1BQYA

Plasminogen activator (tsv-pa) from snake venom
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
234
structure length
234
Chain Sequence
VFGGDECNINEHRSLVVLFNSNGFLCGGTLINQDWVVTAAHCDSNNFQLLFGVHSKKILNEDEQTRDPKEKFFCPNRKKDDEVDKDIMLIKLDSSVSNSEHIAPLSLPSSPPSVGSVCRIMGWGKTIPTKEIYPDVPHCANINILDHAVCRTAYSWRQVANTTLCAGILQGGRDTCHFDSGGPLICNGIFQGIVSWGGHPCGQPGEPGVYTKVFDYLDWIKSIIAGNKDATCPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PLASMINOGEN ACTIVATOR
publication title The crystal structure of the novel snake venom plasminogen activator TSV-PA: a prototype structure for snake venom serine proteinases.
pubmed doi rcsb
source organism Viridovipera stejnegeri
total genus 51
structure length 234
sequence length 234
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1bqyA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1bqyA02
1EXFA 4ZROA 2FMJA 3UQOA 3HKJB 4E06H 3MO3A 8GCHF 1K1NA 1NFYA 1Z7KA 1KYNA 1UK3A 2VGCC 4IC6A 3BTEE 1GJ7B 3F1SB 1OP0A 1G3BA 3TGIE 1CA0C 1O2JA 1B5GH 4CRDA 1AVWA 2GV6A 4BXWA 5FPYA 4D8NA 3F9FA 1AY6H 4GPGA 1DWCH 1DANH 2A5IA 1GHYH 4JMYA 1O31A 1QRXA 1PYTC 4CREA 1C2EA 1DFPA 1L4ZA 3E8LA 1UVTH 5LPEA 4BAOB 1N8OB 2ASUB 1H9LB 2BVXH 3ZZ3A 2FX4A 1D3PB 2Y81A 1AZ8A 3LKWA 3FP8E 1MZAA 1Y59T 1QRZA 3EA9A 1VITH 3HGNA 1UHBA 2BDCA 2R0KA 3L33A 1HJAC 1ELFA 1HB0B 5EXNA 1O5BB 2AFQB 4U32A 1IQLA 4OGYA 5HMAA 1GBCA 3GY7A 5CE1A 4IN1A 5A8XA 4FUIA 4A1XA 1GHAG 1SGQE 2IN2A 2EI6A 1P03A 3STJA 1XUKA 1PJPA 5J4QA 1CQQA 3S9AA 3M7UA 2W7UA 1AWHB 1DY8A 4ISHH 3UIRA 1FQ3A 1H1BA 4OS6A 5HXFA 2P3UB 1S83A 2OTVA 3L6PA 2QXGA 2H9HA 5BRRE 1G36A 1ZTKA 4WVPE 3RXEA 1ZGVA 1G37A 2FO9A 2PFEA 3TJNA 5LH8A 4AGJA 4HFPB 1L1JA 5EPYA 4XBBA 1GBDA 2WINI 5A0AE 1NN6A 1HGTH 1Y8TA 3KF2A 4YO9A 3ZZAA 3RXFA 2Y7ZA 1O3FA 2ZHEH 3SV7A 3F9GA 4OS4A 3P17H 2D2DA 1QGFA 1TOMH 3M5NA 2AIPA 3LC5A 1Z8GA 1DWDH 1RS0A 1V2KT 2H9TH 2J4IA 2UUFB 1UTNA 5A8ZA 1QL7A 3AAVA 3K65B 5DG6A 1O2IA 4GVUA 3O8CA 5GWZA 2R3YA 4NWLA 3UR6A 5EQSA 2CHAC 2A32A 4AB8A 5K7RA 2P3FH 3A7WA 4NSYA 4FUFA 4O3TA 2ZP0H 1EX3A 1MBMA 3M5LA 3QX5H 1SVPA 4YLQH 2Z9IA 3A85A 3SUFA 5EXLA 4DJZB 7GCHG 2BY5X 1QA0A 2ZU5A 1W11U 2UUYA 4OS2A 5JBAS 3I77A 1NO9H 1NT1A 5HGGA 1O2NA 4JZIA 2NU3E 3BTME 1ETTH 3K6ZA 2G00A 1ZZZA 5C5NA 3TJUA 1EOLA 1NC6A 5L2YH 2TBSA 3GY8A 3QZRA 2H6MA 3NUMA 1PPBH 4F4OC 3S7HB 1S82A 1NPMA 2PW8H 1CBWC 2UWLA 2PSYA 2XTTB 2QF3A 1HAOH 1WTGH 1XUJA 1DWEH 2Z7FE 3VB4A 4CBNA 4X6PA 1M9UA 2A7CA 2PKAB 1FY5A 1ZMNA 2PHBA 1ZMJA 4YESB 1DX5M 4XSKU 2XBXA 1TNLA 3E1XB 4TY6A 1P57B 1Y5UT 1GHWH 2W7SA 3A82A 1O2XA 4BAHB 3SU3A 1FPCH 5GDSH 4FU7A 5ESBA 3DHKH 3ZVAA 1SL3A 1ZYOA 1LVBA 1P2JA 1ZPBA 2XRCA 4NIWA 1O38A 5DGJA 1UK4A 4YLUA 1FN8A 2V3OH 3BIVH 3ZV9A 3LH1A 5EODA 1TX6A 3BTGE 3S9CA 4TWWA 2J95A 3UWIA 1IQHA 1YCPM 1LHFH 1OSSA 2AYWA 1GJCB 3TJVA 4THNH 1Z8JB 1C2IA 1O3GA 1SHHB 3BTDE 3GCNA 3A7ZA 1ETSH 3VB3A 3SQHE 1SGNE 2Q6DA 2ZHFH 2BD8A 1KTSB 1KXEA 3M61U 3RU4E 5DJ7A 1C5UA 1V2OT 5DP3A 3TNTA 1IQIA 4I33A 1NFXA 3T26A 4H4FA 1MD8A 1MKWK 1NFUA 5J4SA 1V2NT 3M35A 1SR5C 5L2ZH 1A4WH 1Q2WA 5EG4A 1YGCH 2ZHQH 2QF0A 2EI7A 2DUCA 1O3HA 2AMQA 3Q00A 1GI4A 1GHBF 3RXOA 1TMTH 2J92A 1IHSH 3GY2A 2VU8E 1CU1A 1ZSKA 1C5PA 2BX4A 1IQMA 1K1MA 6ESTA 1O0DH 4AG1A 1C2MA 2GMTB 4AOQA 5BPEA 5F6MA 1G3EA 3UY9A 2VVUA 1HAPH 2W26A 1NFWA 1C5QA 1P09A 3DA9B 4HGCA 1TNIA 5IDKA 1JIRA 1T31A 3MU8A 2O9QA 3Q77A 1O5EH 2OBOA 3A8AA 1FONA 4B1TA 1K1OA 4RKOB 3SW2B 1YBWA 1ARBA 4I8LA 1BBRE 1BTYA 1A0HB 5HM2A 1XVMA 1DXPA 3GISB 1W10U 2TRMA 4INHA 4MPXA 4FUHA 2D26C 2VIQA 3ZZ8A 1WU1A 1H9HE 1YLDA 4CRAA 4U2WA 1QNJA 1UJ1A 1XUIA 1TNGA 3TIUA 2P16A 3DD2H 2GTBA 4R8TB 1P3EA 1PPGE 3S9BA 5A0CA 3H7TA 4I8GA 1LPZB 3A84A 3RXCA 2C3SA 3EA8A 1TBRH 2C8WB 5EW1H 3K6YA 1UCYE 3LIWA 4A7IB 3SO3A 2TGDA 4D76A 2HRVA 1BRBE 1B0FA 2J2UA 2PTCE 1GL1A 1HAYB 5CHAB 3A8DA 1EZSC 1FY3A 1C5YB 4DT7B 1HAVB 1PQ5A 1BTWA 2ILNA 3SJOA 3HK6B 2FTLE 2OINA 2NU2E 1CO7E 3TPIZ 3FP7E 1LKAA 4LK4A 1J14A 3SORA 2AERH 2VIPA 5I46H 1UO6A 2FLRH 1GCTB 1MCVA 1T8MA 5FBEA 2GCTB 1GBIA 2VIDA 1SGCA 4CHAB 1GI3A 2BDBA 1W7XH 1UTOA 3GDSA 2SGEE 1D3DB 2QN5T 4Q80A 3PB1E 1MAXA 2BZ6H 2GV7A 2BDAA 2NWNA 3UNRA 1HAHH 4D7FA 1SGEE 2FDAA 1RTFB 3LJOA 2YNBA 1EAIA 3SOSA 1ID5H 1O2TA 2BD2A 4X1PU 2BM2A 1MTWA 4YOJA 1TGTA 3LGIA 3N7OA 5AVDA 1KDQA 3P70B 1V3XA 4Y7AA 1O3OA 1WQVH 1Q3XA 1C5SA 1WTHD 3M3SA 2VH0A 1JIMA 5SGAE 3SU0A 1C1QA 3SNAA 1THRH 2JKHA 1FIZA 3TH3H 1MTVA 1P02A 5DP8A 2VB0A 2NU0E 3A83A 2SGDE 3MU5A 1GDNA 2WPLS 2GZ7A 1IQNA 1SHYA 1ANBA 1V2QT 1BRCE 3SHCH 4ABAA 3PROA 2HPQH 2EEKA 1PPEE 3TJOA 3U8RH 1EAWA 1EAXA 2GCHF 1SGDE 1MQ6A 2QIQA 4HTCH 1K1PA 3PMAB 1Z8IB 1F0RA 1GG6B 4D7GA 2BQ6B 4LOYH 4ZMAH 2GGVB 1DLEA 3FFGA 4SGAE 3ZVGA 2BX3A 1SQTA 2P95A 4WH8A 2DE8A 1GBEA 2J38A 4WMFA 1EJNA 3OYPA 4Y8YA 2GZ9A 5PTPA 1S84A 1KLTA 1O3JA 3EYDA 2C8ZB 5AFZH 1CGHA 1LPGB 4MG3A 1YPEH 1OPHB 3A80A 1TPAE 2OD3B 3GYMA 4ZKNU 1O2QA 1RJXB 2P59A 1KIGH 1TGBA 3AVZA 1P04A 1T32A 2GX4A 2OLGA 1W7GH 2QGRA 4FXGH 3SNDA 4LZ1H 1IQFA 1ELBA 2GZ8A 1OWHA 1ZGIA 3V7TA 4WMDA 1GHBG 1GI8B 4Y0YE 3RXGA 4ZAEA 3Q3YA 2F9BH 2AEIH 1ANCA 2G4UA 2V3HH 1ACBE 3GY5A 1AD8H 1SGIB 1EUFA 1XMNB 4ISLA 3V13A 1F0TA 1HCGA 1F0SA 1BTUA 1BRAA 2CF9H 2QYIA 4BXSA 3PWCA 2P8OB 1YYY1 5GJ4B 2G55A 2ZCKP 2FZZA 3PTBA 1UTQA 3RUOA 4ZXYH 2FI3E 2ANWA 2Z94A 1TRMA 2QXHA 3VB5A 4AYVB 1EPTB 3DFJA 1SBWA 4DGJA 1SPJA 2QY0B 3RMLH 1AGJA 1DUAA 1WV7H 3KQBA 2BYAX 4IW4E 1UK2A 5ABWA 3U1IB 2BZAA 1UHBB 1VJAU 2HNTE 2V0BA 2FLBH 1GVLA 2ZWLH 1RIWC 1HAIH 2XBWA 2SGQE 1F7ZA 2Z3DA 3BV9B 4X8UH 3V3MA 2ZGJA 1O30A 2KAIB 4X0WU 1SI5H 1UTMA 3RU4D 1SQAA 4OGXA 4A92A 3A7VA 4NG9H 5JBCS 4B75A 1VGCB 1TONA 5CHAC 1TQ7B 1D9IA 3RC4A 1GHZA 3TVJB 3KNXA 4CRBA 1FNIA 3EA7A 3A89A 3RLYH 5JB9S 2BQWB 3PLPA 1AFQC 1C5LH 1DITH 4NIXA 3HGPA 3TGJE 1QBVH 2VINA 1LQEA 1GCTC 3ZVFA 2K1QA 1GBAA 2GCTC 2ZO3H 3C27B 1GI6A 1QBOA 1AUJA 4Y6DA 1O2WA 3D49H 1LHGH 2B9LA 2H1UA 1D3QB 4UFGH 2CGAA 1EASA 3SQEE 1DUEA 3F9HA 2BOHB 3RC5A 1TLDA 3OSYA 3SV9A 1P2MA 3MO6A 4BNRA 3P6ZB 1ZR0A 5A8YA 3MU0A 1GJ6A 1WAYB 2WUCA 4ABJA 1GBKA 2BHGA 1KXDA 3LGVA 2FM2A 4UFDH 1D4PB 1OX1A 1NM6A 9ESTA 2C8XB 9LPRA 3UUZA 5C1XA 5EQQA 2VIOA 1HPGA 3MWIU 4XOJA 3SGAE 4D9QA 1LQDB 4UD9H 2F83A 1PPHE 2RG3A 5FCRA 1P01A 1O2HA 3PTNA 5DP9A 1AIXH 2BVRH 3BG4B 3LGWA 3GOVB 1P2NA 3LU9B 3ENSB 4JCNA 3C1KA 4RSPA 4MQAA 4Y7BA 3ZZCA 1XUGA 1S6FA 3BIUH 1FAXA 2GCHG 3BG8A 4MNVA 1A46H 1DVAH 3EDXB 1QL8A 2P94A 7KMEH 1O2KA 2G4TA 3MHWU 2C93B 3GICB 1P05A 1O3NA 1ZRKA 2F9UA 1P11E 2G52A 1N6XA 1C5VA 2ZNKH 1O2GH 1HDTH 1AUTC 4Q7ZA 1HAZB 3MU1A 2FODA 2OC8A 3R0FA 2AMPA 1QHRB 2YOLA 4X6OA 1EKBB 3P8FA 3SU6A 1C5RA 1C1WH 2BD9A 1EAUA 2ZEBA 1AVGH 2Z9JA 1TNHA 5C1UA 2XBVA 5C3NA 2OUAA 1O5GH 5E0HA 1V2VT 1TGCA 1BOQA 1HYLA 5LPRA 1DOJA 5C5OA 1DDJA 4A5TS 2P93A 3Q3KA 5JYIA 2NU1E 1TGSZ 2O8LA 2Q6GA 1H9IE 1O34A 1BMMH 4LXBH 1AU8A 3EQ0H 2GDDA 1LKBA 1V2PT 4CRGA 1QJ6B 1SLWB 3RXRA 4YOIA 1QY6A 2ALPA 2CMYA 5C2ZA 4X1SU 2P8OC 4A1TA 4NGAH 1ELVA 3ZVEA 1IQGA 1O37A 1P8VC 1C1VH 1OYQA 3CENA 3HATH 1DLKB 3LJJA 1HUTH 3RM0H 2FYQA 1EPTC 1GWAA 1A61H 1TABE 1C1OA 1GVKB 3VFEA 3H7OA 1HJ9A 3P8OA 1J9CH 1T8NA 1EATA 5HM9A 1XUFA 3K2UA 1EP5A 3KEEA 6CHAC 2HWLB 2VH6A 4K1TA 2ZDMA 2ZGBH 2R3UA 4RN6A 1ZOMA 1TOCB 2Z3CA 3NWUA 4B2BA 2D1JA 2ZPRA 3E0NB 2JETB 2Y80A 2G5VA 2XNIA 2FOEA 3UNSA 2ODPA 1TBZH 1L0ZA 3RXIA 5IYTA 2V35A 4NA8A 1DSUA 1V2ST 1ZRBA 1THSH 2FS8A 4FVBA 5FBIA 1QQUA 3GCHB 1ABIH 1K1IA 4X8TH 4GSOA 5E8EH 2FI5E 4VGCB 1RXPA 2VVVA 3RMOH 2Z9KA 1OKXA 2TPIZ 2OC0A 1O32A 3BN9A 3PM3A 4ZHAA 3MNCA 5DP6A 2BDGA 2VIVA 3U8OH 2HALA 1GJBB 3ZZ5A 2ZC9H 4MPVA 1O2RA 1IHTH 2TGTA 2RA0A 2F9VA 3GCTF 5T6DA 1ESBA 3NZIA 3BTHE 4CH8B 2FOCA 4JK6A 2ANMH 1Z6EA 2R2WU 3ATLA 1DSTA 4I31A 1A5GH 3FVFB 2IOTA 1NZQH 4TWYA 1ELAA 1O3IA 2QV1A 4ZXXH 1K21H 3PYHA 1DXWA 1C1PA 2BY8X 2ZQ1A 4WWYA 2WPJS 2FPZA 1SLXB 4Z6AH 2AGGX 1GI0A 3RXJA 1F5KU 3KL6A 1CGJE 4MNYA 5E2PA 3K9XB 4ZHMU 4BOHA 1NS3A 1MD7A 1O3CA 5FPSA 1CT4E 2PR3A 1HXFH 1N6YA 1FI8A 4JZ1A 4QT8C 1O3AA 3QTVH 5F8ZA 4NZQA 1N8OC 3BTKE 1HLTH 4AB9A 2ANKH 3RP2A 1GMCF 1BHXB 3KIDU 1S6HA 3U1JB 3A8BA 1H8IH 1BTPA 3M7TA 2SNWA 5EW2H 1K9OE 2BDYA 1YPMH 1TQ0B 1Z1JA 3KQDA 4IBLH 2PSXA 1ZHMA 3A7YA 4CRCA 2ODQA 4R0IA 2W5EA 1C2KA 5FXLA 1O2YA 5FX5A 1THPB 3LGTA 1ELCA 4F49A 1ZJDA 2R0LA 2BLVA 4BAQB 3A8CA 2FX6A 3T5FH 4ABIA 1BUIA 1FIWA 3SI3H 1SGFA 4BTIB 2OCVB 2OQUA 2AMDA 1GDQA 1BBRH 1L1NA 1UTPA 1OWDA 1S0RA 3ATIA 4K69A 3MO9A 1IQEA 2IJOB 2J34A 2QXJA 2RCEA 1O36A 1LPKB 3O8RA 1C2JA 1L1GA 2ZU3A 3TK6A 4FUCA 5L6NH 3M7QA 1ESTA 4Y11E 1Y3UA 1LHCH 1CA8B 2BXUH 2JH0D 3QZQA 1C5ZB 1ZHRA 2PKAA 2XXLA 1EB1H 3RXPA 1JBUH 1ORFA 1O39A 4CRFA 2FOGA 3MH7A 2CN0H 3W95A 3NXPA 1LCYA 2I6SA 1TA6A 3QTOH 5H4IB 5F8TA 1YM0A 2UWOA 1NRRH 1SG8B 2BLWA 2BVSH 3AW0A 4Y8ZA 3SJ8A 2ZFFH 1HAGE 2A4RA 4NZLA 3SGQE 1UCYH 3MI4A 4Z0KA 4K8BA 1O5AB 1SLVB 1A3EH 3UPEA 1WYKA 2Y82A 1YC0A 4X1RU 3ZYDA 4CH2B 1AB9B 4DOQA 2SGAA 2GKVE 5JB8S 1LVYA 4B2CA 2QAAA 3M36A 1C2LA 1GJ9B 3SV8A 3ATMA 1Y3YA 4GHQA 3VGCB 8KME2 2A7HA 1SSXA 1O2ZA 3GCOA 3O8BA 1BMLA 2JETC 1GL0E 3ZVBA 4NIYA 5E0JA 4ABBA 1BTZA 4MLFB 3FAOA 1RD3B 1QCPA 4ZKOU 3TH4H 3I29A 3BSQA 2ZGHA 1T8LA 3ESTA 1P3CA 2STBE 1F92A 1EJAA 1AFEH 1S5SA 1QTFA 3SU5A 1E34B 2ZTZA 2UUKB 1ELTA 1WBGB 2A31A 1E37B 1O33A 1SQOA 2D8WA 2A4QA 4E05H 3G01A 1LVMA 4A6LA 1AKSB 3BTQE 3VEQB 1GGDB 1H4WA 2ZCLP 3P92A 1AO5A 1GBJA 2STAE 2RDLA 4JYTA 1V2MT 3GCTG 4DIHH 2LPRA 2A0QB 5B6OA 1GI1A 2HNTC 3T25A 3PO1B 5DP7A 3SJIA 3MH4A 1FY1A 1C2FA 2HNTF 3SZNA 1XUHA 1W13U 3D62A 1IQJA 1P2QA 2ESTE 3ODFA 2THFB 1O2VA 1PPFE 3MH6A 3SBKA 3ZV8A 3RLWH 2ZFRH 1G3DA 2ZU2A 2NU4E 1GJ5H 4MDSA 4GCHF 1T4UH 4FU9A 2VGCB 1CGIE 1F5RA 3SJ9A 1CA0B 1QB1A 3KQCA 2BLQA 1KSNA 1P06A 1W12U 4YT6H 4I8HA 1FV9A 1NU9A 4YOGA 4BTTB 2C90B 1TMUH 5F8XA 2C4FH 1BRUP 1Y5AT 1F5LA 3PLBA 1GPZA 4U30A 1W0ZU 1GMCG 5DK1A 4ABEA 1C2GA 1C2DA 2GT8A 2BY9X 1KLIH 5GPIB 2ZPQA 1BHXF 4O03A 2VVCA 1VR1H 1HRTH 1MKXH 1T4VH 1OOKB 2M5TA 2WPKS 3RXSA 3A87A 3OTJE 1NRPH 2GDEH 1C1SA 1HJAB 1C4U2 4KKDA 4IGDA 5CMXH 1YPKH 1YCPH 1D6RA 1LDTT 1KY9A 4NFFA 3RC6A 1QRWA 2BDIA 4B71A 1CVWH 3RXAA 1S85A 1LHDH 4H42U 1EP6A 3HK3B 1HV7A 3MNSA 4NWKA 2Z9LA 2ZDAH 4NSVA 5TCCA 1J15A 4FUEA 3QLPH 1C5XB 1HAVA 2ZTXA 3UOPA 4CR9A 1C1RA 1GMHF 1TPSA 1PQ7A 2FI4E 2CF8H 5HYOA 2ZF0H 1W14U 1SGPE 1J16A 2R2MB 4XBDA 1WUNH 1FN6A 1KXBA 2GMTC 1RFNA 2FYRA 1QR3E 1C9TA 1MTUA 1SOTA 4KTCA 4E7NA 2TGPZ 2Q6FA 3SUDA 2H2ZA 1VJ9U 2BQ7B 2GVFA 3SJKA 1DE7H 1DICA 1JOUB 2Q1JA 1NESE 4IMZA 3TH2H 1HBTH 1OXGA 2F3CE 4ABDA 1MH0A 1EQ9A 1TAWA 4ZH8A 1AE5A 5FCKA 1KXCA 4UDWH 4AZ2B 1QFKH 2O8UA 4YT7H 4JK5A 4XBCA 3E0PB 1O5DH 1AN1E 4X2WA 8LPRA 4NA9H 4I8JA 6LPRA 2VWMA 2P3TB 4KELA 2FOHA 1S0QA 1UVUH 1W3CA 2WYGA 4X8SH 2XC0A 2FS9A 3RDZA 2ZDKA 1C4Y2 2F9OA 1K22H 3TITA 1V2JT 1XM1A 4O9VA 3AASA 4X6MA 3ZZ6A 1O3MA 2PTNA 1TNJA 3OU0A 3ZZBA 3ITIA 2OC1A 4FVDA 5AF9H 2F9PA 1BZXE 4IMQA 4Y76A 2A1DB 3CS7A 1GJDB 2PGQB 5ESTE 1GJAB 2IPHA 1UVSH 4WJG2 1BJUA 4YTAA 1TIOA 4FUBA 2R9PA 3M5MA 1HIAA 2ZKSA 1SFQB 1AHTH 2XCNA 4X2YA 1A5IA 4BAKB 2XBYA 4WY3A 4CHAC 1LHEH 3M3VA 4ISOA 3T27A 4WMEA 4ZKSU 3O8DA 1WOFA 3M5OA 3LONA 5DKMA 1QB9A 3DT0H 2Z3EA 1GHVH 3RXTA 1O2MA 2A5AA 4TPIZ 3VB7A 1MZDA 3OX7U 3A88A 1JXPA 3ZZ9A 1TA2A 1TX7A 1GHXH 5DP5A 2CV3A 4ESTE 5JBBS 4KTUA 1L2EA 1DPOA 2DE9A 1V2WT 2AGEX 4LZ4B 1WCZA 1TE0A 1F2SE 1MAYA 3T28A 2PV9B 4CBOA 5E2OA 2O8MA 1P12E 1TGNA 3AW1A 1MQ5A 4B76A 1FY8E 3F6UH 4GCHG 1GBFA 4AFSA 1ETRH 2YNAA 3QGJA 3VXEH 4J2YB 1ZTLA 1GI2A 3TU7H 1PQAA 1W2KH 5FPTA 4Y71A 1XKBC 4K1EA 4IC5A 4ABHA 3L3TA 1EPTA 4ISNA 4K8YA 1GBLA 2QA9E 4MNXA 1AWFH 4B73A 1ARCA 1VCPA 1O3KA 3QN7A 1GDUA 3TLOA 1GG6C 3T62A 3T2NA 5TJXA 1B7XB 1U6QA 1Z6JH 3SUEA 1KXFA 1YPJH 3JZ1B 3MFJA 3U8TH 2B5TB 1GBHA 3ATWA 1FAKH 4ASHA 1GJ4H 1IAUA 1ZTJA 3LGYA 4AN7A 5JDUB 3SN8A 4JZFH 2H5CA 1QL9A 1NRQH 2KAIA 1FDPA 1BMNH 3S0NA 1G2LA 4OS5A 1SB1H 2ZFTA 1P9UA 1XKAC 1EJMA 3ATKA 3LH3A 2SNVA 3QK1A 1C5NH 1C1TA 2VNTA 3CP7A 3HKIB 1FUJA 2ZDNA 1GJ8B 1TYNA 2UWPA 4PROA 3LC3A 3E91A 4XDEA 1TNKA 1UVPA 1YPHE 3NK8A 5C1YA 2XWAA 4BANB 1GMHG 3P8GA 3BF6H 1A0LA 8ESTE 2JH5D 3BEIB 1T8OA 1BBRK 1CT2E 1TRYA 3QDZB 1XVOA 1VCQA 2F91A 1FLEE 3TK9A 3AAUA 2B0FA 3QUMP 4WXIA 1YF4A 5EPNA 2EI8A 4DG4A 1TFXA 2XC4A 1QURH 1BCUH 1PPCE 1RGQA 3BTWE 1LTOA 1PQ8A 2G5NA 1LO6A 2A2QH 4FUDA 1OWIA 1P0SH 2VWOA 2EA3A 1YLCA 4WF8A 1RTKA 1V2TT 2I6QA 3E3TA 2B8OH 2J94A 1P2KA 5GCHF 5EXMA 4I32A 3GY4A 3SGBE 1ZSJA 1SMFE 1E0FD 1UVOA 1DS2E 1UCYK 2ZFPH 3RMNH 1FMGA 1BDAA 1LMWB 2BD3A 2BDHA 2BD7A 1QA7A 3UNQA 2CJIA 1JMOH 1QQ4A 3IWMA 2FXRA 2ZA5A 3PMHB 2SGPE 1CSOE 1VITG 1AI8H 3RMMH 3H5CB 1A0JA 3EGKH 1K1LA 1SLUB 1FY4A 1BQYA 1VGCC 4NFEA 3SI4H 5A0BA 5LPFA 1ELEE 4NA7A 2Y5FA 2FOAA 5AFYH 2GT7A 4O3UA 2FP7B 3MMGA 3TK5A 1SC8U 4TYDA 4Y10E 2ANYA 2J9NA 1P2IA 3D65E 2JH6D 2ZFSA 5GXPA 2VWNA 4B2AA 2G51A 2O8WA 2HGTH 3RXUA 3KN2A 1TWXB 5L30H 1QJ7B 5JBTA 1QBNA 5AHGH 1HXEH 5TCAA 1DM4B 1C2HA 4H6TA 1MTSA 1O3PB 1B0EA 5JPMH 2PKSB 1Y3XA 5GIBA 2OBQA 1INCA 4AG2A 3F68H 1P9SA 1Z1IA 4IS5A 1PFXC 5DPAA 1C4V2 2HPPH 4UEHH 3UR9A 3ZZ7A 3MNBA 2W3IA 2ZGXH 4FUJA 5EU8A 4Y8XA 3E90B 1ZPCA 1X7AC 2SGFE 4DURA 2ZHDA 1TMBH 1HFDA 1P2OA 1DWBH 8GCHG 1Z8RA 2HOBA 4XFQA 3BG4C 3S69A 4UE7H 1BA8B 4I7YH 1ZMLA 1GI5A 2Y5GA 3M37A 3BTFE 1VZQH 2O8TA 2ZPSA 3LGUA 3STIA 3U9AH 3RXHA 2AGIX 4O97A 1E38B 1G3CA 7ESTE 2H9EH 2ZU4A 4SGBE 3W94A 2LNCA 4UONA 1HAXB 4ABGA 3MTYA 1OP2A 4I8KA 2F9NA 3NKKA 2BY7X 3BTTE 3KCGH 1AE8H 4DW2U 2BTCE 2TGAA 3ZZ4A 3E16B 1A3BH 1AMHA 3SU4A 2GP9B 4AFZA 4Q7XA 1Y5BT 1NTPA 2BMGB 1TB6H 1MKXK 2WV5A 1FJSA 2XCFA 5FHTA 4M7GA 3KGPA 3UWJH 2A5KA 2QC2A 1GMDF 1O2OA 4MNWA 4CR5A 3ZVDA 4HZHA 2BOKA 2RA3A 2FOMB 1SGTA 1SGYE 1YCPK 1MTNB 5DP4A 2WPIS 4K2YA 1H8DH 1QJ1B 5T3HA 1BTHH 3DFLA 2FESH 2XW9A 4K60A 3NCLA 3SUGA 5I25A 4Y0ZE 3SV6A 2ZQ2A 3PLKA 4X2XA 1BTXA 1W0YH 2ZU1A 4ISIH 1AVXA 1C1NA 5A09A 1DY9A 1YPGH 2GD4B 3UFAA 2WPMS 2OQ5A 3IG6B 5FX6A 1NU7B 1ZLRA 1SOZA 3ZVCA 2SFAA 1O2UA 3BEFB 1XXDA 3Q76A 1CT0E 1KDQB 4WXVA 1K28D 2AH4X 3FANA 1NY22 2BD5A 3MH5A 1O5FH 3MOCA 2FOFA 4Q7YA 1FXYA 4TPYA 2H5DA 1W8BH 2CXVA 1ANDA 1JWTA 1JRSA 1J17T 1ELDE 5FAHA 5F03A 5GCHG 1O2PA 4GHTA 3QO6A 1MU8B 4ZHLU 5C67A 1A1RA 1YKTA 2XWBI 1BITA 1OP8A 3Q3XA 1MBQA 4RKJB 3RXQA 1ZSLA 1C9PA 1CHOF 2ZGCA 1YP9A 1KTTB 3CS0A 5A2MH 4FUGA 3RXVA 3RXKA 5EOKA 1AQ7A 3A7XA 4DCDA 1GVZA 3A81A 2PUXB 3I78A 1FZZA 4XE4A 3R3GB 3URDA 2ULLA 2FOBA 3MNXA 4DIIH 3RXMA 3EE0B 5EGMA 4WH6A 4AFQA 3B8JA 2WYJA 1RRKA 4AORA 1C5MD 3DUXH 2Y6TA 3GCHC 2BXTH 4YM9A 4KGAA 3D23A 1RTLA 1RIWB 4VGCC 3V12A 1Y3WA 1IOEA 2WPHS 3V0XA 4BAMB 2C8YB 6GCHF 1ESAA 1G30B 1O35A 2ZIQH 4NCYA 4X1QU 5T6GA 3SHAH 4HI3A 1PPZA 4INLA 4JZEH 3MYWA 4B74A 2OC7A 3FZDA 1AFQB 1WQSA 4OS7A 2WUBA 2BD4A 2A45B 4MVNA 4FU8A 2A2XH 2A4GA 2FEQH 2PLXA 1G32B 1TBQH 1C5WB 4DY7B 3WY8A 4AX9H 4OS1A 1BIOA 2PKSC 3SNCA 2B7DH 3SU2A 1GI9B 3FP6E 3OY5U 4IN2A 3S7KB 3T29A 1EZUC 3U98H 2W3KA 3RXBA 3ZZDA 1G9IE 2VWLA 4UFEH 1ANEA 4YZUA 1NROH 4X8VH 1AZZA 1V2UT 2ZFQH 3NPSA 3RM2H 3SNBA 1ZJKA 1GBMA 2OP9A 3B23B 1A2CH 1O2SA 2ODYB 5EQRA 3PWBA 4UFFH 3F9EA 4X6NA 1O3EA 1EB2A 2ZTYA 1OWEA 3BEUA 3VB6A 4JYVH 2A7JA 1F0UA 5ETXA 4Y79A 4E7RG 1EZXC 2V6NA 3A7TA 3UOUA 1BT7A 1TX8A 2ZDLA 4AYYB 3UQVA 1WSSH 2ZCHP 1S81A 2G81E 1ZHPA 1P10A 1V2RT 3GY6A 4K5ZA 2XC5A 1DT2A 5T6FA 1T7CA 1E36B 4J1YA 4K3JA 1MCTA 1MKWH 1OS8A 1UMAH 3VXFH 2PUQH 1GHAF 1Y3VA 1JRTA 1TPPA 2ZI2H 3EAJA 1YPLH 1GMDG 4INKA 2BB4A 3PV4A 3TNSA 4X1NU 1MTNC 1IQKA 1CHGA 1O3BA 1HIAB 1TRNA 5E0GA 1N1LA 1PYTD 1NRSH 3KQEA 2TIOA 3KHVA 3OY6U 1O5CB 3ODDA 1ELGA 1HNEE 2Z6BD 1J8AA 4H6SB 1L4DA 3URCA 2VJ1A 1BJVA 1CE5A 1C5OH 3B9FH 3GDVA 3JZ2B 1C1MA 2AS9A 2FTMA 1AKSA 1A7SA 1VCWA 1O3LA 3ZYEA 3P95A 1O3DA 3VPKA 2BY6X 2ZECA 1XXFA 1TALA 1ABJH 4K1SA 2OXSA 4GLYA 4GUXA 3PMBB 3QGNB 2HLCA 2Y7XA 1UTKA 1E35B 2Y5HA 3QWCH 4D9RA 3MU4A 1K2I1 1V2LT 1MMJN 2FWWA 5DO4H 1K1JA 4GAWA 2A4OA 1FPHH 3IITA 2ZZUH 4A1VA 3LPRA 1UTLM 4MTBA 2PWXA 5K0HA 1SGRE 1C1UH 3HPTB 2QXIA 2ZHWH 1MU6B 1D3TB 3PMJA 3RXDA 2Z9GA 2ZG0H 3TGKE 1AB9C 1MUEB 2BLOA 1QIXB 1BB0B 4U01A 3SV2H 1D6WA 1LVOA 3RU4T 1YPHC 4JZDH 1CHOG 3UREA 2XYAA 3RXLA 2G8TA 3VGCC 1VITF 4MPWA 2CHAB 2HVXA 3LT3A 2QCYA 1Q31A 1NRNH 3SU1A 4ZUHA 6CHAB 4KP0A 1OWKA 3P8NA 4BTUB 2ALVA 2WV4A 1BMAA 2EC9H 4ZKRU 3M3TA 3ELAH 1TPOA 3E6PH 1HJ8A 3FZZA 1ZPZA 7GCHF 1GI7B 2VIWA 4NIVA 4X2VA 1SFIA 1V6DA 1OYTH 2UUJB 1EZQA 5C20A 1Z71A 6GCHG 4AFUA 1QB6A 3U69H 1GCDA 3GDUA 1EOJA 7LPRA 4TY7A 2AIQA 1A5HA 2FIRH 3GYLB 4JYUH 1XX9A 3UTUH 1O2LA 2PGBB 1GGDC 2ZDVH 3GY3A 1CBWB 4AGKA 3A86A 1OWJA 3LOXA 5G4BA 1SGFG 1UTJA 3PO1C 1KXAA 4Q2KA 1GBBA 1C5TA 1G2MA 4DVAU 4MPUA 4ABFA 5LGOA 3SNEA 3LDXH 4KTSA 1GBTA 1KLJH
chains in the Genus database with same CATH superfamily
1EXFA 4ZROA 2FMJA 3UQOA 3HKJB 4E06H 3MO3A 4Z1MD 8GCHF 1K1NA 1NFYA 1Z7KA 1KYNA 1UK3A 2VGCC 4IC6A 3BTEE 1GJ7B 2PP6A 3F1SB 1OP0A 1G3BA 3TGIE 1CA0C 1O2JA 1B5GH 4CRDA 1AVWA 2GV6A 4BXWA 5FPYA 4D8NA 3F9FA 1AY6H 3PRDA 1DWCH 4GPGA 1DANH 2A5IA 1GHYH 4JMYA 1O31A 1QRXA 1PYTC 4CREA 1C2EA 1DFPA 3WWFA 1L4ZA 1VKYA 3E8LA 1UVTH 5LPEA 4BAOB 1N8OB 1E1QD 1H9LB 2BVXH 2ASUB 2FX4A 1D3PB 2Y81A 3ZZ3A 1AZ8A 3LKWA 3FP8E 1MZAA 1Y59T 1QRZA 3EA9A 1VITH 3HGNA 1UHBA 2BDCA 2R0KA 3L33A 1HJAC 1ELFA 1HB0B 5EXNA 1O5BB 2AFQB 2VBCA 4U32A 1IQLA 4OGYA 5HMAA 1GBCA 3GY7A 5CE1A 4IN1A 5A8XA 3FOAA 4FUIA 4A1XA 1GHAG 2KCPA 1SGQE 2IN2A 2EI6A 1P03A 3STJA 1XUKA 1PJPA 5J4QA 1CQQA 3S9AA 3M7UA 2W7UA 1AWHB 1DY8A 4ISHH 3UIRA 1FQ3A 1H1BA 4OS6A 5HXFA 2P3UB 1S83A 2OTVA 3L6PA 2QXGA 2H9HA 5BRRE 1G36A 1ZTKA 4WVPE 3RXEA 2JJ2D 1ZGVA 1G37A 2FO9A 2PFEA 3TJNA 5LH8A 4AGJA 5KECA 4HG6A 4HFPB 1L1JA 5EPYA 4XBBA 1GBDA 2WINI 2WPDD 5A0AE 1NN6A 3VG8A 1HGTH 1Y8TA 3KF2A 4YO9A 3ZZAA 3RXFA 1MABB 2Y7ZA 1O3FA 2ZHEH 3SV7A 3F9GA 1NBME 3P17H 4OS4A 2D2DA 1QGFA 1TOMH 3M5NA 2AIPA 3LC5A 1Z8GA 1DWDH 1RS0A 1V2KT 2H9TH 2J4IA 4YXWD 2UUFB 1SQRA 1UW7A 1UTNA 3UAIC 5A8ZA 1QL7A 3AAVA 3K65B 5DG6A 1O2IA 4GVUA 3O8CA 5GWZA 2R3YA 4NWLA 3UR6A 5EQSA 2CHAC 2A32A 4AB8A 5K7RA 2P3FH 3A7WA 4NSYA 4FUFA 4O3TA 2ZP0H 1EX3A 1MBMA 1S6LA 3M5LA 3QX5H 1SVPA 4YLQH 2Z9IA 3A85A 3SUFA 5EXLA 4DJZB 5DN6D 7GCHG 2BY5X 1QA0A 2ZU5A 1W11U 2UUYA 4OS2A 5JBAS 3I77A 1NO9H 1NT1A 5HGGA 1O2NA 4JZIA 2NU3E 3BTME 1ETTH 3K6ZA 2G00A 1ZZZA 5C5NA 3TJUA 1EOLA 1NC6A 5L2YH 2TBSA 3GY8A 3QZRA 2H6MA 3NUMA 1PPBH 4F4OC 3S7HB 1S82A 1NPMA 2PW8H 1CBWC 2UWLA 2PSYA 2XTTB 2QF3A 1HAOH 1WTGH 2AHME 1XUJA 1DWEH 2Z7FE 3VB4A 4CBNA 4X6PA 1M9UA 2A7CA 2PKAB 1FY5A 5B6LA 1ZMNA 2PHBA 1ZMJA 4YESB 1DX5M 4XSKU 2XBXA 1TNLA 3E1XB 4TY6A 1P57B 1Y5UT 2M2AA 1GHWH 2W7SA 3A82A 1O2XA 4BAHB 3SU3A 1FPCH 5GDSH 4FU7A 5ESBA 3DHKH 3ZVAA 1SL3A 1ZYOA 1LVBA 1P2JA 1ZPBA 2XRCA 4NIWA 1O38A 5DGJA 1UK4A 4YLUA 1FN8A 2V3OH 3BIVH 3ZV9A 3LH1A 5EODA 1TX6A 3PV2A 3BTGE 3S9CA 4TWWA 2J95A 3UWIA 1IQHA 1YCPM 1LHFH 1OSSA 2AYWA 1GJCB 3TJVA 4THNH 1Z8JB 1C2IA 1O3GA 1SHHB 3BTDE 3GCNA 3H09A 3A7ZA 1ETSH 3VB3A 3SQHE 1SGNE 2Q6DA 2ZHFH 2BD8A 1KTSB 1KXEA 3M61U 3RU4E 5DJ7A 1C5UA 1V2OT 2V3MA 5DP3A 3TNTA 1IQIA 4I33A 1NFXA 3T26A 4H4FA 1MD8A 1MKWK 1NFUA 5J4SA 1V2NT 3M35A 2J98B 1SR5C 5L2ZH 1A4WH 1Q2WA 2L6OA 5EG4A 1YGCH 2ZHQH 2QF0A 2EI7A 2DUCA 1O3HA 2AMQA 5IK2D 3Q00A 1GI4A 1GHBF 3RXOA 1TMTH 2J92A 1IHSH 3GY2A 2VU8E 1CU1A 1ZSKA 1C5PA 2BX4A 1IQMA 1K1MA 6ESTA 1O0DH 4AG1A 1C2MA 2GMTB 4AOQA 5BPEA 5F6MA 1G3EA 3UY9A 2VVUA 1HAPH 2W26A 1NFWA 1C5QA 1H8ED 3SYJA 1P09A 3NRLA 2WZQA 3DA9B 1TNIA 4HGCA 5IDKA 1JIRA 1T31A 3MU8A 2O9QA 3Q77A 1O5EH 2OBOA 3A8AA 1FONA 4B1TA 1K1OA 4RKOB 3SW2B 1YBWA 1ARBA 4I8LA 1BBRE 1BTYA 1A0HB 5HM2A 1XVMA 1DXPA 3GISB 1W10U 2XNDD 2TRMA 4INHA 4MPXA 4FUHA 2D26C 2VIQA 3ZZ8A 1WU1A 1H9HE 1YLDA 4CRAA 4U2WA 1QNJA 1UJ1A 1XUIA 1TNGA 3TIUA 2P16A 3DD2H 2GTBA 4R8TB 1P3EA 1PPGE 3S9BA 5A0CA 3H7TA 4RT1A 4I8GA 1LPZB 3A84A 3RXCA 2C3SA 3EA8A 1TBRH 2C8WB 5EW1H 3K6YA 2IJD1 1UCYE 2XOKD 3LIWA 4A7IB 3SO3A 2TGDA 4D76A 2HRVA 1BRBE 1B0FA 2J2UA 2PTCE 1GL1A 1HAYB 5CHAB 3A8DA 1EZSC 1FY3A 1C5YB 4DT7B 1HAVB 1PQ5A 1BTWA 2ILNA 3SJOA 3HK6B 2FTLE 2V7QD 2OINA 1QZ8A 2NU2E 1CO7E 3TPIZ 3FP7E 1LKAA 4LK4A 1J14A 3SORA 2AERH 2VIPA 5I46H 1UO6A 2FLRH 1GCTB 1MCVA 1T8MA 5FBEA 2GCTB 1GBIA 2VIDA 1SGCA 4CHAB 1GI3A 2BDBA 1W7XH 1UTOA 3GDSA 3PV5A 2SGEE 1D3DB 2QN5T 4Q80A 2YMSB 3PB1E 1MAXA 2BZ6H 2GV7A 2BDAA 2NWNA 3UNRA 1HAHH 4D7FA 1SGEE 2FDAA 1RTFB 3LJOA 2YNBA 1EAIA 3SOSA 1ID5H 1O2TA 2BD2A 4X1PU 2BM2A 1MTWA 3GS9A 4YOJA 1NBMD 1TGTA 3LGIA 3N7OA 2EQNA 5AVDA 1KDQA 3P70B 1V3XA 4Y7AA 1O3OA 1WQVH 1Q3XA 1C5SA 1WTHD 3M3SA 2VH0A 1JIMA 5SGAE 3SU0A 1C1QA 3SNAA 1THRH 2JKHA 1FIZA 3TH3H 1MTVA 1P02A 5DP8A 2VB0A 2NU0E 3A83A 2SGDE 3MU5A 1GDNA 2WPLS 2GZ7A 1IQNA 1SHYA 1ANBA 1V2QT 1BRCE 3SHCH 4ABAA 3PROA 2HPQH 2EEKA 2YMSD 1PPEE 3PRBA 3TJOA 3U8RH 1EAWA 2CK3D 1EAXA 2GCHF 1SGDE 4F55A 1MQ6A 2QIQA 4HTCH 1K1PA 3PMAB 1Z8IB 1F0RA 1GG6B 4D7GA 2BQ6B 4LOYH 4ZMAH 2GGVB 1DLEA 3FFGA 4SGAE 3ZVGA 2BX3A 1SQTA 2P95A 4WH8A 2DE8A 3F2FA 1GBEA 2J38A 4WMFA 1EJNA 3OYPA 4Y8YA 2GZ9A 5PTPA 1S84A 1KLTA 1O3JA 3EYDA 3F0PA 2C8ZB 5AFZH 1CGHA 1LPGB 4MG3A 1YPEH 1OPHB 3A80A 1TPAE 2OD3B 3GYMA 4ZKNU 1O2QA 1RJXB 2P59A 1KIGH 1TGBA 3AVZA 1P04A 1T32A 2WHXA 2GX4A 2OLGA 1W7GH 2QGRA 4FXGH 3SNDA 4LZ1H 1IQFA 1ELBA 2GZ8A 1OWHA 1ZGIA 3V7TA 4WMDA 1GHBG 1GI8B 4Y0YE 3RXGA 4ZAEA 3Q3YA 2F9BH 2AEIH 1ANCA 2G4UA 2V3HH 1ACBE 3GY5A 1AD8H 1SGIB 1EUFA 1XMNB 4ISLA 3V13A 1F0TA 1HCGA 1F0SA 1BTUA 1BRAA 4I86A 2CF9H 2QYIA 4BXSA 3PWCA 2P8OB 1YYY1 1WDIA 5GJ4B 2G55A 2ZCKP 2FZZA 3PTBA 1UTQA 3RUOA 4ZXYH 2FI3E 2ANWA 2Z94A 1TRMA 2QXHA 3VB5A 4AYVB 1EPTB 3DFJA 1SBWA 4ASUD 4DGJA 1SPJA 2QY0B 3RMLH 1AGJA 1DUAA 1WV7H 3KQBA 2BYAX 1COWD 4IW4E 1UK2A 5ABWA 3U1IB 2BZAA 1UHBB 1VJAU 2HNTE 2V0BA 5HKKD 2FLBH 1GVLA 2ZWLH 1RIWC 1HAIH 2XBWA 2SGQE 1F7ZA 2Z3DA 3BV9B 4X8UH 3V3MA 2ZGJA 1O30A 2KAIB 4X0WU 1SI5H 1UTMA 3RU4D 1SQAA 2GJGA 4OGXA 3A7VA 4A92A 4NG9H 5JBCS 4B75A 1VGCB 1TONA 5CHAC 1TQ7B 1D9IA 3RC4A 1GHZA 3TVJB 3KNXA 4CRBA 1FNIA 3EA7A 3A89A 3RLYH 5JB9S 2BQWB 3PLPA 1AFQC 1C5LH 1DITH 4NIXA 1H8HD 3HGPA 3TGJE 1QBVH 2VINA 1LQEA 1GCTC 4M9FA 3ZVFA 2K1QA 1GBAA 2GCTC 2ZO3H 3C27B 1GI6A 1QBOA 1AUJA 3MQKC 4Y6DA 1O2WA 3D49H 2YMSC 1LHGH 2B9LA 2H1UA 1D3QB 4UFGH 2CGAA 1EASA 4TSFD 3SQEE 1DUEA 3F9HA 2BOHB 3RC5A 1TLDA 3OSYA 3SV9A 1P2MA 3MO6A 4BNRA 3P6ZB 1ZR0A 5A8YA 5C17A 3MU0A 1GJ6A 1WAYB 2WUCA 4ABJA 1GBKA 2BHGA 3OTPA 1KXDA 3LGVA 2FM2A 4UFDH 1D4PB 1OX1A 1NM6A 9ESTA 2C8XB 9LPRA 1BMFD 3UUZA 5C1XA 5EQQA 2VIOA 1HPGA 3KYFA 3MWIU 4XOJA 3SGAE 4D9QA 2J5UA 1LQDB 4UD9H 2F83A 1PPHE 2RG3A 5FCRA 1P01A 1O2HA 3PTNA 5DP9A 1AIXH 2BVRH 3BG4B 3LGWA 3GOVB 1P2NA 3LU9B 3ENSB 4JCNA 3C1KA 4RSPA 2F4LA 4MQAA 4Y7BA 3ZZCA 1XUGA 4ACAA 1S6FA 3BIUH 1FAXA 2GCHG 3BG8A 4MNVA 1A46H 3W1EA 1DVAH 3EDXB 1QL8A 2P94A 7KMEH 1O2KA 2G4TA 3MHWU 2C93B 3GICB 1P05A 1O3NA 1ZRKA 2F9UA 1P11E 4DT4A 2G52A 1N6XA 1C5VA 2ZNKH 1O2GH 1HDTH 1AUTC 4Q7ZA 1HAZB 3MU1A 2FODA 2OC8A 3R0FA 2AMPA 1QHRB 2YOLA 4X6OA 1EKBB 3P8FA 3SU6A 1C5RA 1C1WH 2BD9A 5C0TA 1KMHB 1EAUA 2ZEBA 1AVGH 2Z9JA 1TNHA 5C1UA 2XBVA 2W6JD 5C3NA 2OUAA 1O5GH 5E0HA 1V2VT 1TGCA 1BOQA 1HYLA 5LPRA 1DOJA 5C5OA 2L74A 1DDJA 4A5TS 2P93A 3Q3KA 4P00A 5JYIA 2NU1E 3OAAD 1TGSZ 2O8LA 2Q6GA 1H9IE 1O34A 1BMMH 4LXBH 1AU8A 3EQ0H 5HIYA 2GDDA 1LKBA 1V2PT 4CRGA 1QJ6B 1SLWB 3RXRA 4YOIA 1QY6A 2ALPA 2CMYA 5C2ZA 4X1SU 2P8OC 4A1TA 4NGAH 1ELVA 3ZVEA 1IQGA 1O37A 1P8VC 1C1VH 1OYQA 3CENA 3HATH 1DLKB 3LJJA 1HUTH 3RM0H 2FYQA 2EY4C 1EPTC 1GWAA 1A61H 1TABE 1C1OA 1GVKB 3VFEA 3H7OA 1HJ9A 3P8OA 1J9CH 1T8NA 1EATA 5HM9A 1XUFA 3K2UA 1EP5A 3KEEA 6CHAC 2HWLB 2VH6A 4K1TA 2ZDMA 2ZGBH 2R3UA 4RN6A 1ZOMA 1TOCB 2Z3CA 3NWUA 4B2BA 2D1JA 2ZPRA 3E0NB 2JETB 2IPQX 2Y80A 2G5VA 2XNIA 2FOEA 3UNSA 2ODPA 1TBZH 1L0ZA 4P02A 3RXIA 5IYTA 2V35A 4NA8A 1DSUA 1V2ST 1ZRBA 1THSH 2FS8A 4FVBA 5FBIA 1QQUA 3GCHB 1ABIH 1K1IA 4X8TH 4GSOA 5E8EH 2FI5E 4VGCB 4ZCNA 1RXPA 2VVVA 3RMOH 2Z9KA 1OKXA 2TPIZ 2OC0A 1O32A 3BN9A 3PM3A 3CNRA 4ZHAA 3MNCA 5DP6A 2BDGA 2VIVA 3U8OH 2HALA 1GJBB 3ZZ5A 4TT3D 1OHHD 2ZC9H 4MPVA 1O2RA 1IHTH 2TGTA 2RA0A 2F9VA 3GCTF 5T6DA 1ESBA 3NZIA 3F3BA 3BTHE 4CH8B 2FOCA 4JK6A 2ANMH 1Z6EA 2R2WU 3ATLA 1DSTA 4I31A 1A5GH 3FVFB 2IOTA 1NZQH 4TWYA 1ELAA 1O3IA 2QV1A 4ZXXH 1K21H 3PYHA 1DXWA 1C1PA 2BY8X 2ZQ1A 4WWYA 2WPJS 2FPZA 1SLXB 4Z6AH 2AGGX 1GI0A 3RXJA 1F5KU 3KL6A 1CGJE 4MNYA 5E2PA 3K9XB 4ZHMU 4BOHA 1NS3A 1MD7A 1O3CA 5FPSA 1CT4E 2PR3A 1HXFH 1N6YA 1FI8A 4JZ1A 4QT8C 1O3AA 3QTVH 5F8ZA 4NZQA 1N8OC 3BTKE 1HLTH 4AB9A 2ANKH 3RP2A 1GMCF 1BHXB 3KIDU 1S6HA 3U1JB 2LELA 3A8BA 1H8IH 1BTPA 3M7TA 2SNWA 5EW2H 1K9OE 2BDYA 1YPMH 1TQ0B 1Z1JA 3KQDA 4IBLH 2PSXA 1ZHMA 3A7YA 4CRCA 2ODQA 4R0IA 5CHBA 2W5EA 1C2KA 5FXLA 1O2YA 5FX5A 1THPB 3LGTA 1ELCA 4F49A 1ZJDA 2R0LA 2BLVA 4BAQB 3A8CA 2FX6A 3T5FH 4ABIA 1BUIA 1FIWA 3SI3H 1SGFA 4BTIB 2OCVB 2OQUA 2AMDA 2RDEA 1GDQA 1BBRH 1L1NA 1UTPA 1OWDA 1S0RA 3ATIA 4K69A 3MO9A 1IQEA 2IJOB 2J34A 2QXJA 2RCEA 1O36A 1LPKB 3AK5A 3O8RA 1C2JA 1L1GA 2ZU3A 3TK6A 4FUCA 5L6NH 3M7QA 1ESTA 4Y11E 1Y3UA 1LHCH 1CA8B 2BXUH 2JH0D 3QZQA 1C5ZB 1ZHRA 2PKAA 2XXLA 1EB1H 3RXPA 1JBUH 1ORFA 1O39A 4CRFA 2FOGA 3MH7A 2CN0H 3W95A 3NXPA 1LCYA 2I6SA 1TA6A 3QTOH 5H4IB 5F8TA 1YM0A 2UWOA 1NRRH 1SG8B 2BLWA 2BVSH 3AW0A 4Y8ZA 3SJ8A 2ZFFH 1HAGE 2A4RA 4NZLA 3SGQE 1UCYH 3MI4A 4Z0KA 4K8BA 1O5AB 1SLVB 1A3EH 3UPEA 1WYKA 4FOUC 2Y82A 1YC0A 4X1RU 3ZYDA 4CH2B 1AB9B 4DOQA 2SGAA 2GKVE 5JB8S 1LVYA 4B2CA 2QAAA 3M36A 1C2LA 1GJ9B 3SV8A 3ATMA 1Y3YA 4GHQA 3VGCB 8KME2 2A7HA 1SSXA 1O2ZA 3GCOA 3O8BA 1BMLA 2JETC 1GL0E 3ZVBA 4NIYA 3FO8D 5E0JA 4ABBA 1BTZA 4MLFB 3FAOA 1RD3B 1QCPA 4ZKOU 3TH4H 3I29A 3BSQA 2ZGHA 1T8LA 3ESTA 5EJ1A 1P3CA 1FX0B 2STBE 1F92A 1EJAA 1AFEH 1S5SA 1QTFA 3SU5A 1E34B 2ZTZA 2UUKB 1ELTA 1WBGB 2A31A 1E37B 1O33A 1SQOA 2D8WA 2A4QA 4E05H 3G01A 1LVMA 4XD7D 4A6LA 1AKSB 2J98A 3BTQE 3VEQB 1GGDB 1H4WA 2ZCLP 3P92A 1AO5A 1GBJA 2STAE 5C0UA 2RDLA 4JYTA 1V2MT 3GCTG 4DIHH 2LPRA 2A0QB 5B6OA 1GI1A 2HNTC 3T25A 3PO1B 5DP7A 3SJIA 3MH4A 1FY1A 1C2FA 2HNTF 3SZNA 2WSSD 1XUHA 1W13U 3D62A 1IQJA 1P2QA 2ESTE 3ODFA 2THFB 1O2VA 5FL7D 1PPFE 3MH6A 3SBKA 3ZV8A 3RLWH 2ZFRH 1G3DA 2ZU2A 2NU4E 1GJ5H 4MDSA 4GCHF 1T4UH 4FU9A 2VGCB 1CGIE 1F5RA 3SJ9A 1CA0B 1EFRD 1QB1A 2BLQA 1KSNA 1P06A 1W12U 3KQCA 4YT6H 4I8HA 1FV9A 1YLNA 1NU9A 4YOGA 4BTTB 2C90B 1TMUH 5F8XA 2C4FH 1BRUP 1Y5AT 3WWBA 1F5LA 3PLBA 1GPZA 4U30A 1W0ZU 1GMCG 5DK1A 4ABEA 1C2GA 1C2DA 2GT8A 2BY9X 1KLIH 5GPIB 2ZPQA 1BHXF 4O03A 2VVCA 1VR1H 1HRTH 1MKXH 1T4VH 1OOKB 2M5TA 2WPKS 3RXSA 3A87A 3OTJE 1NRPH 2GDEH 1C1SA 1HJAB 1C4U2 4KKDA 4IGDA 5CMXH 1YPKH 1YCPH 1D6RA 1LDTT 1KY9A 4NFFA 3RC6A 1QRWA 2BDIA 3DSPA 4B71A 1CVWH 3RXAA 1S85A 1LHDH 4H42U 1EP6A 3HK3B 3N99A 1HV7A 3MNSA 4NWKA 4RT0A 2Z9LA 2ZDAH 4NSVA 5TCCA 1J15A 4FUEA 3QLPH 1C5XB 1HAVA 2ZTXA 3UOPA 4CR9A 1C1RA 1GMHF 1TPSA 1PQ7A 2FI4E 2CF8H 5HYOA 2ZF0H 1W14U 1SGPE 1J16A 2R2MB 4XBDA 1WUNH 1FN6A 1KXBA 2GMTC 1RFNA 2FYRA 1QR3E 1C9TA 3OEED 1MTUA 1SOTA 4KTCA 4E7NA 2TGPZ 2Q6FA 3OFND 3SUDA 2H2ZA 1VJ9U 2BQ7B 2GVFA 3SJKA 1DE7H 1DICA 5DSFA 1JOUB 2Q1JA 1NESE 2W6ID 4IMZA 3TH2H 1HBTH 3DSGA 1OXGA 2F3CE 4ABDA 1MH0A 1EQ9A 1TAWA 4ZH8A 1AE5A 4B6EA 5FCKA 1KXCA 4UDWH 4AZ2B 1QFKH 2O8UA 4YT7H 4JK5A 2KM0A 4XBCA 3E0PB 1O5DH 1AN1E 4X2WA 8LPRA 4NA9H 4I8JA 6LPRA 3WW7A 2VWMA 2P3TB 4KELA 2FOHA 1S0QA 1UVUH 2F43B 1W3CA 2WYGA 4X8SH 2XC0A 2FS9A 3RDZA 2ZDKA 1C4Y2 2F9OA 1K22H 3TITA 1V2JT 1XM1A 2JJ1D 3AASA 4O9VA 4X6MA 3ZZ6A 1O3MA 2PTNA 1TNJA 3OU0A 3ZZBA 3ITIA 2OC1A 3DSOA 4FVDA 5AF9H 2F9PA 1BZXE 4IMQA 4Y76A 2A1DB 3CS7A 1GJDB 1W0KD 2PGQB 5ESTE 1GJAB 2IPHA 1UVSH 4WJG2 1BJUA 4YTAA 1TIOA 4FUBA 2R9PA 2KR7A 3M5MA 1HIAA 5T1VA 2ZKSA 1SFQB 1AHTH 2XCNA 4X2YA 1A5IA 4BAKB 2XBYA 4WY3A 4CHAC 1LHEH 3M3VA 4ISOA 3T27A 4WMEA 4ZKSU 3OE7D 3O8DA 1WOFA 3KYGA 3M5OA 3LONA 5DKMA 1QB9A 3DT0H 2Z3EA 3SZEA 1GHVH 1YWUA 3RXTA 1O2MA 2A5AA 4TPIZ 3VB7A 1MZDA 3OX7U 3A88A 1JXPA 3OEHD 1TA2A 1TX7A 3ZZ9A 1GHXH 5DP5A 2CV3A 4ESTE 5JBBS 2KCAA 2RFKC 4KTUA 1L2EA 1DPOA 2DE9A 1V2WT 2AGEX 4LZ4B 1WCZA 1TE0A 1F2SE 1MAYA 3T28A 2PV9B 4CBOA 5E2OA 2O8MA 1P12E 1TGNA 3AW1A 1MQ5A 4B76A 1FY8E 3F6UH 4GCHG 1GBFA 4AFSA 1ETRH 2YNAA 3QGJA 3VXEH 4J2YB 1ZTLA 1GI2A 3TU7H 1PQAA 1W2KH 5FPTA 4Y71A 1XKBC 4K1EA 4IC5A 4ABHA 3L3TA 3F2HA 1EPTA 4ISNA 4K8YA 1GBLA 2QA9E 4MNXA 1AWFH 4B73A 1ARCA 1VCPA 1O3KA 3QN7A 1GDUA 3TLOA 1GG6C 3T62A 3T2NA 5TJXA 1B7XB 1U6QA 3ZIAD 1Z6JH 3DCLA 3SUEA 1KXFA 1YPJH 3JZ1B 3MFJA 3U8TH 2B5TB 1GBHA 3ATWA 1FAKH 4ASHA 1GJ4H 1IAUA 1ZTJA 3LGYA 4AN7A 5JDUB 3SN8A 4JZFH 2H5CA 1QL9A 1NRQH 2KAIA 1FDPA 1BMNH 3S0NA 1G2LA 4OS5A 1SB1H 1SKYE 2ZFTA 1P9UA 1XKAC 1EJMA 3ATKA 3LH3A 2SNVA 3QK1A 1C5NH 1C1TA 2VNTA 3CP7A 3HKIB 1FUJA 2ZDNA 1GJ8B 1TYNA 2UWPA 3F0OA 4PROA 3LC3A 3E91A 4XDEA 1TNKA 1UVPA 1YPHE 3NK8A 5C1YA 2XWAA 4BANB 1GMHG 3P8GA 3BF6H 1A0LA 8ESTE 1WXRA 2JH5D 3BEIB 1T8OA 1BBRK 1CT2E 1TRYA 3QDZB 1XVOA 1VCQA 2F91A 1FLEE 3TK9A 5EJZA 3AAUA 2B0FA 3QUMP 4WXIA 1YF4A 5EPNA 2EI8A 4DG4A 1TFXA 2XC4A 1QURH 1BCUH 1PPCE 1RGQA 3BTWE 1LTOA 1PQ8A 2G5NA 1LO6A 1K0HA 2A2QH 4FUDA 1OWIA 1P0SH 2VWOA 2EA3A 1YLCA 4WF8A 1RTKA 1V2TT 2I6QA 3E3TA 2B8OH 2J94A 1P2KA 5GCHF 5EXMA 4I32A 3GY4A 3SGBE 1ZSJA 1SMFE 1E0FD 1UVOA 1DS2E 1UCYK 1YY3A 2ZFPH 3RMNH 4AC9A 1FMGA 1BDAA 3U28C 1LMWB 2BD3A 2BDHA 2BD7A 1QA7A 3UNQA 2LP6A 2CJIA 1JMOH 5HIZA 1QQ4A 3IWMA 2FXRA 2ZA5A 3PMHB 2SGPE 1CSOE 1VITG 1AI8H 3RMMH 3H5CB 1A0JA 3EGKH 1K1LA 1SLUB 1FY4A 1BQYA 1VGCC 2K0QA 4NFEA 3SI4H 5A0BA 5LPFA 1ELEE 4NA7A 2Y5FA 2FOAA 5AFYH 2GT7A 4O3UA 2FP7B 3MMGA 3TK5A 1SC8U 4TYDA 4Y10E 2ANYA 2J9NA 1P2IA 3D65E 2JH6D 2ZFSA 5GXPA 2VWNA 4B2AA 2G51A 2O8WA 2HGTH 3RXUA 3KN2A 1TWXB 5L30H 1QJ7B 5JBTA 1QBNA 5AHGH 5KEDA 1HXEH 5TCAA 1DM4B 1C2HA 4H6TA 1MTSA 5CDFE 1O3PB 1B0EA 5JPMH 2PKSB 1Y3XA 5GIBA 2OBQA 1INCA 4AG2A 3F68H 1P9SA 1Z1IA 4IS5A 1PFXC 2QF4A 5DPAA 1C4V2 2HPPH 4UEHH 3UR9A 3ZZ7A 3MNBA 2W3IA 2ZGXH 4FUJA 5EU8A 4Y8XA 3E90B 1ZPCA 1X7AC 2SGFE 4DURA 2ZHDA 1TMBH 1HFDA 1P2OA 1DWBH 8GCHG 1Z8RA 2HOBA 4XFQA 3EE7A 3BG4C 3S69A 4UE7H 1BA8B 4I7YH 1ZMLA 1GI5A 2Y5GA 3M37A 3BTFE 1VZQH 2O8TA 2ZPSA 3LGUA 3STIA 3U9AH 3RXHA 2AGIX 4O97A 1E38B 1G3CA 7ESTE 2H9EH 2ZU4A 4SGBE 3W94A 2LNCA 4UONA 1HAXB 4ABGA 3MTYA 1OP2A 4I8KA 2F9NA 3NKKA 2BY7X 3BTTE 3KCGH 1AE8H 4B6FA 4DW2U 2BTCE 2TGAA 3ZZ4A 3E16B 1A3BH 1AMHA 3SU4A 2GP9B 4AFZA 4Q7XA 1Y5BT 1NTPA 2BMGB 3FN8A 1TB6H 1MKXK 2WV5A 1FJSA 2XCFA 5FHTA 4M7GA 3KGPA 3UWJH 2A5KA 2QC2A 1GMDF 1O2OA 4MNWA 4CR5A 3ZVDA 4HZHA 2BOKA 2RA3A 2FOMB 1SGTA 1SGYE 1YCPK 1MTNB 5DP4A 2WPIS 4K2YA 1H8DH 1QJ1B 5T3HA 1BTHH 3DFLA 2FESH 2XW9A 4K60A 3NCLA 3SUGA 5I25A 4Y0ZE 3SV6A 2ZQ2A 3PLKA 4X2XA 1BTXA 1W0YH 2ZU1A 4ISIH 1AVXA 1C1NA 5A09A 1DY9A 1YPGH 2GD4B 3UFAA 2WPMS 2OQ5A 3IG6B 5FX6A 1NU7B 1ZLRA 1SOZA 3ZVCA 2SFAA 1O2UA 3BEFB 1XXDA 3Q76A 1CT0E 1KDQB 4WXVA 1K28D 2AH4X 3FANA 5EJLA 1NY22 2BD5A 3MH5A 1O5FH 3MOCA 2FOFA 4Q7YA 1FXYA 4TPYA 2H5DA 2QF5A 1W8BH 2CXVA 1ANDA 1JWTA 1JRSA 1J17T 1ELDE 5FAHA 5F03A 5GCHG 1O2PA 1W0JD 4GHTA 3QO6A 1MU8B 4ZHLU 5C67A 1A1RA 1YKTA 2XWBI 1BITA 1OP8A 3Q3XA 1MBQA 4RKJB 3RXQA 1ZSLA 1C9PA 1CHOF 2ZGCA 1YP9A 1KTTB 3CS0A 5KGOA 4FUGA 3RXVA 3N7DA 3RXKA 5A2MH 5EOKA 1AQ7A 3A7XA 4DCDA 1GVZA 3A81A 2PUXB 3I78A 1FZZA 4XE4A 3R3GB 3URDA 2ULLA 2FOBA 3MNXA 4DIIH 3RXMA 3EE0B 5EGMA 4WH6A 4AFQA 3B8JA 2WYJA 3KQ5A 1RRKA 4AORA 1C5MD 3DUXH 2Y6TA 3GCHC 2BXTH 2KCYA 4FETA 4YM9A 4KGAA 3D23A 1RTLA 1RIWB 2HLDD 4VGCC 3V12A 1Y3WA 1IOEA 2WPHS 3V0XA 4BAMB 2C8YB 6GCHF 2KZ4A 1ESAA 1G30B 1O35A 2ZIQH 4NCYA 4X1QU 5T6GA 3SHAH 4HI3A 1PPZA 4INLA 5C94A 4JZEH 3MYWA 4B74A 2OC7A 3FZDA 1AFQB 1WQSA 4OS7A 2WUBA 2BD4A 2A45B 4MVNA 2J97A 2OK5A 4FU8A 2A2XH 2A4GA 2FEQH 2PLXA 4F48B 1G32B 1TBQH 1C5WB 4DY7B 3WY8A 4AX9H 4OS1A 1BIOA 2PKSC 3SNCA 2B7DH 3SU2A 1GI9B 3FP6E 3OY5U 4IN2A 3S7KB 3T29A 1EZUC 3U98H 2W3KA 3RXBA 3ZZDA 1G9IE 2VWLA 4UFEH 1ANEA 4YZUA 4RI0A 1NROH 4X8VH 1AZZA 1V2UT 2ZFQH 3NPSA 3RM2H 3SNBA 1ZJKA 1GBMA 2KX4A 2OP9A 3B23B 1A2CH 1O2SA 2ODYB 5EQRA 3PWBA 4UFFH 3F9EA 3UB0A 4X6NA 1O3EA 1EB2A 2ZTYA 1OWEA 3BEUA 3VB6A 4JYVH 2A7JA 1F0UA 5ETXA 4Y79A 4E7RG 1EZXC 2V6NA 3A7TA 3UOUA 1BT7A 1TX8A 2ZDLA 4AYYB 3UQVA 1WSSH 2ZCHP 1S81A 2G81E 1ZHPA 1P10A 1V2RT 3GY6A 4K5ZA 2XC5A 1DT2A 5T6FA 1T7CA 3F2GA 1E36B 2JDID 4J1YA 4K3JA 1MCTA 1MKWH 1OS8A 1UMAH 3VXFH 2PUQH 1GHAF 1Y3VA 1JRTA 1TPPA 2ZI2H 3EAJA 1YPLH 4ACBA 1GMDG 4INKA 2BB4A 3PV4A 3TNSA 2KCOA 4X1NU 1MTNC 1IQKA 1CHGA 1O3BA 1HIAB 1TRNA 5E0GA 1N1LA 1PYTD 1NRSH 3KQEA 2TIOA 3KHVA 3OY6U 1O5CB 3ODDA 1ELGA 1HNEE 2Z6BD 1J8AA 4H6SB 1L4DA 3URCA 2VJ1A 1BJVA 1CE5A 1C5OH 3B9FH 3GDVA 3JZ2B 1C1MA 2AS9A 2FTMA 1AKSA 1A7SA 1VCWA 1O3LA 3ZYEA 3P95A 3FKSD 1O3DA 3VPKA 2BY6X 2ZECA 1E1RD 1XXFA 1TALA 1ABJH 4K1SA 2OXSA 4GLYA 4GUXA 3PMBB 3QGNB 2HLCA 2Y7XA 1UTKA 1E35B 2Y5HA 3QWCH 4D9RA 3MU4A 1K2I1 1V2LT 1MMJN 2FWWA 5DO4H 1K1JA 4GAWA 2A4OA 1FPHH 3IITA 2ZZUH 4A1VA 2HVYB 3LPRA 1UTLM 4MTBA 5EIYA 2PWXA 5K0HA 1SGRE 1C1UH 2QE7D 3HPTB 2QXIA 2ZHWH 1MU6B 1D3TB 3PMJA 1E79D 4Q4LA 3RXDA 2Z9GA 2ZG0H 3TGKE 1AB9C 1MUEB 4XRNA 2BLOA 1QIXB 1BB0B 4U01A 3SV2H 1D6WA 1LVOA 3RU4T 1YPHC 4JZDH 1CHOG 3UREA 2XYAA 3RXLA 2KFWA 2G8TA 3VGCC 1VITF 4MPWA 2WV9A 2CHAB 2HVXA 3LT3A 2QCYA 1Q31A 1NRNH 3SU1A 4ZUHA 6CHAB 4KP0A 2JIZD 1OWKA 3P8NA 4BTUB 2ALVA 2WV4A 1BMAA 2EC9H 4ZKRU 3M3TA 3ELAH 1TPOA 3E6PH 1HJ8A 3FZZA 1ZPZA 7GCHF 1GI7B 2VIWA 4NIVA 4Q63A 4X2VA 1SFIA 1V6DA 1OYTH 2UUJB 1EZQA 5C20A 5GNDA 1Z71A 6GCHG 2K8IA 4AFUA 1QB6A 3U69H 1GCDA 3GDUA 1EOJA 3N7EA 7LPRA 4TY7A 2AIQA 1A5HA 2FIRH 3GYLB 4JYUH 1XX9A 3UTUH 1O2LA 2PGBB 4OM9A 5F53A 1GGDC 2ZDVH 3GY3A 1CBWB 4AGKA 3A86A 1OWJA 3LOXA 5G4BA 1SGFG 1UTJA 3PO1C 1KXAA 4Q2KA 1GBBA 1C5TA 1G2MA 4DVAU 4MPUA 4ABFA 5LGOA 3SNEA 3LDXH 4KTSA 1GBTA 1KLJH
chains in the Genus database with same CATH topology
1EXFA 4ZROA 2FMJA 3UQOA 3HKJB 4E06H 3MO3A 8GCHF 1K1NA 1NFYA 1Z7KA 1KYNA 1UK3A 2VGCC 4IC6A 3BTEE 1GJ7B 3F1SB 1OP0A 1G3BA 3TGIE 1CA0C 1O2JA 1B5GH 4CRDA 1AVWA 2GV6A 4BXWA 5FPYA 4D8NA 3F9FA 1AY6H 4GPGA 1DWCH 1DANH 2A5IA 1GHYH 4JMYA 1O31A 1QRXA 1PYTC 4CREA 1C2EA 1DFPA 1L4ZA 3E8LA 1UVTH 5LPEA 4BAOB 1N8OB 2ASUB 1H9LB 2BVXH 3ZZ3A 2FX4A 1D3PB 2Y81A 1AZ8A 3LKWA 3FP8E 1MZAA 1Y59T 1QRZA 3EA9A 1VITH 3HGNA 1UHBA 2BDCA 2R0KA 3L33A 1HJAC 1ELFA 1HB0B 5EXNA 1O5BB 2AFQB 4U32A 1IQLA 4OGYA 5HMAA 1GBCA 3GY7A 5CE1A 4IN1A 5A8XA 4FUIA 4A1XA 1GHAG 1SGQE 2IN2A 2EI6A 1P03A 3STJA 1XUKA 1PJPA 5J4QA 1CQQA 3S9AA 3M7UA 2W7UA 1AWHB 1DY8A 4ISHH 3UIRA 1FQ3A 1H1BA 4OS6A 5HXFA 2P3UB 1S83A 2OTVA 3L6PA 2QXGA 2H9HA 5BRRE 1G36A 1ZTKA 4WVPE 3RXEA 1ZGVA 1G37A 2FO9A 2PFEA 3TJNA 5LH8A 4AGJA 4HFPB 1L1JA 5EPYA 4XBBA 1GBDA 2WINI 5A0AE 1NN6A 1HGTH 1Y8TA 3KF2A 4YO9A 3ZZAA 3RXFA 2Y7ZA 1O3FA 2ZHEH 3SV7A 3F9GA 4OS4A 3P17H 2D2DA 1QGFA 1TOMH 3M5NA 2AIPA 3LC5A 1Z8GA 1DWDH 1RS0A 1V2KT 2H9TH 2J4IA 2UUFB 1UTNA 5A8ZA 1QL7A 3AAVA 3K65B 5DG6A 1O2IA 4GVUA 3O8CA 5GWZA 2R3YA 4NWLA 3UR6A 5EQSA 2CHAC 2A32A 4AB8A 5K7RA 2P3FH 3A7WA 4NSYA 4FUFA 4O3TA 2ZP0H 1EX3A 1MBMA 3M5LA 3QX5H 1SVPA 4YLQH 2Z9IA 3A85A 3SUFA 5EXLA 4DJZB 7GCHG 2BY5X 1QA0A 2ZU5A 1W11U 2UUYA 4OS2A 5JBAS 3I77A 1NO9H 1NT1A 5HGGA 1O2NA 4JZIA 2NU3E 3BTME 1ETTH 3K6ZA 2G00A 1ZZZA 5C5NA 3TJUA 1EOLA 1NC6A 5L2YH 2TBSA 3GY8A 3QZRA 2H6MA 3NUMA 1PPBH 4F4OC 3S7HB 1S82A 1NPMA 2PW8H 1CBWC 2UWLA 2PSYA 2XTTB 2QF3A 1HAOH 1WTGH 1XUJA 1DWEH 2Z7FE 3VB4A 4CBNA 4X6PA 1M9UA 2A7CA 2PKAB 1FY5A 1ZMNA 2PHBA 1ZMJA 4YESB 1DX5M 4XSKU 2XBXA 1TNLA 3E1XB 4TY6A 1P57B 1Y5UT 1GHWH 2W7SA 3A82A 1O2XA 4BAHB 3SU3A 1FPCH 5GDSH 4FU7A 5ESBA 3DHKH 3ZVAA 1SL3A 1ZYOA 1LVBA 1P2JA 1ZPBA 2XRCA 4NIWA 1O38A 5DGJA 1UK4A 4YLUA 1FN8A 2V3OH 3BIVH 3ZV9A 3LH1A 5EODA 1TX6A 3BTGE 3S9CA 4TWWA 2J95A 3UWIA 1IQHA 1YCPM 1LHFH 1OSSA 2AYWA 1GJCB 3TJVA 4THNH 1Z8JB 1C2IA 1O3GA 1SHHB 3BTDE 3GCNA 3A7ZA 1ETSH 3VB3A 3SQHE 1SGNE 2Q6DA 2ZHFH 2BD8A 1KTSB 1KXEA 3M61U 3RU4E 5DJ7A 1C5UA 1V2OT 5DP3A 3TNTA 1IQIA 4I33A 1NFXA 3T26A 4H4FA 1MD8A 1MKWK 1NFUA 5J4SA 1V2NT 3M35A 1SR5C 5L2ZH 1A4WH 1Q2WA 5EG4A 1YGCH 2ZHQH 2QF0A 2EI7A 2DUCA 1O3HA 2AMQA 3Q00A 1GI4A 1GHBF 3RXOA 1TMTH 2J92A 1IHSH 3GY2A 2VU8E 1CU1A 1ZSKA 1C5PA 2BX4A 1IQMA 1K1MA 6ESTA 1O0DH 4AG1A 1C2MA 2GMTB 4AOQA 5BPEA 5F6MA 1G3EA 3UY9A 2VVUA 1HAPH 2W26A 1NFWA 1C5QA 1P09A 3DA9B 4HGCA 1TNIA 5IDKA 1JIRA 1T31A 3MU8A 2O9QA 3Q77A 1O5EH 2OBOA 3A8AA 1FONA 4B1TA 1K1OA 4RKOB 3SW2B 1YBWA 1ARBA 4I8LA 1BBRE 1BTYA 1A0HB 5HM2A 1XVMA 1DXPA 3GISB 1W10U 2TRMA 4INHA 4MPXA 4FUHA 2D26C 2VIQA 3ZZ8A 1WU1A 1H9HE 1YLDA 4CRAA 4U2WA 1QNJA 1UJ1A 1XUIA 1TNGA 3TIUA 2P16A 3DD2H 2GTBA 4R8TB 1P3EA 1PPGE 3S9BA 5A0CA 3H7TA 4I8GA 1LPZB 3A84A 3RXCA 2C3SA 3EA8A 1TBRH 2C8WB 5EW1H 3K6YA 1UCYE 3LIWA 4A7IB 3SO3A 2TGDA 4D76A 2HRVA 1BRBE 1B0FA 2J2UA 2PTCE 1GL1A 1HAYB 5CHAB 3A8DA 1EZSC 1FY3A 1C5YB 4DT7B 1HAVB 1PQ5A 1BTWA 2ILNA 3SJOA 3HK6B 2FTLE 2OINA 2NU2E 1CO7E 3TPIZ 3FP7E 1LKAA 4LK4A 1J14A 3SORA 2AERH 2VIPA 5I46H 1UO6A 2FLRH 1GCTB 1MCVA 1T8MA 5FBEA 2GCTB 1GBIA 2VIDA 1SGCA 4CHAB 1GI3A 2BDBA 1W7XH 1UTOA 3GDSA 2SGEE 1D3DB 2QN5T 4Q80A 3PB1E 1MAXA 2BZ6H 2GV7A 2BDAA 2NWNA 3UNRA 1HAHH 4D7FA 1SGEE 2FDAA 1RTFB 3LJOA 2YNBA 1EAIA 3SOSA 1ID5H 1O2TA 2BD2A 4X1PU 2BM2A 1MTWA 4YOJA 1TGTA 3LGIA 3N7OA 5AVDA 1KDQA 3P70B 1V3XA 4Y7AA 1O3OA 1WQVH 1Q3XA 1C5SA 1WTHD 3M3SA 2VH0A 1JIMA 5SGAE 3SU0A 1C1QA 3SNAA 1THRH 2JKHA 1FIZA 3TH3H 1MTVA 1P02A 5DP8A 2VB0A 2NU0E 3A83A 2SGDE 3MU5A 1GDNA 2WPLS 2GZ7A 1IQNA 1SHYA 1ANBA 1V2QT 1BRCE 3SHCH 4ABAA 3PROA 2HPQH 2EEKA 1PPEE 3TJOA 3U8RH 1EAWA 1EAXA 2GCHF 1SGDE 1MQ6A 2QIQA 4HTCH 1K1PA 3PMAB 1Z8IB 1F0RA 1GG6B 4D7GA 2BQ6B 4LOYH 4ZMAH 2GGVB 1DLEA 3FFGA 4SGAE 3ZVGA 2BX3A 1SQTA 2P95A 4WH8A 2DE8A 1GBEA 2J38A 4WMFA 1EJNA 3OYPA 4Y8YA 2GZ9A 5PTPA 1S84A 1KLTA 1O3JA 3EYDA 2C8ZB 5AFZH 1CGHA 1LPGB 4MG3A 1YPEH 1OPHB 3A80A 1TPAE 2OD3B 3GYMA 4ZKNU 1O2QA 1RJXB 2P59A 1KIGH 1TGBA 3AVZA 1P04A 1T32A 2GX4A 2OLGA 1W7GH 2QGRA 4FXGH 3SNDA 4LZ1H 1IQFA 1ELBA 2GZ8A 1OWHA 1ZGIA 3V7TA 4WMDA 1GHBG 1GI8B 4Y0YE 3RXGA 4ZAEA 3Q3YA 2F9BH 2AEIH 1ANCA 2G4UA 2V3HH 1ACBE 3GY5A 1AD8H 1SGIB 1EUFA 1XMNB 4ISLA 3V13A 1F0TA 1HCGA 1F0SA 1BTUA 1BRAA 2CF9H 2QYIA 4BXSA 3PWCA 2P8OB 1YYY1 5GJ4B 2G55A 2ZCKP 2FZZA 3PTBA 1UTQA 3RUOA 4ZXYH 2FI3E 2ANWA 2Z94A 1TRMA 2QXHA 3VB5A 4AYVB 1EPTB 3DFJA 1SBWA 4DGJA 1SPJA 2QY0B 3RMLH 1AGJA 1DUAA 1WV7H 3KQBA 2BYAX 4IW4E 1UK2A 5ABWA 3U1IB 2BZAA 1UHBB 1VJAU 2HNTE 2V0BA 2FLBH 1GVLA 2ZWLH 1RIWC 1HAIH 2XBWA 2SGQE 1F7ZA 2Z3DA 3BV9B 4X8UH 3V3MA 2ZGJA 1O30A 2KAIB 4X0WU 1SI5H 1UTMA 3RU4D 1SQAA 4OGXA 4A92A 3A7VA 4NG9H 5JBCS 4B75A 1VGCB 1TONA 5CHAC 1TQ7B 1D9IA 3RC4A 1GHZA 3TVJB 3KNXA 4CRBA 1FNIA 3EA7A 3A89A 3RLYH 5JB9S 2BQWB 3PLPA 1AFQC 1C5LH 1DITH 4NIXA 3HGPA 3TGJE 1QBVH 2VINA 1LQEA 1GCTC 3ZVFA 2K1QA 1GBAA 2GCTC 2ZO3H 3C27B 1GI6A 1QBOA 1AUJA 4Y6DA 1O2WA 3D49H 1LHGH 2B9LA 2H1UA 1D3QB 4UFGH 2CGAA 1EASA 3SQEE 1DUEA 3F9HA 2BOHB 3RC5A 1TLDA 3OSYA 3SV9A 1P2MA 3MO6A 4BNRA 3P6ZB 1ZR0A 5A8YA 3MU0A 1GJ6A 1WAYB 2WUCA 4ABJA 1GBKA 2BHGA 1KXDA 3LGVA 2FM2A 4UFDH 1D4PB 1OX1A 1NM6A 9ESTA 2C8XB 9LPRA 3UUZA 5C1XA 5EQQA 2VIOA 1HPGA 3MWIU 4XOJA 3SGAE 4D9QA 1LQDB 4UD9H 2F83A 1PPHE 2RG3A 5FCRA 1P01A 1O2HA 3PTNA 5DP9A 1AIXH 2BVRH 3BG4B 3LGWA 3GOVB 1P2NA 3LU9B 3ENSB 4JCNA 3C1KA 4RSPA 4MQAA 4Y7BA 3ZZCA 1XUGA 1S6FA 3BIUH 1FAXA 2GCHG 3BG8A 4MNVA 1A46H 1DVAH 3EDXB 1QL8A 2P94A 7KMEH 1O2KA 2G4TA 3MHWU 2C93B 3GICB 1P05A 1O3NA 1ZRKA 2F9UA 1P11E 2G52A 1N6XA 1C5VA 2ZNKH 1O2GH 1HDTH 1AUTC 4Q7ZA 1HAZB 3MU1A 2FODA 2OC8A 3R0FA 2AMPA 1QHRB 2YOLA 4X6OA 1EKBB 3P8FA 3SU6A 1C5RA 1C1WH 2BD9A 1EAUA 2ZEBA 1AVGH 2Z9JA 1TNHA 5C1UA 2XBVA 5C3NA 2OUAA 1O5GH 5E0HA 1V2VT 1TGCA 1BOQA 1HYLA 5LPRA 1DOJA 5C5OA 1DDJA 4A5TS 2P93A 3Q3KA 5JYIA 2NU1E 1TGSZ 2O8LA 2Q6GA 1H9IE 1O34A 1BMMH 4LXBH 1AU8A 3EQ0H 2GDDA 1LKBA 1V2PT 4CRGA 1QJ6B 1SLWB 3RXRA 4YOIA 1QY6A 2ALPA 2CMYA 5C2ZA 4X1SU 2P8OC 4A1TA 4NGAH 1ELVA 3ZVEA 1IQGA 1O37A 1P8VC 1C1VH 1OYQA 3CENA 3HATH 1DLKB 3LJJA 1HUTH 3RM0H 2FYQA 1EPTC 1GWAA 1A61H 1TABE 1C1OA 1GVKB 3VFEA 3H7OA 1HJ9A 3P8OA 1J9CH 1T8NA 1EATA 5HM9A 1XUFA 3K2UA 1EP5A 3KEEA 6CHAC 2HWLB 2VH6A 4K1TA 2ZDMA 2ZGBH 2R3UA 4RN6A 1ZOMA 1TOCB 2Z3CA 3NWUA 4B2BA 2D1JA 2ZPRA 3E0NB 2JETB 2Y80A 2G5VA 2XNIA 2FOEA 3UNSA 2ODPA 1TBZH 1L0ZA 3RXIA 5IYTA 2V35A 4NA8A 1DSUA 1V2ST 1ZRBA 1THSH 2FS8A 4FVBA 5FBIA 1QQUA 3GCHB 1ABIH 1K1IA 4X8TH 4GSOA 5E8EH 2FI5E 4VGCB 1RXPA 2VVVA 3RMOH 2Z9KA 1OKXA 2TPIZ 2OC0A 1O32A 3BN9A 3PM3A 4ZHAA 3MNCA 5DP6A 2BDGA 2VIVA 3U8OH 2HALA 1GJBB 3ZZ5A 2ZC9H 4MPVA 1O2RA 1IHTH 2TGTA 2RA0A 2F9VA 3GCTF 5T6DA 1ESBA 3NZIA 3BTHE 4CH8B 2FOCA 4JK6A 2ANMH 1Z6EA 2R2WU 3ATLA 1DSTA 4I31A 1A5GH 3FVFB 2IOTA 1NZQH 4TWYA 1ELAA 1O3IA 2QV1A 4ZXXH 1K21H 3PYHA 1DXWA 1C1PA 2BY8X 2ZQ1A 4WWYA 2WPJS 2FPZA 1SLXB 4Z6AH 2AGGX 1GI0A 3RXJA 1F5KU 3KL6A 1CGJE 4MNYA 5E2PA 3K9XB 4ZHMU 4BOHA 1NS3A 1MD7A 1O3CA 5FPSA 1CT4E 2PR3A 1HXFH 1N6YA 1FI8A 4JZ1A 4QT8C 1O3AA 3QTVH 5F8ZA 4NZQA 1N8OC 3BTKE 1HLTH 4AB9A 2ANKH 3RP2A 1GMCF 1BHXB 3KIDU 1S6HA 3U1JB 3A8BA 1H8IH 1BTPA 3M7TA 2SNWA 5EW2H 1K9OE 2BDYA 1YPMH 1TQ0B 1Z1JA 3KQDA 4IBLH 2PSXA 1ZHMA 3A7YA 4CRCA 2ODQA 4R0IA 2W5EA 1C2KA 5FXLA 1O2YA 5FX5A 1THPB 3LGTA 1ELCA 4F49A 1ZJDA 2R0LA 2BLVA 4BAQB 3A8CA 2FX6A 3T5FH 4ABIA 1BUIA 1FIWA 3SI3H 1SGFA 4BTIB 2OCVB 2OQUA 2AMDA 1GDQA 1BBRH 1L1NA 1UTPA 1OWDA 1S0RA 3ATIA 4K69A 3MO9A 1IQEA 2IJOB 2J34A 2QXJA 2RCEA 1O36A 1LPKB 3O8RA 1C2JA 1L1GA 2ZU3A 3TK6A 4FUCA 5L6NH 3M7QA 1ESTA 4Y11E 1Y3UA 1LHCH 1CA8B 2BXUH 2JH0D 3QZQA 1C5ZB 1ZHRA 2PKAA 2XXLA 1EB1H 3RXPA 1JBUH 1ORFA 1O39A 4CRFA 2FOGA 3MH7A 2CN0H 3W95A 3NXPA 1LCYA 2I6SA 1TA6A 3QTOH 5H4IB 5F8TA 1YM0A 2UWOA 1NRRH 1SG8B 2BLWA 2BVSH 3AW0A 4Y8ZA 3SJ8A 2ZFFH 1HAGE 2A4RA 4NZLA 3SGQE 1UCYH 3MI4A 4Z0KA 4K8BA 1O5AB 1SLVB 1A3EH 3UPEA 1WYKA 2Y82A 1YC0A 4X1RU 3ZYDA 4CH2B 1AB9B 4DOQA 2SGAA 2GKVE 5JB8S 1LVYA