKA 3LGTA 1D3QB 1HFDA 1O0DH 4KP0A 1TOCB 1C2LA 1NN6A 1NRQH 3I29A 1O39A 4ZROA 1GBLA 1V2KT 2V3OH 4WVPE 4WH8A 5EQRA 2ZCLP 2HOBA 1S0RA 1Y3XA 5L2YH 1GBJA 3SNDA 2TPIZ 1MKWH 3TJOA 2TGDA 2XBYA 2GCHF 3UWJH 3AASA 5LPEA 3FP8E 1QIXB 1EPTC 1GGDC 3GCHB 1O2JA 2GZ7A 3A88A 1O2OA 4FUGA 1OYTH 1UO6A 1AVGH 3LGIA 1C9PA 1A1RA 1T8MA 4INHA 4NA9H 1IQJA 2Z9LA 2A45B 4ISNA 1ANDA 2CXVA 3P6ZB 1EP6A 2VWOA 1GCDA 1DICA 2XC0A 1EB2A 5C3NA 3OY6U 2VINA 3A89A 3RXQA 2FOGA 1DX5M 3TIUA 1NU7B 1HAVA 3ODFA 3NXPA 2WINI 3ZZ8A 3Q00A 1F0UA 1O3NA 4O3UA 3SI4H 3SZNA 1CT4E 2ZTZA 1Y3UA 1TMTH 2BD7A 2BY9X 3ZVFA 3QX5H 1ZLRA 2W5EA 3BG4C 5C67A 1P57B 1YPKH 4AGJA 1TAWA 1YPEH 3BTTE 4ZHAA 1MZDA 1O3FA 3Q76A 4NZQA 4D9QA 4VGCC 1MTVA 3A81A 3W94A 3L3TA 2EEKA 3LDXH 4CRDA 3SQEE 3A7VA 1YPLH 1XXDA 1LQEA 2SGQE 3NK8A 2VIPA 1TX6A 2BY5X 1TNLA 1V2LT 3H5CB 3ZVAA 1K1MA 3PLBA 2PGQB 1AZZA 3EAJA 2PLXA 1C1TA 1C1UH 1Z1JA 1ZTJA 1ELEE 2F83A 3SV7A 3RXTA 2CF9H 2V35A 1NZQH 2XYAA 1FDPA 3E90B 8KME2 1CA8B 1BRAA 3QLPH 2OLGA 1UCYK 2G4TA 3SORA 2OUAA 1RD3B 3BTKE 4XFQA 1O38A 2PSYA 4Y0ZE 2VGCB 1OYQA 4Y6DA 4BAKB 1DLEA 2O8LA 4UFFH 3PMJA 1WQVH 1OSSA 4M7GA 2PKAB 1CT0E 1A5HA 1MAXA 1WOFA 1BB0B 1C5RA 1Z71A 2A7CA 3B23B 3D49H 4FUHA 4IS5A 2ZWLH 3P70B 4E7RG 3KEEA 2J2UA 1Z6EA 1LDTT 2F3CE 1DLKB 1HV7A 2A2QH 1BT7A 4F4OC 6CHAB 4KTSA 1C2KA 3S7KB 4B2BA 3LOXA 1SG8B 1VITF 1DSTA 2A5KA 2BYAX 1UVPA 4UFEH 5GIBA 3AVZA 1W11U 1DWBH 1KLIH 1NFWA 3M7UA 1OWDA 6CHAC 2G81E 4ABBA 1BZXE 5FX5A 1O2NA 1FNIA 4X2WA 3SN8A 3SO3A 2XWAA 1CQQA 3ZVGA 4Y10E 1MAYA 1ZSKA 2OC0A 4DVAU 3SU5A 4K8BA 3SGQE 1GHWH 4Y76A 3RXVA 4ZHLU 3GOVB 5C5OA 2F9PA 4KGAA 4CRGA 4X2YA 1HDTH 5EXLA 4DG4A 4I8KA 1GI8B 3LKWA 8ESTE 5EXMA 2GDEH 1HAVB 1EATA 1A46H 2ZNKH 2FM2A 4GLYA 3T29A 2ZFSA 2SFAA 4AG1A 1BMAA 1O3JA 1VJ9U 2J92A 1NFUA 2XBVA 3RXOA 2GMTC 1S0QA 2FPZA 1PPEE 2AFQB 4X1QU 1XKAC 1MU8B 4DY7B 2BXTH 4J1YA 1JBUH 2HRVA 1ZR0A 1X7AC 2KAIB 3G01A 3E16B 3R3GB 2GVFA 3MNCA 3GY6A 1VZQH 2R2MB 1TB6H 1C2IA 1YPHC 1W7XH 2V6NA 2FIRH 4Y0YE 2BOHB 1C5PA 1GMHG 3M7QA 5EG4A 1XUGA 1BRCE 1AKSB 1GCTC 2VIVA 4KTUA 1O3DA 1CO7E 3DFLA 4GPGA 1YPMH 2BVXH 3VXEH 1IQGA 1GG6C 3S9AA 2FDAA 3UOPA 3MU5A 2OINA 1CA0C 3F1SB 2Q6GA 3PM3A 2BB4A 2YOLA 3QUMP 4UEHH 3ZZ9A 1ANBA 1AQ7A 1P2IA 1YC0A 2FOMB 1LVBA 4E05H 4BAOB 1FIZA 1ZZZA 1VITG 1SOZA 3TLOA 1EPTA 5HM2A 1W8BH 2WPKS 1H9HE 3M3TA 8LPRA 3RXUA 3MH4A 3RXKA 1RTFB 4CH8B 3LH1A 1FN6A 3STIA 1HB0B 1FN8A 1BTWA 2BD4A 2QCYA 2OP9A 2UUFB 3RXDA 1FPCH 1PPBH 4INKA 4X6NA 1O3KA 1UJ1A 1O3PB 4YLQH 3RXAA 1C9TA 4FUFA 1LHEH 3RC4A 2ZU2A 2QIQA 1DY9A 1SGQE 1O31A 1SGIB 3QWCH 1GI9B 1JIMA 2QXIA 4Y8XA 3RC6A 4IC5A 1F92A 1FUJA 2G52A 3O8DA 4B71A 2ALVA 5DG6A 1TA6A 2FOCA 2W3IA 4TPIZ 1EUFA 1SQOA 4ABJA 1OOKB 5FX6A 4BTTB 1GVZA 1DVAH 1B5GH 1O37A 2FESH 1ACBE 1YPHE 4DW2U 2WPJS 3MNXA 2H6MA 1D6WA 2ANYA 2ZGBH 2P3UB 4Y8ZA 1O5BB 2R2WU 4BAQB 3ZVBA 3QGNB 5FBEA 1SFQB 1J16A 1SLVB 4K5ZA 1KDQB 2FS9A 4ISLA 5E8EH 5FPYA 3OYPA 3F68H 1A3EH 1DANH 4MPVA 4WF8A 2ZEBA 2F9VA 3V3MA 5LH8A 2BDIA 3RXRA 1KXFA 2QF3A 2AH4X 5HXFA 4RKJB 3SUFA 2THFB 1P2JA 3KQEA 1VR1H 3SUEA 2GDDA 2WV5A 5FXLA 1NT1A 2WPIS 4X2VA 3M5LA 1TNHA 1P05A 1SHYA 7KMEH 4D7FA 1OWHA 1MTUA 5TCCA 1EZQA 4JZ1A 1EZUC 3ZZCA 3WY8A 1ANEA 1C5ZB 1AUJA 3NKKA 3RM0H 1SSXA 1LMWB 2HPQH 1O2KA 3I77A 5EQQA 2ZFTA 3U8RH 4NA7A 3T5FH 1ZGVA 4NIWA 1P8VC 4NCYA 1BHXF 1ELGA 1C1QA 2H2ZA 1C5OH 1L4ZA 3BTME 1IHTH 3K2UA 1SLUB 2A7JA 1F2SE 2BD5A 3PMAB 2VU8E 2GMTB 3UWIA 3A7YA 2ZDLA 1SL3A 7GCHG 1NS3A 1TNIA 3GY3A 2PWXA 3BF6H 4Q2KA 4WXIA 2GCHG 3HK6B 3VB3A 1MD8A 4IMZA 3SNEA 3UY9A 4LZ4B 5ETXA 4WMDA 1ELCA 4DIHH 2WPLS 1BJUA 3PWCA 1UVOA 3T62A 1AIXH 5HYOA 2BM2A 2P3FH 4JZFH 1O5AB 3FFGA 1HXEH 2CV3A 2SGEE 1SMFE 5E2OA 1H4WA 4CBOA 2WPMS 1UVUH 2CF8H 1J15A 1J9CH 2VWNA 1BCUH 3NCLA 1UCYE 4I8HA 2ZDAH 3GY2A 1JXPA 4U30A 2JETC 4ZXXH 4K3JA 3ZZAA 1O2LA 4CHAC 2P93A 3SU4A 1TALA 3GISB 4QT8C 3MU0A 1FY1A 1TGSZ 1GBEA 1S6HA 3M5NA 1C2MA 1AUTC 3M3VA 2A1DB 3SOSA 1O5FH 2FOHA 5EW2H 1AWFH 1Q2WA 3BV9B 4AFZA 1O2ZA 2XC5A 5DP6A 1WBGB 3F9GA 1PPHE 4K69A 5ESBA 2V3HH 4YT7H 1LPGB 2GZ8A 2ZF0H 2GTBA 3P17H 1GI7B 3RXPA 1BBRK 1D3DB 1A4WH 1DM4B 1QRXA 2VVUA 4HGCA 5H4IB 1OWEA 3SI3H 3TJVA 1EOJA 1PJPA 3VFEA 1V2NT 4DIIH 1HJAC 2JH0D 4GHTA 3TH2H 2ANMH 3S9CA 4I8JA 2WUCA 3RP2A 2HVXA 3U1IB 5F6MA 4BTUB 1P2KA 4X1PU 1WUNH 1TBZH 3RXEA 1UVSH 4I8LA 1F0TA 4K1EA 5A8ZA 3A87A 3DT0H 1GHVH 1F5KU 1GGDB 1EPTB 1EX3A 1GJ6A 1DITH 3E0NB 3Q77A 2LPRA 1C5TA 1FV9A 2W26A 2WV4A 3PROA 5JPMH 1GJ5H 2PUQH 3M5OA 1SR5C 1WSSH 4X1NU 1QL8A 3U69H 4JYUH 4UE7H 1HGTH 2P59A 1Q3XA 1YM0A 4FU9A 1PFXC 3FVFB 1NC6A 1S81A 1NRSH 5J4QA 1O36A 2NU4E 3RXCA 1E0FD 3OTJE 2B0FA 1TGBA 3V12A 3K6YA 1TBRH 3O8BA 3RM2H 1GI6A 1GBFA 1NTPA 1QA0A 3MO6A 1TFXA 2ZECA 2ZP0H 4CRCA 1OWKA 4DOQA 4Z6AH 4R0IA 3KL6A 4A7IB 2ZCKP 1VGCB 1HAHH 3TNSA 2H9HA 1GBHA 4AFUA 5EPNA 1Z6JH 1AZ8A 3RMMH 4NIXA 1ABJH 1O3GA 1FMGA 1JMOH 3EGKH 1ELFA 1E35B 3EQ0H 3LGYA 4YT6H 1A5IA 4U2WA 1GMCG 3W95A 1EAIA 5DP7A 1HLTH 2BOKA 1O5CB 2GX4A 1TX7A 2AMDA 5CHAC 1GBBA 2G5VA 2Z3CA 3QGJA 1WTHD 1ZMJA 4YOJA 1TQ7B 2JKHA 2NWNA 4ABFA 1CHOG 4FUDA 2AMPA 5F8TA 2ZFQH 3E0PB 4AB9A 1CE5A 2F9BH 3URCA 1HAZB 1ARBA 1O3BA 1H1BA 3PMHB 2XCNA 1EASA 1P01A 2ZTYA 1DUAA 2UWLA 2LNCA 2OC8A 4OGXA 5FPTA 2XCFA 3UTUH 2CHAC 2R0LA 3MWIU 3QO6A 3CENA 4B73A 4Z0KA 2WYJA 4TWYA 4OS5A 1EKBB 3SU1A 1TRNA 5JBBS 2A5IA 8GCHF 1S82A 1UCYH 3RXFA 1DPOA 1IOEA 1GJAB 1L1NA 2OBQA 4JMYA 4IC6A 5AHGH 3STJA 1QNJA 1W14U 4AGKA 3ATKA 1BMLA 1S6FA 1K21H 5EODA 6GCHG 2BMGB 4JCNA 5FCKA 4B2AA 2C90B 5K7RA 3HKJB 4SGAE 4X1RU 1HIAB 5I46H 3UNSA 4GSOA 3DD2H 2Z6BD 2PKSB 3ENSB 1O3HA 1GCTB 2P8OB 3AAVA 3OX7U 1V2WT 3MH6A 2ZG0H 2O9QA 2G8TA 3SV9A 4A6LA 2P3TB 1RFNA 4LK4A 1ID5H 2CJIA 1E36B 3BIUH 3TVJB 3DUXH 2XTTB 2GCTB 1MU6B 2OXSA 3MHWU 4D76A 3LONA 1D3TB 5BRRE 3H7TA 2SGAA 1H8DH 1C2FA 2GD4B 3GY4A 1ZHPA 1BTHH 1P9SA 4D8NA 1BTXA 4ASHA 2VH6A 1O3OA 3A7WA 1ZJDA 3MI4A 4F49A 1IAUA 1ZGIA 4BNRA 4X8SH 2PSXA 5ESTE 4U32A 3SNBA 2G55A 4A5TS 5EU8A 4THNH 2P16A 1O2WA 4INLA 2BLWA 3PLPA 5C20A 1HCGA 1AB9C 3P8OA 1YPJH 1LTOA 1DOJA 4NSYA 5DO4H 2AGGX 1HAIH 2ZGXH 2FOFA 1YPGH 3NZIA 1AO5A 3T25A 4WY3A 2XW9A 1AFQB 2H5CA 1HAXB 1VJAU 1O2UA 1SGTA 4CR5A 5GDSH 1SGNE 7LPRA 1A0LA 1V2OT 3D65E 2B8OH 3BTQE 1K22H 1TPAE 4YO9A 2Y7XA 1DDJA 5SGAE 4XBDA 1P02A 3ZV8A 2C8YB 3LT3A 5LPRA 5A0BA 2ZO3H 1GHAF 3MU4A 4MG3A 1H8IH 5DJ7A 2RDLA 4KELA 2EI7A 2Q1JA 2D26C 4I8GA 1BMNH 3RU4T 4OS1A 2A4OA 2BDYA 3K65B 3LH3A 4ZKRU 1GJ7B 2VB0A 3A7ZA 1Y5BT 4RSPA 2FODA 5HMAA 3GY7A 5LGOA 3GDVA 2EC9H 3S7HB 5E2PA 3BTHE 3TH3H 1GPZA 1O3EA 2F9NA 3L6PA 2K1QA 1SGFG 1AB9B 1O5DH 1Y59T 2XC4A 2JH5D 4H6SB 2HNTF 1ZHRA 3KCGH 1C5MD 2EA3A 3K6ZA 1LHCH 4ZAEA 1PPCE 1ZYOA 1C5WB 3S69A 1WV7H 4CRAA 4DGJA 3F9FA 1LQDB 2VWMA 1HNEE 5PTPA 1HAGE 4LZ1H 1T8OA 5IDKA 1K1JA 4Y79A 3GCTF 1EZXC 1HJ9A 2WPHS 4ABHA 2HLCA 9ESTA 3PLKA 1SLXB 5EQSA 1VGCC 1PPFE 3Q3KA 1CBWC 2FX4A 5I25A 2TGTA 4DT7B 1SB1H 2P95A 4GCHG 1YLDA 1XVOA 2R0KA 2Y7ZA 2ZQ1A 8GCHG 2A4GA 2P8OC 1WAYB 2SNWA 4NZLA 2GV7A 2XXLA 3VB4A 3MTYA 1XUIA 4IMQA 2UUYA 1O30A 2PTCE 1FZZA 1O2GH 2C4FH 1YLCA 1SBWA 4IGDA 1DWCH 1TRYA 1SOTA 1ESBA 5LPFA 4E7NA 3EYDA 1IQFA 2ZDNA 3MMGA 4YLUA 4KKDA 1ELTA 1TOMH 2DE8A 4WH6A 4ABGA 2GT8A 1LKBA 2GV6A 1TMBH 2J9NA 3UNQA 3AW0A 1C5SA 2FOAA 1TX8A 2C3SA 3AW1A 5T6GA 1QQ4A 3IITA 4JK5A 1C5NH 3TGJE