1AO5A

Mouse glandular kallikrein-13 (prorenin converting enzyme)
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
237
structure length
236
Chain Sequence
VVGGFNCEKNSQPWQVAVYYQKEHICGGVLLDRNWVLTAAHCYVDQYEVWLGKNKLFQEEPSAQHRLVSKSFPHPGFNMSLLMLQTIPPGADFSDDLMLLRLSKPADITDVVKPIALPTKEPKPGSKCLASGWGSITPTWQKPDDLQCVFITLLPNENCAKVYLQKVTDVMLCAGEMGGGKDTCRDDSGGPLICDGILQGTTSYGPVPCGKPGVPAIYTNLIKFNSWIKDTMMKNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Serine protease
molecule keywords GLANDULAR KALLIKREIN-13
publication title The crystal structure of the mouse glandular kallikrein-13 (prorenin converting enzyme)
pubmed rcsb
total genus 54
structure length 236
sequence length 237
chains with identical sequence B
ec nomenclature ec 3.4.21.119: Kallikrein 13.
pdb deposition date 1997-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ao5A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ao5A01
3TGJE 1TBRH 2SGDE 5HGGA 2FMJA 3M7QA 5JBTA 2V35A 2HLCA 1GHAF 1GBEA 3ATKA 5GPIB 1M9UA 4BOHA 3TGIE 2F83A 2J95A 2O8WA 3ITIA 1CA8B 1G37A 1VCQA 2Y7XA 4IGDA 1DLKB 4O03A 6CHAC 4CRGA 1GGDB 1QY6A 2A31A 1WAYB 3BF6H 3FP7E 1FJSA 1ZMJA 1O2JA 2FI3E 3BTEE 3M35A 3RXRA 1TBQH 2D26C 2ZP0H 4FU7A 3P8NA 5A0AE 1K1PA 1O33A 3TJUA 2XC4A 1YPHE 4Y7BA 4MLFB 5ABWA 1K1IA 3VXFH 1VITH 1O2TA 2ZTXA 1O5EH 4X8TH 1GJ7B 3GY3A 1EOLA 1BTXA 1C5TA 3UR9A 1HAOH 2GX4A 3SU6A 5EXNA 1XUJA 1AY6H 1O5CB 1UVPA 2QYIA 2SGEE 1QGFA 5E0JA 4ZUHA 1V2QT 1CBWC 1CU1A 5CE1A 4WMEA 1A0JA 1JMOH 2ODQA 4ZXYH 1ZJKA 4NIXA 3ATWA 4D76A 1FNIA 4TPYA 3ODDA 5FCKA 1O3BA 2AS9A 2RA0A 1TB6H 2WPHS 1MQ6A 2XRCA 2OXSA 4AN7A 1NS3A 5SGAE 1SFIA 1ANCA 1IOEA 1V2NT 4ZAEA 2VWLA 3MU5A 1UTOA 1QURH 3HATH 1C2EA 1EATA 5HXFA 4LZ4B 2STAE 2Z9KA 4IC5A 1RRKA 2VWMA 2ESTE 1TNKA 5FCRA 2AYWA 1IQNA 3GYMA 1O37A 1MU8B 1GDNA 3MHWU 4YOJA 3UREA 4GHQA 4NIWA 4ZMAH 3RLYH 4K1SA 1KLJH 5EW2H 1Z8GA 1A0HB 2WPKS 1O2SA 2ZDNA 4Z6AH 4BTUB 1YPHC 1ZMNA 1MTWA 3E16B 2ANKH 2ZDAH 3UUZA 3UOPA 1FN8A 1GBLA 1MU6B 1GVZA 5EPYA 3SJOA 1ELAA 3P95A 2F9BH 1FLEE 2XBYA 4ABHA 5FX5A 4JYTA 4AFQA 3O8DA 3HPTB 3LOXA 3LJOA 2QXGA 2CF9H 3TK6A 2BZ6H 4K2YA 2ZFRH 4CRCA 1O2XA 4Y8XA 4UONA 2J34A 1UHBA 4Q7YA 4ZHMU 1DM4B 1NROH 2C3SA 2Y7ZA 4GVUA 1KXEA 4GCHF 3BTHE 3AASA 4LOYH 1JRSA 2EA3A 3P92A 1GBMA 1J15A 1UK2A 1Z71A 1SGPE 1NO9H 2OBOA 1ELDE 1JWTA 1GI7B 3SN8A 3W94A 3TGKE 2AIPA 1LVBA 1FIZA 3LGWA 1AMHA 4RSPA 1YPJH 1MUEB 4NA7A 1OWKA 1MKWH 2ZFTA 4K1EA 3PMBB 3MU1A 4NA8A 1NRNH 1TGTA 4NG9H 2ZHQH 1O5DH 3AVZA 1LCYA 2TGAA 3EYDA 1BQYA 2ZNKH 1MBQA 2PGQB 4PROA 2Z3EA 3UIRA 2QY0B 2XBXA 3MU0A 4JZIA 1AQ7A 1SHYA 1WBGB 2ZCHP 4CRAA 3F9GA 2ZU2A 1PQ5A 3E0NB 4FVBA 5HMAA 3A8DA 1S83A 2A32A 4H6SB 1P06A 3FANA 4OS7A 1SLVB 1WU1A 4X6OA 1DUEA 3GCOA 3EA9A 1O3JA 1Q3XA 2P3UB 2PKAB 1T31A 4JZDH 2PUXB 3MMGA 1EP6A 4Y0YE 2ZU1A 1BTZA 3A88A 4WY3A 2BHGA 1OP0A 5G4BA 2ZKSA 3RXKA 1ZPBA 2BVXH 1NESE 2FOAA 2OC7A 1KLIH 4CR5A 1XUHA 5EQQA 4U01A 5C5OA 1O2GH 1D3TB 3P17H 3BEIB 2VIQA 3TK9A 2F3CE 2VVUA 3SUGA 1RIWC 1W7GH 4YZUA 1GJDB 5C1YA 1NFYA 2Z94A 4VGCB 1NPMA 1RGQA 4GAWA 3RXVA 2GVFA 1GCTB 1NFXA 2YOLA 4Y10E 1P2IA 1SPJA 2ZQ2A 2GDEH 1XKAC 3MOCA 2K1QA 2W7UA 3GY5A 3M3VA 4WH6A 1LHDH 3U1JB 4IN2A 1OPHB 4ZKOU 3RC5A 3ZZ4A 3UPEA 1NRQH 1BITA 1NU7B 1P04A 3BTTE 3M5MA 4JMYA 4BANB 1MH0A 1C5NH 3VGCC 4JYUH 2TRMA 3QX5H 1LPZB 3A8CA 5ESTE 4MPWA 5F8TA 4FUIA 3TITA 1XM1A 5FAHA 1T8OA 3A80A 1QL7A 1HAGE 3PMHB 1PPFE 1Y3WA 1O2YA 1UVSH 3LT3A 4ISNA 1ELTA 4MDSA 2BXTH 1HYLA 1UO6A 3K2UA 1RXPA 1C1UH 3PTBA 3SV6A 4J2YB 2QF3A 3MH5A 3B23B 4UEHH 4UFFH 4OS4A 1PFXC 1LQEA 1PPZA 5DJ7A 3GDUA 1KXBA 4Y76A 4AZ2B 1V2UT 5TJXA 2R3UA 2JETC 3RXOA 1DPOA 1T7CA 4HZHA 3L6PA 1EUFA 3BTKE 2P3FH 1S6FA 1GGDC 1GBHA 1LVOA 1W0YH 1BOQA 1P8VC 3GCNA 4FUEA 5T6FA 5E2OA 3TH2H 5C1XA 1KTTB 2IPHA 1QR3E 1CGIE 1MZDA 1HAZB 3RXFA 3S7HB 3QK1A 3HGNA 3AW1A 4NSVA 2H1UA 4YLUA 4KELA 1UK4A 2Z3CA 2VWNA 5I46H 3ZV8A 1MTUA 4XDEA 5J4SA 5AFZH 4B74A 1CQQA 5F8XA 1MQ5A 2B7DH 1OOKB 1FXYA 2Y5FA 4R8TB 4LK4A 4I8HA 4A6LA 3MYWA 1A5HA 1C5VA 1GBAA 2PV9B 1FY5A 1LKBA 3F9FA 3BSQA 5JB8S 1K9OE 5A0BA 2LPRA 2QA9E 2SFAA 1QRWA 3P70B 5C2ZA 3SUDA 1L1JA 2A7JA 1QNJA 4HGCA 1DE7H 1TIOA 6CHAB 4F49A 3V3MA 2WYJA 2ZGBH 3PV4A 1P05A 2QXIA 4WF8A 1BTYA 1C1RA 1CO7E 5TCCA 1JXPA 4Y0ZE 1VITG 1O3KA 1V2MT 2ZU3A 2B9LA 1ORFA 4SGBE 1QHRB 1Z1IA 2RDLA 2PKAA 3BIVH 1BTWA 2FO9A 1P9SA 1GHVH 8KME2 1HIAB 1LPGB 4YTAA 3A7WA 4ABAA 1GI3A 1A1RA 1BTHH 1V6DA 4B71A 3RC4A 3VFEA 1HCGA 2HPQH 4AB9A 3LDXH 3EGKH 1FI8A 2Z9IA 4TWYA 1CBWB 1HAYB 4K5ZA 1T4VH 1C2JA 4DIHH 2BLVA 1ZHRA 4XFQA 3SUFA 3LONA 3V12A 1AE5A 5AVDA 1TOCB 2ZFQH 1C5YB 1KY9A 3T27A 4AOQA 4X1RU 2ZQ1A 4H6TA 5H4IB 2ZFPH 2UUJB 3ZZ6A 1SC8U 3BTFE 1EZQA 2J94A 4JK5A 3MH7A 5DP9A 4CHAC 1H1BA 1P2NA 2C8XB 4B2CA 4AG2A 1TQ0B 4AGKA 1AFQC 4D7FA 1ESBA 3T28A 3UQOA 2BQ6B 2SNVA 2ZHEH 1O3LA 2F9NA 1CGJE 3LPRA 2J38A 1WSSH 1IQIA 1GI0A 1O3FA 3KQEA 3RDZA 4NFEA 1NC6A 4X8SH 1O39A 3Q76A 1ZGVA 4I8JA 2BY9X 1W13U 1XUFA 1PQAA 4JK6A 2OQUA 2O9QA 4MNXA 1QB9A 2O8TA 2W3KA 3VPKA 1SLWB 1P2JA 4O9VA 3MNSA 3MNXA 3MO9A 1AFEH 4CBOA 3D65E 2Q6GA 4FUDA 1ANDA 4B1TA 2YNBA 2ZGJA 3D23A 5GJ4B 1KTSB 3R0FA 1YM0A 3ATLA 1LHGH 2GZ7A 1NRSH 4YOIA 2ZGXH 1GBKA 4NFFA 1YPMH 1TGBA 2WV4A 1NN6A 1F0TA 3CS0A 1BRBE 4MNVA 1E38B 1L4DA 1A61H 2C93B 2P95A 1AUTC 2WPLS 5HYOA 4H4FA 4WWYA 1G2LA 4BAQB 3RXAA 3PO1B 1FUJA 1YCPM 4KGAA 2H9HA 2F91A 1O3OA 3DFJA 2FDAA 1YPLH 2XYAA 4JZEH 5T3HA 4K8BA 2OQ5A 1FY8E 3T2NA 3A8BA 4B75A 2ANMH 1O2VA 1LDTT 2FLRH 1W10U 4INHA 4B2BA 3T26A 4XBCA 4CH8B 1Z8RA 4VGCC 3SJ9A 4HFPB 2FOBA 2QV1A 1NFUA 2XC5A 3KGPA 1KXAA 3K6ZA 3RXIA 1C5QA 1NRPH 1FPHH 1SI5H 1TX7A 1B0FA 2EC9H 4FUJA 4DW2U 3RMMH 3ZVBA 1OXGA 1EJNA 3Q3KA 1L2EA 2OCVB 4E05H 1OS8A 2QXHA 3K65B 1TALA 1DWCH 1HAVB 1C2DA 3EQ0H 1BZXE 2SGPE 4TWWA 1BTPA 2AMPA 4NCYA 1J16A 1MZAA 3P8OA 4MPUA 1ZLRA 3ELAH 2Y5GA 1E36B 2AERH 4MNYA 1HIAA 4WVPE 5EOKA 3T5FH 1YBWA 3ZVCA 1MMJN 1UTMA 4RKOB 1SLXB 1H9HE 4Y79A 4KTUA 1TFXA 2G00A 1C1SA 3MNCA 4B76A 1ELBA 2JH5D 1RIWB 1E34B 3M5NA 4GPGA 1KLTA 3GY6A 1RFNA 1GBCA 3QN7A 3UNSA 1EZUC 1IQLA 1HRTH 3C27B 2ZDMA 2R0KA 1DWEH 1PPGE 2I6QA 3KIDU 1Y3UA 2ZECA 1W2KH 2G81E 2ZCLP 1QBOA 2IJOB 2OP9A 1C5OH 5EGMA 3QZRA 1GMHG 4JZ1A 1ELEE 3GYLB 4ABBA 1HJ8A 1LTOA 1JBUH 2FLBH 2GDDA 2PHBA 3E91A 3P8FA 3DUXH 3VGCB 5JDUB 3HK3B 1GJ5H 1C5ZB 1DWBH 2BTCE 3ZZ8A 1BBRE 1VJAU 1O3EA 4ABGA 1QBNA 1V2PT 8GCHF 2A1DB 2TGTA 3SQEE 5J4QA 1GHYH 1NTPA 1DDJA 1BA8B 2C8WB 3FP8E 5E0HA 2JETB 3A7XA 2ZI2H 4I7YH 1ZRBA 1GHBF 4FUGA 1UMAH 3KQCA 1P09A 4DG4A 4K1TA 2CN0H 2G4UA 5C1UA 4ISIH 5DP7A 5GXPA 2ANWA 4O97A 4XBBA 3RXEA 1O2RA 1EAXA 1V3XA 1PPCE 1A2CH 3GCTF 1ARBA 1YPKH 1C2FA 5L30H 1DFPA 1ELVA 2WPJS 4UFEH 3RMLH 4FU8A 3BEFB 2XCNA 7LPRA 1F0SA 1SGYE 3KEEA 2STBE 1ELCA 2VIPA 3RMOH 3E0PB 1GG6C 1UTKA 4AFSA 3T62A 1RD3B 2ZGHA 3QTOH 1G3CA 4DCDA 3LIWA 2ZPSA 1IQMA 1L1NA 5FX6A 1TBZH 3PYHA 1P57B 2EEKA 5DKMA 1DY8A 1EAUA 1C2GA 1K28D 1IQJA 3RM2H 2QIQA 4NZQA 2DUCA 3UOUA 1ZR0A 3O8CA 2ZU5A 1FAXA 1MTVA 3ENSB 2GKVE 1PYTC 4R0IA 4AG1A 3ZZBA 3SGQE 3SI3H 2BY6X 5JBCS 2PGBB 1T8NA 1DLEA 2PKSC 3ZV9A 1Y3YA 1HAVA 2FM2A 3OSYA 5DK1A 1KXFA 2AMDA 4X6MA 1CGHA 1W11U 2PR3A 1D3DB 5GWZA 2ZDVH 2UWOA 1GVKB 2NU0E 3ZZ3A 3KNXA 3A8AA 1DANH 4BAMB 1B0EA 1K22H 1EQ9A 2G4TA 1BUIA 2A7HA 1BBRK 5LPEA 1CHOG 5I25A 2GTBA 3BV9B 3LGIA 3N7OA 4ABIA 5GIBA 2SNWA 3GICB 1HV7A 2VINA 5A2MH 1RTKA 5A8YA 1P02A 1NM6A 4CREA 2P3TB 3LGYA 2BMGB 4JZFH 4BNRA 1QBVH 3Q3YA 5FPSA 4B2AA 2XC0A 3GY2A 1O2OA 3R3GB 4CHAB 1WQVH 2BD2A 2XBVA 4UFDH 4ZKRU 1GMDG 5T6GA 5L2ZH 1AFQB 1GI6A 1OYTH 1TNHA 1Y59T 1VJ9U 4I8GA 3ZVFA 2B8OH 1XX9A 3PO1C 4X8UH 1NZQH 1AB9C 2BDYA 1NRRH 1TX8A 1GHAG 1QRXA 2ZDKA 2R9PA 3HK6B 3RXUA 3S0NA 5GCHF 4J1YA 4Q2KA 1QB1A 1YP9A 1GWAA 3LC3A 3FVFB 1K1LA 2GV7A 3G01A 2GMTB 4Q7ZA 3SHAH 1ZHMA 1PPEE 3A84A 1GI5A 1INCA 5DP3A 3ZYEA 1SVPA 4AB8A 2ASUB 1K1NA 1MD7A 1Z8IB 2ZHDA 1YCPK 1TRMA 2BD7A 3JZ1B 2CJIA 6LPRA 7KMEH 1C1PA 1SGCA 2FI5E 1EJMA 2UWPA 1Q31A 4I32A 1PQ7A 4FXGH 2XWBI 2O8LA 4CRDA 1P2OA 3KL6A 1TAWA 2H6MA 3A7ZA 2ZDLA 3Q00A 1S0RA 3UQVA 4TY7A 1HJAC 2PFEA 1LVYA 2HALA 1K1OA 4A7IB 1C2MA 4LZ1H 1C5RA 2F9OA 4UE7H 1G3BA 1AI8H 3FFGA 2HOBA 3ZZ9A 2VJ1A 3RP2A 1TE0A 4Q80A 3H7TA 1AHTH 1TLDA 4ABDA 2TBSA 3EDXB 4YOGA 1AU8A 2VNTA 1ZTJA 1DWDH 1T32A 5JYIA 1EASA 1P01A 3FZZA 2J4IA 2VGCC 5JBAS 4IMZA 1F7ZA 1OP2A 1J17T 2ZIQH 2BD5A 4KTSA 5EG4A 3TNSA 1TMTH 2FOGA 1P2MA 4JCNA 1GJ6A 1C5UA 5A8ZA 2PLXA 3SNEA 2FP7B 1V2RT 4FUHA 2I6SA 3SU0A 2A2XH 3M7UA 1N6XA 3RXLA 2A45B 2Q6DA 3B9FH 7ESTE 1E0FD 2BX3A 4FU9A 1VCPA 1JRTA 1SGTA 3SJIA 3MO3A 2BQ7B 5LGOA 1ZGIA 1O3AA 1WUNH 2P94A 3OY6U 1GJCB 3RXBA 2A2QH 4INKA 1O5FH 1GDQA 5AFYH 1O3DA 4A1XA 1WQSA 1C5SA 1V2LT 3D49H 2HVXA 1D4PB 4I8LA 4ZHAA 4ZROA 4BTTB 4IS5A 1ESAA 2BVRH 5FBIA 4FUCA 4WXVA 1DSTA 4IMQA 8LPRA 1UTJA 2BD8A 3SOSA 2ZPRA 1SGQE 1AO5A 1NT1A 4ZXXH 3SU4A 7GCHF 1GPZA 5B6OA 5F6MA 1LMWB 2FYRA 1GDUA 1LQDB 3U8OH 3TJOA 3SU3A 4ZHLU 3OY5U 1EAWA 3ATIA 4Y8ZA 1YLCA 2UUFB 1O3CA 1OYQA 1W0ZU 4DGJA 1ZOMA 2TGPZ 1GL1A 1THRH 1N1LA 4TPIZ 1C5PA 2C4FH 3EAJA 3ATMA 1S6HA 2ZFSA 4GCHG 4AFUA 1GI2A 2FOCA 5JB9S 1GBFA 3K6YA 4D9QA 3MU4A 2VWOA 1W7XH 2HRVA 1AKSB 1G30B 3MI4A 2ZPQA 3UNRA 1OWHA 5C67A 6GCHF 5E2PA 1XUKA 4U32A 3RU4E 4ISLA 1O3PB 2GV6A 3U8RH 3CENA 2KAIB 1ELGA 1AVWA 4DY7B 1Z8JB 3SU5A 3SO3A 3BIUH 3NKKA 1EJAA 1GHWH 3UWJH 1O3GA 5AHGH 3RXMA 1TPSA 1GBTA 1G3EA 1G32B 4DJZB 2BDCA 3O8RA 1GBJA 3S69A 4B73A 1J8AA 5EXLA 1FONA 4ZH8A 2HPPH 4ABJA 1W14U 5HM2A 4WXIA 2NU3E 1DOJA 2OC8A 1V2OT 2BDHA 1JIRA 1OWEA 3VB3A 1C9PA 1P3CA 2BLWA 4YESB 1ACBE 1MTSA 2J2UA 2XWAA 4QT8C 1FN6A 2JH6D 4O3TA 3RU4T 5BRRE 3LC5A 4OS6A 4CRBA 1C2HA 2NWNA 2FS8A 4FUBA 3SJKA 3E1XB 2Z9GA 3RM0H 1SOZA 2FS9A 2AGGX 4CBNA 3QO6A 5EPNA 3A81A 3KF2A 3VB6A 1IHSH 2BDAA 1SOTA 1GG6B 1ZMLA 2OBQA 1O5BB 1K2I1 2QCYA 2HWLB 4UDWH 1D3QB 1BBRH 5DP8A 4MQAA 1YGCH 1XVMA 1HAPH 2UUYA 5E0GA 1DX5M 5CHAB 3RU4D 3KQBA 1O38A 3VB4A 1UTQA 2EI6A 2FOMB 1GI9B 4WMDA 2BZAA 1C4U2 1MKXK 1D6WA 3TIUA 2ALPA 1F0RA 2F9VA 2ZA5A 4K8YA 2M5TA 1TPOA 2EI8A 4DURA 3SZNA 1GMCF 1G3DA 2FTLE 1O2LA 4U2WA 1QQ4A 4DIIH 2BVSH 3FP6E 2Z9LA 3TLOA 1LPKB 1C2LA 3C1KA 1KYNA 2PKSB 3F68H 1BHXF 1HDTH 1C1TA 2GT7A 1GVLA 2BY5X 3TNTA 4ABFA 2GCHF 1GL0E 1FPCH 2PTCE 2P93A 1F5KU 1T4UH 1P2QA 2AGEX 4WJG2 2BOKA 1WTHD 1EKBB 4LXBH 3MO6A 3HKIB 1P03A 3TH3H 1HBTH 1UCYH 3V0XA 4M7GA 1FDPA 3JZ2B 3MH6A 1SMFE 2QF0A 2GMTC 1KXDA 3LKWA 1C1MA 5FHTA 2WPIS 3RXPA 3U8TH 5K0HA 2C90B 5EQSA 3A85A 1YCPH 9LPRA 1U6QA 1QL8A 4DT7B 4ISOA 1GBIA 1MAXA 1TYNA 1TMBH 1F0UA 4KKDA 2Y82A 4IN1A 2VIDA 3DD2H 1HAXB 2Q6FA 1QJ7B 1KIGH 1AKSA 1EPTC 1O35A 2ZG0H 1P0SH 2Y6TA 4GHTA 1D9IA 1CT2E 1EX3A 3SW2B 2FZZA 3MTYA 1TA6A 2OINA 1AB9B 2HNTF 3MNBA 2KAIA 1PPHE 2Z7FE 1XMNB 2BY8X 3BTQE 1MBMA 1V2WT 1C1QA 2QAAA 1Y3VA 1G9IE 5DP4A 3SORA 1A0LA 2H5DA 3E6PH 2BM2A 1EB2A 1FMGA 1V2KT 4O3UA 1O2HA 4YO9A 2W3IA 3LJJA 1O30A 2BDGA 2VH6A 4DVAU 3M3TA 3SHCH 3ZZAA 1GBDA 1KSNA 1SQOA 2QC2A 1H8IH 1AZ8A 2CV3A 2FOEA 3F9HA 1ABJH 1ZPZA 3MFJA 1BT7A 2F9UA 1F5RA 1BRCE 3PLBA 5DP6A 4ZKNU 1RTFB 3Q77A 1BRAA 1TRNA 5ETXA 2P8OC 2ULLA 1Y8TA 4A5TS 2R2MB 2BYAX 5BPEA 3RXJA 3F6UH 1TOMH 4SGAE 1HJAB 2BOHB 1WYKA 2VIVA 3GCHC 1AE8H 4UFGH 1HAHH 4AORA 4MNWA 5DGJA 1F5LA 3L3TA 1OSSA 1TPPA 3M3SA 3SUEA 2VGCB 4I31A 1SGRE 1BIOA 1PQ8A 2Y5HA 3SV7A 1GJ4H 4E06H 3VB5A 2GCTC 2G5VA 1YPEH 1ZTLA 2GGVB 4K69A 1P11E 2Z3DA 4XSKU 1W12U 3STJA 2H9EH 2A4OA 2BDBA 1UVTH 2FXRA 3MH4A 3SNBA 3ZZDA 1ZPCA 2GZ9A 4A92A 1A3BH 4XOJA 1OKXA 4MPVA 3KN2A 1S85A 1UJ1A 3ZZ5A 3SJ8A 3ZZ7A 5A0CA 1Q2WA 2H5CA 1VZQH 4A1TA 3SGBE 4E7RG 1C1VH 1WV7H 3PWBA 2ZFFH 1XXFA 2A5IA 4ABEA 2P16A 1GJAB 1O5GH 1O31A 1C1OA 4RKJB 3WY8A 4IBLH 5CMXH 1BDAA 2AEIH 3Q3XA 1J9CH 1YYY1 3U1IB 4TYDA 3PTNA 5DP5A 1ANBA 1QIXB 1A5GH 3AAUA 1HFDA 3SNDA 1TX6A 3A82A 3I77A 3VB7A 1C2KA 2OD3B 3P8GA 2LNCA 5FPYA 1N6YA 1V2JT 1WCZA 4F4OC 2ZEBA 1NY22 5A09A 1P12E 5DG6A 3L33A 2FESH 5C20A 1B5GH 3T25A 1FV9A 3UR6A 1O2QA 2NU1E 3PWCA 5L2YH 1MTNC 4KP0A 5FXLA 3ODFA 3TVJB 1GJ8B 2CMYA 2AIQA 5DO4H 3QTVH 2A7CA 3MWIU 2XNIA 2Z9JA 1C5XB 2G51A 3ZVAA 1ABIH 3T29A 4ASHA 1H8DH 1OX1A 2FX4A 1BMNH 3CS7A 3NPSA 1UCYE 3URCA 4BTIB 2FEQH 1SGDE 4AFZA 1BJVA 4D8NA 3AAVA 1ESTA 1AD8H 1C4Y2 1GHXH 4D9RA 1DXWA 1C1WH 1UK3A 1OWIA 3RUOA 5CHAC 4IC6A 3S9AA 1BMMH 3M5OA 1O2IA 1XVOA 3H5CB 1MKXH 1IQEA 3SNAA 2XCFA 5C3NA 4FVDA 2QXJA 3PB1E 3TK5A 4X1NU 3PMJA 2QN5T 2BD3A 1A4WH 3EA8A 4RN6A 1BMAA 1PYTD 1O2NA 1SL3A 2V0BA 3EA7A 4OS1A 3FZDA 1DUAA 1TMUH 3EE0B 2XW9A 1YPGH 1F92A 1O2KA 2Y80A 3UTUH 2DE8A 1UTPA 1DS2E 2PSXA 5JBBS 4MTBA 2RG3A 1GI8B 4OGXA 1BMLA 1THSH 3KQDA 3LGVA 1PPBH 3ZVGA 2WINI 2Y81A 2WV5A 2WYGA 3V7TA 2A0QB 1EZSC 1UVUH 5HM9A 4Y11E 1H4WA 4AGJA 2BXUH 1ANEA 3A7VA 3BG4B 2RCEA 5EU8A 3BTDE 3GOVB 3TU7H 2V6NA 3SU2A 2SGQE 3URDA 1O36A 1TNLA 2FX6A 4YT7H 1XUGA 1S5SA 1CSOE 3BG8A 1FAKH 8ESTE 1VR1H 5EQRA 1GBBA 1SGFG 1BTUA 2G8TA 2NU4E 2VIOA 1TGNA 3PM3A 4OGYA 1GHZA 2GD4B 3BTWE 1V2ST 2IN2A 2ZTZA 1HUTH 3LGUA 4X6PA 2THFB 2ODPA 4TY6A 2SGAA 3SV8A 5EW1H 1Y5AT 4NWKA 4KTCA 2Z6BD 3LGTA 1AZZA 1P2KA 1O32A 3E90B 1BJUA 3QGJA 1DICA 8GCHG 4X6NA 4GSOA 1XXDA 4BAOB 1UCYK 1HB0B 1EP5A 1GHBG 2B0FA 2CXVA 5IDKA 2FOFA 2VVVA 3QZQA 1GJBB 1K21H 1YC0A 3GY8A 4YT6H 3U9AH 3QLPH 3ZVDA 1OWJA 3QUMP 3OTJE 1KXCA 2BQWB 3NXPA 1FQ3A 1CA0C 1WTGH 3ZVEA 2CHAC 2FPZA 3BTME 1LHCH 2JKHA 4Y6DA 2ZWLH 3E3TA 3GCTG 3BN9A 1EPTB 1LO6A 2FOHA 1TGSZ 3RXCA 1CHGA 5A8XA 1O3HA 3TPIZ 1D6RA 2QGRA 5F03A 1J14A 2ZHFH 4Y7AA 1G36A 3BEUA 2J92A 3W95A 1QJ1B 2AFQB 3LH1A 1EXFA 1IHTH 3QWCH 4HI3A 1RTLA 2PUQH 1ZRKA 1PJPA 4MPXA 3U69H 1LKAA 1SBWA 4H42U 1VITF 2FODA 5FPTA 3NCLA 1O34A 3B8JA 3BTGE 4BAHB 1T8MA 1C5LH 1O3NA 4A1VA 3S7KB 1L1GA 1YKTA 3M36A 2FYQA 1Y5UT 4AYVB 1IQFA 3O8BA 1SQAA 3SGAE 1S0QA 1TONA 4NGAH 2BLQA 1F2SE 4BAKB 2TIOA 2R2WU 2P8OB 2XTTB 1QL9A 2OC0A 1TQ7B 1AN1E 4BXWA 1GJ9B 3GCHB 1THPB 3FAOA 4OS5A 5L6NH 4E7NA 2XBWA 4Q7XA 1UVOA 3RLWH 3F1SB 3STIA 1BHXB 1Z6JH 1EOJA 1WOFA 4X1QU 2UWLA 2GCTB 2WUCA 1N8OC 1MD8A 2O8UA 1E37B 1CT4E 1K1MA 1QJ6B 2OLGA 3GY7A 1ZHPA 1CE5A 3M61U 2B5TB 1VGCC 1AGJA 5FBEA 1ZZZA 4X0WU 2PWXA 1HJ9A 1O2PA 2W5EA 1O2UA 3TJNA 1Y3XA 4XE4A 1HGTH 2W26A 5T6DA 1Z7KA 2TGDA 1AUJA 1C1NA 3SQHE 1FY4A 2H2ZA 1S81A 3HKJB 2R0LA 2TPIZ 3A87A 2YNAA 3TH4H 4AX9H 1AWFH 2JH0D 5GCHG 1BRUP 4JYVH 3PLPA 1A7SA 1RJXB 3MU8A 1XUIA 2A4GA 2H9TH 3VEQB 3UNQA 3SNCA 3S9CA 2OTVA 1SGIB 3P6ZB 5F8ZA 1HLTH 2J9NA 1P10A 5TCAA 2PSYA 2FI4E 1IAUA 1E35B 2XXLA 5PTPA 5JPMH 4K60A 5E8EH 4YLQH 2ZTYA 4I8KA 2VIWA 3KCGH 1MCTA 1SGEE 5ESBA 1LVMA 3M7TA 3U98H 3SV2H 6ESTA 1MTNB 3SU1A 1SR5C 1O2WA 2A4QA 1O0DH 1SG8B 2GP9B 2BD4A 3UY9A 4INLA 1ID5H 1EPTA 2G55A 1SQTA 5AF9H 4IW4E 3A86A 4WH8A 3NZIA 4ESTE 3A7TA 1GI1A 3UFAA 2W7SA 5EODA 1ZTKA 2ZGCA 1HPGA 2G5NA 5C5NA 3RXHA 5DPAA 3PROA 5LH8A 4BXSA 3RMNH 2O8MA 1MAYA 1IQHA 3K9XB 2VVCA 3BG4C 1Y5BT 1QRZA 4NIVA 4AYYB 1T8LA 2BB4A 1MCVA 2BDIA 1B7XB 1FY3A 1QCPA 1NFWA 1TGCA 2WUBA 1Z6EA 1SSXA 1GI4A 1W8BH 1GCDA 1W3CA 2AMQA 1ARCA 4GUXA 1DY9A 2A5KA 2PW8H 3CP7A 7GCHG 1CT0E 2P59A 1TPAE 3A7YA 3E8LA 2ZHWH 1Z1JA 1S82A 2DE9A 1ETTH 1KDQB 1BCUH 2BD9A 1SGNE 1L4ZA 2V3OH 2BY7X 1NU9A 3DHKH 1BB0B 1GMHF 2ZZUH 4U30A 2IOTA 3M37A 1UTLM 1CVWH 4MVNA 1EB1H 2CGAA 2ZCKP 3GDVA 1C5WB 3A89A 3SV9A 4X1SU 1DSUA 1P3EA 3AW0A 1YF4A 5GDSH 3UWIA 4NSYA 1HXFH 4ISHH 1QFKH 1O3IA 2A5AA 2C8YB 1O5AB 3GY4A 3SI4H 6GCHG 1S84A 2C8ZB 1HXEH 4NZLA 1HNEE 2G52A 1LHFH 2VU8E 2SGFE 4ZKSU 3OYPA 1ZJDA 4NA9H 3TJVA 3F9EA 2BLOA 1TNIA 4Y71A 1A5IA 1V2TT 2BX4A 1TABE 1IQKA 3NK8A 2CF8H 1C2IA 2F9PA 4K3JA 3OU0A 3OX7U 3RXQA 1QQUA 5EXMA 2HGTH 4X2VA 3ZYDA 3V13A 1TNGA 3GISB 3KHVA 1LHEH 1ZSKA 2ZO3H 2FTMA 2ILNA 2ALVA 1TWXB 3NWUA 4XBDA 1O3MA 3S9BA 2D8WA 4X8VH 1DITH 4HTCH 4YM9A 1DT2A 1FIWA 1ZSJA 3HGPA 1H9LB 4GLYA 1ELFA 3ESTA 1V2VT 2GZ8A 5IYTA 1MKWK 1C4V2 1ETSH 1CA0B 1G2MA 2CHAB 1K1JA 1QB6A 4CR9A 2WPMS 3DT0H 2ZU4A 3RC6A 1SLUB 3SBKA 1GCTC 3PLKA 1L0ZA 1QTFA 2HNTE 1JIMA 3QDZB 1SB1H 1UTNA 1ZSLA 4X2YA 1C5MD 2UUKB 1P9UA 1DXPA 2FIRH 3IWMA 4UD9H 2R3YA 4X1PU 2AH4X 2NU2E 1VCWA 4NWLA 2OC1A 2ZC9H 3DA9B 3RXDA 1OP8A 1TNJA 4Y8YA 1X7AC 4MG3A 1AIXH 3A83A 4FUFA 5LPFA 2A4RA 2ANYA 1H9IE 1O2MA 1XKBC 5K7RA 1IQGA 1EZXC 4I33A 1EAIA 4OS2A 5LPRA 1AVGH 1DVAH 3IITA 2AGIX 2RA3A 3D62A 1GMCG 3IG6B 3I78A 1AWHB 1TRYA 4THNH 3M5LA 1OWDA 3VXEH 1SFQB 1FZZA 4CH2B 1ZYOA 3GDSA 1A3EH 2ZF0H 2OUAA 2GCHG 2V3HH 1SHHB 1A46H 3PMAB 1YLDA 3RXTA 2Q1JA 1CHOF 2VB0A 9ESTA 3RXGA 1UHBB 1AVXA 3RXSA 1JOUB 3NUMA 2PTNA 4Z0KA 1QA7A 3DFLA 1O2ZA 1C9TA 3LU9B 1KDQA 4X2XA 1RS0A 1SGFA 2VH0A 1HAIH 3ZZCA 3I29A 2HNTC 2ODYB 1GMDF 2D1JA 3LH3A 1D3PB 1N8OB 4CRFA 2FWWA 1QA0A 1TA2A 3QGNB 2GT8A 1ETRH 4WMFA 4D7GA 4NIYA 1FY1A 3H7OA 1VGCB 4X2WA 2D2DA 4DOQA 2EI7A
chains in the Genus database with same CATH superfamily
3TGJE 1TBRH 2SGDE 5HGGA 2FMJA 3M7QA 5JBTA 2V35A 2HLCA 1GHAF 1GBEA 3F2FA 3ATKA 5GPIB 1M9UA 4BOHA 3TGIE 2F83A 2J95A 2JIZD 2O8WA 3ITIA 1CA8B 1G37A 1VCQA 2Y7XA 4IGDA 1DLKB 4O03A 6CHAC 4CRGA 1GGDB 1QY6A 2A31A 1WAYB 3BF6H 3FP7E 1FJSA 1ZMJA 1O2JA 2FI3E 3BTEE 3M35A 3RXRA 1TBQH 2D26C 2ZP0H 4FU7A 3P8NA 5A0AE 1K1PA 1O33A 3TJUA 2XC4A 1YPHE 4Y7BA 3VG8A 4MLFB 5ABWA 1K1IA 3VXFH 4Q63A 1VITH 1O2TA 2ZTXA 1O5EH 4X8TH 1GJ7B 3GY3A 1EOLA 1BTXA 1C5TA 3UR9A 1HAOH 2GX4A 3SU6A 5EXNA 1XUJA 1AY6H 1O5CB 1UVPA 2QYIA 2SGEE 1QGFA 5E0JA 4ZUHA 1V2QT 1CBWC 1CU1A 5CE1A 4WMEA 1A0JA 1JMOH 2ODQA 4ZXYH 1ZJKA 4NIXA 3ATWA 5CHBA 4D76A 1FNIA 4TPYA 3ODDA 5T1VA 5FCKA 1O3BA 2AS9A 2RA0A 1TB6H 2KCAA 2WPHS 1MQ6A 2XRCA 2OXSA 4AN7A 1NS3A 5SGAE 1SFIA 1ANCA 1IOEA 1V2NT 2J98A 4ZAEA 2VWLA 3MU5A 1UTOA 1QURH 3HATH 1C2EA 1EATA 5HXFA 4LZ4B 3WWFA 2STAE 2Z9KA 4IC5A 1RRKA 2VWMA 2ESTE 1TNKA 5FCRA 2AYWA 1IQNA 3GYMA 1O37A 1MU8B 1GDNA 3MHWU 4YOJA 3UREA 4GHQA 4NIWA 4ZMAH 3RLYH 4K1SA 1KLJH 1E1QD 5EW2H 1Z8GA 1A0HB 2WPKS 3GS9A 1O2SA 2ZDNA 5DN6D 4Z6AH 4BTUB 1YPHC 1ZMNA 1MTWA 3E16B 2WHXA 2ANKH 2ZDAH 3UUZA 3UOPA 1FN8A 1GBLA 1MU6B 1GVZA 5EPYA 3SJOA 1ELAA 3P95A 2F9BH 1FLEE 2XBYA 4ABHA 5FX5A 4JYTA 4AFQA 3O8DA 3HPTB 3LOXA 3LJOA 2QXGA 2CF9H 3TK6A 2BZ6H 3F3BA 2ZFRH 4K2YA 4Q4LA 4CRCA 1O2XA 4Y8XA 2M2AA 4UONA 2J34A 1UHBA 4Q7YA 4ZHMU 1DM4B 1NROH 2C3SA 2Y7ZA 4GVUA 1KXEA 4GCHF 3BTHE 3AASA 4LOYH 1JRSA 2EA3A 3P92A 1GBMA 1J15A 1UK2A 1Z71A 1SGPE 1NO9H 2OBOA 1ELDE 1JWTA 1GI7B 3SN8A 3W94A 3TGKE 2AIPA 1LVBA 1FIZA 3LGWA 1AMHA 4RSPA 1YPJH 1MUEB 4NA7A 1OWKA 1MKWH 2ZFTA 4K1EA 3PMBB 3MU1A 4NA8A 1NRNH 1TGTA 4NG9H 2ZHQH 1O5DH 3AVZA 1LCYA 2TGAA 3EYDA 1BQYA 2ZNKH 2CK3D 1MBQA 2PGQB 4PROA 2Z3EA 3UIRA 2QY0B 2XBXA 3MU0A 2AHME 4JZIA 1AQ7A 1SHYA 1WBGB 2ZCHP 4CRAA 2KCOA 3F9GA 2ZU2A 1H8ED 1PQ5A 2EQNA 3E0NB 4FVBA 5HMAA 3A8DA 1S83A 2A32A 4H6SB 1P06A 3FANA 4OS7A 1SLVB 1WU1A 4X6OA 5IK2D 1DUEA 3GCOA 3EA9A 1O3JA 1Q3XA 2P3UB 2PKAB 1T31A 4JZDH 2PUXB 3MMGA 1EP6A 4Y0YE 2ZU1A 1BTZA 3A88A 4WY3A 2BHGA 1OP0A 5G4BA 3WWBA 2ZKSA 3RXKA 1ZPBA 2BVXH 1NESE 2FOAA 2OC7A 1KLIH 4CR5A 1XUHA 5EQQA 4U01A 5C5OA 1O2GH 1D3TB 3P17H 3BEIB 2VIQA 3TK9A 2F3CE 2VVUA 3SUGA 1RIWC 1W7GH 4YZUA 1GJDB 5C1YA 1NFYA 2Z94A 4VGCB 1NPMA 1RGQA 4GAWA 3RXVA 2GVFA 1GCTB 1NFXA 2YOLA 4Y10E 1P2IA 3FOAA 1SPJA 2ZQ2A 2GDEH 1XKAC 3MOCA 2K1QA 2W7UA 3GY5A 3M3VA 4WH6A 1LHDH 3U1JB 4IN2A 1OPHB 4ZKOU 3OEED 3RC5A 3ZZ4A 3UPEA 1NRQH 1BITA 1NU7B 1P04A 3BTTE 3M5MA 4JMYA 4BANB 1MH0A 1C5NH 3VGCC 4JYUH 2TRMA 3QX5H 1LPZB 3A8CA 5ESTE 4MPWA 5F8TA 4FUIA 5C94A 3TITA 1XM1A 5FAHA 1T8OA 3A80A 1QL7A 1HAGE 3PMHB 1PPFE 1Y3WA 1O2YA 1UVSH 3LT3A 4ISNA 1ELTA 4MDSA 2BXTH 1HYLA 3KQ5A 1UO6A 3K2UA 1RXPA 1C1UH 3PTBA 3SV6A 4J2YB 2QF3A 3MH5A 3B23B 4UEHH 4UFFH 4OS4A 1PFXC 1LQEA 1PPZA 5DJ7A 3GDUA 1KXBA 4Y76A 4AZ2B 1V2UT 5TJXA 2R3UA 2JETC 3RXOA 1DPOA 1T7CA 4HZHA 3L6PA 1EUFA 4RT1A 3BTKE 2P3FH 1S6FA 1GGDC 1GBHA 1LVOA 3NRLA 1W0YH 1BOQA 1P8VC 3GCNA 3OE7D 4FUEA 5T6FA 5E2OA 3TH2H 5C1XA 1KTTB 1YY3A 1QR3E 2IPHA 1CGIE 1MZDA 1HAZB 3RXFA 3S7HB 3QK1A 3HGNA 3AW1A 4NSVA 2YMSB 2H1UA 4YLUA 4KELA 1UK4A 2Z3CA 2VWNA 5I46H 3ZV8A 1MTUA 4XDEA 5J4SA 5AFZH 2L74A 4B74A 1CQQA 5F8XA 1MQ5A 2B7DH 1OOKB 1FXYA 2Y5FA 4R8TB 4LK4A 1WDIA 4I8HA 4A6LA 3MYWA 1A5HA 1C5VA 1GBAA 2PV9B 1FY5A 1LKBA 5EJZA 3F9FA 1BMFD 3BSQA 5JB8S 1K9OE 5A0BA 2LPRA 2QA9E 2SFAA 1QRWA 2J97A 3P70B 5C2ZA 3SUDA 1L1JA 2A7JA 1QNJA 4HGCA 1DE7H 1TIOA 6CHAB 4F49A 3V3MA 2WYJA 2ZGBH 3PV4A 1P05A 2QXIA 4WF8A 2W6ID 1BTYA 1C1RA 1CO7E 5TCCA 1JXPA 4Y0ZE 1VITG 1O3KA 1V2MT 2ZU3A 2B9LA 1ORFA 4SGBE 1QHRB 1Z1IA 2WZQA 2RDLA 2PKAA 3BIVH 1BTWA 2FO9A 1P9SA 1GHVH 8KME2 1HIAB 1LPGB 4YTAA 3A7WA 4ABAA 1GI3A 3F2HA 1A1RA 1BTHH 5EJLA 1V6DA 4B71A 3RC4A 3VFEA 1HCGA 2HPQH 4AB9A 3LDXH 3EGKH 3SZEA 1FI8A 2Z9IA 4TWYA 1CBWB 1HAYB 4K5ZA 1T4VH 1C2JA 4DIHH 2BLVA 1ZHRA 4XFQA 3AK5A 3SUFA 3LONA 3V12A 1AE5A 5AVDA 1TOCB 2ZFQH 1C5YB 1KY9A 3T27A 4AOQA 2KR7A 2ZQ1A 4H6TA 4X1RU 5H4IB 3PV2A 2ZFPH 2UUJB 3ZIAD 3ZZ6A 1SC8U 3BTFE 1EZQA 2J94A 4JK5A 3MH7A 5DP9A 4CHAC 1H1BA 1P2NA 2C8XB 4B2CA 4AG2A 1TQ0B 4AGKA 1AFQC 4D7FA 1ESBA 3T28A 3UAIC 3UQOA 2BQ6B 2SNVA 2ZHEH 1O3LA 2F9NA 1CGJE 3LPRA 2J38A 1WSSH 1IQIA 1GI0A 1O3FA 3KQEA 3RDZA 4NFEA 1NC6A 4X8SH 1O39A 3Q76A 1ZGVA 4I8JA 2BY9X 1W13U 1XUFA 1PQAA 4JK6A 2OQUA 2O9QA 4MNXA 1QB9A 2O8TA 2W3KA 3VPKA 1SLWB 1P2JA 4O9VA 3MNSA 3MNXA 3MO9A 3PRDA 1AFEH 4CBOA 5B6LA 3D65E 2Q6GA 4FUDA 1ANDA 4B1TA 2YNBA 2ZGJA 3D23A 5GJ4B 1KTSB 3R0FA 1YM0A 3ATLA 1LHGH 2GZ7A 1NRSH 4YOIA 2ZGXH 1GBKA 4NFFA 1YPMH 1TGBA 2WV4A 1NN6A 1F0TA 3CS0A 5KGOA 1BRBE 4MNVA 1E38B 1L4DA 1A61H 2C93B 2P95A 1AUTC 2WPLS 5HYOA 4H4FA 4WWYA 1G2LA 4BAQB 3RXAA 3PO1B 1FUJA 1YCPM 4KGAA 2H9HA 2F91A 1O3OA 3DFJA 2FDAA 1YPLH 2XYAA 3DSOA 4JZEH 5T3HA 4K8BA 2OQ5A 1FY8E 3T2NA 3A8BA 4B75A 3N7EA 2ANMH 4F48B 1O2VA 1LDTT 2FLRH 1W10U 4INHA 4B2BA 3T26A 4XBCA 4CH8B 1Z8RA 2LP6A 4VGCC 3SJ9A 4HFPB 2GJGA 2FOBA 2QV1A 1NFUA 2XC5A 3KGPA 1KXAA 3K6ZA 3RXIA 1C5QA 5EIYA 1NRPH 1FPHH 1SI5H 1TX7A 1B0FA 2EC9H 4FUJA 4DW2U 3RMMH 3ZVBA 1OXGA 1EJNA 3Q3KA 1L2EA 2OCVB 4E05H 1OS8A 2QXHA 3K65B 1TALA 1DWCH 5C0TA 1HAVB 1C2DA 3EQ0H 1BZXE 2SGPE 3DCLA 4TWWA 1BTPA 2AMPA 4NCYA 1J16A 1MZAA 3P8OA 4MPUA 1ZLRA 3ELAH 2Y5GA 1E36B 2AERH 4MNYA 1HIAA 4WVPE 5EOKA 3T5FH 1YBWA 3ZVCA 1MMJN 4XRNA 1UTMA 4RKOB 1SLXB 4TT3D 1H9HE 4Y79A 4KTUA 1TFXA 2G00A 1C1SA 3MNCA 4B76A 1ELBA 2JH5D 1RIWB 5HIYA 1E34B 3M5NA 4GPGA 1KLTA 3GY6A 1RFNA 1GBCA 3QN7A 3UNSA 1EZUC 3PV5A 1IQLA 1HRTH 3C27B 2ZDMA 2R0KA 1DWEH 1PPGE 2I6QA 3KIDU 1Y3UA 2ZECA 1W2KH 2L6OA 2G81E 2ZCLP 1QBOA 2IJOB 3N99A 2OP9A 1C5OH 5EGMA 4XD7D 3QZRA 1GMHG 4JZ1A 3SYJA 1ELEE 3GYLB 4ABBA 1HJ8A 1LTOA 1JBUH 2FLBH 2GDDA 2PHBA 3E91A 3P8FA 3DUXH 3VGCB 5JDUB 3HK3B 2YMSD 1GJ5H 1C5ZB 3OFND 4RI0A 1DWBH 2BTCE 3ZZ8A 1BBRE 1VJAU 1O3EA 4ABGA 1QBNA 5C0UA 1V2PT 8GCHF 2A1DB 1W0JD 2J5UA 2TGTA 3SQEE 5J4QA 1GHYH 1NTPA 1DDJA 1BA8B 2C8WB 3FP8E 5E0HA 2JETB 3A7XA 2ZI2H 4I7YH 1ZRBA 1GHBF 4FUGA 1UMAH 2W6JD 3KQCA 1P09A 4DG4A 4K1TA 2CN0H 2G4UA 5C1UA 4ISIH 5DP7A 5GXPA 2ANWA 1SQRA 4O97A 4XBBA 3RXEA 1O2RA 1EAXA 1V3XA 1PPCE 1A2CH 3GCTF 1ARBA 1YPKH 1C2FA 5L30H 1DFPA 1ELVA 2WPJS 4UFEH 3RMLH 4FU8A 3BEFB 2XCNA 7LPRA 1F0SA 1SGYE 3KEEA 2STBE 1ELCA 2VIPA 3RMOH 3E0PB 1GG6C 1UTKA 4AFSA 3T62A 1RD3B 2ZGHA 3QTOH 1G3CA 4DCDA 3LIWA 2ZPSA 1IQMA 1L1NA 5FX6A 1TBZH 3PYHA 1P57B 2EEKA 5DKMA 1DY8A 1EAUA 1C2GA 1K28D 1IQJA 3RM2H 2QIQA 4NZQA 2DUCA 3UOUA 1ZR0A 3O8CA 2ZU5A 1FAXA 1MTVA 3ENSB 2GKVE 1PYTC 4R0IA 4AG1A 3ZZBA 3SGQE 3SI3H 2BY6X 5JBCS 2PGBB 1T8NA 1DLEA 2PKSC 3ZV9A 1Y3YA 1HAVA 2FM2A 3OSYA 5DK1A 1KXFA 2AMDA 4X6MA 1CGHA 1W11U 2PR3A 3FO8D 1D3DB 5GWZA 2ZDVH 2UWOA 1GVKB 2NU0E 3ZZ3A 3KNXA 3A8AA 1DANH 4BAMB 1B0EA 1K22H 1EQ9A 2G4TA 1BUIA 2A7HA 1BBRK 5LPEA 1CHOG 5I25A 2GTBA 3BV9B 3LGIA 3N7OA 4ABIA 5GIBA 2SNWA 3GICB 1HV7A 2VINA 5A2MH 1RTKA 5A8YA 1P02A 1NM6A 4CREA 2P3TB 3LGYA 2BMGB 4JZFH 4ACBA 4BNRA 1QBVH 3Q3YA 5FPSA 4B2AA 2XC0A 3GY2A 1O2OA 3R3GB 4CHAB 1WQVH 2BD2A 2XBVA 4UFDH 4ZKRU 1GMDG 5T6GA 5L2ZH 1AFQB 1GI6A 1OYTH 1TNHA 2KZ4A 1Y59T 1VJ9U 4I8GA 3ZVFA 2B8OH 1XX9A 3PO1C 4X8UH 1NZQH 1AB9C 2BDYA 1NRRH 1TX8A 1GHAG 1QRXA 2ZDKA 2R9PA 3HK6B 3RXUA 3S0NA 1UW7A 5GCHF 4J1YA 4Q2KA 1QB1A 1YP9A 1GWAA 3LC3A 3FVFB 1K1LA 2GV7A 3G01A 2GMTB 4Q7ZA 3SHAH 1ZHMA 1PPEE 3A84A 1GI5A 1INCA 5DP3A 3ZYEA 1SVPA 4AB8A 2ASUB 1K1NA 1MD7A 1Z8IB 2ZHDA 1YCPK 1TRMA 3CNRA 2BD7A 3JZ1B 2CJIA 6LPRA 7KMEH 1C1PA 1SGCA 2FI5E 1EJMA 2UWPA 1Q31A 4I32A 1PQ7A 4FXGH 2XWBI 2O8LA 4CRDA 1P2OA 3KL6A 1TAWA 2H6MA 3A7ZA 2ZDLA 3Q00A 1S0RA 3UQVA 4TY7A 1HJAC 2PFEA 1LVYA 2HALA 1K1OA 4A7IB 1C2MA 4LZ1H 1C5RA 2F9OA 4UE7H 1G3BA 1AI8H 3FFGA 2HOBA 3ZZ9A 2VJ1A 3RP2A 1TE0A 4Q80A 3H7TA 1AHTH 1TLDA 4ABDA 2TBSA 3EDXB 4YOGA 1AU8A 2VNTA 1ZTJA 1DWDH 1T32A 5JYIA 1EASA 1P01A 3FZZA 2J4IA 2VGCC 5JBAS 4IMZA 1F7ZA 1OP2A 1J17T 2ZIQH 2BD5A 4KTSA 5EG4A 3TNSA 3OTPA 1TMTH 2FOGA 1P2MA 4JCNA 1GJ6A 1C5UA 5A8ZA 2PLXA 3SNEA 2FP7B 1V2RT 4FUHA 2I6SA 3SU0A 2A2XH 3M7UA 1N6XA 3RXLA 2A45B 2Q6DA 3B9FH 7ESTE 1E0FD 2BX3A 4FU9A 1VCPA 1JRTA 1SGTA 3SJIA 3MO3A 2HLDD 3FN8A 2BQ7B 5LGOA 1ZGIA 1O3AA 1WUNH 2P94A 3OY6U 1GJCB 3RXBA 2A2QH 4INKA 1O5FH 1GDQA 1COWD 1YWUA 1O3DA 5AFYH 2XNDD 4A1XA 1WQSA 1C5SA 1V2LT 3D49H 2HVYB 2HVXA 1D4PB 4I8LA 4ZHAA 4ZROA 4BTTB 1E79D 2F43B 4IS5A 1ESAA 2BVRH 5FBIA 4FUCA 4WXVA 1DSTA 4IMQA 8LPRA 1UTJA 2BD8A 3SOSA 2ZPRA 1SGQE 1AO5A 1NT1A 4ZXXH 3SU4A 7GCHF 2WSSD 1GPZA 5B6OA 5F6MA 1LMWB 2FYRA 1GDUA 1LQDB 3U8OH 3TJOA 3SU3A 4ZHLU 3OY5U 1EAWA 3ATIA 4Y8ZA 1YLCA 2UUFB 1O3CA 1OYQA 1W0ZU 4DGJA 1ZOMA 2TGPZ 1GL1A 1THRH 1N1LA 1H8HD 4TPIZ 1C5PA 2C4FH 3EAJA 3ATMA 1S6HA 2ZFSA 4GCHG 4AFUA 1GI2A 2FOCA 5JB9S 1GBFA 3K6YA 3N7DA 4D9QA 3MU4A 2VWOA 1W7XH 2HRVA 1AKSB 1G30B 3MI4A 2ZPQA 3UNRA 1OWHA 1YLNA 5C67A 6GCHF 5E2PA 1XUKA 4U32A 3RU4E 4ISLA 1O3PB 2GV6A 3U8RH 3CENA 2KAIB 1ELGA 1AVWA 4DY7B 1Z8JB 3SU5A 3SO3A 3BIUH 3NKKA 1EJAA 1GHWH 3UWJH 5KECA 2KX4A 1O3GA 5AHGH 3RXMA 1TPSA 1GBTA 1G3EA 1G32B 3DSGA 4DJZB 2BDCA 3O8RA 1GBJA 3S69A 4B73A 1J8AA 5EXLA 1FONA 4ZH8A 2HPPH 4ABJA 1W14U 2QF5A 5HM2A 4WXIA 2NU3E 1DOJA 2OC8A 1V2OT 2BDHA 1JIRA 1OWEA 3VB3A 1C9PA 1P3CA 2BLWA 4YESB 1ACBE 1MTSA 2J2UA 2XWAA 4QT8C 1FN6A 2JH6D 4O3TA 3RU4T 5BRRE 3LC5A 4OS6A 4CRBA 1C2HA 2NWNA 2FS8A 4FUBA 3SJKA 3E1XB 2Z9GA 3RM0H 1SOZA 2FS9A 2AGGX 4CBNA 3QO6A 5EPNA 3A81A 3KF2A 3VB6A 1IHSH 2BDAA 1SOTA 1GG6B 1ZMLA 2OBQA 1O5BB 4ASUD 3FKSD 2RFKC 1K2I1 2QCYA 2HWLB 4UDWH 1D3QB 1BBRH 5DP8A 4MQAA 1YGCH 1XVMA 1HAPH 2UUYA 5E0GA 1DX5M 5CHAB 3RU4D 3KQBA 1O38A 3VB4A 1UTQA 2EI6A 2FOMB 1GI9B 4WMDA 2BZAA 1C4U2 1MKXK 1D6WA 3TIUA 2ALPA 1F0RA 2F9VA 2ZA5A 4K8YA 2M5TA 1TPOA 2EI8A 4DURA 3SZNA 1GMCF 4TSFD 1G3DA 2FTLE 1O2LA 4U2WA 1QQ4A 4DIIH 2BVSH 3FP6E 2Z9LA 3TLOA 1LPKB 1C2LA 3C1KA 1KYNA 2PKSB 3W1EA 3F68H 1BHXF 1HDTH 1C1TA 2GT7A 2QF4A 1GVLA 2BY5X 3TNTA 4ABFA 2GCHF 1GL0E 1FPCH 2PTCE 2P93A 1F5KU 1T4UH 1P2QA 2AGEX 4WJG2 2BOKA 1WTHD 1EKBB 4LXBH 2IPQX 3MO6A 3HKIB 1P03A 3TH3H 1HBTH 1UCYH 3V0XA 4M7GA 2F4LA 3KYGA 1FDPA 3JZ2B 3MH6A 1SMFE 2QF0A 2GMTC 1KXDA 3LKWA 1C1MA 5FHTA 2WPIS 3RXPA 3U8TH 5K0HA 2C90B 5EQSA 3A85A 1YCPH 9LPRA 1U6QA 1QL8A 4DT7B 4ISOA 1GBIA 1MAXA 1TYNA 1TMBH 1F0UA 4KKDA 2Y82A 4IN1A 2VIDA 3DD2H 1HAXB 2Q6FA 1QJ7B 2WPDD 1KIGH 2KCPA 1AKSA 1EPTC 1O35A 2ZG0H 1P0SH 2Y6TA 4GHTA 4DT4A 1D9IA 1CT2E 1EX3A 1OHHD 3SW2B 2FZZA 3MTYA 1TA6A 2OINA 1AB9B 2HNTF 3MNBA 2KAIA 1PPHE 2Z7FE 1XMNB 2BY8X 3BTQE 1MBMA 1V2WT 4B6EA 1C1QA 2QAAA 1Y3VA 1G9IE 5DP4A 4M9FA 3SORA 1A0LA 2H5DA 3E6PH 2BM2A 1EB2A 1FMGA 1V2KT 4O3UA 1O2HA 4YO9A 2W3IA 3LJJA 5C17A 1O30A 2BDGA 2VH6A 2KFWA 4DVAU 2OK5A 3M3TA 3SHCH 3ZZAA 1GBDA 1KSNA 1SQOA 2QC2A 1H8IH 1AZ8A 2CV3A 2FOEA 3F9HA 1ABJH 1ZPZA 3MFJA 1BT7A 2F9UA 1F5RA 1BRCE 3PLBA 5DP6A 4ZKNU 1RTFB 3Q77A 1BRAA 1EFRD 1TRNA 5ETXA 2P8OC 2ULLA 1Y8TA 4A5TS 2R2MB 2BYAX 5BPEA 3RXJA 3F6UH 1TOMH 2LELA 4SGAE 1HJAB 2BOHB 1WYKA 4AC9A 2VIVA 3GCHC 1AE8H 4UFGH 1HAHH 4AORA 4MNWA 5DGJA 1F5LA 3L3TA 1OSSA 1TPPA 2K0QA 3M3SA 3SUEA 2VGCB 4I31A 1SGRE 1BIOA 1PQ8A 2Y5HA 3SV7A 1GJ4H 4E06H 3VB5A 2GCTC 2G5VA 4ZCNA 1YPEH 1ZTLA 2GGVB 4K69A 4OM9A 1P11E 1W0KD 2Z3DA 4XSKU 4P00A 1W12U 3STJA 2H9EH 2A4OA 2BDBA 1UVTH 2FXRA 3MH4A 3SNBA 3ZZDA 1ZPCA 2GZ9A 4A92A 1A3BH 4XOJA 1OKXA 3OAAD 3KN2A 4MPVA 1S85A 1UJ1A 3ZZ5A 3SJ8A 3ZZ7A 5A0CA 1Q2WA 2H5CA 1VZQH 4A1TA 4HG6A 3SGBE 3OEHD 4E7RG 1C1VH 1WV7H 3PWBA 2ZFFH 1XXFA 2A5IA 4ABEA 2P16A 1GJAB 1O5GH 1O31A 1C1OA 4RKJB 3WY8A 4IBLH 5CMXH 1BDAA 2AEIH 3Q3XA 1J9CH 1YYY1 3U1IB 4TYDA 3PTNA 5DP5A 1QIXB 1ANBA 1A5GH 3AAUA 1HFDA 3KYFA 3SNDA 1TX6A 3A82A 3I77A 3VB7A 1C2KA 2OD3B 3P8GA 4ACAA 2LNCA 5FPYA 1N6YA 4Z1MD 1V2JT 1WCZA 4F4OC 2ZEBA 1NY22 5A09A 1P12E 5DG6A 3L33A 1SKYE 2FESH 5C20A 1B5GH 3T25A 1FV9A 3UR6A 1O2QA 2NU1E 3PWCA 5L2YH 1MTNC 4KP0A 5FXLA 3ODFA 3TVJB 1GJ8B 2CMYA 2AIQA 5DO4H 3QTVH 2A7CA 3MWIU 2XNIA 2Z9JA 1C5XB 2G51A 3F0PA 4F55A 3ZVAA 1ABIH 3T29A 2VBCA 4ASHA 1H8DH 1OX1A 2FX4A 1BMNH 3CS7A 3NPSA 1UCYE 5KEDA 3URCA 4BTIB 2FEQH 1SGDE 4AFZA 1BJVA 4D8NA 2V7QD 3AAVA 1ESTA 1AD8H 1C4Y2 1GHXH 4D9RA 1DXWA 1C1WH 1UK3A 1OWIA 3RUOA 5CHAC 4IC6A 3S9AA 1BMMH 3M5OA 1O2IA 1XVOA 3H5CB 1MKXH 1IQEA 3SNAA 2XCFA 5C3NA 4FVDA 2QXJA 3PB1E 3TK5A 4FOUC 4X1NU 3PMJA 2QN5T 2BD3A 1FX0B 1A4WH 3EA8A 4RN6A 1BMAA 1PYTD 1O2NA 1SL3A 2V0BA 3EA7A 4OS1A 3FZDA 1DUAA 1TMUH 3EE0B 2XW9A 1YPGH 1F92A 1O2KA 2Y80A 3UTUH 2DE8A 1UTPA 1DS2E 2PSXA 5JBBS 4MTBA 2RG3A 1GI8B 4OGXA 1BMLA 1THSH 3KQDA 3LGVA 1PPBH 3ZVGA 2WINI 2Y81A 2WV5A 2WYGA 3V7TA 2A0QB 1EZSC 1UVUH 5HM9A 4Y11E 1H4WA 4AGJA 2BXUH 1ANEA 3A7VA 3BG4B 2RCEA 5EU8A 3BTDE 3GOVB 3TU7H 2V6NA 3SU2A 2SGQE 3URDA 1O36A 1TNLA 2FX6A 4YT7H 2JJ1D 1XUGA 2V3MA 5CDFE 1S5SA 1CSOE 3BG8A 1FAKH 8ESTE 1VR1H 5EQRA 2RDEA 1GBBA 1SGFG 1K0HA 1BTUA 2G8TA 2NU4E 2VIOA 1TGNA 3PM3A 4OGYA 1GHZA 2GD4B 3BTWE 1V2ST 2IN2A 2ZTZA 1HUTH 3LGUA 4X6PA 2THFB 2ODPA 4TY6A 2SGAA 3UB0A 3SV8A 5EW1H 1Y5AT 4NWKA 4KTCA 2Z6BD 3LGTA 1AZZA 1P2KA 1O32A 3E90B 1BJUA 3QGJA 1DICA 8GCHG 4X6NA 4GSOA 2XOKD 1XXDA 4BAOB 1UCYK 1HB0B 1EP5A 1GHBG 2B0FA 2CXVA 5IDKA 2FOFA 2VVVA 3QZQA 1GJBB 5F53A 1K21H 1YC0A 3GY8A 4YT6H 3U9AH 3QLPH 3ZVDA 1OWJA 3QUMP 3OTJE 1KXCA 2BQWB 3NXPA 1FQ3A 1CA0C 1WTGH 3ZVEA 2CHAC 2FPZA 3BTME 1LHCH 2JKHA 4Y6DA 2ZWLH 3E3TA 3GCTG 4I86A 1QZ8A 3BN9A 1EPTB 4YXWD 1LO6A 2FOHA 1TGSZ 3RXCA 1CHGA 5A8XA 1O3HA 3TPIZ 1D6RA 2QGRA 5F03A 1J14A 2ZHFH 3F0OA 4Y7AA 1G36A 3BEUA 2J92A 3W95A 1QJ1B 2AFQB 3LH1A 1EXFA 1IHTH 3QWCH 4HI3A 1RTLA 2IJD1 2PUQH 1ZRKA 1PJPA 4MPXA 3U69H 1LKAA 1SBWA 4H42U 1VITF 2FODA 5FPTA 3NCLA 1O34A 3B8JA 3BTGE 4BAHB 1T8MA 1C5LH 1O3NA 4A1VA 3S7KB 1L1GA 1YKTA 3M36A 2FYQA 2WV9A 1Y5UT 4AYVB 1IQFA 2EY4C 3O8BA 4RT0A 1SQAA 3SGAE 1S0QA 1TONA 4NGAH 2BLQA 1F2SE 4BAKB 2TIOA 2R2WU 2P8OB 2XTTB 4B6FA 1QL9A 1E1RD 2OC0A 1TQ7B 1AN1E 4BXWA 1GJ9B 3GCHB 1THPB 3FAOA 4OS5A 5L6NH 3PRBA 4E7NA 4P02A 2XBWA 4Q7XA 1UVOA 3RLWH 3F1SB 3STIA 1BHXB 1Z6JH 1EOJA 1S6LA 1WOFA 4X1QU 2UWLA 2GCTB 2WUCA 1N8OC 1MD8A 2O8UA 1E37B 1CT4E 1K1MA 1QJ6B 2OLGA 3GY7A 1ZHPA 1CE5A 3M61U 2B5TB 1VGCC 1AGJA 5FBEA 3H09A 1ZZZA 1NBME 4X0WU 2PWXA 1HJ9A 1O2PA 2W5EA 1O2UA 2QE7D 3TJNA 1Y3XA 4XE4A 1HGTH 2W26A 5T6DA 1MABB 1Z7KA 2TGDA 1AUJA 1C1NA 3SQHE 1FY4A 2H2ZA 1S81A 3WW7A 3HKJB 2R0LA 2K8IA 2TPIZ 3A87A 2YNAA 3TH4H 4AX9H 1AWFH 2JH0D 5GCHG 1BRUP 4JYVH 3PLPA 1A7SA 1RJXB 3MU8A 1XUIA 2A4GA 2H9TH 3VEQB 3UNQA 3SNCA 3S9CA 2OTVA 1SGIB 3P6ZB 5F8ZA 1HLTH 2J9NA 5DSFA 1P10A 5TCAA 2PSYA 2FI4E 1IAUA 1E35B 2XXLA 5PTPA 5JPMH 4K60A 5E8EH 4YLQH 2ZTYA 4I8KA 2VIWA 3KCGH 1MCTA 1SGEE 5ESBA 1LVMA 3M7TA 3U98H 3SV2H 6ESTA 1MTNB 3SU1A 1SR5C 1O2WA 2A4QA 1O0DH 1SG8B 2GP9B 2BD4A 3UY9A 4INLA 1ID5H 1EPTA 2G55A 1SQTA 5AF9H 4IW4E 3A86A 4WH8A 3NZIA 4ESTE 1NBMD 3A7TA 1GI1A 3UFAA 2W7SA 5EODA 1ZTKA 2ZGCA 1HPGA 2G5NA 5C5NA 3RXHA 5DPAA 3PROA 5LH8A 4BXSA 3RMNH 2O8MA 1MAYA 1IQHA 2KCYA 3K9XB 2VVCA 3BG4C 1Y5BT 1QRZA 4NIVA 4AYYB 1T8LA 5EJ1A 2BB4A 1MCVA 2BDIA 1WXRA 1B7XB 1FY3A 1QCPA 1NFWA 1TGCA 2WUBA 1Z6EA 3F2GA 1SSXA 5HKKD 1GI4A 1W8BH 1GCDA 1W3CA 5GNDA 2AMQA 1ARCA 3DSPA 4GUXA 1DY9A 2A5KA 2PP6A 2PW8H 3CP7A 7GCHG 1CT0E 2P59A 1TPAE 3A7YA 3E8LA 2ZHWH 1Z1JA 1S82A 2DE9A 1ETTH 1KDQB 1BCUH 3EE7A 2BD9A 1SGNE 1L4ZA 2V3OH 2BY7X 1NU9A 3DHKH 1BB0B 1GMHF 2ZZUH 4U30A 2IOTA 3M37A 1UTLM 1CVWH 1VKYA 4MVNA 1EB1H 2CGAA 2ZCKP 3GDVA 1C5WB 3A89A 3SV9A 4X1SU 1DSUA 1P3EA 3AW0A 1YF4A 5GDSH 3UWIA 4NSYA 1HXFH 4ISHH 1QFKH 1O3IA 2A5AA 2C8YB 1O5AB 3GY4A 1KMHB 3SI4H 6GCHG 1S84A 2C8ZB 1HXEH 4NZLA 1HNEE 3MQKC 2G52A 1LHFH 2VU8E 2SGFE 4ZKSU 3OYPA 1ZJDA 4NA9H 3TJVA 3F9EA 2BLOA 1TNIA 4Y71A 5HIZA 1A5IA 1V2TT 2BX4A 1TABE 1IQKA 3NK8A 2CF8H 1C2IA 2F9PA 4K3JA 3OU0A 3OX7U 3RXQA 1QQUA 5EXMA 2HGTH 4X2VA 3ZYDA 3V13A 1TNGA 3GISB 3KHVA 1LHEH 1ZSKA 2ZO3H 2FTMA 2ILNA 2ALVA 1TWXB 3NWUA 4XBDA 1O3MA 3S9BA 2D8WA 4X8VH 1DITH 4HTCH 4YM9A 1DT2A 1FIWA 1ZSJA 3HGPA 1H9LB 4GLYA 1ELFA 3ESTA 1V2VT 2GZ8A 5IYTA 1MKWK 1C4V2 1ETSH 1CA0B 1G2MA 2CHAB 1K1JA 1QB6A 4CR9A 2WPMS 3DT0H 2ZU4A 3RC6A 1SLUB 3SBKA 1GCTC 3PLKA 1L0ZA 1QTFA 2J98B 2HNTE 1JIMA 3QDZB 1SB1H 1UTNA 1ZSLA 4X2YA 1C5MD 2UUKB 1P9UA 1DXPA 2FIRH 3IWMA 4UD9H 2R3YA 4X1PU 2AH4X 1VCWA 2NU2E 4NWLA 2OC1A 3U28C 2ZC9H 3DA9B 3RXDA 1OP8A 1TNJA 4Y8YA 1X7AC 4MG3A 1AIXH 3A83A 4FUFA 5LPFA 2A4RA 2ANYA 1H9IE 1O2MA 1XKBC 5K7RA 1IQGA 1EZXC 4I33A 1EAIA 4OS2A 5LPRA 1AVGH 1DVAH 3IITA 2AGIX 2RA3A 3D62A 1GMCG 3IG6B 3I78A 1AWHB 1TRYA 4THNH 2KM0A 5FL7D 3M5LA 1OWDA 3VXEH 1SFQB 1FZZA 4CH2B 1ZYOA 3GDSA 1A3EH 4FETA 2ZF0H 2OUAA 2GCHG 2V3HH 1SHHB 1A46H 3PMAB 1YLDA 3RXTA 2Q1JA 1CHOF 2VB0A 9ESTA 3RXGA 1UHBB 1AVXA 3RXSA 1JOUB 3NUMA 2PTNA 4Z0KA 2JDID 1QA7A 3DFLA 1O2ZA 1C9TA 3LU9B 1KDQA 4X2XA 1RS0A 1SGFA 2VH0A 1HAIH 3ZZCA 3I29A 2HNTC 2YMSC 2ODYB 1GMDF 2D1JA 3LH3A 1D3PB 1N8OB 4CRFA 2JJ2D 2FWWA 1QA0A 1TA2A 3QGNB 2GT8A 1ETRH 4WMFA 4D7GA 4NIYA 1FY1A 3H7OA 1VGCB 4X2WA 2D2DA 4DOQA 2EI7A
chains in the Genus database with same CATH topology
3TGJE 1TBRH 2SGDE 5HGGA 2FMJA 3M7QA 5JBTA 2V35A 2HLCA 1GHAF 1GBEA 3ATKA 5GPIB 1M9UA 4BOHA 3TGIE 2F83A 2J95A 2O8WA 3ITIA 1CA8B 1G37A 1VCQA 2Y7XA 4IGDA 1DLKB 4O03A 6CHAC 4CRGA 1GGDB 1QY6A 2A31A 1WAYB 3BF6H 3FP7E 1FJSA 1ZMJA 1O2JA 2FI3E 3BTEE 3M35A 3RXRA 1TBQH 2D26C 2ZP0H 4FU7A 3P8NA 5A0AE 1K1PA 1O33A 3TJUA 2XC4A 1YPHE 4Y7BA 4MLFB 5ABWA 1K1IA 3VXFH 1VITH 1O2TA 2ZTXA 1O5EH 4X8TH 1GJ7B 3GY3A 1EOLA 1BTXA 1C5TA 3UR9A 1HAOH 2GX4A 3SU6A 5EXNA 1XUJA 1AY6H 1O5CB 1UVPA 2QYIA 2SGEE 1QGFA 5E0JA 4ZUHA 1V2QT 1CBWC 1CU1A 5CE1A 4WMEA 1A0JA 1JMOH 2ODQA 4ZXYH 1ZJKA 4NIXA 3ATWA 4D76A 1FNIA 4TPYA 3ODDA 5FCKA 1O3BA 2AS9A 2RA0A 1TB6H 2WPHS 1MQ6A 2XRCA 2OXSA 4AN7A 1NS3A 5SGAE 1SFIA 1ANCA 1IOEA 1V2NT 4ZAEA 2VWLA 3MU5A 1UTOA 1QURH 3HATH 1C2EA 1EATA 5HXFA 4LZ4B 2STAE 2Z9KA 4IC5A 1RRKA 2VWMA 2ESTE 1TNKA 5FCRA 2AYWA 1IQNA 3GYMA 1O37A 1MU8B 1GDNA 3MHWU 4YOJA 3UREA 4GHQA 4NIWA 4ZMAH 3RLYH 4K1SA 1KLJH 5EW2H 1Z8GA 1A0HB 2WPKS 1O2SA 2ZDNA 4Z6AH 4BTUB 1YPHC 1ZMNA 1MTWA 3E16B 2ANKH 2ZDAH 3UUZA 3UOPA 1FN8A 1GBLA 1MU6B 1GVZA 5EPYA 3SJOA 1ELAA 3P95A 2F9BH 1FLEE 2XBYA 4ABHA 5FX5A 4JYTA 4AFQA 3O8DA 3HPTB 3LOXA 3LJOA 2QXGA 2CF9H 3TK6A 2BZ6H 4K2YA 2ZFRH 4CRCA 1O2XA 4Y8XA 4UONA 2J34A 1UHBA 4Q7YA 4ZHMU 1DM4B 1NROH 2C3SA 2Y7ZA 4GVUA 1KXEA 4GCHF 3BTHE 3AASA 4LOYH 1JRSA 2EA3A 3P92A 1GBMA 1J15A 1UK2A 1Z71A 1SGPE 1NO9H 2OBOA 1ELDE 1JWTA 1GI7B 3SN8A 3W94A 3TGKE 2AIPA 1LVBA 1FIZA 3LGWA 1AMHA 4RSPA 1YPJH 1MUEB 4NA7A 1OWKA 1MKWH 2ZFTA 4K1EA 3PMBB 3MU1A 4NA8A 1NRNH 1TGTA 4NG9H 2ZHQH 1O5DH 3AVZA 1LCYA 2TGAA 3EYDA 1BQYA 2ZNKH 1MBQA 2PGQB 4PROA 2Z3EA 3UIRA 2QY0B 2XBXA 3MU0A 4JZIA 1AQ7A 1SHYA 1WBGB 2ZCHP 4CRAA 3F9GA 2ZU2A 1PQ5A 3E0NB 4FVBA 5HMAA 3A8DA 1S83A 2A32A 4H6SB 1P06A 3FANA 4OS7A 1SLVB 1WU1A 4X6OA 1DUEA 3GCOA 3EA9A 1O3JA 1Q3XA 2P3UB 2PKAB 1T31A 4JZDH 2PUXB 3MMGA 1EP6A 4Y0YE 2ZU1A 1BTZA 3A88A 4WY3A 2BHGA 1OP0A 5G4BA 2ZKSA 3RXKA 1ZPBA 2BVXH 1NESE 2FOAA 2OC7A 1KLIH 4CR5A 1XUHA 5EQQA 4U01A 5C5OA 1O2GH 1D3TB 3P17H 3BEIB 2VIQA 3TK9A 2F3CE 2VVUA 3SUGA 1RIWC 1W7GH 4YZUA 1GJDB 5C1YA 1NFYA 2Z94A 4VGCB 1NPMA 1RGQA 4GAWA 3RXVA 2GVFA 1GCTB 1NFXA 2YOLA 4Y10E 1P2IA 1SPJA 2ZQ2A 2GDEH 1XKAC 3MOCA 2K1QA 2W7UA 3GY5A 3M3VA 4WH6A 1LHDH 3U1JB 4IN2A 1OPHB 4ZKOU 3RC5A 3ZZ4A 3UPEA 1NRQH 1BITA 1NU7B 1P04A 3BTTE 3M5MA 4JMYA 4BANB 1MH0A 1C5NH 3VGCC 4JYUH 2TRMA 3QX5H 1LPZB 3A8CA 5ESTE 4MPWA 5F8TA 4FUIA 3TITA 1XM1A 5FAHA 1T8OA 3A80A 1QL7A 1HAGE 3PMHB 1PPFE 1Y3WA 1O2YA 1UVSH 3LT3A 4ISNA 1ELTA 4MDSA 2BXTH 1HYLA 1UO6A 3K2UA 1RXPA 1C1UH 3PTBA 3SV6A 4J2YB 2QF3A 3MH5A 3B23B 4UEHH 4UFFH 4OS4A 1PFXC 1LQEA 1PPZA 5DJ7A 3GDUA 1KXBA 4Y76A 4AZ2B 1V2UT 5TJXA 2R3UA 2JETC 3RXOA 1DPOA 1T7CA 4HZHA 3L6PA 1EUFA 3BTKE 2P3FH 1S6FA 1GGDC 1GBHA 1LVOA 1W0YH 1BOQA 1P8VC 3GCNA 4FUEA 5T6FA 5E2OA 3TH2H 5C1XA 1KTTB 2IPHA 1QR3E 1CGIE 1MZDA 1HAZB 3RXFA 3S7HB 3QK1A 3HGNA 3AW1A 4NSVA 2H1UA 4YLUA 4KELA 1UK4A 2Z3CA 2VWNA 5I46H 3ZV8A 1MTUA 4XDEA 5J4SA 5AFZH 4B74A 1CQQA 5F8XA 1MQ5A 2B7DH 1OOKB 1FXYA 2Y5FA 4R8TB 4LK4A 4I8HA 4A6LA 3MYWA 1A5HA 1C5VA 1GBAA 2PV9B 1FY5A 1LKBA 3F9FA 3BSQA 5JB8S 1K9OE 5A0BA 2LPRA 2QA9E 2SFAA 1QRWA 3P70B 5C2ZA 3SUDA 1L1JA 2A7JA 1QNJA 4HGCA 1DE7H 1TIOA 6CHAB 4F49A 3V3MA 2WYJA 2ZGBH 3PV4A 1P05A 2QXIA 4WF8A 1BTYA 1C1RA 1CO7E 5TCCA 1JXPA 4Y0ZE 1VITG 1O3KA 1V2MT 2ZU3A 2B9LA 1ORFA 4SGBE 1QHRB 1Z1IA 2RDLA 2PKAA 3BIVH 1BTWA 2FO9A 1P9SA 1GHVH 8KME2 1HIAB 1LPGB 4YTAA 3A7WA 4ABAA 1GI3A 1A1RA 1BTHH 1V6DA 4B71A 3RC4A 3VFEA 1HCGA 2HPQH 4AB9A 3LDXH 3EGKH 1FI8A 2Z9IA 4TWYA 1CBWB 1HAYB 4K5ZA 1T4VH 1C2JA 4DIHH 2BLVA 1ZHRA 4XFQA 3SUFA 3LONA 3V12A 1AE5A 5AVDA 1TOCB 2ZFQH 1C5YB 1KY9A 3T27A 4AOQA 4X1RU 2ZQ1A 4H6TA 5H4IB 2ZFPH 2UUJB 3ZZ6A 1SC8U 3BTFE 1EZQA 2J94A 4JK5A 3MH7A 5DP9A 4CHAC 1H1BA 1P2NA 2C8XB 4B2CA 4AG2A 1TQ0B 4AGKA 1AFQC 4D7FA 1ESBA 3T28A 3UQOA 2BQ6B 2SNVA 2ZHEH 1O3LA 2F9NA 1CGJE 3LPRA 2J38A 1WSSH 1IQIA 1GI0A 1O3FA 3KQEA 3RDZA 4NFEA 1NC6A 4X8SH 1O39A 3Q76A 1ZGVA 4I8JA 2BY9X 1W13U 1XUFA 1PQAA 4JK6A 2OQUA 2O9QA 4MNXA 1QB9A 2O8TA 2W3KA 3VPKA 1SLWB 1P2JA 4O9VA 3MNSA 3MNXA 3MO9A 1AFEH 4CBOA 3D65E 2Q6GA 4FUDA 1ANDA 4B1TA 2YNBA 2ZGJA 3D23A 5GJ4B 1KTSB 3R0FA 1YM0A 3ATLA 1LHGH 2GZ7A 1NRSH 4YOIA 2ZGXH 1GBKA 4NFFA 1YPMH 1TGBA 2WV4A 1NN6A 1F0TA 3CS0A 1BRBE 4MNVA 1E38B 1L4DA 1A61H 2C93B 2P95A 1AUTC 2WPLS 5HYOA 4H4FA 4WWYA 1G2LA 4BAQB 3RXAA 3PO1B 1FUJA 1YCPM 4KGAA 2H9HA 2F91A 1O3OA 3DFJA 2FDAA 1YPLH 2XYAA 4JZEH 5T3HA 4K8BA 2OQ5A 1FY8E 3T2NA 3A8BA 4B75A 2ANMH 1O2VA 1LDTT 2FLRH 1W10U 4INHA 4B2BA 3T26A 4XBCA 4CH8B 1Z8RA 4VGCC 3SJ9A 4HFPB 2FOBA 2QV1A 1NFUA 2XC5A 3KGPA 1KXAA 3K6ZA 3RXIA 1C5QA 1NRPH 1FPHH 1SI5H 1TX7A 1B0FA 2EC9H 4FUJA 4DW2U 3RMMH 3ZVBA 1OXGA 1EJNA 3Q3KA 1L2EA 2OCVB 4E05H 1OS8A 2QXHA 3K65B 1TALA 1DWCH 1HAVB 1C2DA 3EQ0H 1BZXE 2SGPE 4TWWA 1BTPA 2AMPA 4NCYA 1J16A 1MZAA 3P8OA 4MPUA 1ZLRA 3ELAH 2Y5GA 1E36B 2AERH 4MNYA 1HIAA 4WVPE 5EOKA 3T5FH 1YBWA 3ZVCA 1MMJN 1UTMA 4RKOB 1SLXB 1H9HE 4Y79A 4KTUA 1TFXA 2G00A 1C1SA 3MNCA 4B76A 1ELBA 2JH5D 1RIWB 1E34B 3M5NA 4GPGA 1KLTA 3GY6A 1RFNA 1GBCA 3QN7A 3UNSA 1EZUC 1IQLA 1HRTH 3C27B 2ZDMA 2R0KA 1DWEH 1PPGE 2I6QA 3KIDU 1Y3UA 2ZECA 1W2KH 2G81E 2ZCLP 1QBOA 2IJOB 2OP9A 1C5OH 5EGMA 3QZRA 1GMHG 4JZ1A 1ELEE 3GYLB 4ABBA 1HJ8A 1LTOA 1JBUH 2FLBH 2GDDA 2PHBA 3E91A 3P8FA 3DUXH 3VGCB 5JDUB 3HK3B 1GJ5H 1C5ZB 1DWBH 2BTCE 3ZZ8A 1BBRE 1VJAU 1O3EA 4ABGA 1QBNA 1V2PT 8GCHF 2A1DB 2TGTA 3SQEE 5J4QA 1GHYH 1NTPA 1DDJA 1BA8B 2C8WB 3FP8E 5E0HA 2JETB 3A7XA 2ZI2H 4I7YH 1ZRBA 1GHBF 4FUGA 1UMAH 3KQCA 1P09A 4DG4A 4K1TA 2CN0H 2G4UA 5C1UA 4ISIH 5DP7A 5GXPA 2ANWA 4O97A 4XBBA 3RXEA 1O2RA 1EAXA 1V3XA 1PPCE 1A2CH 3GCTF 1ARBA 1YPKH 1C2FA 5L30H 1DFPA 1ELVA 2WPJS 4UFEH 3RMLH 4FU8A 3BEFB 2XCNA 7LPRA 1F0SA 1SGYE 3KEEA 2STBE 1ELCA 2VIPA 3RMOH 3E0PB 1GG6C 1UTKA 4AFSA 3T62A 1RD3B 2ZGHA 3QTOH 1G3CA 4DCDA 3LIWA 2ZPSA 1IQMA 1L1NA 5FX6A 1TBZH 3PYHA 1P57B 2EEKA 5DKMA 1DY8A 1EAUA 1C2GA 1K28D 1IQJA 3RM2H 2QIQA 4NZQA 2DUCA 3UOUA 1ZR0A 3O8CA 2ZU5A 1FAXA 1MTVA 3ENSB 2GKVE 1PYTC 4R0IA 4AG1A 3ZZBA 3SGQE 3SI3H 2BY6X 5JBCS 2PGBB 1T8NA 1DLEA 2PKSC 3ZV9A 1Y3YA 1HAVA 2FM2A 3OSYA 5DK1A 1KXFA 2AMDA 4X6MA 1CGHA 1W11U 2PR3A 1D3DB 5GWZA 2ZDVH 2UWOA 1GVKB 2NU0E 3ZZ3A 3KNXA 3A8AA 1DANH 4BAMB 1B0EA 1K22H 1EQ9A 2G4TA 1BUIA 2A7HA 1BBRK 5LPEA 1CHOG 5I25A 2GTBA 3BV9B 3LGIA 3N7OA 4ABIA 5GIBA 2SNWA 3GICB 1HV7A 2VINA 5A2MH 1RTKA 5A8YA 1P02A 1NM6A 4CREA 2P3TB 3LGYA 2BMGB 4JZFH 4BNRA 1QBVH 3Q3YA 5FPSA 4B2AA 2XC0A 3GY2A 1O2OA 3R3GB 4CHAB 1WQVH 2BD2A 2XBVA 4UFDH 4ZKRU 1GMDG 5T6GA 5L2ZH 1AFQB 1GI6A 1OYTH 1TNHA 1Y59T 1VJ9U 4I8GA 3ZVFA 2B8OH 1XX9A 3PO1C 4X8UH 1NZQH 1AB9C 2BDYA 1NRRH 1TX8A 1GHAG 1QRXA 2ZDKA 2R9PA 3HK6B 3RXUA 3S0NA 5GCHF 4J1YA 4Q2KA 1QB1A 1YP9A 1GWAA 3LC3A 3FVFB 1K1LA 2GV7A 3G01A 2GMTB 4Q7ZA 3SHAH 1ZHMA 1PPEE 3A84A 1GI5A 1INCA 5DP3A 3ZYEA 1SVPA 4AB8A 2ASUB 1K1NA 1MD7A 1Z8IB 2ZHDA 1YCPK 1TRMA 2BD7A 3JZ1B 2CJIA 6LPRA 7KMEH 1C1PA 1SGCA 2FI5E 1EJMA 2UWPA 1Q31A 4I32A 1PQ7A 4FXGH 2XWBI 2O8LA 4CRDA 1P2OA 3KL6A 1TAWA 2H6MA 3A7ZA 2ZDLA 3Q00A 1S0RA 3UQVA 4TY7A 1HJAC 2PFEA 1LVYA 2HALA 1K1OA 4A7IB 1C2MA 4LZ1H 1C5RA 2F9OA 4UE7H 1G3BA 1AI8H 3FFGA 2HOBA 3ZZ9A 2VJ1A 3RP2A 1TE0A 4Q80A 3H7TA 1AHTH 1TLDA 4ABDA 2TBSA 3EDXB 4YOGA 1AU8A 2VNTA 1ZTJA 1DWDH 1T32A 5JYIA 1EASA 1P01A 3FZZA 2J4IA 2VGCC 5JBAS 4IMZA 1F7ZA 1OP2A 1J17T 2ZIQH 2BD5A 4KTSA 5EG4A 3TNSA 1TMTH 2FOGA 1P2MA 4JCNA 1GJ6A 1C5UA 5A8ZA 2PLXA 3SNEA 2FP7B 1V2RT 4FUHA 2I6SA 3SU0A 2A2XH 3M7UA 1N6XA 3RXLA 2A45B 2Q6DA 3B9FH 7ESTE 1E0FD 2BX3A 4FU9A 1VCPA 1JRTA 1SGTA 3SJIA 3MO3A 2BQ7B 5LGOA 1ZGIA 1O3AA 1WUNH 2P94A 3OY6U 1GJCB 3RXBA 2A2QH 4INKA 1O5FH 1GDQA 5AFYH 1O3DA 4A1XA 1WQSA 1C5SA 1V2LT 3D49H 2HVXA 1D4PB 4I8LA 4ZHAA 4ZROA 4BTTB 4IS5A 1ESAA 2BVRH 5FBIA 4FUCA 4WXVA 1DSTA 4IMQA 8LPRA 1UTJA 2BD8A 3SOSA 2ZPRA 1SGQE 1AO5A 1NT1A 4ZXXH 3SU4A 7GCHF 1GPZA 5B6OA 5F6MA 1LMWB 2FYRA 1GDUA 1LQDB 3U8OH 3TJOA 3SU3A 4ZHLU 3OY5U 1EAWA 3ATIA 4Y8ZA 1YLCA 2UUFB 1O3CA 1OYQA 1W0ZU 4DGJA