4ZKOU

The crystal structure of upain-1-w3a in complex with upa at ph7.4
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Urokinase-type plasminogen activator
publication title The crystal structure of mupain-1-IG in complex with murinised human uPA at pH7.4
rcsb
source organism Homo sapiens
total genus 59
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2015-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4zkoU02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4zkoU01
3H7TA 4XE4A 3PTBA 4AOQA 1OYQA 1O30A 2OC8A 1THRH 4B2BA 4ABAA 1DWEH 2VNTA 1SB1H 4PROA 3QLPH 5T3HA 1PQ7A 4CBNA 4JCNA 3P8NA 4K1SA 4K5ZA 5JBBS 2VH0A 2QXGA 4YOIA 2PSXA 1ETSH 1BTUA 3GY3A 2HPPH 1EB1H 4IN2A 1W7XH 3UOPA 3ZZ4A 2HOBA 1LVOA 4MQAA 1NS3A 4ABHA 3LGVA 1OXGA 5HM9A 1GHAG 5DP5A 1F5RA 3TH2H 2WV5A 3RXDA 2TBSA 1RIWC 2J95A 4JZFH 1HJAC 1ZPZA 2TIOA 4NCYA 4NA7A 1FN6A 2A4OA 1IAUA 4ZXXH 2GP9B 4E7NA 4BAQB 1WCZA 3GICB 3TJOA 3ATIA 5L2YH 1SGFG 2H1UA 2ZCKP 1G36A 2H6MA 4GCHG 1AI8H 5CE1A 1YC0A 1N8OB 4CRGA 3PLKA 1EB2A 2BDHA 1UCYH 4OGYA 4XBCA 4D7GA 2JH6D 1C9TA 3KF2A 5LPFA 1O5CB 4IN1A 3I78A 1ZGIA 1SL3A 5DPAA 1V2WT 1ID5H 4AFZA 1BMLA 1TBQH 3LGWA 2ALVA 4KP0A 4LOYH 4SGAE 3UQVA 3M7TA 3MO6A 3SUDA 3FAOA 3A89A 2Q6FA 2XNIA 1PYTD 3BTEE 3RU4D 1L1JA 3BTKE 1PPZA 3Q77A 1MD8A 2R2WU 1BTPA 1LHEH 1MTSA 3S69A 3TJUA 3A7ZA 3M3VA 1Y5AT 1TQ7B 1V2NT 4XSKU 1ZHRA 1T31A 1SPJA 4ZHMU 1S85A 1G37A 2ZDNA 1MTUA 4CBOA 2ZFTA 3SO3A 4CRDA 2PSYA 3GY5A 1GI6A 3JZ2B 2BMGB 1TOCB 2ZFFH 4I8KA 4HGCA 4NFFA 1CGJE 4JZIA 1W3CA 2CHAC 1NRRH 1UVTH 2IOTA 1C4U2 1HBTH 3P8OA 4U2WA 2GZ7A 1QB6A 1VZQH 4INHA 3TU7H 1C2HA 3ZZCA 4D76A 3BG8A 2OP9A 4AGKA 1AWHB 4D9RA 1GBDA 5F8XA 1GDQA 3SUEA 2VIPA 4Y71A 3QDZB 4OS4A 3FVFB 5T6DA 3GYLB 1IQEA 2FS9A 5DK1A 3URDA 4UD9H 4DIHH 1O31A 3LC3A 3AW0A 1IQHA 3ZVCA 2P93A 2GMTC 2FYQA 1SGRE 1KDQA 1FXYA 1YLDA 5DP8A 1MAXA 1C5UA 1GJ6A 1NU7B 4X6OA 4BNRA 4YZUA 2G00A 2J34A 4XOJA 3RXGA 2IJOB 5SGAE 3EA8A 1C1VH 1MAYA 2XWAA 1TNGA 4D7FA 2VWMA 4DCDA 3F1SB 1O3CA 1JMOH 2G5VA 3PLPA 3GCOA 2G4TA 4AORA 3LT3A 2Y5GA 2Z7FE 2FI5E 4Y8ZA 3SNBA 2PKSB 4OS1A 3MMGA 1ZHMA 1AUTC 3AAUA 1UO6A 1HAOH 1GPZA 1T7CA 2PHBA 1QNJA 2IPHA 3AAVA 3R0FA 2J38A 1DM4B 5DJ7A 3UWIA 4I33A 3OY5U 3RUOA 1NFYA 3BTGE 2VH6A 2HGTH 2R9PA 1HXEH 1HCGA 5A0BA 1Q3XA 1LHCH 1G30B 1HB0B 3MO9A 4WMDA 5EW2H 5H4IB 2ZNKH 1ETRH 2CV3A 2F91A 3N7OA 5I46H 1NM6A 1F5KU 3G01A 1EPTC 4NFEA 5A2MH 3NWUA 1WTGH 4YLUA 2WYJA 1IQKA 5AVDA 3PWBA 1TNKA 1GI2A 2PLXA 2XW9A 1QCPA 4OGXA 4X2VA 3STIA 1AB9B 2ILNA 3OX7U 3OTJE 1YPHE 3ZZ5A 1AFQB 2AS9A 2BD3A 2CMYA 4O97A 4AFQA 1BMAA 4BTIB 1V2TT 1GI1A 2G81E 4BAKB 2P95A 1LVYA 3RXEA 3RXCA 4DT7B 1DPOA 1C1WH 3M61U 3ELAH 1FQ3A 1P2KA 3V12A 1O3JA 1V2MT 5HXFA 1FV9A 1O2LA 1C1MA 2FPZA 2KAIA 1UVPA 3D65E 4R0IA 4X6NA 3RMMH 3QGNB 3SGAE 3F6UH 1P8VC 1RD3B 5GIBA 2ZEBA 1C5XB 3A88A 1ELCA 5CHAB 2BVXH 3FP6E 3HGNA 3BTME 5BRRE 1C5YB 3S9BA 2OC0A 2PTNA 2V3HH 1DY8A 3W94A 1O3GA 1AE5A 5ESTE 1ZOMA 2A5IA 4Q2KA 2NU4E 1QBVH 3VGCC 3RC6A 3IWMA 2QCYA 4DVAU 2WUBA 1O2GH 4VGCB 4CRFA 3RMOH 2Z3CA 4ZKOU 1ZLRA 5EXMA 1WOFA 1BRBE 3ZVFA 1ZPBA 2F9UA 1MTWA 3RXQA 2BX4A 3GISB 3SGBE 1N8OC 3RM2H 2A45B 1C2GA 1KXFA 1LPKB 2Z9IA 1K21H 1O37A 4ZKSU 1D4PB 8GCHF 2OC7A 4J1YA 1W8BH 1P2IA 1GBFA 1EOLA 3F68H 3ZZ8A 4AFUA 1W13U 3RXMA 5K0HA 5E0HA 1GMCF 1LHGH 4BOHA 3SU0A 4AG2A 2BQ6B 5EW1H 3HKJB 1KXBA 1TWXB 3ATWA 1XKBC 1CQQA 1P0SH 2NU2E 3SNCA 3M7UA 3NPSA 3MNSA 1C2KA 2HALA 1HAIH 2XCNA 1PJPA 2QV1A 1S84A 1V2ST 3RLWH 2YOLA 1QA0A 3KN2A 2V3OH 4JK5A 1VR1H 2FOAA 3NCLA 2FIRH 2W5EA 1EOJA 3SV2H 1ZJKA 2LPRA 5E0JA 3I29A 1BHXF 4NIWA 2GTBA 1W10U 2Z3DA 2OC1A 4DURA 3GY4A 2O9QA 2O8UA 1ESBA 2QN5T 1YPMH 1OWEA 1B0EA 5T6FA 2B7DH 1P03A 1HYLA 1CA0B 2RDLA 3HK3B 1GDUA 1OWKA 1TNJA 2CN0H 2AIQA 4HZHA 1D3TB 1CGIE 1HIAA 5FX6A 5A8XA 1HXFH 1TX6A 3BG4C 1UVSH 3VB5A 2HNTF 3LJOA 5C1YA 2TGTA 4YOGA 1PQ5A 4RSPA 3M5OA 4Y7AA 3AASA 1HIAB 3E0PB 3LIWA 2QGRA 3OYPA 5GPIB 1C1PA 2DUCA 3DHKH 5EGMA 3PYHA 2Y7XA 2A7HA 3T27A 1XM1A 1K1MA 4Q7XA 4FU7A 1EQ9A 1W0YH 1ABIH 1AKSA 1INCA 1YCPH 2ANKH 3HPTB 1PYTC 1UTPA 1GBIA 2GV6A 1GI7B 2Y7ZA 1YPJH 1G2MA 3EAJA 3EA7A 1AD8H 4E7RG 1NN6A 3KIDU 2GX4A 1P12E 5B6OA 2Q6DA 2R3UA 1ARBA 1EJNA 1JIMA 1AO5A 1EX3A 1GHAF 2OUAA 2PR3A 1GG6C 2ZHQH 2FMJA 4AX9H 3LKWA 5GCHG 1FI8A 2BVRH 1IQGA 1CT4E 1GMDG 3RU4E 4FUIA 1UCYK 2ZFSA 3EE0B 2ZO3H 5BPEA 3D49H 2OQ5A 1P10A 1BCUH 2DE9A 1C2JA 1OX1A 3SNEA 3E1XB 3SGQE 1ZSLA 1BQYA 3RXPA 1K1NA 2BZAA 1WBGB 2Z9GA 1GBLA 5FBIA 2BLQA 2WPJS 1KLJH 1MTNB 1F0TA 1WSSH 1C2IA 1UMAH 2GZ9A 2AFQB 3RXKA 2BQ7B 1DLKB 1TNIA 3QN7A 2Z9KA 3LPRA 3M5NA 4MLFB 5JB9S 3SU6A 3B9FH 1GI3A 1H1BA 2XBXA 1GBKA 4XFQA 1DUAA 1KY9A 2BY8X 4WXIA 4B75A 1LPGB 2THFB 3CENA 3RLYH 4FUBA 4THNH 1AFEH 1S0QA 2ZF0H 2SGPE 3MU1A 5EODA 3F9GA 2G55A 1UTQA 2VIVA 1AB9C 3NUMA 2BY5X 1AZ8A 2H9EH 1Y59T 3KGPA 4JMYA 1EASA 2QXIA 1DVAH 1AFQC 3DUXH 4X6PA 1B5GH 4UEHH 2OD3B 2F9BH 1ZZZA 3OSYA 3ZZDA 3E3TA 4A1TA 3RM0H 3K6YA 1CT0E 4KTUA 2O8TA 4ABDA 2FX4A 1RTFB 1DXWA 1QRZA 3BEIB 1XUGA 1GJBB 2ZA5A 4AYYB 2XTTB 2BDBA 1AVXA 3ZZ3A 1GJ8B 1GHXH 3OY6U 3P70B 1FN8A 3ZV9A 3ATLA 3VFEA 5F6MA 2AGEX 1OWIA 2A4QA 2BB4A 1UTMA 1J14A 5DG6A 1DX5M 1OKXA 1IQLA 2FOFA 1P2NA 1OPHB 1IQIA 1OP8A 1QRWA 1K2I1 1K1IA 2AMDA 3MTYA 3RXTA 1Z6JH 3TJVA 8KME2 3SHAH 3E16B 3RXJA 1A2CH 3QZRA 1TQ0B 1S5SA 4VGCC 1B0FA 3SORA 2VWNA 3TPIZ 3RMNH 3P6ZB 1RXPA 1SQAA 1C5MD 1U6QA 3EQ0H 4IGDA 1FY5A 2A2QH 2BDIA 2PGQB 1ELVA 3RXLA 2ZWLH 4MNYA 2ZPQA 4NZQA 1XUJA 3E0NB 1TX8A 1KXCA 3MNBA 2AH4X 3VPKA 1GJ5H 3O8DA 4ZXYH 1UHBA 3EDXB 4NA8A 4ABJA 1EZQA 1XUKA 5GDSH 1A5HA 5FCKA 2EI8A 3FP8E 3TH4H 4YOJA 5TCCA 3SI3H 4H4FA 2HVXA 1QGFA 1UHBB 3RMLH 1O2NA 3MU8A 4LK4A 3M3TA 6GCHF 4O03A 2BM2A 4KGAA 1AQ7A 2GDDA 2FO9A 2FX6A 1P11E 1C5PA 1P06A 1WU1A 3OU0A 2UWPA 1HGTH 1BJVA 4BAMB 3RXRA 1DFPA 3UNSA 2GT8A 1NRPH 3V13A 1HJ8A 3VXFH 3PO1B 1TB6H 4GSOA 4DIIH 1RJXB 1ZSJA 2FM2A 3P95A 1BHXB 1BTWA 1OWDA 1BTZA 1Y5BT 1O3MA 2OLGA 3MHWU 1CSOE 1MBMA 1YLCA 1ZRKA 2ZZUH 1V2LT 2UWLA 2CGAA 1G3BA 3A82A 3NK8A 4R8TB 4LZ1H 3GY7A 2G52A 2ZTZA 1SLWB 4OS7A 1AY6H 1V2VT 1ZTKA 1T8OA 1ELEE 1SQTA 1V2PT 1L0ZA 1JIRA 1DSTA 4CH8B 1EP5A 1A0HB 4UFEH 1CHOG 1ZYOA 5JBCS 1C5VA 2H5CA 1C5SA 1T8NA 3SQHE 1CA0C 5HYOA 4CRCA 2JKHA 3ZVGA 3FP7E 1BBRK 1VGCB 3L33A 4WH6A 2D1JA 1O2WA 1BMMH 3SJ9A 1BA8B 3MO3A 1J15A 2F9VA 2ZTYA 1LO6A 2W7SA 2R0LA 1SHYA 5EXLA 2UUYA 1ORFA 3V0XA 3TK6A 1G3EA 4KELA 3ESTA 1LQEA 4DJZB 2XRCA 4JZEH 1V2UT 1HFDA 2ZDKA 2VIWA 1IQFA 1EUFA 1O2YA 1MBQA 2TGPZ 2FOEA 1TNLA 1GHBG 1K22H 1AHTH 5FCRA 4TYDA 1AGJA 1MKWK 1GHVH 2FDAA 4AB9A 3SW2B 5JBAS 4YM9A 2ZQ1A 1P01A 3U1JB 5DGJA 6CHAB 3VB7A 3U8TH 1A7SA 2ZHFH 2OINA 3MI4A 1NFXA 1ANEA 1Q2WA 4FUGA 3SV7A 1HLTH 3FANA 2B5TB 1MKXH 4FUFA 3A7VA 1O3NA 1FPHH 1D6WA 1TA6A 3UNRA 1QQUA 4Y8YA 4X1QU 2ZU1A 2D26C 1O2KA 3QZQA 1W11U 2RCEA 5EXNA 2BY6X 1EZSC 4AB8A 2GD4B 1W2KH 4I31A 4O9VA 5A09A 3P92A 4D9QA 2GZ8A 4DW2U 1XUFA 1SFQB 3BEUA 4INLA 2C8YB 1OWJA 1QFKH 2VB0A 3U69H 5LPRA 4ABEA 1MTNC 1A3BH 2B8OH 2P8OC 1AVGH 4X2YA 1O32A 4A5TS 2Z94A 3M35A 3LGYA 1D9IA 1XVOA 1K1PA 2FP7B 4IMQA 1TOMH 5EU8A 2ZHWH 5EQQA 2Y82A 3P8FA 1SR5C 3ZV8A 3NKKA 1QB9A 1UVUH 1C5ZB 4BTUB 4X1SU 5IYTA 3TLOA 2UUFB 4NWKA 4UFGH 1QB1A 2WPHS 1W7GH 4FXGH 2F83A 1VJAU 4FUEA 4WJG2 1T4VH 5C2ZA 1ZRBA 2GCHF 1FZZA 1GI5A 2ZDLA 1O2JA 3ATMA 1HAXB 2C8WB 2FESH 1CHGA 3VB4A 4F4OC 2ZFPH 2J92A 3UY9A 5A8YA 1LKBA 5A0CA 2B0FA 1GJ9B 1SGTA 1NY22 2J4IA 3I77A 2SFAA 2C93B 4UE7H 5E2PA 1O2PA 2BQWB 3Q00A 4A6LA 4ESTE 2BDCA 3TIUA 2Y80A 1TPSA 1EZUC 1O3FA 7LPRA 2TRMA 1FY4A 2ZC9H 1FAKH 1C2FA 1GMHG 1Y3XA 2G4UA 3CS7A 2ULLA 2Y6TA 2BD2A 1SLVB 3SV8A 2H9TH 2SGFE 1QBOA 3VXEH 1K28D 3SQEE 3TH3H 3L6PA 1PPCE 1DITH 1EAUA 1F0UA 3TNSA 1RGQA 2FOBA 1ZGVA 2QYIA 4Z0KA 1TGBA 2XWBI 3BTFE 1GJAB 1CGHA 1V2QT 3NXPA 1GI0A 4TPIZ 3ZVDA 3KQBA 3PMHB 2TPIZ 2J2UA 1YBWA 4NZLA 1A0LA 4RN6A 1A3EH 1WAYB 2ZCHP 1XXFA 4LZ4B 1RS0A 3RU4T 1DT2A 1QL9A 2TGDA 1O3PB 2B9LA 3GCTG 2SGAA 2PW8H 1A46H 3E6PH 1FLEE 4ZUHA 1O3BA 5L2ZH 1NFUA 1IQMA 1O3DA 1SLUB 4NSYA 5E0GA 1FIZA 4Y6DA 2A7CA 4XDEA 2C8ZB 5JYIA 1P05A 2PUQH 1BDAA 1GCTB 1KLIH 2ZGCA 1Q31A 3A84A 5LPEA 1SGCA 2A0QB 1E35B 1HPGA 2BOKA 3SU1A 2C90B 2ZHEH 4ISNA 4ZMAH 1Z1IA 1C5OH 3KHVA 1GHZA 5GCHF 1GMDF 1PQ8A 2ZP0H 1DDJA 5JDUB 1ARCA 1D6RA 2P59A 3PM3A 5DKMA 4ZHLU 3K9XB 3PO1C 5C1UA 1UTKA 3TGJE 4WF8A 3PB1E 2IN2A 3KL6A 8LPRA 1E34B 4WWYA 2ZFRH 3K65B 1S82A 4OS6A 4MNXA 1C5QA 1ANBA 2VIQA 1L4ZA 5FPTA 4MVNA 3SU4A 2ASUB 3A8CA 2ZU4A 1O34A 2FOCA 1UVOA 2VVUA 1DWCH 5J4QA 1ANCA 1FY1A 1MQ5A 1A5GH 3UTUH 1ETTH 1K1LA 3GY6A 4A1XA 1TGCA 2EA3A 2BXUH 3ZZ6A 2HNTC 4TY6A 3ZZ9A 1TALA 3A87A 1O2QA 5DP7A 3M5MA 4KTSA 2QAAA 2Q6GA 3EA9A 3D62A 1VGCC 1W0ZU 3ATKA 3GCHB 3MOCA 1BZXE 2Z9LA 2K1QA 1XKAC 3CS0A 4HFPB 2FLBH 3QO6A 1BTXA 4B76A 1MD7A 1VCQA 2YNBA 2Y5FA 3H5CB 4ISIH 6ESTA 1ZHPA 4Y11E 4O3TA 3A8AA 2SNWA 2FXRA 3S0NA 3QX5H 4OS5A 2OBQA 2VIDA 4YTAA 2G5NA 2VINA 3KCGH 4OS2A 2HNTE 1ZMLA 1SGEE 1UJ1A 1FDPA 3SJOA 1BOQA 1CBWB 3QTVH 2F9NA 1QR3E 3V7TA 1Z8RA 1H9HE 4A7IB 3DA9B 1D3QB 4IC6A 1L2EA 6CHAC 2W7UA 1S83A 3BTHE 3LU9B 3RXHA 1F7ZA 3S7KB 3RP2A 3T2NA 1F92A 4U01A 2ZU2A 2ZU5A 3MFJA 3IG6B 1BUIA 1F5LA 1JWTA 1FY3A 1H9LB 2FTMA 5K7RA 5EQSA 3UOUA 2GVFA 3SV6A 1VITH 2AIPA 3ZVAA 1UTLM 1IHSH 1D3PB 3E91A 1XVMA 2VWLA 1HDTH 1NU9A 2CJIA 1NO9H 3SHCH 4HI3A 4WMEA 3PLBA 1FNIA 4NG9H 5E8EH 1TIOA 4I7YH 3QUMP 3KQCA 4WY3A 1CA8B 2Q1JA 2AMQA 9ESTA 3O8CA 2QA9E 7KMEH 1C5RA 4TWWA 1TRNA 3MH7A 2ANYA 1WQSA 5FPYA 4MNWA 4CRAA 1LQDB 2PTCE 3ZYDA 1HJ9A 1O5FH 3PROA 3L3TA 4ASHA 1AMHA 1SLXB 3MH5A 1HRTH 1YPLH 2O8LA 1F0RA 2VIOA 1GBCA 2ZCLP 4WVPE 2BHGA 1SQOA 1O3AA 1K1JA 1TGNA 3ODDA 1SGPE 4DGJA 2PKSC 1KTTB 3PMJA 3T5FH 1BRUP 1C1QA 2SGDE 1KYNA 1BRAA 3UIRA 1C1TA 2OCVB 3CP7A 1MZAA 4GVUA 3V3MA 1O3KA 1O2ZA 4ABIA 3HGPA 1KTSB 5F03A 2ZGXH 2JH0D 3JZ1B 1NZQH 1N1LA 4JYVH 5C5NA 4NA9H 4GCHF 3RXBA 4DG4A 1FONA 3TVJB 1Z8JB 1MCVA 5FXLA 1RFNA 1O3OA 4NIVA 4ZHAA 5EOKA 5C3NA 3MU4A 2A32A 1SI5H 1ZTLA 5JB8S 4ISOA 2AERH 3MNCA 1LCYA 4AZ2B 2XCFA 1GBBA 1CHOF 1O2OA 3TGKE 3KQEA 1NROH 1GVZA 3VB6A 5EPYA 1P2JA 1V2OT 2BLWA 2P16A 2ESTE 3GDSA 4Y76A 4BTTB 3SJ8A 1HAHH 4NIXA 5G4BA 2A5AA 1G3CA 1KIGH 1TE0A 1YKTA 3DFJA 4Q80A 3SNAA 1ELTA 4X6MA 5HMAA 4XBBA 2XYAA 1NRQH 3QTOH 1OP2A 3SN8A 3A83A 2ZDVH 1NPMA 3C1KA 1O3HA 2M5TA 4K69A 2A4RA 3M3SA 4H42U 3SJKA 1T32A 3HKIB 3UPEA 1GHBF 2ZHDA 2A5KA 1DS2E 2VVVA 5DO4H 3D23A 2Z6BD 3KEEA 2QXJA 2ZDMA 3F9HA 3LONA 1W14U 2HPQH 1P2QA 1P2MA 2XC0A 1GCTC 1K9OE 1XX9A 1WQVH 5ESBA 1NRSH 5CHAC 2XC5A 1BT7A 2V0BA 1DWBH 1BIOA 4MPWA 2Y81A 1O0DH 1L1NA 1TNHA 3ENSB 1GL0E 2UUJB 1C1OA 1QA7A 3SBKA 2H5DA 1FIWA 5IDKA 1ZSKA 2BLOA 2VU8E 1QIXB 1GHWH 2ZIQH 5AFYH 3LOXA 5LGOA 3URCA 1V6DA 5DP6A 1Y3WA 1F0SA 1X7AC 1EPTB 2W26A 1B7XB 3RC4A 1GHYH 5T6GA 1SGNE 2OXSA 4IBLH 3VEQB 1WV7H 4ABFA 4E06H 3A7XA 2GCTB 4FU8A 1J17T 1ESAA 1YM0A 3MNXA 1QY6A 3BTQE 1GL1A 1VJ9U 4JYUH 3LGTA 4MPXA 4RKJB 3U8RH 3UR6A 1O33A 3A8BA 1EKBB 1SSXA 1UK4A 2ODQA 3A81A 5EQRA 1WTHD 4Y7BA 2A7JA 2CXVA 1O3IA 1O2XA 3SNDA 2Y5HA 1SGDE 7GCHG 2WV4A 3ITIA 4Y10E 1PQAA 1AN1E 1XUHA 1P3CA 1A0JA 3STJA 1DLEA 2BDGA 1O2TA 2WUCA 4HTCH 1GBTA 1V2KT 3ODFA 1A1RA 5FBEA 1SC8U 2BD8A 1L1GA 1DICA 3GCHC 2NWNA 1FUJA 1TRYA 3H7OA 2F3CE 2G8TA 3TGIE 1G9IE 3O8BA 4MNVA 3GOVB 3BIVH 3K2UA 1FY8E 1KLTA 1E37B 4J2YB 4X8UH 4I8GA 1NFWA 2R0KA 2TGAA 2V35A 1TA2A 1EJAA 4IS5A 1LVBA 1IQJA 4I8HA 4U32A 4ISLA 4CRBA 3UNQA 1XMNB 4TPYA 3TNTA 1CBWC 1GMHF 3B8JA 5AFZH 4K8YA 1QTFA 2F9PA 3VGCB 4DOQA 1ZTJA 1BMNH 1SGYE 4B2CA 2AGIX 4UFDH 3FZZA 1ELAA 3GYMA 2ZPSA 2BLVA 1QL7A 1Y3UA 4K1TA 1AE8H 3QK1A 2RG3A 4B2AA 1AUJA 4H6SB 1LHFH 4F49A 4JZDH 1P9UA 1ABJH 1UK2A 5DP3A 2P3UB 3ZZ7A 1EAXA 2YNAA 1C5NH 5TCAA 1QJ6B 2R2MB 1JOUB 1K1OA 3ZVEA 3A7WA 3QWCH 4UFFH 3RXIA 4SGBE 1KXAA 1TMBH 4B1TA 1C1RA 2J94A 1Y3YA 2FI4E 3U8OH 4TWYA 4JZ1A 1P9SA 3O8RA 4WH8A 1SOZA 2AGGX 3GCTF 3S9CA 1AU8A 4B71A 3MH6A 2H2ZA 1LMWB 3U9AH 4A1VA 1C5LH 1CE5A 1MTVA 1YGCH 1D3DB 3KNXA 3UR9A 1YP9A 1P3EA 1O5DH 2BYAX 1PPFE 2ANMH 1DOJA 1G2LA 2BXTH 2NU0E 1TX7A 1O5AB 1JRTA 1LTOA 1BTYA 2BDYA 4MPUA 3A7TA 3F9FA 4FUCA 1HAZB 4MG3A 1SGFA 2EEKA 4CHAB 4YT6H 3R3GB 3VB3A 1YYY1 2EI7A 2GGVB 1BRCE 3MU5A 1JXPA 1NTPA 1GI9B 5AHGH 2XBWA 1XUIA 2F9OA 1G3DA 1YPKH 1AWFH 4GHTA 2ANWA 2QC2A 2OQUA 2Z3EA 1WUNH 1YCPM 7ESTE 1THPB 3FZDA 4BXSA 4A92A 1GVKB 5AF9H 1VITG 4E05H 1V2RT 4X1PU 1GBAA 1PPEE 4INKA 2WPIS 1TRMA 4MTBA 4K2YA 2R3YA 1OYTH 3MYWA 2BZ6H 3BG4B 4NSVA 3BSQA 3P17H 3A86A 4CREA 1LVMA 2NU3E 4X2WA 1GBMA 4GHQA 2UUKB 1GGDB 2C3SA 3RXVA 2ZQ2A 2JETB 1E38B 1UK3A 2P94A 1O5EH 1C4V2 3FFGA 4FU9A 2GT7A 2VJ1A 2G51A 1ACBE 4ZROA 4IMZA 1P04A 1H4WA 3SJIA 1YPGH 1KDQB 2FS8A 5C5OA 3M5LA 1ESTA 3AVZA 3T26A 3TITA 3W95A 1UCYE 2BD9A 2FI3E 3UWJH 2C8XB 3WY8A 1TPAE 2XBYA 4MPVA 2VGCB 1DE7H 4K3JA 2A1DB 5F8ZA 5FHTA 5A8ZA 2OBOA 1YPEH 3ZZBA 3SUFA 1KXDA 3TJNA 3IITA 1ZMJA 1H9IE 1RTKA 4YLQH 1LDTT 4FVDA 5LH8A 1OOKB 1SFIA 1GG6B 1FPCH 1C1UH 3PWCA 6GCHG 1JBUH 4DY7B 2BDAA 2BTCE 2ODPA 1QBNA 2J9NA 1C9PA 1V3XA 3LGIA 1MU8B 2D2DA 4ZKRU 1O2HA 4FVBA 1UTOA 3RXUA 3LGUA 5J4SA 4GAWA 1O39A 3S9AA 4X1NU 1GWAA 2ZGBH 2GDEH 2BY7X 1AZZA 4X8TH 1LPZB 3RXOA 5I25A 4MDSA 1GVLA 1L4DA 1ZPCA 3MU0A 1YPHC 2W3IA 2WPKS 1YCPK 2I6QA 2ZGJA 3F9EA 1J8AA 1TYNA 2EI6A 5ABWA 2PKAA 1T4UH 2VWOA 2SNVA 2EC9H 2ZGHA 2UWOA 4B74A 2AYWA 1O2VA 1EAWA 2PKAB 4FUJA 1DY9A 1C2DA 2LNCA 2GCTC 5CMXH 2FWWA 1C5WB 3BTTE 1NC6A 3T62A 1O5BB 1HAGE 4FUHA 4BANB 2AMPA 3K6ZA 1GBEA 1YF4A 3BTWE 1TBZH 1AVWA 1QHRB 4BXWA 1IHTH 5C1XA 3LJJA 1VCWA 1QRXA 1QJ7B 3HK6B 4NGAH 1LHDH 1NESE 4FUDA 1SMFE 1SOTA 4Q7ZA 1O3LA 2ODYB 1FMGA 4U30A 1P09A 2FOGA 2HLCA 1UTNA 4CR9A 1BBRH 3LDXH 4GLYA 3RXFA 5C20A 1A61H 2RA0A 5EG4A 1T8MA 4YO9A 3LH3A 3BTDE 4NWLA 2O8WA 2PUXB 1Y3VA 2P3FH 3M7QA 1TFXA 2KAIB 1Z8GA 1J9CH 4X1RU 4X8SH 2ZU3A 1H8DH 2BX3A 6LPRA 1C5TA 1HUTH 1H8IH 1ANDA 3MH4A 5E2OA 4Z6AH 4Y8XA 3MWIU 1FAXA 3UFAA 4Y79A 3BEFB 2O8MA 4X8VH 2WPLS 1RTLA 4AG1A 1MKWH 1TMTH 5HGGA 1PPHE 1MUEB 3M36A 1S81A 3GDUA 2FODA 5JBTA 5PTPA 1P02A 1XXDA 1HAVA 1GDNA 4XBDA 4I8JA 1SVPA 2CF9H 3KQDA 5TJXA 4ABGA 1ZJDA 4Y0ZE 1TONA 2STBE 2PWXA 1HAVB 2QF0A 3GDVA 1CT2E 1LKAA 2QF3A 3LH1A 2QY0B 4IW4E 3RXAA 3RC5A 1C2EA 4K8BA 4QT8C 4I8LA 1P2OA 3B23B 5FPSA 1MU6B 1G32B 1ZMNA 5HM2A 1QURH 1T8LA 3ZYEA 1HAYB 1NRNH 1OS8A 1IQNA 3DT0H 4K1EA 4IC5A 1O36A 4GUXA 3A80A 4X2XA 4ZAEA 3U98H 1M9UA 3BV9B 4AGJA 3SV9A 2SGQE 2ZTXA 1TGTA 3SU3A 2A4GA 3ZZAA 3Q76A 2QXHA 2RA3A 2ZDAH 1TMUH 4O3UA 1RIWB 1AIXH 1HJAB 1PFXC 5F8TA 2GCHG 2BD7A 2P3TB 1ELDE 1EAIA 8ESTE 1HAPH 4CHAC 2ALPA 1C2MA 1BBRE 3SUGA 3Q3KA 3RDZA 1Z8IB 1GI8B 3EGKH 1MH0A 2SGEE 2FZZA 1BB0B 1QQ4A 4ISHH 4WXVA 4AN7A 4UDWH 4WMFA 1Y5UT 5L30H 1A4WH 4TY7A 1QL8A 1F2SE 5JPMH 1EP6A 1C2LA 1THSH 1O2UA 3Q3YA 4CR5A 1SGQE 3BIUH 2NU1E 1TPPA 1O2SA 1GBJA 2JH5D 1EATA 9LPRA 2A2XH 7GCHF 1O2RA 3NZIA 4K60A 1GGDC 4ZH8A 2DE8A 2WINI 2JETC 2ZI2H 1ZR0A 1W12U 3M37A 3SOSA 2ZKSA 1C4Y2 3A8DA 1JRSA 1GJDB 5ETXA 2HWLB 3T25A 3PTNA 1N6XA 2OTVA 4JK6A 1CO7E 2GKVE 1CU1A 2WPMS 1WYKA 3P8GA 2FLRH 2PFEA 1E36B 3GY2A 3C27B 1KXEA 1AKSB 2AEIH 4GPGA 4B73A 2VGCC 1GBHA 1O3EA 2CHAB 1BTHH 3PV4A 3UREA 4YT7H 4X0WU 1N6YA 1TGSZ 1TAWA 3ZVBA 2A31A 1GJ4H 3UQOA 1DWDH 1O38A 1MMJN 1IOEA 1TBRH 1O2IA 4ZKNU 1SHHB 3QGJA 5EPNA 4D8NA 1DSUA 1S0RA 1CVWH 2FYRA 1SG8B 4ABBA 5FX5A 5GJ4B 2GV7A 2GMTB 4BAOB 5L6NH 3E8LA 1DUEA 2HRVA 1RRKA 1BITA 2ZFQH 1DXPA 1ELBA 2XXLA 1HNEE 3U1IB 1O2MA 3BF6H 2P8OB 1PPGE 5DP4A 3SZNA 2Z9JA 1J16A 4CH2B 1Z6EA 5GXPA 1C1SA 1A5IA 1EZXC 3A7YA 3DFLA 3TK9A 8GCHG 2ZECA 4YESB 1SGIB 4H6TA 2VVCA 1MZDA 3LC5A 2BVSH 4KKDA 1S6HA 1GJ7B 1MCTA 5DP9A 2QIQA 3SU5A 1GMCG 3RXSA 2FEQH 1QJ1B 2FTLE 1OWHA 2V6NA 2ZPRA 4LXBH 3PMAB 1MKXK 3DD2H 1Z71A 1Z7KA 1ELGA 1ELFA 1OSSA 4JYTA 2BD5A 3A85A 4AFSA 1FJSA 1HV7A 1V2JT 1NT1A 1P57B 4UONA 1DANH 1TLDA 1EXFA 2I6SA 2D8WA 2BD4A 1TPOA 4AYVB 1C1NA 1OP0A 3GY8A 1UTJA 2WYGA 4I32A 5FAHA 2PV9B 3TK5A 3UUZA 2STAE 2PGBB 1EPTA 5A0AE 1BJUA 3PMBB 5C67A 4RKOB 3Q3XA 1S6FA 1PPBH 1EJMA 4BAHB 1E0FD 3T29A 2XBVA 2W3KA 1VITF 1GI4A 1MQ6A 3EYDA 1GJCB 2H9HA 3GCNA 1Y8TA 4Q7YA 2XC4A 1SBWA 4KTCA 3HATH 2FOMB 1O35A 5GWZA 4NIYA 2BY9X 1TABE 3SU2A 1KSNA 3T28A 1GCDA 4M7GA 2ZG0H 3AW1A 3BN9A 1Z1JA 2C4FH 2FOHA 1VCPA 3E90B 2CF8H 2BOHB 3SI4H 1O5GH 3S7HB 4Y0YE
chains in the Genus database with same CATH superfamily
3H7TA 2GJGA 4XE4A 3PTBA 4AOQA 1OYQA 1O30A 2OC8A 1THRH 4B2BA 4ABAA 1DWEH 2VNTA 1SB1H 4PROA 3QLPH 5T3HA 1PQ7A 4CBNA 3DSPA 4JCNA 3P8NA 4K1SA 4K5ZA 5JBBS 2VH0A 2QXGA 4YOIA 2PSXA 1ETSH 1BTUA 1W0KD 3GY3A 2HPPH 1EB1H 4IN2A 1W7XH 3UOPA 3ZZ4A 2HOBA 1LVOA 4MQAA 4AC9A 1NS3A 4ABHA 3F3BA 3LGVA 1OXGA 3DSGA 5HM9A 1GHAG 5DP5A 1F5RA 3TH2H 2WV5A 3RXDA 2TBSA 1RIWC 2J95A 4JZFH 1HJAC 1ZPZA 2TIOA 4NCYA 4NA7A 1FN6A 2A4OA 1IAUA 4ZXXH 2GP9B 4E7NA 5FL7D 4BAQB 1WCZA 3GICB 3TJOA 3ATIA 5L2YH 1SGFG 2H1UA 2ZCKP 1G36A 2H6MA 4GCHG 1AI8H 5CE1A 1YC0A 1N8OB 4CRGA 2YMSC 3PLKA 5T1VA 1EB2A 2BDHA 1UCYH 4OGYA 4XBCA 4D7GA 2JH6D 1C9TA 3KF2A 5LPFA 1O5CB 4IN1A 3I78A 1ZGIA 4B6EA 1SL3A 5DPAA 1V2WT 1ID5H 4AFZA 1BMLA 1TBQH 3LGWA 2ALVA 4KP0A 4LOYH 3OFND 4SGAE 3UQVA 3M7TA 3MO6A 3SUDA 3FAOA 3A89A 2Q6FA 2XNIA 1PYTD 3BTEE 3OEED 3RU4D 1L1JA 3BTKE 1PPZA 3Q77A 1MD8A 2R2WU 1BTPA 1LHEH 1MTSA 3S69A 3TJUA 3A7ZA 3M3VA 1Y5AT 1TQ7B 1V2NT 4XSKU 1ZHRA 1T31A 1SPJA 4ZHMU 1S85A 1G37A 2ZDNA 1MTUA 4CBOA 2ZFTA 3SO3A 4CRDA 2PSYA 3GY5A 5C0UA 1GI6A 3JZ2B 2BMGB 1TOCB 2ZFFH 4I8KA 4HGCA 4NFFA 1CGJE 4JZIA 1W3CA 2CHAC 1NRRH 1UVTH 2IOTA 1C4U2 1HBTH 3P8OA 3PV5A 4U2WA 5CDFE 2GZ7A 1QB6A 1VZQH 4INHA 3TU7H 1C2HA 3ZZCA 4D76A 3BG8A 2OP9A 4AGKA 1AWHB 4D9RA 1GBDA 5F8XA 1GDQA 3SUEA 2VIPA 2KCYA 4Y71A 3QDZB 4OS4A 3FVFB 5T6DA 3GYLB 1IQEA 2FS9A 5DK1A 3URDA 4UD9H 4DIHH 1O31A 3LC3A 3AW0A 1IQHA 3ZVCA 2P93A 2GMTC 2FYQA 1SGRE 1KDQA 4FETA 1FXYA 1YLDA 5DP8A 1MAXA 1C5UA 1GJ6A 1NU7B 4X6OA 4BNRA 4YZUA 2G00A 2J34A 4XOJA 3RXGA 2IJOB 5SGAE 3EA8A 1C1VH 1MAYA 2XWAA 1TNGA 4D7FA 2VWMA 4DCDA 3F1SB 1O3CA 1JMOH 2G5VA 3PLPA 3GCOA 2G4TA 4AORA 3LT3A 3GS9A 2Y5GA 2Z7FE 2FI5E 4Y8ZA 3SNBA 2PKSB 4OS1A 3MMGA 1ZHMA 1AUTC 3AAUA 1UO6A 1HAOH 1GPZA 1T7CA 2IPHA 1QNJA 2PHBA 3AAVA 3R0FA 2J38A 1DM4B 5DJ7A 3UWIA 4I33A 3OY5U 3RUOA 1NFYA 2QF5A 3BTGE 4TSFD 2VH6A 2HGTH 2R9PA 1HXEH 1HCGA 3U28C 5A0BA 1Q3XA 3KYGA 1LHCH 1G30B 1HB0B 3MO9A 4WMDA 5EW2H 4TT3D 5H4IB 1VKYA 2ZNKH 1ETRH 2CV3A 2F91A 3N7OA 5I46H 1NM6A 1F5KU 3G01A 1EPTC 4NFEA 2EY4C 5A2MH 3NWUA 1WTGH 4YLUA 2WYJA 1IQKA 5AVDA 3PWBA 1TNKA 1GI2A 2PLXA 2W6ID 5CHBA 2XW9A 1QCPA 4OGXA 4X2VA 3STIA 1AB9B 2ILNA 3OX7U 3OTJE 1YPHE 3ZZ5A 1AFQB 2AS9A 2BD3A 2CMYA 4O97A 4AFQA 1BMAA 4BTIB 2L6OA 1V2TT 1GI1A 2G81E 4BAKB 2P95A 1LVYA 3RXEA 3RXCA 4DT7B 1DPOA 1C1WH 3M61U 3ELAH 1FQ3A 1P2KA 3V12A 1O3JA 1V2MT 5HXFA 1FV9A 1O2LA 1C1MA 2FPZA 2KAIA 1UVPA 3D65E 2F4LA 4R0IA 4X6NA 3RMMH 3QGNB 3SGAE 3F6UH 1P8VC 3UB0A 1RD3B 5GIBA 3N7DA 2ZEBA 1C5XB 3A88A 1ELCA 5CHAB 3F2HA 2BVXH 3FP6E 3HGNA 3WWBA 2WZQA 3BTME 5BRRE 1C5YB 3S9BA 2OC0A 2PTNA 3PV2A 2V3HH 1DY8A 3W94A 2PP6A 1O3GA 1AE5A 5ESTE 1ZOMA 2A5IA 4Q2KA 2NU4E 1QBVH 3VGCC 3RC6A 3IWMA 2QCYA 4DVAU 2WUBA 1O2GH 4VGCB 4CRFA 3RMOH 2Z3CA 4ZKOU 1ZLRA 5EXMA 1WOFA 1BRBE 3ZVFA 1ZPBA 2F9UA 1MTWA 2XOKD 3RXQA 2BX4A 3GISB 3SGBE 1N8OC 3RM2H 2A45B 1C2GA 1KXFA 1LPKB 2Z9IA 1K21H 1O37A 4ZKSU 1D4PB 1YLNA 8GCHF 2OC7A 4J1YA 1W8BH 1YY3A 1P2IA 1GBFA 1EOLA 1E1QD 3F68H 3ZZ8A 4AFUA 1W13U 3RXMA 3VG8A 5K0HA 5E0HA 1GMCF 4Q63A 1LHGH 4BOHA 3SU0A 3FO8D 4AG2A 2BQ6B 2M2AA 4B6FA 5EW1H 3HKJB 1KXBA 1TWXB 3ATWA 1XKBC 1CQQA 1P0SH 2NU2E 3SNCA 3M7UA 3NPSA 3MNSA 1C2KA 2HALA 1HAIH 2XCNA 1PJPA 2QV1A 1S84A 1V2ST 3RLWH 2YOLA 1QA0A 3KN2A 2V3OH 4JK5A 1VR1H 2FOAA 3NCLA 2FIRH 1SQRA 2W5EA 1EOJA 3SV2H 1ZJKA 2LPRA 5E0JA 1KMHB 3I29A 1BHXF 4NIWA 2GTBA 1W10U 4RT1A 2Z3DA 2OC1A 4DURA 3GY4A 5DSFA 2O9QA 2KZ4A 2O8UA 1ESBA 2QN5T 1YPMH 1OWEA 1B0EA 5T6FA 2B7DH 1P03A 1HYLA 1CA0B 2RDLA 3HK3B 1GDUA 1OWKA 1TNJA 2CN0H 2AIQA 4HZHA 1D3TB 5HKKD 1CGIE 1HIAA 5FX6A 5A8XA 1HXFH 1TX6A 3BG4C 1UVSH 3VB5A 2HNTF 3LJOA 5C1YA 2TGTA 4YOGA 1PQ5A 4RSPA 3M5OA 4Y7AA 3AASA 1HIAB 3E0PB 3LIWA 2QGRA 3OYPA 5GPIB 1OHHD 1C1PA 1W0JD 2DUCA 3DHKH 5EGMA 3PYHA 2Y7XA 5C17A 2A7HA 3T27A 1XM1A 1K1MA 4Q7XA 4FU7A 3UAIC 1EQ9A 1W0YH 1ABIH 1AKSA 1INCA 1YCPH 2ANKH 3HPTB 1PYTC 1UTPA 1GBIA 2GV6A 1GI7B 2Y7ZA 1YPJH 1G2MA 3EAJA 3EA7A 1AD8H 4E7RG 1NN6A 3KIDU 2GX4A 1P12E 5B6OA 2Q6DA 2R3UA 1ARBA 1EJNA 1JIMA 1AO5A 1EX3A 1GHAF 2OUAA 2PR3A 1GG6C 2ZHQH 2FMJA 4AX9H 3LKWA 5GCHG 1FI8A 2BVRH 1IQGA 1CT4E 1GMDG 3RU4E 4FUIA 1UCYK 2ZFSA 3EE0B 2ZO3H 5BPEA 3D49H 2OQ5A 1P10A 1BCUH 2DE9A 1C2JA 1OX1A 3SNEA 3E1XB 3SGQE 1ZSLA 1BQYA 3RXPA 1K1NA 2BZAA 1WBGB 2Z9GA 1GBLA 5FBIA 2BLQA 2WPJS 1KLJH 1MTNB 1F0TA 1WSSH 1C2IA 1UMAH 2GZ9A 2AFQB 3RXKA 2BQ7B 1DLKB 1TNIA 3QN7A 2Z9KA 3LPRA 3M5NA 4MLFB 4F55A 5JB9S 3SU6A 3B9FH 1GI3A 1H1BA 2XBXA 1GBKA 4XFQA 1DUAA 1KY9A 2BY8X 4WXIA 4B75A 1LPGB 2THFB 3CENA 3RLYH 1WDIA 3FOAA 4FUBA 4THNH 1AFEH 1S0QA 2ZF0H 2SGPE 3MU1A 2WHXA 5EODA 4XRNA 3F9GA 2G55A 1UTQA 2VIVA 3F2GA 1AB9C 3NUMA 2BY5X 1AZ8A 2H9EH 2K8IA 2RFKC 1Y59T 3KGPA 4JMYA 1EASA 2QXIA 1DVAH 1AFQC 3DUXH 4X6PA 1B5GH 4UEHH 2OD3B 2F9BH 1ZZZA 3OSYA 3ZZDA 3E3TA 4A1TA 3RM0H 3K6YA 1CT0E 4KTUA 2O8TA 4ABDA 2FX4A 1RTFB 1DXWA 1QRZA 3BEIB 1XUGA 1GJBB 2ZA5A 4AYYB 2XTTB 2BDBA 1AVXA 3ZZ3A 1GJ8B 1GHXH 2HVYB 3OY6U 3P70B 1FN8A 3ZV9A 3ATLA 3VFEA 5F6MA 2AGEX 1OWIA 2A4QA 2BB4A 1UTMA 1J14A 5DG6A 1DX5M 1OKXA 1IQLA 2FOFA 1P2NA 1OPHB 1IQIA 1OP8A 1QRWA 5EJLA 1K2I1 3DSOA 1K1IA 2AMDA 3MTYA 3RXTA 1Z6JH 3TJVA 8KME2 3SHAH 3E16B 3RXJA 1A2CH 3QZRA 1TQ0B 1S5SA 4VGCC 1B0FA 3SORA 2VWNA 3TPIZ 3RMNH 3P6ZB 1RXPA 1SQAA 1C5MD 1U6QA 3EQ0H 4IGDA 1FY5A 2A2QH 2BDIA 2PGQB 1ELVA 3RXLA 2ZWLH 4MNYA 2ZPQA 4NZQA 1XUJA 3E0NB 1TX8A 3MQKC 1KXCA 3MNBA 2AH4X 3VPKA 1GJ5H 3O8DA 4ZXYH 1UHBA 3EDXB 4NA8A 4ABJA 1EZQA 1XUKA 5GDSH 1A5HA 5FCKA 2EI8A 3FP8E 3TH4H 4YOJA 5TCCA 3SI3H 4H4FA 2HVXA 1QGFA 1UHBB 3RMLH 1O2NA 3MU8A 4LK4A 3M3TA 6GCHF 4O03A 2BM2A 4KGAA 1AQ7A 2GDDA 2J98A 2FO9A 2FX6A 1P11E 1C5PA 1P06A 1WU1A 3OU0A 2UWPA 1HGTH 1BJVA 4BAMB 3RXRA 1DFPA 2J98B 3UNSA 2GT8A 1NRPH 3V13A 1HJ8A 3VXFH 3PO1B 1TB6H 4GSOA 4DIIH 1RJXB 1ZSJA 2FM2A 3P95A 1BHXB 1BTWA 4ACBA 1OWDA 1BTZA 1Y5BT 1O3MA 2OLGA 3MHWU 2V7QD 1CSOE 1MBMA 1YLCA 1ZRKA 2ZZUH 1V2LT 2UWLA 2CGAA 1G3BA 3A82A 3NK8A 3NRLA 4R8TB 3GY7A 4LZ1H 2G52A 2ZTZA 1SLWB 4OS7A 1AY6H 1V2VT 1ZTKA 1T8OA 1ELEE 1SQTA 1V2PT 1L0ZA 1JIRA 1DSTA 4CH8B 1EP5A 1A0HB 4UFEH 1CHOG 1ZYOA 5JBCS 1C5VA 2H5CA 1C5SA 1T8NA 3SQHE 1CA0C 5HYOA 4CRCA 2JKHA 3ZVGA 3FP7E 1BBRK 1VGCB 3L33A 4WH6A 2D1JA 2EQNA 1O2WA 2XNDD 1BMMH 3SJ9A 1BA8B 3MO3A 1J15A 2F9VA 2ZTYA 1LO6A 2W7SA 2R0LA 1SHYA 5EXLA 2UUYA 1ORFA 3V0XA 3TK6A 1G3EA 4KELA 3ESTA 1LQEA 4DJZB 1NBMD 2XRCA 4JZEH 1V2UT 1HFDA 2ZDKA 2VIWA 1IQFA 1EUFA 1O2YA 1MBQA 2TGPZ 2FOEA 1TNLA 2KCOA 1GHBG 1K22H 1AHTH 5FCRA 4TYDA 1AGJA 1MKWK 1GHVH 2FDAA 4AB9A 3SW2B 5JBAS 4YM9A 2ZQ1A 1P01A 3U1JB 5DGJA 6CHAB 3VB7A 3U8TH 1A7SA 2ZHFH 2OINA 3MI4A 1NFXA 1ANEA 1Q2WA 4FUGA 3SV7A 1HLTH 3CNRA 3FANA 2B5TB 1MKXH 4FUFA 3A7VA 1O3NA 1FPHH 1D6WA 1TA6A 4I86A 3UNRA 1QQUA 4Y8YA 4X1QU 2ZU1A 2D26C 1COWD 1O2KA 3QZQA 1W11U 2RCEA 5EXNA 2BY6X 1EZSC 4AB8A 4P02A 2GD4B 1W2KH 3N7EA 4I31A 4O9VA 5A09A 3P92A 4D9QA 2GZ8A 4DW2U 1XUFA 1SFQB 3BEUA 4INLA 2C8YB 1OWJA 1QFKH 2VB0A 3U69H 5LPRA 4ABEA 1MTNC 1A3BH 2B8OH 2P8OC 1AVGH 4X2YA 1O32A 4A5TS 2Z94A 3M35A 3LGYA 1D9IA 2W6JD 1XVOA 1K1PA 2FP7B 4IMQA 1TOMH 5EU8A 2ZHWH 5EQQA 2Y82A 3P8FA 1H8ED 1SR5C 3NKKA 1QB9A 3ZV8A 1UVUH 1C5ZB 4BTUB 4X1SU 5IYTA 3TLOA 3F0PA 2UUFB 4NWKA 4UFGH 1QB1A 2WPHS 1W7GH 4FXGH 2F83A 1VJAU 4FUEA 4WJG2 1T4VH 5C2ZA 1ZRBA 2GCHF 1FZZA 1GI5A 2K0QA 2ZDLA 1YWUA 1O2JA 3ATMA 1HAXB 2C8WB 2FESH 1CHGA 3VB4A 4F4OC 2ZFPH 2J92A 3UY9A 5A8YA 1LKBA 4ACAA 5A0CA 2B0FA 1GJ9B 1SGTA 1NY22 2J4IA 3I77A 2SFAA 3EE7A 2C93B 4UE7H 5E2PA 1O2PA 3SYJA 2BQWB 3Q00A 4A6LA 4ESTE 2BDCA 3TIUA 2Y80A 1TPSA 1EZUC 1O3FA 3OAAD 7LPRA 2TRMA 1FY4A 2ZC9H 1FAKH 1C2FA 1GMHG 1Y3XA 2G4UA 3CS7A 2ULLA 2Y6TA 2BD2A 1SLVB 3SV8A 2H9TH 2SGFE 1QBOA 3VXEH 1K28D 3SQEE 3TH3H 3L6PA 1PPCE 1DITH 1EAUA 3WW7A 1F0UA 3TNSA 1MABB 1RGQA 2FOBA 1ZGVA 2QYIA 4Z0KA 1TGBA 2XWBI 3BTFE 1GJAB 1CGHA 1V2QT 3NXPA 1GI0A 4TPIZ 3ZVDA 3KQBA 3PMHB 2TPIZ 2J2UA 1YBWA 4NZLA 1A0LA 4RN6A 2JJ2D 1A3EH 1WAYB 2ZCHP 1XXFA 4LZ4B 1RS0A 3RU4T 1DT2A 1QL9A 2TGDA 1O3PB 2B9LA 3GCTG 2SGAA 2PW8H 1A46H 3E6PH 1FLEE 4ZUHA 1O3BA 5L2ZH 1NFUA 1IQMA 1O3DA 1SLUB 4NSYA 5E0GA 1FIZA 4Y6DA 2A7CA 4XDEA 2C8ZB 5JYIA 1P05A 2PUQH 1E79D 1BDAA 1GCTB 1KLIH 2ZGCA 1Q31A 3A84A 5LPEA 1SGCA 2A0QB 1E35B 1HPGA 2BOKA 3SU1A 2C90B 2ZHEH 4ISNA 4ZMAH 1Z1IA 1C5OH 3KHVA 1GHZA 5GCHF 1GMDF 1PQ8A 2QE7D 2ZP0H 1DDJA 5JDUB 1ARCA 1D6RA 2P59A 3PM3A 5DKMA 4ZHLU 4FOUC 3K9XB 3PO1C 5C1UA 2L74A 1UTKA 3TGJE 4WF8A 5B6LA 3PB1E 2IN2A 3KL6A 8LPRA 1E34B 4WWYA 2ZFRH 3K65B 1S82A 4OS6A 4MNXA 1C5QA 2KCAA 1ANBA 2VIQA 1L4ZA 5FPTA 4MVNA 3SU4A 2ASUB 3A8CA 2ZU4A 1O34A 2FOCA 1UVOA 2VVUA 1DWCH 5J4QA 1ANCA 1FY1A 1MQ5A 1A5GH 3UTUH 1ETTH 1K1LA 3GY6A 4A1XA 1TGCA 2EA3A 2BXUH 3ZZ6A 2HNTC 4M9FA 4TY6A 3ZZ9A 1TALA 3A87A 1O2QA 5DP7A 3M5MA 4KTSA 2QAAA 2Q6GA 3EA9A 3D62A 1VGCC 1W0ZU 3ATKA 3GCHB 3MOCA 1BZXE 2Z9LA 2K1QA 1XKAC 3CS0A 4HFPB 2FLBH 3QO6A 1BTXA 4B76A 1MD7A 1VCQA 3OE7D 2YNBA 2Y5FA 3H5CB 4ISIH 6ESTA 1ZHPA 4Y11E 4O3TA 3A8AA 2SNWA 2FXRA 5EJ1A 3QX5H 3S0NA 4OS5A 2OBQA 2VIDA 4YTAA 2G5NA 2VINA 3KCGH 4OS2A 2HNTE 1ZMLA 1SGEE 1UJ1A 1FDPA 3SJOA 1BOQA 1CBWB 3QTVH 2F9NA 1QR3E 3V7TA 1Z8RA 1H9HE 4A7IB 3DA9B 1D3QB 4IC6A 1L2EA 6CHAC 2W7UA 1S83A 3BTHE 3LU9B 3RXHA 4P00A 1F7ZA 3S7KB 3RP2A 3T2NA 1F92A 4U01A 2ZU2A 5GNDA 2ZU5A 3MFJA 3IG6B 1BUIA 1F5LA 1JWTA 1FY3A 1H9LB 2FTMA 5K7RA 5EQSA 3UOUA 2GVFA 3SV6A 1SKYE 1VITH 2AIPA 3ZVAA 1UTLM 1IHSH 2IPQX 1D3PB 3E91A 1XVMA 2VWLA 1HDTH 1NU9A 2CJIA 1NO9H 3SHCH 4HI3A 4WMEA 5DN6D 3PLBA 1FNIA 4NG9H 5E8EH 1TIOA 4I7YH 3QUMP 3KQCA 4WY3A 1CA8B 2Q1JA 2AMQA 9ESTA 3O8CA 2QA9E 7KMEH 1C5RA 4TWWA 1TRNA 3MH7A 2ANYA 1WQSA 5FPYA 4MNWA 4CRAA 1LQDB 2PTCE 3ZYDA 1HJ9A 1O5FH 3PROA 2CK3D 3L3TA 4ASHA 1AMHA 1SLXB 3MH5A 1HRTH 1YPLH 2O8LA 1F0RA 2VIOA 1GBCA 2ZCLP 4WVPE 2BHGA 1SQOA 1O3AA 1K1JA 1TGNA 3ODDA 1SGPE 4DGJA 2PKSC 1KTTB 3PMJA 3T5FH 1BRUP 1C1QA 2SGDE 1KYNA 4Z1MD 1BRAA 3UIRA 1C1TA 2OCVB 3CP7A 1MZAA 4GVUA 3V3MA 1O3KA 1O2ZA 4ABIA 3HGPA 1KTSB 5F03A 2ZGXH 2JH0D 3JZ1B 1NZQH 1N1LA 4JYVH 5C5NA 4NA9H 4GCHF 3RXBA 4DG4A 1FONA 3TVJB 1Z8JB 1MCVA 5FXLA 1RFNA 1O3OA 4NIVA 4ZHAA 1NBME 5EOKA 1FX0B 5C3NA 3MU4A 2A32A 1SI5H 1ZTLA 5HIYA 5JB8S 4ISOA 2AERH 3MNCA 1LCYA 4AZ2B 1WXRA 2XCFA 1GBBA 1CHOF 1O2OA 3TGKE 3KQEA 1NROH 1GVZA 3VB6A 5EPYA 1P2JA 3WWFA 1V2OT 2RDEA 2BLWA 2P16A 2ESTE 3GDSA 4Y76A 4BTTB 3SJ8A 2VBCA 1HAHH 4NIXA 5G4BA 2A5AA 5KGOA 1G3CA 1KIGH 1TE0A 1YKTA 3DFJA 4Q80A 2KCPA 3SNAA 1ELTA 4X6MA 5HMAA 4XBBA 2XYAA 1NRQH 3QTOH 1OP2A 3SN8A 3A83A 2ZDVH 1NPMA 3C1KA 1O3HA 2M5TA 2V3MA 4K69A 2A4RA 3M3SA 4H42U 3SJKA 1T32A 3HKIB 3UPEA 1GHBF 2ZHDA 2LELA 4XD7D 2A5KA 2KFWA 1DS2E 2VVVA 5DO4H 3D23A 2Z6BD 3KEEA 2QXJA 4RT0A 2ZDMA 3F9HA 3LONA 1W14U 2HPQH 1P2QA 1P2MA 2XC0A 1GCTC 1K9OE 1XX9A 1WQVH 5ESBA 1NRSH 5CHAC 2XC5A 1BT7A 2V0BA 1DWBH 1BIOA 4MPWA 2Y81A 1O0DH 1L1NA 1TNHA 3ENSB 1GL0E 2UUJB 1C1OA 1QA7A 3SBKA 2H5DA 1FIWA 5IDKA 1ZSKA 2BLOA 2VU8E 1QIXB 1GHWH 2ZIQH 5C94A 5AFYH 3LOXA 5LGOA 3URCA 1V6DA 5DP6A 5F53A 1Y3WA 1F0SA 1X7AC 1EPTB 2W26A 1B7XB 3RC4A 2WSSD 1GHYH 5T6GA 1SGNE 2OXSA 4YXWD 2QF4A 4IBLH 3VEQB 1WV7H 4ABFA 4E06H 3A7XA 2GCTB 4FU8A 1J17T 1ESAA 1YM0A 3MNXA 1QY6A 3BTQE 1GL1A 1VJ9U 4JYUH 5EIYA 3LGTA 4MPXA 4RKJB 3U8RH 3UR6A 1O33A 3A8BA 1EKBB 1SSXA 1UK4A 2ODQA 3A81A 5EQRA 1WTHD 4Y7BA 2A7JA 2CXVA 1O3IA 1O2XA 2JDID 3SNDA 2Y5HA 1SGDE 7GCHG 2WV4A 3ITIA 4Y10E 1PQAA 1AN1E 1S6LA 3H09A 1XUHA 1P3CA 1A0JA 3STJA 1DLEA 2BDGA 1O2TA 2WUCA 4HTCH 1GBTA 1V2KT 3ODFA 1A1RA 5FBEA 1SC8U 2BD8A 3ZIAD 1L1GA 1DICA 3GCHC 2NWNA 1FUJA 1TRYA 3F0OA 3H7OA 2F3CE 2G8TA 3TGIE 1G9IE 3O8BA 4MNVA 3GOVB 3BIVH 3K2UA 1FY8E 1KLTA 1E37B 4J2YB 4X8UH 4I8GA 1NFWA 2R0KA 2TGAA 2V35A 1TA2A 1EJAA 4IS5A 4Q4LA 1LVBA 1IQJA 4I8HA 4U32A 4ISLA 4CRBA 3UNQA 1XMNB 4TPYA 3TNTA 1CBWC 1GMHF 3B8JA 5AFZH 4K8YA 1QTFA 2F9PA 3VGCB 4DOQA 1ZTJA 1BMNH 1SGYE 4B2CA 2AGIX 2IJD1 4UFDH 3FZZA 1ELAA 3GYMA 2ZPSA 5C0TA 2BLVA 1QL7A 1Y3UA 4K1TA 1AE8H 3QK1A 2RG3A 4B2AA 1AUJA 4H6SB 1LHFH 4F49A 4JZDH 1P9UA 1ABJH 1UK2A 5DP3A 2P3UB 3ZZ7A 1EAXA 2YNAA 1C5NH 5TCAA 2JJ1D 1QJ6B 2R2MB 1JOUB 1K1OA 3ZVEA 3A7WA 3QWCH 4UFFH 3RXIA 4SGBE 1KXAA 1TMBH 4B1TA 1C1RA 2J94A 1Y3YA 2FI4E 3U8OH 4TWYA 4JZ1A 1P9SA 3O8RA 5KEDA 4WH8A 1SOZA 2AGGX 3GCTF 3S9CA 1AU8A 4B71A 3MH6A 2H2ZA 1LMWB 3U9AH 4A1VA 1C5LH 2F43B 1CE5A 1MTVA 1YGCH 1D3DB 3KNXA 3UR9A 1YP9A 1P3EA 1O5DH 2BYAX 1PPFE 2ANMH 1DOJA 1G2LA 2BXTH 2NU0E 1TX7A 1O5AB 1JRTA 1LTOA 1BTYA 2BDYA 4MPUA 3A7TA 3F9FA 4FUCA 1HAZB 4MG3A 1SGFA 2EEKA 4CHAB 4YT6H 3R3GB 3VB3A 1YYY1 2EI7A 2GGVB 1BRCE 3MU5A 1EFRD 1JXPA 1NTPA 1GI9B 5AHGH 2XBWA 1XUIA 2F9OA 1G3DA 1YPKH 1AWFH 4GHTA 2ANWA 2QC2A 3N99A 2OQUA 2Z3EA 1WUNH 1YCPM 3SZEA 7ESTE 1THPB 3OEHD 3FZDA 4BXSA 4A92A 1GVKB 5AF9H 1VITG 4E05H 1V2RT 4X1PU 1GBAA 1PPEE 4INKA 2WPIS 1TRMA 4MTBA 4K2YA 2R3YA 1OYTH 3MYWA 2BZ6H 2JIZD 3BG4B 4NSVA 3BSQA 3P17H 3A86A 4CREA 1LVMA 2NU3E 4X2WA 1GBMA 4GHQA 2UUKB 1GGDB 2C3SA 3RXVA 2ZQ2A 3PRDA 3KYFA 2JETB 1E38B 1UK3A 2P94A 1O5EH 1C4V2 3FFGA 4FU9A 2GT7A 2VJ1A 2G51A 1ACBE 4ZROA 4IMZA 1P04A 1H4WA 3SJIA 1YPGH 1KDQB 2FS8A 5C5OA 2AHME 3M5LA 1ESTA 3AVZA 3T26A 3TITA 3W95A 1UCYE 2BD9A 2FI3E 3UWJH 2HLDD 2C8XB 3WY8A 1TPAE 2XBYA 4MPVA 2VGCB 3PRBA 1QZ8A 1DE7H 4K3JA 2A1DB 5F8ZA 5FHTA 5A8ZA 2OBOA 1YPEH 3ZZBA 3SUFA 1KXDA 2KM0A 3TJNA 3IITA 1ZMJA 1H9IE 1RTKA 4YLQH 1LDTT 4FVDA 5LH8A 1OOKB 1SFIA 1GG6B 1FPCH 1C1UH 3PWCA 6GCHG 1JBUH 4DY7B 2BDAA 2WPDD 2OK5A 2BTCE 2ODPA 1QBNA 2J9NA 1C9PA 1V3XA 3LGIA 1MU8B 2D2DA 4ZKRU 1O2HA 4FVBA 1UTOA 3RXUA 3LGUA 5J4SA 4GAWA 1O39A 3S9AA 4X1NU 1GWAA 2ZGBH 2GDEH 2BY7X 1AZZA 4X8TH 1LPZB 3RXOA 5I25A 4MDSA 1GVLA 1L4DA 1ZPCA 3FKSD 3MU0A 1YPHC 2W3IA 2WPKS 3KQ5A 1YCPK 2I6QA 2ZGJA 3F9EA 1J8AA 1TYNA 2EI6A 5ABWA 2PKAA 1T4UH 2VWOA 2SNVA 2EC9H 2ZGHA 2UWOA 4B74A 1K0HA 2AYWA 1O2VA 1EAWA 2PKAB 4FUJA 1DY9A 1C2DA 2LNCA 2GCTC 5CMXH 2FWWA 4HG6A 1C5WB 3BTTE 1UW7A 1NC6A 3T62A 4RI0A 1O5BB 1HAGE 4FUHA 4BANB 2AMPA 3K6ZA 1GBEA 1YF4A 3BTWE 3AK5A 1TBZH 1AVWA 1QHRB 4BXWA 1IHTH 5C1XA 3LJJA 1VCWA 1QRXA 1QJ7B 3HK6B 4NGAH 1LHDH 1NESE 4FUDA 1SMFE 1SOTA 4Q7ZA 1O3LA 2ODYB 1FMGA 4U30A 1P09A 2FOGA 2HLCA 1UTNA 4CR9A 1BBRH 4DT4A 3LDXH 4GLYA 3RXFA 5C20A 1A61H 2RA0A 5EG4A 1T8MA 4YO9A 3LH3A 3BTDE 4NWLA 2O8WA 2PUXB 1Y3VA 2P3FH 3M7QA 1TFXA 2KAIB 1Z8GA 1J9CH 2WV9A 4X1RU 4X8SH 2ZU3A 1H8DH 2BX3A 6LPRA 1C5TA 1HUTH 1H8IH 1ANDA 3MH4A 2J97A 5E2OA 4Z6AH 4Y8XA 3MWIU 1FAXA 3UFAA 4Y79A 3BEFB 2YMSD 2O8MA 4X8VH 2LP6A 1BMFD 2WPLS 1RTLA 4AG1A 1MKWH 1TMTH 5HGGA 1PPHE 1MUEB 3M36A 1S81A 5IK2D 3GDUA 2FODA 5JBTA 5PTPA 1P02A 1XXDA 1HAVA 1GDNA 4XBDA 4I8JA 1SVPA 2CF9H 3KQDA 3DCLA 5TJXA 4ABGA 1ZJDA 4Y0ZE 1TONA 2STBE 2PWXA 1HAVB 2QF0A 3GDVA 4F48B 1CT2E 1LKAA 2QF3A 3LH1A 2QY0B 4IW4E 3RXAA 3RC5A 1C2EA 4K8BA 4QT8C 4I8LA 1P2OA 3B23B 5FPSA 1MU6B 1G32B 1ZMNA 5HM2A 1QURH 1T8LA 3ZYEA 1HAYB 1NRNH 1OS8A 1IQNA 3DT0H 4K1EA 4IC5A 1O36A 4GUXA 3A80A 4X2XA 4ZAEA 3U98H 1M9UA 3BV9B 4AGJA 3SV9A 2SGQE 2ZTXA 1TGTA 3SU3A 2A4GA 3ZZAA 3Q76A 2QXHA 2RA3A 2ZDAH 1TMUH 4O3UA 1RIWB 1AIXH 1HJAB 1PFXC 5F8TA 2GCHG 2BD7A 2P3TB 1ELDE 1EAIA 8ESTE 1HAPH 4CHAC 2ALPA 1C2MA 1BBRE 3SUGA 3Q3KA 3RDZA 1Z8IB 2YMSB 1GI8B 3EGKH 4OM9A 1MH0A 2SGEE 2FZZA 1BB0B 1QQ4A 4ISHH 4WXVA 4AN7A 4UDWH 4WMFA 1Y5UT 5L30H 1A4WH 4TY7A 1QL8A 1F2SE 5JPMH 1EP6A 3W1EA 1C2LA 1THSH 1O2UA 3Q3YA 4CR5A 1SGQE 3BIUH 2NU1E 1TPPA 1O2SA 1GBJA 2JH5D 1EATA 9LPRA 2A2XH 7GCHF 1O2RA 3NZIA 4K60A 1GGDC 4ZH8A 2DE8A 3FN8A 2WINI 2JETC 2ZI2H 1W12U 1ZR0A 3M37A 3SOSA 1E1RD 2ZKSA 1C4Y2 3A8DA 1JRSA 1GJDB 5EJZA 5ETXA 2HWLB 3T25A 3PTNA 1N6XA 2OTVA 4JK6A 1CO7E 2GKVE 1CU1A 2WPMS 1WYKA 3P8GA 2FLRH 4ASUD 2PFEA 1E36B 3GY2A 3C27B 1KXEA 1AKSB 2AEIH 4GPGA 4B73A 2VGCC 1GBHA 1O3EA 2CHAB 1BTHH 3PV4A 3UREA 4YT7H 4X0WU 1N6YA 1TGSZ 1TAWA 3ZVBA 2A31A 1GJ4H 3UQOA 3F2FA 1DWDH 1O38A 1MMJN 1IOEA 1TBRH 1O2IA 4ZKNU 1SHHB 3QGJA 5EPNA 4D8NA 1DSUA 1S0RA 5HIZA 1CVWH 2FYRA 1SG8B 4ABBA 5FX5A 5GJ4B 2GV7A 2GMTB 4BAOB 5L6NH 3E8LA 1DUEA 2HRVA 1RRKA 1BITA 2ZFQH 1DXPA 1ELBA 2XXLA 1HNEE 3U1IB 1O2MA 3BF6H 2P8OB 1PPGE 5DP4A 3SZNA 2Z9JA 1J16A 4CH2B 1Z6EA 5GXPA 1C1SA 1A5IA 1EZXC 3A7YA 3DFLA 3TK9A 8GCHG 2ZECA 4YESB 1SGIB 4H6TA 2VVCA 1MZDA 3OTPA 3LC5A 2BVSH 4KKDA 1S6HA 1GJ7B 1MCTA 5DP9A 2QIQA 3SU5A 1GMCG 3RXSA 2FEQH 2FTLE 1QJ1B 1OWHA 2V6NA 2ZPRA 4LXBH 3PMAB 1MKXK 3DD2H 1Z71A 4ZCNA 1Z7KA 1ELGA 1ELFA 1OSSA 4JYTA 2BD5A 3A85A 4AFSA 1FJSA 1HV7A 1V2JT 1NT1A 1P57B 2KR7A 1DANH 4UONA 1TLDA 1EXFA 2I6SA 2D8WA 2BD4A 1TPOA 1H8HD 4AYVB 1C1NA 1OP0A 3GY8A 1UTJA 2WYGA 4I32A 5FAHA 2PV9B 3TK5A 3UUZA 2STAE 2J5UA 2PGBB 1EPTA 5A0AE 1BJUA 2KX4A 3PMBB 5C67A 4RKOB 3Q3XA 1S6FA 1PPBH 1EJMA 4BAHB 1E0FD 3T29A 2XBVA 2W3KA 1VITF 1GI4A 1MQ6A 3EYDA 1GJCB 2H9HA 3GCNA 1Y8TA 4Q7YA 2XC4A 1SBWA 5KECA 4KTCA 3HATH 2FOMB 1O35A 5GWZA 4NIYA 2BY9X 1TABE 3SU2A 1KSNA 3T28A 1GCDA 4M7GA 2ZG0H 3AW1A 3BN9A 1Z1JA 2C4FH 2FOHA 1VCPA 3E90B 2CF8H 2BOHB 3SI4H 1O5GH 3S7HB 4Y0YE
chains in the Genus database with same CATH topology
3H7TA 4XE4A 3PTBA 4AOQA 1OYQA 1O30A 2OC8A 1THRH 4B2BA 4ABAA 1DWEH 2VNTA 1SB1H 4PROA 3QLPH 5T3HA 1PQ7A 4CBNA 4JCNA 3P8NA 4K1SA 4K5ZA 5JBBS 2VH0A 2QXGA 4YOIA 2PSXA 1ETSH 1BTUA 3GY3A 2HPPH 1EB1H 4IN2A 1W7XH 3UOPA 3ZZ4A 2HOBA 1LVOA 4MQAA 1NS3A 4ABHA 3LGVA 1OXGA 5HM9A 1GHAG 5DP5A 1F5RA 3TH2H 2WV5A 3RXDA 2TBSA 1RIWC 2J95A 4JZFH 1HJAC 1ZPZA 2TIOA 4NCYA 4NA7A 1FN6A 2A4OA 1IAUA 4ZXXH 2GP9B 4E7NA 4BAQB 1WCZA 3GICB 3TJOA 3ATIA 5L2YH 1SGFG 2H1UA 2ZCKP 1G36A 2H6MA 4GCHG 1AI8H 5CE1A 1YC0A 1N8OB 4CRGA 3PLKA 1EB2A 2BDHA 1UCYH 4OGYA 4XBCA 4D7GA 2JH6D 1C9TA 3KF2A 5LPFA 1O5CB 4IN1A 3I78A 1ZGIA 1SL3A 5DPAA 1V2WT 1ID5H 4AFZA 1BMLA 1TBQH 3LGWA 2ALVA 4KP0A 4LOYH 4SGAE 3UQVA 3M7TA 3MO6A 3SUDA 3FAOA 3A89A 2Q6FA 2XNIA 1PYTD 3BTEE 3RU4D 1L1JA 3BTKE 1PPZA 3Q77A 1MD8A 2R2WU 1BTPA 1LHEH 1MTSA 3S69A 3TJUA 3A7ZA 3M3VA 1Y5AT 1TQ7B 1V2NT 4XSKU 1ZHRA 1T31A 1SPJA 4ZHMU 1S85A 1G37A 2ZDNA 1MTUA 4CBOA 2ZFTA 3SO3A 4CRDA 2PSYA 3GY5A 1GI6A 3JZ2B 2BMGB 1TOCB 2ZFFH 4I8KA 4HGCA 4NFFA 1CGJE 4JZIA 1W3CA 2CHAC 1NRRH 1UVTH 2IOTA 1C4U2 1HBTH 3P8OA 4U2WA 2GZ7A 1QB6A 1VZQH 4INHA 3TU7H 1C2HA 3ZZCA 4D76A 3BG8A 2OP9A 4AGKA 1AWHB 4D9RA 1GBDA 5F8XA 1GDQA 3SUEA 2VIPA 4Y71A 3QDZB 4OS4A 3FVFB 5T6DA 3GYLB 1IQEA 2FS9A 5DK1A 3URDA 4UD9H 4DIHH 1O31A 3LC3A 3AW0A 1IQHA 3ZVCA 2P93A 2GMTC 2FYQA 1SGRE 1KDQA 1FXYA 1YLDA 5DP8A 1MAXA 1C5UA 1GJ6A 1NU7B 4X6OA 4BNRA 4YZUA 2G00A 2J34A 4XOJA 3RXGA 2IJOB 5SGAE 3EA8A 1C1VH 1MAYA 2XWAA 1TNGA 4D7FA 2VWMA 4DCDA 3F1SB 1O3CA 1JMOH 2G5VA 3PLPA 3GCOA 2G4TA 4AORA 3LT3A 2Y5GA 2Z7FE 2FI5E 4Y8ZA 3SNBA 2PKSB 4OS1A 3MMGA 1ZHMA 1AUTC 3AAUA 1UO6A 1HAOH 1GPZA 1T7CA 2PHBA 1QNJA 2IPHA 3AAVA 3R0FA 2J38A 1DM4B 5DJ7A 3UWIA 4I33A 3OY5U 3RUOA 1NFYA 3BTGE 2VH6A 2HGTH 2R9PA 1HXEH 1HCGA 5A0BA 1Q3XA 1LHCH 1G30B 1HB0B 3MO9A 4WMDA 5EW2H 5H4IB 2ZNKH 1ETRH 2CV3A 2F91A 3N7OA 5I46H 1NM6A 1F5KU 3G01A 1EPTC 4NFEA 5A2MH 3NWUA 1WTGH 4YLUA 2WYJA 1IQKA 5AVDA 3PWBA 1TNKA 1GI2A 2PLXA 2XW9A 1QCPA 4OGXA 4X2VA 3STIA 1AB9B 2ILNA 3OX7U 3OTJE 1YPHE 3ZZ5A 1AFQB 2AS9A 2BD3A 2CMYA 4O97A 4AFQA 1BMAA 4BTIB 1V2TT 1GI1A 2G81E 4BAKB 2P95A 1LVYA 3RXEA 3RXCA 4DT7B 1DPOA 1C1WH 3M61U 3ELAH 1FQ3A 1P2KA 3V12A 1O3JA 1V2MT 5HXFA 1FV9A 1O2LA 1C1MA 2FPZA 2KAIA 1UVPA 3D65E 4R0IA 4X6NA 3RMMH 3QGNB 3SGAE 3F6UH 1P8VC 1RD3B 5GIBA 2ZEBA 1C5XB 3A88A 1ELCA 5CHAB 2BVXH 3FP6E 3HGNA 3BTME 5BRRE 1C5YB 3S9BA 2OC0A 2PTNA 2V3HH 1DY8A 3W94A 1O3GA 1AE5A 5ESTE 1ZOMA 2A5IA 4Q2KA 2NU4E 1QBVH 3VGCC 3RC6A 3IWMA 2QCYA 4DVAU 2WUBA 1O2GH 4VGCB 4CRFA 3RMOH 2Z3CA 4ZKOU 1ZLRA 5EXMA 1WOFA 1BRBE 3ZVFA 1ZPBA 2F9UA 1MTWA 3RXQA 2BX4A 3GISB 3SGBE 1N8OC 3RM2H 2A45B 1C2GA 1KXFA 1LPKB 2Z9IA 1K21H 1O37A 4ZKSU 1D4PB 8GCHF 2OC7A 4J1YA 1W8BH 1P2IA 1GBFA 1EOLA 3F68H 3ZZ8A 4AFUA 1W13U 3RXMA 5K0HA 5E0HA 1GMCF 1LHGH 4BOHA 3SU0A 4AG2A 2BQ6B 5EW1H 3HKJB 1KXBA 1TWXB 3ATWA 1XKBC 1CQQA 1P0SH 2NU2E 3SNCA 3M7UA 3NPSA 3MNSA 1C2KA 2HALA 1HAIH 2XCNA 1PJPA 2QV1A 1S84A 1V2ST 3RLWH 2YOLA 1QA0A 3KN2A 2V3OH 4JK5A 1VR1H 2FOAA 3NCLA 2FIRH 2W5EA 1EOJA 3SV2H 1ZJKA 2LPRA 5E0JA 3I29A 1BHXF 4NIWA 2GTBA 1W10U 2Z3DA 2OC1A 4DURA 3GY4A 2O9QA 2O8UA 1ESBA 2QN5T 1YPMH 1OWEA 1B0EA 5T6FA 2B7DH 1P03A 1HYLA 1CA0B 2RDLA 3HK3B 1GDUA 1OWKA 1TNJA 2CN0H 2AIQA 4HZHA 1D3TB 1CGIE 1HIAA 5FX6A 5A8XA 1HXFH 1TX6A 3BG4C 1UVSH 3VB5A 2HNTF 3LJOA 5C1YA 2TGTA 4YOGA 1PQ5A 4RSPA 3M5OA 4Y7AA 3AASA 1HIAB 3E0PB 3LIWA 2QGRA 3OYPA 5GPIB 1C1PA 2DUCA 3DHKH 5EGMA 3PYHA 2Y7XA 2A7HA 3T27A 1XM1A 1K1MA 4Q7XA 4FU7A 1EQ9A 1W0YH 1ABIH 1AKSA 1INCA 1YCPH 2ANKH 3HPTB 1PYTC 1UTPA 1GBIA 2GV6A 1GI7B 2Y7ZA 1YPJH 1G2MA 3EAJA 3EA7A 1AD8H 4E7RG 1NN6A 3KIDU 2GX4A 1P12E 5B6OA 2Q6DA 2R3UA 1ARBA 1EJNA 1JIMA 1AO5A 1EX3A 1GHAF 2OUAA 2PR3A 1GG6C 2ZHQH 2FMJA 4AX9H 3LKWA 5GCHG 1FI8A 2BVRH 1IQGA 1CT4E 1GMDG 3RU4E 4FUIA 1UCYK 2ZFSA 3EE0B 2ZO3H 5BPEA 3D49H 2OQ5A 1P10A 1BCUH 2DE9A 1C2JA 1OX1A 3SNEA 3E1XB 3SGQE 1ZSLA 1BQYA 3RXPA 1K1NA 2BZAA 1WBGB 2Z9GA 1GBLA 5FBIA 2BLQA 2WPJS 1KLJH 1MTNB 1F0TA 1WSSH 1C2IA 1UMAH 2GZ9A 2AFQB 3RXKA 2BQ7B 1DLKB 1TNIA 3QN7A 2Z9KA 3LPRA 3M5NA 4MLFB 5JB9S 3SU6A 3B9FH 1GI3A 1H1BA 2XBXA 1GBKA 4XFQA 1DUAA 1KY9A 2BY8X 4WXIA 4B75A 1LPGB 2THFB 3CENA 3RLYH 4FUBA 4THNH 1AFEH 1S0QA 2ZF0H 2SGPE 3MU1A 5EODA 3F9GA 2G55A 1UTQA 2VIVA 1AB9C 3NUMA 2BY5X 1AZ8A 2H9EH 1Y59T 3KGPA 4JMYA 1EASA 2QXIA 1DVAH 1AFQC 3DUXH 4X6PA 1B5GH 4UEHH 2OD3B 2F9BH 1ZZZA 3OSYA 3ZZDA 3E3TA 4A1TA 3RM0H 3K6YA 1CT0E 4KTUA 2O8TA 4ABDA 2FX4A 1RTFB 1DXWA 1QRZA 3BEIB 1XUGA 1GJBB 2ZA5A 4AYYB 2XTTB 2BDBA 1AVXA 3ZZ3A 1GJ8B 1GHXH 3OY6U 3P70B 1FN8A 3ZV9A 3ATLA 3VFEA 5F6MA 2AGEX 1OWIA 2A4QA 2BB4A 1UTMA 1J14A 5DG6A 1DX5M 1OKXA 1IQLA 2FOFA 1P2NA 1OPHB 1IQIA 1OP8A 1QRWA 1K2I1 1K1IA 2AMDA 3MTYA 3RXTA 1Z6JH 3TJVA 8KME2 3SHAH 3E16B 3RXJA 1A2CH 3QZRA 1TQ0B 1S5SA 4VGCC 1B0FA 3SORA 2VWNA 3TPIZ 3RMNH 3P6ZB 1RXPA 1SQAA 1C5MD 1U6QA 3EQ0H 4IGDA 1FY5A 2A2QH 2BDIA 2PGQB 1ELVA 3RXLA 2ZWLH 4MNYA 2ZPQA 4NZQA 1XUJA 3E0NB 1TX8A 1KXCA 3MNBA 2AH4X 3VPKA 1GJ5H 3O8DA 4ZXYH 1UHBA 3EDXB 4NA8A 4ABJA 1EZQA 1XUKA 5GDSH 1A5HA 5FCKA 2EI8A 3FP8E 3TH4H 4YOJA 5TCCA 3SI3H 4H4FA 2HVXA 1QGFA 1UHBB 3RMLH 1O2NA 3MU8A 4LK4A 3M3TA 6GCHF 4O03A 2BM2A 4KGAA 1AQ7A 2GDDA 2FO9A 2FX6A 1P11E 1C5PA 1P06A 1WU1A 3OU0A 2UWPA 1HGTH 1BJVA 4BAMB 3RXRA 1DFPA 3UNSA 2GT8A 1NRPH 3V13A 1HJ8A 3VXFH 3PO1B 1TB6H 4GSOA 4DIIH 1RJXB 1ZSJA 2FM2A 3P95A 1BHXB 1BTWA 1OWDA 1BTZA 1Y5BT 1O3MA 2OLGA 3MHWU 1CSOE 1MBMA 1YLCA 1ZRKA 2ZZUH 1V2LT 2UWLA 2CGAA 1G3BA 3A82A 3NK8A 4R8TB 4LZ1H 3GY7A 2G52A 2ZTZA 1SLWB 4OS7A 1AY6H 1V2VT 1ZTKA 1T8OA 1ELEE 1SQTA 1V2PT 1L0ZA 1JIRA 1DSTA 4CH8B 1EP5A 1A0HB 4UFEH 1CHOG 1ZYOA 5JBCS 1C5VA 2H5CA 1C5SA 1T8NA 3SQHE 1CA0C 5HYOA 4CRCA 2JKHA 3ZVGA 3FP7E 1BBRK 1VGCB 3L33A 4WH6A 2D1JA 1O2WA 1BMMH 3SJ9A 1BA8B 3MO3A 1J15A 2F9VA 2ZTYA 1LO6A 2W7SA 2R0LA 1SHYA 5EXLA 2UUYA 1ORFA 3V0XA 3TK6A 1G3EA 4KELA 3ESTA 1LQEA 4DJZB 2XRCA 4JZEH 1V2UT 1HFDA 2ZDKA 2VIWA 1IQFA 1EUFA 1O2YA 1MBQA 2TGPZ 2FOEA 1TNLA 1GHBG 1K22H 1AHTH 5FCRA 4TYDA 1AGJA 1MKWK 1GHVH 2FDAA 4AB9A 3SW2B 5JBAS 4YM9A 2ZQ1A 1P01A 3U1JB 5DGJA 6CHAB 3VB7A 3U8TH 1A7SA 2ZHFH 2OINA 3MI4A 1NFXA 1ANEA 1Q2WA 4FUGA 3SV7A 1HLTH 3FANA 2B5TB 1MKXH 4FUFA 3A7VA 1O3NA 1FPHH 1D6WA 1TA6A 3UNRA 1QQUA 4Y8YA 4X1QU 2ZU1A 2D26C 1O2KA 3QZQA 1W11U 2RCEA 5EXNA 2BY6X 1EZSC 4AB8A 2GD4B 1W2KH 4I31A 4O9VA 5A09A 3P92A 4D9QA 2GZ8A 4DW2U 1XUFA 1SFQB 3BEUA 4INLA 2C8YB 1OWJA 1QFKH 2VB0A 3U69H 5LPRA 4ABEA 1MTNC 1A3BH 2B8OH 2P8OC 1AVGH 4X2YA 1O32A 4A5TS 2Z94A 3M35A 3LGYA 1D9IA 1XVOA 1K1PA 2FP7B 4IMQA 1TOMH 5EU8A 2ZHWH 5EQQA 2Y82A 3P8FA 1SR5C 3ZV8A 3NKKA 1QB9A 1UVUH 1C5ZB 4BTUB 4X1SU 5IYTA 3TLOA 2UUFB 4NWKA 4UFGH 1QB1A 2WPHS 1W7GH 4FXGH 2F83A 1VJAU 4FUEA 4WJG2 1T4VH 5C2ZA 1ZRBA 2GCHF 1FZZA 1GI5A 2ZDLA 1O2JA 3ATMA 1HAXB 2C8WB 2FESH 1CHGA 3VB4A 4F4OC 2ZFPH 2J92A 3UY9A 5A8YA 1LKBA 5A0CA 2B0FA 1GJ9B 1SGTA 1NY22 2J4IA 3I77A 2SFAA 2C93B 4UE7H 5E2PA 1O2PA 2BQWB 3Q00A 4A6LA 4ESTE 2BDCA 3TIUA 2Y80A 1TPSA 1EZUC 1O3FA 7LPRA 2TRMA 1FY4A 2ZC9H 1FAKH 1C2FA 1GMHG 1Y3XA 2G4UA 3CS7A 2ULLA 2Y6TA 2BD2A 1SLVB 3SV8A 2H9TH 2SGFE 1QBOA 3VXEH 1K28D 3SQEE 3TH3H 3L6PA 1PPCE 1DITH 1EAUA 1F0UA 3TNSA 1RGQA 2FOBA 1ZGVA 2QYIA 4Z0KA 1TGBA 2XWBI 3BTFE 1GJAB 1CGHA 1V2QT 3NXPA 1GI0A 4TPIZ 3ZVDA 3KQBA 3PMHB 2TPIZ 2J2UA 1YBWA 4NZLA 1A0LA 4RN6A 1A3EH 1WAYB 2ZCHP 1XXFA 4LZ4B 1RS0A 3RU4T 1DT2A 1QL9A 2TGDA 1O3PB 2B9LA 3GCTG 2SGAA 2PW8H 1A46H 3E6PH 1FLEE 4ZUHA 1O3BA 5L2ZH 1NFUA 1IQMA 1O3DA 1SLUB 4NSYA 5E0GA 1FIZA 4Y6DA 2A7CA 4XDEA 2C8ZB 5JYIA 1P05A 2PUQH 1BDAA 1GCTB 1KLIH 2ZGCA 1Q31A 3A84A 5LPEA 1SGCA 2A0QB 1E35B 1HPGA 2BOKA 3SU1A 2C90B 2ZHEH 4ISNA 4ZMAH 1Z1IA 1C5OH 3KHVA 1GHZA 5GCHF 1GMDF 1PQ8A 2ZP0H 1DDJA 5JDUB 1ARCA 1D6RA 2P59A 3PM3A 5DKMA 4ZHLU 3K9XB 3PO1C 5C1UA 1UTKA 3TGJE 4WF8A 3PB1E 2IN2A 3KL6A 8LPRA 1E34B 4WWYA 2ZFRH 3K65B 1S82A 4OS6A 4MNXA 1C5QA 1ANBA 2VIQA 1L4ZA 5FPTA 4MVNA 3SU4A 2ASUB 3A8CA 2ZU4A 1O34A 2FOCA 1UVOA 2VVUA 1DWCH 5J4QA 1ANCA 1FY1A 1MQ5A 1A5GH 3UTUH 1ETTH 1K1LA 3GY6A 4A1XA