1BQYA

Plasminogen activator (tsv-pa) from snake venom
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
234
structure length
234
Chain Sequence
VFGGDECNINEHRSLVVLFNSNGFLCGGTLINQDWVVTAAHCDSNNFQLLFGVHSKKILNEDEQTRDPKEKFFCPNRKKDDEVDKDIMLIKLDSSVSNSEHIAPLSLPSSPPSVGSVCRIMGWGKTIPTKEIYPDVPHCANINILDHAVCRTAYSWRQVANTTLCAGILQGGRDTCHFDSGGPLICNGIFQGIVSWGGHPCGQPGEPGVYTKVFDYLDWIKSIIAGNKDATCPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLASMINOGEN ACTIVATOR
publication title The crystal structure of the novel snake venom plasminogen activator TSV-PA: a prototype structure for snake venom serine proteinases.
pubmed doi rcsb
source organism Viridovipera stejnegeri
molecule tags Hydrolase/hydrolase inhibitor
total genus 51
structure length 234
sequence length 234
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1bqyA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1bqyA02
4O3UA 3BIUH 2WPIS 2OXSA 1GJ7B 3SORA 1NFXA 4IGDA 1UCYK 2ZPRA 4AGJA 1ZRBA 4I32A 3ZZBA 3LU9B 4X1PU 1BMAA 1ZMLA 1FIZA 1HNEE 1VJAU 2F9PA 3ATLA 1K21H 3F68H 4IN2A 3ZVFA 2F91A 2QGRA 1PPGE 1Q2WA 2TGDA 3EA8A 3A86A 5EGMA 5IDKA 4X2XA 4FU8A 2ALPA 2FP7B 3SNBA 1V2LT 5FBEA 1X7AC 4A6LA 4OS6A 1O2OA 5BRRE 5E2PA 1P02A 1TB6H 3BN9A 3A84A 1C1VH 3GOVB 1E34B 1GBCA 1Y5UT 2BD3A 1GHBF 1DSTA 4Y7BA 3UQOA 1IQJA 3I78A 1SGIB 2TBSA 3BTGE 4AB9A 3GY7A 1L0ZA 1B0FA 2AIQA 1TNIA 1G3BA 2ZU3A 4CRAA 3SOSA 3RU4T 7ESTE 2ODQA 2D8WA 1FONA 1N8OC 2AERH 4MG3A 1HAOH 2EI7A 1SL3A 2BLVA 1AVGH 4CBOA 3AW1A 2FTLE 3ZZ5A 3KQBA 1WU1A 1RRKA 2DE8A 4H42U 4ZKRU 3ZZ4A 1THSH 3BTEE 2WYGA 3VGCB 4Q2KA 2QN5T 3LGTA 4CR9A 3GICB 4X6OA 4Y79A 3SGQE 1SGYE 4I33A 1V2TT 1A46H 1ZHMA 5A2MH 5EXLA 3W94A 1OYQA 3BEFB 3LPRA 2V35A 2F9OA 1LTOA 2G4UA 5EW1H 5G4BA 5T6DA 3SI4H 1DUAA 4DJZB 1SSXA 1BTYA 4IS5A 3ZZ7A 1XX9A 1HIAA 4Q7XA 2P95A 2B7DH 1PQ5A 1A4WH 3RXIA 4OGYA 4CBNA 1YCPK 4A92A 2H9TH 3FVFB 2K1QA 2NU1E 1MBMA 4Q7ZA 3SI3H 4ZKNU 1CGHA 3SUFA 2ZHFH 4VGCC 5JBCS 4FUIA 1O33A 3OY6U 3LC5A 1BA8B 1H9IE 4HTCH 4LZ4B 3RC6A 1DWEH 1FIWA 1HRTH 1S6HA 1QRXA 1LQEA 2W7UA 1ETSH 1QURH 5FXLA 3A8AA 1NRSH 2ZCKP 3E6PH 1NFYA 2RCEA 1HBTH 1PJPA 3STJA 4XSKU 1DY9A 4YOGA 2JETC 3GDVA 3TJOA 3PLKA 1G3CA 5EXMA 2P59A 4Y8XA 3E3TA 4X8SH 3VB4A 1TPAE 2G52A 3R0FA 3U9AH 3OYPA 1K22H 3SV7A 3A8DA 5GIBA 1MKWK 1YYY1 1O2VA 2J94A 5DP4A 3UNQA 4MTBA 4B71A 2OQ5A 1NFWA 3GY2A 1C1PA 4ZUHA 4WMFA 3P92A 1EZSC 1ID5H 3BG4C 4TWYA 4CHAB 1G30B 3BV9B 3SU4A 2THFB 3I29A 2OD3B 3SW2B 4X1NU 3QN7A 2WUCA 3RMNH 1C9PA 3DFLA 4GLYA 2A7HA 3U8OH 3PMJA 5I46H 1FLEE 4JK5A 1F0SA 3M3VA 1TA6A 1YPKH 4Y8ZA 1S83A 1KXAA 3E0PB 2GCHF 1K1JA 4ZXYH 1BITA 3C27B 3MO6A 4K1SA 5FPSA 5SGAE 1KLIH 1W12U 1MAXA 1OYTH 4X6MA 1BB0B 3FANA 1QY6A 2QXHA 1ZJDA 1GMCG 2A4QA 2XC4A 3UWJH 5L6NH 3SNEA 1C5XB 2H5DA 5JB8S 1BBRE 1O2HA 2CF8H 4FU7A 1SG8B 2TIOA 1EAXA 2VGCC 1C5QA 2YOLA 3KHVA 1AO5A 1C5OH 4CRGA 1DOJA 1N6XA 1K1LA 2R2WU 1EKBB 1TGCA 3SNDA 2Y82A 1CA8B 3RXCA 1C5YB 5DP8A 2G4TA 1O34A 4GCHF 3K9XB 3KNXA 1E36B 1GBTA 2BMGB 2JKHA 1AU8A 5F6MA 2IPHA 2BDAA 2G55A 3LGUA 1GHAF 1TX6A 4UFDH 2XRCA 1RGQA 5C20A 3BTQE 5L2YH 1KSNA 3SV9A 1MBQA 5JDUB 2TRMA 4I8LA 4NFFA 3RXDA 4H4FA 1V2OT 5DP7A 1DXPA 3SNAA 1ZTKA 4JZFH 1RFNA 1SLVB 2C93B 3A7XA 1TPSA 3TIUA 1EZQA 2H5CA 5T6GA 8GCHF 3CP7A 1DWCH 2V6NA 3MFJA 2VWOA 1UTLM 2ANKH 3BF6H 2ZPSA 2WPJS 1FN6A 1MTWA 2G5VA 3F9FA 3KEEA 4Y11E 1CO7E 3VPKA 1P2IA 1AFEH 2C8XB 3UFAA 3MH6A 3TPIZ 1UTNA 2IOTA 4ZHLU 1Z6JH 1C1OA 1EXFA 2XWBI 3E0NB 1GHZA 2XXLA 1D3QB 3QDZB 3MMGA 1O2SA 2SGQE 2ZNKH 4AFZA 1IQIA 1EUFA 5EQQA 1HAXB 2OC7A 3KQDA 3QO6A 1SGFA 1UVSH 3RC4A 1O3BA 1GBBA 2ZDMA 1SGDE 1TGTA 1F0RA 3GY8A 2QF3A 2FXRA 3SHAH 2GT8A 1UHBB 3RC5A 2VVUA 1MU6B 1EJMA 2FOGA 4WVPE 1EX3A 1KTTB 3LT3A 5EQSA 2W5EA 1GDNA 1OOKB 1K9OE 1N6YA 3RLYH 1O5FH 2G81E 3SBKA 2BYAX 3P8FA 1OP8A 3EA9A 3NZIA 4JZEH 4UFFH 4F49A 1O2ZA 1O31A 4AGKA 7GCHG 3LDXH 2BY9X 2ZGJA 2SNWA 2HLCA 1KXFA 1C2DA 1FAKH 1PYTC 1O5GH 4WXVA 2UWPA 9ESTA 1O32A 4B75A 5DP3A 1TONA 1ACBE 1C9TA 4DVAU 1C5RA 3MU4A 4SGBE 2BDCA 2OQUA 4AB8A 1T4VH 4BXSA 2PGQB 2ZHWH 1EJNA 4BTIB 1HJ8A 1SOTA 1E37B 2Z9JA 1S81A 1B0EA 1KDQB 2ZZUH 1T8OA 2P16A 3HATH 1UCYE 2ULLA 4NA7A 2VIPA 1MMJN 3LJJA 5EOKA 1YPJH 3F9HA 1QRWA 3GDUA 2FX4A 1O5BB 1DFPA 1FNIA 4IW4E 1O35A 3T28A 3ESTA 5FCRA 4A1XA 2VVVA 5JBAS 1XUGA 2A5AA 1MQ5A 1SGCA 3GY6A 2GX4A 2V0BA 1V3XA 2A4RA 3MTYA 3SJ8A 1V6DA 4XBCA 3TH4H 1AWHB 2QXIA 3RXAA 1ZTLA 4YLUA 3PO1B 2XCNA 4O9VA 2H9HA 2VIWA 1AIXH 1IQGA 3UQVA 4GUXA 1S6FA 1YGCH 2BOHB 1QBVH 2ZFRH 3BTME 4NIXA 3TLOA 4ABGA 3TGIE 1J16A 1ZSLA 2QAAA 3ZYDA 4Q80A 5JBBS 5GWZA 1BTUA 4YT6H 3P8OA 1DLEA 3MWIU 1EQ9A 1AB9B 1DITH 2B5TB 2R2MB 2G8TA 1QJ7B 2ZQ2A 1O2QA 3GYLB 2BY5X 1YF4A 4NIVA 3HK3B 4XE4A 1VCWA 3SHCH 5EQRA 2XC5A 1P10A 2H6MA 1V2UT 3UTUH 1A7SA 1OWEA 3SU3A 5EPYA 1L2EA 1LHCH 4KGAA 1IQEA 1O2WA 4LOYH 3LGYA 1N1LA 2BTCE 3FP8E 3OSYA 4I31A 2FZZA 1BJVA 1W7GH 1D3PB 7LPRA 3MH7A 3RMOH 2R9PA 4ISHH 3RXQA 3F6UH 3RLWH 4ISIH 2J2UA 1D4PB 1ZJKA 5ESTE 1J15A 1VR1H 4Y76A 2ZFSA 1C5TA 2FOEA 3VB5A 3CENA 3NUMA 1LQDB 1SOZA 1NRPH 1GCDA 5FX5A 5LPRA 2CJIA 2Y5FA 2ASUB 4Y0ZE 2D2DA 4DIIH 1BRCE 2XBWA 1MD8A 3MH4A 5T6FA 1H9LB 1EPTC 3UNRA 3A8CA 2PKAB 4HZHA 2F9UA 1HXFH 3PROA 1UTQA 1RXPA 1O3FA 1TIOA 1NFUA 5DK1A 2F83A 4GHQA 4YOIA 1O2UA 4TY7A 4NA9H 1MCTA 4INLA 1WSSH 2Q1JA 3IWMA 1D6WA 1XUJA 2D1JA 1TGNA 2ZQ1A 1A2CH 1NU9A 1O2IA 1UTOA 3F9EA 5F8ZA 4X8UH 2ZCHP 1HCGA 1UHBA 4NGAH 4I8JA 1V2JT 3SJOA 1GPZA 3TVJB 2CGAA 2ZP0H 5FX6A 1S5SA 1VITG 3AAUA 2J9NA 1C1UH 1IOEA 1C5PA 1GMHF 1JXPA 2EEKA 4ZAEA 1GBEA 4MNYA 1NC6A 4Q7YA 1G36A 5FPYA 1FAXA 4ABEA 1P3CA 2O9QA 1DE7H 1FDPA 2GTBA 1ZRKA 1BHXF 1FPCH 1OXGA 4B74A 3M7QA 3D23A 2OC1A 1KXDA 3SU2A 1PPZA 1NRNH 4MNXA 1OWHA 1ZLRA 2CXVA 5I25A 3LGWA 2Q6FA 1BTWA 3D49H 2GT7A 2J95A 4B76A 1GBLA 5IYTA 3QX5H 2YNBA 4TYDA 1SHYA 3A83A 3BTHE 1P9SA 1DSUA 5GXPA 1CT0E 3O8BA 4BTTB 3UREA 3PTNA 3MYWA 1YBWA 1QB1A 5FCKA 2STBE 1KDQA 2OBQA 2R3YA 2Z9KA 1N8OB 1O3HA 1MZDA 1P57B 4A1TA 4ISOA 2BVSH 1K1MA 4BAHB 2FX6A 1ZMJA 1P11E 1TQ0B 3ZVCA 5GPIB 5EU8A 4ABIA 1O39A 3T26A 1CT2E 2FO9A 1QBNA 1JMOH 4WF8A 1OKXA 2R3UA 3BG8A 3RXJA 1TNJA 1C1MA 3BIVH 2ZDVH 4DIHH 3LIWA 1DUEA 5DGJA 4ABDA 1DT2A 1HV7A 2PV9B 4JMYA 4Z0KA 1OX1A 3A7ZA 1J8AA 3LH3A 3RM0H 2UWLA 3UOUA 1UVPA 1KTSB 3K6ZA 2OCVB 3F1SB 2UUYA 4WWYA 1O2GH 4K69A 2EA3A 2WUBA 1QA7A 4AG1A 1BT7A 1L1GA 3MH5A 4PROA 5PTPA 4BAOB 1PYTD 4MPVA 2W7SA 5AVDA 3QWCH 3S7KB 4VGCB 2ZG0H 3ZVGA 1UK2A 2BDHA 2ZEBA 1LVOA 1P04A 3P95A 4UFEH 2ZC9H 1QL9A 4FVBA 2BLOA 3RXPA 1QGFA 3LKWA 1CU1A 1O2YA 3QTVH 1BBRH 2XC0A 4OS1A 2ZTZA 4X2YA 1LPKB 1HLTH 4NZLA 1IQNA 1GHYH 1XVMA 1W10U 4FXGH 5ETXA 1O5EH 4X2WA 1SGQE 3OY5U 2GZ7A 1SI5H 3FAOA 4ZKSU 3URCA 2OC8A 2XBXA 3H7OA 1SLUB 2XYAA 4K3JA 1DM4B 1V2MT 1JRTA 2HNTF 3SV2H 5C1UA 2FPZA 3PYHA 3GY5A 2JETB 3ZVEA 2GMTC 4I7YH 3A89A 4FUBA 1QTFA 1NO9H 2PKAA 1F5LA 1IQKA 1V2NT 1QQUA 1OWKA 2QCYA 1T32A 3SU1A 1UTKA 2A31A 1AUTC 4INKA 5F8TA 1LPGB 2FYQA 4Y0YE 4YOJA 1WAYB 3ZV8A 4B2CA 1WTHD 2GCTC 3UY9A 3BG4B 2VIVA 1TNLA 1JWTA 5LPFA 2XTTB 1ETRH 3ATIA 1C1WH 1KY9A 3ZVBA 2HRVA 3MHWU 2OINA 1AQ7A 2B9LA 2V3OH 1ELEE 2A2XH 2PR3A 1NS3A 3V3MA 3ZZ9A 4IMZA 1D3TB 4X1QU 2J92A 4TPYA 3MI4A 2BDBA 2AIPA 4E7NA 1ARCA 1G37A 1ORFA 1YCPM 1KXBA 1W2KH 4AG2A 1FXYA 4OS5A 1H8DH 1INCA 1P8VC 4I8HA 3MNCA 1AY6H 1FQ3A 2Q6DA 3SJKA 1HDTH 1A5HA 1TA2A 1JBUH 2QXGA 4CRFA 4AFQA 1LCYA 2IN2A 1C2IA 4K8BA 1P9UA 1TRNA 1SB1H 2VGCB 2VIQA 1SQAA 2P94A 2RG3A 3EYDA 3P17H 1H8IH 1V2ST 2BZ6H 2A0QB 4GPGA 4NSYA 4UE7H 1HAPH 1GI6A 1DICA 2BD7A 5HXFA 1GHBG 3QLPH 4YZUA 2NU0E 1WV7H 1TPPA 2WPHS 4DOQA 1EB2A 1UTPA 2A5KA 2SNVA 1GJAB 3M35A 1GVZA 5K7RA 4HGCA 3PM3A 1YPLH 3M5OA 3DUXH 2ZCLP 2STAE 2FESH 4ZH8A 1O3GA 1C2HA 6LPRA 6ESTA 1GJCB 1GI9B 2DUCA 2W3KA 5JPMH 4LXBH 4U2WA 1TLDA 2FDAA 1CBWB 3EGKH 1GJ9B 2GV6A 3N7OA 2H1UA 1CQQA 3M3TA 2G00A 3VEQB 1GI4A 3AVZA 3H7TA 6CHAC 1C1TA 4UD9H 1J14A 3RXRA 2ZO3H 1TX7A 1O3PB 3PTBA 4DT7B 1YPMH 1J17T 3K6YA 1E0FD 4CRDA 1HAVB 1GMDF 1LHEH 1BTZA 3QGJA 1YP9A 4GHTA 1UTJA 4B2AA 1C5UA 2VJ1A 1ZPBA 4R0IA 5ABWA 7GCHF 3BEUA 1C2GA 3SUGA 1GVLA 3P8GA 4GAWA 3TJVA 3BEIB 3TITA 1SC8U 1GL1A 1ABIH 3A7WA 2QY0B 1MTVA 2PFEA 1UVTH 2ZDKA 3L6PA 5C1YA 1CHOF 1O3NA 3RXUA 1F92A 3EE0B 4WH8A 1AD8H 2FIRH 4TWWA 4MNVA 1KXCA 2VVCA 4I8KA 4D9QA 1C1QA 2AFQB 1G3DA 5ESBA 2BY6X 1WTGH 2AS9A 3KQCA 1CBWC 2PUXB 2HGTH 1OWIA 1CGIE 1QJ1B 2AEIH 2VWLA 4DW2U 1C5MD 4O3TA 1MU8B 3E90B 1XXDA 2QC2A 2WYJA 3M5NA 1XMNB 2ZHDA 1NN6A 1QBOA 2ZTYA 3STIA 3ELAH 5EODA 3TH2H 4ZHAA 1MTSA 1GBIA 1L1NA 1PQ8A 4WXIA 2BB4A 3TNSA 1FPHH 3VB7A 5CE1A 1BMMH 2F9NA 1BCUH 1LDTT 3PMAB 1GGDC 4IBLH 1ZPCA 4KTCA 4A5TS 1YLCA 3PMBB 2WPKS 4WJG2 1C4Y2 3T29A 3SZNA 4DURA 1V2PT 4Y7AA 2VU8E 2Z94A 4M7GA 2P3UB 1NT1A 1CA0C 1FUJA 1JIRA 3BTDE 3GYMA 3VB6A 4CREA 3A80A 1ELBA 3RXKA 2C4FH 1SLXB 3NXPA 4CRBA 2BY8X 5AF9H 1ZTJA 3U8TH 1ZHPA 2Y6TA 2GCHG 1MUEB 3HGNA 3M7UA 2A7JA 4B73A 4AN7A 4IN1A 1IHTH 1MTUA 4OS4A 2WV5A 5A0BA 1Y3UA 2Z7FE 4JZIA 1L4ZA 2QA9E 4DGJA 2DE9A 1GI5A 4RSPA 3UOPA 1C1RA 4ABHA 1FN8A 2CHAC 3HKJB 1OWDA 3TJNA 1IQFA 1O0DH 1M9UA 2C8ZB 2FS8A 4BAQB 1GI1A 2O8UA 2PSXA 3C1KA 2NWNA 1FY4A 1MZAA 3DD2H 2BZAA 1MH0A 2SGDE 5F8XA 1TMTH 4GCHG 1HAHH 2J38A 2ZECA 1LHDH 4NG9H 1G2LA 2A1DB 1GHAG 2BLWA 2BVRH 2ANMH 1HAYB 1GJ8B 1TBZH 4BAKB 4Y8YA 3TGKE 3EA7A 1YPGH 2FLBH 3V12A 2A4GA 4ABBA 5DG6A 3OU0A 1GBJA 4XBDA 2H9EH 5K0HA 2PKSC 1FV9A 2FTMA 1FMGA 4LZ1H 5C1XA 1GJ5H 1Y3XA 2QIQA 4D7GA 2SGAA 4D8NA 3IITA 3PWCA 3RU4D 2ZI2H 8GCHG 3F9GA 4WMEA 1FZZA 3NK8A 3U8RH 1EPTB 3HGPA 1HJAC 1CVWH 1T8MA 4IC5A 3U98H 1UK3A 5CHAC 3Q00A 3L3TA 5HMAA 4UONA 3QZRA 3D62A 2RA3A 1Y5AT 3T2NA 4ABAA 4E7RG 3GCHC 1MTNC 4SGAE 1HB0B 1Z1JA 2QF0A 3R3GB 3VXEH 1TX8A 1BJUA 1HAVA 3JZ1B 3S9BA 5DPAA 5FBIA 2WV4A 3UWIA 1O5AB 3ATWA 1VJ9U 2AYWA 3UPEA 1P09A 1EASA 5GCHG 2PUQH 5BPEA 4O03A 4B1TA 1TYNA 1P3EA 4FUJA 1J9CH 1MCVA 1BRBE 3BTTE 3DFJA 3CS0A 3EQ0H 5HM9A 5CMXH 5LH8A 3Q3KA 2Y7XA 3SNCA 4AYYB 2HPQH 2ZGBH 3M37A 3RXLA 3SQEE 3O8CA 2SGFE 2D26C 2A4OA 4X0WU 3T5FH 4I8GA 2FWWA 1CT4E 3LONA 5C2ZA 3M3SA 1GBAA 2BD9A 1P2QA 3PV4A 1O36A 4BNRA 1C2LA 1S0RA 2PW8H 4LK4A 3RXTA 1Z6EA 1BMNH 4ABFA 1GBKA 1K1PA 4OS7A 1C1NA 2GZ9A 1SGNE 2VWNA 3L33A 2BD4A 2XWAA 1ELGA 3QK1A 1QA0A 4FUGA 4BXWA 5JBTA 1T8LA 1TOMH 6GCHF 5T3HA 1O2KA 1CSOE 2VINA 1W0ZU 3KN2A 2SFAA 1F0TA 2OBOA 3AASA 1MAYA 1V2RT 1YC0A 3ENSB 4GVUA 4IMQA 1TPOA 1PQ7A 2FOFA 3GY3A 1UVOA 2C8WB 2HWLB 3E8LA 2FOAA 3FP6E 4JZ1A 1TFXA 2FOCA 5E8EH 4YO9A 2NU4E 4TPIZ 2Y80A 3QGNB 1G3EA 1ELAA 3ZVAA 3P8NA 3V7TA 1P2OA 2B0FA 4ABJA 4JYUH 3PLBA 3LGIA 2CV3A 5FHTA 3GISB 2BVXH 3S7HB 3TNTA 1GJ6A 1WOFA 1L1JA 1P06A 1RTLA 1PPCE 1Y8TA 1VITH 2GKVE 1AVWA 2BM2A 2ZF0H 3LOXA 2BD2A 4ESTE 1DANH 3MU0A 3RMLH 3SO3A 5EG4A 1O38A 1AKSB 1RIWC 3ODFA 2GDDA 1AFQC 2O8MA 1WQSA 4NIWA 3SJIA 1EP5A 1NTPA 1AE8H 3RDZA 4QT8C 1SHHB 1GHVH 2BDYA 1SPJA 2VH0A 1O3CA 1WCZA 3M5LA 2BDGA 2GDEH 4HI3A 3TGJE 3UR9A 1TBRH 5L2ZH 3OTJE 1O3JA 2ESTE 3Q3YA 1DDJA 1FY1A 3M36A 2ZU1A 4FUHA 2KAIB 3SV8A 8LPRA 1D3DB 8ESTE 2C8YB 2ZPQA 3PWBA 3W95A 1K1NA 4MNWA 4XOJA 1F0UA 4JCNA 1PPEE 2FYRA 2W3IA 4Y10E 4K8YA 1MKXH 1K1IA 3A7VA 2R0LA 5L30H 3B9FH 2PGBB 1ZZZA 3ZZDA 4KP0A 2XNIA 2VWMA 3AW0A 1O2MA 3TK6A 3LGVA 3TU7H 3KQEA 5DJ7A 2GMTB 1OS8A 1EPTA 1RJXB 1TNHA 2P93A 1GCTC 5F03A 1H1BA 3Q77A 1JOUB 1YPHC 5FPTA 9LPRA 2BOKA 4U32A 1Y3WA 1AN1E 4JYTA 1GI0A 3S69A 5J4QA 1Z8JB 2GCTB 2QXJA 4J2YB 2OC0A 3JZ2B 1O30A 1WBGB 1Z8IB 2FS9A 2BQWB 5TCAA 3S0NA 1SGRE 1AI8H 1QL8A 2ZGCA 2QYIA 2VH6A 1DLKB 2SGPE 2W26A 4AFUA 2GP9B 1IQMA 4NFEA 3EAJA 1GJBB 1A0LA 1YPEH 2GD4B 4WMDA 1C5WB 3ZZCA 2Y5HA 1O5CB 4CH8B 1BRUP 1ESAA 4OGXA 5E0HA 3NKKA 1AZZA 4X8TH 1UJ1A 2Z9LA 1AMHA 2AMDA 1ANDA 2HPPH 1W3CA 3T25A 1A5IA 1Z1IA 1GMHG 2PTCE 2P8OC 3RXHA 2ZHEH 1G9IE 4AOQA 1ANCA 3FP7E 2RA0A 1LKAA 2VNTA 4OS2A 1ZSKA 2HOBA 1HUTH 1GBFA 4CR5A 3MU1A 2AGIX 3TH3H 1NRRH 1EZXC 5AHGH 1NM6A 4BOHA 5AFZH 2GGVB 4MPUA 2AMQA 2FEQH 3GCTG 2ZDLA 3HPTB 1P05A 1SGPE 4F4OC 5C3NA 1BTPA 1LO6A 4MDSA 1BTXA 1XUFA 1C2MA 2I6SA 2BHGA 1O37A 1VZQH 1U6QA 1C5ZB 1O2PA 3KGPA 2ZU4A 3UNSA 2CMYA 3B23B 1GMCF 5HGGA 4YM9A 2Z9IA 3UR6A 4H6SB 3NPSA 3A87A 1OP2A 1T4UH 1C2JA 1C4U2 1K28D 3BSQA 2FOBA 1G2MA 2XW9A 7KMEH 1A1RA 1LVBA 3VB3A 1TGBA 2HNTC 4BANB 2BQ7B 3RM2H 2O8TA 3EDXB 1FJSA 3Q76A 3K65B 2BQ6B 2AGGX 5TJXA 2LPRA 3QUMP 3FFGA 1T31A 4TY6A 1LMWB 1ZHRA 1SMFE 1KIGH 4J1YA 2ZA5A 1P0SH 3BTKE 1C2FA 4FU9A 6CHAB 1GWAA 1Z8RA 3HK6B 4ZMAH 2IJOB 4BAMB 3GCNA 2ZTXA 1AGJA 2A2QH 2WINI 2ZWLH 5FAHA 5DP6A 2BD8A 2RDLA 5LGOA 3V0XA 1XKAC 2GV7A 2O8WA 1KXEA 2JH6D 1ZPZA 1QHRB 2BX4A 3VFEA 3GDSA 4Z6AH 5A8YA 2BLQA 4FUFA 1GHWH 1GVKB 1ELDE 1LVYA 4X6PA 4X2VA 1AKSA 4NWLA 4KTSA 4CH2B 4Y6DA 1SVPA 4WY3A 4ASHA 1ETTH 3VGCC 1NZQH 2ZGHA 1BOQA 3MNSA 4X6NA 1ELFA 2F3CE 1TRYA 1VCQA 1O3MA 3PB1E 3QZQA 1NRQH 1QIXB 1NROH 3CS7A 4HFPB 1EZUC 3GY4A 1T7CA 1HJ9A 1KLTA 3S9AA 2JH0D 2FI5E 2KAIA 3M61U 3A7YA 1C4V2 1CGJE 1ZGIA 4MQAA 1IAUA 1QNJA 1ESBA 1OSSA 4YLQH 1XKBC 1EB1H 2EI8A 2NU3E 2UUJB 4ZHMU 1DPOA 2R0KA 1TGSZ 4DCDA 4ZKOU 2PTNA 5EXNA 3QTOH 2V3HH 1NPMA 2FOHA 4AX9H 1W13U 2BD5A 5EW2H 4NWKA 3ATKA 1ELVA 1V2WT 1F2SE 2A5IA 4R8TB 3GCOA 1Q31A 2ZGXH 1Y5BT 4FUCA 1UCYH 4U30A 4UDWH 5B6OA 3HKIB 4THNH 1C5LH 3G01A 1O2XA 5J4SA 1QQ4A 1UTMA 4E05H 4K5ZA 4INHA 1EAUA 1C5NH 1GGDB 1QR3E 3OX7U 4JK6A 1GG6B 5E0JA 1O2NA 1T8NA 1C5SA 2ZFPH 1GI8B 4KKDA 1CA0B 1YKTA 1RS0A 1GL0E 2O8LA 1Y3VA 4A1VA 4X1SU 5JB9S 1S82A 1ZOMA 2FOMB 2ANYA 2J4IA 3A81A 3TJUA 4MVNA 3U1IB 1TALA 3DT0H 3P70B 1A5GH 4FUEA 3ZZ3A 1TAWA 1THPB 1QRZA 1KLJH 1THRH 4WH6A 3V13A 3KL6A 3A85A 4BTUB 1AZ8A 1F5KU 1AUJA 1C1SA 4CHAC 1HPGA 2CF9H 1IHSH 1RTKA 3BTWE 1BUIA 4ZROA 2CHAB 1HFDA 2Y81A 2NU2E 3MOCA 1ELCA 2TGPZ 5AFYH 1FY5A 3B8JA 3SN8A 4XDEA 1SGFG 2VB0A 2ODYB 1YPHE 3SU0A 1QB9A 5H4IB 3U1JB 3ZZAA 1Q3XA 1O2LA 1EJAA 3ZVDA 1DWDH 1TQ7B 3NCLA 1WUNH 1PPBH 2TPIZ 1BRAA 1FY3A 3RXVA 1HAGE 2B8OH 3TK5A 4AFSA 1GG6C 1TE0A 4ISNA 4UFGH 4YESB 1UMAH 1A0JA 1S85A 1GI2A 4UEHH 2P3TB 1AVXA 1IQLA 1D9IA 4K1TA 3RXSA 3O8RA 1CHGA 2PKSB 1YCPH 4YTAA 3SQHE 5E0GA 4KTUA 2FLRH 1GI7B 4NZQA 2ZDNA 1W0YH 1GBDA 2XCFA 4NSVA 2FM2A 4NA8A 1LKBA 3A7TA 1AHTH 5GCHF 2M5TA 1XVOA 1ZSJA 1DXWA 1HJAB 1GHXH 2CN0H 2J34A 1Z7KA 3KCGH 1DY8A 3U69H 5CHAB 1HAZB 4AYVB 2ZFFH 1ZR0A 1V2QT 1C5VA 1PPFE 3I77A 1C2KA 3RP2A 1KYNA 3GCHB 1DS2E 5GDSH 2Q6GA 1FY8E 1MTNB 1O3IA 1GMDG 1UO6A 1AE5A 2PLXA 2OTVA 2Z3CA 3SV6A 3E16B 8KME2 5DP5A 3RXGA 2UWOA 2BY7X 1O2TA 3PLPA 4D76A 3M5MA 4K60A 3LJOA 4X1RU 3D65E 3SUDA 2FI4E 3A82A 1BTHH 1DWBH 1CHOG 1MKWH 2PHBA 1SGEE 1SGTA 3RXEA 3S9CA 1ABJH 3RU4E 1NESE 1DX5M 5JYIA 2HNTE 3RXBA 4D9RA 3ATMA 1ANEA 2WPMS 1FI8A 1Y59T 1A61H 2A45B 3ITIA 4XBBA 1F7ZA 2Z9GA 2OUAA 1EOLA 2ILNA 2YNAA 3IG6B 5DP9A 1B5GH 1LVMA 1V2KT 2G5NA 1LHFH 1XXFA 1A3BH 4JZDH 2F9VA 3FZDA 2H2ZA 3AAVA 5A0CA 4A7IB 3K2UA 1O3EA 1K2I1 2G51A 3VXFH 1MKXK 1BZXE 1W11U 2ZIQH 1EATA 3MNXA 1YLDA 2EC9H 1TOCB 1XM1A 4JYVH 1VITF 4E06H 1K1OA 4H6TA 2F9BH 1MD7A 5HM2A 2AMPA 4U01A 4XFQA 1P12E 2EI6A 2WPLS 1H4WA 1JRSA 4D7FA 1Y3YA 1ANBA 2UUKB 1LHGH 2Z6BD 1O3AA 3T62A 4MPXA 2ZHQH 1HYLA 2ZU5A 2OP9A 3Q3XA 1VGCB 2C90B 1P2NA 1O3LA 2PWXA 3MNBA 1GBMA 1GI3A 2ZFTA 3O8DA 4DG4A 1P03A 1V2VT 4KELA 5C67A 1OP0A 2FODA 4ISLA 1O3DA 4FVDA 2BXUH 3RXOA 3MU8A 1QFKH 5C5OA 3RUOA 5A8XA 1BMLA 1H9HE 1VCPA 1RTFB 1YM0A 3E91A 1PFXC 1UK4A 1PPHE 1A3EH 2ALVA 3RXFA 1W14U 1SFIA 3A8BA 1BBRK 1ZMNA 2JH5D 1OWJA 4RKOB 3ZZ6A 1SQTA 2ZU2A 2FI3E 1SLWB 3T27A 1G32B 1RIWB 3URDA 1GDQA 1WYKA 1AFQB 1Z71A 1XUHA 2GZ8A 1EOJA 1BDAA 2BXTH 2C3SA 3SJ9A 2AH4X 1E38B 3SUEA 2TGAA 2GVFA 3WY8A 4YT7H 3PO1C 5A8ZA 5A0AE 1QL7A 1AWFH 1P2JA 1S0QA 2XBYA 2XBVA 1O3KA 1TABE 2PSYA 3P6ZB 3M7TA 1BQYA 2LNCA 2UUFB 2A32A 3SGBE 1HIAB 1VGCC 1BHXB 1A0HB 3KIDU 2QV1A 3SU6A 2Y5GA 5DKMA 2HVXA 1AB9C 2A7CA 2TGTA 5GJ4B 2ZDAH 5C5NA 3NWUA 1ESTA 1O2RA 1JIMA 4MLFB 1O5DH 3FZZA 3KF2A 1ELTA 1OPHB 1UVUH 4GSOA 4FUDA 1NU7B 2BX3A 1P2KA 1SR5C 3MU5A 2FMJA 2Y7ZA 5EPNA 5E2OA 1P01A 1P2MA 3SU5A 1RD3B 1GCTB 1S84A 1W8BH 1SFQB 1PQAA 2ANWA 1F5RA 2I6QA 1ARBA 5DO4H 5HYOA 1O3OA 1SQOA 1DVAH 1TWXB 5LPEA 1GDUA 3LC3A 4RN6A 1LPZB 1QCPA 2HALA 2SGEE 2ODPA 2OLGA 1TMBH 1C2EA 2Z3DA 1D6RA 1QB6A 4K2YA 4Y71A 1HAIH 1IQHA 1Z8GA 4X8VH 3DHKH 4CRCA 3UUZA 3UIRA 1EP6A 3ODDA 3A88A 3ZV9A 1EAWA 5TCCA 2ZKSA 2AGEX 3GCTF 4RKJB 2VIOA 2P3FH 3MO3A 3PMHB 4DY7B 1ZGVA 1ZYOA 1XUIA 1L4DA 1W7XH 3H5CB 2ZFQH 1B7XB 1XUKA 4B2BA 3SGAE 1TRMA 1MQ6A 1NY22 4NIYA 1GJ4H 1HGTH 2P8OB 1SBWA 4IC6A 2BDIA 4AZ2B 5A09A 2VIDA 1TBQH 1O2JA 4MPWA 1TMUH 4K1EA 1E35B 1TNKA 1WQVH 3RXMA 1GBHA 3ZYEA 3TK9A 1EAIA 3RMMH 4NCYA 1HXEH 4O97A 2Z3EA 1TNGA 3E1XB 1CE5A 3LH1A 1BIOA 3DA9B 3MO9A 1QJ6B 3ZZ8A 1GJDB 4ZXXH 3BTFE 6GCHG 4AORA
chains in the Genus database with same CATH superfamily
4O3UA 3BIUH 2WPIS 2OXSA 1GJ7B 3SORA 1NFXA 4IGDA 1UCYK 2ZPRA 4AGJA 1ZRBA 4I32A 3ZZBA 3LU9B 4X1PU 1BMAA 1ZMLA 1FIZA 1HNEE 1VJAU 2F9PA 2CK3D 3ATLA 1K21H 3F68H 4IN2A 3ZVFA 2F91A 2QGRA 1PPGE 1Q2WA 2TGDA 3EA8A 3A86A 5EGMA 5IDKA 2VBCA 4X2XA 4FU8A 2ALPA 2FP7B 3SNBA 1V2LT 5FBEA 1X7AC 4A6LA 4OS6A 1O2OA 5FL7D 5BRRE 1FX0B 5E2PA 1P02A 1TB6H 3BN9A 3A84A 1C1VH 3GOVB 1E34B 1GBCA 1Y5UT 2BD3A 1GHBF 1DSTA 4Y7BA 3UQOA 1IQJA 3I78A 1SGIB 2TBSA 3BTGE 4AB9A 3GY7A 1L0ZA 1B0FA 2AIQA 1TNIA 1G3BA 3GS9A 2ZU3A 4CRAA 3SOSA 3RU4T 7ESTE 2ODQA 2D8WA 1FONA 1N8OC 2AERH 4MG3A 1HAOH 2EI7A 1SL3A 2BLVA 1AVGH 4CBOA 3AW1A 2FTLE 3ZZ5A 2HLDD 2QF5A 3KQBA 1WU1A 1RRKA 2DE8A 4H42U 4ZKRU 3ZZ4A 1THSH 3BTEE 2WYGA 3VGCB 4Q2KA 2QN5T 3LGTA 4CR9A 3GICB 4X6OA 4Y79A 3SGQE 1SGYE 4I33A 1V2TT 1A46H 1ZHMA 5A2MH 5EXLA 3W94A 1OYQA 3BEFB 3LPRA 4TT3D 2V35A 2F9OA 1LTOA 2G4UA 5EW1H 5G4BA 5T6DA 3SI4H 1DUAA 4DJZB 1SSXA 1BTYA 4IS5A 3ZZ7A 1XX9A 1HIAA 4Q7XA 3MQKC 3WWFA 2P95A 2B7DH 1PQ5A 1A4WH 3RXIA 4OGYA 4CBNA 1YCPK 4A92A 2H9TH 3FVFB 2K1QA 2NU1E 1MBMA 4Q7ZA 3SI3H 4ZKNU 1CGHA 3SUFA 2L74A 2ZHFH 4VGCC 5JBCS 4FUIA 1W0KD 1O33A 3OY6U 3LC5A 1BA8B 1H9IE 4HTCH 4LZ4B 3RC6A 1DWEH 1FIWA 1HRTH 2KR7A 1S6HA 1QRXA 1LQEA 2W7UA 1E1RD 1ETSH 1QURH 5FXLA 3A8AA 1NRSH 2ZCKP 3E6PH 1NFYA 2RCEA 1HBTH 1PJPA 3STJA 4XSKU 1DY9A 4YOGA 3WWBA 2JETC 3GDVA 3TJOA 3PLKA 1G3CA 5EXMA 2P59A 4Y8XA 3E3TA 4X8SH 3VB4A 1TPAE 2G52A 3R0FA 3U9AH 3OYPA 1K22H 3SV7A 3A8DA 1K0HA 5GIBA 1MKWK 1YYY1 1O2VA 2J94A 5DP4A 3UNQA 4MTBA 5DSFA 4B71A 2OQ5A 1NFWA 3GY2A 1C1PA 4ZUHA 4WMFA 3P92A 1EZSC 1ID5H 3BG4C 4TWYA 4CHAB 2JDID 1G30B 3BV9B 3SU4A 2THFB 2KM0A 2GJGA 2OD3B 3I29A 4X1NU 3SW2B 3QN7A 2WUCA 3RMNH 1C9PA 3DFLA 4GLYA 2A7HA 3U8OH 3PMJA 5I46H 1FLEE 4JK5A 1F0SA 3M3VA 1TA6A 1YPKH 4Y8ZA 5EJZA 1S83A 1KXAA 3E0PB 2GCHF 1K1JA 4ZXYH 1BITA 3C27B 3MO6A 4K1SA 5FPSA 5SGAE 1KLIH 1W12U 1MAXA 1OYTH 4X6MA 1BB0B 3FANA 1QY6A 2QXHA 1ZJDA 1GMCG 2A4QA 2XC4A 3UWJH 5L6NH 3SNEA 1C5XB 2H5DA 5JB8S 1BBRE 1O2HA 2CF8H 4FU7A 1SG8B 2TIOA 1EAXA 2VGCC 1C5QA 2YOLA 3KHVA 1AO5A 1C5OH 4CRGA 1DOJA 1N6XA 1K1LA 2R2WU 1EKBB 1TGCA 3SNDA 2Y82A 1CA8B 1WXRA 3RXCA 1C5YB 5DP8A 2G4TA 1O34A 4GCHF 3K9XB 3KNXA 4P00A 1E36B 1GBTA 2BMGB 2JKHA 2LP6A 1AU8A 5F6MA 2IPHA 2BDAA 2G55A 3LGUA 1GHAF 1TX6A 4UFDH 2XRCA 1RGQA 5C20A 3BTQE 5L2YH 1KSNA 3SV9A 1MBQA 3UB0A 2KX4A 3N7DA 5JDUB 2TRMA 4I8LA 4NFFA 3RXDA 4H4FA 1V2OT 5DP7A 1DXPA 3SNAA 1ZTKA 4JZFH 1RFNA 1SLVB 2C93B 3A7XA 1TPSA 3TIUA 1EZQA 2H5CA 5T6GA 8GCHF 3CP7A 1DWCH 2V6NA 3MFJA 2VWOA 1UTLM 2EY4C 2ANKH 3BF6H 2ZPSA 2WPJS 1FN6A 1MTWA 2G5VA 3F9FA 3KEEA 4Y11E 1CO7E 3VPKA 1P2IA 1AFEH 2C8XB 3UFAA 3MH6A 3TPIZ 1UTNA 2IOTA 4ZHLU 1Z6JH 1C1OA 1EXFA 2XWBI 3E0NB 1GHZA 4XRNA 2XXLA 1D3QB 3QDZB 3MMGA 1O2SA 2SGQE 2ZNKH 4AFZA 1IQIA 1EUFA 5C94A 5EQQA 1HAXB 2OC7A 3KQDA 3QO6A 1SGFA 1UVSH 3OAAD 1O3BA 1GBBA 3RC4A 2ZDMA 1SGDE 1TGTA 1F0RA 3GY8A 2QF3A 2FXRA 3SHAH 2GT8A 1UHBB 3RC5A 2VVUA 1MU6B 1EJMA 2FOGA 4WVPE 1EX3A 1KTTB 3LT3A 5EQSA 2W5EA 1GDNA 1OOKB 1K9OE 1NBME 1N6YA 3RLYH 1O5FH 2G81E 3SBKA 2BYAX 3P8FA 1OP8A 2WZQA 3EA9A 3NZIA 4JZEH 4UFFH 4F49A 1O2ZA 1O31A 4AGKA 3DSOA 7GCHG 3LDXH 2BY9X 2ZGJA 2SNWA 1NBMD 2HLCA 1KXFA 1C2DA 1FAKH 1PYTC 1O5GH 4WXVA 2UWPA 9ESTA 1O32A 4B75A 5DP3A 1TONA 3OE7D 1ACBE 1C9TA 4HG6A 1C5RA 4DVAU 3MU4A 4SGBE 2BDCA 2OQUA 4AB8A 1T4VH 4BXSA 2PGQB 3FN8A 2ZHWH 1EJNA 4BTIB 1HJ8A 1SOTA 1E37B 2Z9JA 1S81A 1B0EA 1KDQB 2ZZUH 1T8OA 2P16A 3HATH 1UCYE 2ULLA 4NA7A 2VIPA 1MMJN 3LJJA 2RFKC 5EOKA 1YPJH 3F9HA 1QRWA 3GDUA 2FX4A 1O5BB 1DFPA 1FNIA 4IW4E 1O35A 3T28A 3ESTA 5FCRA 4A1XA 2VVVA 5JBAS 1XUGA 2A5AA 1MQ5A 1SGCA 3GY6A 2GX4A 2V0BA 1V3XA 2A4RA 3MTYA 3SJ8A 1V6DA 4XBCA 3TH4H 1AWHB 2QXIA 3RXAA 1ZTLA 4YLUA 3PO1B 2XCNA 5F53A 4O9VA 2H9HA 2VIWA 1AIXH 1IQGA 3DCLA 3UQVA 3KYFA 4GUXA 1S6FA 1YGCH 2BOHB 1QBVH 2ZFRH 2V7QD 3BTME 4NIXA 3TLOA 4ABGA 3TGIE 1J16A 1ZSLA 2QAAA 3ZYDA 4Q80A 5JBBS 5GWZA 1BTUA 4YT6H 3P8OA 1DLEA 3MWIU 1EQ9A 1AB9B 1DITH 2B5TB 2R2MB 2RDEA 2G8TA 3UAIC 1QJ7B 2ZQ2A 1O2QA 3GYLB 2BY5X 1YF4A 4NIVA 3HK3B 4XE4A 1VCWA 3SHCH 5EQRA 2XC5A 1P10A 2H6MA 1V2UT 3UTUH 1A7SA 1OWEA 3SU3A 5EPYA 1L2EA 1LHCH 4KGAA 1IQEA 1O2WA 4LOYH 3LGYA 2YMSB 2V3MA 1N1LA 2BTCE 3FP8E 3OSYA 4I31A 2FZZA 1BJVA 1W7GH 1D3PB 7LPRA 3MH7A 3RMOH 2R9PA 4ISHH 3RXQA 3F6UH 3RLWH 4ISIH 2J2UA 1D4PB 1ZJKA 5ESTE 1J15A 1VR1H 4Y76A 2ZFSA 1C5TA 2FOEA 3VB5A 3CENA 3NUMA 1LQDB 1SOZA 1NRPH 1GCDA 3PRDA 5FX5A 5LPRA 2CJIA 2Y5FA 2ASUB 4Y0ZE 2D2DA 4DIIH 1BRCE 2XBWA 2K8IA 1MD8A 3MH4A 5T6FA 1H9LB 1EPTC 3UNRA 3A8CA 2PKAB 4HZHA 2F9UA 1HXFH 3PROA 1UTQA 1RXPA 1O3FA 1TIOA 1NFUA 5DK1A 2F83A 4GHQA 4YOIA 1O2UA 4TY7A 4NA9H 1MCTA 1SKYE 4INLA 1WSSH 2Q1JA 4ACBA 3IWMA 1D6WA 1XUJA 2D1JA 1TGNA 2ZQ1A 1A2CH 1NU9A 1O2IA 1UTOA 3F9EA 5F8ZA 4X8UH 2ZCHP 1HCGA 1S6LA 1UHBA 4NGAH 4I8JA 1V2JT 3SJOA 1GPZA 5DN6D 3TVJB 2CGAA 2ZP0H 5FX6A 1S5SA 1VITG 3AAUA 2J9NA 1C1UH 1IOEA 1C5PA 1GMHF 1JXPA 2EEKA 4ZAEA 1GBEA 4MNYA 1NC6A 4Q7YA 1G36A 5FPYA 1FAXA 4ABEA 1P3CA 2O9QA 1DE7H 1FDPA 2KCOA 2GTBA 1ZRKA 1BHXF 1FPCH 1OXGA 4B74A 3M7QA 5EJ1A 3D23A 2OC1A 1KXDA 1QZ8A 3SU2A 1PPZA 1NRNH 4MNXA 1OWHA 1ZLRA 2CXVA 5I25A 3LGWA 2Q6FA 1BTWA 1KMHB 3D49H 2GT7A 2J95A 4B76A 1GBLA 5IYTA 3QX5H 2YNBA 4TYDA 1SHYA 3A83A 3BTHE 1P9SA 1DSUA 5GXPA 1CT0E 3O8BA 4BTTB 3UREA 3PTNA 5C0UA 3MYWA 1YBWA 1QB1A 5FCKA 2STBE 1KDQA 2OBQA 2R3YA 2Z9KA 4RI0A 1N8OB 1O3HA 1MZDA 1P57B 4A1TA 4ISOA 2BVSH 1K1MA 4BAHB 2FX6A 1ZMJA 1P11E 1TQ0B 3ZVCA 3OFND 5GPIB 5EU8A 4ABIA 3ZIAD 1O39A 3T26A 4TSFD 1CT2E 2FO9A 4M9FA 1QBNA 1JMOH 4WF8A 1OKXA 2R3UA 3BG8A 3RXJA 1TNJA 1C1MA 3BIVH 2ZDVH 4DIHH 3LIWA 1DUEA 5DGJA 4ABDA 1DT2A 1HV7A 2PV9B 1W0JD 4JMYA 4Z0KA 1OX1A 3A7ZA 1J8AA 3LH3A 3RM0H 2UWLA 3UOUA 1UVPA 1KTSB 3K6ZA 2OCVB 3F1SB 2UUYA 4WWYA 1O2GH 3FKSD 4K69A 2EA3A 2WUBA 1QA7A 4AG1A 3NRLA 1BT7A 1L1GA 3MH5A 2OK5A 4PROA 5PTPA 2JJ2D 4BAOB 1PYTD 4MPVA 2W7SA 5AVDA 3QWCH 3S7KB 4VGCB 2ZG0H 3ZVGA 1UK2A 2WSSD 2BDHA 2JIZD 2ZEBA 1LVOA 1P04A 3P95A 4UFEH 2ZC9H 5KGOA 1QL9A 4FVBA 2BLOA 3RXPA 1QGFA 3LKWA 1CU1A 1O2YA 3QTVH 1BBRH 2XC0A 4OS1A 2ZTZA 4X2YA 4F48B 1LPKB 1HLTH 4NZLA 1IQNA 1GHYH 1XVMA 1W10U 4FXGH 5ETXA 1O5EH 4X2WA 1SGQE 3OY5U 2GZ7A 1SI5H 3FAOA 4ZKSU 3URCA 2OC8A 2XBXA 3H7OA 1SLUB 2XYAA 4K3JA 1DM4B 1V2MT 1JRTA 2HNTF 3SV2H 5C1UA 2FPZA 3PYHA 3GY5A 2JETB 3ZVEA 1WDIA 2GMTC 4I7YH 3A89A 4FUBA 1QTFA 3N7EA 1NO9H 2PKAA 1F5LA 1IQKA 1V2NT 1QQUA 1OWKA 2QCYA 1T32A 3SU1A 1UTKA 2A31A 1AUTC 4INKA 5F8TA 1LPGB 2FYQA 4Y0YE 4YOJA 5KEDA 1WAYB 3ZV8A 4B2CA 1WTHD 2GCTC 3UY9A 3BG4B 2VIVA 1TNLA 1JWTA 5LPFA 2XTTB 2KCYA 1ETRH 3ATIA 1C1WH 1KY9A 3ZVBA 2HRVA 3MHWU 2OINA 1AQ7A 2B9LA 2V3OH 1ELEE 2A2XH 2PR3A 1NS3A 3V3MA 3ZZ9A 4IMZA 1D3TB 4X1QU 2J92A 3F2HA 4TPYA 3MI4A 2BDBA 2AIPA 4E7NA 1ARCA 1G37A 2KCAA 1ORFA 1YCPM 1KXBA 1W2KH 4AG2A 1FXYA 4OS5A 1H8DH 1INCA 1P8VC 4I8HA 3MNCA 1AY6H 1FQ3A 2Q6DA 3SJKA 2J97A 1HDTH 1A5HA 1TA2A 1JBUH 2QXGA 4CRFA 4AFQA 1LCYA 2IN2A 1C2IA 4K8BA 1P9UA 1TRNA 1SB1H 2VGCB 2VIQA 1SQAA 2P94A 2RG3A 3EYDA 3P17H 1H8IH 1V2ST 2BZ6H 2A0QB 4GPGA 3CNRA 3U28C 3F3BA 4NSYA 4UE7H 1HAPH 1GI6A 1DICA 2BD7A 5HXFA 1GHBG 3QLPH 1E79D 4YZUA 2NU0E 1WV7H 1TPPA 2WPHS 4DOQA 1EB2A 1UTPA 2A5KA 2SNVA 1GJAB 3M35A 1GVZA 5K7RA 4HGCA 3PM3A 1YPLH 3M5OA 3DUXH 2ZCLP 2STAE 2FESH 4ZH8A 1O3GA 1C2HA 6LPRA 6ESTA 1GJCB 1GI9B 2DUCA 2W3KA 5JPMH 4LXBH 4U2WA 1TLDA 2FDAA 1CBWB 3EGKH 1GJ9B 2GV6A 3N7OA 2H1UA 1CQQA 3M3TA 2G00A 3VEQB 1GI4A 3AVZA 3H7TA 6CHAC 1C1TA 4UD9H 1J14A 3RXRA 2ZO3H 2J5UA 1TX7A 1O3PB 3PTBA 4DT7B 1YPMH 1J17T 3K6YA 1E0FD 4CRDA 1HAVB 1GMDF 1LHEH 1BTZA 3QGJA 1YP9A 4GHTA 1UTJA 4FETA 1C5UA 4B2AA 2LELA 2VJ1A 1ZPBA 4R0IA 5ABWA 7GCHF 3BEUA 1C2GA 3SUGA 1GVLA 3P8GA 4GAWA 3TJVA 3BEIB 3TITA 1SC8U 3OTPA 1GL1A 1ABIH 3A7WA 2QY0B 1MTVA 2PFEA 1UVTH 2ZDKA 3L6PA 5C1YA 1CHOF 1O3NA 3RXUA 1F92A 3EE0B 4WH8A 1AD8H 2FIRH 4TWWA 4MNVA 1YLNA 1KXCA 2VVCA 4I8KA 4D9QA 1C1QA 2AFQB 1G3DA 5ESBA 2BY6X 1WTGH 2AS9A 3KQCA 1CBWC 2PUXB 1H8ED 2HGTH 1OWIA 1CGIE 1QJ1B 2AEIH 2VWLA 4DW2U 1C5MD 4O3TA 1MU8B 3E90B 1XXDA 2QC2A 2WYJA 3M5NA 1XMNB 2ZHDA 1NN6A 1QBOA 2ZTYA 3STIA 3ELAH 5EODA 3TH2H 4ZHAA 1MTSA 1GBIA 1L1NA 1PQ8A 4WXIA 2BB4A 3TNSA 1FPHH 3VB7A 5CE1A 1BMMH 2F9NA 1BCUH 1LDTT 3PMAB 1GGDC 4IBLH 1ZPCA 4KTCA 4A5TS 1YLCA 3PMBB 2WPKS 4WJG2 1C4Y2 3T29A 3SZNA 4DURA 1V2PT 4Y7AA 2VU8E 2Z94A 4M7GA 1NT1A 1JIRA 1CA0C 1FUJA 2P3UB 3BTDE 3GYMA 3VB6A 4CREA 3A80A 1ELBA 3RXKA 2C4FH 2M2AA 1SLXB 3NXPA 4CRBA 2BY8X 5AF9H 1ZTJA 3U8TH 1ZHPA 2Y6TA 2GCHG 1MUEB 3HGNA 3M7UA 2A7JA 4B73A 4P02A 4AN7A 4IN1A 1IHTH 1MTUA 4OS4A 2WV5A 5A0BA 1Y3UA 2Z7FE 4JZIA 1L4ZA 2QA9E 4DGJA 2DE9A 1GI5A 4RSPA 3UOPA 1C1RA 4ABHA 1FN8A 2CHAC 3HKJB 1OWDA 3TJNA 1IQFA 1O0DH 1M9UA 2C8ZB 2FS8A 4BAQB 2HVYB 1GI1A 2O8UA 2PSXA 3C1KA 2NWNA 1FY4A 1MZAA 3DD2H 2BZAA 1MH0A 2SGDE 4B6FA 5F8XA 1TMTH 4GCHG 1HAHH 2J38A 2ZECA 1LHDH 4NG9H 1G2LA 2A1DB 1E1QD 1GHAG 2BLWA 2ANMH 2BVRH 1HAYB 1GJ8B 1TBZH 4BAKB 4Y8YA 3TGKE 3EA7A 1YPGH 2FLBH 3V12A 2A4GA 4ABBA 5DG6A 3OU0A 1GBJA 4XBDA 2H9EH 4OM9A 2PKSC 1FV9A 5K0HA 2FTMA 3F2GA 1FMGA 4LZ1H 3F0PA 5C1XA 1GJ5H 3WW7A 1Y3XA 2QIQA 4D7GA 2SGAA 4D8NA 3IITA 3PWCA 3RU4D 2ZI2H 8GCHG 3F9GA 4WMEA 1FZZA 3NK8A 5GNDA 3U8RH 1EPTB 3HGPA 1HJAC 1CVWH 3OEHD 4ASUD 1T8MA 4IC5A 3U98H 1UK3A 5CHAC 3Q00A 3PRBA 3L3TA 5HMAA 4UONA 3QZRA 3D62A 3FOAA 2RA3A 1Y5AT 3T2NA 4ABAA 4E7RG 3GCHC 1MTNC 4SGAE 1HB0B 1Z1JA 2QF0A 3KQ5A 3R3GB 3VXEH 1TX8A 1BJUA 1HAVA 3JZ1B 3S9BA 5DPAA 5FBIA 2WV4A 2PP6A 3UWIA 1O5AB 3ATWA 1VJ9U 2AYWA 4I86A 3UPEA 1P09A 1EASA 5GCHG 2PUQH 5BPEA 4O03A 4B1TA 2QE7D 1TYNA 1P3EA 4FUJA 1J9CH 1MCVA 1BRBE 3BTTE 3DFJA 3CS0A 4B6EA 3EQ0H 5HM9A 5CMXH 5LH8A 3Q3KA 2WV9A 2KZ4A 2Y7XA 3SNCA 4AYYB 5C17A 2HPQH 2ZGBH 3M37A 3RXLA 3SQEE 3O8CA 2SGFE 2D26C 4FOUC 2A4OA 4X0WU 3T5FH 4I8GA 2FWWA 1CT4E 3LONA 5C2ZA 3M3SA 1GBAA 2BD9A 1P2QA 3PV4A 1O36A 3FO8D 4BNRA 1C2LA 2QF4A 1S0RA 2PW8H 4LK4A 3RXTA 1Z6EA 1BMNH 2EQNA 4ABFA 1GBKA 1K1PA 1YY3A 4OS7A 2L6OA 1C1NA 3H09A 2GZ9A 1SGNE 2VWNA 3L33A 2BD4A 2XWAA 1ELGA 3QK1A 1QA0A 4FUGA 4BXWA 5JBTA 1T8LA 1TOMH 6GCHF 5T3HA 1O2KA 1CSOE 2VINA 1W0ZU 3KN2A 2SFAA 1F0TA 2OBOA 3AASA 1MAYA 1V2RT 1YC0A 3ENSB 4GVUA 4IMQA 1TPOA 1PQ7A 2FOFA 3GY3A 1UVOA 2C8WB 2HWLB 3E8LA 2FOAA 3FP6E 4JZ1A 1TFXA 4Q63A 2FOCA 5E8EH 4YO9A 2NU4E 4TPIZ 2Y80A 3QGNB 1G3EA 1SQRA 1ELAA 3ZVAA 3P8NA 3V7TA 1P2OA 2B0FA 4ABJA 4ZCNA 4JYUH 3PLBA 3LGIA 2CV3A 5FHTA 3GISB 2BVXH 3S7HB 3TNTA 1GJ6A 1WOFA 1L1JA 1P06A 1RTLA 1PPCE 1Y8TA 1VITH 2GKVE 1AVWA 2BM2A 2ZF0H 3LOXA 2BD2A 4ESTE 1DANH 3MU0A 3RMLH 3SO3A 5EG4A 1O38A 1AKSB 1RIWC 3ODFA 2GDDA 1AFQC 2O8MA 1WQSA 4NIWA 3SJIA 4XD7D 1EP5A 1NTPA 3PV2A 1AE8H 3RDZA 4QT8C 1SHHB 1GHVH 2BDYA 1SPJA 2VH0A 1O3CA 1WCZA 3M5LA 2BDGA 2GDEH 4HI3A 3TGJE 3UR9A 1TBRH 5L2ZH 3OTJE 1O3JA 2ESTE 3Q3YA 1DDJA 3DSPA 1FY1A 3M36A 2ZU1A 4FUHA 2KAIB 3SV8A 8LPRA 1D3DB 8ESTE 2C8YB 2ZPQA 3PWBA 3W95A 1K1NA 4MNWA 4XOJA 1F0UA 2W6ID 4JCNA 1PPEE 2FYRA 2W3IA 4Y10E 4K8YA 1MKXH 1K1IA 3A7VA 2R0LA 5L30H 3B9FH 2PGBB 1ZZZA 3ZZDA 4KP0A 2XNIA 2VWMA 3AW0A 1O2MA 2WHXA 3TK6A 3LGVA 3TU7H 4Q4LA 3KQEA 5DJ7A 2GMTB 5HKKD 1OS8A 1EPTA 1RJXB 1TNHA 2P93A 1GCTC 5F03A 1H1BA 3Q77A 1JOUB 1YPHC 5FPTA 9LPRA 2BOKA 4U32A 1Y3WA 1AN1E 4JYTA 1GI0A 3S69A 5J4QA 1Z8JB 2GCTB 2QXJA 4J2YB 2OC0A 3JZ2B 1O30A 1WBGB 1Z8IB 1BMFD 2FS9A 2BQWB 5TCAA 3S0NA 1SGRE 1AI8H 1QL8A 2ZGCA 2QYIA 2VH6A 1DLKB 2SGPE 2W26A 4AFUA 2GP9B 1IQMA 4NFEA 4F55A 3EAJA 1GJBB 1A0LA 1YPEH 2GD4B 4WMDA 1C5WB 3ZZCA 2Y5HA 1O5CB 4CH8B 1BRUP 1ESAA 4OGXA 5E0HA 3NKKA 1AZZA 4X8TH 1UJ1A 2Z9LA 1AMHA 2AMDA 1ANDA 2HPPH 1W3CA 3T25A 1A5IA 1Z1IA 1GMHG 2PTCE 2P8OC 3RXHA 2ZHEH 1G9IE 4AOQA 1ANCA 3FP7E 2RA0A 1LKAA 2VNTA 4OS2A 1ZSKA 2HOBA 1HUTH 1GBFA 4CR5A 3MU1A 2AGIX 2KCPA 3TH3H 1NRRH 1EZXC 5AHGH 1NM6A 4BOHA 5AFZH 2GGVB 3DSGA 2AMQA 4MPUA 3N99A 2FEQH 3GCTG 2ZDLA 3HPTB 1P05A 1SGPE 4F4OC 5C3NA 1BTPA 1LO6A 4MDSA 1BTXA 1XUFA 1C2MA 2I6SA 2BHGA 3F2FA 1O37A 1VZQH 1U6QA 4ACAA 1C5ZB 1O2PA 3KGPA 2ZU4A 3UNSA 2CMYA 3B23B 1GMCF 5HGGA 4YM9A 2Z9IA 3UR6A 4H6SB 3NPSA 3A87A 1OP2A 1T4UH 1C2JA 1C4U2 1K28D 3BSQA 2FOBA 1G2MA 2XW9A 7KMEH 1A1RA 1LVBA 3VB3A 1TGBA 2HNTC 4BANB 2BQ7B 3RM2H 2O8TA 3EDXB 1FJSA 3Q76A 3K65B 2BQ6B 2AGGX 5TJXA 2LPRA 3QUMP 3FFGA 1T31A 5CHBA 4TY6A 1LMWB 5B6LA 1ZHRA 1SMFE 1KIGH 4J1YA 2F43B 2ZA5A 1P0SH 3BTKE 1C2FA 4FU9A 6CHAB 1GWAA 1Z8RA 3HK6B 4ZMAH 2IJOB 4BAMB 3GCNA 2ZTXA 1AGJA 2A2QH 2WINI 2ZWLH 5FAHA 5DP6A 2IPQX 2BD8A 2RDLA 5LGOA 3V0XA 1XKAC 2GV7A 2O8WA 1KXEA 2JH6D 1ZPZA 1QHRB 2BX4A 3VFEA 3GDSA 4Z6AH 5A8YA 2BLQA 4FUFA 1GHWH 1GVKB 1ELDE 1LVYA 4X6PA 4X2VA 1AKSA 4NWLA 4KTSA 4CH2B 4Y6DA 1SVPA 4WY3A 4ASHA 1ETTH 3VGCC 1NZQH 2ZGHA 1BOQA 3MNSA 4X6NA 1ELFA 1VKYA 2F3CE 5IK2D 1TRYA 1VCQA 1O3MA 3PB1E 3QZQA 1MABB 1NRQH 1QIXB 1NROH 5CDFE 3CS7A 4HFPB 1EZUC 3GY4A 1T7CA 1HJ9A 1KLTA 3S9AA 2JH0D 2FI5E 2KAIA 3M61U 3A7YA 1C4V2 1CGJE 1ZGIA 4MQAA 1IAUA 1QNJA 1ESBA 1OSSA 4YLQH 1XKBC 1EB1H 2EI8A 2NU3E 2UUJB 4ZHMU 1DPOA 3SYJA 2R0KA 1TGSZ 4DCDA 4ZKOU 2PTNA 5EXNA 3QTOH 2V3HH 1NPMA 2FOHA 4AX9H 1W13U 2BD5A 5EW2H 4NWKA 3ATKA 1ELVA 1V2WT 1F2SE 2A5IA 4R8TB 3GCOA 1Q31A 2ZGXH 1Y5BT 2XOKD 4FUCA 1UCYH 4U30A 4UDWH 5B6OA 3HKIB 4THNH 1C5LH 3G01A 1O2XA 5J4SA 1QQ4A 1UTMA 4E05H 4K5ZA 4INHA 1EAUA 1C5NH 1GGDB 1QR3E 3OX7U 2YMSD 4JK6A 1GG6B 5E0JA 1O2NA 1T8NA 1C5SA 2ZFPH 1GI8B 5HIYA 4KKDA 1CA0B 1YKTA 1RS0A 1GL0E 2O8LA 1Y3VA 4A1VA 4X1SU 5JB9S 1S82A 1ZOMA 2FOMB 2ANYA 2J4IA 3A81A 3TJUA 4MVNA 3U1IB 1TALA 3DT0H 3P70B 1A5GH 4FUEA 3ZZ3A 1TAWA 1THPB 1QRZA 1KLJH 1THRH 4WH6A 3V13A 3KL6A 3A85A 4BTUB 1AZ8A 1F5KU 2F4LA 1AUJA 1C1SA 4CHAC 1HPGA 3OEED 2CF9H 1IHSH 1RTKA 3BTWE 1BUIA 4ZROA 2CHAB 1HFDA 2Y81A 2NU2E 3MOCA 4AC9A 1ELCA 2TGPZ 5AFYH 1FY5A 3B8JA 3SN8A 4XDEA 1YWUA 1SGFG 2VB0A 2ODYB 1YPHE 3SU0A 1COWD 1QB9A 5H4IB 3U1JB 3ZZAA 1Q3XA 1O2LA 1EJAA 3ZVDA 3KYGA 1DWDH 1TQ7B 3NCLA 1WUNH 1PPBH 2TPIZ 5T1VA 1BRAA 1FY3A 3RXVA 1HAGE 2J98B 2B8OH 3TK5A 4AFSA 1GG6C 1TE0A 4ISNA 4UFGH 4YESB 1UMAH 1A0JA 2JJ1D 1S85A 1GI2A 4UEHH 2P3TB 1AVXA 1IQLA 1D9IA 4K1TA 3RXSA 3O8RA 1CHGA 2PKSB 1YCPH 1EFRD 4DT4A 4YTAA 3SQHE 5E0GA 4KTUA 2FLRH 1GI7B 4NZQA 2ZDNA 1W0YH 3PV5A 1GBDA 2XCFA 4NSVA 2FM2A 4NA8A 4Z1MD 1LKBA 3A7TA 1AHTH 5GCHF 2M5TA 1XVOA 1ZSJA 1DXWA 1HJAB 1GHXH 2CN0H 2J34A 1Z7KA 3KCGH 1DY8A 3U69H 5CHAB 1HAZB 4AYVB 2ZFFH 1ZR0A 1V2QT 5EJLA 1C5VA 1PPFE 3I77A 1C2KA 3RP2A 1KYNA 3GCHB 1DS2E 5GDSH 2Q6GA 1FY8E 1MTNB 1O3IA 1GMDG 1UO6A 1AE5A 2PLXA 2OTVA 2Z3CA 3SV6A 3E16B 8KME2 5DP5A 2W6JD 3RXGA 2UWOA 2BY7X 5C0TA 1O2TA 3PLPA 4D76A 3M5MA 4K60A 3LJOA 4X1RU 2WPDD 3D65E 3SUDA 5KECA 2FI4E 3A82A 1BTHH 1DWBH 1CHOG 1MKWH 1SGEE 1SGTA 2PHBA 3RXEA 3S9CA 1ABJH 3RU4E 5EIYA 1NESE 1DX5M 5JYIA 2HNTE 3RXBA 4D9RA 3ATMA 1ANEA 2WPMS 1FI8A 1Y59T 1A61H 2A45B 3ITIA 4XBBA 1F7ZA 2Z9GA 2OUAA 1EOLA 2ILNA 2YNAA 3IG6B 1H8HD 5DP9A 1B5GH 1LVMA 1V2KT 2G5NA 1LHFH 1XXFA 1A3BH 4JZDH 2F9VA 3FZDA 2H2ZA 3AAVA 5A0CA 4A7IB 3K2UA 1O3EA 1K2I1 2G51A 3VXFH 1MKXK 1BZXE 1W11U 2ZIQH 1EATA 3MNXA 1YLDA 2EC9H 1TOCB 1XM1A 4JYVH 1VITF 4E06H 1K1OA 4H6TA 2F9BH 1MD7A 5HM2A 2AMPA 4U01A 4XFQA 1P12E 2EI6A 2WPLS 1H4WA 1JRSA 4D7FA 1Y3YA 1ANBA 2UUKB 1LHGH 2Z6BD 1O3AA 3T62A 4MPXA 2ZHQH 1HYLA 2ZU5A 2OP9A 3Q3XA 1VGCB 2C90B 1P2NA 1O3LA 2PWXA 3MNBA 1GBMA 1GI3A 2ZFTA 3O8DA 4DG4A 1P03A 1V2VT 4KELA 5C67A 1OP0A 2FODA 4ISLA 1O3DA 4FVDA 2BXUH 3RXOA 3MU8A 1QFKH 5C5OA 3RUOA 5A8XA 1BMLA 1H9HE 1VCPA 1RTFB 1YM0A 3E91A 1PFXC 1UK4A 1PPHE 1A3EH 2ALVA 3RXFA 1W14U 3SZEA 1SFIA 3A8BA 2IJD1 1BBRK 1ZMNA 2JH5D 1OWJA 4RKOB 3ZZ6A 1SQTA 2ZU2A 2FI3E 1SLWB 3T27A 1G32B 1RIWB 3URDA 1GDQA 1WYKA 1AFQB 1Z71A 1XUHA 3VG8A 2GZ8A 1EOJA 1BDAA 2BXTH 2C3SA 3SJ9A 2AH4X 1E38B 3SUEA 2TGAA 3EE7A 2GVFA 3AK5A 3WY8A 4YT7H 3PO1C 5A8ZA 5A0AE 1QL7A 1AWFH 1P2JA 3W1EA 1S0QA 2KFWA 2XBYA 2XBVA 1O3KA 1TABE 2PSYA 3F0OA 3P6ZB 3M7TA 2J98A 1BQYA 2LNCA 2UUFB 2A32A 3SGBE 1HIAB 1VGCC 1BHXB 1A0HB 3KIDU 2QV1A 3SU6A 2Y5GA 5DKMA 2HVXA 1AB9C 2A7CA 2TGTA 5GJ4B 2ZDAH 5C5NA 3NWUA 1ESTA 1O2RA 1JIMA 4MLFB 1O5DH 3FZZA 3KF2A 1ELTA 1OPHB 1UVUH 4GSOA 4FUDA 1NU7B 2BX3A 1P2KA 1SR5C 2YMSC 2FMJA 2Y7ZA 3MU5A 5E2OA 1P01A 1P2MA 5EPNA 3SU5A 1RD3B 1GCTB 1S84A 1W8BH 1SFQB 1PQAA 2ANWA 1F5RA 2XNDD 2I6QA 1ARBA 5DO4H 5HYOA 1O3OA 1UW7A 1OHHD 1SQOA 1DVAH 1TWXB 5LPEA 1GDUA 3LC3A 4RN6A 1LPZB 1QCPA 2HALA 2SGEE 2ODPA 2OLGA 1TMBH 1C2EA 2Z3DA 1D6RA 1QB6A 4K2YA 2K0QA 4Y71A 1HAIH 1IQHA 1Z8GA 4X8VH 3DHKH 4CRCA 3UUZA 3UIRA 1EP6A 3ODDA 3A88A 3ZV9A 1EAWA 5TCCA 2ZKSA 2AGEX 2AHME 3GCTF 4RT1A 4RKJB 2VIOA 2P3FH 3MO3A 3PMHB 4DY7B 1ZGVA 1ZYOA 1XUIA 1L4DA 1W7XH 3H5CB 2ZFQH 1B7XB 1XUKA 4B2BA 3SGAE 1TRMA 1MQ6A 1NY22 4NIYA 1GJ4H 1HGTH 2P8OB 1SBWA 4IC6A 2BDIA 4AZ2B 5A09A 2VIDA 1TBQH 1O2JA 4MPWA 1TMUH 4K1EA 1E35B 1TNKA 1WQVH 3RXMA 1GBHA 3ZYEA 3TK9A 1EAIA 3RMMH 4NCYA 1HXEH 4O97A 2Z3EA 1TNGA 3E1XB 1CE5A 3LH1A 1BIOA 3DA9B 3MO9A 1QJ6B 4YXWD 5HIZA 3ZZ8A 1GJDB 4ZXXH 3BTFE 4RT0A 6GCHG 4AORA
chains in the Genus database with same CATH topology
4O3UA 3BIUH 2WPIS 2OXSA 1GJ7B 3SORA 1NFXA 4IGDA 1UCYK 2ZPRA 4AGJA 1ZRBA 4I32A 3ZZBA 3LU9B 4X1PU 1BMAA 1ZMLA 1FIZA 1HNEE 1VJAU 2F9PA 3ATLA 1K21H 3F68H 4IN2A 3ZVFA 2F91A 2QGRA 1PPGE 1Q2WA 2TGDA 3EA8A 3A86A 5EGMA 5IDKA 4X2XA 4FU8A 2ALPA 2FP7B 3SNBA 1V2LT 5FBEA 1X7AC 4A6LA 4OS6A 1O2OA 5BRRE 5E2PA 1P02A 1TB6H 3BN9A 3A84A 1C1VH 3GOVB 1E34B 1GBCA 1Y5UT 2BD3A 1GHBF 1DSTA 4Y7BA 3UQOA 1IQJA 3I78A 1SGIB 2TBSA 3BTGE 4AB9A 3GY7A 1L0ZA 1B0FA 2AIQA 1TNIA 1G3BA 2ZU3A 4CRAA 3SOSA 3RU4T 7ESTE 2ODQA 2D8WA 1FONA 1N8OC 2AERH 4MG3A 1HAOH 2EI7A 1SL3A 2BLVA 1AVGH 4CBOA 3AW1A 2FTLE 3ZZ5A 3KQBA 1WU1A 1RRKA 2DE8A 4H42U 4ZKRU 3ZZ4A 1THSH 3BTEE 2WYGA 3VGCB 4Q2KA 2QN5T 3LGTA 4CR9A 3GICB 4X6OA 4Y79A 3SGQE 1SGYE 4I33A 1V2TT 1A46H 1ZHMA 5A2MH 5EXLA 3W94A 1OYQA 3BEFB 3LPRA 2V35A 2F9OA 1LTOA 2G4UA 5EW1H 5G4BA 5T6DA 3SI4H 1DUAA 4DJZB 1SSXA 1BTYA 4IS5A 3ZZ7A 1XX9A 1HIAA 4Q7XA 2P95A 2B7DH 1PQ5A 1A4WH 3RXIA 4OGYA 4CBNA 1YCPK 4A92A 2H9TH 3FVFB 2K1QA 2NU1E 1MBMA 4Q7ZA 3SI3H 4ZKNU 1CGHA 3SUFA 2ZHFH 4VGCC 5JBCS 4FUIA 1O33A 3OY6U 3LC5A 1BA8B 1H9IE 4HTCH 4LZ4B 3RC6A 1DWEH 1FIWA 1HRTH 1S6HA 1QRXA 1LQEA 2W7UA 1ETSH 1QURH 5FXLA 3A8AA 1NRSH 2ZCKP 3E6PH 1NFYA 2RCEA 1HBTH 1PJPA 3STJA 4XSKU 1DY9A 4YOGA 2JETC 3GDVA 3TJOA 3PLKA 1G3CA 5EXMA 2P59A 4Y8XA 3E3TA 4X8SH 3VB4A 1TPAE 2G52A 3R0FA 3U9AH 3OYPA 1K22H 3SV7A 3A8DA 5GIBA 1MKWK 1YYY1 1O2VA 2J94A 5DP4A 3UNQA 4MTBA 4B71A 2OQ5A 1NFWA 3GY2A 1C1PA 4ZUHA 4WMFA 3P92A 1EZSC 1ID5H 3BG4C 4TWYA 4CHAB 1G30B 3BV9B 3SU4A 2THFB 3I29A 2OD3B 3SW2B 4X1NU 3QN7A 2WUCA 3RMNH 1C9PA 3DFLA 4GLYA 2A7HA 3U8OH 3PMJA 5I46H 1FLEE 4JK5A 1F0SA 3M3VA 1TA6A 1YPKH 4Y8ZA 1S83A 1KXAA 3E0PB 2GCHF 1K1JA 4ZXYH 1BITA 3C27B 3MO6A 4K1SA 5FPSA 5SGAE 1KLIH 1W12U 1MAXA 1OYTH 4X6MA 1BB0B 3FANA 1QY6A 2QXHA 1ZJDA 1GMCG 2A4QA 2XC4A 3UWJH 5L6NH 3SNEA 1C5XB 2H5DA 5JB8S 1BBRE 1O2HA 2CF8H 4FU7A 1SG8B 2TIOA 1EAXA 2VGCC 1C5QA 2YOLA 3KHVA 1AO5A 1C5OH 4CRGA 1DOJA 1N6XA 1K1LA 2R2WU 1EKBB 1TGCA 3SNDA 2Y82A 1CA8B 3RXCA 1C5YB 5DP8A 2G4TA 1O34A 4GCHF 3K9XB 3KNXA 1E36B 1GBTA 2BMGB 2JKHA 1AU8A 5F6MA 2IPHA 2BDAA 2G55A 3LGUA 1GHAF 1TX6A 4UFDH 2XRCA 1RGQA 5C20A 3BTQE 5L2YH 1KSNA 3SV9A 1MBQA 5JDUB 2TRMA 4I8LA 4NFFA 3RXDA 4H4FA 1V2OT 5DP7A 1DXPA 3SNAA 1ZTKA 4JZFH 1RFNA 1SLVB 2C93B 3A7XA 1TPSA 3TIUA 1EZQA 2H5CA 5T6GA 8GCHF 3CP7A 1DWCH 2V6NA 3MFJA 2VWOA 1UTLM 2ANKH 3BF6H 2ZPSA 2WPJS 1FN6A 1MTWA 2G5VA 3F9FA 3KEEA 4Y11E 1CO7E 3VPKA 1P2IA 1AFEH 2C8XB 3UFAA 3MH6A 3TPIZ 1UTNA 2IOTA 4ZHLU 1Z6JH 1C1OA 1EXFA 2XWBI 3E0NB 1GHZA 2XXLA 1D3QB 3QDZB 3MMGA 1O2SA 2SGQE 2ZNKH 4AFZA 1IQIA 1EUFA 5EQQA 1HAXB 2OC7A 3KQDA 3QO6A 1SGFA 1UVSH 3RC4A 1O3BA 1GBBA 2ZDMA 1SGDE 1TGTA 1F0RA 3GY8A 2QF3A 2FXRA 3SHAH 2GT8A 1UHBB 3RC5A 2VVUA 1MU6B 1EJMA 2FOGA 4WVPE 1EX3A 1KTTB 3LT3A 5EQSA 2W5EA 1GDNA 1OOKB 1K9OE 1N6YA 3RLYH 1O5FH 2G81E 3SBKA 2BYAX 3P8FA 1OP8A 3EA9A 3NZIA 4JZEH 4UFFH 4F49A 1O2ZA 1O31A 4AGKA 7GCHG 3LDXH 2BY9X 2ZGJA 2SNWA 2HLCA 1KXFA 1C2DA 1FAKH 1PYTC 1O5GH 4WXVA 2UWPA 9ESTA 1O32A 4B75A 5DP3A 1TONA 1ACBE 1C9TA 4DVAU 1C5RA 3MU4A 4SGBE 2BDCA 2OQUA 4AB8A 1T4VH 4BXSA 2PGQB 2ZHWH 1EJNA 4BTIB 1HJ8A 1SOTA 1E37B 2Z9JA 1S81A 1B0EA 1KDQB 2ZZUH 1T8OA 2P16A 3HATH 1UCYE 2ULLA 4NA7A 2VIPA 1MMJN 3LJJA 5EOKA 1YPJH 3F9HA 1QRWA 3GDUA 2FX4A 1O5BB 1DFPA 1FNIA 4IW4E 1O35A 3T28A 3ESTA 5FCRA 4A1XA 2VVVA 5JBAS 1XUGA 2A5AA 1MQ5A 1SGCA 3GY6A 2GX4A 2V0BA 1V3XA 2A4RA 3MTYA 3SJ8A 1V6DA 4XBCA 3TH4H 1AWHB 2QXIA 3RXAA 1ZTLA 4YLUA 3PO1B 2XCNA 4O9VA 2H9HA 2VIWA 1AIXH 1IQGA 3UQVA 4GUXA 1S6FA 1YGCH 2BOHB 1QBVH 2ZFRH 3BTME 4NIXA 3TLOA 4ABGA 3TGIE 1J16A 1ZSLA 2QAAA 3ZYDA 4Q80A 5JBBS 5GWZA 1BTUA 4YT6H 3P8OA 1DLEA 3MWIU 1EQ9A 1AB9B 1DITH 2B5TB 2R2MB 2G8TA 1QJ7B 2ZQ2A 1O2QA 3GYLB 2BY5X 1YF4A 4NIVA 3HK3B 4XE4A 1VCWA 3SHCH 5EQRA 2XC5A 1P10A 2H6MA 1V2UT 3UTUH 1A7SA 1OWEA 3SU3A 5EPYA 1L2EA 1LHCH 4KGAA 1IQEA 1O2WA 4LOYH 3LGYA 1N1LA 2BTCE 3FP8E 3OSYA 4I31A 2FZZA 1BJVA 1W7GH 1D3PB 7LPRA 3MH7A 3RMOH 2R9PA 4ISHH 3RXQA 3F6UH 3RLWH 4ISIH 2J2UA 1D4PB 1ZJKA 5ESTE 1J15A 1VR1H 4Y76A 2ZFSA 1C5TA 2FOEA 3VB5A 3CENA 3NUMA 1LQDB 1SOZA 1NRPH 1GCDA 5FX5A 5LPRA 2CJIA 2Y5FA 2ASUB 4Y0ZE 2D2DA 4DIIH 1BRCE 2XBWA 1MD8A 3MH4A 5T6FA 1H9LB 1EPTC 3UNRA 3A8CA 2PKAB 4HZHA 2F9UA 1HXFH 3PROA 1UTQA 1RXPA 1O3FA 1TIOA 1NFUA 5DK1A 2F83A 4GHQA 4YOIA 1O2UA 4TY7A 4NA9H 1MCTA 4INLA 1WSSH 2Q1JA 3IWMA 1D6WA 1XUJA 2D1JA 1TGNA 2ZQ1A 1A2CH 1NU9A 1O2IA 1UTOA 3F9EA 5F8ZA 4X8UH 2ZCHP 1HCGA 1UHBA 4NGAH 4I8JA 1V2JT 3SJOA 1GPZA 3TVJB 2CGAA 2ZP0H 5FX6A 1S5SA 1VITG 3AAUA 2J9NA 1C1UH 1IOEA 1C5PA 1GMHF 1JXPA 2EEKA 4ZAEA 1GBEA 4MNYA 1NC6A 4Q7YA 1G36A 5FPYA 1FAXA 4ABEA 1P3CA 2O9QA 1DE7H 1FDPA 2GTBA 1ZRKA 1BHXF 1FPCH 1OXGA 4B74A 3M7QA 3D23A 2OC1A 1KXDA 3SU2A 1PPZA 1NRNH 4MNXA 1OWHA 1ZLRA 2CXVA 5I25A 3LGWA 2Q6FA 1BTWA 3D49H 2GT7A 2J95A 4B76A 1GBLA 5IYTA 3QX5H 2YNBA 4TYDA 1SHYA 3A83A 3BTHE 1P9SA 1DSUA 5GXPA 1CT0E 3O8BA 4BTTB 3UREA 3PTNA 3MYWA 1YBWA 1QB1A 5FCKA 2STBE 1KDQA 2OBQA 2R3YA 2Z9KA 1N8OB 1O3HA 1MZDA 1P57B 4A1TA 4ISOA 2BVSH 1K1MA 4BAHB 2FX6A 1ZMJA 1P11E 1TQ0B 3ZVCA 5GPIB 5EU8A 4ABIA 1O39A 3T26A 1CT2E 2FO9A 1QBNA 1JMOH 4WF8A 1OKXA 2R3UA 3BG8A 3RXJA 1TNJA 1C1MA 3BIVH 2ZDVH 4DIHH 3LIWA 1DUEA 5DGJA 4ABDA 1DT2A 1HV7A 2PV9B 4JMYA 4Z0KA 1OX1A 3A7ZA 1J8AA 3LH3A 3RM0H 2UWLA 3UOUA 1UVPA 1KTSB 3K6ZA 2OCVB 3F1SB 2UUYA 4WWYA 1O2GH 4K69A 2EA3A 2WUBA 1QA7A 4AG1A 1BT7A 1L1GA 3MH5A 4PROA 5PTPA 4BAOB 1PYTD 4MPVA 2W7SA 5AVDA 3QWCH 3S7KB 4VGCB 2ZG0H 3ZVGA 1UK2A 2BDHA 2ZEBA 1LVOA 1P04A 3P95A 4UFEH 2ZC9H 1QL9A 4FVBA 2BLOA 3RXPA 1QGFA 3LKWA 1CU1A 1O2YA 3QTVH 1BBRH 2XC0A 4OS1A 2ZTZA 4X2YA 1LPKB 1HLTH 4NZLA 1IQNA 1GHYH 1XVMA 1W10U 4FXGH 5ETXA 1O5EH 4X2WA 1SGQE 3OY5U 2GZ7A 1SI5H 3FAOA 4ZKSU 3URCA 2OC8A 2XBXA 3H7OA 1SLUB 2XYAA 4K3JA 1DM4B 1V2MT 1JRTA 2HNTF 3SV2H 5C1UA 2FPZA 3PYHA 3GY5A 2JETB 3ZVEA 2GMTC 4I7YH 3A89A 4FUBA 1QTFA 1NO9H 2PKAA 1F5LA 1IQKA 1V2NT 1QQUA 1OWKA 2QCYA 1T32A 3SU1A 1UTKA 2A31A 1AUTC 4INKA 5F8TA 1LPGB 2FYQA 4Y0YE 4YOJA 1WAYB 3ZV8A 4B2CA 1WTHD 2GCTC 3UY9A 3BG4B 2VIVA 1TNLA 1JWTA 5LPFA 2XTTB 1ETRH 3ATIA 1C1WH 1KY9A 3ZVBA 2HRVA 3MHWU 2OINA 1AQ7A 2B9LA 2V3OH 1ELEE 2A2XH 2PR3A 1NS3A 3V3MA 3ZZ9A 4IMZA 1D3TB 4X1QU 2J92A 4TPYA 3MI4A 2BDBA 2AIPA 4E7NA 1ARCA 1G37A 1ORFA 1YCPM 1KXBA 1W2KH 4AG2A 1FXYA 4OS5A 1H8DH 1INCA 1P8VC 4I8HA 3MNCA 1AY6H 1FQ3A 2Q6DA 3SJKA 1HDTH 1A5HA 1TA2A 1JBUH 2QXGA 4CRFA 4AFQA 1LCYA 2IN2A 1C2IA 4K8BA 1P9UA 1TRNA 1SB1H 2VGCB 2VIQA 1SQAA 2P94A 2RG3A 3EYDA 3P17H 1H8IH 1V2ST 2BZ6H 2A0QB 4GPGA 4NSYA 4UE7H 1HAPH 1GI6A 1DICA 2BD7A 5HXFA 1GHBG 3QLPH 4YZUA 2NU0E 1WV7H 1TPPA 2WPHS 4DOQA 1EB2A 1UTPA 2A5KA 2SNVA 1GJAB 3M35A 1GVZA 5K7RA 4HGCA 3PM3A 1YPLH 3M5OA 3DUXH 2ZCLP 2STAE 2FESH 4ZH8A 1O3GA 1C2HA 6LPRA 6ESTA 1GJCB 1GI9B 2DUCA 2W3KA 5JPMH 4LXBH 4U2WA 1TLDA 2FDAA 1CBWB 3EGKH 1GJ9B 2GV6A 3N7OA 2H1UA 1CQQA 3M3TA 2G00A 3VEQB 1GI4A 3AVZA 3H7TA 6CHAC 1C1TA 4UD9H 1J14A 3RXRA 2ZO3H 1TX7A 1O3PB 3PTBA 4DT7B 1YPMH 1J17T 3K6YA 1E0FD 4CRDA 1HAVB 1GMDF 1LHEH 1BTZA 3QGJA 1YP9A 4GHTA 1UTJA 4B2AA 1C5UA 2VJ1A 1ZPBA 4R0IA 5ABWA 7GCHF 3BEUA 1C2GA 3SUGA 1GVLA 3P8GA 4GAWA 3TJVA 3BEIB 3TITA 1SC8U 1GL1A 1ABIH 3A7WA 2QY0B 1MTVA 2PFEA 1UVTH 2ZDKA 3L6PA 5C1YA 1CHOF 1O3NA 3RXUA 1F92A 3EE0B 4WH8A 1AD8H 2FIRH 4TWWA 4MNVA 1KXCA 2VVCA 4I8KA 4D9QA 1C1QA 2AFQB 1G3DA 5ESBA 2BY6X 1WTGH 2AS9A 3KQCA 1CBWC 2PUXB 2HGTH 1OWIA 1CGIE 1QJ1B 2AEIH 2VWLA 4DW2U 1C5MD 4O3TA 1MU8B 3E90B 1XXDA 2QC2A 2WYJA 3M5NA 1XMNB 2ZHDA 1NN6A 1QBOA 2ZTYA 3STIA 3ELAH 5EODA 3TH2H 4ZHAA 1MTSA 1GBIA 1L1NA 1PQ8A 4WXIA 2BB4A 3TNSA 1FPHH 3VB7A 5CE1A 1BMMH 2F9NA 1BCUH 1LDTT 3PMAB 1GGDC 4IBLH 1ZPCA 4KTCA 4A5TS 1YLCA 3PMBB 2WPKS 4WJG2 1C4Y2 3T29A 3SZNA 4DURA 1V2PT 4Y7AA 2VU8E 2Z94A 4M7GA 2P3UB 1NT1A 1CA0C 1FUJA 1JIRA 3BTDE 3GYMA 3VB6A 4CREA 3A80A 1ELBA 3RXKA 2C4FH 1SLXB 3NXPA 4CRBA 2BY8X 5AF9H 1ZTJA 3U8TH 1ZHPA 2Y6TA 2GCHG 1MUEB 3HGNA 3M7UA 2A7JA 4B73A 4AN7A 4IN1A 1IHTH 1MTUA 4OS4A 2WV5A 5A0BA 1Y3UA 2Z7FE