1KXBA

Sindbis virus capsid (s215a mutant), tetragonal crystal form
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
158
structure length
158
Chain Sequence
ALKLEADRLFDVKNEDGDVIGHALAMEGKVMKPLHVKGTIDHPVLSKLKFTKSSAYDMEFAQLPVNMRSEAFTYTSEHPEGFYNWHHGAVQYSGGRFTIPRGVGGRGDAGRPIMDNSGRVVAIVLGGADEGTRTALSVVTWNSKGKTIKTTPEGTEEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords SINDBIS VIRUS CAPSID PROTEIN
publication title Structural analysis of Sindbis virus capsid mutants involving assembly and catalysis.
pubmed doi rcsb
source organism Sindbis virus
total genus 33
structure length 158
sequence length 158
ec nomenclature ec 3.4.21.90: Togavirin.
pdb deposition date 1996-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1kxbA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1kxbA01
3GY4A 4A5TS 3VGCB 2CJIA 3P6ZB 5EPYA 1S0QA 4UD9H 4VGCC 3D23A 2ZG0H 2BY7X 2RCEA 2ZTZA 4FUDA 4E05H 2PR3A 2GZ7A 3F9EA 2V35A 2V0BA 1QB1A 3SZNA 1P06A 4F4OC 3FVFB 2Z3CA 3VEQB 1UMAH 5AFYH 1O32A 1A3BH 1EZUC 1KLIH 2R0LA 2FO9A 2PTNA 2XRCA 2V3OH 1GJ4H 1IHTH 1BBRE 4CRAA 2W3IA 3ZZ6A 3SBKA 2H5DA 1N8OC 7KMEH 1IQGA 1TA6A 1SGEE 1ZPCA 4WMDA 3UR6A 3B23B 4I8GA 1ZRBA 1O2XA 3P17H 2HNTE 3RXBA 1BTZA 1G36A 1XKBC 4JZEH 2VJ1A 1Y5BT 1UTKA 1E38B 2FXRA 2PSXA 5CHAC 2QA9E 1ELDE 4O03A 1YPEH 1O3JA 2F83A 1O2RA 4H6TA 2BD7A 3M5LA 3LJJA 1O2KA 1TMTH 1ANDA 1ETRH 2JETC 4ISIH 5JBTA 5DP8A 3SQHE 2A5IA 4ISNA 1YLCA 3I77A 2R9PA 4GLYA 3SU2A 3HK6B 1VCWA 1YPHE 4GSOA 1OOKB 4FUHA 5LPFA 1HRTH 3UWJH 4IMQA 4DOQA 3DFLA 3T29A 1N6XA 3ZVFA 1G3DA 3A7VA 3M3VA 3UNQA 2FOBA 4OS2A 2ZU5A 5FPTA 1O2SA 1C5SA 2IN2A 3M35A 3SUFA 1HFDA 2GKVE 2G5NA 1CGHA 1XUJA 1EAUA 1C4U2 1MD8A 2BY6X 2TIOA 2XCFA 2ZEBA 3U1IB 2P59A 2ESTE 3W94A 1GDNA 2W26A 1A5IA 3BTQE 3O8DA 1WTGH 2A2QH 1MU8B 1MTWA 2LNCA 3DA9B 4AFQA 1J8AA 2C8XB 4AFUA 8KME2 3AW0A 1NESE 3FZDA 1T8OA 2I6SA 2ZFPH 3SNAA 4WH6A 4MTBA 1SR5C 4CBNA 3NCLA 1LKBA 1SHYA 4CRGA 4JK6A 3B9FH 1GWAA 2TPIZ 3SU0A 3RLWH 2F9VA 1E36B 2GV6A 4FUFA 3U1JB 1GVKB 2XCNA 1P2OA 4ZXXH 3BTTE 3FFGA 3RXVA 1GBMA 1E35B 2ZTYA 5JYIA 3T2NA 3BTWE 3UUZA 4INLA 1SMFE 3V12A 2AERH 1TX6A 3OX7U 4NZQA 5EODA 4DG4A 2ZQ2A 1IQNA 1TA2A 4ESTE 2DUCA 1ZJKA 1XXFA 1TBZH 1WBGB 3SQEE 2WUCA 2GCTC 1OKXA 3A7WA 2PUXB 2VH6A 1LHFH 4UFDH 3RXMA 3GY3A 2P8OB 4TYDA 4WMFA 1INCA 1TALA 1S81A 1HAYB 1A7SA 1VCQA 1O3FA 3BN9A 1O3BA 2A5KA 3LGUA 3BTDE 3BIVH 1LQDB 4GCHG 1DDJA 1O3LA 1GJ8B 1QCPA 4CHAB 1VITF 3KQDA 1T31A 3A8CA 2VB0A 1C2DA 1RIWC 2P3TB 1IQKA 3SU4A 4CRBA 4DCDA 2ZU3A 2BZ6H 2GV7A 1XM1A 3M37A 2H1UA 4XOJA 1VCPA 4NA7A 1W14U 2FOCA 3MU0A 1V3XA 1JXPA 1GHWH 3ZZBA 4GHTA 3D49H 3Q77A 1XXDA 4KTUA 2SGFE 1C1RA 1P8VC 1B5GH 1QHRB 1DX5M 3GCNA 2WPIS 3U8OH 1C1WH 1NPMA 2VIVA 3TGKE 2AMPA 6CHAB 2A7CA 2P95A 3E6PH 4K69A 1GI8B 1QGFA 1HBTH 1Y3YA 2DE9A 1UCYK 2PHBA 1TPOA 3V3MA 3U9AH 4XFQA 1GDUA 1JRTA 2AMDA 3LOXA 3TK6A 3URDA 2I6QA 3SV8A 1O2GH 1BTUA 2UUJB 1AZ8A 1MTNB 2G55A 1FXYA 3ZZ4A 1MAXA 1NFWA 3LJOA 3TLOA 4Y8YA 3LGWA 3Q00A 4YZUA 4Q80A 1C5YB 2FTMA 4WMEA 1C5OH 3MNXA 3GCOA 1AWFH 1K1PA 2ZFSA 2ZU1A 3PMBB 1A5GH 1K2I1 1C4Y2 1PQ8A 5F8TA 3PMAB 3PWCA 3LONA 3LPRA 3UTUH 2GMTC 2UWLA 4U30A 4BAOB 1SLUB 1IQJA 4Y8XA 2C8ZB 2F9UA 1GCDA 4MNYA 4JYTA 2WV5A 1GJ9B 1NC6A 1GI9B 4MQAA 1HXFH 1JWTA 1LVMA 1VITH 3EE0B 1PQ7A 1C5XB 2EEKA 3ZVGA 3PWBA 2FS9A 2FOEA 5IYTA 1OWIA 1ZHMA 4B75A 2D2DA 1Z8JB 4AGKA 3SU1A 3R3GB 1HLTH 5T6DA 5DP4A 3S7HB 4ABGA 1XVOA 4K5ZA 1WYKA 1DY8A 1EOJA 1DITH 4IC5A 1V2UT 1W0ZU 5HXFA 2VIOA 5ESBA 2HNTF 2GTBA 4XE4A 1NFYA 3RXDA 3S7KB 1SLVB 2FLBH 3K65B 4FUJA 1VR1H 3TH4H 3HGNA 1ELGA 4JK5A 3VB4A 3SN8A 1GBBA 1QBVH 3NZIA 1SGIB 2RG3A 2ZDAH 2FMJA 3MHWU 1CBWC 1CGJE 2BYAX 3ZVEA 1GI4A 3E90B 1B0EA 2ZHWH 1XVMA 2B5TB 1LVYA 1YPGH 5SGAE 1GPZA 5J4SA 4A1VA 1PPZA 1G2MA 4BXWA 1WCZA 1OS8A 4KKDA 1YF4A 2C8WB 1L0ZA 3SNBA 2EI7A 4ABAA 1THPB 1GGDC 1MUEB 3LGYA 3PROA 3SU3A 1O2QA 2FPZA 3I78A 3UNRA 2ZA5A 4MPUA 1CA8B 2HWLB 1AWHB 1TOMH 1D3TB 3C27B 2THFB 3D62A 1SOTA 3SNEA 1V2NT 4A92A 2FEQH 4YT6H 1SI5H 3RXTA 2ZFTA 3QK1A 2ZDNA 4I32A 1G3EA 1P2NA 3BTME 4HZHA 1ELEE 1JBUH 2VNTA 1BBRH 1C2HA 6ESTA 3BF6H 1XUHA 4F49A 1BJUA 2NU4E 4VGCB 4I8JA 1TNLA 1ELVA 3SJOA 2XBVA 5G4BA 2FYQA 1LO6A 5DPAA 3E16B 1O5FH 5F03A 3LC3A 3GY5A 1ZTLA 3QN7A 1GI6A 1V2LT 3GISB 2ZDMA 1AIXH 1VITG 2VGCC 3BIUH 1GMCG 1FQ3A 1S84A 3KNXA 1Y3XA 2A5AA 2ZF0H 2QV1A 1CHGA 1H9HE 2CN0H 3F9GA 1CA0C 5DG6A 2QN5T 3HATH 1K1OA 1K1LA 3ESTA 1FPHH 1C2JA 4MDSA 4BXSA 1O3GA 3LGIA 1QB9A 1AFQC 4ABHA 2BY9X 1AE5A 1N8OB 1THSH 1JOUB 4D7GA 5A8ZA 3EYDA 2A31A 2R3UA 3T27A 1ZGVA 1IHSH 1QJ6B 1DXWA 1BIOA 2XC4A 1O3KA 1DWBH 2VINA 1F5RA 5CHAB 1HJAB 3FANA 1XKAC 5GJ4B 2WPMS 5DP5A 1V2KT 2PV9B 6GCHG 1L1JA 3EDXB 2JETB 4UONA 2Z94A 1DUAA 4K1EA 1Z8RA 1F5LA 1LHGH 1SVPA 3KQEA 3NK8A 2FM2A 3A8DA 4MVNA 1D4PB 1CHOF 3MTYA 1BTXA 1TGCA 1GL0E 1FMGA 1RS0A 1TGSZ 2F9PA 3ATIA 1GI5A 4FU7A 2BVRH 3G01A 4FVDA 5L2YH 5FBIA 1ABJH 1IQMA 4X6MA 5JB9S 1FJSA 1O5DH 1QURH 4K2YA 2B7DH 2EI8A 2PGBB 2BLQA 5A0BA 1TBQH 3TIUA 2BOHB 5EXMA 5JBAS 1HAZB 1Y3UA 1ARBA 3OYPA 1X7AC 2G4UA 1SC8U 1SGFG 1BTWA 1RTLA 2A0QB 3QDZB 1GBEA 3M5OA 3SJIA 3UIRA 1FUJA 2WPKS 2JH6D 1NFXA 1YCPM 2FOHA 4H6SB 1QR3E 1ESTA 1MCVA 1V2WT 2OINA 2BDIA 2P93A 4B71A 5E0HA 5EU8A 1EZQA 4OS4A 3M7UA 1G3BA 2Y7XA 1AFEH 1EOLA 3E8LA 1TNKA 5IDKA 7LPRA 5ABWA 1A3EH 3TJOA 1SHHB 3UPEA 3LGVA 1UVUH 3AASA 3DD2H 2UWOA 4AFSA 1C5TA 4NIWA 3M7TA 2UUFB 2O8TA 1GJ5H 3A88A 4WF8A 3K9XB 3M3TA 1LVOA 2QY0B 2AEIH 1NTPA 1FAXA 1ETSH 4O97A 2Y82A 1WQVH 1DUEA 2GCTB 3P8FA 1V2OT 1HAOH 3MO9A 2A7JA 3UY9A 3PLPA 5HM9A 1WU1A 1G2LA 1ANEA 1P10A 1GI0A 2ANWA 2W3KA 1S82A 1AI8H 1LDTT 4ZROA 3U8TH 1MH0A 1BHXF 1S6FA 1TQ7B 1O3AA 3U69H 3RXEA 3P8OA 3RXOA 1CGIE 1NFUA 1DS2E 1GVZA 1TGNA 3KEEA 1RIWB 1ZTKA 1C1VH 3A8AA 3E91A 4KGAA 3OSYA 4UEHH 1Z7KA 3UQVA 1LHEH 2GZ9A 1P01A 2OC7A 1BCUH 2OUAA 1G32B 4Z6AH 1YCPH 5K7RA 1UCYE 4GAWA 1SGCA 2LPRA 2EI6A 1TX8A 1Q2WA 1O5CB 3LGTA 2Y81A 2BB4A 3HGPA 2AMQA 3LU9B 4UFGH 4X6NA 1AUTC 2ILNA 3A80A 2B0FA 4DW2U 3M61U 2QGRA 1N6YA 4Q7XA 3VXFH 2GD4B 5DP3A 5HM2A 4YM9A 1MKXH 1PPHE 1Y5AT 3PV4A 1C2GA 4Y6DA 4FUCA 1ZTJA 1P09A 1UTJA 1UTOA 4Y10E 3URCA 1KYNA 1J17T 4Y7AA 3QGNB 1UK4A 1ZOMA 2OBOA 5CMXH 1NU9A 3RC6A 2O8LA 1O3DA 2QXIA 1TPPA 1A4WH 4FU8A 2Y5GA 1HCGA 1MZDA 2ZGBH 1BQYA 1FN6A 1KXDA 2UUKB 2Z7FE 2R0KA 2O9QA 3A81A 1BRUP 2VIDA 1L4DA 3SNDA 3TK9A 2GMTB 4Y8ZA 1C5MD 1V2PT 4SGBE 3ZZDA 2Y6TA 4WJG2 1W0YH 2ZPQA 4OS7A 2Z9JA 2GT8A 3MH5A 1TPAE 5GWZA 2FX6A 1A46H 1UTMA 3KCGH 4X2XA 3GYMA 1HV7A 2BX3A 3Q3YA 1M9UA 3BTGE 3QWCH 1BMAA 1C5VA 1SG8B 2XC5A 4MNXA 4NFFA 4XSKU 3DT0H 2TBSA 3I29A 1U6QA 3GY6A 3FP6E 1GMHF 3BEFB 1CHOG 3QX5H 4J1YA 2BM2A 4AB9A 1LTOA 3MFJA 1O3OA 3RM0H 5HYOA 1K1NA 3QTVH 5GIBA 2FOGA 2OTVA 2G52A 1Y3VA 1O2NA 4Y0ZE 1YBWA 4ZKOU 1DVAH 1GJBB 1GJ6A 5EQSA 4U32A 1CBWB 1O0DH 1Y3WA 1EZSC 1ZMJA 3RU4D 2R2WU 2ZCHP 3RMNH 1O2ZA 1SGYE 1TMBH 1EP5A 4NZLA 1KTSB 5F6MA 1SFIA 3F9HA 3BSQA 1C5LH 3ZZ7A 1QJ1B 1JMOH 3A83A 3QGJA 2ZECA 1P2MA 3N7OA 2ANMH 1YYY1 2D8WA 2OCVB 1VJ9U 1W3CA 2Z6BD 2G5VA 1P3CA 4YT7H 1GGDB 7GCHF 1NN6A 2VVVA 4ZH8A 1P2IA 2GCHF 1NY22 3F6UH 1EZXC 3KL6A 1P12E 3QO6A 1O33A 3A7YA 4WVPE 1KXCA 4AG1A 1O2UA 2FOMB 2Q6GA 3PTNA 1AUJA 1H1BA 2B8OH 2FYRA 2SNWA 2A45B 1QIXB 3UWIA 1GG6C 2NWNA 2Z3DA 5A8YA 3QZRA 2ZP0H 2J92A 3TGJE 2Z9LA 3ZVAA 1MBQA 1XUIA 3MNSA 1SPJA 4OGYA 3ZZAA 1ANBA 1O2LA 2QF0A 3LT3A 1O3EA 2HPPH 3U8RH 4DT7B 1DSUA 3TH2H 1FIWA 3SJKA 1FLEE 1O36A 1QL8A 4NIVA 3EQ0H 1FY5A 1QRWA 4E7NA 4X8VH 2FI4E 5JBCS 1WOFA 2FESH 4GPGA 3SNCA 1GMCF 2HALA 1O2JA 2ZGXH 3BG4C 1XMNB 5JPMH 4NSVA 2Y80A 5EG4A 1Y59T 2ZI2H 2TGTA 1P03A 4QT8C 2VGCB 1JIRA 5GDSH 2XBWA 4Y11E 1TIOA 2OC0A 1G9IE 1QL7A 4ZMAH 1CA0B 2O8UA 1GBIA 1ANCA 4TPYA 5C1UA 1G3CA 1CE5A 2BDAA 2Z3EA 1AFQB 4X8TH 2AIPA 3SV6A 3U98H 1IQHA 2PLXA 2ZPRA 1UVSH 3VB3A 5FPSA 9LPRA 5TCAA 4IMZA 3V0XA 1OWDA 1P3EA 3MYWA 6GCHF 2A1DB 1Z1JA 1DWCH 1FN8A 2TRMA 2VWNA 1GBFA 1YPLH 1P0SH 1YKTA 4B2BA 1MU6B 4JCNA 1OWJA 2ZCLP 4BTUB 1HAXB 5DK1A 2BQ7B 1WUNH 2ZU2A 1HDTH 5E2PA 2H5CA 4KTCA 1ZSKA 4YO9A 4ZHMU 4K1TA 1GMDG 3GY2A 2NU2E 2PGQB 3MU5A 1GHXH 1PYTD 3OU0A 4Q7ZA 1BMMH 1C2KA 1ZZZA 1A0HB 1K22H 2ZGJA 1QBNA 2G00A 1GHYH 1XX9A 4GUXA 1C5NH 1SFQB 1S0RA 1MAYA 1BTPA 3ZV8A 4B1TA 3UFAA 1BRBE 4AORA 1O30A 1ZHRA 1GHAG 2O8WA 4BNRA 4ZKRU 4BAHB 3MOCA 4HGCA 4E06H 1S5SA 2P3FH 1YPJH 3A7ZA 3UNSA 1TGTA 4X1RU 2C4FH 1GI2A 1EATA 1ORFA 1ZSJA 1YP9A 1C1PA 3P8NA 5DP9A 2YNAA 1S85A 3RMOH 2G81E 2SGAA 4AYYB 1GMHG 4JZFH 1HUTH 4TY7A 1MKWK 4ZXYH 4WH8A 5L2ZH 1C2IA 4AYVB 4Z0KA 3L33A 5AVDA 1O2YA 3JZ2B 3ATMA 1C9PA 2QXJA 4NIYA 1D6WA 3RUOA 1O3CA 2QIQA 1ID5H 3UREA 2ZKSA 4Y79A 2BQWB 4BAMB 1C5WB 1GCTC 1TNIA 2CF8H 1UCYH 1IQIA 3RC5A 5FAHA 1HB0B 2P3UB 1NT1A 1Z6JH 1O5EH 1LMWB 1ZMNA 2FX4A 1L4ZA 1D3QB 1EAWA 1SLXB 1W7XH 1EX3A 5GCHF 2XBYA 4ISOA 1NZQH 1O3IA 1UHBB 1EKBB 1DICA 1ELTA 1YPKH 1QQ4A 4K8YA 7GCHG 3LC5A 4GVUA 3VB7A 1P57B 1TRYA 2GCHG 4U01A 4BTIB 4Q2KA 2D1JA 4D8NA 2ODPA 1VJAU 2ZDVH 1RRKA 4U2WA 3ATKA 2VIQA 4IGDA 1DANH 4LZ1H 3K6YA 1ELAA 3A86A 4KTSA 4B76A 3ZVBA 8GCHG 2OC1A 3MU8A 1W13U 3P70B 1AKSB 2Y7ZA 3NKKA 1CVWH 2BHGA 2PKAB 2H9HA 1GHZA 1TWXB 2GZ8A 1V2VT 3P95A 2G8TA 3FP7E 4X0WU 1UHBA 3IG6B 2ZWLH 1NU7B 3MI4A 4FXGH 4ZUHA 2BDYA 3TK5A 2BDHA 2SGPE 3VPKA 3D65E 2YNBA 2BMGB 2ZU4A 1UK2A 4MPWA 1H9LB 1C1OA 4PROA 1P2JA 1Q31A 1NRQH 4DURA 1CO7E 1Z8GA 3T5FH 1YM0A 5HMAA 1GI7B 2RA3A 3NPSA 4IC6A 4JZIA 1PQ5A 2BLVA 1EPTC 3MH6A 4OS6A 3LH1A 3HK3B 3S9BA 1AKSA 2BX4A 3HPTB 1OP8A 1C1TA 2PKAA 3AW1A 1MD7A 1FY4A 3SGBE 4DY7B 1B0FA 1H8DH 3EGKH 1B7XB 4UDWH 2Q6FA 3ELAH 1O38A 1IOEA 1MMJN 4UFEH 1GJCB 1KY9A 4ISLA 4JYVH 3BTFE 4NCYA 1Z8IB 4IBLH 3RP2A 1TONA 3T28A 4BAQB 1TPSA 2EC9H 1DT2A 1SL3A 2BZAA 1H4WA 1EAXA 2XWBI 2M5TA 3SOSA 2CF9H 1ELFA 4WWYA 1AQ7A 4K3JA 5CE1A 1A61H 1T8NA 2J2UA 4I33A 3H7OA 1OXGA 5HGGA 1QA0A 4YLUA 1ZHPA 1BB0B 3SU6A 2FLRH 3RXUA 1T7CA 4RN6A 2Z9KA 1EP6A 3GDSA 1TB6H 2VH0A 1V6DA 2ZNKH 1BA8B 1T4VH 3RXAA 3SU5A 1DLKB 2BD3A 4AN7A 2AFQB 2ODQA 3UOUA 2F9OA 2Q1JA 3KGPA 4NSYA 2ZDKA 2IOTA 3ZV9A 1ZPZA 2NU3E 2VWMA 5TCCA 4X1SU 5J4QA 1AHTH 2J34A 4YOGA 3RU4E 3WY8A 3LIWA 1OYQA 2ZZUH 5EXNA 2ANKH 1FAKH 2C8YB 1O3MA 2SGQE 3CENA 5ESTE 1A5HA 1HJ9A 1MZAA 1YCPK 1GBDA 1C5QA 3BEIB 4NWKA 3OTJE 3RXQA 3ZYEA 2Y5HA 4DIIH 1P05A 1W2KH 4I31A 5DO4H 4XBBA 5A09A 4LZ4B 1MTSA 1CT2E 1EB2A 2PUQH 3M7QA 5A0CA 1F0SA 4XBCA 1K21H 2VU8E 3EA8A 4HTCH 1E37B 2BDGA 5EQRA 1AD8H 3E0NB 4OS1A 1BRAA 1FV9A 1MKXK 3QZQA 1K9OE 1O3NA 2HNTC 4O3UA 4AGJA 1K1MA 2WINI 1UJ1A 2ZDLA 2SFAA 1EAIA 1GDQA 1P2KA 3OY5U 1GG6B 1MBMA 5C67A 1DLEA 1DXPA 2AGGX 3RM2H 1KXFA 4MG3A 4WY3A 1K1IA 1N1LA 1MQ6A 1MCTA 1TMUH 2NU0E 4I7YH 1AB9C 2QCYA 2BD9A 2AGEX 1QB6A 2OD3B 1C4V2 2BLWA 3PB1E 2A4QA 3T25A 3PO1C 3ITIA 2FI3E 1ETTH 4X1QU 1RXPA 2VIPA 3SUGA 1YPHC 2BD2A 1ESAA 3GDUA 3NWUA 1LCYA 1BTYA 5B6OA 1RGQA 1JRSA 2BD4A 1WV7H 2IJOB 2FTLE 4MPXA 5GCHG 2A4OA 2HGTH 1AVXA 1KDQB 3BG4B 2CV3A 1SGTA 3ZYDA 4HFPB 4X6OA 5JDUB 5LGOA 3K2UA 3SW2B 5C20A 1ABIH 5T6GA 4CRDA 1UVTH 1P9UA 1P11E 1GBCA 1F0UA 1TLDA 4MNWA 3VB5A 1OPHB 3A87A 1BHXB 2WPLS 3ZZ8A 3MWIU 3SV7A 3GICB 4LOYH 1C1QA 2CMYA 4A7IB 1MQ5A 1F2SE 1SGQE 1FI8A 1LQEA 1AE8H 3T62A 5DKMA 4IW4E 2ANYA 1D3PB 1SGPE 5AF9H 1V2MT 2V6NA 4A6LA 3ATWA 3GCHC 1KDQA 3IITA 3DHKH 3SUDA 1NRNH 3A84A 1ZLRA 4GHQA 2XNIA 3AAUA 2GX4A 3RXJA 3PMJA 1TABE 1QL9A 2XYAA 1RTFB 1NM6A 3PLBA 3SJ9A 3GOVB 1WSSH 5FCRA 2P94A 4YOJA 2O8MA 1TRMA 4X8UH 1SGDE 4K60A 1GMDF 1F0TA 4NA8A 3SI4H 2UWPA 3DUXH 4JZDH 1GHVH 1LHDH 2ZGCA 1F7ZA 3SV9A 5EGMA 2ZCKP 3M3SA 1DFPA 2F9BH 1BTHH 4DIHH 3A7XA 3O8RA 1QBOA 1V2ST 1WAYB 2RDLA 1CT0E 1GHAF 3AAVA 2OBQA 4WXVA 5DJ7A 3RXHA 1QFKH 5FX5A 4X2WA 4Y76A 1C1MA 1DOJA 1OWKA 1LHCH 2UUYA 4ZKNU 1C5ZB 2TGDA 1WTHD 2J9NA 1HXEH 2XWAA 3GY8A 1GBJA 3MH7A 4AOQA 4ABBA 1C9TA 2FODA 1UVPA 2J38A 5FXLA 1AZZA 3FZZA 5EOKA 3HKJB 1HJAC 4YTAA 3JZ1B 1CU1A 2ODYB 4CRFA 1CSOE 4INKA 4O3TA 4CR9A 1TQ0B 4UE7H 1J14A 1LKAA 3VFEA 3SHAH 1EASA 1EUFA 4BAKB 1GHBF 1EJMA 1AVWA 5FHTA 1ZPBA 1C2MA 1ZGIA 2PWXA 1Z1IA 2ALVA 5EPNA 1NO9H 3TNTA 2OQ5A 3LDXH 1NROH 2WPHS 3NXPA 1HNEE 5BRRE 1SGNE 2TGPZ 4DGJA 3NUMA 4OGXA 1NS3A 2ZHFH 1UVOA 2W7UA 1C2LA 2HRVA 3RU4T 1YLDA 3CS7A 3KQCA 1FPCH 3RXGA 1EJAA 1J16A 1FY8E 4X8SH 1GCTB 3ODFA 1OWHA 2SNVA 2Q6DA 2CHAC 4Y71A 5C2ZA 3TGIE 5E8EH 5C5NA 1DWEH 1KLJH 1YPMH 3GCTF 3M5MA 3EA9A 4SGAE 4A1TA 3MH4A 1AU8A 2HOBA 1ESBA 4NA9H 2A2XH 3R0FA 2ASUB 1C1NA 3C1KA 1W7GH 1AO5A 1J15A 5I46H 2VVCA 2F9NA 1BRCE 5EW1H 2XBXA 8GCHF 1GVLA 3SUEA 1NRRH 2A4RA 1PPGE 4RKOB 1A0JA 2BD5A 2FP7B 4THNH 2BQ6B 1W12U 2A7HA 1NRPH 4E7RG 1S6HA 1VZQH 3M5NA 1ZJDA 2GDDA 3H7TA 3SO3A 3QLPH 2ZQ1A 2V3HH 4B74A 3PMHB 2BVSH 1Z6EA 1O2PA 1PJPA 2FOFA 1LPKB 2GT7A 1GI3A 3RMLH 2EA3A 1WQSA 8ESTE 1DY9A 3TVJB 1MTUA 2H9TH 1SB1H 2XXLA 2C90B 3GY7A 1DM4B 4ABFA 1BZXE 1K28D 5AHGH 2QYIA 3VB6A 1EPTB 5FX6A 1RD3B 4K1SA 1SQAA 1GBTA 2QXGA 3UQOA 4K8BA 3V7TA 4Q7YA 5A8XA 1YGCH 2CGAA 4AG2A 1UTNA 3KHVA 2GGVB 1IQLA 4B73A 1VGCC 1P9SA 2HLCA 1O39A 3BEUA 3RXIA 1H8IH 2PKSC 3F68H 4DJZB 4BOHA 3FP8E 1O3HA 4O9VA 1EPTA 5AFZH 3VGCC 1C5UA 2A4GA 3RXRA 2ZFRH 2R3YA 1KLTA 4FUGA 1TNGA 1T8MA 2F91A 1FZZA 2C3SA 2H9EH 1QJ7B 2AH4X 2OC8A 1HPGA 3BTEE 3RMMH 1G37A 4UFFH 7ESTE 2P16A 4D9QA 4AFZA 4M7GA 1D9IA 5E2OA 4FUBA 4D7FA 2ZGHA 2GP9B 3E0PB 3E3TA 3RXSA 1E34B 4OS5A 2OXSA 3MNBA 2BD8A 3IWMA 5EW2H 4ZAEA 2A32A 4X1PU 3RDZA 2XTTB 1PPCE 4NWLA 4R8TB 1C2EA 8LPRA 4ABIA 3ODDA 1XUFA 4X1NU 2ALPA 1QY6A 1T32A 3E1XB 9ESTA 4YESB 1T4UH 1V2TT 2BTCE 2WV4A 3T26A 2WYGA 2C93B 1H9IE 4ZHLU 1TNHA 2VWLA 1ARCA 1HGTH 3BG8A 1AMHA 1G30B 5PTPA 4J2YB 3LKWA 5H4IB 2WPJS 1D3DB 2STBE 1UTQA 4KELA 2F3CE 4NIXA 1UTPA 1HAVB 2JH5D 1BBRK 1YC0A 4KP0A 4ABDA 1Q3XA 4JYUH 2W5EA 2ZC9H 3TU7H 2JKHA 2QXHA 1A0LA 1W10U 2H6MA 2QAAA 2BVXH 1XUGA 4H4FA 3L6PA 2H2ZA 3KQBA 1V2RT 1KSNA 5TJXA 2FDAA 2D26C 3AVZA 2FWWA 3A89A 3KN2A 2BY8X 4I8KA 4AX9H 2FZZA 1GHBG 1O5GH 3ZZ3A 2ZIQH 5L30H 1SGFA 1TNJA 2Y5FA 1OSSA 1HAVA 2BY5X 2FI5E 1F5KU 2Z9GA 4LXBH 3SJ8A 2WUBA 1DSTA 1C5RA 4JZ1A 1FDPA 1ELBA 4MLFB 2AS9A 2ZFQH 5A0AE 3SI3H 3S0NA 4AZ2B 3HKIB 1SQOA 3A85A 1TFXA 1ZR0A 3SGQE 3UR9A 1JIMA 1O2IA 1AB9B 2BDCA 2STAE 3KF2A 1FONA 1UO6A 2J94A 1W11U 1FIZA 1GBKA 1TE0A 3MMGA 3S9AA 1EQ9A 2XC0A 3PO1B 6LPRA 1GJDB 1UTLM 3H5CB 5DP7A 3GCTG 4Y7BA 1THRH 3OY6U 2VIWA 3TH3H 5C1YA 3STIA 4WXIA 1HAIH 5I25A 1DWDH 4B2AA 1OP2A 1HAHH 3SHCH 1ZMLA 1LVBA 4FVBA 4I8HA 5E0GA 4CH2B 3O8CA 1KXEA 3Q3KA 1O2HA 4R0IA 1P04A 1KIGH 1SQTA 3CS0A 4YOIA 1V2JT 4RSPA 3EAJA 5LH8A 1O2OA 1IQFA 4X6PA 4FUEA 5E0JA 4YLQH 1LPGB 1QRXA 5FCKA 3P8GA 2HPQH 2CXVA 5FPYA 1O35A 3EA7A 5C5OA 2K1QA 1GJAB 3TNSA 3GCHB 1F92A 5T3HA 3RC4A 1NRSH 1SLWB 2KAIB 5GXPA 1PFXC 4IN1A 5BPEA 3F1SB 3TJUA 1L1NA 1V2QT 3UOPA 5LPRA 1PPBH 2P8OC 4ZHAA 3V13A 3VXEH 2GVFA 2BXUH 2ULLA 2OP9A 1C2FA 1PQAA 4AB8A 3P92A 3RXCA 1O2WA 5K0HA 3Q3XA 1MKWH 5DP6A 3A82A 1BT7A 1KXBA 3BTHE 1ACBE 1P2QA 2ZHEH 4CHAC 2AGIX 2BOKA 1ZRKA 2RA0A 3TITA 2BXTH 5LPEA 2SGDE 1LPZB 1CQQA 2KAIA 4NG9H 4RKJB 3A8BA 4ASHA 1QRZA 1DE7H 4ISHH 3GYLB 1O2VA 5ETXA 2WYJA 4TWYA 1BJVA 2ZO3H 4FU9A 1BITA 3DFJA 3RLYH 1GL1A 1XUKA 4LK4A 4CH8B 1HYLA 3GDVA 1T8LA 1MTVA 2BLOA 2J95A 1BDAA 3ZZ5A 3MU1A 3ENSB 1TBRH 2JH0D 1FY3A 5EXLA 6CHAC 1QA7A 1SGRE 1TGBA 5L6NH 3MU4A 3ATLA 1PPFE 1Y8TA 4NGAH 4BTTB 4X2YA 1W8BH 1FY1A 1DPOA 1QQUA 2TGAA 4MNVA 3BTKE 3RXPA 1MTNC 5T6FA 1BMLA 4IS5A 2QC2A 2AIQA 1O5AB 2FS8A 1A2CH 5DGJA 3LH3A 3TJVA 4ABEA 2DE8A 1GBHA 3QUMP 2J4IA 3S9CA 1BMNH 4D9RA 1GBAA 5F8XA 3KIDU 1O31A 3A7TA 1O5BB 3PLKA 1GJ7B 5C3NA 1HJ8A 1L1GA 4XDEA 1HIAB 1UK3A 1E0FD 2ZFFH 3TJNA 3MO3A 3ZVDA 4HI3A 1BOQA 2HVXA 3RXLA 4D76A 2VWOA 3PTBA 1O34A 3SORA 3TPIZ 4CRCA 1D6RA 2CHAB 1O2TA 1ZYOA 4Y0YE 2XW9A 3F9FA 1J9CH 1KTTB 4IN2A 4CBOA 1K1JA 1PPEE 4H42U 2Z9IA 1FNIA 4CR5A 3SV2H 3RXKA 1PYTC 1BUIA 1F0RA 3W95A 1A1RA 1C1SA 1HIAA 5EQQA 4NFEA 5JB8S 3B8JA 1ELCA 1AY6H 4TY6A 1RJXB 1SOZA 4JMYA 1C1UH 1SSXA 1RFNA 1RTKA 1EXFA 3FAOA 1P02A 2FOAA 1AGJA 1TOCB 1TRNA 2SGEE 1Y5UT 3BV9B 4ABJA 4DVAU 3M36A 3O8BA 2QF3A 2PW8H 2GDEH 1OWEA 1TYNA 2NU1E 2G4TA 4INHA 1AVGH 2IPHA 3STJA 1L2EA 1TX7A 3Q76A 3PYHA 2W7SA 1OP0A 2VVUA 1EJNA 1GBLA 1AN1E 1OX1A 2FIRH 4TWWA 1O3PB 3K6ZA 5F8ZA 2YOLA 1ZSLA 3S69A 5A2MH 1HAPH 2OQUA 4BANB 2ZTXA 1OYTH 3MNCA 1CT4E 1QNJA 1QTFA 2ZHDA 4GCHF 3PM3A 4I8LA 4XBDA 4A1XA 2ZHQH 1TAWA 4TPIZ 3CP7A 4B2CA 3RXFA 2G51A 2B9LA 1GI1A 1S83A 1Z71A 1O2MA 4FUIA 1C5PA 1KXAA 2PTCE 3SGAE 3ZZCA 2PSYA 2BDBA 2PFEA 2OLGA 1IAUA 5FBEA 1HAGE 1EB1H 4MPVA 1IQEA 5JBBS 4X2VA 1O37A 1VGCB 1SBWA 4CREA 2AYWA 4ZKSU 3ZZ9A 2R2MB 3MO6A 2ZPSA 2PKSB 3L3TA 5GPIB 3QTOH 3ZVCA 5C1XA
chains in the Genus database with same CATH superfamily
3GY4A 4A5TS 3VGCB 2CJIA 3P6ZB 5EPYA 2JDID 1S0QA 4UD9H 4VGCC 3D23A 2ZG0H 2BY7X 2RCEA 2ZTZA 4FUDA 4E05H 2PR3A 2GZ7A 3F9EA 2V35A 2V0BA 1QB1A 3SZNA 1P06A 4F4OC 3FVFB 2Z3CA 3VEQB 2WSSD 1UMAH 5AFYH 1O32A 1A3BH 1EZUC 1KLIH 2R0LA 2FO9A 2PTNA 2XRCA 2V3OH 1GJ4H 1IHTH 1BBRE 4CRAA 2W3IA 3ZZ6A 3SBKA 2H5DA 1N8OC 7KMEH 1IQGA 1TA6A 1SGEE 1ZPCA 4WMDA 3UR6A 2KCPA 3B23B 4I8GA 1ZRBA 1O2XA 3P17H 2HNTE 3RXBA 1BTZA 1G36A 1XKBC 4JZEH 2VJ1A 1Y5BT 1UTKA 1E38B 2FXRA 2PSXA 5CHAC 2QA9E 1ELDE 4O03A 1YPEH 1O3JA 2F83A 1O2RA 4H6TA 2BD7A 3M5LA 3LJJA 1O2KA 1TMTH 1ANDA 1ETRH 2JETC 4ISIH 5JBTA 5DP8A 4FETA 3SQHE 2A5IA 4ISNA 1YLCA 3I77A 2R9PA 4GLYA 3SU2A 3HK6B 1VCWA 1YPHE 4GSOA 1OOKB 4FUHA 5HIZA 5LPFA 1HRTH 4Z1MD 3UWJH 4IMQA 4DOQA 3DFLA 3T29A 1N6XA 3ZVFA 1G3DA 3A7VA 3M3VA 3UNQA 3AK5A 2FOBA 4OS2A 2ZU5A 5FPTA 1O2SA 1C5SA 2IN2A 3M35A 3SUFA 4RT0A 1HFDA 2GKVE 2G5NA 1CGHA 1XUJA 1EAUA 1C4U2 4RI0A 1MD8A 2BY6X 2TIOA 2XCFA 2ZEBA 3U1IB 2P59A 2ESTE 3W94A 1GDNA 2W26A 1A5IA 3BTQE 3O8DA 1WTGH 2A2QH 1MU8B 1MTWA 2LNCA 3DA9B 4AFQA 1J8AA 2C8XB 4AFUA 8KME2 3AW0A 1NESE 3FZDA 1T8OA 2I6SA 2ZFPH 3SNAA 4WH6A 4MTBA 1SR5C 4CBNA 3NCLA 1LKBA 1SHYA 4CRGA 4JK6A 3B9FH 1GWAA 2TPIZ 3SU0A 3RLWH 2F9VA 1E36B 2GV6A 4FUFA 3U1JB 1GVKB 2XCNA 5CHBA 1P2OA 4ZXXH 3BTTE 3FFGA 3RXVA 1GBMA 5F53A 1E35B 2ZTYA 5JYIA 3T2NA 3BTWE 3N7DA 3UUZA 4INLA 1WXRA 1SMFE 3V12A 2AERH 1TX6A 3OX7U 4NZQA 5EODA 4DG4A 4F55A 5EIYA 4Q63A 3OTPA 2ZQ2A 1IQNA 1TA2A 4ESTE 2DUCA 1ZJKA 1XXFA 1TBZH 1WBGB 3SQEE 2WUCA 2GCTC 1OKXA 3A7WA 2PUXB 2VH6A 1LHFH 3F2FA 4UFDH 3RXMA 3GY3A 2P8OB 4TYDA 4WMFA 5EJ1A 1INCA 1TALA 1S81A 4AC9A 1HAYB 1A7SA 1VCQA 1O3FA 2KZ4A 1O3BA 3BN9A 2A5KA 3LGUA 3BTDE 3BIVH 1LQDB 4GCHG 2K8IA 1DDJA 1O3LA 1GJ8B 1QCPA 4CHAB 1VITF 3KQDA 1T31A 3A8CA 2VB0A 1C2DA 1RIWC 2P3TB 1IQKA 3SU4A 4CRBA 4DCDA 2ZU3A 2BZ6H 2GV7A 1XM1A 3M37A 2H1UA 4XOJA 1VCPA 4NA7A 1W14U 2FOCA 3MU0A 1V3XA 1JXPA 1GHWH 3ZZBA 4GHTA 3D49H 3Q77A 3F0PA 1XXDA 4KTUA 3KYFA 2SGFE 1C1RA 1P8VC 1B5GH 1QHRB 1DX5M 3GCNA 2WPIS 3U8OH 5IK2D 2PP6A 1C1WH 1NPMA 2VIVA 3TGKE 2AMPA 6CHAB 2A7CA 2P95A 3E6PH 4K69A 1GI8B 1QGFA 1HBTH 1Y3YA 2DE9A 1UCYK 2YMSC 2PHBA 1TPOA 3V3MA 3U9AH 4XFQA 1GDUA 1JRTA 2AMDA 1MABB 3LOXA 3TK6A 3URDA 2I6QA 3SV8A 1O2GH 1BTUA 2J5UA 2UUJB 1AZ8A 1MTNB 2G55A 3H09A 1FXYA 3ZZ4A 1MAXA 1NFWA 3LJOA 3TLOA 4Y8YA 3LGWA 3Q00A 4YZUA 4Q80A 1C5YB 2FTMA 2KFWA 4WMEA 1C5OH 3MNXA 3GCOA 1AWFH 1K1PA 2ZFSA 2ZU1A 3PMBB 1A5GH 1K2I1 1C4Y2 1PQ8A 5F8TA 3PMAB 1WDIA 3LONA 3LPRA 3PWCA 3UTUH 2GMTC 2LP6A 2UWLA 4U30A 4BAOB 1SLUB 1IQJA 4Y8XA 2C8ZB 2F9UA 1GCDA 5EJLA 4MNYA 4JYTA 2WV5A 1GJ9B 1NC6A 1GI9B 4MQAA 1HXFH 1JWTA 1LVMA 1VITH 3EE0B 1PQ7A 1C5XB 2EEKA 3ZVGA 2EQNA 3PWBA 2FS9A 2FOEA 5IYTA 1OWIA 1ZHMA 4B75A 2D2DA 1Z8JB 4AGKA 3SU1A 3R3GB 1HLTH 5T6DA 5DP4A 3S7HB 4ABGA 1XVOA 4K5ZA 1VKYA 1WYKA 1DY8A 1EOJA 1DITH 4IC5A 1V2UT 1W0ZU 5HXFA 2VIOA 5ESBA 2HNTF 4B6FA 2GTBA 4XE4A 1NFYA 3RXDA 3S7KB 1SLVB 2FLBH 3K65B 4FUJA 1VR1H 3TH4H 3HGNA 1UW7A 1ELGA 4JK5A 3VB4A 3OE7D 3SN8A 1GBBA 1QBVH 3NZIA 1SGIB 2RG3A 2ZDAH 2FMJA 3MHWU 5FL7D 1CBWC 1CGJE 2BYAX 3ZVEA 1GI4A 3E90B 1B0EA 2ZHWH 1XVMA 2B5TB 1LVYA 1YPGH 5SGAE 1GPZA 5J4SA 4A1VA 1PPZA 1G2MA 4BXWA 5GNDA 1WCZA 1OS8A 4KKDA 1YF4A 2C8WB 1L0ZA 3SNBA 2EI7A 4ABAA 1K0HA 1THPB 1GGDC 1MUEB 3LGYA 3PROA 3SU3A 1O2QA 2FPZA 3I78A 3UNRA 2ZA5A 4MPUA 1H8HD 1CA8B 4XD7D 2HWLB 1AWHB 1TOMH 1D3TB 3C27B 2THFB 3D62A 1SOTA 3SNEA 1V2NT 4A92A 2FEQH 4YT6H 1SI5H 3RXTA 2ZFTA 3QK1A 2ZDNA 4I32A 1G3EA 5C0UA 1P2NA 3BTME 4HZHA 1COWD 1ELEE 1JBUH 3SZEA 2VNTA 1BBRH 1C2HA 6ESTA 3BF6H 1XUHA 4F49A 1BJUA 2NU4E 4VGCB 4I8JA 1TNLA 1ELVA 2V7QD 3SJOA 2XBVA 5G4BA 2FYQA 1LO6A 5DPAA 3E16B 1O5FH 5F03A 3LC3A 3GY5A 1ZTLA 3QN7A 1GI6A 1V2LT 3GISB 2ZDMA 1AIXH 1VITG 2VGCC 3BIUH 1GMCG 1FQ3A 1S84A 3KNXA 1Y3XA 2A5AA 2ZF0H 2QV1A 1CHGA 1H9HE 2CN0H 3F9GA 3OAAD 1CA0C 5DG6A 2QN5T 3HATH 1K1OA 1K1LA 3ESTA 1FPHH 1C2JA 4MDSA 4BXSA 1O3GA 3LGIA 1QB9A 1AFQC 1YY3A 4ABHA 2BY9X 1AE5A 1N8OB 1THSH 1JOUB 4D7GA 5A8ZA 3EYDA 2A31A 2R3UA 3T27A 1ZGVA 1IHSH 1QJ6B 1DXWA 1BIOA 2XC4A 1O3KA 1DWBH 2VINA 1F5RA 5CHAB 1HJAB 3FANA 1XKAC 5GJ4B 2WPMS 5DP5A 1V2KT 2KCYA 2PV9B 6GCHG 1L1JA 3EDXB 2JETB 4UONA 2Z94A 1DUAA 4K1EA 1Z8RA 1F5LA 1LHGH 1SVPA 3KQEA 3NK8A 2FM2A 3A8DA 4MVNA 4FOUC 1D4PB 1CHOF 3MTYA 1BTXA 1TGCA 1GL0E 1FMGA 1RS0A 1TGSZ 2F9PA 3ATIA 1GI5A 4FU7A 2BVRH 3G01A 4FVDA 5L2YH 5FBIA 1ABJH 1IQMA 4X6MA 5JB9S 1FJSA 1O5DH 1QURH 4K2YA 4XRNA 2B7DH 2EI8A 2PGBB 2BLQA 5A0BA 1TBQH 3TIUA 2BOHB 5EXMA 5JBAS 1HAZB 1Y3UA 1ARBA 3OYPA 1X7AC 2G4UA 1SC8U 1SGFG 1BTWA 1RTLA 2WV9A 2A0QB 3QDZB 1GBEA 3M5OA 3SJIA 3UIRA 1EFRD 1FUJA 2WPKS 2JH6D 1NFXA 1YCPM 2FOHA 4H6SB 1QR3E 1ESTA 1MCVA 1V2WT 2L6OA 2OINA 2BDIA 2P93A 4B71A 5E0HA 5EU8A 1EZQA 4B6EA 4OS4A 3M7UA 1G3BA 2Y7XA 1AFEH 1EOLA 3E8LA 4TSFD 1TNKA 5IDKA 2F4LA 7LPRA 5ABWA 1A3EH 3TJOA 1SHHB 3UPEA 3LGVA 1UVUH 3AASA 3DD2H 2UWOA 4AFSA 1C5TA 4NIWA 3M7TA 2K0QA 2UUFB 2O8TA 1GJ5H 3A88A 4WF8A 3K9XB 3M3TA 3CNRA 1LVOA 2QY0B 2AEIH 1NTPA 1FAXA 2EY4C 1ETSH 4O97A 2Y82A 1WQVH 1DUEA 2GCTB 5KECA 3P8FA 1V2OT 1HAOH 1W0JD 3MO9A 2A7JA 3UY9A 3PLPA 5HM9A 1WU1A 1G2LA 1ANEA 1P10A 1GI0A 2ANWA 2W3KA 1S82A 1AI8H 1LDTT 4ZROA 3U8TH 1MH0A 1BHXF 1S6FA 1TQ7B 1O3AA 3U69H 3RXEA 3P8OA 3RXOA 1CGIE 1NFUA 1DS2E 1GVZA 1TGNA 3DSGA 3KEEA 1RIWB 1ZTKA 1C1VH 3A8AA 3E91A 4KGAA 3OSYA 4UEHH 1Z7KA 3UQVA 1LHEH 2GZ9A 1P01A 2OC7A 1BCUH 2OUAA 1G32B 4Z6AH 1YCPH 5K7RA 1UCYE 4GAWA 1SGCA 2LPRA 2EI6A 2IPQX 1TX8A 1Q2WA 1O5CB 2LELA 3LGTA 2Y81A 2BB4A 3HGPA 2AMQA 3LU9B 4UFGH 4X6NA 1AUTC 2ILNA 3A80A 2B0FA 4DW2U 3M61U 2QGRA 2V3MA 3GS9A 1N6YA 4Q7XA 3VXFH 2GD4B 5DP3A 5HM2A 4YM9A 1MKXH 1PPHE 1Y5AT 2YMSB 3PV4A 1C2GA 4Y6DA 4FUCA 1ZTJA 1P09A 1UTJA 1UTOA 4Y10E 3URCA 1KYNA 1J17T 4Y7AA 3QGNB 1UK4A 3FN8A 1ZOMA 2OBOA 5CMXH 1NU9A 3RC6A 2O8LA 1O3DA 2QXIA 1TPPA 1A4WH 4FU8A 2Y5GA 1HCGA 1MZDA 2ZGBH 1BQYA 1FN6A 1KXDA 2UUKB 2Z7FE 2R0KA 2O9QA 3A81A 1BRUP 2VIDA 1L4DA 3SNDA 3TK9A 2GMTB 4Y8ZA 1C5MD 1V2PT 4SGBE 3ZZDA 2Y6TA 4WJG2 1W0YH 2ZPQA 4OS7A 2Z9JA 2GT8A 3MH5A 1TPAE 5GWZA 2FX6A 1A46H 1UTMA 3KCGH 4X2XA 3GYMA 1HV7A 2BX3A 3Q3YA 1M9UA 3BTGE 3QWCH 1BMAA 1C5VA 1SG8B 2XC5A 4MNXA 4NFFA 4XSKU 3DT0H 2TBSA 3I29A 1U6QA 3GY6A 3FP6E 1GMHF 3BEFB 1CHOG 3QX5H 4J1YA 2BM2A 1S6LA 4AB9A 1LTOA 3MFJA 5KGOA 1O3OA 3RM0H 5HYOA 1K1NA 3QTVH 5GIBA 2FOGA 2OTVA 2G52A 1Y3VA 1O2NA 4Y0ZE 1YBWA 4ZKOU 1DVAH 1GJBB 1GJ6A 5EQSA 4U32A 2F43B 1CBWB 1O0DH 1Y3WA 1EZSC 1ZMJA 3RU4D 2R2WU 2ZCHP 4HG6A 3RMNH 1O2ZA 1SGYE 1TMBH 1EP5A 4NZLA 1KTSB 5F6MA 1SFIA 3F9HA 3BSQA 1C5LH 3ZZ7A 1QJ1B 1JMOH 3A83A 3QGJA 2ZECA 1P2MA 3N7OA 2ANMH 1YYY1 2D8WA 2OCVB 1VJ9U 1W3CA 2Z6BD 2G5VA 1P3CA 4YT7H 1GGDB 7GCHF 1NN6A 2VVVA 2JJ2D 4ZH8A 1P2IA 2GCHF 1NY22 3F6UH 1EZXC 3KL6A 1P12E 3QO6A 1O33A 3A7YA 4WVPE 1KXCA 4AG1A 1O2UA 2FOMB 2Q6GA 3PTNA 1AUJA 1H1BA 2B8OH 2FYRA 2SNWA 2A45B 1QIXB 3N7EA 3UWIA 3N99A 1GG6C 2NWNA 2Z3DA 3PRDA 5A8YA 3QZRA 2JJ1D 2J92A 2ZP0H 3TGJE 2Z9LA 3ZVAA 1MBQA 1XUIA 3MNSA 1SPJA 4OGYA 3ZZAA 1ANBA 1O2LA 2QF0A 3LT3A 1O3EA 2HPPH 3U8RH 4DT7B 1DSUA 2WZQA 3TH2H 1FIWA 3SJKA 1FLEE 1O36A 1QL8A 4NIVA 1H8ED 3VG8A 3EQ0H 1FY5A 1QRWA 3KYGA 4E7NA 4X8VH 2FI4E 5JBCS 2XOKD 1WOFA 2FESH 4GPGA 3SNCA 1GMCF 2HALA 1O2JA 2ZGXH 3BG4C 1XMNB 5JPMH 4NSVA 2Y80A 5EG4A 1Y59T 2ZI2H 2TGTA 1P03A 4QT8C 2VGCB 1JIRA 5GDSH 2XBWA 4Y11E 1TIOA 2KM0A 1G9IE 2OC0A 1QL7A 4ZMAH 1CA0B 2O8UA 1GBIA 1ANCA 4TPYA 5C1UA 1G3CA 1CE5A 2BDAA 2Z3EA 1AFQB 4X8TH 2AIPA 3SV6A 3U98H 1IQHA 2PLXA 2ZPRA 1UVSH 3VB3A 5FPSA 9LPRA 5TCAA 4IMZA 3V0XA 1OWDA 1P3EA 3MYWA 6GCHF 2A1DB 1Z1JA 1DWCH 1FN8A 2TRMA 2VWNA 1GBFA 1YPLH 1P0SH 1YKTA 4B2BA 2QF5A 3F2GA 1MU6B 4JCNA 1OWJA 2ZCLP 4BTUB 1HAXB 5DK1A 2BQ7B 1WUNH 2ZU2A 1HDTH 5E2PA 2H5CA 4KTCA 1ZSKA 4YO9A 4ZHMU 4K1TA 3PRBA 1GMDG 3GY2A 2NU2E 2PGQB 3MU5A 1GHXH 1PYTD 3OU0A 4Q7ZA 1BMMH 1C2KA 5C17A 1ZZZA 1A0HB 1K22H 2ZGJA 1QBNA 2G00A 1GHYH 1XX9A 4GUXA 1C5NH 1SFQB 1S0RA 1MAYA 5HKKD 2W6ID 1BTPA 3ZV8A 4B1TA 3UFAA 1BRBE 4AORA 1O30A 1ZHRA 2QF4A 1GHAG 2O8WA 4BNRA 4ZKRU 4BAHB 3MOCA 3U28C 4HGCA 4E06H 1S5SA 5DSFA 2P3FH 1YPJH 3A7ZA 3UNSA 1TGTA 4X1RU 2C4FH 1BMFD 1GI2A 1EATA 2HVYB 1ORFA 1ZSJA 1YP9A 1C1PA 3P8NA 5DP9A 2YNAA 1S85A 2RFKC 3RMOH 2G81E 2SGAA 4AYYB 1GMHG 4JZFH 1HUTH 4TY7A 1MKWK 4ZXYH 4WH8A 5L2ZH 1C2IA 4AYVB 4Z0KA 3L33A 2CK3D 5AVDA 1O2YA 2VBCA 3JZ2B 3ATMA 1C9PA 2QXJA 4NIYA 1D6WA 3RUOA 1O3CA 2QIQA 1ID5H 3UREA 2ZKSA 4Y79A 2BQWB 4OM9A 4BAMB 1C5WB 1GCTC 1TNIA 2CF8H 3MQKC 1UCYH 1IQIA 3RC5A 5FAHA 1HB0B 2P3UB 1NT1A 1Z6JH 1O5EH 1LMWB 1ZMNA 2FX4A 1L4ZA 1D3QB 1EAWA 1QZ8A 1SLXB 1EX3A 1W7XH 2XBYA 4ISOA 5GCHF 1NZQH 1O3IA 1UHBB 1EKBB 1DICA 1ELTA 1YPKH 1QQ4A 4K8YA 7GCHG 3LC5A 4GVUA 3VB7A 1P57B 1TRYA 2GCHG 4U01A 4BTIB 4Q2KA 2D1JA 3OFND 4D8NA 2ODPA 1VJAU 2ZDVH 1RRKA 1SQRA 4U2WA 3ATKA 2VIQA 4IGDA 1DANH 4LZ1H 3K6YA 1OHHD 1ELAA 3A86A 4KTSA 4B76A 3ZVBA 8GCHG 2OC1A 3MU8A 1W13U 3P70B 1AKSB 2Y7ZA 3NKKA 1CVWH 2BHGA 2PKAB 2H9HA 1GHZA 1TWXB 2GZ8A 1V2VT 3P95A 2G8TA 3FP7E 4X0WU 1UHBA 3IG6B 2ZWLH 1NU7B 3MI4A 4FXGH 4ZUHA 2BDYA 3TK5A 2BDHA 2SGPE 3VPKA 3D65E 2YNBA 2BMGB 2ZU4A 1UK2A 4MPWA 1H9LB 1C1OA 4PROA 1P2JA 1Q31A 1NRQH 4DURA 1CO7E 1Z8GA 3T5FH 1YM0A 5HMAA 3WWBA 1GI7B 2RA3A 3NPSA 4IC6A 4JZIA 1PQ5A 2BLVA 1EPTC 3MH6A 4OS6A 3LH1A 3HK3B 3S9BA 1AKSA 2BX4A 3HPTB 1OP8A 1C1TA 2PKAA 3AW1A 1MD7A 1FY4A 3SGBE 4DY7B 1B0FA 1H8DH 3EGKH 1B7XB 4UDWH 2Q6FA 3ELAH 1O38A 1IOEA 1MMJN 4UFEH 1GJCB 1KY9A 4ISLA 4JYVH 3BTFE 4NCYA 1Z8IB 4IBLH 3RP2A 1TONA 3T28A 4I86A 3UAIC 4BAQB 1TPSA 2EC9H 1DT2A 1SL3A 2BZAA 1H4WA 1EAXA 2XWBI 2M5TA 3SOSA 2CF9H 1ELFA 4WWYA 1AQ7A 4K3JA 5CE1A 1A61H 1T8NA 2J2UA 4I33A 3H7OA 1OXGA 5HGGA 1QA0A 4YLUA 1ZHPA 1BB0B 3SU6A 4Q4LA 2FLRH 3RXUA 1T7CA 4RN6A 5C0TA 2Z9KA 1EP6A 3GDSA 1TB6H 2VH0A 1V6DA 2ZNKH 1BA8B 1T4VH 3RXAA 3SU5A 1DLKB 2BD3A 4AN7A 2AFQB 2ODQA 3DSPA 3UOUA 2F9OA 2Q1JA 3KGPA 4NSYA 2ZDKA 2IOTA 3ZV9A 1ZPZA 2NU3E 2VWMA 5TCCA 4X1SU 5J4QA 3OEED 1AHTH 2J34A 4YOGA 3RU4E 3WY8A 3LIWA 1OYQA 2ZZUH 5EXNA 2ANKH 1FAKH 2C8YB 1O3MA 2SGQE 3CENA 4YXWD 5ESTE 1A5HA 1HJ9A 1MZAA 1YCPK 1GBDA 1C5QA 3BEIB 4NWKA 3OTJE 3RXQA 3ZYEA 2Y5HA 4DIIH 1P05A 1W2KH 4I31A 5DO4H 4XBBA 5A09A 4LZ4B 1MTSA 1CT2E 1EB2A 5B6LA 2PUQH 3M7QA 5A0CA 1F0SA 4XBCA 1K21H 2VU8E 3EA8A 4HTCH 1E37B 2BDGA 5EQRA 1AD8H 3E0NB 4OS1A 1BRAA 1FV9A 1MKXK 3QZQA 1K9OE 1O3NA 2HNTC 4O3UA 4AGJA 1K1MA 5DN6D 2WINI 1UJ1A 3WWFA 2ZDLA 2SFAA 1EAIA 1GDQA 1P2KA 3OY5U 1GG6B 1MBMA 5C67A 1DLEA 1DXPA 2AGGX 3RM2H 1E1QD 1KXFA 4MG3A 4P00A 4WY3A 1K1IA 1N1LA 1MQ6A 1MCTA 1TMUH 2NU0E 4I7YH 1AB9C 2QCYA 2BD9A 2AGEX 1QB6A 2OD3B 3PV5A 1C4V2 2BLWA 3FO8D 2A4QA 3PB1E 3T25A 3PO1C 3ITIA 2FI3E 1ETTH 4X1QU 1RXPA 2VIPA 3SUGA 1YPHC 2BD2A 1ESAA 2W6JD 3GDUA 3NWUA 1LCYA 1BTYA 5B6OA 1RGQA 1JRSA 2BD4A 1WV7H 2IJOB 2FTLE 4MPXA 5GCHG 2A4OA 2HGTH 1AVXA 1KDQB 3BG4B 2CV3A 1SGTA 3ZYDA 4HFPB 4X6OA 5JDUB 5LGOA 3K2UA 3SW2B 5C20A 1ABIH 5T6GA 2YMSD 4CRDA 1UVTH 1P9UA 1P11E 1GBCA 1F0UA 1TLDA 4MNWA 3VB5A 1OPHB 3A87A 1BHXB 2WPLS 3ZZ8A 3MWIU 3SV7A 3GICB 4LOYH 1C1QA 2CMYA 4A7IB 1MQ5A 1F2SE 1SGQE 1FI8A 1LQEA 3F0OA 1AE8H 3T62A 4ZCNA 3FKSD 5DKMA 4IW4E 2ANYA 1D3PB 1SGPE 5AF9H 1V2MT 2V6NA 4A6LA 3ATWA 3GCHC 1KDQA 3IITA 3DHKH 3SUDA 2J97A 1NRNH 3A84A 1ZLRA 4GHQA 2XNIA 3AAUA 2GX4A 3RXJA 3PMJA 1TABE 1QL9A 2XYAA 1RTFB 1NM6A 3PLBA 3SJ9A 3GOVB 1WSSH 5FCRA 2P94A 4YOJA 2O8MA 1TRMA 4X8UH 1SGDE 4K60A 1GMDF 1F0TA 4NA8A 3SI4H 2UWPA 3DUXH 4JZDH 5EJZA 1GHVH 1LHDH 2ZGCA 1F7ZA 3SV9A 5EGMA 2ZCKP 3M3SA 1DFPA 1NBMD 2F9BH 1BTHH 4DIHH 3A7XA 3O8RA 1QBOA 1V2ST 1WAYB 2RDLA 1CT0E 4ACBA 1GHAF 2AHME 3AAVA 2OBQA 3F2HA 4WXVA 5DJ7A 3RXHA 1QFKH 5FX5A 4X2WA 4Y76A 1C1MA 1DOJA 1OWKA 1LHCH 2UUYA 4ZKNU 1C5ZB 2TGDA 1WTHD 2J9NA 1HXEH 2XWAA 3GY8A 1GBJA 3MH7A 4AOQA 4ABBA 1C9TA 2FODA 1UVPA 2J38A 5FXLA 1AZZA 3FZZA 5EOKA 3HKJB 1HJAC 4YTAA 2HLDD 3JZ1B 1CU1A 2ODYB 4CRFA 1CSOE 4INKA 4O3TA 4CR9A 1TQ0B 2L74A 4UE7H 1J14A 1LKAA 3VFEA 3SHAH 1EASA 1EUFA 4BAKB 1GHBF 1EJMA 4DT4A 1AVWA 5FHTA 1ZPBA 1C2MA 4ACAA 1ZGIA 2PWXA 1Z1IA 2ALVA 5EPNA 1NO9H 3TNTA 2OQ5A 3LDXH 1NROH 2WPHS 3NXPA 1HNEE 5BRRE 1SGNE 2TGPZ 4DGJA 3NUMA 4OGXA 1NS3A 2ZHFH 1UVOA 2W7UA 1C2LA 3WW7A 2HRVA 3RU4T 1YLDA 3CS7A 3KQCA 1FPCH 3RXGA 2KCAA 1EJAA 1J16A 1FY8E 4X8SH 1GCTB 3ODFA 1OWHA 2SNVA 2Q6DA 2CHAC 4Y71A 5C2ZA 3TGIE 5E8EH 5C5NA 1DWEH 1KLJH 1YPMH 3GCTF 3M5MA 3EA9A 4SGAE 4A1TA 3MH4A 1AU8A 2HOBA 1ESBA 1FX0B 4NA9H 2A2XH 3R0FA 2ASUB 1C1NA 3C1KA 1W7GH 1AO5A 1J15A 5I46H 2VVCA 2F9NA 1BRCE 5EW1H 2XBXA 8GCHF 1GVLA 3SUEA 1NRRH 2A4RA 1PPGE 4RKOB 1A0JA 2BD5A 2FP7B 4THNH 2BQ6B 1W12U 2A7HA 1NRPH 4E7RG 1S6HA 1VZQH 3M5NA 3W1EA 1ZJDA 2GDDA 3H7TA 3SO3A 3QLPH 2ZQ1A 2V3HH 4B74A 3PMHB 2BVSH 1Z6EA 1O2PA 1PJPA 2FOFA 1LPKB 2GT7A 1GI3A 3RMLH 2EA3A 1WQSA 8ESTE 1DY9A 3TVJB 1MTUA 2H9TH 1SB1H 2XXLA 2C90B 3GY7A 1DM4B 4ABFA 1BZXE 1K28D 5AHGH 2QYIA 3VB6A 1EPTB 5FX6A 1RD3B 4K1SA 1SQAA 1GBTA 2QXGA 3UQOA 4K8BA 3V7TA 4Q7YA 5A8XA 1YGCH 2CGAA 4AG2A 1UTNA 3KHVA 3FOAA 2GGVB 1IQLA 4B73A 1VGCC 1P9SA 2HLCA 1O39A 3BEUA 3RXIA 1H8IH 2PKSC 3F68H 4DJZB 4BOHA 1YWUA 3FP8E 1O3HA 2WPDD 4O9VA 1EPTA 5AFZH 3VGCC 1C5UA 2A4GA 3RXRA 2ZFRH 2R3YA 1KLTA 4FUGA 1TNGA 1T8MA 2F91A 1FZZA 2C3SA 2KX4A 2H9EH 1QJ7B 2AH4X 2OC8A 1HPGA 3BTEE 3RMMH 1G37A 4UFFH 7ESTE 2P16A 4D9QA 4AFZA 4M7GA 1D9IA 5E2OA 4FUBA 2IJD1 4D7FA 2ZGHA 2GP9B 3E0PB 3E3TA 3RXSA 1E34B 4OS5A 2OXSA 3MNBA 2BD8A 3IWMA 5EW2H 4ZAEA 2A32A 4X1PU 3RDZA 2XTTB 1PPCE 4NWLA 4R8TB 1C2EA 3OEHD 4RT1A 8LPRA 4ABIA 2KR7A 3ODDA 1XUFA 4X1NU 2ALPA 1QY6A 1T32A 2RDEA 3E1XB 9ESTA 4YESB 1T4UH 1V2TT 2BTCE 2WV4A 3T26A 2WYGA 2C93B 1H9IE 4ZHLU 1TNHA 2VWLA 1ARCA 1HGTH 3BG8A 3SYJA 1AMHA 1G30B 5PTPA 4J2YB 3LKWA 5H4IB 2WPJS 1D3DB 2STBE 1UTQA 4KELA 2F3CE 4NIXA 1UTPA 1HAVB 2JH5D 1BBRK 1YC0A 4KP0A 4ABDA 1Q3XA 4JYUH 4ASUD 2W5EA 2ZC9H 3TU7H 2JKHA 2QXHA 1A0LA 1W10U 2H6MA 2QAAA 2BVXH 1SKYE 1XUGA 4H4FA 3L6PA 2H2ZA 2JIZD 3KQBA 1V2RT 1KSNA 5TJXA 2FDAA 2D26C 3AVZA 2FWWA 3A89A 3KN2A 4P02A 2BY8X 4I8KA 4AX9H 2FZZA 1GHBG 1O5GH 5C94A 3ZZ3A 2ZIQH 5L30H 1SGFA 1TNJA 2Y5FA 1OSSA 1YLNA 1HAVA 2BY5X 2FI5E 1F5KU 2Z9GA 4LXBH 3SJ8A 2WUBA 1DSTA 1C5RA 1W0KD 4JZ1A 1FDPA 1ELBA 4MLFB 2AS9A 2ZFQH 5A0AE 3SI3H 3S0NA 4AZ2B 3HKIB 1SQOA 3UB0A 3A85A 1TFXA 4M9FA 1ZR0A 3SGQE 3UR9A 1JIMA 1O2IA 1AB9B 2BDCA 2STAE 3KF2A 5CDFE 1FONA 1UO6A 2J94A 1W11U 1FIZA 1GBKA 1TE0A 3MMGA 3S9AA 1EQ9A 2XC0A 3PO1B 6LPRA 1GJDB 1UTLM 3H5CB 5DP7A 3GCTG 4Y7BA 1THRH 3OY6U 2VIWA 3TH3H 5C1YA 3STIA 2J98B 4WXIA 1HAIH 5I25A 1DWDH 4B2AA 1OP2A 1HAHH 3SHCH 1ZMLA 1LVBA 4FVBA 4I8HA 5E0GA 4CH2B 3O8CA 1KXEA 3Q3KA 1O2HA 3ZIAD 4R0IA 1P04A 1KIGH 1SQTA 3CS0A 4YOIA 1V2JT 4RSPA 3EAJA 5LH8A 1O2OA 1IQFA 4TT3D 4X6PA 4FUEA 5E0JA 4YLQH 1LPGB 2GJGA 1QRXA 5FCKA 3P8GA 2J98A 2HPQH 2CXVA 5FPYA 1O35A 3EA7A 5C5OA 2K1QA 1GJAB 3TNSA 3GCHB 1F92A 5T3HA 3RC4A 1NRSH 1SLWB 2KAIB 5GXPA 1PFXC 4IN1A 5BPEA 3F1SB 3TJUA 1L1NA 1V2QT 3UOPA 5LPRA 1PPBH 2P8OC 4ZHAA 3V13A 3VXEH 2GVFA 2BXUH 2ULLA 1C2FA 1PQAA 2OP9A 4AB8A 3P92A 3RXCA 3F3BA 1O2WA 5K0HA 3Q3XA 1MKWH 5DP6A 3A82A 1BT7A 1KXBA 3BTHE 1ACBE 1P2QA 2ZHEH 3KQ5A 4CHAC 2AGIX 2BOKA 1ZRKA 2RA0A 3TITA 1NBME 2BXTH 2SGDE 5LPEA 1LPZB 5HIYA 1CQQA 2KAIA 4NG9H 4RKJB 3A8BA 4ASHA 1QRZA 1DE7H 4ISHH 3GYLB 1O2VA 5ETXA 2WYJA 4TWYA 1BJVA 2ZO3H 4FU9A 1BITA 3DFJA 3RLYH 1GL1A 1XUKA 2OK5A 4LK4A 4CH8B 1HYLA 3GDVA 5KEDA 1T8LA 1MTVA 2BLOA 2J95A 1BDAA 3ZZ5A 3MU1A 3ENSB 1TBRH 3EE7A 2JH0D 1FY3A 5EXLA 6CHAC 1QA7A 1SGRE 1TGBA 3DSOA 2WHXA 5L6NH 3MU4A 3ATLA 1PPFE 1Y8TA 4NGAH 4BTTB 4X2YA 1W8BH 1FY1A 1DPOA 1QQUA 2TGAA 4MNVA 3BTKE 3RXPA 1MTNC 5T6FA 1BMLA 4IS5A 2QC2A 2AIQA 1O5AB 2FS8A 1A2CH 5DGJA 3LH3A 3TJVA 4ABEA 2DE8A 1GBHA 3QUMP 2J4IA 3S9CA 1BMNH 4D9RA 1GBAA 5F8XA 3KIDU 1O31A 1E79D 3A7TA 1O5BB 3PLKA 1GJ7B 5C3NA 1HJ8A 1L1GA 4XDEA 1HIAB 1UK3A 1E0FD 2M2AA 2ZFFH 3TJNA 3MO3A 3ZVDA 4HI3A 1BOQA 2HVXA 3RXLA 4D76A 2XNDD 2VWOA 3PTBA 1O34A 3SORA 3TPIZ 4CRCA 1D6RA 2CHAB 1O2TA 1ZYOA 4Y0YE 2XW9A 3F9FA 1J9CH 1KTTB 3PV2A 4IN2A 4CBOA 1K1JA 1PPEE 3DCLA 4H42U 2Z9IA 1FNIA 4CR5A 3SV2H 3RXKA 1PYTC 1BUIA 1F0RA 3W95A 1A1RA 1C1SA 1HIAA 5EQQA 4NFEA 5JB8S 5T1VA 3B8JA 1ELCA 1AY6H 4TY6A 1RJXB 1SOZA 4F48B 4JMYA 1C1UH 1SSXA 1RFNA 1RTKA 1EXFA 3FAOA 1P02A 2FOAA 1AGJA 1TOCB 1TRNA 2SGEE 1Y5UT 3BV9B 2KCOA 1E1RD 4ABJA 4DVAU 3M36A 3O8BA 2QF3A 2PW8H 2GDEH 1OWEA 1TYNA 2NU1E 2G4TA 4INHA 1AVGH 2IPHA 3STJA 1L2EA 1TX7A 3Q76A 3PYHA 2W7SA 1OP0A 2VVUA 1EJNA 1GBLA 1AN1E 1OX1A 2FIRH 4TWWA 1O3PB 3K6ZA 3NRLA 5F8ZA 2YOLA 1ZSLA 3S69A 5A2MH 1HAPH 2OQUA 4BANB 2ZTXA 1OYTH 3MNCA 1CT4E 1QNJA 1QTFA 2ZHDA 4GCHF 3PM3A 4I8LA 4XBDA 4A1XA 2ZHQH 1TAWA 4TPIZ 3CP7A 4B2CA 3RXFA 2G51A 2B9LA 1GI1A 1S83A 1Z71A 1O2MA 4FUIA 1C5PA 2QE7D 1KXAA 2PTCE 3SGAE 3ZZCA 2PSYA 2BDBA 2PFEA 2OLGA 1IAUA 5FBEA 1HAGE 1EB1H 4MPVA 1IQEA 5JBBS 4X2VA 1O37A 1VGCB 1SBWA 4CREA 2AYWA 1KMHB 4ZKSU 3ZZ9A 2R2MB 3MO6A 2ZPSA 2PKSB 3L3TA 5GPIB 3QTOH 3ZVCA 5C1XA
chains in the Genus database with same CATH topology
3GY4A 4A5TS 3VGCB 2CJIA 3P6ZB 5EPYA 1S0QA 4UD9H 4VGCC 3D23A 2ZG0H 2BY7X 2RCEA 2ZTZA 4FUDA 4E05H 2PR3A 2GZ7A 3F9EA 2V35A 2V0BA 1QB1A 3SZNA 1P06A 4F4OC 3FVFB 2Z3CA 3VEQB 1UMAH 5AFYH 1O32A 1A3BH 1EZUC 1KLIH 2R0LA 2FO9A 2PTNA 2XRCA 2V3OH 1GJ4H 1IHTH 1BBRE 4CRAA 2W3IA 3ZZ6A 3SBKA 2H5DA 1N8OC 7KMEH 1IQGA 1TA6A 1SGEE 1ZPCA 4WMDA 3UR6A 3B23B 4I8GA 1ZRBA 1O2XA 3P17H 2HNTE 3RXBA 1BTZA 1G36A 1XKBC 4JZEH 2VJ1A 1Y5BT 1UTKA 1E38B 2FXRA 2PSXA 5CHAC 2QA9E 1ELDE 4O03A 1YPEH 1O3JA 2F83A 1O2RA 4H6TA 2BD7A 3M5LA 3LJJA 1O2KA 1TMTH 1ANDA 1ETRH 2JETC 4ISIH 5JBTA 5DP8A 3SQHE 2A5IA 4ISNA 1YLCA 3I77A 2R9PA 4GLYA 3SU2A 3HK6B 1VCWA 1YPHE 4GSOA 1OOKB 4FUHA 5LPFA 1HRTH 3UWJH 4IMQA 4DOQA 3DFLA 3T29A 1N6XA 3ZVFA 1G3DA 3A7VA 3M3VA 3UNQA 2FOBA 4OS2A 2ZU5A 5FPTA 1O2SA 1C5SA 2IN2A 3M35A 3SUFA 1HFDA 2GKVE 2G5NA 1CGHA 1XUJA 1EAUA 1C4U2 1MD8A 2BY6X 2TIOA 2XCFA 2ZEBA 3U1IB 2P59A 2ESTE 3W94A 1GDNA 2W26A 1A5IA 3BTQE 3O8DA 1WTGH 2A2QH 1MU8B 1MTWA 2LNCA 3DA9B 4AFQA 1J8AA 2C8XB 4AFUA 8KME2 3AW0A 1NESE 3FZDA 1T8OA 2I6SA 2ZFPH 3SNAA 4WH6A 4MTBA 1SR5C 4CBNA 3NCLA 1LKBA 1SHYA 4CRGA 4JK6A 3B9FH 1GWAA 2TPIZ 3SU0A 3RLWH 2F9VA 1E36B 2GV6A 4FUFA 3U1JB 1GVKB 2XCNA 1P2OA 4ZXXH 3BTTE 3FFGA 3RXVA 1GBMA 1E35B 2ZTYA 5JYIA 3T2NA 3BTWE 3UUZA 4INLA 1SMFE 3V12A 2AERH 1TX6A 3OX7U 4NZQA 5EODA 4DG4A 2ZQ2A 1IQNA 1TA2A 4ESTE 2DUCA 1ZJKA 1XXFA 1TBZH 1WBGB 3SQEE 2WUCA 2GCTC 1OKXA 3A7WA 2PUXB 2VH6A 1LHFH 4UFDH 3RXMA 3GY3A 2P8OB 4TYDA 4WMFA 1INCA 1TALA 1S81A 1HAYB 1A7SA 1VCQA 1O3FA 3BN9A 1O3BA 2A5KA 3LGUA 3BTDE 3BIVH 1LQDB 4GCHG 1DDJA 1O3LA 1GJ8B 1QCPA 4CHAB 1VITF 3KQDA 1T31A 3A8CA 2VB0A 1C2DA 1RIWC 2P3TB 1IQKA 3SU4A 4CRBA 4DCDA 2ZU3A 2BZ6H 2GV7A 1XM1A 3M37A 2H1UA 4XOJA 1VCPA 4NA7A 1W14U 2FOCA 3MU0A 1V3XA 1JXPA 1GHWH 3ZZBA 4GHTA 3D49H 3Q77A 1XXDA 4KTUA 2SGFE 1C1RA 1P8VC 1B5GH 1QHRB 1DX5M 3GCNA 2WPIS 3U8OH 1C1WH 1NPMA 2VIVA 3TGKE 2AMPA 6CHAB 2A7CA 2P95A 3E6PH 4K69A 1GI8B 1QGFA 1HBTH 1Y3YA 2DE9A 1UCYK 2PHBA 1TPOA 3V3MA 3U9AH 4XFQA 1GDUA 1JRTA 2AMDA 3LOXA 3TK6A 3URDA 2I6QA 3SV8A 1O2GH 1BTUA 2UUJB 1AZ8A 1MTNB 2G55A 1FXYA 3ZZ4A 1MAXA 1NFWA 3LJOA 3TLOA 4Y8YA 3LGWA 3Q00A 4YZUA 4Q80A 1C5YB 2FTMA 4WMEA 1C5OH 3MNXA 3GCOA 1AWFH 1K1PA 2ZFSA 2ZU1A 3PMBB 1A5GH 1K2I1 1C4Y2 1PQ8A 5F8TA 3PMAB 3PWCA 3LONA 3LPRA 3UTUH 2GMTC 2UWLA 4U30A 4BAOB 1SLUB 1IQJA 4Y8XA 2C8ZB 2F9UA 1GCDA 4MNYA 4JYTA 2WV5A 1GJ9B 1NC6A 1GI9B 4MQAA 1HXFH 1JWTA 1LVMA 1VITH 3EE0B 1PQ7A 1C5XB 2EEKA 3ZVGA 3PWBA 2FS9A 2FOEA 5IYTA 1OWIA 1ZHMA 4B75A 2D2DA 1Z8JB 4AGKA 3SU1A 3R3GB 1HLTH 5T6DA 5DP4A 3S7HB 4ABGA 1XVOA 4K5ZA 1WYKA 1DY8A 1EOJA 1DITH 4IC5A 1V2UT 1W0ZU 5HXFA 2VIOA 5ESBA 2HNTF 2GTBA 4XE4A 1NFYA 3RXDA 3S7KB 1SLVB 2FLBH 3K65B 4FUJA 1VR1H 3TH4H 3HGNA 1ELGA 4JK5A 3VB4A 3SN8A 1GBBA 1QBVH 3NZIA 1SGIB 2RG3A 2ZDAH 2FMJA 3MHWU 1CBWC 1CGJE 2BYAX 3ZVEA 1GI4A 3E90B 1B0EA 2ZHWH 1XVMA 2B5TB 1LVYA 1YPGH 5SGAE 1GPZA 5J4SA 4A1VA 1PPZA 1G2MA 4BXWA 1WCZA 1OS8A 4KKDA 1YF4A 2C8WB 1L0ZA 3SNBA 2EI7A 4ABAA 1THPB 1GGDC 1MUEB 3LGYA 3PROA 3SU3A 1O2QA 2FPZA 3I78A 3UNRA 2ZA5A 4MPUA 1CA8B 2HWLB 1AWHB 1TOMH 1D3TB 3C27B 2THFB 3D62A 1SOTA 3SNEA 1V2NT 4A92A 2FEQH 4YT6H 1SI5H 3RXTA 2ZFTA 3QK1A 2ZDNA 4I32A 1G3EA 1P2NA 3BTME 4HZHA 1ELEE 1JBUH 2VNTA 1BBRH 1C2HA 6ESTA 3BF6H 1XUHA 4F49A 1BJUA 2NU4E 4VGCB 4I8JA 1TNLA 1ELVA 3SJOA 2XBVA 5G4BA 2FYQA 1LO6A 5DPAA 3E16B 1O5FH 5F03A 3LC3A 3GY5A 1ZTLA 3QN7A 1GI6A 1V2LT 3GISB 2ZDMA 1AIXH 1VITG 2VGCC 3BIUH 1GMCG 1FQ3A 1S84A 3KNXA 1Y3XA 2A5AA 2ZF0H 2QV1A 1CHGA 1H9HE 2CN0H 3F9GA 1CA0C 5DG6A 2QN5T 3HATH 1K1OA 1K1LA 3ESTA 1FPHH 1C2JA 4MDSA 4BXSA 1O3GA 3LGIA 1QB9A 1AFQC 4ABHA 2BY9X 1AE5A 1N8OB 1THSH 1JOUB 4D7GA 5A8ZA 3EYDA 2A31A 2R3UA 3T27A 1ZGVA 1IHSH 1QJ6B 1DXWA 1BIOA 2XC4A 1O3KA 1DWBH 2VINA 1F5RA 5CHAB 1HJAB 3FANA 1XKAC 5GJ4B 2WPMS 5DP5A 1V2KT 2PV9B 6GCHG 1L1JA 3EDXB 2JETB 4UONA 2Z94A 1DUAA 4K1EA 1Z8RA 1F5LA 1LHGH 1SVPA 3KQEA 3NK8A 2FM2A 3A8DA 4MVNA 1D4PB 1CHOF 3MTYA 1BTXA 1TGCA 1GL0E 1FMGA 1RS0A 1TGSZ 2F9PA 3ATIA 1GI5A 4FU7A 2BVRH 3G01A 4FVDA 5L2YH 5FBIA 1ABJH 1IQMA 4X6MA 5JB9S 1FJSA 1O5DH 1QURH 4K2YA 2B7DH 2EI8A 2PGBB 2BLQA 5A0BA 1TBQH 3TIUA 2BOHB 5EXMA 5JBAS 1HAZB 1Y3UA 1ARBA 3OYPA 1X7AC 2G4UA 1SC8U 1SGFG 1BTWA 1RTLA 2A0QB 3QDZB 1GBEA 3M5OA 3SJIA 3UIRA 1FUJA 2WPKS 2JH6D 1NFXA 1YCPM 2FOHA 4H6SB 1QR3E 1ESTA 1MCVA 1V2WT 2OINA 2BDIA 2P93A 4B71A 5E0HA 5EU8A 1EZQA 4OS4A 3M7UA 1G3BA 2Y7XA 1AFEH 1EOLA 3E8LA 1TNKA 5IDKA 7LPRA 5ABWA 1A3EH 3TJOA 1SHHB 3UPEA 3LGVA 1UVUH 3AASA 3DD2H 2UWOA 4AFSA 1C5TA 4NIWA 3M7TA 2UUFB 2O8TA 1GJ5H 3A88A 4WF8A 3K9XB 3M3TA 1LVOA 2QY0B 2AEIH 1NTPA 1FAXA 1ETSH 4O97A 2Y82A 1WQVH 1DUEA 2GCTB 3P8FA 1V2OT 1HAOH 3MO9A 2A7JA 3UY9A 3PLPA 5HM9A 1WU1A 1G2LA 1ANEA 1P10A 1GI0A 2ANWA 2W3KA 1S82A 1AI8H 1LDTT 4ZROA 3U8TH 1MH0A 1BHXF 1S6FA 1TQ7B 1O3AA 3U69H 3RXEA 3P8OA 3RXOA 1CGIE 1NFUA 1DS2E 1GVZA 1TGNA 3KEEA 1RIWB 1ZTKA 1C1VH 3A8AA 3E91A 4KGAA 3OSYA 4UEHH 1Z7KA 3UQVA 1LHEH 2GZ9A 1P01A 2OC7A 1BCUH 2OUAA 1G32B 4Z6AH 1YCPH 5K7RA 1UCYE 4GAWA 1SGCA 2LPRA 2EI6A 1TX8A 1Q2WA 1O5CB 3LGTA 2Y81A 2BB4A 3HGPA 2AMQA 3LU9B 4UFGH 4X6NA 1AUTC 2ILNA 3A80A 2B0FA 4DW2U 3M61U 2QGRA 1N6YA 4Q7XA 3VXFH 2GD4B 5DP3A 5HM2A 4YM9A 1MKXH 1PPHE 1Y5AT 3PV4A 1C2GA 4Y6DA 4FUCA 1ZTJA 1P09A 1UTJA 1UTOA 4Y10E 3URCA 1KYNA 1J17T 4Y7AA 3QGNB 1UK4A 1ZOMA 2OBOA 5CMXH 1NU9A 3RC6A 2O8LA 1O3DA 2QXIA 1TPPA 1A4WH 4FU8A 2Y5GA 1HCGA 1MZDA 2ZGBH 1BQYA 1FN6A 1KXDA 2UUKB 2Z7FE 2R0KA 2O9QA 3A81A 1BRUP 2VIDA 1L4DA 3SNDA 3TK9A 2GMTB 4Y8ZA 1C5MD 1V2PT 4SGBE 3ZZDA 2Y6TA 4WJG2 1W0YH 2ZPQA 4OS7A 2Z9JA 2GT8A 3MH5A 1TPAE 5GWZA 2FX6A 1A46H 1UTMA 3KCGH 4X2XA 3GYMA 1HV7A 2BX3A 3Q3YA 1M9UA 3BTGE 3QWCH 1BMAA 1C5VA 1SG8B 2XC5A 4MNXA 4NFFA 4XSKU 3DT0H 2TBSA 3I29A 1U6QA 3GY6A 3FP6E 1GMHF 3BEFB 1CHOG 3QX5H 4J1YA 2BM2A 4AB9A 1LTOA 3MFJA 1O3OA 3RM0H 5HYOA 1K1NA 3QTVH 5GIBA 2FOGA 2OTVA 2G52A 1Y3VA 1O2NA 4Y0ZE 1YBWA 4ZKOU 1DVAH 1GJBB 1GJ6A 5EQSA 4U32A 1CBWB 1O0DH 1Y3WA 1EZSC 1ZMJA 3RU4D 2R2WU 2ZCHP 3RMNH 1O2ZA 1SGYE 1TMBH 1EP5A 4NZLA 1KTSB 5F6MA 1SFIA 3F9HA 3BSQA 1C5LH 3ZZ7A 1QJ1B 1JMOH 3A83A 3QGJA 2ZECA 1P2MA 3N7OA 2ANMH 1YYY1 2D8WA 2OCVB 1VJ9U 1W3CA 2Z6BD 2G5VA 1P3CA 4YT7H 1GGDB 7GCHF 1NN6A 2VVVA 4ZH8A 1P2IA 2GCHF 1NY22 3F6UH 1EZXC 3KL6A 1P12E 3QO6A 1O33A 3A7YA 4WVPE 1KXCA 4AG1A 1O2UA 2FOMB 2Q6GA 3PTNA 1AUJA 1H1BA 2B8OH 2FYRA 2SNWA 2A45B 1QIXB 3UWIA 1GG6C 2NWNA 2Z3DA 5A8YA 3QZRA 2ZP0H 2J92A 3TGJE 2Z9LA 3ZVAA 1MBQA 1XUIA 3MNSA 1SPJA 4OGYA 3ZZAA 1ANBA 1O2LA 2QF0A 3LT3A 1O3EA 2HPPH 3U8RH 4DT7B 1DSUA 3TH2H 1FIWA 3SJKA 1FLEE 1O36A 1QL8A 4NIVA 3EQ0H 1FY5A 1QRWA 4E7NA 4X8VH 2FI4E 5JBCS 1WOFA 2FESH 4GPGA 3SNCA 1GMCF 2HALA 1O2JA 2ZGXH 3BG4C 1XMNB 5JPMH 4NSVA 2Y80A 5EG4A 1Y59T 2ZI2H 2TGTA 1P03A 4QT8C 2VGCB 1JIRA 5GDSH 2XBWA 4Y11E 1TIOA 2OC0A 1G9IE 1QL7A 4ZMAH 1CA0B 2O8UA 1GBIA 1ANCA 4TPYA 5C1UA 1G3CA 1CE5A 2BDAA 2Z3EA 1AFQB 4X8TH 2AIPA 3SV6A 3U98H 1IQHA 2PLXA 2ZPRA 1UVSH 3VB3A 5FPSA 9LPRA 5TCAA 4IMZA 3V0XA 1OWDA 1P3EA 3MYWA 6GCHF 2A1DB 1Z1JA 1DWCH 1FN8A 2TRMA 2VWNA 1GBFA 1YPLH 1P0SH 1YKTA 4B2BA 1MU6B 4JCNA 1OWJA 2ZCLP 4BTUB 1HAXB 5DK1A 2BQ7B 1WUNH 2ZU2A 1HDTH 5E2PA 2H5CA 4KTCA 1ZSKA 4YO9A 4ZHMU 4K1TA 1GMDG 3GY2A 2NU2E 2PGQB 3MU5A 1GHXH 1PYTD 3OU0A 4Q7ZA 1BMMH 1C2KA 1ZZZA 1A0HB 1K22H 2ZGJA 1QBNA 2G00A 1GHYH 1XX9A 4GUXA 1C5NH 1SFQB 1S0RA 1MAYA 1BTPA 3ZV8A 4B1TA 3UFAA 1BRBE 4AORA 1O30A 1ZHRA 1GHAG 2O8WA 4BNRA 4ZKRU 4BAHB 3MOCA 4HGCA 4E06H 1S5SA 2P3FH 1YPJH 3A7ZA 3UNSA 1TGTA 4X1RU 2C4FH 1GI2A 1EATA 1ORFA 1ZSJA 1YP9A 1C1PA 3P8NA 5DP9A 2YNAA 1S85A 3RMOH 2G81E 2SGAA 4AYYB 1GMHG 4JZFH 1HUTH 4TY7A 1MKWK 4ZXYH 4WH8A 5L2ZH 1C2IA 4AYVB 4Z0KA 3L33A 5AVDA 1O2YA 3JZ2B 3ATMA 1C9PA 2QXJA 4NIYA 1D6WA 3RUOA 1O3CA 2QIQA 1ID5H 3UREA 2ZKSA 4Y79A 2BQWB 4BAMB 1C5WB 1GCTC 1TNIA 2CF8H 1UCYH 1IQIA 3RC5A 5FAHA 1HB0B 2P3UB 1NT1A 1Z6JH 1O5EH 1LMWB 1ZMNA 2FX4A 1L4ZA 1D3QB 1EAWA 1SLXB 1W7XH 1EX3A 5GCHF 2XBYA 4ISOA 1NZQH 1O3IA 1UHBB 1EKBB 1DICA 1ELTA 1YPKH 1QQ4A 4K8YA 7GCHG 3LC5A 4GVUA 3VB7A 1P57B 1TRYA 2GCHG