1AO5A

Mouse glandular kallikrein-13 (prorenin converting enzyme)
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
237
structure length
236
Chain Sequence
VVGGFNCEKNSQPWQVAVYYQKEHICGGVLLDRNWVLTAAHCYVDQYEVWLGKNKLFQEEPSAQHRLVSKSFPHPGFNMSLLMLQTIPPGADFSDDLMLLRLSKPADITDVVKPIALPTKEPKPGSKCLASGWGSITPTWQKPDDLQCVFITLLPNENCAKVYLQKVTDVMLCAGEMGGGKDTCRDDSGGPLICDGILQGTTSYGPVPCGKPGVPAIYTNLIKFNSWIKDTMMKNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the mouse glandular kallikrein-13 (prorenin converting enzyme)
pubmed rcsb
molecule tags Serine protease
molecule keywords GLANDULAR KALLIKREIN-13
total genus 54
structure length 236
sequence length 237
chains with identical sequence B
ec nomenclature ec 3.4.21.119: Kallikrein 13.
pdb deposition date 1997-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ao5A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ao5A01
4U01A 1T31A 2G5NA 1GCTB 1TALA 4INLA 2W3IA 4X6OA 5T6FA 1BTWA 4JYTA 2C8WB 2BOHB 1ELDE 5EQSA 3SQHE 3UR6A 3NXPA 3LGUA 1FZZA 4NSVA 4X8SH 1ZLRA 5F8ZA 1UK3A 2QN5T 3UOPA 4I8GA 4OGXA 3STJA 3TNTA 1DS2E 1O2ZA 2OCVB 2XCFA 4GCHG 3RXBA 2VJ1A 4KP0A 3S7HB 5FXLA 2BLQA 3K6ZA 4Z0KA 3RXJA 1O2SA 1W13U 4Y6DA 3SZNA 4ZXXH 2BMGB 1N8OC 3URCA 1O5EH 1VZQH 3ATIA 4CBOA 3RU4T 2G52A 2GD4B 1CGIE 3ATWA 3EQ0H 1GL0E 1EPTC 1ELFA 1NU9A 3LC5A 2O9QA 2C8XB 5K0HA 2BY9X 5C3NA 1MZAA 2R0LA 4ABDA 5B6OA 1GI1A 4R0IA 1NFXA 1C1NA 1EXFA 1MH0A 1K1PA 5BRRE 3OTJE 3U1IB 4D76A 4MPVA 3A81A 1O3AA 1BITA 5FX5A 4ZKRU 1IQHA 1K22H 1GHWH 4AX9H 5DP8A 2H9HA 1G32B 1GHAF 2BQ7B 3SJ8A 1EAIA 1RIWC 2ZHQH 3SGQE 2VH0A 4MPXA 1O3BA 1HAXB 1NRRH 3LONA 3GCOA 1FY4A 3RC4A 3EDXB 1C4U2 2AMDA 2Y5HA 2GVFA 1LVMA 5LH8A 1Z6JH 2H5DA 1DWEH 2J9NA 3RUOA 4BTTB 2BD7A 2ZC9H 1S84A 1TAWA 3UNRA 3TVJB 2FYQA 1O2UA 3F9HA 1VGCC 1OWJA 8KME2 2PUXB 3AW1A 1UTLM 3FAOA 4JYUH 5IDKA 4WH6A 4BANB 5AFYH 2Z3EA 2XC4A 2UWLA 3E0NB 1NM6A 4GAWA 1SHHB 2BZAA 3RP2A 1A5HA 2FP7B 1G3BA 1ACBE 3M5NA 1HAZB 2VB0A 1P06A 1SG8B 1ZPBA 5FPSA 1UVSH 3GY8A 3MO3A 2C90B 2EI6A 3BTME 1TGNA 3UTUH 3KQEA 4D7GA 1F0SA 1Z8IB 4YO9A 2B0FA 4TWWA 1P10A 2AS9A 2ILNA 1QFKH 1GVZA 2A31A 1FN6A 4J1YA 2SGAA 3ATKA 1S6FA 2ZKSA 5EQRA 1WSSH 1RIWB 3CENA 1FONA 5AF9H 3B9FH 1BZXE 2ZTYA 1P9UA 2P8OB 1KLTA 1TX6A 1TRYA 2ZPSA 2G4UA 2HLCA 1GG6B 3DFJA 3RXGA 1GHYH 1GBJA 1HFDA 1DLKB 3GY7A 1C1SA 2PV9B 1OWHA 2XRCA 4CHAC 2BY8X 2GT7A 5ESBA 3F9EA 1AFQC 1C4V2 4RN6A 2F9PA 1GBDA 1S85A 4I8JA 4X1NU 3H5CB 3PO1B 1MTUA 1O3FA 3T62A 4XBDA 1BJVA 1O35A 1QJ7B 2F3CE 1W0YH 2BOKA 1TX7A 1YPGH 5DPAA 1BB0B 1O34A 1BUIA 2ANKH 4MPUA 1ZJKA 4ASHA 4Y8YA 3BV9B 2A45B 2QGRA 5ETXA 3F1SB 2BYAX 1C1WH 1LQEA 4YLUA 1HIAA 1HBTH 1O2HA 1LCYA 4I8LA 4I32A 2F9UA 1O2LA 1V2RT 1DANH 1BOQA 1IQFA 3QDZB 1W3CA 1GBKA 4ZKOU 5GJ4B 1O0DH 1O2QA 2J2UA 1V2VT 2ZGXH 5HM2A 1VJAU 4GUXA 1T32A 4JK6A 2HPPH 1EJMA 4VGCB 8GCHF 1MQ5A 2VNTA 3AASA 2B5TB 2OP9A 1O3IA 2NU1E 3RXQA 2ZI2H 4B2AA 4YLQH 4BXWA 1FPHH 4DOQA 2BM2A 3GCHB 1QA7A 1A7SA 1E0FD 1K28D 3FFGA 3LJJA 3QTOH 3ZVBA 4CBNA 2FOMB 1BHXF 1ZPCA 4RKJB 5EW1H 3MU8A 3PMJA 3P70B 4IBLH 2XCNA 1OOKB 3GCNA 4PROA 2XBXA 1ZJDA 2FDAA 3A88A 5E2OA 4IN1A 1C2GA 4ZHLU 1GBEA 2EEKA 1JMOH 3I77A 3GDUA 3TH4H 1F5KU 2BXTH 3M5OA 2GMTB 4X1RU 5DKMA 1V2PT 1QCPA 1IQMA 2XC0A 3BTQE 1Z8GA 8LPRA 1BTUA 3BTTE 4DW2U 1UTMA 1KDQB 4MNYA 4TYDA 5E2PA 3BF6H 3TU7H 5IYTA 1OP2A 1WAYB 9ESTA 1LPKB 2THFB 2VIQA 3SU4A 1SI5H 5J4QA 4IGDA 4CRAA 1HNEE 4NA9H 1TA6A 1AWFH 3K9XB 5GCHG 3RDZA 1C5RA 3LGVA 4GSOA 2Y81A 1QRWA 2C8YB 4MQAA 1C1OA 3NK8A 4XE4A 2OUAA 1YCPM 4ISLA 2Y82A 1CE5A 2FI4E 4ISIH 3BG4B 1EB1H 1O3HA 2TGDA 4K2YA 2TGTA 4GLYA 1HYLA 1SHYA 4YESB 1JBUH 4ABGA 4D9QA 1TGSZ 3D62A 2BD5A 2FI3E 3VFEA 2P3UB 3MNSA 1G30B 1L0ZA 3SJKA 1XVOA 2ANMH 1ZSKA 1C2JA 2O8LA 2FS8A 1BMAA 1YPLH 2Y6TA 4YM9A 3E0PB 4XSKU 1Y5AT 5J4SA 1OP0A 4I7YH 5JBBS 5PTPA 3VB4A 3TJVA 2TPIZ 4CRCA 2ZTZA 1UO6A 2BZ6H 2A2QH 1A0HB 1ETRH 3L33A 4GCHF 3ZZ3A 2WUBA 3ODFA 2OC8A 5DG6A 1D9IA 3KQDA 3SU0A 2OBOA 2EA3A 2P93A 2ZFFH 1BDAA 4CRDA 1Z7KA 3STIA 3SJ9A 1BBRH 5AVDA 4Q7XA 2RCEA 3EE0B 1P9SA 3MU0A 1HJ9A 4NZQA 3BEUA 3UWIA 1ORFA 1P2MA 4JZIA 1BRAA 1FQ3A 1AUTC 1ANDA 1O32A 3S69A 4TPIZ 3BTEE 3RXLA 1RTLA 1DVAH 1GGDC 5DP9A 3RMLH 3ZYDA 3OY5U 1CA0B 3OY6U 3SJIA 3UNSA 3DUXH 3GDSA 4NFEA 3SNDA 5K7RA 4ESTE 3ATLA 2H2ZA 2ANYA 2OLGA 2WPMS 4QT8C 2XTTB 5FCKA 3ESTA 8GCHG 3SNCA 5I46H 1V3XA 1A5GH 4X2XA 4CRGA 1DWDH 1XXDA 1C2HA 3ZZ4A 1FAXA 4JZEH 1GBTA 3DA9B 1LKAA 1HB0B 2R9PA 2SGDE 1V2TT 1SBWA 3NKKA 4NSYA 1DSUA 1DICA 5GDSH 1XMNB 1EPTB 1QA0A 3BEIB 2ZQ1A 1O5DH 4NIYA 1QB9A 1C1MA 3MU4A 3P6ZB 1DLEA 1DWCH 1MBMA 1SMFE 2AGIX 1GPZA 5F6MA 3PROA 1ZZZA 1CHOF 2IOTA 4GVUA 1KLJH 1O3EA 1J9CH 1YLDA 1ANBA 3D65E 1FPCH 1BCUH 3HGNA 2OBQA 3K2UA 4WH8A 2HALA 4GHTA 1GJDB 4K60A 4K8YA 4AFQA 2ZFSA 1HPGA 4B74A 3VEQB 3HK3B 2WYJA 1ZHRA 2FOGA 2J92A 1O2XA 1WTHD 1C4Y2 2ZG0H 2O8UA 3W95A 3TH2H 1G2MA 1RRKA 1EPTA 1TOMH 1T4UH 4K69A 2BB4A 3QZRA 2GT8A 5A8XA 5E8EH 2ZFQH 3MH5A 1VCQA 1EZQA 1O5FH 1WOFA 3PMAB 3EAJA 4X0WU 1ESBA 3QN7A 3BTWE 2GDEH 2DUCA 1Y5BT 1EP5A 3SHAH 3LC3A 1NC6A 3PWBA 1D3PB 3E91A 1GI8B 3SUGA 2FOBA 4NFFA 3ZVDA 1QHRB 1UTKA 2ZTXA 3M61U 2PKSC 1ZTKA 3H7TA 1EZUC 2QYIA 3M5MA 3HKIB 3VB3A 4XBCA 3GY3A 3ZZ7A 1A1RA 4BAOB 1O3KA 1GMDG 1O2PA 1D4PB 4JK5A 1TGCA 1CU1A 2UUJB 1HJAC 1W10U 2H1UA 4ISNA 2QV1A 1WU1A 4OS1A 3RXFA 1DE7H 4DIHH 2W7SA 1MAXA 1L1GA 5EQQA 2GDDA 5AFZH 1C5VA 3P8FA 1KTTB 4WF8A 3IG6B 4IMQA 3RXVA 1TNGA 4Y11E 2OINA 1ESAA 1ARBA 1D3TB 1TABE 1GHBF 2Z9LA 1JWTA 1GJAB 1EB2A 6ESTA 2Y80A 1YPJH 4GPGA 1SOTA 1OYTH 1TPSA 5EPNA 2JH0D 3MYWA 2P3FH 4LOYH 1KXCA 1P2OA 4X1QU 1OWIA 1SL3A 3VPKA 1UCYH 1GJ9B 4ZUHA 3LGYA 1G3EA 4ZHMU 4E7NA 2TBSA 4DY7B 1GJ8B 1TBRH 3PMHB 1LHGH 1MCTA 1EUFA 1P0SH 1GBLA 1WCZA 1BBRK 5EXMA 2ZZUH 2FX4A 1ZHMA 3PB1E 1SQOA 3M5LA 1ANEA 1A3EH 3SO3A 4H4FA 1MCVA 1YM0A 3F9FA 5GPIB 3T28A 1G3CA 5E0HA 1SGYE 1EP6A 2BDBA 4I31A 4BAMB 2FM2A 1JIRA 1MKXH 2VIVA 1ELAA 4K8BA 4VGCC 2NU3E 3SORA 3SUFA 4X2WA 3RXUA 5TCAA 1QL7A 3S9AA 2GZ7A 1K1LA 1M9UA 3A8CA 3A84A 3KF2A 2OD3B 4B76A 1O3NA 1QJ1B 2WPJS 1DY8A 2M5TA 1AY6H 4MVNA 2WPHS 2ZECA 3FP8E 1SGEE 2CF8H 4BOHA 1MKWH 2K1QA 4UFDH 3UOUA 2W7UA 1AVWA 4Y8XA 2FLRH 4CREA 1YGCH 2J34A 2HPQH 3D49H 1C5YB 4OS7A 1C5QA 2QC2A 1WV7H 3E16B 1BA8B 2JH6D 3UY9A 1V2NT 1NTPA 3Q3YA 1UJ1A 1UVTH 2BD2A 4I8HA 2BQ6B 1K1JA 5LGOA 2IJOB 1QGFA 1Y3UA 1O2YA 1P09A 4YT7H 2SGFE 3ZZ6A 1J8AA 2ZDAH 3QO6A 1AUJA 1UHBA 4AB9A 4ISHH 3KNXA 2PW8H 3GY4A 3ATMA 4O97A 5DJ7A 1LMWB 2BD4A 4FU7A 3SUDA 7ESTE 4AGKA 2STBE 4MNVA 3DD2H 2VU8E 2ZHDA 5EG4A 2AYWA 2ASUB 2IPHA 2C93B 3RXKA 3ODDA 3NUMA 3TITA 1MZDA 4YOGA 1FIZA 4X2VA 1C5XB 1C1QA 3HGPA 3OSYA 2EI7A 1O3MA 3IITA 1C1RA 1O2MA 1FI8A 1F5LA 4IN2A 1UTNA 1W14U 1WQVH 3MH4A 2WPLS 3IWMA 2Z9KA 5CMXH 4DG4A 1DXPA 3RXEA 1EQ9A 1ZHPA 4OS2A 4GHQA 3V12A 1GI3A 2ZIQH 1C5NH 1ELVA 1MQ6A 3LGWA 1J17T 5FCRA 2HGTH 1P12E 3SI3H 4ABBA 3RM2H 1SGDE 4M7GA 1BTYA 4Y0ZE 1V2WT 1C2EA 3RC5A 1A5IA 2PKAB 3M7QA 3A82A 1C2LA 4ZXYH 1ESTA 1E35B 1TX8A 4ZH8A 3RLWH 3UIRA 1KXFA 5DK1A 4FUCA 1AE5A 1AB9B 1SGQE 1MUEB 2FOEA 2C3SA 1GWAA 4Y79A 2A5AA 1AB9C 4MNWA 1PYTD 1A61H 5AHGH 2C8ZB 1F0UA 2BDGA 1OWEA 2FMJA 2A5KA 4UEHH 3FZDA 5T6GA 3A7VA 2Z7FE 3ELAH 3NZIA 2V35A 3MNCA 2FOFA 3U8RH 2V0BA 2R0KA 3LKWA 1C9PA 1LQDB 2DE8A 1GI6A 5EW2H 4K1TA 2FOHA 1F0RA 3EYDA 1SSXA 1DY9A 1OS8A 1SLXB 5JYIA 1TE0A 4X6PA 5EODA 1BJUA 2R3YA 2YOLA 1LVBA 3SU5A 4CRFA 3SV9A 3BTHE 1F2SE 4IS5A 4BTIB 3Q77A 4UD9H 2AMPA 2GP9B 2BLWA 5CE1A 4O03A 2UWPA 3TIUA 3PYHA 2GCTB 1GGDB 1BMNH 5ESTE 2R2WU 3MNXA 1MAYA 1RJXB 1DM4B 1W0ZU 1TPOA 3M7TA 2BLVA 1GVLA 1P57B 4AORA 3SNAA 2ZO3H 1C5TA 4UONA 1GJ7B 1HXEH 4DJZB 5FHTA 4X8VH 2FLBH 2ODPA 3A7XA 1EAWA 1GI0A 1FXYA 4YOIA 1DFPA 1TNKA 1YPMH 1Z1IA 3B8JA 3TK5A 1WQSA 3MFJA 1BMLA 1QB1A 1W12U 3E1XB 1IQJA 2NU2E 4CHAB 1MKXK 3U8OH 2J38A 4F4OC 1SQTA 2YNAA 1O3PB 3ZVGA 3ZZ9A 2PWXA 1A2CH 1YPKH 1GMCF 4THNH 1VCPA 2Q6FA 3KCGH 2GCTC 4X8TH 4Q2KA 3ZV9A 2EI8A 4RKOB 1L1NA 1T7CA 2ZDMA 4AG1A 2UUFB 1O2RA 1C5ZB 2QA9E 4H6SB 1GHBG 1AZZA 3CP7A 4MPWA 2ZCKP 1BBRE 3UQOA 1MMJN 1QBNA 2ZGCA 3SQEE 1NU7B 1QTFA 2FTLE 1T8LA 1N6YA 2F9NA 1GDQA 3SJOA 1FN8A 2JETB 5CHAB 1HDTH 5GIBA 1SGTA 4OS4A 1BTPA 2ZHFH 2F9VA 4HTCH 1C1UH 3EA8A 2STAE 4Y0YE 2PKSB 4U32A 1Z1JA 3GOVB 2EC9H 1UVUH 9LPRA 4KTCA 2PFEA 1NO9H 3RM0H 1OWDA 4J2YB 1TPAE 4FUHA 1P2KA 1HLTH 4BAKB 2A0QB 5JB9S 1V2JT 2NU4E 5A09A 3URDA 1F0TA 3R0FA 1O2KA 1TLDA 2VVVA 2ZHWH 1O3OA 1KDQA 4FVBA 2OXSA 2PKAA 1K21H 2A4OA 2WUCA 1OSSA 1TONA 1KXDA 3TH3H 1THSH 1A0LA 5F8TA 2O8MA 1LTOA 2D1JA 1Z71A 2JKHA 1P11E 5A0CA 1BTZA 1K1MA 2B7DH 4TY7A 2NWNA 2BDCA 2BY5X 2Z6BD 4DIIH 1GDNA 4INHA 1C2KA 3C27B 2CHAC 3MU5A 2WPKS 2ZU4A 4B75A 1TMTH 3TLOA 4JMYA 2A4QA 2CV3A 3RXOA 1O3CA 2KAIA 3KHVA 3A89A 4YTAA 1NN6A 6CHAB 1GJCB 3QX5H 4NA8A 5FBEA 3G01A 5DP4A 1TGBA 2BVXH 1S81A 1QY6A 3ZZ8A 5E0GA 2ODYB 5C1YA 3E90B 1Q3XA 1FY1A 1OWKA 1BIOA 2XXLA 7KMEH 4WMDA 1UMAH 4DGJA 2OC7A 4Y7BA 3ZZDA 2VWMA 4UFEH 3MH6A 3A7WA 5EU8A 5JBCS 2GZ9A 2H5CA 1V2QT 3SV6A 2ANWA 1L4DA 1EAXA 1SFIA 2GCHG 1QRXA 1GBAA 2OTVA 1HAHH 1QR3E 1V2UT 3UFAA 3SU6A 1IHTH 1T8NA 1GMHF 4UFFH 3RU4E 2Q1JA 4ABIA 2P16A 1WTGH 3FZZA 1P03A 4XDEA 2BX3A 1O2IA 4D9RA 3U1JB 1TYNA 2G5VA 1DT2A 1AI8H 4Y8ZA 1C5OH 1GMDF 1P8VC 1LVYA 1B5GH 2HNTF 3M3SA 1EKBB 2ZU5A 1H1BA 3P92A 1BT7A 1XUHA 2GTBA 1P2JA 3SGAE 1PPGE 3KQCA 1AHTH 3U98H 1G3DA 4AB8A 2VGCC 1EASA 1HAVB 1TIOA 1T4VH 1F7ZA 1OXGA 1S6HA 5LPEA 2VIOA 4MDSA 1IQLA 1D6RA 3P8OA 2F9OA 2D8WA 1TBQH 3D23A 1SGNE 1OKXA 3GY5A 1GDUA 3E6PH 1V2KT 2ZDVH 1QURH 1TNJA 2ZDLA 3TJUA 2XC5A 4JCNA 4KKDA 3F6UH 1XKAC 3QGNB 4FUJA 1EOLA 2ZU3A 1P2IA 1KTSB 3KN2A 2BLOA 1QBVH 5EOKA 2SGQE 1PJPA 2PTCE 2PHBA 1THPB 2ZFRH 1O2JA 3U69H 2SNWA 5DP6A 2ZQ2A 3A7YA 4NZLA 4WMFA 1UTPA 3L3TA 4HFPB 1A4WH 1MTVA 4E06H 1CA8B 1G37A 1XM1A 1GCDA 3HPTB 5ABWA 1O3LA 1AKSA 3PTNA 4A6LA 4INKA 2A4GA 3BTFE 1GI4A 5FAHA 1ELTA 1FY8E 4AFSA 1RTKA 3QGJA 5TJXA 1NS3A 3TPIZ 5E0JA 1H8DH 2PTNA 5HMAA 2QCYA 1EATA 3JZ2B 1SGFG 1W2KH 5TCCA 5DP5A 1ZTJA 1NRQH 1C9TA 2J95A 1BTXA 1VGCB 3A8AA 4FUFA 1FMGA 4HGCA 3P95A 3PWCA 1ZMJA 1K1NA 3W94A 1C5PA 1NY22 2ZWLH 5BPEA 1GI5A 4WY3A 1PQ7A 1QQUA 1YKTA 5A0BA 1CBWB 1GHAG 4RSPA 4NIVA 3ZVCA 4ABHA 1AN1E 2G00A 2G81E 4CR5A 2FOCA 2CGAA 3SOSA 4K1SA 1Q31A 3O8BA 3AAUA 1EZSC 2Z94A 3UR9A 1YC0A 2WYGA 4Q7YA 3TJOA 4DT7B 1NFUA 3S9CA 3KGPA 2BD9A 1AU8A 2H9TH 1O2VA 1H8IH 5GXPA 2G4TA 2PSYA 2B9LA 4XFQA 1NRNH 1QRZA 1SQAA 3SV2H 1HAPH 3GICB 5C67A 1HRTH 1L2EA 1K9OE 2LPRA 2FX6A 3GCHC 1PPBH 1QL8A 2FODA 3LIWA 1NROH 3M7UA 3TNSA 2CXVA 3MNBA 3CS0A 1IQNA 1LHFH 3AW0A 2AGGX 1ID5H 1NZQH 2RA3A 4JYVH 4NGAH 1LHEH 3UWJH 5GWZA 4BXSA 3SBKA 1VITG 3UQVA 1ZRKA 1ZGIA 3R3GB 1UK2A 2Y5FA 3BTDE 1O30A 3S9BA 2GGVB 3T27A 1CO7E 3LGIA 3A83A 1S0QA 1H9IE 3ZVFA 4MTBA 1O36A 1TGTA 1AO5A 2ZGBH 6GCHF 3RXTA 5SGAE 4AZ2B 1D6WA 1ANCA 2PGQB 4ZROA 3A85A 5EXNA 1N8OB 1SPJA 1NPMA 3HK6B 1G36A 4SGBE 5FX6A 4ABFA 1PPFE 3ITIA 4ZHAA 2A7JA 2G51A 2ZDNA 1LPZB 5JDUB 4NG9H 1PFXC 1O5GH 2PGBB 1F92A 4B73A 1P2NA 2ZHEH 1H9HE 2V3HH 4D7FA 2JETC 6CHAC 3KEEA 1GHZA 4FUGA 2Z3DA 3B23B 3PLPA 5FBIA 1KLIH 1G9IE 3BG8A 5L30H 2AEIH 3SNEA 3BTGE 1KXAA 2I6QA 1CQQA 1TWXB 1IOEA 1K1IA 2ZNKH 1CBWC 1LHDH 1B7XB 3H7OA 4A5TS 4DCDA 1TFXA 4Q7ZA 2FESH 1AZ8A 1GBCA 1SLUB 1GMHG 3SU1A 1FDPA 1ABIH 3UNQA 1KXBA 3MO6A 2A32A 1YCPH 3LJOA 3GCTG 4TWYA 1TOCB 5C1UA 1QNJA 1DSTA 3T5FH 1AD8H 4K5ZA 3VXEH 1DX5M 2SNVA 1OPHB 1XUGA 2WINI 1GJ5H 5EXLA 2ULLA 3PLBA 1NRSH 1SGIB 1GBBA 2J94A 1XUIA 2DE9A 1AVXA 3F68H 4KTSA 2BX4A 2LNCA 4LK4A 3LH1A 2OQUA 1CGHA 1NFWA 1Y3XA 1P2QA 1IQKA 4OS5A 4JZDH 2TIOA 3SGBE 4CR9A 4NWKA 2GMTC 4O3TA 4WXIA 3ZVEA 1HV7A 4FUEA 1E37B 1GVKB 2AMQA 4H6TA 3A8DA 1XVMA 3VXFH 2QAAA 1ETTH 2TRMA 4CH2B 3QLPH 1SLWB 1ZMLA 4ISOA 4SGAE 3KQBA 2XWAA 1SGRE 2ZDKA 1DOJA 2ZFTA 1P02A 1MBQA 2P59A 1MTSA 2WV5A 5F03A 3Q76A 5JB8S 1P05A 1TQ0B 3O8DA 1NFYA 1O5BB 4ABJA 2KAIB 5C20A 4A92A 2ZCHP 2GV6A 3LH3A 1OP8A 1FAKH 4WWYA 1ZOMA 2GCHF 1AWHB 1RXPA 2PSXA 1UCYK 3MU1A 2P94A 2UWOA 2A1DB 1W7XH 1HAVA 3MO9A 1GJ6A 4XBBA 2R2MB 2D2DA 2QIQA 3K65B 3NPSA 4H42U 3RMOH 1HJ8A 1HCGA 2VWLA 2HRVA 1W11U 4I8KA 1LDTT 2AERH 2Y5GA 3PO1C 4FUDA 2ZF0H 1HUTH 1C2DA 1PPEE 2FI5E 3FP7E 1Q2WA 3GYMA 3A86A 2ZP0H 4FU9A 4KELA 1IHSH 2TGAA 2O8WA 3M3TA 1SFQB 1S82A 3RXIA 1KSNA 5DGJA 4B2BA 1N1LA 6GCHG 4AYYB 3PM3A 4LZ4B 5C5OA 1KIGH 2XBYA 3LOXA 4X6MA 1ARCA 2WPIS 4UFGH 3PTBA 1V2ST 2F91A 2P3TB 3ZVAA 4D8NA 4X1PU 4Y10E 3RXMA 2FTMA 5EGMA 3RXDA 3U9AH 1LKBA 2OC1A 2XNIA 2O8TA 2A2XH 1Y3YA 4AG2A 2BVRH 1EJAA 2VWOA 3OX7U 3RMNH 1RFNA 1C1PA 4B2CA 4HI3A 4WMEA 3Q00A 2CN0H 3E8LA 4AYVB 3RC6A 1YPHC 3BG4C 1FY3A 4Y71A 3I29A 1O2TA 1SB1H 1GBFA 3V0XA 5FPYA 2G55A 2PLXA 4K3JA 1LVOA 2VVUA 3ZZ5A 2ZEBA 1F5RA 3EA7A 3MMGA 1UTJA 4ABAA 1Y5UT 2CMYA 1FIWA 2A4RA 4FUBA 2VIWA 4I33A 2ZA5A 1O3JA 1BQYA 3SHCH 3ENSB 2ZGJA 1DUEA 3EA9A 1V2MT 3GCTF 1VCWA 1MTWA 4XOJA 3NWUA 1AKSB 4E05H 2BQWB 3VB5A 1C5SA 1CT0E 1MTNC 3LPRA 3I78A 5T3HA 1INCA 1GBIA 3AAVA 1VITF 3U8TH 1O3DA 1FY5A 1XUFA 1CSOE 2XYAA 2PUQH 5A8ZA 4B1TA 5C1XA 1BTHH 5L2ZH 4UE7H 1D3QB 4NCYA 3TK9A 1GI9B 1SR5C 1MU6B 1PPCE 1IAUA 5HGGA 2Q6GA 2RG3A 1GL1A 1GHXH 4WXVA 1K2I1 1VITH 2GKVE 5LPRA 5CHAC 3TGKE 1DITH 1C1TA 3SV8A 1FV9A 2G8TA 2H6MA 3ZV8A 1C1VH 2HNTC 1VR1H 1UVPA 4CH8B 4YOJA 1P01A 3FP6E 4MG3A 1C5LH 1PPHE 1Z8JB 1RD3B 1IQEA 4FVDA 3ZZBA 1CA0C 2VIPA 2HOBA 2OC0A 3RXAA 4AOQA 3M36A 3GDVA 1C5WB 3KL6A 1L1JA 1YBWA 5C5NA 2ZCLP 1O31A 3E3TA 3O8RA 1C5MD 3QUMP 2BD8A 1HIAB 1J15A 1MU8B 1FLEE 3VGCB 1FNIA 3A7ZA 3SNBA 1H9LB 1D3DB 5DO4H 4FU8A 3P8NA 1Y59T 1B0EA 2ALPA 1QQ4A 4A1TA 3KIDU 1Y3WA 1N6XA 2V3OH 1T8MA 4DURA 3Q3XA 1XKBC 1DDJA 3SN8A 3UUZA 2VVCA 4Q80A 3A7TA 3CS7A 3LGTA 1AFEH 3TJNA 1FJSA 1K1OA 1QBOA 3K6YA 1DPOA 1AMHA 2QF3A 1ZTLA 1AFQB 3QTVH 2QF0A 2Y7ZA 4B71A 3BEFB 1RTFB 1O3GA 1UTOA 1GMCG 1V2LT 5DP7A 1E38B 1O33A 4Y7AA 7GCHF 1C2FA 1UVOA 7GCHG 2ZU2A 3DFLA 5I25A 3MOCA 4ABEA 2XBWA 2QXJA 1UTQA 1W8BH 4FXGH 3SI4H 3T25A 1NT1A 1YP9A 2RA0A 1QL9A 2P95A 1WYKA 1O2NA 3DT0H 1GCTC 4K1EA 2ODQA 1TRNA 1B0FA 1HAIH 2FYRA 3BN9A 1KYNA 1AVGH 5JPMH 1NRPH 4LXBH 1XUKA 2W26A 2Y7XA 5HM9A 1C2IA 5A0AE 1RS0A 2BHGA 1YPHE 4BTUB 2BY7X 1UCYE 2SGPE 3EGKH 3PV4A 2ZU1A 1A46H 1JXPA 5A2MH 4JZ1A 3T26A 3SUEA 2FEQH 1P3CA 1VJ9U 2A5IA 1PPZA 1GHVH 4A7IB 1THRH 4AN7A 2UUKB 1SGFA 2J4IA 3LT3A 1EOJA 1KXEA 2ESTE 2FS9A 4HZHA 1GI2A 5L6NH 1ELCA 1LO6A 1JRTA 1SGPE 3M37A 3PMBB 3MTYA 3SV7A 3HATH 4X8UH 1A3BH 3N7OA 1JIMA 2FIRH 1MTNB 4F49A 1OYQA 1BHXB 5T6DA 1S83A 5H4IB 4O3UA 5G4BA 2BXUH 1UHBB 3MI4A 1RGQA 2I6SA 2BTCE 4IC5A 2FZZA 1TB6H 3S0NA 4U2WA 2W5EA 4OS6A 2AH4X 1SOZA 3BSQA 1HAYB 1E34B 1A0JA 1SC8U 1YYY1 4NA7A 4R8TB 4YT6H 3ZZAA 2B8OH 1GI7B 3Q3KA 2ZGHA 1XXFA 1PQ8A 4A1XA 2AGEX 1Y3VA 1GJ4H 1HGTH 3RXSA 1P04A 2XWBI 5EPYA 4CRBA 1O2WA 1BRBE 2Z3CA 2ZFPH 1T8OA 1CT4E 3OU0A 3RMMH 2PR3A 1TNIA 3S7KB 1GBHA 2VH6A 2AFQB 4WVPE 3QK1A 4OGYA 3L6PA 2XW9A 3DHKH 4X1SU 2BDIA 4IMZA 4DVAU 4AFZA 2Z9JA 1O2OA 2NU0E 3BIUH 2FWWA 1UK4A 2CJIA 3P8GA 3TK6A 2BDYA 6LPRA 2BDHA 2GX4A 1O38A 3MHWU 1ELBA 5GCHF 1KY9A 1WUNH 5DP3A 2QXHA 1DXWA 3QZQA 4AFUA 2ALVA 2R3UA 3MWIU 1S5SA 1TMBH 1ZR0A 2F83A 2SFAA 1J16A 1HAGE 1L4ZA 1JOUB 3UPEA 2AIQA 1DWBH 3LU9B 1QB6A 4NIWA 2VGCB 1DUAA 1O2GH 2Q6DA 4ZKNU 1ELEE 1P3EA 3RXRA 3SU3A 2CHAB 1O5AB 3V3MA 4Y76A 5HYOA 3TGJE 3T2NA 1PQAA 1U6QA 1GBMA 1LHCH 3GISB 1EAUA 2A7HA 4NIXA 4NWLA 4U30A 2FO9A 1TRMA 1YLCA 3ZZCA 1TA2A 3GY2A 1TBZH 2A7CA 2GV7A 1ELGA 2W3KA 2QXIA 4A1VA 2V6NA 4BAQB 4FUIA 1CHGA 4JZFH 1AGJA 2TGPZ 4TPYA 4KGAA 2AIPA 1X7AC 1ABJH 1PQ5A 2SGEE 2XBVA 7LPRA 3O8CA 1PYTC 1V2OT 2HNTE 2HWLB 1W7GH 2H9EH 3FVFB 4E7RG 1XUJA 3VGCC 1ZSLA 3VB7A 1TQ7B 2Z9GA 5FPTA 3M35A 5A8YA 2ZPQA 1OX1A 1SVPA 2RDLA 1SLVB 4BAHB 1V6DA 3SU2A 4ZMAH 2CF9H 2GZ8A 1C5UA 2QXGA 3V13A 1O5CB 2YNBA 3RU4D 2Z9IA 1GJBB 1TNHA 1ZSJA 2JH5D 1CGJE 8ESTE 3SW2B 2P8OC 1LPGB 3HKJB 3V7TA 1C2MA 4LZ1H 1MD7A 3VB6A 1EJNA 3M3VA 2C4FH 1TNLA 5HXFA 1SGCA 1G2LA 1BMMH 1EZXC 2ZPRA 1Z6EA 2VINA 1IQIA 4BNRA 3RXPA 1QJ6B 1GG6C 4IW4E 3ZYEA 1TPPA 2BY6X 4MNXA 1J14A 3A87A 1BRUP 3JZ1B 1AIXH 1FUJA 2D26C 1O39A 1EX3A 1O37A 3RXHA 1ZRBA 1CHOG 2BDAA 3F9GA 3P17H 5L2YH 3A80A 3GYLB 1E36B 3OYPA 4X6NA 1IQGA 4YZUA 4X2YA 3FANA 2FPZA 3MH7A 4WJG2 1TMUH 1MKWK 4IC6A 2WV4A 1XX9A 1Z8RA 1JRSA 2BD3A 3NCLA 1ZMNA 1CVWH 1WBGB 4TY6A 3AVZA 3A8BA 1MD8A 1ZPZA 1S0RA 3RLYH 1HJAB 1QIXB 2FOAA 3T29A 2IN2A 1YPEH 3BIVH 3BTKE 3GY6A 3RXCA 1CT2E 3C1KA 2UUYA 1YF4A 1NESE 3PLKA 1H4WA 3LDXH 2HVXA 3UREA 4KTUA 1Y8TA 2QY0B 1ETSH 5C2ZA 4ZKSU 4MLFB 2OQ5A 4AGJA 3TGIE 1HXFH 4O9VA 5F8XA 2F9BH 3QWCH 1ZYOA 1AQ7A 4Z6AH 5LPFA 4UDWH 1YCPK 1BRCE 2BVSH 2VIDA 2VWNA 1HAOH 3WY8A 1ZGVA 2FXRA 5JBAS 5JBTA 4ZAEA 1AE8H
chains in the Genus database with same CATH superfamily
4U01A 5KEDA 1T31A 2G5NA 2KCOA 1GCTB 1TALA 4INLA 2W3IA 4X6OA 2J98A 5T6FA 1BTWA 4JYTA 2C8WB 2BOHB 1ELDE 5EQSA 3SQHE 3UR6A 3NXPA 3LGUA 4ACAA 1FZZA 4NSVA 4X8SH 1ZLRA 5F8ZA 1UK3A 2QN5T 3UOPA 4I8GA 4OGXA 3STJA 3TNTA 1DS2E 1O2ZA 2OCVB 2XCFA 4GCHG 3RXBA 2VJ1A 4KP0A 3S7HB 5FXLA 2BLQA 3K6ZA 4Z0KA 3RXJA 1O2SA 1W13U 4Y6DA 3SZNA 4ZXXH 2BMGB 3F3BA 1N8OC 3URCA 1O5EH 1VZQH 3ATIA 4CBOA 3RU4T 2G52A 2GD4B 1CGIE 3ATWA 3EQ0H 1GL0E 1EPTC 1ELFA 1NU9A 3LC5A 2O9QA 2C8XB 5K0HA 2BY9X 2KCPA 5C3NA 1MZAA 2R0LA 4ABDA 5B6OA 1GI1A 4R0IA 1NFXA 1C1NA 1EXFA 1MH0A 1K1PA 5BRRE 3OTJE 3U1IB 4D76A 4MPVA 3A81A 1O3AA 1BITA 3WW7A 2KCYA 5FX5A 4ZKRU 4RI0A 1IQHA 1K22H 1GHWH 4AX9H 5DP8A 2H9HA 1G32B 1GHAF 2BQ7B 3SJ8A 1EAIA 1RIWC 2ZHQH 3SGQE 2VH0A 4MPXA 1O3BA 1HAXB 1NRRH 3LONA 3GCOA 1FY4A 3RC4A 3EDXB 1C4U2 2AMDA 2Y5HA 2GVFA 1LVMA 3KQ5A 5LH8A 1Z6JH 2H5DA 1DWEH 2J9NA 3RUOA 4BTTB 2BD7A 2ZC9H 1S84A 1TAWA 3UNRA 3TVJB 2FYQA 1NBME 1O2UA 3F9HA 1VGCC 1OWJA 8KME2 2PUXB 3AW1A 1UTLM 2YMSC 2V7QD 4B6FA 3FAOA 4JYUH 5IDKA 4WH6A 4BANB 5AFYH 2Z3EA 2XC4A 2UWLA 3E0NB 1NM6A 4M9FA 4GAWA 1SHHB 2BZAA 3RP2A 2EQNA 1A5HA 2FP7B 1G3BA 1ACBE 3M5NA 1HAZB 2VB0A 1P06A 1SG8B 1ZPBA 5FPSA 1UVSH 3GY8A 3MO3A 2C90B 2EI6A 3BTME 1TGNA 3UTUH 3KQEA 4D7GA 1F0SA 1Z8IB 4YO9A 2B0FA 4TWWA 1P10A 2AS9A 2ILNA 1QFKH 1GVZA 2A31A 1FN6A 4J1YA 2SGAA 3ATKA 1S6FA 2ZKSA 5EQRA 1WSSH 1RIWB 3CENA 1FONA 5AF9H 3B9FH 1BZXE 2ZTYA 2W6ID 1P9UA 4Z1MD 2P8OB 1KLTA 1TX6A 1TRYA 2ZPSA 2G4UA 2HLCA 2XOKD 1GG6B 3DFJA 3RXGA 1GHYH 1GBJA 1HFDA 1DLKB 3GY7A 1C1SA 2PV9B 1OWHA 2XRCA 4CHAC 2BY8X 2GT7A 5ESBA 3F9EA 1AFQC 1C4V2 4RN6A 2F9PA 1GBDA 5HIYA 1S85A 4I8JA 4X1NU 3H5CB 3PO1B 1MTUA 1O3FA 3T62A 4XBDA 1BJVA 1O35A 1QJ7B 2F3CE 1W0YH 2BOKA 1TX7A 1YPGH 5DPAA 1BB0B 1O34A 1BUIA 2ANKH 4MPUA 1ZJKA 4ASHA 4Y8YA 3BV9B 2A45B 2QGRA 5ETXA 3F1SB 2YMSB 2BYAX 1C1WH 1LQEA 4YLUA 1HIAA 1HBTH 1O2HA 1LCYA 4I8LA 4I32A 3MQKC 2F9UA 1O2LA 1V2RT 1DANH 1BOQA 1IQFA 3QDZB 1W3CA 1GBKA 4ZKOU 5GJ4B 1O0DH 1O2QA 2J2UA 1V2VT 2ZGXH 5HM2A 1VJAU 4GUXA 1T32A 4JK6A 2HPPH 1EJMA 4VGCB 8GCHF 1MQ5A 2VNTA 3AASA 2B5TB 2OP9A 1O3IA 2NU1E 3RXQA 2ZI2H 4B2AA 4YLQH 4BXWA 1FPHH 4DOQA 2BM2A 3GCHB 1COWD 1QA7A 1A7SA 1E0FD 1K28D 3FFGA 3LJJA 3QTOH 3ZVBA 4CBNA 2FOMB 1BHXF 1ZPCA 4RKJB 5EW1H 3MU8A 3PMJA 3P70B 4IBLH 2XCNA 1OOKB 3GCNA 4PROA 2XBXA 1ZJDA 2FDAA 5EIYA 3A88A 5E2OA 4IN1A 1C2GA 4ZHLU 1GBEA 2EEKA 1JMOH 4ASUD 3NRLA 3I77A 3GDUA 3TH4H 1F5KU 2BXTH 3M5OA 2GMTB 4X1RU 5DKMA 1V2PT 1QCPA 1IQMA 2XNDD 2XC0A 3BTQE 1Z8GA 8LPRA 1BTUA 3BTTE 4DW2U 1UTMA 1KDQB 4MNYA 4TYDA 5E2PA 3BF6H 3TU7H 3KYFA 5IYTA 1OP2A 1WAYB 9ESTA 1LPKB 2THFB 2VIQA 3SU4A 1SI5H 5J4QA 4IGDA 4CRAA 1HNEE 4NA9H 1TA6A 1AWFH 2J98B 3K9XB 5GCHG 3RDZA 1C5RA 3LGVA 4GSOA 2Y81A 1EFRD 1QRWA 2C8YB 4MQAA 1C1OA 3NK8A 4XE4A 2OUAA 1YCPM 4ISLA 2Y82A 1CE5A 2FI4E 4ISIH 3BG4B 1EB1H 1O3HA 2TGDA 3PV2A 2TGTA 4GLYA 4K2YA 1HYLA 1SHYA 4YESB 1JBUH 4ABGA 4D9QA 1TGSZ 3D62A 2BD5A 2FI3E 3VFEA 2P3UB 3MNSA 1G30B 1L0ZA 2KZ4A 3SJKA 1S6LA 1XVOA 2ANMH 1ZSKA 1C2JA 2O8LA 2FS8A 1BMAA 1YPLH 2Y6TA 4YM9A 3E0PB 4XSKU 1Y5AT 3F2FA 5J4SA 1OP0A 4I7YH 5JBBS 5PTPA 3VB4A 3TJVA 2TPIZ 4CRCA 2ZTZA 1UO6A 2BZ6H 2A2QH 1A0HB 1ETRH 3L33A 4GCHF 3ZZ3A 2WUBA 3ODFA 2OC8A 5DG6A 1D9IA 3KQDA 3SU0A 2OBOA 2EA3A 2P93A 2ZFFH 1BDAA 4CRDA 1FX0B 1Z7KA 3STIA 3SJ9A 1BBRH 5AVDA 4Q7XA 2RCEA 3EE0B 1P9SA 2W6JD 3MU0A 1HJ9A 4NZQA 3BEUA 3UWIA 1ORFA 1P2MA 4JZIA 1BRAA 4Q4LA 1FQ3A 1AUTC 1ANDA 1O32A 3S69A 4TPIZ 3BTEE 3RXLA 1RTLA 1DVAH 1GGDC 5DP9A 3RMLH 1H8HD 4I86A 3ZYDA 3OY5U 1CA0B 3OY6U 3SJIA 3UNSA 3DUXH 3GDSA 4NFEA 3SNDA 5K7RA 4ESTE 3OEED 3ATLA 2H2ZA 2ANYA 2OLGA 2WPMS 4QT8C 2XTTB 5FCKA 3ESTA 8GCHG 3SNCA 5I46H 1V3XA 1A5GH 4X2XA 4CRGA 1DWDH 1XXDA 1C2HA 3ZZ4A 1FAXA 4JZEH 1GBTA 3DA9B 1LKAA 1HB0B 2R9PA 2SGDE 1V2TT 1SBWA 3NKKA 4NSYA 1DSUA 1DICA 5EJZA 5GDSH 3FN8A 1XMNB 1EPTB 1QA0A 3BEIB 2ZQ1A 1O5DH 4NIYA 1QB9A 1SKYE 1C1MA 3MU4A 3P6ZB 1DLEA 1DWCH 1MBMA 1SMFE 2AGIX 1GPZA 5F6MA 3PROA 5T1VA 1ZZZA 1CHOF 2IOTA 2KFWA 4GVUA 1KLJH 1O3EA 1J9CH 1YLDA 1ANBA 3D65E 1FPCH 1BCUH 3HGNA 2OBQA 3K2UA 4WH8A 2HALA 4GHTA 1GJDB 4K60A 4K8YA 4AFQA 2ZFSA 1HPGA 4B74A 3VEQB 1SQRA 3HK3B 2WYJA 1ZHRA 2FOGA 2J92A 2IJD1 1O2XA 1WTHD 1C4Y2 2ZG0H 2O8UA 3W95A 3TH2H 1G2MA 1RRKA 1EPTA 1TOMH 1T4UH 4K69A 2BB4A 3QZRA 2GT8A 2WSSD 5E8EH 5A8XA 2ZFQH 1E1RD 3MH5A 1VCQA 1EZQA 1O5FH 1WOFA 3PMAB 3EAJA 4X0WU 1ESBA 3QN7A 3BTWE 2CK3D 2GDEH 2DUCA 1Y5BT 1EP5A 3SHAH 3LC3A 3U28C 1NC6A 3PWBA 1D3PB 3E91A 1GI8B 3SUGA 2FOBA 4NFFA 3ZVDA 1QHRB 1UTKA 2ZTXA 3M61U 2PKSC 1ZTKA 3H7TA 1EZUC 2QYIA 3M5MA 3HKIB 3VB3A 4XBCA 3GY3A 3ZZ7A 1A1RA 2OK5A 4BAOB 1O3KA 1GMDG 1O2PA 1D4PB 4JK5A 1TGCA 1CU1A 2UUJB 1HJAC 1W10U 2H1UA 4ISNA 2QV1A 1WU1A 4OS1A 5GNDA 1DE7H 3RXFA 4DIHH 2W7SA 1E79D 1MAXA 1L1GA 5EQQA 2IPQX 2EY4C 2GDDA 5AFZH 1C5VA 3P8FA 5CHBA 1KTTB 4WF8A 3IG6B 4IMQA 3RXVA 3SZEA 1TNGA 4Y11E 2OINA 1ESAA 1ARBA 1D3TB 1TABE 1GHBF 2Z9LA 1JWTA 1GJAB 1EB2A 6ESTA 2Y80A 1YPJH 4GPGA 1SOTA 1OYTH 1TPSA 5EPNA 2JH0D 3MYWA 2P3FH 4LOYH 1KXCA 1P2OA 4X1QU 1OWIA 1SL3A 5DSFA 3VPKA 1UCYH 2QF4A 1GJ9B 4ZUHA 3LGYA 1G3EA 4ZHMU 4E7NA 2TBSA 4DY7B 1GJ8B 1TBRH 3PMHB 1LHGH 1MCTA 1EUFA 1P0SH 1GBLA 1WCZA 1BBRK 5EXMA 2ZZUH 2FX4A 1ZHMA 3PB1E 1SQOA 3WWBA 3M5LA 1ANEA 1A3EH 3SO3A 4H4FA 1MCVA 1YM0A 3N7EA 3F9FA 5GPIB 3T28A 1G3CA 5E0HA 1SGYE 1EP6A 2BDBA 4I31A 4BAMB 2FM2A 1JIRA 2WZQA 1MKXH 2VIVA 1ELAA 4K8BA 4VGCC 2NU3E 1K0HA 3SORA 3SUFA 4X2WA 3RXUA 5TCAA 1QL7A 3S9AA 2GZ7A 1K1LA 2KCAA 1M9UA 3A8CA 3A84A 3KF2A 2OD3B 4B76A 1O3NA 1QJ1B 2WPJS 1DY8A 1YWUA 2M5TA 1AY6H 2J97A 4MVNA 2WPHS 2ZECA 3FP8E 1SGEE 2CF8H 4BOHA 1MKWH 2K1QA 4UFDH 3UAIC 3UOUA 2W7UA 1AVWA 3GS9A 2FLRH 4Y8XA 4CREA 1YGCH 2J34A 2HPQH 3D49H 1C5YB 4OS7A 2QC2A 1C5QA 1WV7H 1OHHD 3E16B 1BA8B 2JH6D 3UY9A 1V2NT 1NTPA 3Q3YA 1UJ1A 1UVTH 2BD2A 4I8HA 2BQ6B 1K1JA 5LGOA 4DT4A 2IJOB 1QGFA 1Y3UA 1O2YA 1P09A 4YT7H 2SGFE 3PRBA 3ZZ6A 1J8AA 2ZDAH 3QO6A 1AUJA 1UHBA 4AB9A 4ISHH 3KNXA 2PW8H 3GY4A 3ATMA 4O97A 5DJ7A 1LMWB 2BD4A 4FU7A 2PP6A 3SUDA 2RFKC 7ESTE 4AGKA 2STBE 4MNVA 3DD2H 2VU8E 2ZHDA 5EG4A 2AYWA 2ASUB 2IPHA 2C93B 3RXKA 3ODDA 3NUMA 3TITA 1MZDA 4YOGA 1FIZA 4X2VA 1C5XB 1C1QA 4XRNA 3HGPA 3OSYA 2EI7A 1O3MA 3IITA 1C1RA 1O2MA 1FI8A 1F5LA 4IN2A 1UTNA 1W14U 1WQVH 3MH4A 2WPLS 3IWMA 2Z9KA 5CMXH 3F0PA 4DG4A 1DXPA 2F43B 3RXEA 1EQ9A 1ZHPA 4OS2A 4GHQA 3V12A 1GI3A 2ZIQH 1C5NH 1ELVA 1MQ6A 3LGWA 1J17T 5FCRA 2HGTH 1P12E 2K0QA 3SI3H 3FOAA 4ABBA 4ZCNA 5DN6D 3RM2H 1SGDE 4M7GA 1BTYA 4Y0ZE 1V2WT 1C2EA 3RC5A 1A5IA 2PKAB 3M7QA 3A82A 1C2LA 4ZXYH 1ESTA 1E35B 1TX8A 4ZH8A 3RLWH 3UIRA 1KXFA 5DK1A 4FUCA 1AE5A 1WDIA 1AB9B 1SGQE 1MUEB 2FOEA 2C3SA 1GWAA 4Y79A 2A5AA 1AB9C 2V3MA 4MNWA 1PYTD 1A61H 5AHGH 5HIZA 2C8ZB 1F0UA 2BDGA 1OWEA 2FMJA 2A5KA 4UEHH 3FZDA 5T6GA 3A7VA 2Z7FE 3ELAH 3NZIA 2V35A 3MNCA 2FOFA 3U8RH 2V0BA 2R0KA 3LKWA 1C9PA 1LQDB 2DE8A 1GI6A 5EW2H 4K1TA 2FOHA 2F4LA 1F0RA 1H8ED 3EYDA 1SSXA 1DY9A 1OS8A 1SLXB 5JYIA 1TE0A 4X6PA 5EODA 1BJUA 2R3YA 2YOLA 5C0UA 1LVBA 3SU5A 4CRFA 3SV9A 3BTHE 1F2SE 4IS5A 4BTIB 3Q77A 4UD9H 2AMPA 3ZIAD 2GP9B 2BLWA 5CE1A 4O03A 2UWPA 3TIUA 3PYHA 2GCTB 1GGDB 2KX4A 1BMNH 5ESTE 2R2WU 3MNXA 1MAYA 1RJXB 1DM4B 1W0ZU 1TPOA 3M7TA 2BLVA 1GVLA 1P57B 4AORA 3SNAA 2ZO3H 1C5TA 4UONA 3PV5A 1GJ7B 1HXEH 4DJZB 5FHTA 4X8VH 2FLBH 2ODPA 3A7XA 1EAWA 1GI0A 1FXYA 4YOIA 1DFPA 1TNKA 1YPMH 1Z1IA 3B8JA 3TK5A 1WQSA 3MFJA 1BMLA 1QB1A 1W12U 3E1XB 1IQJA 2NU2E 4CHAB 1MKXK 3U8OH 2J38A 4F4OC 1SQTA 2YNAA 1O3PB 3ZVGA 1MABB 3ZZ9A 2PWXA 1A2CH 1YPKH 1GMCF 4THNH 1VCPA 2Q6FA 3KCGH 2GCTC 4X8TH 4Q2KA 3ZV9A 2EI8A 4RKOB 1L1NA 1T7CA 3N7DA 2ZDMA 4AG1A 2UUFB 1O2RA 3OEHD 1C5ZB 2QA9E 4H6SB 1GHBG 1AZZA 3CP7A 4MPWA 2ZCKP 1BBRE 3UQOA 1MMJN 1QBNA 2ZGCA 3SQEE 1NU7B 1QTFA 2FTLE 1T8LA 1N6YA 2F9NA 1GDQA 4FETA 3SJOA 3FKSD 1FN8A 2JETB 5CHAB 1HDTH 5GIBA 1SGTA 4OS4A 1BTPA 2ZHFH 2F9VA 4HTCH 1C1UH 3EA8A 1BMFD 2STAE 4Y0YE 2PKSB 4U32A 2YMSD 1Z1JA 3GOVB 2EC9H 1UVUH 2RDEA 3OFND 9LPRA 4KTCA 2PFEA 1NO9H 3RM0H 1OWDA 4J2YB 1TPAE 4FUHA 1P2KA 1HLTH 4BAKB 2A0QB 5JB9S 1V2JT 2NU4E 5A09A 3URDA 1F0TA 3R0FA 1O2KA 1TLDA 2VVVA 2ZHWH 1O3OA 3AK5A 1KDQA 4FVBA 2OXSA 2PKAA 4FOUC 1K21H 2A4OA 2WUCA 1OSSA 1TONA 1KXDA 3TH3H 1THSH 1A0LA 5F8TA 2O8MA 1LTOA 2D1JA 1Z71A 2JKHA 1P11E 3OE7D 5A0CA 2LELA 1BTZA 1K1MA 2K8IA 2B7DH 4TY7A 2J5UA 2NWNA 2BDCA 2BY5X 2Z6BD 4DIIH 1GDNA 4INHA 1C2KA 2M2AA 3C27B 2CHAC 5CDFE 3MU5A 2JJ2D 2WPKS 2ZU4A 4B75A 1TMTH 3TLOA 4JMYA 2A4QA 5C17A 2CV3A 3RXOA 1O3CA 2KAIA 3KHVA 3A89A 4YTAA 1NN6A 6CHAB 1W0KD 1GJCB 2HLDD 3QX5H 4NA8A 5FBEA 3G01A 5DP4A 1TGBA 2BVXH 2L74A 1S81A 1QY6A 3ZZ8A 5E0GA 2ODYB 5C1YA 3E90B 1Q3XA 1FY1A 1OWKA 1BIOA 2XXLA 7KMEH 2QE7D 4WMDA 1UMAH 4DGJA 2JIZD 2OC7A 4Y7BA 3ZZDA 2VWMA 4UFEH 3MH6A 3A7WA 5EU8A 5JBCS 2GZ9A 2H5CA 1V2QT 5HKKD 3SV6A 2ANWA 1L4DA 1EAXA 1SFIA 2GCHG 1QRXA 1GBAA 2OTVA 1HAHH 1QR3E 1V2UT 3UFAA 3SU6A 1IHTH 1T8NA 5C94A 1GMHF 4UFFH 3RU4E 2Q1JA 4ABIA 2P16A 1WTGH 3FZZA 1P03A 4XDEA 2BX3A 1O2IA 4D9RA 3U1JB 4P02A 1TYNA 2G5VA 1DT2A 1AI8H 4Y8ZA 1C5OH 1GMDF 1P8VC 1LVYA 1VKYA 1B5GH 2HNTF 3M3SA 1EKBB 2ZU5A 1H1BA 3P92A 1BT7A 1XUHA 2GTBA 1P2JA 3SGAE 1PPGE 3KQCA 1AHTH 3U98H 1G3DA 4AB8A 2VGCC 3EE7A 1EASA 1HAVB 1TIOA 1T4VH 1F7ZA 1OXGA 1S6HA 5LPEA 2VIOA 4MDSA 1IQLA 1D6RA 3P8OA 2F9OA 2D8WA 1TBQH 3D23A 1SGNE 1OKXA 3GY5A 1GDUA 3E6PH 1V2KT 2ZDVH 1QURH 1TNJA 2ZDLA 3TJUA 2XC5A 4JCNA 4KKDA 3F6UH 1XKAC 3QGNB 4FUJA 1EOLA 2ZU3A 1P2IA 1KTSB 3KN2A 2BLOA 1QBVH 5EOKA 2SGQE 1PJPA 2PTCE 2PHBA 1THPB 2JJ1D 2ZFRH 1O2JA 3U69H 2SNWA 5DP6A 2ZQ2A 3A7YA 4NZLA 4WMFA 3DSOA 1UTPA 1YLNA 3L3TA 4HFPB 2JDID 1A4WH 1MTVA 4E06H 1CA8B 1G37A 1XM1A 1GCDA 3HPTB 5ABWA 1O3LA 1AKSA 3PTNA 4A6LA 4INKA 2A4GA 3BTFE 1GI4A 5FAHA 1ELTA 1FY8E 4AFSA 1RTKA 3QGJA 5TJXA 1NS3A 3TPIZ 2AHME 5E0JA 1H8DH 2PTNA 5HMAA 2QCYA 1EATA 3JZ2B 1SGFG 1W2KH 3FO8D 5TCCA 5DP5A 1ZTJA 1NRQH 1C9TA 2J95A 1BTXA 1VGCB 3A8AA 4FUFA 1FMGA 2WV9A 4HGCA 3P95A 3PWCA 1ZMJA 1K1NA 3W94A 1C5PA 4ACBA 1NY22 2ZWLH 5BPEA 1GI5A 4WY3A 1PQ7A 1QQUA 3CNRA 1YKTA 2WPDD 5A0BA 1CBWB 1GHAG 4RSPA 4NIVA 3ZVCA 4ABHA 1AN1E 2G00A 2G81E 4CR5A 2FOCA 2CGAA 3SOSA 4K1SA 1Q31A 5IK2D 3O8BA 3AAUA 1EZSC 2Z94A 3UR9A 1YC0A 2WYGA 4Q7YA 3TJOA 4DT7B 1NFUA 3S9CA 3KGPA 2BD9A 1AU8A 2H9TH 1O2VA 1H8IH 5GXPA 2G4TA 2PSYA 2B9LA 4XFQA 1NRNH 1QRZA 3DCLA 1SQAA 3SV2H 1HAPH 3GICB 5C67A 1HRTH 1L2EA 1K9OE 2LPRA 2FX6A 3GCHC 1PPBH 1QL8A 2HVYB 2FODA 3LIWA 1NROH 3M7UA 3TNSA 2CXVA 3MNBA 3CS0A 1IQNA 1LHFH 3AW0A 2AGGX 1ID5H 1NZQH 2RA3A 4JYVH 4NGAH 1LHEH 3UWJH 5GWZA 4BXSA 3SBKA 1VITG 3UQVA 1ZRKA 1ZGIA 3R3GB 1UK2A 2Y5FA 3BTDE 1O30A 3S9BA 2GGVB 3T27A 1CO7E 3LGIA 4TSFD 3A83A 1S0QA 1H9IE 3ZVFA 4MTBA 1O36A 1TGTA 1AO5A 2ZGBH 6GCHF 3RXTA 5SGAE 4AZ2B 1D6WA 1ANCA 2PGQB 4ZROA 3A85A 5EXNA 1N8OB 1SPJA 1NPMA 3HK6B 1G36A 4SGBE 5FX6A 4ABFA 1PPFE 3ITIA 4ZHAA 2A7JA 2G51A 2ZDNA 1LPZB 4XD7D 5JDUB 4NG9H 1PFXC 1O5GH 2PGBB 4Q63A 1F92A 4B73A 1P2NA 4TT3D 2ZHEH 1H9HE 2V3HH 4D7FA 2JETC 6CHAC 3KEEA 1GHZA 4FUGA 2Z3DA 3B23B 3PLPA 5FBIA 1KLIH 1G9IE 5EJ1A 3BG8A 5L30H 2AEIH 3OTPA 3SNEA 3BTGE 1KXAA 2KM0A 2I6QA 1CQQA 1TWXB 1IOEA 1K1IA 2ZNKH 1CBWC 1LHDH 1B7XB 3H7OA 4A5TS 4DCDA 1TFXA 4Q7ZA 2FESH 1AZ8A 1GBCA 1SLUB 1GMHG 3SU1A 1FDPA 1ABIH 3UNQA 1KXBA 3MO6A 2A32A 1YCPH 3LJOA 3GCTG 4TWYA 1E1QD 3PRDA 1TOCB 5C1UA 1QNJA 1DSTA 3T5FH 1AD8H 4K5ZA 3VXEH 1DX5M 2SNVA 1OPHB 1XUGA 2WINI 1GJ5H 5EXLA 5B6LA 2ULLA 3PLBA 1NRSH 3N99A 1SGIB 1GBBA 2J94A 1XUIA 2DE9A 1AVXA 3F68H 4KTSA 2BX4A 2LNCA 4LK4A 3LH1A 2OQUA 1CGHA 1NFWA 1Y3XA 1P2QA 1IQKA 4OS5A 4JZDH 2TIOA 3SGBE 4CR9A 4NWKA 2GMTC 4O3TA 4WXIA 3ZVEA 1HV7A 4FUEA 1E37B 1GVKB 2AMQA 4H6TA 3A8DA 1XVMA 3VXFH 2QAAA 1ETTH 2TRMA 4CH2B 3QLPH 1SLWB 1ZMLA 4ISOA 4SGAE 3KQBA 2XWAA 1SGRE 2ZDKA 5KGOA 1DOJA 2ZFTA 1P02A 1MBQA 2P59A 1MTSA 2WV5A 5F03A 3Q76A 5JB8S 1P05A 1TQ0B 3O8DA 5EJLA 1NFYA 4OM9A 1O5BB 4ABJA 2KAIB 5C20A 4A92A 2ZCHP 2GV6A 3LH3A 1OP8A 1FAKH 4WWYA 1ZOMA 2GCHF 1AWHB 1RXPA 2PSXA 1UCYK 4AC9A 3MU1A 2P94A 2UWOA 2A1DB 1W7XH 1HAVA 3MO9A 1GJ6A 4XBBA 2R2MB 2D2DA 2QIQA 3K65B 3NPSA 4H42U 3RMOH 1HJ8A 1HCGA 3WWFA 2GJGA 5C0TA 2VWLA 2HRVA 1W11U 4I8KA 1LDTT 2AERH 2Y5GA 3PO1C 4FUDA 2ZF0H 1HUTH 1C2DA 1PPEE 2FI5E 3FP7E 1Q2WA 3GYMA 3A86A 2ZP0H 4FU9A 4KELA 1IHSH 2TGAA 2O8WA 3M3TA 1SFQB 1S82A 3RXIA 1KSNA 5DGJA 4B2BA 1N1LA 6GCHG 4AYYB 3PM3A 4LZ4B 5C5OA 1KIGH 2XBYA 3LOXA 4X6MA 1ARCA 2WPIS 4UFGH 3PTBA 1V2ST 2F91A 2P3TB 3ZVAA 4D8NA 4X1PU 2L6OA 4Y10E 3RXMA 2FTMA 5EGMA 3RXDA 3U9AH 4F55A 1LKBA 2OC1A 2XNIA 2O8TA 2A2XH 1Y3YA 5F53A 5FL7D 4AG2A 2BVRH 1EJAA 2VWOA 3OX7U 3RMNH 1RFNA 1C1PA 4B2CA 4HI3A 4B6EA 4WMEA 3F0OA 3Q00A 2CN0H 3E8LA 4AYVB 3RC6A 1YPHC 3BG4C 1FY3A 4Y71A 3I29A 1O2TA 1SB1H 1GBFA 3V0XA 5FPYA 2G55A 2PLXA 4K3JA 1LVOA 2VVUA 3ZZ5A 1NBMD 1F5RA 2ZEBA 2KR7A 3EA7A 3MMGA 1UTJA 4ABAA 1Y5UT 2CMYA 1FIWA 2A4RA 4FUBA 2VIWA 4I33A 2ZA5A 1O3JA 1BQYA 3SHCH 3ENSB 2ZGJA 1DUEA 3EA9A 1V2MT 4RT1A 5KECA 3GCTF 1VCWA 1MTWA 4XOJA 3NWUA 1AKSB 4E05H 2BQWB 2QF5A 1C5SA 1CT0E 3VB5A 1MTNC 3LPRA 3I78A 5T3HA 4F48B 1INCA 1GBIA 3AAVA 1VITF 3U8TH 1O3DA 1FY5A 1XUFA 1CSOE 2XYAA 2PUQH 3F2GA 5A8ZA 4B1TA 5C1XA 1BTHH 5L2ZH 4UE7H 1D3QB 4NCYA 3TK9A 1GI9B 1SR5C 1MU6B 1PPCE 1IAUA 5HGGA 2Q6GA 2RG3A 1GL1A 1GHXH 4WXVA 1K2I1 1VITH 2GKVE 5LPRA 5CHAC 3TGKE 1DITH 1C1TA 3SV8A 1FV9A 2G8TA 2H6MA 1KMHB 3ZV8A 1C1VH 2HNTC 1VR1H 1UVPA 4CH8B 4YOJA 1P01A 3FP6E 4MG3A 1C5LH 1PPHE 1Z8JB 4RT0A 1RD3B 1IQEA 4FVDA 3ZZBA 1CA0C 2VIPA 2HOBA 2OC0A 3RXAA 4AOQA 3M36A 3GDVA 1C5WB 3KL6A 1L1JA 1YBWA 5C5NA 2ZCLP 1O31A 3E3TA 3O8RA 1C5MD 3QUMP 2BD8A 1HIAB 1J15A 1MU8B 1FLEE 3VGCB 1FNIA 3A7ZA 3SNBA 1H9LB 1D3DB 5DO4H 4FU8A 3P8NA 1Y59T 1B0EA 2ALPA 1QQ4A 4A1TA 3KIDU 1Y3WA 1N6XA 2V3OH 1T8MA 4DURA 1W0JD 3Q3XA 1XKBC 1DDJA 3SN8A 3UUZA 2VVCA 4Q80A 3A7TA 3CS7A 3LGTA 1AFEH 3TJNA 1FJSA 1K1OA 1QBOA 3K6YA 1DPOA 1AMHA 2QF3A 1ZTLA 1AFQB 3QTVH 3H09A 2QF0A 2Y7ZA 4B71A 3BEFB 1RTFB 1O3GA 1UTOA 1GMCG 1V2LT 5DP7A 1E38B 1O33A 4Y7AA 7GCHF 1C2FA 1UVOA 7GCHG 2ZU2A 3DFLA 5I25A 3MOCA 4ABEA 2XBWA 2QXJA 1UTQA 1W8BH 4FXGH 3KYGA 3SI4H 3T25A 1NT1A 1YP9A 2RA0A 1QL9A 2P95A 1WYKA 1O2NA 3DT0H 1GCTC 4K1EA 2ODQA 1TRNA 1B0FA 1HAIH 2FYRA 3BN9A 1KYNA 1AVGH 1QZ8A 5JPMH 1NRPH 4LXBH 1XUKA 2W26A 2Y7XA 5HM9A 1C2IA 5A0AE 2WHXA 1RS0A 2BHGA 1YPHE 3DSPA 1YY3A 4BTUB 2BY7X 1UCYE 2SGPE 3EGKH 3PV4A 2ZU1A 1A46H 1JXPA 5A2MH 4JZ1A 3T26A 3SUEA 2FEQH 1P3CA 1VJ9U 2A5IA 1PPZA 1GHVH 4A7IB 1THRH 4AN7A 2UUKB 1SGFA 2J4IA 4P00A 3LT3A 1EOJA 1KXEA 2ESTE 2VBCA 2FS9A 4HZHA 1GI2A 5L6NH 1ELCA 1LO6A 1JRTA 1SGPE 3M37A 3PMBB 3MTYA 3SV7A 3HATH 4X8UH 1A3BH 3N7OA 1JIMA 2FIRH 3F2HA 1MTNB 4F49A 1OYQA 1BHXB 5T6DA 1S83A 5H4IB 4O3UA 5G4BA 3W1EA 2BXUH 2LP6A 1UHBB 3MI4A 1RGQA 2I6SA 2BTCE 4IC5A 2FZZA 1TB6H 3S0NA 4U2WA 2W5EA 4OS6A 2AH4X 1SOZA 3BSQA 1HAYB 1E34B 1A0JA 1SC8U 1YYY1 4NA7A 4R8TB 4YT6H 3ZZAA 2B8OH 1GI7B 3DSGA 3Q3KA 2ZGHA 1XXFA 3VG8A 1PQ8A 4A1XA 2AGEX 1Y3VA 1GJ4H 1HGTH 3RXSA 1P04A 2XWBI 5EPYA 4CRBA 1O2WA 1BRBE 2Z3CA 2ZFPH 1T8OA 1UW7A 1CT4E 3OU0A 3RMMH 2PR3A 1TNIA 3S7KB 1GBHA 2VH6A 2AFQB 4WVPE 3QK1A 4OGYA 3L6PA 2XW9A 3DHKH 4X1SU 2BDIA 4IMZA 4DVAU 4AFZA 2Z9JA 1O2OA 2NU0E 3BIUH 2FWWA 1UK4A 2CJIA 3P8GA 3TK6A 2BDYA 6LPRA 2BDHA 2GX4A 1O38A 3MHWU 1ELBA 5GCHF 1KY9A 1WUNH 5DP3A 2QXHA 1DXWA 3QZQA 4AFUA 2ALVA 2R3UA 3MWIU 1S5SA 1TMBH 1ZR0A 3OAAD 2F83A 2SFAA 1J16A 1HAGE 1L4ZA 1JOUB 3UPEA 2AIQA 1DWBH 3LU9B 1QB6A 4NIWA 2VGCB 1DUAA 1O2GH 2Q6DA 4ZKNU 1ELEE 1P3EA 3RXRA 3SU3A 2CHAB 1O5AB 3V3MA 4Y76A 5HYOA 3TGJE 3T2NA 1PQAA 1U6QA 1GBMA 1LHCH 3GISB 1EAUA 2A7HA 4NIXA 4NWLA 4U30A 2FO9A 1TRMA 1YLCA 3ZZCA 1TA2A 3GY2A 1TBZH 2A7CA 2GV7A 1ELGA 2W3KA 2QXIA 1WXRA 4A1VA 2V6NA 4BAQB 4FUIA 1CHGA 4JZFH 1AGJA 2TGPZ 4TPYA 4KGAA 2AIPA 1X7AC 1ABJH 1PQ5A 2SGEE 2XBVA 7LPRA 3O8CA 1PYTC 1V2OT 2HNTE 2HWLB 1W7GH 2H9EH 3FVFB 4E7RG 1XUJA 3VGCC 1ZSLA 3VB7A 1TQ7B 2Z9GA 5FPTA 3M35A 5A8YA 2ZPQA 1OX1A 1SVPA 2RDLA 1SLVB 4BAHB 1V6DA 3SU2A 4ZMAH 2CF9H 2GZ8A 1C5UA 2QXGA 3V13A 1O5CB 2YNBA 3RU4D 2Z9IA 1GJBB 1TNHA 1ZSJA 2JH5D 1CGJE 8ESTE 3SW2B 2P8OC 1LPGB 3HKJB 3V7TA 1C2MA 4LZ1H 1MD7A 3VB6A 1EJNA 3M3VA 2C4FH 1TNLA 5HXFA 1SGCA 1G2LA 1BMMH 1EZXC 2ZPRA 1Z6EA 2VINA 1IQIA 4BNRA 3RXPA 1QJ6B 1GG6C 4IW4E 3ZYEA 1TPPA 2BY6X 4MNXA 1J14A 3A87A 1BRUP 3JZ1B 1AIXH 1FUJA 2D26C 1O39A 1EX3A 1O37A 3RXHA 1ZRBA 1CHOG 2BDAA 3F9GA 3P17H 5L2YH 3A80A 4YXWD 3GYLB 1E36B 3OYPA 4X6NA 1IQGA 4YZUA 4X2YA 3FANA 2FPZA 3MH7A 4WJG2 1TMUH 4HG6A 1MKWK 4IC6A 2WV4A 1XX9A 1Z8RA 1JRSA 2BD3A 3NCLA 1ZMNA 1CVWH 1WBGB 4TY6A 3AVZA 3A8BA 1MD8A 1ZPZA 1S0RA 3RLYH 1HJAB 1QIXB 2FOAA 3T29A 2IN2A 1YPEH 3BIVH 3BTKE 3GY6A 3RXCA 1CT2E 3C1KA 2UUYA 1YF4A 1NESE 3PLKA 1H4WA 3LDXH 2HVXA 3UREA 4KTUA 1Y8TA 2QY0B 1ETSH 5C2ZA 4ZKSU 4MLFB 2OQ5A 3UB0A 4AGJA 3TGIE 1HXFH 4O9VA 5F8XA 2F9BH 3QWCH 1ZYOA 3SYJA 1AQ7A 4Z6AH 5LPFA 4UDWH 1YCPK 1BRCE 2BVSH 2VIDA 2VWNA 1HAOH 3WY8A 1ZGVA 2FXRA 5JBAS 5JBTA 4ZAEA 1AE8H
chains in the Genus database with same CATH topology
4U01A 1T31A 2G5NA 1GCTB 1TALA 4INLA 2W3IA 4X6OA 5T6FA 1BTWA 4JYTA 2C8WB 2BOHB 1ELDE 5EQSA 3SQHE 3UR6A 3NXPA 3LGUA 1FZZA 4NSVA 4X8SH 1ZLRA 5F8ZA 1UK3A 2QN5T 3UOPA 4I8GA 4OGXA 3STJA 3TNTA 1DS2E 1O2ZA 2OCVB 2XCFA 4GCHG 3RXBA 2VJ1A 4KP0A 3S7HB 5FXLA 2BLQA 3K6ZA 4Z0KA 3RXJA 1O2SA 1W13U 4Y6DA 3SZNA 4ZXXH 2BMGB 1N8OC 3URCA 1O5EH 1VZQH 3ATIA 4CBOA 3RU4T 2G52A 2GD4B 1CGIE 3ATWA 3EQ0H 1GL0E 1EPTC 1ELFA 1NU9A 3LC5A 2O9QA 2C8XB 5K0HA 2BY9X 5C3NA 1MZAA 2R0LA 4ABDA 5B6OA 1GI1A 4R0IA 1NFXA 1C1NA 1EXFA 1MH0A 1K1PA 5BRRE 3OTJE 3U1IB 4D76A 4MPVA 3A81A 1O3AA 1BITA 5FX5A 4ZKRU 1IQHA 1K22H 1GHWH 4AX9H 5DP8A 2H9HA 1G32B 1GHAF 2BQ7B 3SJ8A 1EAIA 1RIWC 2ZHQH 3SGQE 2VH0A 4MPXA 1O3BA 1HAXB 1NRRH 3LONA 3GCOA 1FY4A 3RC4A 3EDXB 1C4U2 2AMDA 2Y5HA 2GVFA 1LVMA 5LH8A 1Z6JH 2H5DA 1DWEH 2J9NA 3RUOA 4BTTB 2BD7A 2ZC9H 1S84A 1TAWA 3UNRA 3TVJB 2FYQA 1O2UA 3F9HA 1VGCC 1OWJA 8KME2 2PUXB 3AW1A 1UTLM 3FAOA 4JYUH 5IDKA 4WH6A 4BANB 5AFYH 2Z3EA 2XC4A 2UWLA 3E0NB 1NM6A 4GAWA 1SHHB 2BZAA 3RP2A 1A5HA 2FP7B 1G3BA 1ACBE 3M5NA 1HAZB 2VB0A 1P06A 1SG8B 1ZPBA 5FPSA 1UVSH 3GY8A 3MO3A 2C90B 2EI6A 3BTME 1TGNA 3UTUH 3KQEA 4D7GA 1F0SA 1Z8IB 4YO9A 2B0FA 4TWWA 1P10A 2AS9A 2ILNA 1QFKH 1GVZA 2A31A 1FN6A 4J1YA 2SGAA 3ATKA 1S6FA 2ZKSA 5EQRA 1WSSH 1RIWB 3CENA 1FONA 5AF9H 3B9FH 1BZXE 2ZTYA 1P9UA 2P8OB 1KLTA 1TX6A 1TRYA 2ZPSA 2G4UA 2HLCA 1GG6B 3DFJA 3RXGA 1GHYH 1GBJA 1HFDA 1DLKB 3GY7A 1C1SA 2PV9B 1OWHA 2XRCA 4CHAC 2BY8X 2GT7A 5ESBA 3F9EA 1AFQC 1C4V2 4RN6A 2F9PA 1GBDA 1S85A 4I8JA 4X1NU 3H5CB 3PO1B 1MTUA 1O3FA 3T62A 4XBDA 1BJVA 1O35A 1QJ7B 2F3CE 1W0YH 2BOKA 1TX7A 1YPGH 5DPAA 1BB0B 1O34A 1BUIA 2ANKH 4MPUA 1ZJKA 4ASHA 4Y8YA 3BV9B 2A45B 2QGRA 5ETXA 3F1SB 2BYAX 1C1WH 1LQEA 4YLUA 1HIAA 1HBTH 1O2HA 1LCYA 4I8LA 4I32A 2F9UA 1O2LA 1V2RT 1DANH 1BOQA 1IQFA 3QDZB 1W3CA 1GBKA 4ZKOU 5GJ4B 1O0DH 1O2QA 2J2UA 1V2VT 2ZGXH 5HM2A 1VJAU 4GUXA 1T32A 4JK6A 2HPPH 1EJMA 4VGCB 8GCHF 1MQ5A 2VNTA 3AASA 2B5TB 2OP9A 1O3IA 2NU1E 3RXQA 2ZI2H 4B2AA 4YLQH 4BXWA 1FPHH 4DOQA 2BM2A 3GCHB 1QA7A 1A7SA 1E0FD 1K28D 3FFGA 3LJJA 3QTOH 3ZVBA 4CBNA 2FOMB 1BHXF 1ZPCA 4RKJB 5EW1H 3MU8A 3PMJA 3P70B 4IBLH 2XCNA 1OOKB 3GCNA 4PROA 2XBXA 1ZJDA 2FDAA 3A88A 5E2OA 4IN1A 1C2GA 4ZHLU 1GBEA 2EEKA 1JMOH 3I77A 3GDUA 3TH4H 1F5KU 2BXTH 3M5OA 2GMTB 4X1RU 5DKMA 1V2PT 1QCPA 1IQMA 2XC0A 3BTQE 1Z8GA 8LPRA 1BTUA 3BTTE 4DW2U 1UTMA 1KDQB 4MNYA 4TYDA 5E2PA 3BF6H 3TU7H 5IYTA 1OP2A 1WAYB 9ESTA 1LPKB 2THFB 2VIQA 3SU4A 1SI5H 5J4QA 4IGDA 4CRAA 1HNEE 4NA9H 1TA6A 1AWFH 3K9XB 5GCHG 3RDZA 1C5RA 3LGVA 4GSOA 2Y81A 1QRWA 2C8YB 4MQAA 1C1OA 3NK8A 4XE4A 2OUAA 1YCPM 4ISLA 2Y82A 1CE5A 2FI4E 4ISIH 3BG4B 1EB1H 1O3HA 2TGDA 4K2YA 2TGTA 4GLYA 1HYLA 1SHYA 4YESB 1JBUH 4ABGA 4D9QA 1TGSZ 3D62A 2BD5A 2FI3E 3VFEA 2P3UB 3MNSA 1G30B 1L0ZA 3SJKA 1XVOA 2ANMH 1ZSKA 1C2JA 2O8LA 2FS8A 1BMAA 1YPLH 2Y6TA 4YM9A 3E0PB 4XSKU 1Y5AT 5J4SA 1OP0A 4I7YH 5JBBS 5PTPA 3VB4A 3TJVA 2TPIZ 4CRCA 2ZTZA 1UO6A 2BZ6H 2A2QH 1A0HB 1ETRH 3L33A 4GCHF 3ZZ3A 2WUBA 3ODFA 2OC8A 5DG6A 1D9IA 3KQDA 3SU0A 2OBOA 2EA3A 2P93A 2ZFFH 1BDAA 4CRDA 1Z7KA 3STIA 3SJ9A 1BBRH 5AVDA 4Q7XA 2RCEA 3EE0B 1P9SA 3MU0A 1HJ9A 4NZQA 3BEUA 3UWIA 1ORFA 1P2MA 4JZIA 1BRAA 1FQ3A 1AUTC 1ANDA 1O32A 3S69A 4TPIZ 3BTEE 3RXLA 1RTLA 1DVAH 1GGDC 5DP9A 3RMLH 3ZYDA 3OY5U 1CA0B 3OY6U 3SJIA 3UNSA 3DUXH 3GDSA 4NFEA 3SNDA 5K7RA 4ESTE 3ATLA 2H2ZA 2ANYA 2OLGA 2WPMS 4QT8C 2XTTB 5FCKA 3ESTA 8GCHG 3SNCA 5I46H 1V3XA 1A5GH 4X2XA 4CRGA 1DWDH 1XXDA 1C2HA 3ZZ4A 1FAXA 4JZEH 1GBTA 3DA9B 1LKAA 1HB0B 2R9PA 2SGDE 1V2TT 1SBWA 3NKKA 4NSYA 1DSUA 1DICA 5GDSH 1XMNB 1EPTB 1QA0A 3BEIB 2ZQ1A 1O5DH 4NIYA 1QB9A 1C1MA 3MU4A 3P6ZB 1DLEA 1DWCH 1MBMA 1SMFE 2AGIX 1GPZA 5F6MA 3PROA 1ZZZA 1CHOF 2IOTA 4GVUA 1KLJH 1O3EA 1J9CH 1YLDA 1ANBA 3D65E 1FPCH 1BCUH 3HGNA 2OBQA 3K2UA 4WH8A 2HALA 4GHTA 1GJDB 4K60A 4K8YA 4AFQA 2ZFSA 1HPGA 4B74A 3VEQB 3HK3B 2WYJA 1ZHRA 2FOGA 2J92A 1O2XA 1WTHD 1C4Y2 2ZG0H 2O8UA 3W95A 3TH2H 1G2MA 1RRKA 1EPTA 1TOMH 1T4UH 4K69A 2BB4A 3QZRA 2GT8A 5A8XA 5E8EH 2ZFQH 3MH5A 1VCQA 1EZQA 1O5FH 1WOFA 3PMAB 3EAJA 4X0WU 1ESBA 3QN7A 3BTWE 2GDEH 2DUCA 1Y5BT 1EP5A 3SHAH 3LC3A 1NC6A 3PWBA 1D3PB 3E91A 1GI8B 3SUGA 2FOBA 4NFFA 3ZVDA 1QHRB 1UTKA 2ZTXA 3M61U 2PKSC 1ZTKA 3H7TA 1EZUC 2QYIA 3M5MA 3HKIB 3VB3A 4XBCA 3GY3A 3ZZ7A 1A1RA 4BAOB 1O3KA 1GMDG 1O2PA 1D4PB 4JK5A 1TGCA 1CU1A 2UUJB 1HJAC 1W10U 2H1UA 4ISNA 2QV1A 1WU1A 4OS1A 3RXFA 1DE7H 4DIHH 2W7SA 1MAXA 1L1GA 5EQQA 2GDDA 5AFZH 1C5VA 3P8FA 1KTTB 4WF8A 3IG6B 4IMQA 3RXVA 1TNGA 4Y11E 2OINA 1ESAA 1ARBA 1D3TB 1TABE 1GHBF 2Z9LA 1JWTA 1GJAB 1EB2A 6ESTA 2Y80A 1YPJH 4GPGA 1SOTA 1OYTH 1TPSA 5EPNA 2JH0D 3MYWA 2P3FH 4LOYH 1KXCA 1P2OA 4X1QU 1OWIA 1SL3A 3VPKA 1UCYH 1GJ9B 4ZUHA 3LGYA 1G3EA 4ZHMU 4E7NA 2TBSA 4DY7B 1GJ8B 1TBRH 3PMHB 1LHGH 1MCTA 1EUFA 1P0SH 1GBLA 1WCZA 1BBRK 5EXMA 2ZZUH 2FX4A 1ZHMA 3PB1E 1SQOA 3M5LA 1ANEA 1A3EH 3SO3A 4H4FA 1MCVA 1YM0A 3F9FA 5GPIB 3T28A 1G3CA 5E0HA 1SGYE 1EP6A 2BDBA 4I31A 4BAMB 2FM2A 1JIRA 1MKXH 2VIVA 1ELAA 4K8BA 4VGCC 2NU3E 3SORA 3SUFA 4X2WA 3RXUA 5TCAA 1QL7A 3S9AA 2GZ7A 1K1LA 1M9UA 3A8CA 3A84A 3KF2A 2OD3B 4B76A 1O3NA 1QJ1B 2WPJS 1DY8A 2M5TA 1AY6H 4MVNA 2WPHS 2ZECA 3FP8E 1SGEE 2CF8H 4BOHA 1MKWH 2K1QA 4UFDH 3UOUA 2W7UA 1AVWA 4Y8XA 2FLRH 4CREA 1YGCH 2J34A 2HPQH 3D49H 1C5YB 4OS7A 1C5QA 2QC2A 1WV7H 3E16B 1BA8B 2JH6D 3UY9A 1V2NT 1NTPA 3Q3YA 1UJ1A 1UVTH 2BD2A 4I8HA 2BQ6B 1K1JA 5LGOA 2IJOB 1QGFA 1Y3UA 1O2YA 1P09A 4YT7H 2SGFE 3ZZ6A 1J8AA 2ZDAH 3QO6A 1AUJA 1UHBA 4AB9A 4ISHH 3KNXA 2PW8H 3GY4A 3ATMA 4O97A 5DJ7A 1LMWB 2BD4A 4FU7A 3SUDA 7ESTE 4AGKA 2STBE 4MNVA 3DD2H 2VU8E 2ZHDA 5EG4A 2AYWA 2ASUB 2IPHA 2C93B 3RXKA 3ODDA 3NUMA 3TITA 1MZDA 4YOGA 1FIZA 4X2VA 1C5XB 1C1QA 3HGPA 3OSYA 2EI7A 1O3MA 3IITA 1C1RA 1O2MA 1FI8A 1F5LA 4IN2A 1UTNA 1W14U 1WQVH 3MH4A 2WPLS 3IWMA 2Z9KA 5CMXH 4DG4A 1DXPA 3RXEA 1EQ9A 1ZHPA 4OS2A 4GHQA 3V12A 1GI3A 2ZIQH 1C5NH 1ELVA 1MQ6A 3LGWA 1J17T 5FCRA 2HGTH 1P12E 3SI3H 4ABBA 3RM2H 1SGDE 4M7GA 1BTYA 4Y0ZE 1V2WT 1C2EA 3RC5A 1A5IA 2PKAB 3M7QA 3A82A 1C2LA 4ZXYH 1ESTA 1E35B 1TX8A 4ZH8A 3RLWH 3UIRA 1KXFA 5DK1A 4FUCA 1AE5A 1AB9B 1SGQE 1MUEB 2FOEA 2C3SA 1GWAA 4Y79A 2A5AA 1AB9C 4MNWA 1PYTD 1A61H 5AHGH 2C8ZB 1F0UA 2BDGA 1OWEA 2FMJA 2A5KA 4UEHH 3FZDA 5T6GA 3A7VA 2Z7FE 3ELAH 3NZIA 2V35A 3MNCA 2FOFA 3U8RH 2V0BA 2R0KA 3LKWA 1C9PA 1LQDB 2DE8A 1GI6A 5EW2H 4K1TA 2FOHA 1F0RA 3EYDA 1SSXA 1DY9A 1OS8A 1SLXB 5JYIA 1TE0A 4X6PA 5EODA 1BJUA 2R3YA 2YOLA 1LVBA 3SU5A 4CRFA 3SV9A 3BTHE 1F2SE 4IS5A 4BTIB 3Q77A 4UD9H 2AMPA 2GP9B 2BLWA 5CE1A 4O03A 2UWPA 3TIUA 3PYHA 2GCTB 1GGDB 1BMNH 5ESTE 2R2WU 3MNXA 1MAYA 1RJXB 1DM4B 1W0ZU 1TPOA 3M7TA 2BLVA 1GVLA 1P57B 4AORA 3SNAA 2ZO3H 1C5TA 4UONA 1GJ7B 1HXEH 4DJZB 5FHTA 4X8VH 2FLBH 2ODPA 3A7XA 1EAWA 1GI0A 1FXYA 4YOIA 1DFPA 1TNKA 1YPMH 1Z1IA 3B8JA 3TK5A 1WQSA 3MFJA 1BMLA 1QB1A 1W12U 3E1XB 1IQJA 2NU2E 4CHAB 1MKXK 3U8OH 2J38A 4F4OC 1SQTA 2YNAA 1O3PB 3ZVGA 3ZZ9A 2PWXA 1A2CH 1YPKH 1GMCF 4THNH 1VCPA 2Q6FA 3KCGH 2GCTC 4X8TH 4Q2KA 3ZV9A 2EI8A 4RKOB 1L1NA 1T7CA 2ZDMA 4AG1A 2UUFB 1O2RA 1C5ZB 2QA9E 4H6SB 1GHBG 1AZZA 3CP7A 4MPWA 2ZCKP 1BBRE 3UQOA 1MMJN 1QBNA 2ZGCA 3SQEE 1NU7B 1QTFA 2FTLE 1T8LA 1N6YA 2F9NA 1GDQA 3SJOA 1FN8A 2JETB 5CHAB 1HDTH 5GIBA 1SGTA 4OS4A 1BTPA 2ZHFH 2F9VA 4HTCH 1C1UH 3EA8A 2STAE 4Y0YE 2PKSB 4U32A 1Z1JA 3GOVB 2EC9H 1UVUH 9LPRA 4KTCA 2PFEA 1NO9H 3RM0H 1OWDA 4J2YB 1TPAE 4FUHA 1P2KA 1HLTH 4BAKB 2A0QB 5JB9S 1V2JT 2NU4E 5A09A 3URDA 1F0TA 3R0FA 1O2KA 1TLDA 2VVVA 2ZHWH 1O3OA 1KDQA 4FVBA 2OXSA 2PKAA 1K21H 2A4OA 2WUCA 1OSSA 1TONA 1KXDA 3TH3H 1THSH 1A0LA 5F8TA 2O8MA 1LTOA 2D1JA 1Z71A 2JKHA 1P11E 5A0CA 1BTZA 1K1MA 2B7DH 4TY7A 2NWNA 2BDCA 2BY5X 2Z6BD 4DIIH 1GDNA 4INHA 1C2KA 3C27B 2CHAC 3MU5A 2WPKS 2ZU4A 4B75A 1TMTH 3TLOA 4JMYA 2A4QA 2CV3A 3RXOA 1O3CA 2KAIA 3KHVA 3A89A 4YTAA 1NN6A 6CHAB 1GJCB 3QX5H 4NA8A 5FBEA 3G01A 5DP4A 1TGBA 2BVXH 1S81A 1QY6A 3ZZ8A 5E0GA 2ODYB 5C1YA 3E90B 1Q3XA 1FY1A 1OWKA 1BIOA 2XXLA 7KMEH 4WMDA 1UMAH 4DGJA 2OC7A 4Y7BA 3ZZDA 2VWMA 4UFEH 3MH6A 3A7WA 5EU8A