4ZKOU

The crystal structure of upain-1-w3a in complex with upa at ph7.4
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of mupain-1-IG in complex with murinised human uPA at pH7.4
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Urokinase-type plasminogen activator
total genus 59
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2015-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4zkoU02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4zkoU01
4B71A 1JRSA 1F0TA 2FM2A 2ZP0H 3E91A 3K2UA 4CRGA 1ETSH 4MNVA 4Q7ZA 2ZIQH 1EATA 1ESTA 1OX1A 3M7TA 2V0BA 1DSUA 4CREA 3SQHE 2YNBA 2AGIX 1BA8B 2FWWA 5EW2H 2P3UB 2H5CA 1O2VA 2XBXA 1PQAA 4XSKU 1GHZA 3VFEA 4XOJA 1YGCH 1O3DA 1XUKA 2SNVA 1ZSKA 2G5VA 1YKTA 3UNQA 1GI3A 1KY9A 1P3CA 1J16A 2EEKA 2OBOA 3V13A 4NFFA 1RJXB 3TK9A 1HAZB 3EAJA 2R3UA 1LVYA 1A0LA 2C93B 1GBBA 2D2DA 3RXVA 1V2UT 1W7GH 3P70B 1V2WT 1XMNB 1AKSB 1V2PT 1O2IA 3VPKA 1NFWA 3PLKA 4ABGA 3PO1B 3OY5U 1K1LA 3P17H 1DITH 1QL9A 3UOPA 1FIZA 2PSXA 3NKKA 3GYMA 1GI8B 4GHQA 3A81A 4ESTE 2ZQ2A 1H9IE 5A0AE 2GCHF 3AAVA 1C5NH 4FUFA 1Y3UA 8ESTE 1TA2A 3T5FH 1GL0E 3BTDE 2J38A 3H7OA 1YBWA 1MAXA 2ODYB 1GI2A 2HLCA 4INLA 2QF3A 4JZEH 1B7XB 1P04A 2SGPE 1ELBA 3STIA 2VGCC 1YPHC 2OC7A 1O2PA 1TBRH 1WTHD 5FBEA 3DT0H 1IAUA 4AYVB 3PMAB 2H9EH 1A46H 2ZTXA 5EXMA 5DO4H 3UY9A 1GGDB 1O2UA 1IQIA 3KEEA 1O3IA 1KTTB 1SSXA 4D9QA 2VIDA 1THSH 1HJAC 1CHOG 1ARCA 1C1RA 1CVWH 1D3TB 1UJ1A 3RP2A 3SHCH 4Z6AH 3SU1A 1L1NA 1O33A 3A83A 1INCA 1KYNA 1NESE 2BLWA 2UUJB 1A3EH 1K1NA 1T31A 1MBQA 1UVUH 2O9QA 2FOMB 2A5AA 1C2IA 1HXEH 1KLIH 4NWLA 1N8OC 3GDVA 1HLTH 3ATKA 1SG8B 3RXLA 1ELGA 8KME2 1LTOA 2BD4A 3R3GB 3QN7A 2JKHA 5FX6A 2QA9E 3T26A 5HGGA 1ZJDA 2FS9A 5T6DA 5TCAA 1TOCB 1ELDE 1Q31A 4BOHA 1GBIA 4MVNA 1FAKH 3TIUA 1TX8A 2HWLB 1GJ5H 3ZYEA 1EAUA 3BEUA 2CXVA 2M5TA 1JWTA 1G3CA 1O0DH 2PGBB 2AIQA 4BTTB 1ZLRA 3RUOA 3SZNA 4X6OA 1Q2WA 1FY4A 1AB9B 3AVZA 2PUQH 2AFQB 1P2OA 2R2MB 3TJOA 2VIVA 2SGDE 3RXHA 1G2LA 3BTME 2ZCKP 4Y6DA 1DE7H 1RTKA 3MH5A 1LQEA 4U2WA 3ELAH 3DFLA 3T27A 1G36A 5A2MH 2Z3CA 5JYIA 1SR5C 3A7ZA 2ZFQH 4ZKSU 3ZYDA 4AN7A 1A0JA 4OS1A 2FS8A 3MYWA 2GZ9A 2Z3EA 4XFQA 3S9BA 4TPYA 3UR9A 3T2NA 1BHXB 1QCPA 1C5ZB 2BVSH 1QL7A 4ISOA 5FXLA 3GCOA 5DKMA 1V2MT 1O2ZA 3FP7E 1O3OA 1LQDB 3SU4A 1ANBA 1B0FA 4DOQA 3O8CA 4I32A 1KXCA 3VXEH 3MO9A 2ZCLP 2PKAA 3RU4D 1GBMA 3SV2H 2BD2A 2GT8A 2PFEA 5EW1H 3ZZAA 3NUMA 2WUCA 3DHKH 5JB8S 3BG4C 2UWLA 3MU5A 2V3HH 2Z9JA 4MPUA 1ABJH 2ZA5A 1FJSA 2GDDA 2A4QA 1CA0C 3KHVA 5T3HA 3QGJA 3K6ZA 1PPGE 1FPCH 1GDQA 2DUCA 2ZPSA 1G32B 5ESTE 2FESH 1KSNA 3Q3KA 5PTPA 1O3BA 1QBOA 3F9HA 4XE4A 1GHBG 1LHCH 3P8OA 4GSOA 1GHBF 1TWXB 5DGJA 3RMLH 4K8BA 2FLBH 1QL8A 1BMLA 3UQVA 1ANEA 3E16B 4GHTA 5J4QA 4GCHG 1F2SE 2Y5HA 3F1SB 1HAXB 3BTEE 4KTSA 1TMBH 1QBVH 3U8TH 1JMOH 2HGTH 1N1LA 2O8TA 1HIAA 1DY8A 2Z9KA 1TIOA 3QZRA 2BY9X 3RDZA 3T25A 1CGHA 1SMFE 2CHAB 2Z7FE 1UVOA 1ZPCA 2CF9H 1V2OT 2EA3A 5FCKA 3RC6A 1SHYA 1DUAA 1DOJA 2VVVA 2Y82A 1VCPA 1GBKA 3JZ1B 4MPXA 1W0ZU 1AMHA 3RU4E 1TPOA 4GAWA 1YCPK 5FPSA 4CHAB 2UWPA 1P05A 3NWUA 3ZVGA 1P03A 1Y8TA 1MKWH 3TK5A 1QGFA 2DE8A 1TGNA 1LVBA 1O39A 1XX9A 4F49A 1TAWA 1HAVA 3RXIA 1O2HA 5JBBS 4DVAU 1EPTB 4IGDA 1RFNA 1MQ5A 2F9PA 1BTHH 1WCZA 3VEQB 2A4OA 3BEIB 1ZTLA 1W3CA 2ILNA 2PW8H 2ZF0H 1TGBA 4Y7AA 3U9AH 3SBKA 3ZZ9A 1XM1A 2Y81A 2G8TA 1QB9A 1BITA 1O2SA 3BIVH 3OSYA 1C4U2 2ANWA 4YT6H 4A6LA 4ZXYH 2YNAA 2PLXA 1OSSA 1UTPA 4DT7B 4BAOB 3VB4A 1UCYK 1MU6B 1ANCA 4OS5A 3AASA 4NIYA 2J9NA 2BTCE 3BG4B 4PROA 2BDIA 3U98H 1EXFA 4ISHH 2ASUB 1A2CH 4DJZB 1GJDB 3DA9B 1OYTH 1HAYB 2ZHFH 2F9UA 2FOHA 1A3BH 1G37A 1C2HA 2R0LA 1CA0B 4YT7H 7GCHG 3MNXA 2QYIA 2Y7XA 4FUGA 3LH3A 4VGCC 1E37B 4K1EA 1C4Y2 1NROH 1TNLA 1PJPA 1AVWA 4K2YA 4X1QU 1PQ8A 4IC5A 4WVPE 2ZPQA 4JMYA 3V3MA 2PTNA 2A2QH 2BYAX 1ZHRA 3R0FA 1MH0A 1O2NA 1O2QA 1QA0A 1C5LH 2J34A 2J92A 4OGYA 2NU0E 3S9CA 2VWLA 1UK4A 3HATH 4YOIA 1GJCB 3L33A 4WH6A 1IQNA 5EXNA 2ZFTA 4Y0ZE 3UTUH 1BHXF 3GY5A 5FHTA 1BRCE 1CHGA 4UFEH 4AOQA 1K1PA 2W5EA 1AE8H 1BBRH 2ZGHA 3RXTA 4Y8ZA 1TNJA 2FODA 2P3TB 3L3TA 3ZZ5A 2BVRH 2XC0A 4Q80A 2VH6A 2BLVA 1O31A 1XVOA 5AF9H 2FOGA 2ZU4A 1TNIA 1UK2A 3NXPA 4ZHMU 1TX7A 3F9GA 1HAVB 1XKBC 1EAWA 2VINA 2WPJS 1XKAC 2WYGA 5EOKA 3KQCA 1GMDG 1EPTC 4UFGH 3SN8A 4D9RA 4I8LA 2RG3A 1HBTH 4ABBA 4YESB 4AB8A 1SLUB 3W95A 3D49H 1BBRK 3RU4T 3TLOA 1ZRKA 1SGRE 1E0FD 1F7ZA 1YPHE 1GI7B 1O3HA 1SFIA 3BIUH 3A7TA 1C5OH 4TPIZ 1EOLA 1EP5A 3RXUA 1P09A 4X0WU 5FCRA 7LPRA 5C1XA 3SOSA 1FY3A 4RSPA 2GT7A 3KF2A 1BTYA 1E36B 2ANMH 2ZGCA 2GZ8A 1S0QA 2XYAA 5JBTA 4ZKRU 1SOTA 1AZZA 2VJ1A 1BMMH 1SFQB 1O30A 3O8DA 4FXGH 1SBWA 2XBWA 4BAKB 3LPRA 1DWBH 1OP2A 1P06A 3E6PH 4YTAA 1SL3A 1EJNA 2ZHEH 1H9LB 3QDZB 1OXGA 1P12E 1L4DA 4NZQA 3ZVEA 1D6WA 1C2LA 2A1DB 2R2WU 5DG6A 1SQOA 2W26A 5LPRA 2QGRA 3RMNH 1W0YH 3RXDA 3QLPH 1MKXK 4O03A 1Y3VA 1C2EA 2QIQA 2G51A 1ACBE 4X2YA 2EC9H 3FAOA 5CHAC 2FPZA 3K9XB 1GBEA 1ORFA 5FBIA 2F3CE 1ZRBA 8GCHF 2ESTE 1TMTH 4D7GA 1DFPA 1QB6A 1AWFH 2GV6A 1NPMA 3GDSA 3A80A 1C1PA 1P0SH 3VB6A 1MTVA 3UIRA 4K3JA 2IN2A 1QFKH 1V2TT 2ZDNA 1GBTA 4DG4A 2PHBA 1P02A 1GCTC 1UK3A 4ZXXH 1MKWK 1PPZA 1V2NT 2W3IA 4LXBH 3MWIU 4K69A 2A7CA 1GI9B 1FNIA 2KAIA 1GBFA 1TQ0B 1ZYOA 3LGVA 2FTMA 1C5PA 1TE0A 3ZVFA 1B0EA 3BTTE 3U8RH 2ALPA 3QTVH 1VITG 1HV7A 1H9HE 2BDYA 2WPKS 5ABWA 2WPLS 1DY9A 1YCPM 2FOAA 1O3NA 4BAHB 4DCDA 1AVGH 2ZHDA 1QJ7B 1DXPA 1EUFA 2QC2A 4D8NA 1O5BB 3ZV8A 4RN6A 1P2MA 3SUGA 3ZVDA 4JZDH 1O32A 4H42U 3FVFB 2NU2E 1C2GA 3I29A 2Q6DA 3U1IB 1LO6A 1VR1H 3BSQA 1TOMH 2BY7X 4CRCA 1GI5A 1BJUA 3MH6A 1OOKB 1FPHH 5ETXA 1YM0A 1Z1IA 2TGPZ 4ZMAH 2VWOA 4Y71A 3EA7A 3A7VA 1ZR0A 3URCA 5C3NA 1D3PB 1KTSB 1GHXH 2HPQH 3TJVA 1S84A 3ZVCA 1EP6A 1JXPA 1DM4B 1PFXC 2IOTA 1GG6B 1O3AA 5ESBA 1GJ7B 3A85A 1PQ5A 2C8XB 1UTKA 3KQDA 1GHWH 2BDCA 2BXUH 4GPGA 1KXEA 3EE0B 3QZQA 3FZZA 1PQ7A 1QNJA 1VGCB 4NFEA 1HAPH 2P8OC 1FXYA 3EGKH 4WJG2 1C5TA 1MKXH 3EDXB 1TPAE 2CGAA 2RA3A 2TPIZ 2FOCA 3MU4A 2C8WB 1NFYA 1HIAB 2CN0H 2Q6FA 1SGTA 5JBCS 2PKSB 1TNGA 2TGAA 3GY6A 1FAXA 2FMJA 1K1JA 1CGJE 1CT2E 1SPJA 3UNRA 1EQ9A 1SHHB 3MU1A 1F5LA 1GI4A 3SU6A 1FI8A 1QTFA 4LZ4B 5L6NH 2ZHQH 1ABIH 2JETC 3SNDA 3P8FA 3LDXH 4ZAEA 1WYKA 2ZU5A 2P95A 3TJUA 1BRBE 3LGTA 1GCTB 4IN1A 2FOFA 4BANB 1ZMNA 2EI8A 1SVPA 3PM3A 3D23A 3BF6H 5C5NA 5SGAE 2R0KA 3AAUA 1NRPH 3UWIA 3HPTB 1S83A 5LPEA 1IQFA 1GL1A 1GHAG 2RCEA 3KCGH 1YPEH 2XC4A 5HM2A 2G55A 1QB1A 2ZWLH 2GKVE 1TFXA 3QUMP 4YLQH 1LMWB 4XBBA 1ZZZA 5EU8A 1O2MA 1SOZA 1TGSZ 4UFFH 3GDUA 2AEIH 4UE7H 4BTIB 4RKOB 1IOEA 1C1MA 4OS2A 3PO1C 4UD9H 1T8MA 1A61H 2ZFSA 3TGKE 3OYPA 1O2RA 1W10U 1H8DH 1DSTA 1O2GH 1AZ8A 4HTCH 2Y7ZA 2XXLA 3LJOA 3SNCA 3FANA 1UTQA 5E2PA 2ZDVH 1RIWB 1BB0B 4CBNA 2OQ5A 5F03A 4ZROA 1LPZB 2B9LA 2CMYA 2G5NA 1AIXH 2BMGB 1GDNA 4WY3A 6CHAB 1OP8A 1HYLA 4JK6A 3NK8A 3BV9B 1C5WB 2VGCB 1TONA 3S9AA 3T62A 1NU7B 2BLOA 2F9OA 4Y79A 1GG6C 1SGCA 2AH4X 3EA9A 2Y5GA 1WTGH 3TNSA 5EPNA 2YOLA 4B75A 3TU7H 3G01A 2Z9IA 4Y10E 4IMZA 2B0FA 1HXFH 4TWWA 2V35A 1DWDH 1O3LA 1C1OA 2XRCA 3M5OA 1PYTD 2FIRH 2FX6A 4BAMB 2BX4A 5A0CA 1EOJA 1LKBA 5DPAA 3M3SA 3SI3H 3ZZBA 1AQ7A 1KIGH 2QN5T 1OS8A 2QXJA 1S5SA 4FU7A 5BPEA 4E7NA 3L6PA 3CENA 4X6PA 1CBWB 3IWMA 4A5TS 2XC5A 2GTBA 2HNTC 1BBRE 3TJNA 2A31A 2C8YB 2FTLE 3LC5A 1E38B 2OD3B 4FUEA 4MNXA 2C4FH 4OS7A 3TNTA 1MTNB 3PMHB 3MU8A 3PYHA 1O2WA 1BQYA 2FLRH 5EG4A 5AVDA 1V2LT 4YM9A 3ZVBA 1P9SA 1IQEA 2QXGA 2OP9A 5JPMH 4WF8A 1EPTA 4KP0A 1ELFA 4H4FA 1E34B 1HJ9A 2ZDMA 2XTTB 1GBJA 3IG6B 4OGXA 1O34A 2Q6GA 1DVAH 2G00A 1E35B 1WBGB 2BOHB 1F0UA 5K7RA 1ANDA 1EX3A 2FZZA 1P2NA 3EA8A 1BRAA 1ZJKA 1LHFH 1ZHMA 2P94A 1QIXB 3M7QA 1ELEE 4D7FA 4HGCA 3SV6A 2FEQH 4D76A 5GDSH 5TCCA 1K22H 2O8LA 4JZFH 3SUEA 5E2OA 1Q3XA 1RIWC 3LIWA 3SNEA 1UHBB 2F9NA 1AE5A 2OTVA 1WV7H 4WH8A 2XCFA 1F0RA 1LHDH 1NU9A 1THPB 4QT8C 5DP6A 1RTFB 1GBCA 2A4GA 5HM9A 3BTQE 6CHAC 4KGAA 1ESAA 3LC3A 1L2EA 1YPGH 1J8AA 3LH1A 2HNTE 5E0GA 2CF8H 5LGOA 3OTJE 4B2CA 1VCQA 1L1GA 1UTNA 4I31A 1O3KA 2VIWA 1XXFA 3U1JB 4GLYA 4ABDA 1Y59T 2THFB 1C4V2 3NZIA 4JYVH 2GCTB 2QAAA 1W14U 2HALA 3SGQE 2A32A 2LPRA 2SGAA 4SGBE 4UFDH 3SU5A 2ODQA 3GOVB 1AFQC 1WQVH 3K6YA 1G30B 2BQ7B 1V2KT 2A0QB 3ATWA 3SHAH 5JB9S 1P2JA 1AO5A 3QX5H 3GY3A 1CBWC 4FU8A 1BJVA 3M5NA 4XDEA 4U30A 2QV1A 4MQAA 2PTCE 1WAYB 2VIQA 2PSYA 5EPYA 5EQSA 3MO6A 1MTNC 1A1RA 3RXKA 1T8LA 2RA0A 3CP7A 3PWCA 4KKDA 4E05H 4FUJA 2PWXA 4ISNA 1C2JA 1OPHB 3RXQA 5L30H 1GI1A 3MU0A 1S85A 2AIPA 3ATIA 1EB1H 1G9IE 1ZSJA 1TRMA 3LGUA 2H1UA 1A0HB 2ZECA 1EB2A 3TH2H 1FIWA 5C2ZA 3C1KA 5HXFA 1JIRA 1C2DA 1Y3XA 3ZV9A 2G52A 5EQQA 1QRXA 4K60A 1PPBH 3SU2A 3TK6A 1DLKB 2BZ6H 4X6NA 1UTMA 3SO3A 1HCGA 3RXMA 3KN2A 3LGYA 3M5MA 4BNRA 3Q3XA 4DIHH 3HK3B 3TH4H 2O8MA 2QXIA 1EAXA 2BB4A 1FZZA 2QCYA 3GCNA 1SGQE 6GCHG 1GMHG 3Q77A 2PUXB 1GMHF 1IHSH 2BDHA 1FUJA 3S69A 2P3FH 2V6NA 2GMTB 1Z6EA 1BTXA 2BD5A 2Q1JA 5AFYH 3OY6U 5DP4A 5HMAA 3GY2A 2GZ7A 4AGKA 1K1OA 1H1BA 5A0BA 2ZFRH 4MNWA 4Y7BA 3P92A 2GVFA 3OU0A 1NFUA 1S0RA 2QY0B 1LVMA 5A8ZA 3ODFA 2W3KA 1T4VH 1CQQA 1LKAA 1NN6A 3UQOA 2UUFB 2ZTZA 3LOXA 3M36A 1BMNH 2HOBA 2HRVA 2SFAA 3M61U 2AYWA 2BY8X 3MTYA 4YO9A 1A5GH 1P3EA 1TYNA 2BX3A 5DP3A 1UCYH 2GCTC 2IPHA 3ZZ3A 3KIDU 5IDKA 1GDUA 2FDAA 1O2XA 1HAIH 3W94A 1GVLA 2AS9A 3VXFH 3BTKE 1AFQB 5FPYA 3E90B 4DY7B 4IC6A 1QHRB 1P57B 5LH8A 2O8WA 3B8JA 4AG1A 1IQGA 2FOBA 3QTOH 4R0IA 1HNEE 2WUBA 2XNIA 4J2YB 2OINA 1TX6A 4ISIH 1F5KU 3SORA 1Z8RA 3ODDA 2ZGBH 4YOGA 1W12U 1IQHA 1QJ1B 2HNTF 4E06H 2OC1A 4R8TB 4IS5A 4I8KA 3TGJE 2BLQA 1Z71A 2C90B 3ITIA 4UDWH 2HVXA 6LPRA 5J4SA 4X1PU 1BRUP 1MCVA 1SGPE 1CT4E 1O35A 1HPGA 4ABFA 1WSSH 9ESTA 4MPWA 3DUXH 1XUFA 5JDUB 1C2MA 4UONA 3A86A 3DFJA 3SI4H 1EJAA 3HKJB 1B5GH 1UTJA 5EQRA 3TVJB 2J95A 3Q00A 3VGCB 3LJJA 1QURH 1QQ4A 4I7YH 2FI3E 1XXDA 4FUHA 4NSYA 4AYYB 1MTWA 2OC0A 3MHWU 3ATMA 3RXFA 2VB0A 6ESTA 1GMCF 1AVXA 1DXWA 4M7GA 3V7TA 1MTUA 3A8CA 4A1TA 3BTFE 1O5EH 1QBNA 3UR6A 5A09A 2WV4A 3RLWH 1YF4A 1K2I1 4B2BA 3BTWE 4WMDA 3E3TA 4I8HA 2STBE 3RXSA 1UTLM 4DIIH 2BY6X 4HZHA 4NWKA 3M37A 1GJBB 4NGAH 4AGJA 1XUJA 4FUDA 1TRNA 4Z0KA 3RM0H 5GCHG 3GCHB 1JBUH 3QK1A 1DWEH 2GV7A 3KGPA 1ELCA 4NCYA 1OWHA 1Y3YA 1LPGB 5T6GA 3SJIA 1MZDA 4H6TA 1C5QA 1LDTT 3OX7U 1THRH 1BTUA 4DGJA 4AFSA 1AUTC 1NRSH 3SW2B 1CSOE 1RTLA 4NA8A 5IYTA 1HFDA 1L4ZA 3MNCA 3RXJA 1BUIA 1RS0A 4CRDA 4CR9A 2WPIS 2Y80A 1BOQA 5L2ZH 3GISB 1J17T 1FY8E 1UVTH 1OWDA 2SGFE 2CV3A 2IJOB 3P8GA 3RXAA 4BXSA 3UREA 1ZPZA 4ZH8A 3RC4A 1XUGA 1ZGIA 3ZZCA 2GCHG 1NRQH 5EGMA 3H5CB 3FP8E 4JCNA 2H6MA 4A7IB 1AI8H 2VVUA 1P2IA 1ZGVA 2OXSA 1GJ6A 3LU9B 3GYLB 4NA9H 1PPFE 4ZKOU 1IQMA 4TY7A 4F4OC 7GCHF 3AW0A 3M5LA 3LGWA 1Y5UT 2F9VA 4INKA 2Y5FA 3SGAE 1FONA 1V2JT 4TYDA 2WV5A 4CH2B 2TBSA 3FZDA 2BQWB 3A8DA 3RXBA 1FQ3A 4ABEA 2ZTYA 1Z7KA 3SV7A 3UFAA 1W11U 4X2XA 4RKJB 2CJIA 4E7RG 2G81E 2VWNA 1SGFA 1FDPA 1BTZA 5GWZA 2ZC9H 4JK5A 3HK6B 3A7XA 3D65E 1N6XA 2UUYA 1XUIA 1O3PB 1T7CA 3RXCA 3A8BA 3V12A 3KNXA 2VIOA 1DANH 4OS6A 1C1SA 1CE5A 1LHEH 2BOKA 3H7TA 4I8JA 1RGQA 2PKAB 1C2KA 1NM6A 2ZU3A 3RXPA 4NIVA 1YLDA 3QGNB 4K5ZA 1P8VC 1BTWA 2VU8E 5A8YA 3K65B 1C5UA 1MU8B 3MFJA 3PTBA 3N7OA 4GVUA 3TH3H 4K1TA 1NZQH 4JYTA 4YZUA 5GPIB 1OWIA 3GCHC 1MUEB 1O3JA 3ZZ8A 3RXOA 2A45B 4CRFA 3T29A 3VB5A 1ZTKA 1QQUA 8LPRA 1AD8H 3GY4A 2KAIB 4IMQA 4GCHF 1GVZA 1GHAF 1GBDA 1KDQB 2ALVA 1SGYE 1GJ4H 2NU4E 2ZCHP 1YP9A 1C1WH 4NIXA 4Q7YA 1GJAB 1FLEE 4Y8XA 1DX5M 1FY5A 4JZIA 4ABAA 2PGQB 2WYJA 1PPEE 1WU1A 4U01A 3ESTA 4O3TA 1RRKA 3SJOA 3FFGA 2OC8A 4O9VA 2EI6A 3ZZ7A 2P93A 4BTUB 1C9TA 2BDAA 2AGEX 1GGDC 1P01A 2XWAA 1VGCC 1EKBB 4XBCA 5FAHA 1P11E 1HJAB 3A7YA 1YPMH 2BD7A 1O5GH 4HI3A 4O97A 1VITH 7ESTE 2UUKB 4NG9H 1C1NA 1IQJA 1TQ7B 3Q3YA 3DD2H 1O2YA 4UEHH 5HYOA 1W13U 1C5VA 1YLCA 1OWEA 1TNKA 1W7XH 1N6YA 2TGDA 2XBVA 1CT0E 1D4PB 1MD8A 5BRRE 2AMDA 1JRTA 1ZHPA 1N8OB 2WPMS 2ZKSA 5CMXH 5F8XA 3PWBA 4A1XA 1NRRH 4B74A 3M35A 3LGIA 4CRBA 3PB1E 1DS2E 7KMEH 1ELVA 1M9UA 2JETB 4CBOA 5F8ZA 2H5DA 1C5RA 3PMJA 1OKXA 1ZPBA 2TGTA 2VH0A 2GX4A 1SC8U 2TRMA 3EYDA 1NT1A 1TBQH 2Z3DA 1T4UH 4X2WA 1BCUH 1D6RA 3P6ZB 4YOJA 2JH5D 3FP6E 1V3XA 1ZMLA 1BDAA 1C1TA 2B7DH 3RXEA 3LT3A 1AN1E 3U69H 3S7HB 1AB9C 2NWNA 4FUBA 2PR3A 2PV9B 3V0XA 4BAQB 1HJ8A 1UMAH 4KTUA 1C5MD 1G3BA 2SGQE 1EAIA 2WPHS 1K1MA 1YPLH 4X8VH 1EZXC 3BTHE 2H2ZA 1S6HA 2Z94A 3SJKA 2BDBA 3QWCH 1ZSLA 1KLJH 2GGVB 2VWMA 4X1NU 3PTNA 3B9FH 3P95A 2LNCA 1Z6JH 2BVXH 2G4UA 5C1UA 4AORA 5A8XA 2VNTA 1O2TA 3ZZDA 4NIWA 2J94A 3I78A 4AZ2B 1TA6A 4ISLA 1AWHB 4DW2U 1DDJA 3E0PB 2I6QA 2A7JA 3RLYH 2NU3E 1VCWA 1L1JA 3SV9A 1F92A 1A4WH 2P59A 2STAE 1GBHA 3S7KB 1KXDA 3MI4A 4WXIA 4WXVA 5EODA 1JIMA 4AB9A 1V2VT 1DWCH 4IN2A 2H9HA 1BMAA 1YYY1 3ZVAA 1ETRH 4X8TH 2RDLA 3ATLA 1O3EA 3GY7A 1C9PA 1O5DH 2NU1E 2SNWA 5L2YH 1YC0A 2BXTH 1NC6A 4B2AA 1MD7A 1K28D 2UWOA 3SJ8A 4TWYA 5E0JA 1RXPA 1MTSA 3NCLA 5FX5A 4IW4E 1SLXB 2SGEE 1SQTA 2Z9LA 3QO6A 1O5FH 3KQEA 3KL6A 4ABJA 2A5IA 2ZNKH 1A7SA 1OWJA 1UO6A 3SNBA 1SI5H 1CU1A 1C5YB 2AMPA 3A88A 1A5IA 1D9IA 1P2KA 1VJAU 3HGPA 1QY6A 4IBLH 1P2QA 4TY6A 4BXWA 1BZXE 4AFQA 1TABE 1TALA 9LPRA 1OP0A 2CHAC 1GWAA 5E0HA 3MH7A 5AHGH 5DJ7A 1V2QT 4B76A 3I77A 5H4IB 1LPKB 1YPJH 1ARBA 1K1IA 1HGTH 1KXAA 4B1TA 3UPEA 1G3EA 4CHAC 3D62A 1DPOA 1NS3A 2ANYA 3RXRA 3GCTF 1K21H 3GCTG 1EZSC 1EZQA 1Z1JA 5C1YA 1YCPH 1FY1A 1C5SA 1SGDE 1XUHA 1Y5AT 1AGJA 1ZMJA 3BG8A 1OYQA 1GHVH 5JBAS 1F5RA 1MCTA 2AERH 2K1QA 1NY22 2AMQA 3ENSB 4ZHAA 1W8BH 4AX9H 2D8WA 4NA7A 2FO9A 1O37A 3MH4A 5GIBA 1HAOH 2ZHWH 3E0NB 1Y5BT 1GJ9B 3SQEE 1S82A 4SGAE 8GCHG 1WOFA 1P10A 1RD3B 2D1JA 2J4IA 2OLGA 1OWKA 2JH6D 5DP5A 2ZFFH 3A8AA 1QJ6B 2BD8A 3GY8A 2ZG0H 1BT7A 3A87A 4Q2KA 2JH0D 2Z6BD 4YLUA 2VIPA 1W2KH 3C27B 5I25A 3RC5A 3SUDA 1SGEE 1SLWB 1TB6H 1YPKH 4FUCA 3B23B 4K1SA 2OCVB 1TGTA 1Z8GA 1SLVB 3SV8A 3MNBA 4INHA 1ELTA 5FPTA 2ZGXH 2P16A 1FN8A 2ZDAH 1V2ST 4KELA 1VZQH 1MBMA 5G4BA 3O8RA 3S0NA 1IQKA 5DP8A 1GCDA 1EZUC 4VGCB 1DT2A 1S81A 4FVBA 1GJ8B 3M3VA 3SU3A 1C1QA 4ASHA 1LCYA 1U6QA 3AW1A 4A1VA 5CE1A 2BY5X 5E8EH 1PPCE 2FP7B 1QRWA 1MMJN 2O8UA 2OQUA 2HPPH 4LZ1H 1MZAA 1UTOA 1HB0B 3BTGE 2C8ZB 2GP9B 1HAHH 1J9CH 1O3CA 1NFXA 1O5CB 1QR3E 1V2RT 2FI5E 2FXRA 4MPVA 1KDQA 4U32A 3PMBB 3NPSA 1GBAA 3ZZ4A 1AY6H 4FUIA 1T8NA 5I46H 1WUNH 4LOYH 1AU8A 2B8OH 4WWYA 1IHTH 2ZO3H 1O36A 3LONA 3M3TA 4CH8B 3EQ0H 2FYQA 1J14A 2C3SA 2ANKH 1MAYA 1NO9H 1O2JA 1O5AB 3A82A 2F9BH 3VB3A 2ZEBA 5F6MA 2FI4E 3PLBA 2ODPA 1FN6A 1FMGA 2V3OH 2ZQ1A 2BQ6B 1KLTA 2GMTC 5T6FA 1GHYH 5F8TA 2Y6TA 1ZTJA 2B5TB 2OBQA 3O8BA 1H4WA 4MNYA 3UNSA 3KQBA 3LKWA 4MLFB 4X2VA 3ZZ6A 1AFEH 1TRYA 5EXLA 1O3MA 3RMMH 5GCHF 5C20A 4DURA 4K8YA 4CRAA 1Z8IB 4A92A 1DICA 3SNAA 1O38A 3SUFA 5DP9A 1AKSA 2ZI2H 3TITA 1G3DA 4Y11E 4NZLA 3PV4A 5C5OA 1HAGE 4THNH 4B73A 3MNSA 3T28A 1O2LA 1CHOF 4KTCA 3A7WA 1VITF 4OS4A 4MDSA 5GXPA 1H8IH 2FOEA 2FX4A 1P9UA 1C1VH 1IQLA 2OUAA 1BIOA 2BDGA 3U8OH 1C2FA 5LPFA 1GBLA 1AHTH 4X8SH 2W7SA 3UWJH 1L0ZA 2ZU1A 4Q7XA 3RMOH 1Y3WA 5DK1A 5DP7A 2I6SA 4HFPB 1D3QB 1GPZA 1T8OA 1UHBA 4X6MA 1NTPA 3CS7A 1TPSA 3SJ9A 2A4RA 4XBDA 3RM2H 4Y0YE 2BD9A 1UCYE 1K9OE 2GD4B 3MMGA 4ZUHA 2F83A 3PROA 4H6SB 4X1SU 1CGIE 1D3DB 1KXFA 4WMEA 3BN9A 5CHAB 5TJXA 6GCHF 3JZ2B 1TBZH 1TMUH 4ZKNU 1MQ6A 1EJMA 1SGFG 4CR5A 1EASA 4ZHLU 2QF0A 2A5KA 2D26C 4WMFA 1PYTC 2FYRA 2ZDLA 2ZU2A 1S6FA 1HRTH 3CS0A 2ZGJA 3MO3A 2ZPRA 1FV9A 5GJ4B 1KXBA 3A89A 3RXGA 2TIOA 2R3YA 5K0HA 1O2KA 4MG3A 3VGCC 1PPHE 1CO7E 2J2UA 3SU0A 4ABIA 1HUTH 4X8UH 2VVCA 2W7UA 2XWBI 3E1XB 4GUXA 3P8NA 1ETTH 3F9EA 4Y76A 3M7UA 1NRNH 1UVPA 2ZFPH 1SGNE 1QRZA 2EI7A 2XW9A 3TGIE 1SB1H 1QA7A 2AGGX 1ESBA 1LVOA 1Z8JB 1ID5H 2G4TA 3GICB 4FU9A 3HGNA 3URDA 1V6DA 1J15A 4FVDA 1GI6A 2H9TH 2A7HA 1C1UH 3F9FA 4JZ1A 4ABHA 1G2MA 1TNHA 2XCNA 3E8LA 2ZDKA 4I33A 4AFZA 1A5HA 1T32A 2Z9GA 3PLPA 1F0SA 2GDEH 4I8GA 1CA8B 1DUEA 3F6UH 1JOUB 5C67A 1GI0A 1BTPA 2BM2A 4J1YA 3SGBE 4AFUA 1WQSA 2ZZUH 1TLDA 3UOUA 1GVKB 1AUJA 1TGCA 4LK4A 1DLEA 1ELAA 2ULLA 3MOCA 3Q76A 1O3FA 4X1RU 3HKIB 3TPIZ 1VJ9U 4AG2A 3STJA 1SQAA 3F68H 4O3UA 3BEFB 4Y8YA 5B6OA 3IITA 1TPPA 1O3GA 1ZOMA 3A84A 2XBYA 5AFZH 3WY8A 1GMDF 2P8OB 4JYUH 2WINI 4NSVA 1SGIB 1XVMA 1UVSH 3VB7A 1X7AC 4MTBA 1HDTH 2R9PA 2F91A 2DE9A 1O2OA 1GMCG 2BD3A 3UUZA 2A2XH 2PKSC 1C5XB 1LHGH 2QXHA 2BZAA 2BHGA
chains in the Genus database with same CATH superfamily
4Z1MD 4B71A 1JRSA 1F0TA 2FM2A 2ZP0H 3E91A 5KEDA 3K2UA 4CRGA 1ETSH 4MNVA 4Q7ZA 2ZIQH 1EATA 1ESTA 1OX1A 3M7TA 2V0BA 1DSUA 3OFND 4CREA 3SQHE 2YNBA 2AGIX 1BA8B 2FWWA 5EW2H 2P3UB 2H5CA 1O2VA 2XBXA 1PQAA 4XSKU 1GHZA 3VFEA 4XOJA 5C0UA 1YGCH 1O3DA 1XUKA 2SNVA 1ZSKA 2G5VA 1YKTA 3UNQA 1GI3A 1KY9A 1P3CA 1J16A 2EEKA 2OBOA 3V13A 4NFFA 1RJXB 3TK9A 1HAZB 3EAJA 2R3UA 1LVYA 1A0LA 2C93B 1GBBA 2D2DA 3RXVA 1V2UT 3W1EA 1W7GH 3P70B 1V2WT 1XMNB 1AKSB 1V2PT 1VKYA 1O2IA 3VPKA 1NFWA 3PLKA 4ABGA 2K0QA 3PO1B 3OY5U 1K1LA 4FOUC 3P17H 1DITH 1QL9A 3UOPA 1FIZA 2PSXA 3NKKA 3GYMA 1GI8B 4GHQA 3A81A 4ESTE 2ZQ2A 1H9IE 5A0AE 2GCHF 3AAVA 1C5NH 4FUFA 1Y3UA 8ESTE 1TA2A 3T5FH 1GL0E 3BTDE 2J38A 3H7OA 2W6ID 1YBWA 1MAXA 2ODYB 3DSPA 1GI2A 2HLCA 4INLA 2QF3A 4JZEH 1B7XB 1P04A 2SGPE 1ELBA 5GNDA 3STIA 2VGCC 1YPHC 3VG8A 2OC7A 1O2PA 1TBRH 1WTHD 4FETA 5FBEA 3DT0H 1IAUA 4AYVB 4TT3D 3PMAB 2H9EH 1A46H 2AHME 1EFRD 2ZTXA 5EXMA 5DO4H 3UY9A 1GGDB 1O2UA 1IQIA 3KEEA 1O3IA 1KTTB 1SSXA 4D9QA 2VIDA 1THSH 1HJAC 3OE7D 1CHOG 1ARCA 1C1RA 1CVWH 1D3TB 1UJ1A 3RP2A 3SHCH 4Z6AH 3SU1A 1L1NA 1O33A 3A83A 1INCA 1KYNA 1NESE 2BLWA 2UUJB 1A3EH 3N7EA 1K1NA 1T31A 1MBQA 2KCOA 1UVUH 2O9QA 2FOMB 2A5AA 1C2IA 1HXEH 1KLIH 4NWLA 1N8OC 3GDVA 1HLTH 3ATKA 1SG8B 3RXLA 1ELGA 8KME2 1LTOA 2BD4A 3R3GB 3QN7A 2JKHA 5FX6A 2QA9E 3T26A 5HGGA 1ZJDA 2FS9A 5T6DA 5TCAA 1TOCB 1ELDE 1Q31A 4BOHA 1GBIA 4MVNA 1FAKH 3TIUA 1TX8A 2HWLB 1GJ5H 3ZYEA 1EAUA 3BEUA 2CXVA 2M5TA 1JWTA 1G3CA 1O0DH 2PGBB 2AIQA 4BTTB 1ZLRA 2KX4A 3RUOA 3SZNA 4X6OA 1Q2WA 1FY4A 1AB9B 3AVZA 2PUQH 2AFQB 1P2OA 2R2MB 3TJOA 1E1RD 2VIVA 2SGDE 3RXHA 1G2LA 3BTME 2ZCKP 4Y6DA 1DE7H 1RTKA 3MH5A 1LQEA 4U2WA 3ELAH 4DT4A 3DFLA 2LELA 3T27A 1G36A 5A2MH 2Z3CA 5JYIA 1SR5C 3A7ZA 2ZFQH 4ZKSU 3ZYDA 4AN7A 1A0JA 4OS1A 2FS8A 3F0OA 3MYWA 2GZ9A 2Z3EA 4XFQA 3S9BA 4TPYA 3UR9A 3T2NA 1BHXB 1QCPA 1C5ZB 2BVSH 1QL7A 4ISOA 5FXLA 3GCOA 5DKMA 1V2MT 1O2ZA 3FP7E 1O3OA 1LQDB 3SU4A 1ANBA 1B0FA 4DOQA 3O8CA 1S6LA 3F2FA 4I32A 1KXCA 3VXEH 3MO9A 2PP6A 2ZCLP 3AK5A 2PKAA 3RU4D 1GBMA 3N99A 3SV2H 2BD2A 2GT8A 2PFEA 5EW1H 3ZZAA 3NUMA 2WUCA 3DHKH 5JB8S 3BG4C 2UWLA 3MU5A 2V3HH 2Z9JA 4MPUA 1ABJH 2ZA5A 1FJSA 2GDDA 2A4QA 1CA0C 2YMSB 3KHVA 5T3HA 3QGJA 3K6ZA 1PPGE 1FPCH 1GDQA 2DUCA 2ZPSA 1G32B 5ESTE 2FESH 1KSNA 3Q3KA 5PTPA 1O3BA 1QBOA 3F9HA 4XE4A 1GHBG 1LHCH 3P8OA 4GSOA 1GHBF 1TWXB 5DGJA 3RMLH 4K8BA 2FLBH 1QL8A 1BMLA 3UQVA 1ANEA 3E16B 4GHTA 5J4QA 4GCHG 3H09A 1F2SE 2Y5HA 3F1SB 1HAXB 3BTEE 4KTSA 1TMBH 1QBVH 3U8TH 2VBCA 1K0HA 1JMOH 2HGTH 1N1LA 2O8TA 1HIAA 1DY8A 2Z9KA 5HKKD 1TIOA 3QZRA 2BY9X 3RDZA 3T25A 1CGHA 1SMFE 2CHAB 2Z7FE 1UVOA 1ZPCA 3SYJA 2CF9H 1V2OT 2EA3A 5FCKA 3RC6A 1SHYA 1DUAA 1DOJA 2VVVA 2Y82A 1VCPA 1GBKA 3JZ1B 4MPXA 1W0ZU 1AMHA 3RU4E 1TPOA 4GAWA 1YCPK 5FPSA 4CHAB 2J98A 2UWPA 1P05A 4RI0A 3NWUA 3ZVGA 1P03A 1Y8TA 1MKWH 3TK5A 1QGFA 2DE8A 1TGNA 1LVBA 1O39A 1XX9A 4F49A 1TAWA 1W0JD 1HAVA 3RXIA 1O2HA 5JBBS 4DVAU 1EPTB 4IGDA 1RFNA 1MQ5A 2F9PA 1BTHH 1WCZA 3VEQB 2A4OA 3BEIB 1ZTLA 1W3CA 2ILNA 2PW8H 2ZF0H 1TGBA 4Y7AA 3U9AH 3SBKA 3ZZ9A 1XM1A 2Y81A 2G8TA 1QB9A 1BITA 1O2SA 3BIVH 3OSYA 1C4U2 2ANWA 4YT6H 4A6LA 4ZXYH 2YNAA 2PLXA 1OSSA 1UTPA 4DT7B 4BAOB 3VB4A 1UCYK 1MU6B 1ANCA 4OS5A 3AASA 4NIYA 2J9NA 2BTCE 3BG4B 4PROA 2BDIA 3U98H 1EXFA 4ISHH 2ASUB 1A2CH 4DJZB 1GJDB 3DA9B 1OYTH 1HAYB 2ZHFH 2F9UA 2FOHA 1A3BH 1G37A 1C2HA 2R0LA 1CA0B 2YMSC 4YT7H 7GCHG 3MNXA 3ZIAD 2QYIA 2Y7XA 4FUGA 3LH3A 4VGCC 1E37B 4K1EA 1C4Y2 1NROH 1TNLA 1PJPA 1AVWA 4K2YA 4X1QU 1PQ8A 4IC5A 4WVPE 2ZPQA 4JMYA 3V3MA 2PTNA 2A2QH 1NBME 2BYAX 1ZHRA 3R0FA 1MH0A 1O2NA 1O2QA 1QA0A 1C5LH 2J34A 2J92A 4OGYA 2NU0E 4P02A 3S9CA 2VWLA 1UK4A 3OTPA 3HATH 4YOIA 1GJCB 3L33A 4WH6A 1IQNA 5EXNA 2ZFTA 4Y0ZE 5HIYA 3UTUH 1BHXF 3GY5A 5FHTA 1BRCE 1CHGA 4UFEH 2V7QD 1K1PA 2W5EA 4AOQA 1AE8H 1BBRH 2ZGHA 4Q63A 3RXTA 4Y8ZA 1TNJA 2FODA 2P3TB 3L3TA 3ZZ5A 2BVRH 2LP6A 2XC0A 4Q80A 2VH6A 2M2AA 2BLVA 1O31A 1XVOA 5AF9H 2FOGA 2ZU4A 1TNIA 1UK2A 3NXPA 4ZHMU 1TX7A 3F9GA 1HAVB 1XKBC 1EAWA 2VINA 2WPJS 1XKAC 2WYGA 5EOKA 3KQCA 1GMDG 1EPTC 4UFGH 3SN8A 4D9RA 4I8LA 2RG3A 1HBTH 4ABBA 4YESB 4AB8A 2J5UA 1SLUB 3W95A 3D49H 1BBRK 3RU4T 3TLOA 1ZRKA 1SGRE 1E0FD 3F3BA 1F7ZA 1YPHE 1GI7B 1O3HA 1SFIA 3BIUH 3A7TA 1C5OH 4TPIZ 1EOLA 3DSOA 1EP5A 3RXUA 1P09A 4X0WU 5FCRA 7LPRA 5C1XA 3U28C 3SOSA 1FY3A 4RSPA 2GT7A 2QE7D 3KF2A 1BTYA 1E36B 2ANMH 2ZGCA 2GZ8A 1S0QA 2XYAA 2L74A 5JBTA 4ZKRU 1SOTA 1AZZA 2VJ1A 1BMMH 1SFQB 1O30A 3O8DA 4FXGH 1SBWA 2XBWA 4BAKB 3LPRA 1DWBH 1OP2A 1P06A 3E6PH 4YTAA 1SL3A 1EJNA 2ZHEH 1H9LB 3QDZB 5C17A 1OXGA 1P12E 1L4DA 4NZQA 3ZVEA 1D6WA 1C2LA 2A1DB 2R2WU 5DG6A 1SQOA 2W26A 4P00A 5LPRA 2QGRA 3RMNH 1W0YH 3RXDA 3QLPH 1MKXK 4O03A 1Y3VA 1C2EA 2QIQA 2G51A 1ACBE 4X2YA 2EC9H 3FAOA 2EQNA 5CHAC 2FPZA 3KYFA 3K9XB 1GBEA 1ORFA 5FBIA 2F3CE 1ZRBA 8GCHF 2ESTE 1TMTH 4D7GA 3PRDA 1DFPA 1QB6A 5EJ1A 1AWFH 2GV6A 1NPMA 3GDSA 3A80A 1C1PA 1P0SH 3VB6A 1MTVA 3UIRA 4K3JA 2IN2A 1QFKH 1V2TT 2ZDNA 1GBTA 4DG4A 2PHBA 1P02A 1GCTC 1UK3A 4ZXXH 1MKWK 1PPZA 1V2NT 2W3IA 4LXBH 3MWIU 4K69A 2A7CA 1GI9B 3PV5A 1FNIA 2KAIA 1GBFA 1TQ0B 1ZYOA 3LGVA 2FTMA 1C5PA 1TE0A 3ZVFA 1B0EA 3BTTE 5IK2D 3U8RH 1COWD 2ALPA 3QTVH 1VITG 3F2HA 1HV7A 1H9HE 2BDYA 2WPKS 5ABWA 2WPLS 1DY9A 1YCPM 2FOAA 1O3NA 4BAHB 4DCDA 1AVGH 2ZHDA 1QJ7B 1DXPA 1EUFA 2QC2A 4D8NA 1O5BB 2EY4C 4RN6A 3ZV8A 1P2MA 3SUGA 3ZVDA 4JZDH 2J97A 1O32A 4H42U 3FVFB 2NU2E 1C2GA 3I29A 2Q6DA 3U1IB 3SZEA 1LO6A 1VR1H 3BSQA 1TOMH 2BY7X 4CRCA 1GI5A 1BJUA 3MH6A 4YXWD 1OOKB 1FPHH 5ETXA 1YM0A 1Z1IA 2TGPZ 4ZMAH 1H8HD 2VWOA 4Y71A 3EA7A 3A7VA 1ZR0A 3URCA 5C3NA 1D3PB 1KTSB 1GHXH 2HPQH 3TJVA 1S84A 3ZVCA 1EP6A 1JXPA 1DM4B 1PFXC 2IOTA 1GG6B 1O3AA 5ESBA 1GJ7B 3A85A 1PQ5A 2C8XB 1UTKA 3KQDA 1GHWH 2BDCA 2BXUH 4GPGA 1KXEA 3EE0B 3QZQA 3FZZA 1PQ7A 1QNJA 1VGCB 4NFEA 1HAPH 2P8OC 1FXYA 3EGKH 4WJG2 1C5TA 1MKXH 3EDXB 1TPAE 2CGAA 2RA3A 2TPIZ 2FOCA 3MU4A 2C8WB 1NFYA 1HIAB 2CN0H 2Q6FA 1SGTA 5JBCS 3OAAD 2PKSB 1TNGA 2TGAA 3GY6A 1FAXA 2FMJA 1K1JA 1CGJE 1CT2E 1SPJA 3UNRA 1EQ9A 1SHHB 3MU1A 5DN6D 1F5LA 5C94A 1GI4A 3SU6A 1FI8A 1QTFA 4LZ4B 5L6NH 2ZHQH 1ABIH 2JETC 3SNDA 3P8FA 3LDXH 4ZAEA 1WYKA 2ZU5A 2P95A 3TJUA 1BRBE 3LGTA 1GCTB 4IN1A 2FOFA 4BANB 1ZMNA 2EI8A 1SVPA 3UB0A 3PM3A 3D23A 3WWFA 3BF6H 5C5NA 5SGAE 3F0PA 2R0KA 3AAUA 1NRPH 3UWIA 3HPTB 1S83A 5LPEA 1IQFA 1GL1A 1GHAG 2RCEA 3KCGH 1YPEH 2XC4A 5HM2A 2G55A 1QB1A 2ZWLH 2GKVE 1TFXA 3QUMP 4YLQH 1LMWB 4XBBA 1ZZZA 5EU8A 1O2MA 1SOZA 1TGSZ 4UFFH 3GDUA 2AEIH 4UE7H 4BTIB 4RKOB 1IOEA 1C1MA 4OS2A 3PO1C 4UD9H 1T8MA 1A61H 2ZFSA 3TGKE 3OYPA 1O2RA 1W10U 1H8DH 1DSTA 1O2GH 1AZ8A 4HTCH 2WPDD 2Y7ZA 2XXLA 3LJOA 3SNCA 3FANA 1UTQA 5E2PA 2ZDVH 1RIWB 1BB0B 4CBNA 2XOKD 2OQ5A 5F03A 4ZROA 1LPZB 2B9LA 2CMYA 2G5NA 1AIXH 2BMGB 1GDNA 3KQ5A 4WY3A 6CHAB 5FL7D 1OP8A 1HYLA 3DSGA 4JK6A 3NK8A 3BV9B 1C5WB 2VGCB 4I86A 1TONA 3S9AA 3T62A 1NU7B 2BLOA 2F9OA 4Y79A 1GG6C 1SGCA 2AH4X 3EA9A 2Y5GA 1WTGH 3TNSA 5EPNA 2YOLA 4B75A 3TU7H 3G01A 2Z9IA 1WDIA 4Y10E 4IMZA 2B0FA 1HXFH 4TWWA 2V35A 1DWDH 1O3LA 1C1OA 2XRCA 3M5OA 1PYTD 2FIRH 2FX6A 4BAMB 2BX4A 5A0CA 1EOJA 1LKBA 5DPAA 3M3SA 3SI3H 3ZZBA 1AQ7A 1KIGH 2JIZD 2QN5T 1OS8A 2QXJA 1S5SA 4FU7A 5BPEA 4E7NA 3L6PA 3CENA 4X6PA 1CBWB 3IWMA 4A5TS 2XC5A 2GTBA 2HNTC 1BBRE 3TJNA 2A31A 2RDEA 2C8YB 2FTLE 3LC5A 1E38B 2OD3B 4FUEA 4MNXA 2C4FH 4OS7A 4RT1A 3TNTA 1MTNB 3PMHB 2KM0A 3MU8A 3PYHA 1O2WA 1BQYA 2FLRH 5EG4A 5AVDA 1V2LT 4YM9A 3ZVBA 1P9SA 1IQEA 2QXGA 2OP9A 5JPMH 4WF8A 1EPTA 4KP0A 1ELFA 4H4FA 1E34B 1HJ9A 2ZDMA 2XTTB 1GBJA 3IG6B 4OGXA 1O34A 2Q6GA 1DVAH 2G00A 1E35B 1WBGB 2BOHB 5CHBA 1F0UA 5K7RA 1ANDA 1EX3A 2FZZA 1P2NA 3EA8A 1BRAA 1ZJKA 1LHFH 4AC9A 1ZHMA 2P94A 1QIXB 2WZQA 3M7QA 1ELEE 4D7FA 4HGCA 3SV6A 2FEQH 4D76A 5GDSH 5TCCA 1K22H 2O8LA 4JZFH 3SUEA 5E2OA 1Q3XA 1RIWC 3LIWA 3SNEA 1UHBB 2F9NA 1AE5A 2OTVA 1WV7H 4WH8A 2F4LA 2XCFA 1F0RA 1LHDH 1NU9A 1THPB 4QT8C 5DP6A 1RTFB 1GBCA 2A4GA 5HM9A 3BTQE 6CHAC 4KGAA 4M9FA 1ESAA 3LC3A 1L2EA 1YPGH 1J8AA 3LH1A 2HNTE 5E0GA 2CF8H 5LGOA 3OTJE 4B2CA 1VCQA 1L1GA 2IPQX 1YLNA 1UTNA 4I31A 2L6OA 1O3KA 2VIWA 1XXFA 3U1JB 4GLYA 4ABDA 1Y59T 2THFB 1C4V2 3NZIA 4JYVH 2GCTB 2QAAA 1W14U 5CDFE 2HALA 3SGQE 1MABB 2A32A 2LPRA 2SGAA 4SGBE 4UFDH 3SU5A 2ODQA 4ZCNA 3GOVB 1AFQC 1WQVH 3K6YA 1G30B 2BQ7B 1V2KT 2A0QB 3ATWA 3SHAH 5JB9S 1P2JA 1AO5A 3QX5H 3GY3A 1CBWC 1W0KD 4FU8A 1BJVA 3M5NA 4XDEA 4U30A 2QV1A 2QF4A 4MQAA 4F48B 2PTCE 1WAYB 2VIQA 2PSYA 5EPYA 3FN8A 5EQSA 3MO6A 1MTNC 1A1RA 3RXKA 1T8LA 2RA0A 2KCPA 3FKSD 3CP7A 3PWCA 4KKDA 4E05H 4FUJA 2PWXA 4ISNA 1C2JA 1OPHB 3RXQA 5L30H 1GI1A 3MU0A 1S85A 2AIPA 3ATIA 1EB1H 1G9IE 1ZSJA 1TRMA 1H8ED 3LGUA 2H1UA 1A0HB 2ZECA 1EB2A 3TH2H 1FIWA 5C2ZA 3C1KA 5HXFA 1JIRA 1C2DA 1Y3XA 3ZV9A 2G52A 5EQQA 1QRXA 4K60A 1PPBH 3SU2A 3TK6A 1DLKB 2BZ6H 4X6NA 1UTMA 3SO3A 1HCGA 3RXMA 3KN2A 3LGYA 3M5MA 4BNRA 3Q3XA 4DIHH 3HK3B 3TH4H 2O8MA 2QXIA 1EAXA 2BB4A 3GS9A 1FZZA 2QCYA 3GCNA 1SGQE 6GCHG 1GMHG 3F2GA 3Q77A 2PUXB 1GMHF 1IHSH 2BDHA 1FUJA 3S69A 2P3FH 2V6NA 2GMTB 1Z6EA 1BTXA 2BD5A 2Q1JA 5AFYH 3OY6U 5DP4A 5HMAA 3GY2A 2GZ7A 4AGKA 1K1OA 1H1BA 5A0BA 2ZFRH 4MNWA 4Y7BA 3P92A 2GVFA 3OU0A 1NFUA 1S0RA 2QY0B 1LVMA 5A8ZA 3ODFA 2W3KA 1T4VH 1CQQA 1LKAA 1NN6A 3UQOA 4Q4LA 2UUFB 2ZTZA 3LOXA 3M36A 1BMNH 2HOBA 2HRVA 2SFAA 3M61U 2AYWA 2BY8X 3MTYA 4YO9A 1A5GH 1P3EA 1TYNA 2BX3A 5DP3A 1UCYH 2GCTC 2IPHA 3ZZ3A 3KIDU 5IDKA 1GDUA 2FDAA 1O2XA 1HAIH 3W94A 1GVLA 2AS9A 3VXFH 3BTKE 1AFQB 5FPYA 3E90B 4DY7B 4IC6A 1QHRB 3OEED 1P57B 5LH8A 2O8WA 3B8JA 4AG1A 1IQGA 2FOBA 3QTOH 4R0IA 3KYGA 1HNEE 2JJ1D 2WUBA 2XNIA 4J2YB 2OINA 1TX6A 4ISIH 1F5KU 3N7DA 3SORA 1Z8RA 3ODDA 2ZGBH 4YOGA 1W12U 1IQHA 1QJ1B 2HNTF 4E06H 2OC1A 4R8TB 1NBMD 4IS5A 4I8KA 4TSFD 3TGJE 2BLQA 1Z71A 2C90B 3ITIA 4UDWH 2HVXA 6LPRA 5J4SA 4X1PU 1BRUP 1MCVA 1SGPE 1CT4E 1O35A 5KECA 1HPGA 4ABFA 1WSSH 9ESTA 4MPWA 3DUXH 1XUFA 5JDUB 1C2MA 4UONA 3A86A 3DFJA 3SI4H 1EJAA 3HKJB 1B5GH 1UTJA 5EQRA 3TVJB 2J95A 3Q00A 3VGCB 3LJJA 1QURH 1QQ4A 4I7YH 2FI3E 1XXDA 4FUHA 4NSYA 5C0TA 4AYYB 1MTWA 2OC0A 3MHWU 3ATMA 3RXFA 2VB0A 6ESTA 1GMCF 1AVXA 1DXWA 4M7GA 3V7TA 1MTUA 3A8CA 4A1TA 3BTFE 1O5EH 1QBNA 3UR6A 5A09A 2WV4A 3RLWH 2KCAA 1YF4A 1K2I1 4B2BA 3BTWE 4WMDA 3E3TA 4I8HA 2STBE 3RXSA 1UTLM 4DIIH 2BY6X 4HZHA 4NWKA 3M37A 1GJBB 1WXRA 4NGAH 4AGJA 1XUJA 4FUDA 1TRNA 4Z0KA 3RM0H 5GCHG 3GCHB 1JBUH 3QK1A 1DWEH 2GV7A 3KGPA 1ELCA 4NCYA 1OWHA 1Y3YA 1LPGB 5T6GA 3SJIA 1MZDA 4H6TA 1C5QA 1LDTT 3OX7U 1THRH 1BTUA 4DGJA 4AFSA 1AUTC 1NRSH 3SW2B 1CSOE 1RTLA 4NA8A 5IYTA 1HFDA 1L4ZA 3MNCA 3RXJA 1BUIA 1RS0A 4CRDA 4CR9A 2WPIS 2Y80A 1BOQA 5L2ZH 3GISB 1J17T 1FY8E 1UVTH 1OWDA 2SGFE 2CV3A 2IJOB 3P8GA 3RXAA 4BXSA 3UREA 1ZPZA 4ZH8A 3RC4A 1XUGA 1ZGIA 3ZZCA 2GCHG 1NRQH 5EGMA 3H5CB 3FP8E 4JCNA 2H6MA 4A7IB 2JJ2D 1AI8H 2VVUA 1P2IA 1ZGVA 2OXSA 1GJ6A 2QF5A 3LU9B 3GYLB 4NA9H 1PPFE 4ZKOU 2WV9A 1IQMA 4TY7A 4F4OC 5F53A 7GCHF 3AW0A 3M5LA 1SQRA 3LGWA 4ACBA 1Y5UT 2F9VA 4INKA 2Y5FA 2IJD1 3SGAE 1FONA 1V2JT 4TYDA 2WV5A 4CH2B 2TBSA 3FZDA 2BQWB 3A8DA 3RXBA 1FQ3A 4ABEA 3PV2A 2ZTYA 1Z7KA 3SV7A 3UFAA 1W11U 4X2XA 4RKJB 2CJIA 4E7RG 2G81E 2VWNA 1SGFA 1FDPA 1BTZA 5GWZA 2ZC9H 4JK5A 3HK6B 3A7XA 3D65E 1N6XA 2GJGA 2UUYA 1XUIA 1O3PB 1T7CA 3RXCA 3A8BA 3V12A 3KNXA 2VIOA 1DANH 4F55A 4OS6A 1C1SA 1CE5A 1LHEH 2BOKA 3H7TA 4I8JA 1RGQA 2PKAB 1C2KA 1NM6A 2ZU3A 3RXPA 4NIVA 1YLDA 3QGNB 4K5ZA 5B6LA 1P8VC 1BTWA 2VU8E 5A8YA 3K65B 1C5UA 1MU8B 3MFJA 3PTBA 3N7OA 4GVUA 3TH3H 4K1TA 1NZQH 4JYTA 4YZUA 5GPIB 1OWIA 3GCHC 1MUEB 1O3JA 3ZZ8A 3RXOA 2A45B 4CRFA 2KFWA 3T29A 3VB5A 1ZTKA 1QQUA 8LPRA 1AD8H 3GY4A 2KAIB 4IMQA 4GCHF 1GVZA 1GHAF 1GBDA 1KDQB 2ALVA 1SGYE 1GJ4H 2NU4E 2ZCHP 4HG6A 1YP9A 1C1WH 4NIXA 4Q7YA 1GJAB 1FLEE 4Y8XA 1DX5M 1FY5A 4JZIA 4ABAA 2PGQB 2WYJA 1PPEE 1WU1A 4U01A 3ESTA 4O3TA 1RRKA 3SJOA 3FFGA 2OC8A 4O9VA 5EJLA 2EI6A 3ZZ7A 2P93A 4BTUB 2J98B 1C9TA 2BDAA 2AGEX 1GGDC 1P01A 2XWAA 2YMSD 1VGCC 1EKBB 4XBCA 5FAHA 1P11E 3WWBA 1HJAB 3A7YA 1YPMH 2BD7A 1O5GH 4HI3A 4O97A 1VITH 7ESTE 2UUKB 4NG9H 1C1NA 1IQJA 1TQ7B 3Q3YA 3DD2H 1O2YA 4UEHH 1OHHD 5HYOA 1W13U 1C5VA 1YLCA 1OWEA 1TNKA 1W7XH 1N6YA 2TGDA 1CT0E 1D4PB 2XBVA 1MD8A 5BRRE 3DCLA 2AMDA 1JRTA 1ZHPA 1N8OB 2WPMS 2ZKSA 5CMXH 5F8XA 3PWBA 2HVYB 4A1XA 4ACAA 1NRRH 4B74A 3M35A 3LGIA 4CRBA 3PB1E 1DS2E 7KMEH 1ELVA 1M9UA 2JETB 4CBOA 5F8ZA 2H5DA 1C5RA 3PMJA 1OKXA 1ZPBA 1UW7A 2TGTA 2VH0A 2GX4A 1SC8U 2TRMA 3EYDA 1NT1A 1TBQH 2Z3DA 1T4UH 4X2WA 1BCUH 1D6RA 3P6ZB 4YOJA 2JH5D 3FP6E 2W6JD 1V3XA 1ZMLA 1BDAA 1C1TA 2B7DH 3RXEA 3LT3A 1AN1E 3U69H 3S7HB 1AB9C 2NWNA 4FUBA 2PR3A 2PV9B 3V0XA 4BAQB 1HJ8A 1UMAH 1SKYE 4KTUA 1C5MD 1G3BA 2SGQE 1EAIA 2WPHS 1YY3A 1K1MA 1YPLH 4X8VH 1EZXC 3BTHE 2H2ZA 1S6HA 2Z94A 3SJKA 3FOAA 2BDBA 3QWCH 1ZSLA 1KLJH 2GGVB 2VWMA 4X1NU 3PTNA 3B9FH 3P95A 2LNCA 1Z6JH 2BVXH 2G4UA 5C1UA 4AORA 5A8XA 2VNTA 1O2TA 3ZZDA 4NIWA 2J94A 3I78A 4AZ2B 1TA6A 4ISLA 1AWHB 4DW2U 1DDJA 3E0PB 1QZ8A 2I6QA 2A7JA 3RLYH 2RFKC 2NU3E 1VCWA 1L1JA 3SV9A 1F92A 1A4WH 2P59A 2STAE 1GBHA 3S7KB 1KXDA 3MI4A 4WXIA 4WXVA 5EODA 1JIMA 4AB9A 1V2VT 1DWCH 3MQKC 4IN2A 4XD7D 2H9HA 1BMAA 1YYY1 3ZVAA 1ETRH 4X8TH 2RDLA 3ATLA 1O3EA 3GY7A 1C9PA 1O5DH 2NU1E 2SNWA 5L2YH 4B6EA 1BMFD 1YC0A 2BXTH 1NC6A 4B2AA 1MD7A 1K28D 2UWOA 3SJ8A 4TWYA 5E0JA 1RXPA 1MTSA 3NCLA 5FX5A 4IW4E 1SLXB 2SGEE 1SQTA 2Z9LA 3QO6A 1O5FH 3KQEA 3KL6A 4ABJA 2A5IA 2ZNKH 1A7SA 1OWJA 1UO6A 3SNBA 1SI5H 1CU1A 1C5YB 2AMPA 3A88A 1A5IA 1D9IA 1P2KA 1VJAU 3HGPA 1QY6A 4IBLH 1P2QA 4TY6A 4BXWA 1BZXE 2K8IA 4AFQA 1TABE 1TALA 9LPRA 1OP0A 2CHAC 1GWAA 5E0HA 3MH7A 5AHGH 5DJ7A 1V2QT 4B76A 3I77A 5H4IB 1LPKB 1YPJH 1ARBA 1K1IA 1HGTH 2KCYA 1KXAA 4B1TA 3UPEA 1G3EA 4CHAC 3D62A 1DPOA 1NS3A 2ANYA 3RXRA 3GCTF 1K21H 3GCTG 1EZSC 1EZQA 1Z1JA 5C1YA 1YCPH 1FY1A 1C5SA 1SGDE 1XUHA 1Y5AT 1AGJA 1ZMJA 3BG8A 1OYQA 1GHVH 5JBAS 1F5RA 1MCTA 2AERH 2K1QA 3OEHD 1NY22 2AMQA 3ENSB 4ZHAA 1W8BH 4AX9H 2D8WA 3EE7A 4NA7A 2FO9A 1O37A 3MH4A 5GIBA 1HAOH 2ZHWH 3E0NB 1Y5BT 1GJ9B 3SQEE 1S82A 4SGAE 8GCHG 1WOFA 1P10A 1RD3B 2D1JA 2J4IA 2OLGA 1OWKA 2JH6D 5DP5A 2ZFFH 3A8AA 1QJ6B 2BD8A 3GY8A 2ZG0H 1BT7A 3A87A 4Q2KA 2JH0D 2Z6BD 4YLUA 2VIPA 1W2KH 3C27B 5KGOA 5I25A 3RC5A 3SUDA 3UAIC 1SGEE 1SLWB 1TB6H 1YPKH 4FUCA 3PRBA 3B23B 2OK5A 4K1SA 2OCVB 1TGTA 1Z8GA 1SLVB 3SV8A 3MNBA 4INHA 1ELTA 5FPTA 2ZGXH 2P16A 1FN8A 2ZDAH 1V2ST 5T1VA 4KELA 1VZQH 1MBMA 5G4BA 3O8RA 3S0NA 1IQKA 5DP8A 1GCDA 1EZUC 4VGCB 1DT2A 1S81A 4FVBA 1GJ8B 4B6FA 3M3VA 3SU3A 1C1QA 4ASHA 1LCYA 1U6QA 3AW1A 4A1VA 5CE1A 2BY5X 5E8EH 1PPCE 2FP7B 1QRWA 1MMJN 2O8UA 2OQUA 2HPPH 4LZ1H 1MZAA 1UTOA 1HB0B 3BTGE 2C8ZB 2GP9B 5EJZA 1HAHH 1J9CH 1O3CA 1NFXA 1O5CB 1QR3E 4OM9A 1V2RT 2FI5E 4RT0A 2FXRA 4MPVA 1KDQA 4U32A 3PMBB 3NPSA 4ASUD 1GBAA 3ZZ4A 1AY6H 4FUIA 2WSSD 1T8NA 5I46H 2KZ4A 3CNRA 1WUNH 2XNDD 4LOYH 1E79D 1AU8A 2B8OH 4WWYA 1IHTH 2ZO3H 1O36A 3LONA 3M3TA 4CH8B 3EQ0H 2FYQA 1J14A 2C3SA 3WW7A 2ANKH 1MAYA 1NO9H 1O2JA 1O5AB 3A82A 2F9BH 3VB3A 2ZEBA 5F6MA 2FI4E 3PLBA 2ODPA 1FN6A 1FMGA 2V3OH 2ZQ1A 2BQ6B 1KLTA 2GMTC 5T6FA 1GHYH 5F8TA 2Y6TA 1ZTJA 2B5TB 2OBQA 3O8BA 1H4WA 4MNYA 3UNSA 3KQBA 3LKWA 4MLFB 4X2VA 3ZZ6A 1AFEH 1TRYA 5EXLA 1O3MA 3RMMH 5GCHF 5C20A 4DURA 4K8YA 4CRAA 1Z8IB 4A92A 1DICA 3SNAA 1O38A 3SUFA 5DP9A 1AKSA 2ZI2H 3TITA 1G3DA 4Y11E 4NZLA 3PV4A 5C5OA 1HAGE 4THNH 4B73A 3MNSA 3T28A 1O2LA 1CHOF 4KTCA 3A7WA 1VITF 4OS4A 4MDSA 5GXPA 2CK3D 1H8IH 2FOEA 2FX4A 1P9UA 1C1VH 1IQLA 2OUAA 1BIOA 2V3MA 2BDGA 3U8OH 1C2FA 5LPFA 1GBLA 1AHTH 4X8SH 2W7SA 1FX0B 3UWJH 1L0ZA 2ZU1A 4Q7XA 3RMOH 1Y3WA 5DK1A 5DP7A 1E1QD 2I6SA 4HFPB 1D3QB 1GPZA 1T8OA 1UHBA 4X6MA 2KR7A 1NTPA 3CS7A 1TPSA 3SJ9A 2A4RA 4XBDA 3RM2H 4Y0YE 2BD9A 1UCYE 1K9OE 2GD4B 3MMGA 4ZUHA 2F83A 3PROA 4H6SB 4X1SU 1CGIE 1D3DB 1KXFA 4WMEA 3BN9A 5CHAB 5TJXA 6GCHF 3JZ2B 1TBZH 1TMUH 4ZKNU 3FO8D 1MQ6A 1EJMA 1SGFG 4CR5A 1EASA 4ZHLU 2QF0A 2A5KA 2D26C 4WMFA 1PYTC 2FYRA 2ZDLA 2ZU2A 1S6FA 1HRTH 3CS0A 2ZGJA 2JDID 3MO3A 2ZPRA 5EIYA 1FV9A 5GJ4B 1KXBA 1YWUA 3A89A 2HLDD 3RXGA 2TIOA 2R3YA 5K0HA 1O2KA 4MG3A 3VGCC 1PPHE 1CO7E 2J2UA 3SU0A 4ABIA 1HUTH 4X8UH 2VVCA 2W7UA 2XWBI 3E1XB 4GUXA 3P8NA 1ETTH 3F9EA 4Y76A 3M7UA 1NRNH 1UVPA 2ZFPH 1SGNE 1QRZA 2EI7A 2XW9A 3NRLA 3TGIE 5HIZA 1SB1H 1QA7A 2AGGX 1ESBA 1LVOA 1Z8JB 1ID5H 2G4TA 3GICB 4FU9A 3HGNA 3URDA 1V6DA 1J15A 4FVDA 2WHXA 1GI6A 2H9TH 2A7HA 1C1UH 3F9FA 4JZ1A 4ABHA 1G2MA 1TNHA 2XCNA 3E8LA 2ZDKA 1KMHB 4I33A 4AFZA 1A5HA 1T32A 2Z9GA 3PLPA 2F43B 1F0SA 2GDEH 4I8GA 1CA8B 1DUEA 3F6UH 1JOUB 5C67A 1GI0A 1BTPA 2BM2A 4J1YA 3SGBE 4AFUA 1WQSA 2ZZUH 1TLDA 3UOUA 1GVKB 1AUJA 1TGCA 4LK4A 1DLEA 1ELAA 2ULLA 3MOCA 3Q76A 1O3FA 4X1RU 3HKIB 3TPIZ 1VJ9U 4AG2A 3STJA 1SQAA 3F68H 4O3UA 4XRNA 3BEFB 4Y8YA 5B6OA 3IITA 5DSFA 1TPPA 1O3GA 1ZOMA 3A84A 2XBYA 5AFZH 3WY8A 1GMDF 2P8OB 4JYUH 2WINI 4NSVA 1SGIB 1XVMA 1UVSH 3VB7A 1X7AC 4MTBA 1HDTH 2R9PA 2F91A 2DE9A 1O2OA 1GMCG 2BD3A 3UUZA 2A2XH 2PKSC 1C5XB 1LHGH 2QXHA 2BZAA 2BHGA
chains in the Genus database with same CATH topology
4B71A 1JRSA 1F0TA 2FM2A 2ZP0H 3E91A 3K2UA 4CRGA 1ETSH 4MNVA 4Q7ZA 2ZIQH 1EATA 1ESTA 1OX1A 3M7TA 2V0BA 1DSUA 4CREA 3SQHE 2YNBA 2AGIX 1BA8B 2FWWA 5EW2H 2P3UB 2H5CA 1O2VA 2XBXA 1PQAA 4XSKU 1GHZA 3VFEA 4XOJA 1YGCH 1O3DA 1XUKA 2SNVA 1ZSKA 2G5VA 1YKTA 3UNQA 1GI3A 1KY9A 1P3CA 1J16A 2EEKA 2OBOA 3V13A 4NFFA 1RJXB 3TK9A 1HAZB 3EAJA 2R3UA 1LVYA 1A0LA 2C93B 1GBBA 2D2DA 3RXVA 1V2UT 1W7GH 3P70B 1V2WT 1XMNB 1AKSB 1V2PT 1O2IA 3VPKA 1NFWA 3PLKA 4ABGA 3PO1B 3OY5U 1K1LA 3P17H 1DITH 1QL9A 3UOPA 1FIZA 2PSXA 3NKKA 3GYMA 1GI8B 4GHQA 3A81A 4ESTE 2ZQ2A 1H9IE 5A0AE 2GCHF 3AAVA 1C5NH 4FUFA 1Y3UA 8ESTE 1TA2A 3T5FH 1GL0E 3BTDE 2J38A 3H7OA 1YBWA 1MAXA 2ODYB 1GI2A 2HLCA 4INLA 2QF3A 4JZEH 1B7XB 1P04A 2SGPE 1ELBA 3STIA 2VGCC 1YPHC 2OC7A 1O2PA 1TBRH 1WTHD 5FBEA 3DT0H 1IAUA 4AYVB 3PMAB 2H9EH 1A46H 2ZTXA 5EXMA 5DO4H 3UY9A 1GGDB 1O2UA 1IQIA 3KEEA 1O3IA 1KTTB 1SSXA 4D9QA 2VIDA 1THSH 1HJAC 1CHOG 1ARCA 1C1RA 1CVWH 1D3TB 1UJ1A 3RP2A 3SHCH 4Z6AH 3SU1A 1L1NA 1O33A 3A83A 1INCA 1KYNA 1NESE 2BLWA 2UUJB 1A3EH 1K1NA 1T31A 1MBQA 1UVUH 2O9QA 2FOMB 2A5AA 1C2IA 1HXEH 1KLIH 4NWLA 1N8OC 3GDVA 1HLTH 3ATKA 1SG8B 3RXLA 1ELGA 8KME2 1LTOA 2BD4A 3R3GB 3QN7A 2JKHA 5FX6A 2QA9E 3T26A 5HGGA 1ZJDA 2FS9A 5T6DA 5TCAA 1TOCB 1ELDE 1Q31A 4BOHA 1GBIA 4MVNA 1FAKH 3TIUA 1TX8A 2HWLB 1GJ5H 3ZYEA 1EAUA 3BEUA 2CXVA 2M5TA 1JWTA 1G3CA 1O0DH 2PGBB 2AIQA 4BTTB 1ZLRA 3RUOA 3SZNA 4X6OA 1Q2WA 1FY4A 1AB9B 3AVZA 2PUQH 2AFQB 1P2OA 2R2MB 3TJOA 2VIVA 2SGDE 3RXHA 1G2LA 3BTME 2ZCKP 4Y6DA 1DE7H 1RTKA 3MH5A 1LQEA 4U2WA 3ELAH 3DFLA 3T27A 1G36A 5A2MH 2Z3CA 5JYIA 1SR5C 3A7ZA 2ZFQH 4ZKSU 3ZYDA 4AN7A 1A0JA 4OS1A 2FS8A 3MYWA 2GZ9A 2Z3EA 4XFQA 3S9BA 4TPYA 3UR9A 3T2NA 1BHXB 1QCPA 1C5ZB 2BVSH 1QL7A 4ISOA 5FXLA 3GCOA 5DKMA 1V2MT 1O2ZA 3FP7E 1O3OA 1LQDB 3SU4A 1ANBA 1B0FA 4DOQA 3O8CA 4I32A 1KXCA 3VXEH 3MO9A 2ZCLP 2PKAA 3RU4D 1GBMA 3SV2H 2BD2A 2GT8A 2PFEA 5EW1H 3ZZAA 3NUMA 2WUCA 3DHKH 5JB8S 3BG4C 2UWLA 3MU5A 2V3HH 2Z9JA 4MPUA 1ABJH 2ZA5A 1FJSA 2GDDA 2A4QA 1CA0C 3KHVA 5T3HA 3QGJA 3K6ZA 1PPGE 1FPCH 1GDQA 2DUCA 2ZPSA 1G32B 5ESTE 2FESH 1KSNA 3Q3KA 5PTPA 1O3BA 1QBOA 3F9HA 4XE4A 1GHBG 1LHCH 3P8OA 4GSOA 1GHBF 1TWXB 5DGJA 3RMLH 4K8BA 2FLBH 1QL8A 1BMLA 3UQVA 1ANEA 3E16B 4GHTA 5J4QA 4GCHG 1F2SE 2Y5HA 3F1SB 1HAXB 3BTEE 4KTSA 1TMBH 1QBVH 3U8TH 1JMOH 2HGTH 1N1LA 2O8TA 1HIAA 1DY8A 2Z9KA 1TIOA 3QZRA 2BY9X 3RDZA 3T25A 1CGHA 1SMFE 2CHAB 2Z7FE 1UVOA 1ZPCA 2CF9H 1V2OT 2EA3A 5FCKA 3RC6A 1SHYA 1DUAA 1DOJA 2VVVA 2Y82A 1VCPA 1GBKA 3JZ1B 4MPXA 1W0ZU 1AMHA 3RU4E 1TPOA 4GAWA 1YCPK 5FPSA 4CHAB 2UWPA 1P05A 3NWUA 3ZVGA 1P03A 1Y8TA 1MKWH 3TK5A 1QGFA 2DE8A 1TGNA 1LVBA 1O39A 1XX9A 4F49A 1TAWA 1HAVA 3RXIA 1O2HA 5JBBS 4DVAU 1EPTB 4IGDA 1RFNA 1MQ5A 2F9PA 1BTHH 1WCZA 3VEQB 2A4OA 3BEIB 1ZTLA 1W3CA 2ILNA 2PW8H 2ZF0H 1TGBA 4Y7AA 3U9AH 3SBKA 3ZZ9A 1XM1A 2Y81A 2G8TA 1QB9A 1BITA 1O2SA 3BIVH 3OSYA 1C4U2 2ANWA 4YT6H 4A6LA 4ZXYH 2YNAA 2PLXA 1OSSA 1UTPA 4DT7B 4BAOB 3VB4A 1UCYK 1MU6B 1ANCA 4OS5A 3AASA 4NIYA 2J9NA 2BTCE 3BG4B 4PROA 2BDIA 3U98H 1EXFA 4ISHH 2ASUB 1A2CH 4DJZB 1GJDB 3DA9B 1OYTH 1HAYB 2ZHFH 2F9UA 2FOHA 1A3BH 1G37A 1C2HA 2R0LA 1CA0B 4YT7H 7GCHG 3MNXA 2QYIA 2Y7XA 4FUGA 3LH3A 4VGCC 1E37B 4K1EA 1C4Y2 1NROH 1TNLA 1PJPA 1AVWA 4K2YA 4X1QU 1PQ8A 4IC5A 4WVPE 2ZPQA 4JMYA 3V3MA 2PTNA 2A2QH 2BYAX 1ZHRA 3R0FA 1MH0A 1O2NA 1O2QA 1QA0A 1C5LH 2J34A 2J92A 4OGYA 2NU0E 3S9CA 2VWLA 1UK4A 3HATH 4YOIA 1GJCB 3L33A 4WH6A 1IQNA 5EXNA 2ZFTA 4Y0ZE 3UTUH 1BHXF 3GY5A 5FHTA 1BRCE 1CHGA 4UFEH 4AOQA 1K1PA 2W5EA 1AE8H 1BBRH 2ZGHA 3RXTA 4Y8ZA 1TNJA 2FODA 2P3TB 3L3TA 3ZZ5A 2BVRH 2XC0A 4Q80A 2VH6A 2BLVA 1O31A 1XVOA 5AF9H 2FOGA 2ZU4A 1TNIA 1UK2A 3NXPA 4ZHMU 1TX7A 3F9GA 1HAVB 1XKBC 1EAWA 2VINA 2WPJS 1XKAC 2WYGA 5EOKA 3KQCA 1GMDG 1EPTC 4UFGH 3SN8A 4D9RA 4I8LA 2RG3A 1HBTH 4ABBA 4YESB 4AB8A 1SLUB 3W95A 3D49H 1BBRK 3RU4T 3TLOA 1ZRKA 1SGRE 1E0FD 1F7ZA 1YPHE 1GI7B 1O3HA 1SFIA 3BIUH 3A7TA 1C5OH 4TPIZ 1EOLA 1EP5A 3RXUA 1P09A 4X0WU 5FCRA 7LPRA 5C1XA 3SOSA 1FY3A 4RSPA 2GT7A 3KF2A 1BTYA 1E36B 2ANMH 2ZGCA 2GZ8A 1S0QA 2XYAA 5JBTA 4ZKRU 1SOTA 1AZZA 2VJ1A 1BMMH 1SFQB 1O30A 3O8DA 4FXGH 1SBWA 2XBWA 4BAKB 3LPRA 1DWBH 1OP2A 1P06A 3E6PH 4YTAA 1SL3A 1EJNA 2ZHEH 1H9LB 3QDZB 1OXGA 1P12E 1L4DA 4NZQA 3ZVEA 1D6WA 1C2LA 2A1DB 2R2WU 5DG6A 1SQOA 2W26A 5LPRA 2QGRA 3RMNH 1W0YH 3RXDA 3QLPH 1MKXK 4O03A 1Y3VA 1C2EA 2QIQA 2G51A 1ACBE 4X2YA 2EC9H 3FAOA 5CHAC 2FPZA 3K9XB 1GBEA 1ORFA 5FBIA 2F3CE 1ZRBA 8GCHF 2ESTE 1TMTH 4D7GA 1DFPA 1QB6A 1AWFH 2GV6A 1NPMA 3GDSA 3A80A 1C1PA 1P0SH 3VB6A 1MTVA 3UIRA 4K3JA 2IN2A 1QFKH 1V2TT 2ZDNA 1GBTA 4DG4A 2PHBA 1P02A 1GCTC 1UK3A 4ZXXH 1MKWK 1PPZA 1V2NT 2W3IA 4LXBH 3MWIU 4K69A 2A7CA 1GI9B 1FNIA 2KAIA 1GBFA 1TQ0B 1ZYOA 3LGVA 2FTMA 1C5PA 1TE0A 3ZVFA 1B0EA 3BTTE 3U8RH 2ALPA 3QTVH 1VITG 1HV7A 1H9HE 2BDYA 2WPKS 5ABWA 2WPLS 1DY9A 1YCPM 2FOAA 1O3NA 4BAHB 4DCDA 1AVGH 2ZHDA 1QJ7B 1DXPA 1EUFA 2QC2A 4D8NA 1O5BB 3ZV8A 4RN6A 1P2MA 3SUGA 3ZVDA 4JZDH 1O32A 4H42U 3FVFB 2NU2E 1C2GA 3I29A 2Q6DA 3U1IB 1LO6A 1VR1H 3BSQA 1TOMH 2BY7X 4CRCA 1GI5A 1BJUA 3MH6A 1OOKB 1FPHH 5ETXA 1YM0A 1Z1IA 2TGPZ 4ZMAH 2VWOA 4Y71A 3EA7A 3A7VA 1ZR0A 3URCA 5C3NA 1D3PB 1KTSB 1GHXH 2HPQH 3TJVA 1S84A 3ZVCA 1EP6A 1JXPA 1DM4B 1PFXC 2IOTA 1GG6B 1O3AA 5ESBA 1GJ7B 3A85A 1PQ5A 2C8XB 1UTKA 3KQDA 1GHWH 2BDCA 2BXUH 4GPGA 1KXEA 3EE0B 3QZQA 3FZZA 1PQ7A 1QNJA 1VGCB 4NFEA 1HAPH 2P8OC 1FXYA 3EGKH 4WJG2 1C5TA 1MKXH 3EDXB 1TPAE 2CGAA 2RA3A 2TPIZ 2FOCA 3MU4A 2C8WB 1NFYA 1HIAB 2CN0H 2Q6FA 1SGTA 5JBCS 2PKSB 1TNGA 2TGAA 3GY6A 1FAXA 2FMJA 1K1JA 1CGJE 1CT2E 1SPJA 3UNRA 1EQ9A 1SHHB 3MU1A 1F5LA 1GI4A 3SU6A 1FI8A 1QTFA 4LZ4B 5L6NH 2ZHQH 1ABIH 2JETC 3SNDA 3P8FA 3LDXH 4ZAEA 1WYKA 2ZU5A 2P95A 3TJUA 1BRBE 3LGTA 1GCTB 4IN1A 2FOFA 4BANB 1ZMNA 2EI8A 1SVPA 3PM3A 3D23A 3BF6H 5C5NA 5SGAE 2R0KA 3AAUA 1NRPH 3UWIA 3HPTB 1S83A 5LPEA 1IQFA 1GL1A 1GHAG 2RCEA 3KCGH 1YPEH 2XC4A 5HM2A 2G55A 1QB1A 2ZWLH 2GKVE 1TFXA 3QUMP 4YLQH 1LMWB 4XBBA 1ZZZA 5EU8A 1O2MA 1SOZA 1TGSZ 4UFFH 3GDUA 2AEIH 4UE7H 4BTIB 4RKOB 1IOEA 1C1MA 4OS2A 3PO1C 4UD9H 1T8MA 1A61H 2ZFSA 3TGKE 3OYPA 1O2RA 1W10U 1H8DH 1DSTA 1O2GH 1AZ8A 4HTCH 2Y7ZA 2XXLA 3LJOA 3SNCA 3FANA 1UTQA 5E2PA 2ZDVH 1RIWB 1BB0B 4CBNA 2OQ5A 5F03A 4ZROA 1LPZB 2B9LA 2CMYA 2G5NA 1AIXH 2BMGB 1GDNA 4WY3A 6CHAB 1OP8A 1HYLA 4JK6A 3NK8A 3BV9B 1C5WB 2VGCB 1TONA 3S9AA 3T62A 1NU7B 2BLOA 2F9OA 4Y79A 1GG6C 1SGCA 2AH4X 3EA9A 2Y5GA 1WTGH 3TNSA 5EPNA 2YOLA 4B75A 3TU7H 3G01A 2Z9IA 4Y10E 4IMZA 2B0FA 1HXFH 4TWWA 2V35A 1DWDH 1O3LA 1C1OA 2XRCA 3M5OA 1PYTD 2FIRH 2FX6A 4BAMB 2BX4A 5A0CA 1EOJA 1LKBA 5DPAA 3M3SA 3SI3H 3ZZBA 1AQ7A 1KIGH 2QN5T 1OS8A 2QXJA 1S5SA 4FU7A 5BPEA 4E7NA 3L6PA 3CENA 4X6PA 1CBWB 3IWMA 4A5TS 2XC5A 2GTBA 2HNTC 1BBRE 3TJNA 2A31A 2C8YB 2FTLE 3LC5A 1E38B 2OD3B 4FUEA 4MNXA 2C4FH 4OS7A 3TNTA 1MTNB 3PMHB 3MU8A 3PYHA 1O2WA 1BQYA 2FLRH 5EG4A 5AVDA 1V2LT 4YM9A 3ZVBA 1P9SA 1IQEA 2QXGA 2OP9A 5JPMH 4WF8A 1EPTA 4KP0A 1ELFA 4H4FA 1E34B 1HJ9A 2ZDMA 2XTTB 1GBJA 3IG6B 4OGXA 1O34A 2Q6GA 1DVAH 2G00A 1E35B 1WBGB 2BOHB 1F0UA 5K7RA 1ANDA 1EX3A 2FZZA 1P2NA 3EA8A 1BRAA 1ZJKA 1LHFH 1ZHMA 2P94A 1QIXB 3M7QA 1ELEE 4D7FA 4HGCA 3SV6A 2FEQH 4D76A 5GDSH 5TCCA 1K22H 2O8LA 4JZFH 3SUEA 5E2OA 1Q3XA 1RIWC 3LIWA 3SNEA 1UHBB 2F9NA 1AE5A 2OTVA 1WV7H 4WH8A 2XCFA 1F0RA 1LHDH 1NU9A 1THPB 4QT8C 5DP6A 1RTFB 1GBCA 2A4GA 5HM9A 3BTQE 6CHAC 4KGAA 1ESAA 3LC3A 1L2EA 1YPGH 1J8AA 3LH1A 2HNTE 5E0GA 2CF8H 5LGOA 3OTJE 4B2CA 1VCQA 1L1GA 1UTNA 4I31A 1O3KA 2VIWA 1XXFA 3U1JB 4GLYA 4ABDA 1Y59T 2THFB 1C4V2 3NZIA 4JYVH 2GCTB 2QAAA 1W14U 2HALA 3SGQE 2A32A 2LPRA 2SGAA 4SGBE 4UFDH 3SU5A 2ODQA 3GOVB 1AFQC 1WQVH 3K6YA 1G30B 2BQ7B 1V2KT 2A0QB 3ATWA 3SHAH 5JB9S 1P2JA 1AO5A 3QX5H 3GY3A 1CBWC 4FU8A 1BJVA 3M5NA 4XDEA 4U30A 2QV1A 4MQAA 2PTCE 1WAYB 2VIQA 2PSYA 5EPYA 5EQSA 3MO6A 1MTNC 1A1RA 3RXKA 1T8LA 2RA0A 3CP7A 3PWCA 4KKDA 4E05H 4FUJA 2PWXA 4ISNA 1C2JA 1OPHB 3RXQA 5L30H 1GI1A 3MU0A 1S85A 2AIPA 3ATIA 1EB1H 1G9IE 1ZSJA 1TRMA 3LGUA 2H1UA 1A0HB 2ZECA 1EB2A 3TH2H 1FIWA 5C2ZA 3C1KA 5HXFA