2AH4X

Guanidinobenzoyl-trypsin acyl-enzyme at 1.13 a resolution
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta-trypsin
publication title Insights into the serine protease mechanism from atomic resolution structures of trypsin reaction intermediates
pubmed doi rcsb
molecule tags Hydrolase
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2005-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ah4X01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ah4X02
3M7TA 7GCHG 2ODQA 1A5IA 1T8LA 1F5RA 1PQ5A 3CENA 1L4ZA 1MUEB 1SGFG 1BBRE 1VR1H 3UUZA 1NC6A 3QO6A 2JH0D 2OP9A 3KF2A 4GHTA 4A1TA 3GICB 1C2LA 2FOFA 3OYPA 4ZKNU 4AG2A 3U8RH 1O3GA 1SOTA 3GYLB 1ZSJA 4KP0A 2ZFRH 5DP4A 2Y6TA 5AFZH 1AZ8A 1PQAA 1Y3XA 5EODA 3RXQA 3V12A 1BMNH 1RD3B 4O03A 3DD2H 1N6XA 1EOLA 2DE9A 3C1KA 2IJOB 5AVDA 4I8GA 4CH2B 1NESE 8LPRA 1CE5A 2G4TA 4ISIH 1OP2A 4MNYA 1GI0A 1GJAB 4FVDA 3RP2A 4I8KA 2A32A 1PQ7A 2J34A 1B5GH 1PQ8A 4NA8A 3T27A 1IQJA 1MU8B 4HFPB 2ZCLP 1OWKA 1C5UA 1P3CA 3U8OH 3PO1B 5CMXH 4XSKU 3TH3H 5J4QA 4IS5A 1WU1A 2J4IA 4AGJA 1C9TA 3RC4A 1V2JT 3UWJH 1O3EA 3URCA 4K69A 1H1BA 1EJNA 4JCNA 1EATA 3GCOA 2D2DA 2BVRH 3ZYEA 1C1UH 5EQRA 1OS8A 4WXIA 4ISLA 2ZTYA 1LTOA 2F3CE 2NWNA 1SR5C 1FY4A 3GY7A 2P16A 3VB7A 1O2MA 3RXRA 1F0RA 2GCTB 1MTNC 3AASA 1YKTA 2Y7XA 4INLA 1AFQC 2QXIA 4YTAA 2W3IA 2TIOA 1HXFH 2PLXA 4O3UA 4ABGA 3HKJB 3ZZCA 1AFEH 3GY6A 1ESTA 4UD9H 2TBSA 1JWTA 2FX4A 2H6MA 2ZGHA 2J38A 3TJOA 1ZTKA 4A5TS 2EA3A 1P2QA 2V35A 4ASHA 1ID5H 5DO4H 2OXSA 2R0KA 4OS5A 1QB9A 2CHAC 1C2JA 1VITG 4DURA 3B23B 3SU1A 3SNAA 1J16A 2CGAA 2HOBA 3F9EA 4MNXA 5DKMA 4YLUA 4R0IA 1TQ7B 5EXNA 4CBNA 1HJ8A 4ZXXH 1F0UA 3F6UH 4H42U 4UFDH 1GG6B 2ZQ1A 1CBWB 2P8OC 2AFQB 1SGRE 1O2SA 3EA8A 1O3AA 1GI7B 1ETTH 1J15A 2FESH 4X1SU 3T62A 2OC8A 1AE8H 4LZ1H 1C2FA 2PGBB 3D62A 3I78A 2CXVA 3QGNB 4UONA 1BDAA 2F9UA 2UUKB 1O2IA 4Y0YE 4B75A 1OKXA 3DA9B 1DUEA 3BG4B 3ZYDA 5PTPA 3SGAE 1LKAA 1D6RA 4Y7BA 1O2XA 1NM6A 1C1QA 4BTTB 3S69A 1HAXB 1L4DA 1PFXC 1YM0A 2FOAA 3RXVA 1O2YA 1QBOA 4MNWA 3UTUH 2NU2E 2GT8A 4ABEA 4AFUA 1WTGH 4E06H 2VVVA 3HK6B 2OTVA 4M7GA 2A4QA 3SO3A 4K1SA 5JBTA 1FY1A 4B2CA 2OQUA 2ZI2H 6GCHG 4F49A 3QN7A 2XCNA 1RTLA 1ORFA 5EW2H 1BITA 1MQ6A 1EJMA 3BEUA 1P2KA 2ZO3H 1QRZA 3Q00A 3RXFA 4CHAB 1S84A 1FAKH 2IPHA 1GHAF 4DIIH 2WPIS 1NRQH 1L1NA 1HAVB 3QX5H 3O8DA 5K0HA 1SL3A 1UTKA 1SVPA 2QIQA 3D49H 5FPTA 1SC8U 3LGVA 1BTXA 4K60A 4FUIA 1YP9A 1TX6A 1AD8H 1EPTA 2BD3A 2H9TH 3TJNA 1OWJA 4DG4A 1MH0A 2F9BH 3SGBE 3LT3A 2PKSC 3BF6H 1HAOH 2ZFQH 3F1SB 1S81A 2BDBA 3B8JA 3ATIA 1SOZA 3RDZA 1OYQA 3L6PA 3A84A 3SI3H 3TH4H 2AGGX 1QURH 3MU5A 1CHOG 3PLBA 1N1LA 4BAOB 2ZPSA 2BXUH 5EXLA 1XUHA 1FUJA 2SGQE 3RXIA 1KLIH 1RIWB 1GWAA 5DP3A 2C8YB 5E0HA 3SJOA 3T25A 1S0RA 1SGPE 1Y3VA 3F9GA 1FPCH 3VB5A 2VIDA 1DOJA 1C4U2 2GZ7A 1KXDA 2FI5E 3KQEA 1OWHA 3A82A 3FP7E 3A88A 1TNIA 4UE7H 2BHGA 5A0AE 3JZ1B 1KDQB 1D3PB 2FX6A 3K6YA 3KGPA 1RTFB 2I6SA 2HNTE 1GJ6A 1O36A 1S85A 4ABBA 5AHGH 1ZGIA 1KY9A 3UNQA 1P9UA 1O39A 1NZQH 3RLYH 1C5RA 2A31A 2CF8H 1P3EA 2QF0A 3MWIU 3PMBB 2B0FA 1D3QB 4X8VH 2AERH 4ISOA 4D7FA 1GBTA 1O5FH 1UCYH 1EPTC 1VCWA 2WPLS 4BXSA 2VWNA 2ZGBH 4Z0KA 2BY8X 3A8CA 1EAUA 1UJ1A 3ZVFA 1T8NA 1HJ9A 1NRRH 1LVYA 5JB9S 1FMGA 1W3CA 1HLTH 2UUFB 4JZ1A 4U2WA 3QZQA 3MH4A 2BDHA 3RM2H 2ZIQH 2UWOA 1P11E 3A7XA 3E91A 4HZHA 6CHAB 3A7YA 1NROH 1XUIA 1O2WA 4DT7B 1DE7H 2AYWA 1O3BA 1ELVA 1ESBA 2ZFPH 1GDQA 1XUKA 1GHYH 1P57B 4X0WU 3GOVB 1FJSA 5E2OA 1TBQH 2Q6GA 1SHYA 4ISNA 1C2KA 3BTKE 2ANMH 4RKJB 4B1TA 5GCHF 3UR9A 5T6FA 2LNCA 1NFXA 1O3MA 1W7GH 2SFAA 1G30B 1FONA 2O8MA 4Y8ZA 2CF9H 1HJAC 2F9VA 2I6QA 1C1VH 2AMQA 1ZSKA 4YOGA 1ANCA 2SGAA 4NFFA 2CN0H 1A2CH 4FUBA 2WPHS 4BAHB 1O5BB 2OQ5A 4DIHH 2WINI 1AUTC 1ANBA 2R2WU 2UWPA 4D8NA 1W10U 2TGTA 2FP7B 1YCPM 1SLXB 1AWFH 1TQ0B 3AW1A 3TK5A 1P2JA 1P9SA 1GI2A 1QJ6B 4CR9A 1AMHA 4DCDA 1ACBE 3SV7A 5DP9A 2O8UA 3ZVBA 4DJZB 3SUEA 3U9AH 4E05H 4JMYA 2BY7X 4CBOA 1WQVH 3RC5A 5FBEA 2PTCE 1MKWH 5JBCS 1RRKA 1NO9H 2B8OH 1C1TA 2BLWA 3PV4A 3A81A 3SQHE 1IQKA 2GCHF 3HPTB 2ZHDA 1ZTJA 3V3MA 5ESTE 2BTCE 1DVAH 1O3OA 1HAZB 1LDTT 4O9VA 3ATWA 3RU4D 1Y3YA 1EUFA 4IC5A 2J9NA 4GUXA 4TYDA 2Z9JA 2EI7A 4NZLA 2BDGA 1Y5BT 2TGDA 2YNAA 2D8WA 2SGDE 1FAXA 1PPEE 2O8LA 4HI3A 4RN6A 1PPGE 1EAIA 2VWOA 1Z6JH 2V3HH 1GI6A 1IQLA 4ESTE 3SZNA 1P01A 1P2IA 2Q1JA 3BTTE 1HXEH 2XTTB 2CJIA 2V0BA 2QV1A 5C5NA 4FU7A 1XUGA 1IQFA 3ZZDA 4BOHA 1D3DB 1H9HE 5HM9A 5A09A 4A92A 3MNBA 1CHGA 2ZCHP 2GMTB 3M5LA 1KXCA 2FLRH 1SGFA 1D6WA 1GI9B 2BYAX 5GJ4B 2F9OA 1BMLA 2WPJS 2OBQA 5SGAE 4IN1A 3SW2B 1ZMJA 3O8RA 1WCZA 1GBHA 1F92A 1UTPA 2GDEH 4U01A 1SHHB 1SGNE 4TY7A 1AKSB 2O8TA 1LPZB 1RJXB 3AAUA 3Q77A 2A4RA 5EQSA 1MKXK 2QXHA 1HAHH 1ELAA 1GI4A 4YT6H 4MPWA 1W11U 5DGJA 5TCCA 1GGDC 1BTUA 1AKSA 4U30A 1MTWA 1TE0A 2AEIH 1G2MA 1TYNA 2BX3A 1BRBE 2BD8A 1LVMA 3OY5U 2QA9E 1VZQH 1V2NT 3GCHC 2BXTH 1BTPA 1HNEE 2C90B 4GCHG 1QBVH 5E2PA 1TNLA 3QWCH 1S6FA 2A5AA 1BA8B 1KIGH 1DXPA 4NG9H 5EGMA 3S7KB 1K22H 3RXDA 3E6PH 5A8ZA 4FVBA 1FY8E 1O30A 1OSSA 4B76A 3ODFA 2PGQB 5A8XA 3NWUA 1V2VT 2DE8A 4WMDA 2K1QA 2Y82A 3S0NA 1HIAB 3IITA 4TWWA 4B2AA 1V2PT 2FYRA 1INCA 1AY6H 4B74A 3ZZ3A 3EDXB 4CRCA 4X2WA 1HDTH 2ZDNA 1UTMA 5DG6A 2P59A 3F9FA 1KTTB 1G37A 2XNIA 3GY2A 1TRNA 1QIXB 4JK5A 4Y10E 3TH2H 4OS4A 1FZZA 4JYTA 4Q7ZA 3PMAB 3S9CA 1KLJH 3Q3XA 5C1XA 2R3YA 5IDKA 2Y5GA 1N6YA 4IMQA 1BQYA 1QB6A 2PV9B 3A7ZA 3BTFE 3ZZ7A 1A0JA 1HAIH 1K1PA 1SFIA 1ESAA 1BHXB 4CRFA 4OS1A 1ZSLA 2D1JA 4FUGA 5I46H 3MU4A 1IAUA 2ALPA 4UFGH 3UNSA 3KIDU 1GBJA 1MBQA 1P2OA 3QDZB 4H6TA 2SNVA 2NU4E 5JBBS 1BHXF 3OTJE 1N8OC 2FTMA 2R0LA 3E0PB 1VITF 4X8TH 3EA9A 2G81E 4IC6A 3RXGA 1UVUH 5GXPA 3M7UA 4H4FA 1DDJA 1YCPH 3BTHE 1H4WA 1QA7A 4GLYA 1AFQB 1DWBH 5JPMH 3PLPA 4NSYA 4J1YA 1Z8IB 2FI4E 1WUNH 1WBGB 2HRVA 2XCFA 3SU5A 4THNH 5K7RA 1GJBB 3EGKH 3LIWA 1UVOA 3RU4T 4DOQA 1YBWA 3K9XB 3GISB 1E36B 1GBIA 3HATH 3MO6A 2PKAA 2PUXB 1XUFA 4BTUB 1SQAA 1VGCB 1O3PB 3VGCC 4ABDA 1GJ9B 1DLEA 2J92A 3H7OA 4JZIA 1ZMNA 4B71A 3TNTA 1DM4B 1YPHC 5CE1A 3GDVA 1DWCH 1O38A 5HMAA 1GHBF 2GVFA 1C5MD 3RXHA 1IHSH 1W2KH 2C8XB 2VINA 4TPIZ 3U1JB 1ZPZA 3BEIB 1G36A 1GMCG 3BEFB 1RXPA 5C3NA 1O34A 1QY6A 4AGKA 4AB8A 5E0GA 2FZZA 2Q6FA 1V2UT 3ESTA 5AFYH 1UTQA 5T6DA 1SB1H 1O31A 3BV9B 4NCYA 2SNWA 5C1YA 3GDUA 4FUDA 1AB9B 1YPHE 3PMHB 2ASUB 2ZDLA 3PTNA 3CS0A 1TALA 4B73A 1THRH 3RMOH 4Y11E 1O5GH 1K2I1 1T32A 1BCUH 3PYHA 2ESTE 5DK1A 2Z9IA 1XVOA 3UNRA 3UOUA 1TNHA 3LGUA 1FDPA 1FN6A 1JIMA 1Z71A 2G8TA 1SGDE 1W12U 2JH6D 1C5VA 4GHQA 4Y71A 1OWDA 3RXPA 2Z94A 3VXFH 1RTKA 1AIXH 3P8FA 1X7AC 3P8NA 3PWBA 2STAE 1IHTH 1PYTD 1Q3XA 3A80A 4TPYA 5EW1H 2G55A 1CHOF 4X8UH 1OX1A 4MQAA 1SQOA 5J4SA 1QFKH 5EPYA 2FTLE 1UK2A 1C1WH 2JETB 5FPSA 4GSOA 1W7XH 1C4Y2 1Z1JA 1EP6A 2OC1A 3RUOA 1O3JA 3FZDA 1KTSB 2GT7A 4X2VA 2NU1E 3M7QA 3E0NB 3VB4A 1JRSA 3GCTG 2HVXA 3U8TH 3UWIA 3GCNA 1XVMA 1ZJDA 2H5DA 2VIQA 3M37A 2WYJA 5CHAC 4ISHH 4YLQH 2BOKA 4A1XA 1C5XB 1MTSA 2XWAA 2W26A 1MCVA 5DP7A 3SV9A 1THPB 4XDEA 1O32A 4ZMAH 1MZDA 4KELA 1O3CA 4SGAE 1TFXA 1FIZA 4IW4E 1QCPA 2YNBA 1P05A 5HYOA 1W14U 2ZU1A 2C8WB 1E37B 1A61H 1O2ZA 1H9LB 2ZA5A 3RXEA 2LPRA 1C5SA 2FO9A 4X8SH 3BTDE 2PR3A 3SJKA 3TGJE 1JMOH 1BMMH 1V2QT 2XC0A 2JH5D 4NIXA 1ZTLA 4E7NA 3URDA 5L30H 3SORA 3PO1C 1V2LT 3P6ZB 1FLEE 2RDLA 4BAMB 4JK6A 1AVXA 1OOKB 1TWXB 3P70B 1Z8RA 1SGQE 1O2GH 1SLVB 2ZTZA 3ENSB 3GY3A 2ZHQH 3S9AA 2VGCB 3CP7A 2J2UA 4X1PU 2BD5A 5F8ZA 4ABAA 4RKOB 1O2TA 2VWLA 1ETRH 1ZLRA 1P2MA 4Y6DA 3SHAH 3MMGA 2VU8E 1H8IH 1VJ9U 1LPKB 1AUJA 1D9IA 3SJ9A 2BD7A 1ELBA 3TK6A 5F8TA 1CO7E 2Z9GA 1SGIB 1GL1A 1O2HA 3W95A 1DSTA 3I29A 3LH1A 3SU4A 1YPGH 2OUAA 3IWMA 3TGKE 1NTPA 4ZKSU 1BJVA 1ZHMA 1J17T 3STJA 2BD9A 1BJUA 1EPTB 5E8EH 5F03A 3GY5A 3D65E 1RS0A 4JZEH 4TWYA 5JB8S 1O3FA 2KAIA 1WQSA 2STBE 2ZGXH 2BQWB 3UPEA 2O8WA 3P92A 2FWWA 3DFLA 4UEHH 3LJOA 3TJVA 1DICA 2FOHA 1M9UA 1PPHE 2RA0A 1KXBA 5G4BA 3RXTA 1GCTC 1MD7A 3RXLA 1TGBA 4JZDH 2HNTC 4AX9H 5T3HA 2BLQA 1WYKA 3Q3KA 1GG6C 1OPHB 3QTVH 4Q7XA 2JKHA 4E7RG 1T31A 3K2UA 3ZVEA 3LGIA 1A46H 1BTWA 4FUHA 3TIUA 3OSYA 2ZU3A 3BG4C 1FQ3A 3SV2H 1OXGA 4AYYB 1LHCH 1BBRH 5T6GA 1ARBA 1AN1E 2ZKSA 2OCVB 4RSPA 1DX5M 1HRTH 3EYDA 1F0TA 2F9PA 5FXLA 2P3TB 3FP6E 2WV5A 1O2NA 1MAXA 1UTJA 1Z7KA 1W0ZU 2HALA 1O2RA 2FOCA 4BXWA 2ZCKP 1QR3E 2ZPRA 4D9RA 1O2VA 1BT7A 8GCHF 2H9EH 1SG8B 1AHTH 2H9HA 4OS6A 4AFSA 1LQEA 1EASA 1O2JA 3NPSA 3I77A 4AFZA 3PM3A 4MVNA 2PW8H 1BZXE 4Y76A 1O5EH 1O3DA 4ABIA 1ZRKA 3UFAA 1HBTH 1NRSH 5C5OA 1HV7A 1GJ7B 1V3XA 2PWXA 2ZU4A 3UOPA 5LPRA 2QF3A 2BX4A 3V13A 3MYWA 1ELGA 4NA7A 1ZJKA 1BRAA 1Q2WA 4ZHLU 1OWEA 1BTHH 4YM9A 4FU9A 2BD2A 3GY4A 2PUQH 4WMFA 1IQMA 2EI6A 1V2WT 4NSVA 1WTHD 2A5KA 2G5VA 3U98H 1WV7H 1GPZA 2ODYB 4YZUA 3UY9A 2WUCA 1KSNA 5E0JA 1LHFH 4FU8A 2ULLA 4XBCA 1PPFE 2IOTA 5LPEA 1AWHB 1C1OA 1NRPH 4FXGH 4CRAA 1K21H 1YPLH 1AI8H 3SU6A 6ESTA 2G51A 3E8LA 3M3TA 1RIWC 1EZSC 1GHAG 3R0FA 3RXSA 1QTFA 2ZDKA 1SMFE 2G5NA 2FOBA 1QQ4A 2G52A 2PHBA 2A2XH 4FUJA 2VVCA 1UCYK 1VITH 3ATLA 1TMBH 2FOEA 1GDUA 1EQ9A 4UFEH 2Z9LA 1ANEA 1FY5A 4QT8C 4D9QA 2VNTA 2ODPA 3N7OA 1TABE 2W7SA 1GGDB 1HGTH 1EKBB 2QCYA 1IQNA 1QJ7B 1K1LA 1DUAA 2ANWA 3A7TA 1MTVA 1UMAH 3MU8A 1QHRB 4SGBE 4Q7YA 1GL0E 3SU2A 1DXWA 2XRCA 1GI5A 4B2BA 2FMJA 1GI8B 2FM2A 1E35B 3NK8A 1YLCA 3EAJA 3M5NA 2XBWA 5HM2A 1NPMA 1SPJA 1CA0B 1LO6A 3TNSA 1THSH 4LZ4B 2H5CA 2ZWLH 3H5CB 2HWLB 1J14A 1CA8B 1V6DA 2RCEA 3A8DA 4WH6A 3TJUA 1L0ZA 3TVJB 1K1IA 4MG3A 2ZG0H 3E3TA 3T26A 1P03A 4WWYA 4NZQA 1S5SA 2FXRA 3LPRA 2B5TB 2QGRA 3ODDA 4UDWH 1GMDF 3SQEE 3SNEA 3U1IB 3UQVA 1EAWA 4GPGA 2VWMA 2OBOA 3M36A 2P94A 3RMMH 1HCGA 2Z3CA 1NFWA 1Y3UA 2BVSH 2BQ7B 2FYQA 1FV9A 1LMWB 1LHEH 3E16B 3M5MA 1CGJE 1O33A 1LHGH 2ZZUH 1CU1A 9ESTA 3E1XB 1HAPH 1C2HA 3ELAH 1FPHH 7GCHF 2NU3E 2Y81A 1Z1IA 1O5AB 1FN8A 1SLUB 1UK4A 2C8ZB 2BY5X 2ZFFH 1ELEE 1A5GH 2A2QH 4ZKRU 1K1JA 2BLVA 5FCRA 1KLTA 3BN9A 3ZVCA 5FHTA 4CRGA 4ZUHA 1OP8A 1P8VC 1V2RT 4XE4A 4ZH8A 1C2IA 9LPRA 3ZVAA 5BRRE 1MKWK 1CT4E 2HLCA 2A45B 1JBUH 3LGYA 3IG6B 1AVGH 4X1NU 4H6SB 5C2ZA 1XKAC 2XBVA 4KTUA 2BVXH 1J8AA 2XBXA 3EE0B 1C5LH 2A0QB 2A4OA 1UK3A 2GX4A 3TITA 5I25A 1QGFA 1L1JA 4ABHA 3RXAA 1CSOE 4Y0ZE 1YPKH 1BRUP 2FEQH 3RMNH 1K1MA 1UTNA 1UVTH 1TRMA 1K28D 1DY8A 1MBMA 5AF9H 2HGTH 4JYVH 1IQGA 1EP5A 1IQEA 5GCHG 1TOMH 1QJ1B 1SQTA 3FANA 5EPNA 3LOXA 3NXPA 1JOUB 5ESBA 1L1GA 1GJCB 3QZRA 4XOJA 1EX3A 3F9HA 3RU4E 1DPOA 2ANYA 4XFQA 3ZZ4A 2P3UB 2ZHWH 1NFUA 1P12E 3ZVGA 1AGJA 1LVBA 3A85A 1T8MA 2OC0A 3BTWE 1TX7A 3MI4A 2D26C 4NFEA 3VGCB 5C67A 3KQBA 2FDAA 3LH3A 1NS3A 3STIA 4K1TA 4O3TA 1ETSH 1O3HA 1A4WH 1CT2E 1EB1H 2XC5A 3QK1A 1XM1A 1LQDB 1O37A 1Y8TA 1F5LA 1F7ZA 1YGCH 3ZV8A 2W5EA 1ELTA 1CQQA 4J2YB 1XMNB 4HTCH 2TGAA 1G3EA 3MNSA 2ZTXA 1TPSA 1UTOA 1C2GA 1O2LA 1SGCA 1P2NA 1XX9A 3M3VA 3ZVDA 2VIVA 2GCHG 4Q80A 5GPIB 1O2QA 1ZHPA 1YYY1 4NWLA 1O3KA 4XBBA 2NU0E 3QGJA 4OGYA 2AS9A 3HGPA 1DWEH 1NU7B 2UUJB 3SNCA 1DY9A 1DFPA 4F4OC 1K9OE 1BOQA 2GZ9A 5A2MH 1DLKB 1U6QA 2H1UA 1A5HA 1QA0A 5HXFA 1GHXH 1HAYB 2OD3B 1MTNB 4X6NA 2PFEA 4O97A 5DPAA 3SUDA 4BAQB 1GBKA 1SFQB 2FOMB 2ZHFH 3SU3A 1GDNA 3OU0A 2BDAA 2PKAB 4NA9H 3M5OA 2TRMA 4MDSA 5FCKA 1Y5AT 5C1UA 1UO6A 1PPBH 1TA6A 1UVSH 3LONA 2ZFTA 1YC0A 1BTZA 3SGQE 5F8XA 1T8OA 2AGEX 3TU7H 2AH4X 2CHAB 1GBDA 5CHAB 1G3DA 3SU0A 1GVZA 3RXJA 1HYLA 3SV8A 4AZ2B 1C1PA 1ZPCA 3SN8A 1OP0A 2VH0A 3VFEA 3FAOA 4K1EA 3NZIA 1QL7A 2GZ8A 2GTBA 3BIVH 2P8OB 3Q76A 2IN2A 6GCHF 3R3GB 1UCYE 5H4IB 2SGEE 3LU9B 2M5TA 2YOLA 3MH7A 1QL9A 3MO3A 4D76A 1P02A 1V2TT 3TPIZ 2V3OH 1S82A 3BTME 1YCPK 1KXEA 3PWCA 1YPMH 1BRCE 3LDXH 1TNKA 5JDUB 1TLDA 1FXYA 3L3TA 3UQOA 3W94A 1C5OH 2QYIA 1TA2A 5EQQA 1O2KA 2PSYA 2WYGA 2ZQ2A 4WH8A 4VGCC 2VIWA 4ZKOU 1Y59T 4WVPE 4LOYH 2BY6X 2P93A 2RG3A 1C5NH 3A7VA 4AN7A 2VB0A 2ZDMA 4ABJA 4PROA 4K5ZA 1GMHG 3MFJA 1GI3A 1TBZH 3BSQA 4OS7A 3PROA 2ZF0H 3UREA 3PB1E 4A1VA 1FIWA 1VCQA 2W3KA 2FIRH 1ZYOA 3ZZ6A 1QL8A 3SOSA 5DJ7A 2BOHB 2R9PA 5LPFA 1GJ8B 4NGAH 3ZZAA 1TONA 1EZXC 1FNIA 4X6MA 2BDYA 1B0FA 1AZZA 1PPZA 3V0XA 1LKBA 1JRTA 1F5KU 1ELFA 1P0SH 3RXCA 1GJDB 1UVPA 1VCPA 1VGCC 1C5TA 1K1NA 2PKSB 4I33A 3RXUA 4Y7AA 1CVWH 2F9NA 2Z6BD 4I31A 2PTNA 4A7IB 1GCTB 2FS9A 3MHWU 1T7CA 1ABIH 3O8CA 2AMPA 1OWIA 5EXMA 1MZAA 1SGEE 1TMUH 3RLWH 3LGTA 1O3NA 5F6MA 5GIBA 5GDSH 2A7JA 3OY6U 1S0QA 1NN6A 1DITH 2GV7A 3M61U 1AVWA 2TPIZ 2HNTF 1Z8JB 2VJ1A 2CV3A 4AG1A 3TGIE 1PYTC 4UFFH 1L2EA 4YESB 2ZC9H 3T5FH 4WY3A 5L2ZH 1FI8A 4KTCA 1CT0E 4CH8B 3GDSA 3M35A 1AB9C 1AU8A 1GHZA 1ELDE 2ZGJA 4Y8YA 1FY3A 1V2OT 3S7HB 3RM0H 2P95A 1KXAA 2VIOA 5L2YH 1A7SA 1NRNH 2QY0B 4NIWA 1SI5H 1SBWA 4BAKB 4Q2KA 3ATKA 1GJ4H 1GHBG 2UUYA 1TGCA 4KTSA 5DP8A 4Y79A 3UR6A 1P09A 1TB6H 4MTBA 1KXFA 2GCTC 4ZROA 3ZZBA 2UWLA 2J94A 3DUXH 1GHVH 3BTQE 4I32A 2ZGCA 2KAIB 1MMJN 1XKBC 1A0HB 1T4VH 4WJG2 3RMLH 3GYMA 1GBFA 2JETC 2AIPA 3K6ZA 3MNCA 4YOJA 1V2MT 3F68H 4JZFH 1ZMLA 3MNXA 2CMYA 1E38B 3LGWA 1MAYA 4WF8A 2WPKS 4MLFB 3OX7U 1G32B 1O5DH 4NIVA 3VPKA 4DY7B 1TNJA 2ZDAH 2AIQA 1TIOA 3VB6A 1HAVA 2FS8A 3P8OA 2B9LA 2V6NA 1Z8GA 1JIRA 3PTBA 1G3CA 1O2OA 3B9FH 3LKWA 3A86A 3LJJA 1F2SE 1RGQA 1W8BH 4HGCA 1CGHA 3T29A 5B6OA 3RXBA 4Z6AH 1CBWC 4K2YA 1C5YB 1C2MA 1EJAA 2WPMS 4OGXA 3UIRA 4XBDA 2ZNKH 3BTGE 2QXGA 1NT1A 4IGDA 3H7TA 1TX8A 1LCYA 1HJAB 3ZZ5A 4K8YA 5LH8A 1RFNA 2P3FH 1P04A 4WMEA 4ABFA 4KKDA 5A0CA 2Y80A 1B7XB 1BTYA 3KEEA 1LHDH 1TGSZ 2A1DB 3ATMA 4GVUA 4R8TB 3A8AA 3SHCH 4YT7H 3SI4H 2F91A 2ZDVH 1GBMA 7KMEH 3ZV9A 3QUMP 3VB3A 3A7WA 3FFGA 4MNVA 2ZHEH 5L6NH 5EU8A 1VJAU 2VGCC 1G9IE 2BLOA 2SGPE 1W13U 4U32A 3P8GA 2Z7FE 4CRDA 3T2NA 3AW0A 1LVOA 1KDQA 4I8LA 1TBRH 3KNXA 1ANDA 4X2YA 1A0LA 1HFDA 1YLDA 3DFJA 4I8HA 1W0YH 4CHAC 1C2DA 3MU1A 1QQUA 2ILNA 1SLWB 2RA3A 2FPZA 4MPVA 1ABJH 3A8BA 1E0FD 4INKA 1TGTA 1SSXA 1YF4A 1Z6EA 2Z3EA 3KL6A 1AO5A 2XXLA 5A8YA 3V7TA 1DSUA 1PPCE 2ZEBA 1C5QA 1A1RA 3A83A 3KQDA 1ZRBA 1B0EA 2BZ6H 1BBRK 1GBLA 1C2EA 1QRWA 1WOFA 1ZGVA 2QXJA 2J95A 1UHBB 2OC7A 5GWZA 1BB0B 1JXPA 4GCHF 4NIYA 3M3SA 2AGIX 1G3BA 4BTIB 1UHBA 1XXFA 3MH6A 4CRBA 1MQ5A 1KYNA 3HK3B 3G01A 2W7UA 5EOKA 1A3EH 4TY6A 4X2XA 1TOCB 3QTOH 5LGOA 1GBBA 5TCAA 2A7CA 5ABWA 3SUGA 3MTYA 1H9IE 1EXFA 1D4PB 2XYAA 4I8JA 4AB9A 1J9CH 1GBCA 2BDIA 2Z9KA 3TLOA 4IBLH 3CS7A 1ZHRA 3SNBA 1TGNA 1EOJA 3JZ2B 2R2MB 1TMTH 1GVKB 2H2ZA 3FP8E 3KQCA 1IQHA 2Z3DA 1DANH 3RXKA 3NUMA 4BANB 1O5CB 2A7HA 1C9PA 2GGVB 1O2UA 4K8BA 3RXMA 1A3BH 1TRYA 2FI3E 3LC3A 2ALVA 3LC5A 1DT2A 1XUJA 3GCHB 1S83A 2ZPQA 3VEQB 1GJ5H 3RXOA 4NWKA 1C5ZB 2XW9A 2BY9X 1HPGA 3DT0H 1D3TB 1ZOMA 1MU6B 2B7DH 1Y3WA 1MD8A 2BZAA 1GVLA 1SGTA 1AE5A 2G00A 1YPJH 2R3UA 2QC2A 3K65B 2GKVE 2ZP0H 1TPPA 3EQ0H 3P95A 5FPYA 5BPEA 1MKXH 2XC4A 3EA7A 2GD4B 2QN5T 1EAXA 5FX6A 1HUTH 1IOEA 3FVFB 1C4V2 1C5PA 3KN2A 3QLPH 6CHAC 3T28A 2F83A 4INHA 1ELCA 1GHWH 7ESTE 5A0BA 2GV6A 4DVAU 4LK4A 4KGAA 1GBEA 2SGFE 4X1QU 3SUFA 1GI1A 1LPGB 4ZAEA 3SBKA 3HGNA 1O3LA 5JBAS 4X6PA 4YO9A 2G4UA 3C27B 1P10A 4ZXYH 2Y7ZA 8GCHG 1T4UH 1ZPBA 2QAAA 2ZU2A 2XWBI 1BMAA 4MPXA 1BUIA 3O8BA 5JYIA 2PSXA 4LXBH 1TAWA 4BNRA 3FZZA 3NCLA 3Q3YA 1C1MA 4JYUH 2WUBA 3RC6A 4K3JA 3AAVA 3A87A 2ANKH 2VH6A 1V2ST 5TJXA 3MH5A 1N8OB 7LPRA 4IMZA 1NY22 2Q6DA 1MTUA 4FUCA 2EI8A 2Y5FA 3ZZ8A 1GBAA 3D23A 5FBIA 1NFYA 4AYVB 3BG8A 3BTEE 4AOQA 6LPRA 4DW2U 1O2PA 1C1SA 3L33A 1GMCF 1QB1A 3PMJA 1UTLM 3MO9A 1NU9A 1SGYE 4GAWA 2FODA 5HGGA 5DP6A 4ZHMU 1TNGA 2ZECA 4X1RU 4FUEA 2GP9B 4X6OA 2FOGA 4AFQA 4FUFA 5FX5A 1C1NA 4I7YH 1HB0B 1HAGE 4Y8XA 4DGJA 4WXVA 1S6HA 3DHKH 1K1OA 3SV6A 1CA0C 3MU0A 2THFB 4ZHAA 4YOIA 3A89A 3S9BA 2FLBH 1DS2E 8ESTE 4MPUA 1O0DH 1XXDA 1GCDA 1TPAE 1C5WB 2VVUA 1V2KT 3VXEH 1EZUC 2BB4A 3SJ8A 1QRXA 3WY8A 3KHVA 5EG4A 3U69H 1IQIA 1ARCA 2C3SA 1EB2A 2GDDA 1GMHF 1CGIE 2OINA 1HIAA 2A4GA 2ZFSA 3P17H 1OYTH 3BIUH 2BQ6B 1WAYB 3ITIA 2BD4A 3MOCA 4A6LA 4AORA 1BIOA 1H8DH 2BMGB 1O35A 4CR5A 1F0SA 2GMTC 3SJIA 1PJPA 2O9QA 1ZR0A 2HPQH 1P06A 5FAHA 5IYTA 1Q31A 1E34B 2A5IA 2HPPH 2ZU5A 5ETXA 3PLKA 2C93B 1YPEH 1AQ7A 5DP5A 3TK9A 3GCTF 3KCGH 3GY8A 2EEKA 1O3IA 2OLGA 1ZZZA 2DUCA 1TPOA 4CREA 5C20A 1QNJA 1C1RA 1WSSH 4VGCB 2C4FH 8KME2 3HKIB 4D7GA 2BM2A 1DWDH 2Y5HA 3AVZA 3ZZ9A 3SNDA 1MCTA 1GMDG 2AMDA 2WV4A 3E90B 2XBYA 1EZQA 3NKKA 1G2LA 2VIPA 1QBNA 2BDCA 4IN2A 4OS2A 1Y5UT 2TGPZ 2EC9H
chains in the Genus database with same CATH superfamily
3M7TA 7GCHG 2ODQA 1A5IA 1T8LA 1F5RA 1PQ5A 3CENA 1L4ZA 1MUEB 1SGFG 1BBRE 1VR1H 3UUZA 1NC6A 3QO6A 2JH0D 2OP9A 3KF2A 4GHTA 4A1TA 3GICB 1C2LA 2FOFA 3OYPA 4ZKNU 4AG2A 3U8RH 1O3GA 1SOTA 3GYLB 1ZSJA 4KP0A 2ZFRH 5DP4A 2Y6TA 5AFZH 1AZ8A 1PQAA 1Y3XA 2XOKD 5EODA 3RXQA 3V12A 1BMNH 1RD3B 4O03A 3DD2H 1N6XA 1EOLA 2DE9A 3C1KA 2IJOB 5AVDA 2PP6A 4I8GA 4CH2B 1NESE 8LPRA 1CE5A 2G4TA 4ISIH 1OP2A 4MNYA 1GI0A 4FOUC 1GJAB 4FVDA 3RP2A 4I8KA 2A32A 1PQ7A 2J34A 1B5GH 4FETA 1PQ8A 4NA8A 3T27A 1IQJA 1MU8B 4HFPB 2ZCLP 1OWKA 1C5UA 1P3CA 3U8OH 3PO1B 5CDFE 5CMXH 3KYFA 4XSKU 3TH3H 5J4QA 4IS5A 1WU1A 2J4IA 4AGJA 1C9TA 3RC4A 1V2JT 3UWJH 1O3EA 3URCA 5EJ1A 4K69A 1H1BA 1EJNA 4JCNA 1EATA 3GCOA 2D2DA 2BVRH 3ZYEA 1C1UH 5EQRA 1OS8A 4WXIA 4ISLA 2ZTYA 1LTOA 2F3CE 2NWNA 1SR5C 1FY4A 3GY7A 2P16A 3VB7A 1O2MA 3RXRA 1F0RA 2RFKC 2GCTB 1MTNC 3AASA 2EQNA 1YKTA 2Y7XA 4INLA 1AFQC 2QXIA 2WHXA 4YTAA 2W3IA 2TIOA 1HXFH 4F55A 2PLXA 4O3UA 4ABGA 3HKJB 3ZZCA 1AFEH 2W6JD 3GY6A 1ESTA 2JDID 3H09A 4UD9H 2TBSA 1JWTA 2FX4A 2H6MA 2ZGHA 4TT3D 2J38A 3TJOA 1ZTKA 4A5TS 2EA3A 1P2QA 2V35A 4ASHA 1ID5H 5DO4H 2OXSA 2R0KA 4OS5A 1QB9A 2CHAC 1C2JA 1VITG 2F43B 4DURA 3B23B 3SU1A 3SNAA 1J16A 2CGAA 2HOBA 3F9EA 4MNXA 5DKMA 4YLUA 4R0IA 1TQ7B 5EXNA 4CBNA 1HJ8A 4ZXXH 1F0UA 3F6UH 4H42U 4UFDH 1GG6B 2ZQ1A 1CBWB 2P8OC 2AFQB 1SGRE 1O2SA 3EA8A 1O3AA 1GI7B 1ETTH 1J15A 2FESH 4X1SU 3T62A 2OC8A 1AE8H 4LZ1H 1C2FA 2PGBB 3D62A 3I78A 2YMSD 2CXVA 3QGNB 4UONA 1BDAA 2F9UA 2UUKB 1O2IA 4Y0YE 4B75A 3AK5A 1OKXA 3DA9B 1DUEA 3BG4B 3ZYDA 5PTPA 3SGAE 1LKAA 3F2GA 1D6RA 4Y7BA 1O2XA 1NM6A 1C1QA 4BTTB 3S69A 1HAXB 1L4DA 1PFXC 1YM0A 2FOAA 3RXVA 1O2YA 1QBOA 4MNWA 2K0QA 3UTUH 2NU2E 2GT8A 4ABEA 5DSFA 4AFUA 1WTGH 4E06H 2VVVA 3HK6B 1W0KD 2OTVA 4M7GA 2A4QA 3SO3A 4K1SA 5JBTA 1FY1A 4B2CA 2OQUA 2ZI2H 6GCHG 4F49A 3QN7A 2XCNA 1RTLA 1ORFA 5EW2H 1BITA 1MQ6A 1EJMA 3BEUA 1P2KA 2ZO3H 1QRZA 3Q00A 5CHBA 3RXFA 4CHAB 1S84A 1FAKH 2IPHA 1GHAF 4DIIH 2WPIS 1NRQH 1L1NA 1HAVB 3QX5H 3O8DA 5K0HA 1SL3A 1UTKA 1SVPA 2QIQA 3D49H 5FPTA 1SC8U 3LGVA 1BTXA 4K60A 4FUIA 1YP9A 1TX6A 1SQRA 1AD8H 1EPTA 2BD3A 2H9TH 3TJNA 1OWJA 4DG4A 1MH0A 2F9BH 3SGBE 3LT3A 2PKSC 3BF6H 1HAOH 2ZFQH 3F1SB 1S81A 2BDBA 3B8JA 3ATIA 1SOZA 3RDZA 1OYQA 3L6PA 3A84A 3SI3H 3TH4H 2AGGX 1QURH 3MU5A 1CHOG 3PLBA 1N1LA 4BAOB 2ZPSA 2BXUH 5EXLA 1XUHA 1FUJA 2SGQE 3RXIA 1KLIH 1RIWB 1GWAA 5DP3A 2C8YB 5E0HA 3SJOA 4P00A 3T25A 3EE7A 1S0RA 1SGPE 1Y3VA 3F9GA 1FPCH 3VB5A 2VIDA 1DOJA 1C4U2 2GZ7A 1KXDA 2FI5E 3KQEA 1OWHA 3A82A 3FP7E 3A88A 1TNIA 4UE7H 2BHGA 5A0AE 3JZ1B 1KDQB 1D3PB 2FX6A 3K6YA 3KGPA 1RTFB 2I6SA 2HNTE 1GJ6A 5KEDA 1O36A 1S85A 4ABBA 5AHGH 1ZGIA 1KY9A 3UNQA 1P9UA 1O39A 1NZQH 3RLYH 1C5RA 2A31A 2CF8H 1P3EA 2QF0A 3F2HA 3MWIU 3PMBB 2B0FA 1D3QB 4X8VH 2AERH 4ISOA 4D7FA 1GBTA 1O5FH 1UCYH 1EPTC 1VCWA 2WPLS 4BXSA 2VWNA 2ZGBH 4Z0KA 2BY8X 3A8CA 1EAUA 1UJ1A 3ZVFA 1T8NA 3CNRA 1HJ9A 1NRRH 1LVYA 5JB9S 1FMGA 1W3CA 1HLTH 2QF4A 2UUFB 4JZ1A 4U2WA 3QZQA 3MH4A 2BDHA 3RM2H 2ZIQH 2UWOA 1P11E 3A7XA 3E91A 4HZHA 6CHAB 3A7YA 1NROH 1XUIA 1O2WA 4DT7B 3OAAD 1DE7H 2AYWA 1O3BA 1ELVA 1ESBA 2ZFPH 3OEED 1GDQA 1XUKA 1GHYH 1P57B 4X0WU 3GOVB 1FJSA 5E2OA 1TBQH 2Q6GA 1SHYA 4ISNA 1C2KA 3BTKE 2ANMH 4RKJB 4B1TA 5GCHF 3UR9A 5T6FA 2LNCA 1NFXA 1O3MA 1W7GH 2SFAA 1G30B 1FONA 2O8MA 4Y8ZA 2CF9H 1HJAC 2F9VA 2I6QA 1C1VH 2AMQA 1ZSKA 4YOGA 1ANCA 2SGAA 4NFFA 2CN0H 1A2CH 4FUBA 2WPHS 4BAHB 1O5BB 2OQ5A 4DIHH 2WINI 1AUTC 1ANBA 2R2WU 2UWPA 4D8NA 1W10U 2TGTA 2FP7B 1YCPM 1SLXB 1AWFH 1TQ0B 3AW1A 3TK5A 1P2JA 1P9SA 1GI2A 1QJ6B 4CR9A 1AMHA 4DCDA 1ACBE 3SV7A 5DP9A 2O8UA 3ZVBA 4DJZB 3SUEA 2WSSD 3U9AH 4E05H 4JMYA 2BY7X 4CBOA 1WQVH 2VBCA 2J98A 3RC5A 5FBEA 2PTCE 1MKWH 5JBCS 1RRKA 1NO9H 2B8OH 1C1TA 2BLWA 3PV4A 2XNDD 3A81A 1IQKA 2GCHF 3HPTB 3SQHE 2ZHDA 1ZTJA 3V3MA 5ESTE 2BTCE 1DVAH 1O3OA 1HAZB 1LDTT 4O9VA 2RDEA 3ATWA 3RU4D 1Y3YA 1EUFA 4IC5A 2J9NA 4GUXA 4TYDA 2Z9JA 2EI7A 4NZLA 2BDGA 1Y5BT 2TGDA 2YNAA 2D8WA 2SGDE 1FAXA 1PPEE 2O8LA 4HI3A 4RN6A 1PPGE 1EAIA 2VWOA 1Z6JH 2V3HH 1GI6A 5DN6D 1IQLA 4ESTE 3SZNA 1P01A 1P2IA 2Q1JA 3BTTE 1HXEH 2XTTB 2CJIA 2V0BA 5GNDA 2QV1A 5C5NA 4FU7A 1XUGA 5HIYA 1IQFA 3ZZDA 4BOHA 1D3DB 1H9HE 5HM9A 5A09A 2V3MA 4A92A 3MNBA 1CHGA 2ZCHP 2GMTB 3M5LA 1KXCA 2FLRH 1SGFA 1D6WA 1GI9B 2BYAX 5GJ4B 2F9OA 1BMLA 5C0UA 2WPJS 2OBQA 5SGAE 4IN1A 3SW2B 1ZMJA 3O8RA 1WCZA 1GBHA 1F92A 1UTPA 2GDEH 4U01A 1SHHB 1SGNE 4TY7A 1AKSB 2O8TA 1LPZB 1RJXB 3AAUA 3Q77A 2A4RA 5EQSA 1MKXK 2QXHA 1HAHH 1ELAA 1GI4A 4YT6H 4MPWA 1W11U 5DGJA 5TCCA 1GGDC 1BTUA 1AKSA 4U30A 1MTWA 1TE0A 2AEIH 1G2MA 1TYNA 2BX3A 1BRBE 2BD8A 2IPQX 1LVMA 3OY5U 2QA9E 4Q4LA 3PV2A 1VZQH 1NBMD 1V2NT 3GCHC 2BXTH 1BTPA 1HNEE 2C90B 4GCHG 1QBVH 5E2PA 1TNLA 3QWCH 1S6FA 2A5AA 1BA8B 1KIGH 1DXPA 4NG9H 5EGMA 3S7KB 1K22H 3RXDA 3E6PH 5A8ZA 4FVBA 1FY8E 1O30A 1OSSA 4B76A 3ODFA 2PGQB 5A8XA 3NWUA 1V2VT 2DE8A 4WMDA 2K1QA 2Y82A 3S0NA 1HIAB 3IITA 4TWWA 4B2AA 1V2PT 2FYRA 1INCA 1AY6H 4B74A 3ZZ3A 3EDXB 4CRCA 4X2WA 1HDTH 2ZDNA 1UTMA 5DG6A 2P59A 3F9FA 1KTTB 1G37A 2XNIA 1S6LA 3GY2A 1TRNA 1QIXB 4JK5A 4Y10E 3TH2H 2KCOA 4OS4A 1FZZA 4JYTA 4Q7ZA 3PMAB 3S9CA 1KLJH 3Q3XA 5C1XA 2R3YA 5IDKA 2Y5GA 1N6YA 4IMQA 1BQYA 1QB6A 2PV9B 3A7ZA 3BTFE 3ZZ7A 1A0JA 1HAIH 1K1PA 1SFIA 1ESAA 1BHXB 4CRFA 4OS1A 1ZSLA 2D1JA 4FUGA 5I46H 3MU4A 1IAUA 2ALPA 4UFGH 3UNSA 3KIDU 1GBJA 1MBQA 1P2OA 3QDZB 4H6TA 3UAIC 2SNVA 2NU4E 5JBBS 1BHXF 3OTJE 1N8OC 2FTMA 2R0LA 3E0PB 2OK5A 1VITF 4X8TH 3EA9A 2G81E 4IC6A 4OM9A 3RXGA 1UVUH 5GXPA 3M7UA 4H4FA 1DDJA 1YCPH 3BTHE 1H4WA 1QA7A 4GLYA 3WWBA 1AFQB 1DWBH 5JPMH 3PLPA 4NSYA 4J1YA 1Z8IB 1NBME 2FI4E 1WUNH 1WBGB 2HRVA 2XCFA 3SU5A 4THNH 5K7RA 1GJBB 1WDIA 3EGKH 3LIWA 1UVOA 3RU4T 4DOQA 1YBWA 3K9XB 3GISB 1E36B 1GBIA 3HATH 3MO6A 2PKAA 2PUXB 1XUFA 3MQKC 4BTUB 1SQAA 1VGCB 1O3PB 3VGCC 4ABDA 1GJ9B 1DLEA 2J92A 3H7OA 4JZIA 1ZMNA 4B71A 3TNTA 1DM4B 1YPHC 5CE1A 3GDVA 1DWCH 1O38A 5HMAA 1GHBF 2GVFA 1C5MD 3RXHA 1IHSH 1W2KH 2C8XB 2VINA 4TPIZ 3U1JB 1ZPZA 3BEIB 4XRNA 1G36A 1GMCG 3BEFB 1RXPA 5C3NA 1O34A 3SYJA 1QY6A 4AGKA 4AB8A 5E0GA 2FZZA 2Q6FA 1V2UT 3ESTA 5AFYH 1UTQA 5T6DA 1SB1H 1O31A 1K0HA 3BV9B 4NCYA 2SNWA 5C1YA 3GDUA 4FUDA 1AB9B 1YPHE 3PMHB 2ASUB 2ZDLA 3PTNA 3CS0A 1TALA 4B73A 1THRH 3RMOH 4Y11E 1O5GH 1K2I1 1T32A 1BCUH 3PYHA 2ESTE 5DK1A 2Z9IA 1XVOA 2KM0A 3UNRA 3UOUA 1TNHA 5B6LA 3LGUA 1FDPA 1FN6A 1JIMA 1Z71A 2G8TA 1SGDE 1W12U 2JH6D 1C5VA 4GHQA 4Y71A 1OWDA 3RXPA 2Z94A 3VXFH 1RTKA 1AIXH 3P8FA 1X7AC 3P8NA 3PWBA 2STAE 1IHTH 1PYTD 1Q3XA 3A80A 4TPYA 2WV9A 5EW1H 2G55A 1CHOF 4X8UH 1OX1A 4MQAA 1SQOA 5J4SA 1QFKH 5EPYA 2FTLE 1UK2A 1C1WH 2JETB 5FPSA 4GSOA 1W7XH 5KGOA 1C4Y2 1Z1JA 3DCLA 3PRDA 1EP6A 2OC1A 3RUOA 1O3JA 3F0PA 3FZDA 1KTSB 2GT7A 4X2VA 2NU1E 3M7QA 3E0NB 3VB4A 1JRSA 3GCTG 1H8ED 2HVXA 3U8TH 3OFND 3UWIA 3GCNA 1XVMA 1ZJDA 2H5DA 2VIQA 3M37A 2WYJA 5CHAC 4ISHH 4YLQH 2BOKA 4A1XA 1C5XB 1MTSA 2XWAA 2W26A 1MCVA 5DP7A 3SV9A 1THPB 4XDEA 1O32A 4ZMAH 1KMHB 1MZDA 4KELA 4RT0A 1O3CA 4SGAE 1TFXA 3F2FA 1FIZA 4IW4E 1QCPA 2YNBA 1P05A 5HYOA 1W14U 2ZU1A 2C8WB 1E37B 1A61H 1O2ZA 1H9LB 2ZA5A 3RXEA 2LPRA 1C5SA 2FO9A 4X8SH 3BTDE 2PR3A 3SJKA 5KECA 3TGJE 2KCAA 1JMOH 1BMMH 1V2QT 2XC0A 2JH5D 4NIXA 1ZTLA 4E7NA 3URDA 5L30H 3SORA 3PO1C 1V2LT 3P6ZB 1FLEE 2RDLA 4BAMB 4JK6A 1AVXA 1OOKB 1TWXB 3P70B 1Z8RA 1SGQE 3KYGA 1O2GH 1SLVB 2ZTZA 3ENSB 3GY3A 2ZHQH 3S9AA 2VGCB 3CP7A 2J2UA 4X1PU 2BD5A 5F8ZA 4ABAA 4RKOB 1O2TA 2VWLA 1ETRH 1ZLRA 1P2MA 4Y6DA 3SHAH 2EY4C 2VU8E 3MMGA 1H8IH 1VJ9U 1H8HD 1LPKB 1AUJA 1D9IA 3SJ9A 2BD7A 1ELBA 3TK6A 5F8TA 1CO7E 3NRLA 2Z9GA 1SGIB 1GL1A 1O2HA 3W95A 1DSTA 3I29A 3LH1A 3SU4A 1YPGH 2OUAA 3IWMA 3TGKE 1NTPA 4ZKSU 5EJZA 1BJVA 1ZHMA 1J17T 3STJA 2BD9A 1BJUA 1EPTB 5E8EH 5F03A 3GY5A 3D65E 1RS0A 4JZEH 4TWYA 5JB8S 4YXWD 1O3FA 2KAIA 1WQSA 2STBE 2YMSC 2ZGXH 4Z1MD 2BQWB 3UPEA 2O8WA 3P92A 2FWWA 3DFLA 4UEHH 3LJOA 3TJVA 1DICA 2FOHA 1M9UA 1PPHE 2RA0A 1KXBA 5G4BA 3RXTA 1GCTC 1MD7A 3RXLA 1TGBA 4JZDH 2HNTC 4AX9H 5T3HA 2BLQA 1WYKA 3Q3KA 1GG6C 1OPHB 3QTVH 4Q7XA 2JKHA 4E7RG 1T31A 2KR7A 3K2UA 2QE7D 3ZVEA 3LGIA 1A46H 1BTWA 4FUHA 3TIUA 3OSYA 2ZU3A 3BG4C 1FQ3A 3SV2H 1OXGA 4AYYB 1LHCH 1BBRH 2M2AA 5T6GA 1ARBA 1AN1E 2ZKSA 2OCVB 4RSPA 1DX5M 1HRTH 4M9FA 3EYDA 1F0TA 2F9PA 5FXLA 2P3TB 3FP6E 2WV5A 1O2NA 1MAXA 1UTJA 1Z7KA 1W0ZU 2HALA 1O2RA 2FOCA 4BXWA 2ZCKP 1QR3E 2ZPRA 4D9RA 1O2VA 1BT7A 8GCHF 2H9EH 1SG8B 1AHTH 2H9HA 4OS6A 4AFSA 1LQEA 3UB0A 1EASA 1O2JA 3NPSA 3I77A 4AFZA 3PM3A 4MVNA 2PW8H 1BZXE 4Y76A 4P02A 1O5EH 1O3DA 4ABIA 3OE7D 1ZRKA 3UFAA 1HBTH 1NRSH 5C5OA 5T1VA 1HV7A 1GJ7B 1V3XA 2PWXA 2ZU4A 3UOPA 5LPRA 2QF3A 2BX4A 3V13A 3MYWA 1ELGA 4NA7A 1ZJKA 1BRAA 1YWUA 1Q2WA 4ZHLU 1OWEA 1BTHH 2J5UA 4YM9A 4FU9A 2BD2A 3GY4A 2PUQH 4WMFA 1IQMA 5FL7D 2EI6A 1V2WT 4NSVA 3FKSD 1WTHD 2A5KA 2G5VA 3U98H 1WV7H 1GPZA 2ODYB 4YZUA 3UY9A 2WUCA 1KSNA 5E0JA 1LHFH 4FU8A 2ULLA 4XBCA 1PPFE 2IOTA 1E79D 2LP6A 5LPEA 1AWHB 1C1OA 1NRPH 4FXGH 4CRAA 1K21H 1YPLH 1AI8H 3SU6A 6ESTA 2G51A 3E8LA 3M3TA 1RIWC 1EZSC 1GHAG 3R0FA 3RXSA 1QTFA 2ZDKA 1SMFE 2G5NA 2FOBA 5C94A 1QQ4A 2G52A 2PHBA 2A2XH 4FUJA 2VVCA 1UCYK 1VITH 3ATLA 1TMBH 2FOEA 1GDUA 1EQ9A 4UFEH 2Z9LA 1ANEA 1FY5A 4QT8C 4D9QA 2VNTA 2ODPA 3N7OA 1TABE 2W7SA 1GGDB 2J98B 1HGTH 1EKBB 2QCYA 1IQNA 1QJ7B 1K1LA 1DUAA 2ANWA 3A7TA 1MTVA 3KQ5A 1UMAH 3MU8A 1QHRB 4SGBE 4Q7YA 1GL0E 3SU2A 1DXWA 2XRCA 1GI5A 4B2BA 2FMJA 1GI8B 2FM2A 1E35B 3NK8A 1YLCA 3EAJA 3M5NA 2XBWA 5HM2A 1NPMA 1SPJA 1CA0B 1LO6A 3TNSA 1THSH 4LZ4B 2H5CA 2ZWLH 3DSPA 3H5CB 2HWLB 1J14A 1CA8B 1V6DA 2RCEA 3A8DA 4WH6A 3TJUA 1L0ZA 3TVJB 2IJD1 1K1IA 4MG3A 2ZG0H 3E3TA 3T26A 1P03A 4WWYA 4NZQA 1S5SA 2FXRA 3LPRA 2B5TB 2QGRA 3ODDA 4UDWH 1GMDF 3SQEE 3SNEA 3U1IB 3UQVA 1EAWA 4GPGA 2VWMA 2OBOA 3M36A 2P94A 3RMMH 1HCGA 2Z3CA 1NFWA 1Y3UA 2BVSH 2BQ7B 2FYQA 1FV9A 1LMWB 1LHEH 3E16B 3M5MA 1CGJE 1O33A 1LHGH 2ZZUH 1CU1A 9ESTA 3E1XB 1HAPH 1C2HA 3ELAH 1FPHH 7GCHF 2NU3E 2Y81A 1Z1IA 1O5AB 1FN8A 1SLUB 1UK4A 2C8ZB 3N7EA 2BY5X 2ZFFH 1ELEE 1A5GH 2A2QH 4ZKRU 1K1JA 2BLVA 5FCRA 1KLTA 3BN9A 3ZVCA 5FHTA 4CRGA 4ZUHA 1OP8A 1P8VC 1V2RT 4XE4A 4ZH8A 1C2IA 9LPRA 3ZVAA 5BRRE 1MKWK 1YY3A 1CT4E 4ACBA 2HLCA 2A45B 1JBUH 3LGYA 3IG6B 1AVGH 4X1NU 4H6SB 5C2ZA 1XKAC 2XBVA 4KTUA 2BVXH 1J8AA 2XBXA 3EE0B 1C5LH 2A0QB 2A4OA 1UK3A 2GX4A 3TITA 5I25A 1QGFA 1L1JA 4XD7D 4ABHA 3RXAA 1CSOE 2QF5A 4Y0ZE 1YPKH 1BRUP 2FEQH 3RMNH 1K1MA 1UTNA 1UVTH 1TRMA 1K28D 1DY8A 1MBMA 5AF9H 2HGTH 4JYVH 3ZIAD 3U28C 1IQGA 1EP5A 1IQEA 5GCHG 1TOMH 4B6FA 1QJ1B 1SQTA 3FANA 5EPNA 2L6OA 3LOXA 3NXPA 1JOUB 5ESBA 1L1GA 1GJCB 3QZRA 4XOJA 1EX3A 3F9HA 3RU4E 1DPOA 2ANYA 4XFQA 3ZZ4A 2P3UB 2ZHWH 1NFUA 1P12E 3ZVGA 1AGJA 1LVBA 3N7DA 3A85A 1T8MA 2OC0A 3BTWE 1TX7A 3MI4A 2D26C 4NFEA 3VGCB 5C67A 2JJ2D 3KQBA 2FDAA 3LH3A 1NS3A 3STIA 4K1TA 4O3TA 2KZ4A 1ETSH 1O3HA 1SKYE 1A4WH 1CT2E 1EB1H 2XC5A 3QK1A 1XM1A 1LQDB 1O37A 1Y8TA 1F5LA 1F7ZA 1YGCH 3ZV8A 2W5EA 1ELTA 3OEHD 1CQQA 4J2YB 1XMNB 4HTCH 2TGAA 1G3EA 3MNSA 2ZTXA 1TPSA 1UTOA 1C2GA 1O2LA 1SGCA 1P2NA 1XX9A 3M3VA 3ZVDA 2VIVA 2GCHG 4Q80A 5GPIB 1O2QA 1ZHPA 1YYY1 4NWLA 1O3KA 4XBBA 2NU0E 3QGJA 4OGYA 2AS9A 3HGPA 1DWEH 1NU7B 2UUJB 3SNCA 1DY9A 1DFPA 4F4OC 1K9OE 1BOQA 4ZCNA 2GZ9A 5A2MH 1DLKB 1U6QA 3N99A 2H1UA 1A5HA 1QA0A 5HXFA 1GHXH 1HAYB 4Q63A 2OD3B 1MTNB 4X6NA 2PFEA 4O97A 5DPAA 3SUDA 4BAQB 1GBKA 1SFQB 2FOMB 2ZHFH 3SU3A 3W1EA 1GDNA 3OU0A 2BDAA 2PKAB 4NA9H 3M5OA 2TRMA 4MDSA 5FCKA 1Y5AT 5C1UA 5F53A 3F3BA 1UO6A 1PPBH 2J97A 1TA6A 1UVSH 3LONA 2ZFTA 1FX0B 1YC0A 1BTZA 3SGQE 5F8XA 1T8OA 2AGEX 3TU7H 2AH4X 1BMFD 2CHAB 1GBDA 5CHAB 1G3DA 3SU0A 1GVZA 3RXJA 1HYLA 3SV8A 4AZ2B 1C1PA 1ZPCA 3SN8A 1OP0A 2VH0A 3PV5A 1COWD 3VFEA 3FAOA 4K1EA 3NZIA 1QL7A 2GZ8A 2GTBA 3BIVH 2P8OB 3Q76A 2IN2A 6GCHF 3R3GB 1UCYE 5H4IB 2SGEE 3LU9B 2M5TA 2YOLA 3MH7A 1QL9A 3VG8A 4ACAA 3MO3A 4D76A 1P02A 1V2TT 3TPIZ 2V3OH 1S82A 3BTME 1YCPK 1KXEA 3PWCA 1YPMH 1BRCE 3LDXH 1TNKA 5JDUB 1TLDA 1FXYA 3L3TA 3UQOA 3W94A 1C5OH 2QYIA 1TA2A 5EQQA 1O2KA 2PSYA 2WYGA 2ZQ2A 4WH8A 4VGCC 2VIWA 4ZKOU 1Y59T 4WVPE 4LOYH 2BY6X 2P93A 2RG3A 1C5NH 3A7VA 4AN7A 2VB0A 2ZDMA 4ABJA 4PROA 4K5ZA 1GMHG 3MFJA 1GI3A 1TBZH 3BSQA 4OS7A 3PROA 2ZF0H 3UREA 3PB1E 4A1VA 1FIWA 1VCQA 2W3KA 2FIRH 1ZYOA 3ZZ6A 1QL8A 3SOSA 5DJ7A 2BOHB 2R9PA 1EFRD 5LPFA 1GJ8B 4NGAH 3ZZAA 5C0TA 1TONA 1EZXC 1MABB 1FNIA 4X6MA 4AC9A 3SZEA 2BDYA 1B0FA 1AZZA 1PPZA 3V0XA 1LKBA 1JRTA 1F5KU 1ELFA 1P0SH 3RXCA 2YMSB 1GJDB 1UVPA 1VCPA 1VGCC 1C5TA 1K1NA 2PKSB 4I33A 3RXUA 4Y7AA 1CVWH 2F9NA 2Z6BD 4I31A 2PTNA 4A7IB 4B6EA 1GCTB 2FS9A 3MHWU 1T7CA 1ABIH 3O8CA 2AMPA 1OWIA 5EXMA 1MZAA 1SGEE 1TMUH 3RLWH 3LGTA 1O3NA 5F6MA 5GIBA 5GDSH 2A7JA 3OY6U 1S0QA 1VKYA 1NN6A 1DITH 2GV7A 3M61U 1AVWA 2TPIZ 2HNTF 1Z8JB 5C17A 2VJ1A 2CV3A 4AG1A 3TGIE 1PYTC 4UFFH 1L2EA 4YESB 1YLNA 2ZC9H 3T5FH 4WY3A 5L2ZH 1FI8A 4KTCA 1CT0E 4CH8B 3GDSA 3M35A 1AB9C 1AU8A 1GHZA 1ELDE 1QZ8A 2ZGJA 4Y8YA 1FY3A 1V2OT 3S7HB 3RM0H 2P95A 1KXAA 3DSGA 2VIOA 5L2YH 1A7SA 1NRNH 2QY0B 4NIWA 1SI5H 1SBWA 4BAKB 4Q2KA 3ATKA 1GJ4H 1GHBG 2UUYA 1TGCA 4KTSA 5DP8A 4Y79A 3UR6A 1P09A 1TB6H 4MTBA 1KXFA 2GCTC 4RT1A 4ZROA 3ZZBA 2UWLA 2J94A 5HIZA 2HVYB 3DUXH 1GHVH 3BTQE 4I32A 2ZGCA 3WWFA 2KAIB 1MMJN 1XKBC 1A0HB 1T4VH 4WJG2 3RMLH 3GYMA 1GBFA 2JETC 2AIPA 3K6ZA 3MNCA 4YOJA 1V2MT 3F68H 4JZFH 1ZMLA 3MNXA 2CMYA 1E38B 3LGWA 1MAYA 4WF8A 5HKKD 3WW7A 2WPKS 4MLFB 3OX7U 1G32B 1O5DH 4NIVA 3VPKA 4DY7B 1TNJA 2ZDAH 2AIQA 1TIOA 3VB6A 1HAVA 2FS8A 3P8OA 2B9LA 2V6NA 1Z8GA 1JIRA 3PTBA 1G3CA 1O2OA 3B9FH 3LKWA 3A86A 3LJJA 2V7QD 1F2SE 1RGQA 1W8BH 4HGCA 1CGHA 3T29A 5B6OA 3RXBA 4Z6AH 1CBWC 4K2YA 1C5YB 1C2MA 2WZQA 1EJAA 2KFWA 2WPMS 4OGXA 3UIRA 4XBDA 2ZNKH 3BTGE 2QXGA 1NT1A 4IGDA 3H7TA 1TX8A 1LCYA 1HJAB 3ZZ5A 4K8YA 1E1RD 5LH8A 1RFNA 2P3FH 1P04A 4WMEA 4ABFA 4KKDA 5A0CA 2Y80A 1B7XB 1BTYA 3KEEA 1LHDH 1TGSZ 4TSFD 2A1DB 5EIYA 3ATMA 4GVUA 4R8TB 3A8AA 3SHCH 4F48B 4YT7H 3SI4H 2F91A 2ZDVH 1GBMA 3FOAA 7KMEH 3ZV9A 3QUMP 3VB3A 3A7WA 3FFGA 4MNVA 2ZHEH 5L6NH 5EU8A 1VJAU 2VGCC 1G9IE 2BLOA 2SGPE 1W13U 4U32A 3P8GA 2Z7FE 4CRDA 3T2NA 3AW0A 1LVOA 1KDQA 4I8LA 1TBRH 3KNXA 1ANDA 4X2YA 1A0LA 1HFDA 1YLDA 3DFJA 4I8HA 1W0YH 4CHAC 1C2DA 3MU1A 1QQUA 2ILNA 1SLWB 2RA3A 2FPZA 4MPVA 1ABJH 3A8BA 2KX4A 1E0FD 4INKA 1TGTA 1SSXA 1YF4A 1Z6EA 2Z3EA 3KL6A 1AO5A 2XXLA 5A8YA 3V7TA 1DSUA 1PPCE 2ZEBA 1C5QA 1A1RA 3A83A 3KQDA 1ZRBA 1B0EA 2BZ6H 1BBRK 1GBLA 1C2EA 1QRWA 1WOFA 1ZGVA 2QXJA 2J95A 1UHBB 2OC7A 5GWZA 1BB0B 1JXPA 4GCHF 4NIYA 3M3SA 2AGIX 1G3BA 4BTIB 1UHBA 1XXFA 3MH6A 4CRBA 1MQ5A 1KYNA 3HK3B 3G01A 3FN8A 2W7UA 5EOKA 1A3EH 4TY6A 4X2XA 1TOCB 3QTOH 5LGOA 1GBBA 5TCAA 2A7CA 5ABWA 3SUGA 3MTYA 1H9IE 1EXFA 1D4PB 2XYAA 4I8JA 4AB9A 1J9CH 1GBCA 2BDIA 2Z9KA 3TLOA 4IBLH 3CS7A 1ZHRA 3SNBA 1TGNA 1EOJA 3JZ2B 2R2MB 1TMTH 1GVKB 2H2ZA 3FP8E 3KQCA 1IQHA 2Z3DA 1DANH 2W6ID 3RXKA 3NUMA 4BANB 1O5CB 2A7HA 1C9PA 2GGVB 1O2UA 4K8BA 3RXMA 1A3BH 1TRYA 2FI3E 3LC3A 2ALVA 3LC5A 1DT2A 1XUJA 3GCHB 1S83A 2ZPQA 3VEQB 2F4LA 5IK2D 1GJ5H 3RXOA 4NWKA 1C5ZB 2XW9A 2BY9X 1HPGA 3DT0H 1D3TB 1ZOMA 1MU6B 2B7DH 1Y3WA 1MD8A 2BZAA 1GVLA 1SGTA 1AE5A 2G00A 1YPJH 2R3UA 2QC2A 3K65B 2GKVE 4DT4A 1W0JD 2ZP0H 1TPPA 3EQ0H 3P95A 2JIZD 5FPYA 3FO8D 5BPEA 3OTPA 1MKXH 2XC4A 3EA7A 2GD4B 2K8IA 2QN5T 1EAXA 5FX6A 1HUTH 1IOEA 3FVFB 1C4V2 1C5PA 3KN2A 3QLPH 6CHAC 3T28A 2F83A 4INHA 1ELCA 1GHWH 7ESTE 5A0BA 2GV6A 4DVAU 4ASUD 4LK4A 4KGAA 1GBEA 2SGFE 4X1QU 3SUFA 1GI1A 1LPGB 4ZAEA 2GJGA 3SBKA 3HGNA 1O3LA 5JBAS 4X6PA 4YO9A 2G4UA 3C27B 1P10A 4ZXYH 2Y7ZA 8GCHG 1T4UH 1ZPBA 2QAAA 2ZU2A 2XWBI 3GS9A 1BMAA 4MPXA 1BUIA 3O8BA 5JYIA 2PSXA 4LXBH 1TAWA 4BNRA 3FZZA 2KCYA 3NCLA 3Q3YA 1C1MA 4JYUH 2WUBA 3RC6A 3PRBA 4K3JA 3AAVA 3A87A 2ANKH 4HG6A 2VH6A 1V2ST 5TJXA 2JJ1D 3MH5A 1N8OB 4I86A 7LPRA 4IMZA 1NY22 2Q6DA 1MTUA 4FUCA 2EI8A 2Y5FA 3ZZ8A 1GBAA 3D23A 5FBIA 1NFYA 4AYVB 3BG8A 3BTEE 4AOQA 2AHME 6LPRA 4DW2U 1O2PA 1C1SA 3L33A 1GMCF 1QB1A 3PMJA 1UTLM 3MO9A 1NU9A 1SGYE 4GAWA 2FODA 5HGGA 5DP6A 4ZHMU 1TNGA 2ZECA 4X1RU 4FUEA 1OHHD 2GP9B 4X6OA 2FOGA 4AFQA 4FUFA 5FX5A 1C1NA 4I7YH 1HB0B 1HAGE 1WXRA 4Y8XA 4DGJA 4WXVA 1S6HA 3DHKH 1K1OA 3SV6A 1CA0C 3MU0A 2THFB 4ZHAA 4YOIA 3A89A 3S9BA 2FLBH 1DS2E 8ESTE 4MPUA 1O0DH 1XXDA 1GCDA 1TPAE 1C5WB 2VVUA 1V2KT 3VXEH 2L74A 1EZUC 2BB4A 3SJ8A 1UW7A 1QRXA 3WY8A 3F0OA 3KHVA 2LELA 5EG4A 3U69H 1IQIA 1ARCA 2C3SA 3DSOA 1EB2A 2GDDA 1GMHF 1CGIE 2OINA 1HIAA 2A4GA 2ZFSA 3P17H 1OYTH 3BIUH 5EJLA 2BQ6B 1WAYB 3ITIA 2BD4A 3MOCA 4A6LA 4AORA 1BIOA 1H8DH 2BMGB 1O35A 4CR5A 1F0SA 2KCPA 2GMTC 3SJIA 1PJPA 2O9QA 1ZR0A 2HPQH 1P06A 5FAHA 4RI0A 5IYTA 1Q31A 1E34B 2A5IA 2HPPH 2ZU5A 5ETXA 3PLKA 2C93B 1YPEH 1AQ7A 5DP5A 3TK9A 3GCTF 3KCGH 3GY8A 2EEKA 1O3IA 2OLGA 1ZZZA 2DUCA 1TPOA 4CREA 5C20A 1QNJA 1C1RA 1WSSH 4VGCB 2C4FH 8KME2 3HKIB 4D7GA 2BM2A 1DWDH 2Y5HA 3AVZA 3ZZ9A 3SNDA 1MCTA 1GMDG 2AMDA 1E1QD 2WV4A 2HLDD 3E90B 2XBYA 1EZQA 3NKKA 1G2LA 2CK3D 2VIPA 1QBNA 2BDCA 4IN2A 4OS2A 1Y5UT 2TGPZ 2WPDD 2EC9H
chains in the Genus database with same CATH topology
3M7TA 7GCHG 2ODQA 1A5IA 1T8LA 1F5RA 1PQ5A 3CENA 1L4ZA 1MUEB 1SGFG 1BBRE 1VR1H 3UUZA 1NC6A 3QO6A 2JH0D 2OP9A 3KF2A 4GHTA 4A1TA 3GICB 1C2LA 2FOFA 3OYPA 4ZKNU 4AG2A 3U8RH 1O3GA 1SOTA 3GYLB 1ZSJA 4KP0A 2ZFRH 5DP4A 2Y6TA 5AFZH 1AZ8A 1PQAA 1Y3XA 5EODA 3RXQA 3V12A 1BMNH 1RD3B 4O03A 3DD2H 1N6XA 1EOLA 2DE9A 3C1KA 2IJOB 5AVDA 4I8GA 4CH2B 1NESE 8LPRA 1CE5A 2G4TA 4ISIH 1OP2A 4MNYA 1GI0A 1GJAB 4FVDA 3RP2A 4I8KA 2A32A 1PQ7A 2J34A 1B5GH 1PQ8A 4NA8A 3T27A 1IQJA 1MU8B 4HFPB 2ZCLP 1OWKA 1C5UA 1P3CA 3U8OH 3PO1B 5CMXH 4XSKU 3TH3H 5J4QA 4IS5A 1WU1A 2J4IA 4AGJA 1C9TA 3RC4A 1V2JT 3UWJH 1O3EA 3URCA 4K69A 1H1BA 1EJNA 4JCNA 1EATA 3GCOA 2D2DA 2BVRH 3ZYEA 1C1UH 5EQRA 1OS8A 4WXIA 4ISLA 2ZTYA 1LTOA 2F3CE 2NWNA 1SR5C 1FY4A 3GY7A 2P16A 3VB7A 1O2MA 3RXRA 1F0RA 2GCTB 1MTNC 3AASA 1YKTA 2Y7XA 4INLA 1AFQC 2QXIA 4YTAA 2W3IA 2TIOA 1HXFH 2PLXA 4O3UA 4ABGA 3HKJB 3ZZCA 1AFEH 3GY6A 1ESTA 4UD9H 2TBSA 1JWTA 2FX4A 2H6MA 2ZGHA 2J38A 3TJOA 1ZTKA 4A5TS 2EA3A 1P2QA 2V35A 4ASHA 1ID5H 5DO4H 2OXSA 2R0KA 4OS5A 1QB9A 2CHAC 1C2JA 1VITG 4DURA 3B23B 3SU1A 3SNAA 1J16A 2CGAA 2HOBA 3F9EA 4MNXA 5DKMA 4YLUA 4R0IA 1TQ7B 5EXNA 4CBNA 1HJ8A 4ZXXH 1F0UA 3F6UH 4H42U 4UFDH 1GG6B 2ZQ1A 1CBWB 2P8OC 2AFQB 1SGRE 1O2SA 3EA8A 1O3AA 1GI7B 1ETTH 1J15A 2FESH 4X1SU 3T62A 2OC8A 1AE8H 4LZ1H 1C2FA 2PGBB 3D62A 3I78A 2CXVA 3QGNB 4UONA 1BDAA 2F9UA 2UUKB 1O2IA 4Y0YE 4B75A 1OKXA 3DA9B 1DUEA 3BG4B 3ZYDA 5PTPA 3SGAE 1LKAA 1D6RA 4Y7BA 1O2XA 1NM6A 1C1QA 4BTTB 3S69A 1HAXB 1L4DA 1PFXC 1YM0A 2FOAA 3RXVA 1O2YA 1QBOA 4MNWA 3UTUH 2NU2E 2GT8A 4ABEA 4AFUA 1WTGH 4E06H 2VVVA 3HK6B 2OTVA 4M7GA 2A4QA 3SO3A 4K1SA 5JBTA 1FY1A 4B2CA 2OQUA 2ZI2H 6GCHG 4F49A 3QN7A 2XCNA 1RTLA 1ORFA 5EW2H 1BITA 1MQ6A 1EJMA 3BEUA 1P2KA 2ZO3H 1QRZA 3Q00A 3RXFA 4CHAB 1S84A 1FAKH 2IPHA 1GHAF 4DIIH 2WPIS 1NRQH 1L1NA 1HAVB 3QX5H 3O8DA 5K0HA 1SL3A 1UTKA 1SVPA 2QIQA 3D49H 5FPTA 1SC8U 3LGVA 1BTXA 4K60A 4FUIA 1YP9A 1TX6A 1AD8H 1EPTA 2BD3A 2H9TH 3TJNA 1OWJA 4DG4A 1MH0A 2F9BH 3SGBE 3LT3A 2PKSC 3BF6H 1HAOH 2ZFQH 3F1SB 1S81A 2BDBA 3B8JA 3ATIA 1SOZA 3RDZA 1OYQA 3L6PA 3A84A 3SI3H 3TH4H 2AGGX 1QURH 3MU5A 1CHOG 3PLBA 1N1LA 4BAOB 2ZPSA 2BXUH 5EXLA 1XUHA 1FUJA 2SGQE 3RXIA 1KLIH 1RIWB 1GWAA 5DP3A 2C8YB 5E0HA 3SJOA 3T25A 1S0RA 1SGPE 1Y3VA 3F9GA 1FPCH 3VB5A 2VIDA 1DOJA 1C4U2 2GZ7A 1KXDA 2FI5E 3KQEA 1OWHA 3A82A 3FP7E 3A88A 1TNIA 4UE7H 2BHGA 5A0AE 3JZ1B 1KDQB 1D3PB 2FX6A 3K6YA 3KGPA 1RTFB 2I6SA 2HNTE 1GJ6A 1O36A 1S85A 4ABBA 5AHGH 1ZGIA 1KY9A 3UNQA 1P9UA 1O39A 1NZQH 3RLYH 1C5RA 2A31A 2CF8H 1P3EA 2QF0A 3MWIU 3PMBB 2B0FA 1D3QB 4X8VH 2AERH 4ISOA 4D7FA 1GBTA 1O5FH 1UCYH 1EPTC 1VCWA 2WPLS 4BXSA 2VWNA 2ZGBH 4Z0KA 2BY8X 3A8CA 1EAUA 1UJ1A 3ZVFA 1T8NA 1HJ9A 1NRRH 1LVYA 5JB9S 1FMGA 1W3CA 1HLTH 2UUFB 4JZ1A 4U2WA 3QZQA 3MH4A 2BDHA 3RM2H 2ZIQH 2UWOA 1P11E 3A7XA 3E91A 4HZHA 6CHAB 3A7YA 1NROH 1XUIA 1O2WA 4DT7B 1DE7H 2AYWA 1O3BA 1ELVA 1ESBA 2ZFPH 1GDQA 1XUKA 1GHYH 1P57B 4X0WU 3GOVB 1FJSA 5E2OA 1TBQH 2Q6GA 1SHYA 4ISNA 1C2KA 3BTKE 2ANMH 4RKJB 4B1TA 5GCHF 3UR9A 5T6FA 2LNCA 1NFXA 1O3MA 1W7GH 2SFAA 1G30B 1FONA 2O8MA 4Y8ZA 2CF9H 1HJAC 2F9VA 2I6QA 1C1VH 2AMQA 1ZSKA 4YOGA 1ANCA 2SGAA 4NFFA 2CN0H 1A2CH 4FUBA 2WPHS 4BAHB 1O5BB 2OQ5A 4DIHH 2WINI 1AUTC 1ANBA 2R2WU 2UWPA 4D8NA 1W10U 2TGTA 2FP7B 1YCPM 1SLXB 1AWFH 1TQ0B 3AW1A 3TK5A 1P2JA 1P9SA 1GI2A 1QJ6B 4CR9A 1AMHA 4DCDA 1ACBE 3SV7A 5DP9A 2O8UA 3ZVBA 4DJZB 3SUEA 3U9AH 4E05H 4JMYA 2BY7X 4CBOA 1WQVH 3RC5A 5FBEA 2PTCE 1MKWH 5JBCS 1RRKA 1NO9H 2B8OH 1C1TA 2BLWA 3PV4A 3A81A 3SQHE 1IQKA 2GCHF 3HPTB 2ZHDA 1ZTJA 3V3MA 5ESTE 2BTCE 1DVAH 1O3OA 1HAZB 1LDTT 4O9VA 3ATWA 3RU4D 1Y3YA 1EUFA 4IC5A 2J9NA 4GUXA 4TYDA 2Z9JA 2EI7A 4NZLA 2BDGA 1Y5BT 2TGDA 2YNAA 2D8WA 2SGDE 1FAXA 1PPEE 2O8LA 4HI3A 4RN6A 1PPGE 1EAIA 2VWOA 1Z6JH 2V3HH 1GI6A 1IQLA 4ESTE 3SZNA 1P01A 1P2IA 2Q1JA 3BTTE 1HXEH 2XTTB 2CJIA 2V0BA 2QV1A 5C5NA 4FU7A 1XUGA 1IQFA 3ZZDA 4BOHA 1D3DB 1H9HE 5HM9A 5A09A 4A92A 3MNBA 1CHGA 2ZCHP 2GMTB 3M5LA 1KXCA 2FLRH 1SGFA 1D6WA 1GI9B 2BYAX 5GJ4B 2F9OA 1BMLA 2WPJS 2OBQA 5SGAE 4IN1A 3SW2B 1ZMJA 3O8RA 1WCZA 1GBHA 1F92A 1UTPA 2GDEH 4U01A 1SHHB 1SGNE 4TY7A 1AKSB 2O8TA 1LPZB 1RJXB 3AAUA 3Q77A 2A4RA 5EQSA 1MKXK 2QXHA 1HAHH 1ELAA 1GI4A 4YT6H 4MPWA 1W11U 5DGJA 5TCCA 1GGDC 1BTUA 1AKSA 4U30A 1MTWA 1TE0A 2AEIH 1G2MA 1TYNA 2BX3A 1BRBE 2BD8A 1LVMA 3OY5U 2QA9E 1VZQH 1V2NT 3GCHC 2BXTH 1BTPA 1HNEE 2C90B 4GCHG 1QBVH 5E2PA 1TNLA 3QWCH 1S6FA 2A5AA 1BA8B 1KIGH 1DXPA 4NG9H 5EGMA 3S7KB 1K22H 3RXDA 3E6PH 5A8ZA 4FVBA 1FY8E 1O30A 1OSSA 4B76A 3ODFA 2PGQB 5A8XA 3NWUA 1V2VT 2DE8A 4WMDA 2K1QA 2Y82A 3S0NA 1HIAB 3IITA 4TWWA 4B2AA 1V2PT 2FYRA 1INCA 1AY6H 4B74A 3ZZ3A 3EDXB 4CRCA 4X2WA 1HDTH 2ZDNA 1UTMA 5DG6A 2P59A 3F9FA 1KTTB 1G37A 2XNIA 3GY2A 1TRNA 1QIXB 4JK5A 4Y10E 3TH2H 4OS4A 1FZZA 4JYTA 4Q7ZA 3PMAB 3S9CA 1KLJH 3Q3XA 5C1XA 2R3YA 5IDKA 2Y5GA 1N6YA 4IMQA 1BQYA 1QB6A 2PV9B 3A7ZA 3BTFE 3ZZ7A 1A0JA 1HAIH 1K1PA 1SFIA 1ESAA 1BHXB 4CRFA 4OS1A 1ZSLA 2D1JA 4FUGA 5I46H 3MU4A 1IAUA 2ALPA 4UFGH 3UNSA 3KIDU 1GBJA 1MBQA 1P2OA 3QDZB 4H6TA 2SNVA 2NU4E 5JBBS 1BHXF 3OTJE 1N8OC 2FTMA 2R0LA 3E0PB 1VITF 4X8TH 3EA9A 2G81E 4IC6A 3RXGA 1UVUH 5GXPA 3M7UA 4H4FA 1DDJA 1YCPH 3BTHE 1H4WA 1QA7A 4GLYA 1AFQB 1DWBH 5JPMH 3PLPA 4NSYA 4J1YA 1Z8IB 2FI4E 1WUNH 1WBGB 2HRVA 2XCFA 3SU5A 4THNH 5K7RA 1GJBB 3EGKH 3LIWA 1UVOA 3RU4T 4DOQA 1YBWA 3K9XB 3GISB 1E36B 1GBIA 3HATH 3MO6A 2PKAA 2PUXB 1XUFA 4BTUB 1SQAA 1VGCB 1O3PB 3VGCC 4ABDA 1GJ9B 1DLEA 2J92A 3H7OA 4JZIA 1ZMNA 4B71A 3TNTA 1DM4B 1YPHC 5CE1A 3GDVA 1DWCH 1O38A 5HMAA 1GHBF 2GVFA 1C5MD 3RXHA 1IHSH 1W2KH 2C8XB 2VINA 4TPIZ 3U1JB 1ZPZA 3BEIB 1G36A 1GMCG 3BEFB 1RXPA 5C3NA 1O34A 1QY6A 4AGKA 4AB8A 5E0GA 2FZZA 2Q6FA 1V2UT 3ESTA 5AFYH 1UTQA 5T6DA 1SB1H 1O31A 3BV9B 4NCYA 2SNWA 5C1YA 3GDUA 4FUDA 1AB9B 1YPHE 3PMHB 2ASUB 2ZDLA 3PTNA 3CS0A 1TALA 4B73A 1THRH 3RMOH 4Y11E 1O5GH 1K2I1 1T32A 1BCUH 3PYHA 2ESTE 5DK1A 2Z9IA 1XVOA 3UNRA 3UOUA 1TNHA 3LGUA 1FDPA 1FN6A 1JIMA 1Z71A 2G8TA 1SGDE 1W12U 2JH6D 1C5VA 4GHQA 4Y71A 1OWDA 3RXPA 2Z94A 3VXFH 1RTKA 1AIXH 3P8FA 1X7AC 3P8NA 3PWBA 2STAE 1IHTH 1PYTD 1Q3XA 3A80A 4TPYA 5EW1H 2G55A 1CHOF 4X8UH 1OX1A 4MQAA 1SQOA 5J4SA 1QFKH 5EPYA 2FTLE 1UK2A 1C1WH 2JETB 5FPSA 4GSOA 1W7XH 1C4Y2 1Z1JA 1EP6A 2OC1A 3RUOA 1O3JA 3FZDA 1KTSB 2GT7A 4X2VA 2NU1E 3M7QA 3E0NB 3VB4A 1JRSA 3GCTG 2HVXA 3U8TH 3UWIA 3GCNA 1XVMA 1ZJDA 2H5DA 2VIQA 3M37A 2WYJA 5CHAC 4ISHH 4YLQH 2BOKA 4A1XA 1C5XB 1MTSA 2XWAA 2W26A 1MCVA 5DP7A 3SV9A 1THPB 4XDEA 1O32A 4ZMAH 1MZDA 4KELA 1O3CA 4SGAE 1TFXA 1FIZA 4IW4E 1QCPA 2YNBA 1P05A 5HYOA 1W14U 2ZU1A 2C8WB 1E37B 1A61H 1O2ZA 1H9LB 2ZA5A 3RXEA 2LPRA 1C5SA 2FO9A 4X8SH 3BTDE 2PR3A 3SJKA 3TGJE 1JMOH 1BMMH 1V2QT 2XC0A 2JH5D 4NIXA 1ZTLA 4E7NA 3URDA 5L30H 3SORA 3PO1C 1V2LT 3P6ZB 1FLEE 2RDLA 4BAMB 4JK6A 1AVXA 1OOKB 1TWXB 3P70B 1Z8RA 1SGQE 1O2GH 1SLVB 2ZTZA 3ENSB 3GY3A 2ZHQH 3S9AA 2VGCB 3CP7A 2J2UA 4X1PU 2BD5A 5F8ZA 4ABAA 4RKOB 1O2TA 2VWLA 1ETRH 1ZLRA 1P2MA 4Y6DA 3SHAH 3MMGA 2VU8E 1H8IH 1VJ9U 1LPKB 1AUJA 1D9IA 3SJ9A 2BD7A 1ELBA 3TK6A 5F8TA 1CO7E 2Z9GA 1SGIB 1GL1A 1O2HA 3W95A 1DSTA 3I29A 3LH1A 3SU4A 1YPGH 2OUAA 3IWMA 3TGKE 1NTPA 4ZKSU 1BJVA 1ZHMA 1J17T 3STJA 2BD9A 1BJUA 1EPTB 5E8EH 5F03A 3GY5A 3D65E 1RS0A 4JZEH 4TWYA 5JB8S 1O3FA 2KAIA 1WQSA 2STBE 2ZGXH 2BQWB 3UPEA 2O8WA 3P92A 2FWWA 3DFLA 4UEHH 3LJOA 3TJVA 1DICA 2FOHA 1M9UA 1PPHE 2RA0A 1KXBA 5G4BA 3RXTA 1GCTC 1MD7A 3RXLA 1TGBA 4JZDH 2HNTC 4AX9H 5T3HA 2BLQA 1WYKA 3Q3KA 1GG6C 1OPHB 3QTVH 4Q7XA 2JKHA 4E7RG 1T31A 3K2UA 3ZVEA 3LGIA 1A46H 1BTWA 4FUHA 3TIUA 3OSYA 2ZU3A 3BG4C 1FQ3A 3SV2H 1OXGA 4AYYB 1LHCH 1BBRH 5T6GA 1ARBA 1AN1E 2ZKSA 2OCVB 4RSPA 1DX5M 1HRTH 3EYDA 1F0TA 2F9PA 5FXLA 2P3TB 3FP6E 2WV5A 1O2NA 1MAXA 1UTJA 1Z7KA 1W0ZU 2HALA 1O2RA 2FOCA 4BXWA 2ZCKP 1QR3E 2ZPRA 4D9RA 1O2VA 1BT7A 8GCHF 2H9EH 1SG8B 1AHTH 2H9HA 4OS6A 4AFSA 1LQEA 1EASA 1O2JA 3NPSA 3I77A 4AFZA 3PM3A 4MVNA 2PW8H 1BZXE 4Y76A 1O5EH 1O3DA 4ABIA 1ZRKA 3UFAA 1HBTH 1NRSH 5C5OA 1HV7A 1GJ7B 1V3XA 2PWXA 2ZU4A 3UOPA 5LPRA 2QF3A 2BX4A