1KXBA

Sindbis virus capsid (s215a mutant), tetragonal crystal form
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
158
structure length
158
Chain Sequence
ALKLEADRLFDVKNEDGDVIGHALAMEGKVMKPLHVKGTIDHPVLSKLKFTKSSAYDMEFAQLPVNMRSEAFTYTSEHPEGFYNWHHGAVQYSGGRFTIPRGVGGRGDAGRPIMDNSGRVVAIVLGGADEGTRTALSVVTWNSKGKTIKTTPEGTEEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SINDBIS VIRUS CAPSID PROTEIN
publication title Structural analysis of Sindbis virus capsid mutants involving assembly and catalysis.
pubmed doi rcsb
source organism Sindbis virus
molecule tags Viral protein
total genus 33
structure length 158
sequence length 158
ec nomenclature ec 3.4.21.90: Togavirin.
pdb deposition date 1996-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1kxbA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1kxbA01
1MD8A 2PR3A 1QB6A 1AVWA 1IQFA 2ZU5A 2R0KA 5SGAE 1HAIH 2P95A 3AAVA 4UE7H 7ESTE 1EZSC 4ZAEA 4CBOA 1T32A 2SGEE 3T27A 1KTTB 4UDWH 4X2XA 4BTTB 2ZDLA 1SHYA 2ZTZA 2JH6D 1ZTJA 4Y6DA 4FVDA 4GLYA 2SFAA 5CMXH 2BLQA 4JZ1A 5EODA 3K9XB 5GPIB 8GCHF 3Q3XA 2BXUH 1FY5A 3LJOA 1C5RA 3M5NA 1CBWB 4AYVB 1TBQH 1KXEA 2WPLS 2VIPA 1RTKA 1P2OA 2XC0A 1TOCB 1TQ7B 3BEUA 2FI5E 2ZU3A 1UVOA 1QCPA 4AB9A 1YPHE 1O3MA 1C2LA 1ELGA 3NWUA 1O2TA 1TYNA 2P16A 3EQ0H 1VGCC 4FUFA 1B0EA 1O3GA 1XUHA 3SNCA 1TPAE 3LH1A 1AKSA 3UNQA 2ODQA 1WCZA 2ZDAH 3GICB 1DSTA 1O2GH 1O3PB 2GDEH 4NG9H 1YYY1 4X6OA 1C1SA 3PMJA 5L30H 2ODYB 1RIWC 2ZFQH 3P6ZB 3RXFA 3SU1A 1O3HA 3BTGE 5EXLA 2G4UA 1O2NA 4WXVA 3JZ2B 2TGTA 3RXBA 2IJOB 3C27B 2V35A 1IQHA 1K21H 3B23B 1C1QA 3LJJA 1TGBA 2BY5X 1S0QA 3FAOA 5A09A 1SGFG 2Z94A 3KF2A 5JBTA 2D8WA 4INKA 3W95A 2QGRA 1YPHC 2ZTXA 2ZNKH 1UVUH 2ZKSA 1UTOA 3BTFE 3K2UA 1UO6A 4I33A 3GCHC 1NRRH 5JPMH 2AMDA 2OLGA 3R3GB 3V13A 1DUAA 1FIWA 3SV2H 3PMHB 1CU1A 3ZVEA 1S5SA 1KXAA 1A5GH 1D3QB 1HJ9A 1BZXE 1OWKA 2VJ1A 3DHKH 1MCTA 1DS2E 3NPSA 3UQOA 3GY6A 1LHGH 3U1IB 4Y7BA 1NRNH 1TWXB 1H9LB 1EJAA 2H9TH 1FONA 3TPIZ 1H8DH 3PLBA 4ISIH 2FOEA 2D2DA 1PFXC 4X1QU 1C9PA 2O8TA 2VVCA 2FLRH 1BTYA 1KLTA 1O3JA 1HJ8A 4ZUHA 5C67A 1UK4A 1LVYA 1BJUA 1HRTH 5TJXA 3DFJA 4AB8A 1TONA 4BAMB 2A2XH 3DT0H 3KEEA 1IQKA 2PKSC 5HM9A 1FIZA 2A4GA 2C93B 3RXCA 3PYHA 2ZWLH 2J38A 3SU3A 4HZHA 1TBZH 2Z9IA 4OS5A 2P8OC 1A0HB 4FU9A 2SGPE 1C2HA 4HI3A 1BRUP 2BXTH 3MWIU 1YPMH 4Y10E 1AB9C 3MH4A 4O3TA 1Y59T 2O9QA 2QC2A 2XC5A 1C5XB 4ASHA 2AERH 3SGQE 1O5BB 4B2CA 2G5NA 5FX6A 1PQ8A 1ZLRA 4ABDA 2BD9A 5TCAA 2BY7X 1YBWA 2PGBB 3HKIB 3RXAA 3MNXA 3RC5A 4B71A 1EPTC 5GIBA 3S0NA 1JBUH 2P3TB 1GWAA 1U6QA 2G00A 5FBIA 4ZHMU 3SU6A 4ABIA 1SGDE 1GL0E 1ZSKA 4RKOB 1P10A 3BG8A 3U8TH 1OP2A 4ESTE 1TGCA 2Y5GA 1A46H 1AY6H 1GJ8B 4WF8A 1P9SA 3A7ZA 1Z6EA 3QDZB 3A88A 2EEKA 1V3XA 1WTHD 1Y3YA 1O0DH 1CA0B 1P04A 1KIGH 2ZHFH 1HV7A 3VXFH 1FXYA 1C2EA 1P2QA 1ZOMA 3T2NA 3A7XA 3VB5A 1L1JA 3A82A 3UPEA 2XBXA 1DXPA 4J2YB 1SI5H 3ZYEA 1GVLA 1ELVA 1OOKB 4BNRA 2GV7A 5EU8A 4AORA 1GL1A 4TWWA 5DP3A 2ZPRA 4WH6A 1T31A 1Z6JH 2C8YB 3HK3B 2GCTC 3KQEA 2ZGJA 1BRCE 3ATIA 3QWCH 1WBGB 3QGJA 2W7UA 4JZIA 3RMLH 1UTKA 1SFIA 1V2JT 2ZC9H 4WJG2 2BZAA 3GYMA 1IAUA 3I29A 3A86A 1BTPA 5AFZH 3P8GA 4NZQA 1QJ1B 2SGDE 3VPKA 2FI4E 7GCHF 1OWEA 3SU4A 4K8YA 2B5TB 3SUEA 1P2NA 2C8ZB 2HRVA 2Y80A 2VINA 1J16A 1Y5UT 2LNCA 3RXPA 1XUIA 1O33A 1ZHMA 2VB0A 5A8XA 1P12E 4ISOA 2AGGX 5E0GA 3ZZCA 1BTWA 2BD2A 3TLOA 3O8CA 4BTIB 3BTDE 5I25A 2OQ5A 1ZJDA 1GJ5H 1GBIA 1TPOA 2SGFE 1EAWA 2FM2A 1TNLA 4X1SU 3F9EA 2FTMA 2BDBA 4Q7ZA 5DK1A 1ELAA 5AHGH 3ODFA 4YO9A 3SU2A 1MAYA 3M37A 1H9HE 1EZXC 1A7SA 3UFAA 2DUCA 5FXLA 1O2KA 2ZHEH 1FUJA 1UTQA 1O2YA 4Y76A 2IOTA 3S9CA 1F7ZA 1HAYB 1HAXB 1J8AA 3SUGA 2ZFRH 5A0AE 2AS9A 2ZFTA 1QL8A 1SGEE 1FY3A 4ZXYH 1JXPA 3T26A 2BX4A 3F6UH 1XKAC 3ZV9A 1DWEH 1DT2A 3BTEE 1BQYA 3E16B 3F9GA 3SI3H 1JOUB 2AYWA 1DLEA 1FZZA 3BTME 2BOKA 1TA6A 4AFZA 3TJVA 1NM6A 2Z3EA 2UWLA 1GG6B 3RMNH 4YOJA 1TFXA 1C1TA 4JZEH 1G9IE 2GVFA 1AFEH 2OD3B 1CSOE 3LU9B 1V2PT 2ZEBA 1BRBE 3FP6E 4YOGA 3V0XA 1GBFA 1GMHG 2BM2A 3VFEA 3M7QA 2OC8A 2XCFA 1XXDA 1C1VH 2VVUA 4HTCH 3GY8A 1ZR0A 2TGPZ 5FX5A 3S7KB 4BXSA 2ILNA 1ELBA 5JDUB 1G32B 1MCVA 1F0RA 1AD8H 2SNWA 4B2BA 4AOQA 1IHSH 4GCHF 4OGYA 3QTVH 1DY9A 8ESTE 2PW8H 6GCHF 4GUXA 3LH3A 3LC5A 2OXSA 2TIOA 4D8NA 1Z8IB 1A3EH 1NFUA 1GBJA 1QL7A 1MTUA 5EPNA 4R0IA 3HK6B 4MVNA 4CRAA 2C3SA 1W7GH 3NCLA 1D6WA 1LPZB 4M7GA 2Z6BD 1IQMA 2ZCLP 3SUFA 1SLVB 1HBTH 3QLPH 1HYLA 2OBOA 3KIDU 3UREA 3P70B 3CP7A 1RTFB 1TNGA 1UCYK 3SZNA 2CMYA 2HNTE 2ZU1A 1UK3A 3GCTG 4H6TA 1NY22 1LTOA 1CA0C 3SJIA 3M3TA 2OQUA 2GD4B 1DX5M 9ESTA 2XBWA 4FVBA 2V3HH 4D7GA 3ENSB 1OKXA 1SGQE 3ZZ6A 4Z6AH 2ZU4A 3QTOH 1TGTA 1OX1A 3ZZ3A 2WPHS 5GCHG 1BBRK 3MO3A 3HKJB 3SNDA 5IYTA 3VB7A 5CE1A 1OP8A 3QK1A 4X1NU 2DE9A 1JMOH 3SJ9A 3ZVBA 2BB4A 4MNXA 1PJPA 3KCGH 2V6NA 1EZQA 2CJIA 5T3HA 3UWJH 1GJBB 3VEQB 1ZPZA 2WYGA 5E2OA 2HNTC 1TBRH 3BTWE 2FEQH 4FU8A 4VGCB 4CH8B 2ZGCA 3SV8A 3ZZBA 1LCYA 1P8VC 1C4Y2 4CH2B 4UONA 3PWBA 2ESTE 2H9EH 4AYYB 1GHAG 1O3EA 1LKAA 1AFQC 1K1LA 1K1PA 3PMAB 4INLA 1YLDA 2QXJA 1ELTA 2Z3CA 3TK5A 1AWHB 2F9BH 3W94A 2GX4A 1TNJA 3STIA 4CHAB 1BT7A 1Y3VA 1C2DA 1WTGH 5JYIA 1VCWA 3H7TA 1MBQA 1DVAH 1O2UA 1O5AB 1VZQH 2WYJA 5EXNA 3RDZA 1L4DA 1FY1A 4K8BA 3ATMA 1QBNA 2J4IA 1P0SH 1ESBA 4FU7A 1WYKA 3KGPA 1DXWA 2ZU2A 3MOCA 4YESB 3A8BA 1BDAA 1IQJA 2VH0A 1O3NA 3RXGA 1ZTKA 1GBDA 2D1JA 1MTSA 1GCTB 4NWLA 1FPHH 2C90B 1YP9A 1C2FA 1A4WH 2FI3E 2G51A 1EPTA 1Y5BT 4X6NA 4ZMAH 1THRH 2Z3DA 2BYAX 1A61H 2ALVA 4FUHA 1C5TA 2CF8H 1UVTH 4B75A 1GG6C 1AZ8A 5EQQA 2FPZA 3A89A 4KTUA 2AEIH 1O2LA 2AMPA 1Z1JA 2KAIB 1EZUC 1C2IA 3ATKA 4JK5A 4ABFA 1GMDG 3QO6A 3MU1A 5DJ7A 2FOHA 1CGJE 3MO9A 3MU4A 3MH6A 1QGFA 1S83A 3RC4A 1HAGE 3LGTA 3Q00A 4LOYH 2BTCE 2OP9A 4ZXXH 1UVSH 1QRZA 3UNSA 4NFFA 4OS4A 1FPCH 3R0FA 1SFQB 2ZCHP 1DANH 1GJ6A 4UD9H 3URDA 3M3VA 2BVSH 5ABWA 4XBDA 5DGJA 4CRBA 4JYTA 1W0ZU 3ITIA 4NSVA 2R9PA 4FUJA 3A80A 3RXMA 1O2ZA 1O2HA 3TGJE 3VB4A 3NK8A 4X1RU 1SQOA 3OYPA 1C1WH 1INCA 1TX7A 3RLYH 4NIYA 2OTVA 4CR5A 5FPYA 3BIUH 1SGRE 1KSNA 2HWLB 4PROA 2UWOA 2EI7A 3IG6B 4K1TA 1O2WA 1CHGA 1P3EA 1SGCA 4CREA 3RXIA 2Y5FA 2BD7A 4X2WA 2F9NA 3IWMA 1D3DB 2H2ZA 2NU1E 1YC0A 2SGAA 5L2ZH 2TGDA 3SQEE 3EE0B 2CGAA 1RD3B 1C1OA 3GOVB 1ZPBA 3TVJB 1ARCA 1H9IE 1GI0A 3KHVA 1C5PA 5BPEA 5LGOA 4NWKA 3O8BA 1BMLA 1O5GH 1OPHB 2XXLA 2OCVB 3SU5A 1KLJH 1FQ3A 4CRGA 1AU8A 1TX8A 3NXPA 1YKTA 8LPRA 4DURA 3MYWA 4MTBA 2GT8A 2Y81A 2FYQA 1TGNA 1LKBA 1O2QA 3KQBA 1ELCA 1ELFA 1KDQB 4DJZB 1BHXB 1OYQA 3E0PB 1DITH 4X6MA 1NO9H 2VWOA 5F8ZA 1S0RA 2FODA 4VGCC 3U8OH 1F5RA 1DDJA 2GT7A 1K1MA 2ZDNA 2QYIA 3GCNA 1CHOG 1O5DH 3RXVA 2A0QB 4NA7A 5CHAB 3F9FA 2A5IA 1P2IA 1PPFE 4KTCA 1W3CA 2G52A 2GZ7A 1D3TB 1EXFA 2B0FA 4DIIH 2WV5A 4I32A 3BEIB 4JCNA 5EXMA 3U8RH 4Y71A 1EP6A 2HALA 4CHAC 4A92A 2Y6TA 3TJNA 2PLXA 1V2TT 2GGVB 4O9VA 3GDVA 2EI8A 2J92A 1NFXA 1JRTA 3LGVA 4ZKOU 1SOTA 1SGYE 2Y7ZA 2XTTB 3F68H 6ESTA 2VH6A 4J1YA 1H4WA 3L3TA 1K28D 2ZFSA 3RM0H 1W8BH 3UUZA 1GJDB 2BDGA 5EG4A 2SGQE 1HAHH 1D6RA 1Q2WA 1KXCA 1NRPH 1WQSA 4B74A 1C4V2 1HIAB 1FAXA 5C20A 1MKWK 1GMHF 1ZPCA 3D65E 5DP9A 4WWYA 1A5HA 3K65B 2G81E 1GDNA 3VB6A 4NFEA 2HGTH 1WSSH 2H1UA 1BCUH 2G4TA 3A84A 3A87A 5JB8S 3H5CB 1XUGA 4Q7YA 4JZDH 1GMCF 1OWDA 1QNJA 5E8EH 1UCYH 1TB6H 1GBEA 1F0TA 3OY5U 1VJ9U 1WOFA 1B0FA 1NU7B 3RU4E 1M9UA 4ZHLU 3CENA 2YOLA 1O2RA 2V0BA 1TRYA 1P06A 2A4QA 2THFB 4ZHAA 9LPRA 2A32A 1WU1A 4ABGA 1S6HA 4K69A 4CRCA 2ZQ2A 2BMGB 1KXFA 4Y8XA 5F03A 3TGKE 3M7TA 1AUJA 3K6YA 4NCYA 2A4RA 3ZZ7A 2JH0D 1ORFA 1OWHA 1O5CB 4X8VH 3SI4H 3GCTF 2F3CE 2VWLA 3LONA 2VIVA 1DLKB 4E7NA 2FESH 4NSYA 4IBLH 2H5DA 1W11U 3TH3H 1P9UA 1QRXA 1J17T 1UK2A 1ZYOA 2XC4A 1GI6A 3M5MA 1PPCE 2VIDA 1TX6A 1C5OH 1OWJA 4A1TA 1C2JA 3D49H 3MO6A 2Z9GA 3T25A 1W7XH 2AIQA 4YLUA 1T8LA 5F8XA 2QXHA 2GTBA 2WV4A 1G3CA 3M5OA 3TNSA 3ZV8A 2UUJB 1GI7B 1ZJKA 1A5IA 1VJAU 2ZGXH 4SGAE 2HLCA 2P93A 2ZTYA 2A5KA 1XVMA 2BQ6B 5HM2A 1VITG 2A45B 1O2OA 2QV1A 3ZZAA 3BTHE 1CBWC 2ZQ1A 3SJ8A 1YGCH 2BDIA 1UTNA 1AVXA 5EW2H 2GCHF 5DP7A 2BDCA 1Q31A 4Y7AA 3MNBA 3KNXA 5EQRA 1Y5AT 3RXOA 5I46H 1H8IH 3FZDA 1P2KA 2VIOA 1GJCB 1XM1A 3LGUA 3PMBB 4THNH 1L0ZA 3DD2H 1GBCA 1QBVH 1ESAA 1ANCA 3PWCA 5EW1H 4H42U 4LZ1H 1UTMA 1AE8H 3QGNB 4HGCA 2SNVA 1C9TA 4AG2A 2TPIZ 1UTPA 3SV7A 3MNCA 2ZDMA 1SR5C 3S9BA 5HMAA 5PTPA 2HOBA 3QZQA 2J2UA 1C1RA 1K1NA 4QT8C 2OUAA 4U01A 3BTTE 1HJAB 1G36A 1V6DA 4X8TH 2ZZUH 1HCGA 4JYUH 8GCHG 5CHAC 7KMEH 2HVXA 2W7SA 1FDPA 3UWIA 2Y82A 2PFEA 1CT2E 3S9AA 1O2VA 1FNIA 2QY0B 1HAOH 3LT3A 2H9HA 2R3UA 4X1PU 4ZKRU 4Y11E 1T8MA 5F6MA 2FXRA 1BTZA 3T5FH 3A7WA 1Y8TA 5C1XA 2H5CA 3PV4A 3SO3A 5DP8A 5C1YA 2VGCB 1TAWA 1GBLA 3E0NB 3TK9A 4FUBA 4GHQA 2WINI 4ISNA 4FUCA 3E1XB 5E0HA 1BTHH 2VWNA 3MU5A 4Z0KA 4H4FA 1PPBH 3EA7A 1ABIH 2J94A 3RXQA 4NIXA 3UOUA 4YLQH 1V2ST 2B9LA 3GDUA 2FO9A 1GVZA 3S7HB 4AX9H 1HXFH 3KQDA 1EP5A 2PTCE 3ZVDA 1ZMNA 1WUNH 3Q77A 2BLOA 2OC1A 3VGCB 1NC6A 4DY7B 1PPZA 2XBVA 1O3IA 1C5VA 1FY4A 1NESE 4DVAU 1GDQA 2A31A 1AE5A 3ZYDA 3UY9A 4AG1A 1DY8A 1LHDH 1C5ZB 4X0WU 1BOQA 4ABJA 3EYDA 3ZZ4A 2IN2A 1ZSJA 2GMTB 1OWIA 2QXIA 4ZKNU 4B76A 2W3KA 1GDUA 4WMEA 4BAKB 1GHXH 1ANEA 2RCEA 2ZG0H 3NKKA 2XW9A 1YLCA 1O2PA 1O2JA 3M61U 4DW2U 2PSYA 1W0YH 1EX3A 1CGHA 5AFYH 5C1UA 4XE4A 4OS7A 1MMJN 5JB9S 3L6PA 3MFJA 1L1GA 1RRKA 1CE5A 1NZQH 3F9HA 4KGAA 1Y3WA 4UFGH 2GV6A 4B1TA 2K1QA 3SV9A 5A2MH 1KYNA 4WH8A 1WAYB 1JRSA 2BY6X 1B7XB 2ULLA 3SU0A 3HATH 5JBAS 2FWWA 3CS7A 3A81A 3VXEH 3OX7U 1EJMA 3FP7E 3RUOA 1PYTC 2ANMH 3RXEA 2BX3A 1C1UH 1AUTC 4Y8YA 1GBTA 3AAUA 5J4QA 2C8WB 3PTBA 1O30A 2Y5HA 3BIVH 3PLPA 4XOJA 5GWZA 1IQGA 2ZDVH 2A5AA 1GJ9B 1E38B 5FAHA 4MPXA 2YNAA 3D62A 5JBBS 2Y7XA 4K5ZA 4I8JA 4MPUA 3RP2A 5LPRA 3A7YA 5AVDA 4D76A 3M7UA 1TMBH 5B6OA 1EOJA 4FUDA 1S84A 3NZIA 4I8LA 4A1XA 3PO1B 1ESTA 1IHTH 3BN9A 4BAQB 3ZZ8A 3TK6A 1S85A 1Z71A 4Q2KA 5H4IB 4IC5A 1C5LH 1MTNB 1P57B 1VGCB 1CO7E 5DPAA 1MAXA 4IS5A 2EA3A 1MKWH 2BDAA 1P03A 1C2GA 1MD7A 2TGAA 2BZ6H 1ELEE 2AFQB 8KME2 1SC8U 4BTUB 2FOBA 1XUFA 5ETXA 1V2RT 6CHAB 2ZGHA 1GI1A 1HAVB 2BD8A 2QXGA 4ISHH 1DUEA 4I8KA 3BSQA 4K3JA 1V2MT 2QN5T 1S6FA 4K1SA 3GY7A 4UEHH 1GJ4H 1F0UA 3RXHA 1QY6A 4E05H 2A4OA 1GCDA 1DWBH 1FN6A 5DP4A 1GHVH 3E91A 2ZA5A 1C5MD 1LHEH 1H1BA 2J9NA 3MH5A 1G2LA 4JZFH 2KAIA 3RMMH 2OC0A 1E34B 1RS0A 1J9CH 1PPHE 4GSOA 1MZDA 1C5QA 3MH7A 4IW4E 2UUKB 3QX5H 1LHCH 1UHBB 4ZROA 2VGCC 1ZZZA 4O97A 3ZVAA 1O3OA 4E7RG 5FPSA 5LPEA 3MU0A 2VU8E 3T62A 3TGIE 3OSYA 2P3FH 1K9OE 1D9IA 2IPHA 1N1LA 2FX4A 5GDSH 3F1SB 1HUTH 1YPLH 1EAUA 2I6SA 3ZVGA 4TYDA 1GBHA 2V3OH 1P3CA 3SORA 1SGNE 3M5LA 1PYTD 3CS0A 3T29A 3O8DA 1D4PB 5DG6A 1GGDB 2ZHWH 1EUFA 2FOMB 1BTUA 4ABHA 3QZRA 4ZKSU 3ODDA 2R2MB 1T4VH 2ASUB 3VGCC 1F0SA 1NS3A 4NZLA 4U2WA 1F2SE 2RDLA 1O3FA 3WY8A 2ANKH 3E8LA 4O03A 1C4U2 3T28A 3UQVA 4NIWA 1MUEB 1SQAA 2Z7FE 2FYRA 3RXUA 1XKBC 1LMWB 1QB1A 1L1NA 3SNBA 2D26C 2F9OA 4ABBA 2GMTC 1C5SA 3RXRA 3U98H 3GY3A 1B5GH 1K1IA 5HGGA 1IOEA 4MDSA 1V2QT 2GP9B 1CA8B 1P01A 2FTLE 1XX9A 5C2ZA 3ZVFA 2XBYA 1HFDA 1PQ7A 3U1JB 3GY4A 3SHCH 1UMAH 1AB9B 5A0CA 1QQUA 2Q6FA 1AO5A 2LPRA 1YCPM 4FUIA 4LK4A 2ZCKP 2ANYA 4CBNA 6LPRA 1OSSA 4I31A 4I8GA 2XRCA 5ESTE 3RXDA 5T6GA 2ZFFH 1W12U 2Z9LA 1HLTH 1KDQA 1MU6B 1ZTLA 2JETB 1W13U 2G55A 2VIQA 4U30A 1LPGB 2QAAA 1GI9B 3EA9A 1V2VT 1JWTA 2R2WU 3MNSA 1A0JA 1G30B 2XWBI 2W26A 5E0JA 1NU9A 5E2PA 5DP5A 1ETTH 3AW0A 1YPJH 4D9RA 2PKAA 4GVUA 3C1KA 1O39A 5A0BA 3SGAE 1TPSA 4BXWA 1ZSLA 1ELDE 1QA7A 4GCHG 1YM0A 1MKXK 1LO6A 2RA0A 3KL6A 4F4OC 1LVMA 6GCHG 5BRRE 4D7FA 3GCOA 5J4SA 4RN6A 4IN2A 1EJNA 1SLXB 1V2NT 5DP6A 2PUQH 3Q3YA 3RLWH 5F8TA 1ETRH 2FX6A 4DT7B 4I8HA 3PO1C 1SGPE 4Y0ZE 2QA9E 2TRMA 1G2MA 4YTAA 1THSH 4WVPE 2FLBH 3PLKA 1MTNC 3UNRA 3FFGA 1QB9A 1RFNA 2NU4E 2C8XB 1SBWA 2GCTB 3M35A 3A7TA 1ZRBA 1TALA 1FY8E 3HGNA 4MPWA 5JBCS 3E3TA 1HIAA 2PKAB 3E6PH 1NFYA 3I78A 6CHAC 1G3EA 1UTJA 2M5TA 2PGQB 1DE7H 2UUYA 4O3UA 2CXVA 1SLWB 2BD5A 1FJSA 1OYTH 1W14U 3BF6H 1CVWH 2PSXA 1O34A 2PUXB 4Q7XA 4BANB 2CN0H 4AGJA 4AN7A 3SHAH 1A1RA 4ZH8A 1EATA 3PM3A 1ZHPA 4IC6A 4IMZA 1X7AC 2ZGBH 2QCYA 1C5WB 3SGBE 4K60A 1UCYE 3BG4B 2UUFB 1V2LT 3E90B 1AKSB 4OS1A 5T6DA 4BOHA 4X8UH 3GY5A 1K2I1 2XYAA 5IDKA 3BTQE 1O3BA 1DWCH 1S82A 2A2QH 2AIPA 4GPGA 1GCTC 3UIRA 4A5TS 3A7VA 1JIRA 1MH0A 1MBMA 1VCQA 1A3BH 1ETSH 1N8OB 2AMQA 2ZECA 5FHTA 1AZZA 2Z9KA 2A1DB 3OTJE 1GBBA 1GGDC 1YPEH 1BBRE 1F5KU 2BDYA 1NROH 1LVOA 1EQ9A 3KQCA 1TNHA 5TCCA 1UJ1A 4ISLA 3LKWA 2ZIQH 1Z7KA 3OY6U 5C3NA 3NUMA 1QR3E 1V2OT 4NIVA 2STBE 3SNEA 1K1OA 4XSKU 2O8WA 1TE0A 4IMQA 1AIXH 1IQIA 1AQ7A 1MU8B 3A85A 2FS8A 2XNIA 1GBAA 3MTYA 3SNAA 1EASA 4BAOB 3U9AH 3SQHE 1BBRH 2EI6A 1Z8JB 1GHBG 4AFSA 2ZFPH 1FI8A 4D9QA 4X2VA 3M36A 1BJVA 1CT0E 4FXGH 2A7JA 2FS9A 4LZ4B 1J15A 4RSPA 1TQ0B 2HNTF 1ZMJA 1S81A 1O35A 1FV9A 3N7OA 4ABAA 1EB1H 1GJAB 1BTXA 1V2KT 1CGIE 1O3KA 4DG4A 1QHRB 2A7HA 3FVFB 1GHYH 2ZHQH 1AWFH 3AVZA 3FP8E 3KN2A 1IQEA 2C4FH 2GZ8A 2TBSA 5GCHF 3HPTB 2O8UA 1W10U 1SLUB 1UVPA 1QQ4A 1ANDA 1E37B 1QTFA 2JETC 4KTSA 4R8TB 5L2YH 1QJ7B 3LGYA 1DWDH 1BMNH 3DUXH 1SOZA 4F49A 2F9PA 1O2SA 1ZHRA 3RM2H 2Q6GA 1RGQA 4YT7H 2BDHA 1AN1E 1AMHA 2FOGA 3P17H 1O2XA 1BA8B 2G5VA 4A7IB 2JKHA 2WUCA 3ELAH 1UTLM 3S69A 1TRMA 3GISB 2F9UA 2W3IA 3EA8A 2FDAA 1J14A 4TPYA 1YCPK 1GHAF 4TWYA 5LPFA 2BHGA 3SJOA 2F83A 1G3BA 1TNIA 1SB1H 1P11E 2ZHDA 2H6MA 2RG3A 1O38A 4MPVA 2B8OH 3EGKH 2WPKS 3PTNA 1PQAA 1TGSZ 2PV9B 3U69H 3A8CA 1P05A 4RKJB 1FLEE 3RXJA 4DIHH 2GZ9A 5K0HA 1IQLA 1K1JA 2ZF0H 2WPJS 4AFUA 2BY8X 2ODPA 4DOQA 1GI3A 1QBOA 1NRSH 1VITH 2J95A 1VCPA 5T6FA 1GPZA 5HXFA 1L4ZA 5LH8A 1GBKA 4XBCA 1TA2A 1DSUA 2ANWA 1XMNB 2W5EA 3TH2H 2VVVA 3IITA 1T8NA 1C1MA 3RXKA 1P09A 2ZPSA 4B73A 1L2EA 1P2JA 1AI8H 4U32A 2O8MA 1AGJA 3DA9B 1AFQB 1O3DA 1YF4A 4A1VA 5EPYA 1BB0B 4AZ2B 3A8DA 4MLFB 1PPGE 4UFEH 1E35B 3RU4T 3Q76A 3RXSA 1THPB 1VR1H 5A8ZA 4AGKA 3MI4A 1ID5H 1XUKA 1C5YB 2OINA 3BG4C 3LGIA 4NA9H 3H7OA 3TNTA 3P8FA 1O2IA 1EAIA 1GMDF 1T7CA 5FCRA 1LPKB 3RU4D 3SW2B 2BVRH 4YZUA 1K22H 4SGBE 2NU2E 1TABE 2EC9H 1N8OC 7LPRA 5L6NH 4MQAA 3SUDA 2BQWB 3ZZDA 3Q3KA 3V3MA 4E06H 1TOMH 2OC7A 4XBBA 1HPGA 3D23A 3BTKE 1XUJA 1BMAA 3TIUA 3TJUA 3PB1E 1PQ5A 1G3DA 3TU7H 4MNVA 5FPTA 1TLDA 4CR9A 1V2WT 1NTPA 1KXDA 1GVKB 2BD4A 2VNTA 1BMMH 3RXTA 4KP0A 1DICA 2RA3A 5EQSA 4LXBH 1CT4E 1ZMLA 1MKXH 4Y79A 1FMGA 1SGTA 1GJ7B 3EDXB 2QF0A 1NFWA 1KLIH 1ACBE 3UTUH 3SJKA 1HNEE 5HYOA 4HFPB 4XFQA 1YPKH 4A6LA 4TY7A 4Y8ZA 4I7YH 1Y3UA 3LPRA 2P59A 1LQEA 1Z8GA 3ZVCA 1BRAA 4XDEA 2YNBA 1O36A 2AH4X 1GHZA 1QA0A 1ZRKA 1OXGA 3LC3A 4WMFA 1BITA 4B2AA 1MQ5A 4BAHB 3I77A 3L33A 4YOIA 4X2YA 1GMCG 1HXEH 3GYLB 3SBKA 1O2MA 1A0LA 3DFLA 2BQ7B 3V7TA 3ZZ9A 4YM9A 1RJXB 1EKBB 1E0FD 5ESBA 4CRDA 1SL3A 1TIOA 1GI5A 1O3AA 4OGXA 2QF3A 1D3PB 2CHAB 1C5UA 1SGIB 4IGDA 1SHHB 2VWMA 1C5NH 3V12A 1MZAA 1LQDB 3BEFB 1GHWH 2NU0E 1NRQH 3LOXA 2FOFA 3P95A 5C5OA 1TNKA 3LIWA 5GXPA 3TITA 1LDTT 1O3CA 1FAKH 1LVBA 3P92A 3MU8A 1F5LA 1HAVA 4K1EA 1TMTH 4NA8A 1E36B 1RXPA 1CHOF 3O8RA 1SSXA 2BLWA 3SV6A 1DM4B 3HGPA 3G01A 3P8OA 2A7CA 2VIWA 1DPOA 4JYVH 3EAJA 1HAPH 2FP7B 2STAE 2HPQH 2PHBA 5FBEA 1O3LA 3LDXH 4UFFH 1O31A 1GI2A 3SN8A 1KY9A 1EB2A 1AVGH 1UHBA 1TRNA 4FUGA 2FOCA 1N6YA 1ZGVA 3MHWU 3VB3A 3UOPA 3ATLA 3JZ1B 1ANBA 4KELA 3RXLA 2GKVE 1GI4A 4H6SB 1YPGH 2F9VA 1QL9A 4GHTA 1BIOA 1OS8A 1HJAC 3AASA 1CQQA 1QIXB 4TPIZ 1C1NA 1RIWB 1SG8B 2CV3A 3B9FH 2GDDA 1EOLA 3GDSA 1T4UH 4UFDH 2BVXH 2OBQA 3OU0A 2J34A 1SGFA 4X6PA 4CRFA 1QRWA 2Z9JA 3UR6A 2GCHG 2FOAA 3QUMP 2CF9H 5K7RA 2WUBA 1Y3XA 1T8OA 2BD3A 4NGAH 2R3YA 2ZI2H 3K6ZA 3BV9B 2Q1JA 3TJOA 1PPEE 1NN6A 1EAXA 2UWPA 2ZPQA 3FZZA 2BOHB 4MNYA 1KXBA 1A2CH 4Q80A 1DOJA 2Q6DA 3GCHB 1GI8B 1O5EH 4OS6A 5FCKA 1IQNA 2ZDKA 1RTLA 4INHA 1BUIA 5DO4H 2FZZA 2JH5D 4TY6A 2R0LA 7GCHG 1P2MA 4ABEA 1O5FH 3P8NA 1SPJA 5EOKA 4OS2A 3UR9A 4KKDA 4K2YA 1NT1A 2FMJA 3STJA 2XCNA 1NPMA 5G4BA 1O37A 2WPIS 1GHBF 4DGJA 1TPPA 1OP0A 2PTNA 1W2KH 1C1PA 1Q3XA 3A8AA 4FUEA 5DKMA 1O32A 1Z1IA 4GAWA 1P02A 2QIQA 3GY2A 4WMDA 1XVOA 1HB0B 3ATWA 5GJ4B 1V2UT 1QURH 2F91A 1LHFH 4IN1A 2PKSB 2DE8A 1DFPA 1ARBA 2G8TA 2XWAA 3FANA 4AFQA 1GBMA 2BLVA 1HAZB 4Y0YE 1MQ6A 2O8LA 4MG3A 4JK6A 3URCA 1WV7H 3RC6A 1HGTH 1F92A 2P8OB 2HPPH 1QFKH 2P3UB 2B7DH 3MMGA 1YCPH 5EGMA 1ABJH 1G37A 2ZP0H 1AHTH 3PROA 4WY3A 2ZO3H 1N6XA 1HDTH 5C5NA 1C2MA 1BHXF 1FN8A 1SVPA 3RMOH 3LGWA 3ESTA 4JMYA 1JIMA 2AGIX 2BY9X 1VITF 2AGEX 3TH4H 2PWXA 1MTWA 1KTSB 1XXFA 2ALPA 2FIRH 3M3SA 2WPMS 2NWNA 4YT6H 3A83A 1SMFE 4WXIA 1ZGIA 3ZZ5A 2P94A 2NU3E 1Z8RA 1TMUH 3B8JA 4MNWA 1EPTB 1MTVA 1WQVH 4DCDA 1SQTA 3AW1A 5A8YA 5AF9H 1C2KA 4X8SH 3QN7A 2CHAC 1QJ6B 2I6QA 3SOSA
chains in the Genus database with same CATH superfamily
1MD8A 2PR3A 1QB6A 1AVWA 1IQFA 2ZU5A 2R0KA 5SGAE 1HAIH 2P95A 3AAVA 4UE7H 7ESTE 1EZSC 4ZAEA 4CBOA 1T32A 2SGEE 3T27A 1KTTB 4UDWH 4X2XA 4BTTB 2L74A 2ZDLA 1SHYA 2ZTZA 2JH6D 1ZTJA 4Y6DA 4FVDA 4GLYA 2SFAA 3KYGA 5CMXH 2BLQA 4JZ1A 5EODA 3K9XB 5GPIB 8GCHF 3Q3XA 2BXUH 1FY5A 3LJOA 1C5RA 3M5NA 1CBWB 4AYVB 3F0PA 1TBQH 1KXEA 2WPLS 2VIPA 1RTKA 1P2OA 2XC0A 1TOCB 1TQ7B 3BEUA 2FI5E 2ZU3A 1UVOA 1QCPA 4AB9A 1YPHE 1O3MA 1C2LA 1ELGA 3NWUA 1O2TA 1TYNA 2P16A 3EQ0H 1VGCC 4FUFA 1B0EA 1O3GA 1XUHA 3SNCA 1TPAE 3LH1A 1AKSA 3UNQA 2ODQA 1WCZA 2ZDAH 3GICB 1DSTA 1O2GH 1O3PB 2GDEH 4NG9H 1YYY1 4X6OA 1C1SA 3PMJA 3WW7A 2ODYB 5L30H 1RIWC 2ZFQH 3P6ZB 3RXFA 3SU1A 1O3HA 3BTGE 5EXLA 2G4UA 1O2NA 4WXVA 3JZ2B 2TGTA 3RXBA 2IJOB 3C27B 2V35A 1IQHA 1K21H 3B23B 1C1QA 3LJJA 1TGBA 2BY5X 1S0QA 3FAOA 5A09A 1SGFG 2Z94A 3KF2A 5JBTA 4AC9A 2D8WA 4INKA 3W95A 2QGRA 1YPHC 2ZTXA 2ZNKH 1UVUH 2ZKSA 1UTOA 1WDIA 3BTFE 3K2UA 1UO6A 4I33A 3GCHC 1NRRH 5JPMH 2AMDA 2OLGA 3R3GB 3V13A 1DUAA 1FIWA 3SV2H 3PMHB 1CU1A 3ZVEA 1S5SA 1KXAA 1A5GH 1D3QB 1HJ9A 1BZXE 3OEHD 1OWKA 2VJ1A 3DHKH 1MCTA 3F2FA 1DS2E 3NPSA 3UQOA 3GY6A 1LHGH 3U1IB 4Y7BA 1NRNH 1TWXB 1H9LB 1EJAA 2H9TH 1FONA 3TPIZ 1H8DH 3PLBA 4ISIH 2FOEA 2D2DA 1PFXC 4X1QU 3OFND 2QF5A 1C9PA 2KCPA 2O8TA 2VVCA 2FLRH 1BTYA 1KLTA 1O3JA 1HJ8A 4ZUHA 5C67A 1UK4A 1LVYA 4XRNA 1BJUA 1HRTH 2WZQA 5TJXA 3DFJA 4AB8A 1TONA 4BAMB 2A2XH 3DT0H 3FKSD 3KEEA 1IQKA 2PKSC 5HM9A 1FIZA 2A4GA 2C93B 3RXCA 3PYHA 2ZWLH 2J38A 3SU3A 4HZHA 1TBZH 2Z9IA 4OS5A 2P8OC 1YLNA 1A0HB 4FU9A 2SGPE 1C2HA 4HI3A 1BRUP 2BXTH 3MWIU 1YPMH 4Y10E 1AB9C 3MH4A 4O3TA 1Y59T 2IPQX 2O9QA 2QC2A 2XC5A 1C5XB 4ASHA 2AERH 3SGQE 1O5BB 4B2CA 2G5NA 3ZIAD 5FX6A 1PQ8A 1ZLRA 4ABDA 2BD9A 5TCAA 2BY7X 1YBWA 2PGBB 3HKIB 3RXAA 3MNXA 3RC5A 4B71A 1EPTC 5GIBA 3S0NA 1JBUH 2P3TB 1GWAA 1U6QA 2G00A 5FBIA 4ZHMU 3SU6A 4ABIA 1SGDE 1GL0E 1ZSKA 4RKOB 1P10A 3BG8A 3U8TH 1OP2A 4ESTE 1TGCA 3N7DA 2Y5GA 1A46H 1AY6H 1GJ8B 4WF8A 4ACBA 1P9SA 3A7ZA 1Z6EA 3QDZB 3A88A 2EEKA 1V3XA 1WTHD 1Y3YA 1O0DH 1CA0B 1P04A 1KIGH 2ZHFH 1HV7A 3VXFH 1FXYA 1C2EA 1P2QA 1ZOMA 3T2NA 3A7XA 3VB5A 1L1JA 3A82A 3UPEA 2XBXA 1DXPA 4J2YB 5F53A 1SI5H 3ZYEA 1GVLA 1ELVA 1OOKB 4BNRA 2GV7A 5EU8A 4AORA 1GL1A 4TWWA 5DP3A 2ZPRA 5KECA 4WH6A 1T31A 1Z6JH 2C8YB 3HK3B 2GCTC 3KQEA 2ZGJA 1BRCE 3ATIA 3QWCH 1WBGB 3QGJA 2W7UA 4FOUC 4JZIA 3RMLH 1UTKA 1SFIA 1V2JT 2ZC9H 4WJG2 2BZAA 3GYMA 1IAUA 3I29A 5C17A 3A86A 1BTPA 2W6ID 5AFZH 3P8GA 4NZQA 1QJ1B 2SGDE 3VPKA 2FI4E 7GCHF 1OWEA 3SU4A 4K8YA 2B5TB 3SUEA 1P2NA 2C8ZB 2HRVA 2JDID 2Y80A 2VINA 1J16A 2V3MA 1Y5UT 2LNCA 3RXPA 1XUIA 1O33A 1ZHMA 2VB0A 5A8XA 1P12E 4ISOA 2AGGX 5E0GA 3CNRA 1BTWA 2BD2A 3TLOA 3ZZCA 3O8CA 4BTIB 3BTDE 5I25A 2OQ5A 1ZJDA 1GJ5H 1GBIA 1TPOA 2SGFE 1EAWA 2FM2A 1TNLA 4X1SU 3F9EA 2FTMA 2BDBA 4Q7ZA 5DK1A 4Z1MD 3F2HA 1ELAA 5AHGH 3ODFA 4YO9A 3SU2A 1MAYA 3M37A 1H9HE 1EZXC 1A7SA 3UFAA 2DUCA 5FXLA 1O2KA 2ZHEH 1FUJA 1UTQA 1O2YA 4Y76A 2IOTA 3S9CA 1F7ZA 1HAYB 1HAXB 1J8AA 3SUGA 2ZFRH 5A0AE 2AS9A 2ZFTA 1QL8A 1SGEE 1FY3A 4ZXYH 1JXPA 3T26A 2BX4A 3F6UH 1XKAC 3ZV9A 1DWEH 1DT2A 3BTEE 1BQYA 3E16B 3F9GA 3SI3H 1JOUB 2AYWA 1DLEA 1FZZA 3BTME 2BOKA 1TA6A 4AFZA 3TJVA 1NM6A 2Z3EA 2UWLA 1GG6B 3RMNH 4YOJA 2KCYA 1TFXA 1C1TA 4JZEH 1G9IE 2GVFA 1AFEH 2OD3B 1CSOE 3LU9B 1V2PT 2ZEBA 1BRBE 3FP6E 4YOGA 3V0XA 1GBFA 1GMHG 2BM2A 3VFEA 3M7QA 2OC8A 2XCFA 1XXDA 1C1VH 2VVUA 4HTCH 3GY8A 1ZR0A 2TGPZ 5FX5A 3S7KB 4BXSA 2ILNA 1ELBA 5JDUB 1G32B 1MCVA 1F0RA 1AD8H 2SNWA 4B2BA 4AOQA 1IHSH 4GCHF 4OGYA 3QTVH 1DY9A 8ESTE 2PW8H 6GCHF 4GUXA 1COWD 3LH3A 3LC5A 1YY3A 2OXSA 2TIOA 3AK5A 4D8NA 1Z8IB 1A3EH 1NFUA 1GBJA 1QL7A 1MTUA 5EPNA 4R0IA 3HK6B 4MVNA 4CRAA 2C3SA 1W7GH 3NCLA 1D6WA 1LPZB 4M7GA 2Z6BD 1IQMA 2ZCLP 3SUFA 1SLVB 1HBTH 3OEED 1HYLA 3QLPH 2OBOA 3KIDU 3UREA 3P70B 4HG6A 1K0HA 3CP7A 1RTFB 1TNGA 1UCYK 3SZNA 2CMYA 2HNTE 2ZU1A 1SKYE 1UK3A 3GCTG 4H6TA 1NY22 1LTOA 1CA0C 3SJIA 5C0TA 3M3TA 2OQUA 2GD4B 2K0QA 1DX5M 9ESTA 2XBWA 4FVBA 2V3HH 4D7GA 3ENSB 1OKXA 1SGQE 3ZZ6A 4Z6AH 2ZU4A 3QTOH 1TGTA 1OX1A 3ZZ3A 2WPHS 5GCHG 1BBRK 3MO3A 3HKJB 3SNDA 5IYTA 3VB7A 5CE1A 1OP8A 3QK1A 4X1NU 2DE9A 1JMOH 3SJ9A 3ZVBA 2BB4A 4MNXA 1PJPA 3KCGH 4TT3D 2V6NA 1EZQA 2CJIA 5T3HA 3UWJH 1GJBB 3VEQB 1ZPZA 2XNDD 2WYGA 5E2OA 2HNTC 1TBRH 3BTWE 2FEQH 4FU8A 4VGCB 4CH8B 2ZGCA 3SV8A 3ZZBA 1LCYA 1P8VC 1C4Y2 4CH2B 4UONA 3PWBA 2ESTE 2H9EH 4AYYB 1GHAG 3EE7A 1O3EA 1LKAA 1AFQC 1K1LA 1K1PA 3PMAB 4INLA 1YLDA 2QXJA 5HKKD 1ELTA 2Z3CA 3TK5A 1AWHB 2F9BH 3W94A 2GX4A 2VBCA 1TNJA 3STIA 4CHAB 1BT7A 1Y3VA 1C2DA 1WTGH 3NRLA 5JYIA 1VCWA 3H7TA 1MBQA 1DVAH 1O2UA 1O5AB 1VZQH 2WYJA 5KGOA 3KQ5A 3KYFA 5EXNA 3UB0A 5CDFE 3RDZA 1L4DA 3PRDA 1FY1A 4B6EA 4K8BA 2KCAA 3ATMA 1QBNA 5IK2D 2J4IA 1P0SH 1ESBA 4FU7A 1WYKA 3KGPA 1DXWA 2ZU2A 3MOCA 4YESB 3A8BA 1BDAA 1IQJA 2VH0A 1O3NA 3RXGA 1ZTKA 1GBDA 2D1JA 1MTSA 1GCTB 4NWLA 1FPHH 2C90B 1YP9A 1C2FA 1A4WH 2FI3E 2G51A 1EPTA 1Y5BT 4X6NA 4ZMAH 1THRH 2KZ4A 2Z3DA 5EIYA 2BYAX 1A61H 2ALVA 4FUHA 1C5TA 2CF8H 1UVTH 4B75A 1GG6C 1AZ8A 5EQQA 2FPZA 3A89A 4KTUA 2AEIH 1O2LA 5B6LA 1S6LA 2AMPA 1YWUA 1SQRA 2KFWA 1Z1JA 2KAIB 1EZUC 1C2IA 3ATKA 4JK5A 4ABFA 1GMDG 3QO6A 3MU1A 5DJ7A 2FOHA 1CGJE 3MO9A 3MU4A 3MH6A 1QGFA 1S83A 3RC4A 1HAGE 1KMHB 3LGTA 3Q00A 4LOYH 2BTCE 2OP9A 4ZXXH 1UVSH 1QRZA 3UNSA 4NFFA 4OS4A 1FPCH 3R0FA 1SFQB 2ZCHP 1DANH 1GJ6A 4UD9H 3URDA 3M3VA 1W0JD 2BVSH 5ABWA 4XBDA 5DGJA 4CRBA 4JYTA 1W0ZU 1W0KD 3ITIA 4NSVA 2R9PA 4FUJA 3A80A 3RXMA 1O2ZA 4ACAA 1O2HA 3TGJE 3VB4A 3NK8A 4X1RU 1SQOA 3OYPA 1C1WH 1INCA 3OTPA 1TX7A 3RLYH 2J5UA 4NIYA 2OTVA 4CR5A 5FPYA 3BIUH 1SGRE 1KSNA 2HWLB 4PROA 2UWOA 5DN6D 2EI7A 3IG6B 4K1TA 1O2WA 1CHGA 1P3EA 1SGCA 4CREA 3RXIA 2Y5FA 2BD7A 4X2WA 2F9NA 3IWMA 1D3DB 2H2ZA 2NU1E 1YC0A 2JJ1D 2SGAA 5L2ZH 2TGDA 3SQEE 3EE0B 3H09A 2CGAA 1RD3B 1C1OA 3GOVB 1ZPBA 3TVJB 1ARCA 1H9IE 5C94A 1GI0A 3GS9A 3KHVA 1C5PA 5BPEA 5LGOA 2LP6A 4NWKA 3O8BA 2HVYB 1BMLA 1O5GH 1OPHB 2XXLA 2OCVB 3SU5A 1KLJH 1FQ3A 4CRGA 1AU8A 1TX8A 2QE7D 3NXPA 1YKTA 8LPRA 2F4LA 3MYWA 4DURA 4MTBA 2GT8A 1H8HD 2Y81A 2FYQA 1TGNA 1LKBA 1O2QA 3KQBA 1ELCA 1ELFA 1KDQB 4DJZB 1BHXB 1OYQA 3E0PB 1DITH 4X6MA 1NO9H 2VWOA 5F8ZA 1S0RA 2FODA 4VGCC 3U8OH 1F5RA 1DDJA 2GT7A 1K1MA 2ZDNA 2QYIA 3GCNA 1CHOG 1O5DH 3RXVA 2J97A 2A0QB 4NA7A 5CHAB 3F9FA 2A5IA 1P2IA 1PPFE 4KTCA 1W3CA 2G52A 2GZ7A 1D3TB 1EXFA 2B0FA 3DSPA 2WV5A 4DIIH 4I32A 3BEIB 4JCNA 5EXMA 3U8RH 4Y71A 1EP6A 2HALA 4CHAC 4A92A 2Y6TA 3TJNA 2PLXA 1V2TT 2GGVB 4O9VA 4B6FA 3GDVA 2EI8A 2J92A 1NFXA 1JRTA 3LGVA 4ZKOU 1SOTA 1SGYE 2Y7ZA 2XTTB 3F68H 6ESTA 2VH6A 4J1YA 1H4WA 3L3TA 4F48B 1K28D 2ZFSA 3RM0H 1W8BH 3UUZA 1GJDB 2BDGA 5EG4A 2SGQE 1HAHH 1D6RA 1Q2WA 4XD7D 1KXCA 1NRPH 3SYJA 1WQSA 4B74A 1C4V2 1HIAB 1FAXA 5C20A 1MKWK 1GMHF 1ZPCA 3D65E 5DP9A 4WWYA 1A5HA 3K65B 2G81E 1GDNA 3VB6A 4NFEA 2HGTH 1WSSH 2H1UA 1BCUH 2G4TA 3A84A 3A87A 5JB8S 3H5CB 1XUGA 4Q7YA 4JZDH 1GMCF 1OWDA 1QNJA 5E8EH 1UCYH 1TB6H 1GBEA 1F0TA 3OY5U 1VJ9U 1WOFA 1B0FA 1NU7B 3RU4E 1M9UA 4ZHLU 3CENA 2YOLA 1O2RA 2V0BA 1TRYA 1P06A 2A4QA 2THFB 4ZHAA 9LPRA 2A32A 1WU1A 4ABGA 1S6HA 4K69A 4CRCA 2ZQ2A 2BMGB 1KXFA 4Y8XA 2KX4A 5F03A 3TGKE 3M7TA 1AUJA 3K6YA 4NCYA 2A4RA 3ZZ7A 2JH0D 1ORFA 1OWHA 1O5CB 4X8VH 3SI4H 3GCTF 2F3CE 2VWLA 4RI0A 3LONA 2VIVA 1DLKB 4E7NA 2FESH 2W6JD 4NSYA 4IBLH 2H5DA 1W11U 3TH3H 1P9UA 1QRXA 1J17T 1UK2A 1ZYOA 2XC4A 1GI6A 3M5MA 1PPCE 2VIDA 1TX6A 1C5OH 2WSSD 1OWJA 4A1TA 1C2JA 3D49H 3MO6A 2Z9GA 3T25A 1W7XH 2AIQA 2WPDD 4YLUA 1T8LA 2XOKD 5F8XA 2QXHA 2GTBA 2WV4A 1G3CA 3M5OA 3TNSA 3ZV8A 2UUJB 1GI7B 1ZJKA 1A5IA 1VJAU 2ZGXH 4SGAE 2HLCA 2P93A 2ZTYA 2A5KA 1XVMA 2BQ6B 5HM2A 1VITG 2A45B 1O2OA 2QV1A 3ZZAA 3BTHE 1CBWC 2ZQ1A 3SJ8A 1YGCH 2BDIA 1UTNA 1AVXA 5EW2H 2GCHF 5DP7A 2BDCA 1Q31A 4Y7AA 3MNBA 3KNXA 5EQRA 1Y5AT 3RXOA 5I46H 1H8IH 2IJD1 1P2KA 3FZDA 2VIOA 1GJCB 1XM1A 3LGUA 3PMBB 4OM9A 4THNH 1L0ZA 3DD2H 1GBCA 1QBVH 1ESAA 1ANCA 3PWCA 5EW1H 4H42U 4LZ1H 1OHHD 1UTMA 1AE8H 3QGNB 4HGCA 2SNVA 1C9TA 4AG2A 2TPIZ 1UTPA 3SV7A 3MNCA 2ZDMA 1SR5C 3S9BA 5HMAA 5PTPA 2HOBA 3QZQA 2J2UA 1C1RA 1K1NA 4QT8C 2OUAA 4U01A 3BTTE 1HJAB 1G36A 1V6DA 4X8TH 2ZZUH 1HCGA 4JYUH 8GCHG 5CHAC 7KMEH 2HVXA 2W7SA 1FDPA 3UWIA 2Y82A 2PFEA 1CT2E 3S9AA 1O2VA 1FNIA 2QY0B 1HAOH 3LT3A 2H9HA 2R3UA 4X1PU 4ZKRU 4Y11E 1T8MA 5F6MA 2FXRA 1EFRD 1BTZA 2CK3D 3A7WA 3T5FH 1Y8TA 5C1XA 2H5CA 3PV4A 3SO3A 4DT4A 5DP8A 5C1YA 2VGCB 1TAWA 1GBLA 3E0NB 3TK9A 4FUBA 4GHQA 2WINI 4ISNA 4FUCA 3E1XB 5E0HA 1BTHH 2VWNA 3MU5A 4Z0KA 4H4FA 1PPBH 3EA7A 1ABIH 2J94A 3RXQA 4NIXA 3UOUA 4YLQH 1V2ST 1QZ8A 2B9LA 3GDUA 2JIZD 2FO9A 1GVZA 3S7HB 4AX9H 1HXFH 2KM0A 3FOAA 3KQDA 1EP5A 2PTCE 3ZVDA 1ZMNA 1WUNH 3Q77A 2BLOA 2OC1A 3VGCB 1NC6A 4DY7B 1PPZA 2XBVA 1O3IA 1C5VA 1FY4A 1NESE 4DVAU 1GDQA 2A31A 1AE5A 3ZYDA 3UY9A 4AG1A 1DY8A 1LHDH 1C5ZB 4X0WU 1BOQA 4ABJA 3EYDA 3ZZ4A 2IN2A 1ZSJA 2GMTB 1OWIA 2QXIA 4ZKNU 4B76A 2W3KA 1GDUA 4WMEA 4BAKB 1GHXH 1ANEA 2RCEA 2ZG0H 3NKKA 2XW9A 1YLCA 1O2PA 1O2JA 3M61U 4DW2U 2PSYA 1W0YH 1EX3A 2RDEA 1CGHA 5AFYH 5C1UA 4XE4A 4OS7A 1MMJN 5JB9S 3L6PA 3MFJA 1L1GA 1RRKA 1CE5A 1NZQH 3F9HA 4KGAA 1Y3WA 4UFGH 2GV6A 4B1TA 2K1QA 3SV9A 5A2MH 2J98B 1KYNA 2WHXA 4WH8A 1WAYB 1JRSA 2BY6X 3PV2A 1B7XB 2ULLA 3SU0A 3HATH 5JBAS 2FWWA 3CS7A 3A81A 3VXEH 3OX7U 1EJMA 3FP7E 3RUOA 1PYTC 5DSFA 2ANMH 3RXEA 2BX3A 1C1UH 5C0UA 1AUTC 4Y8YA 1GBTA 3AAUA 5J4QA 3F3BA 2C8WB 3PTBA 1O30A 2Y5HA 3BIVH 3PLPA 4XOJA 5GWZA 1IQGA 2ZDVH 2A5AA 1GJ9B 1E38B 5FAHA 4MPXA 2YNAA 3D62A 5JBBS 2Y7XA 4K5ZA 4I8JA 4MPUA 3RP2A 5LPRA 3A7YA 5AVDA 4D76A 3M7UA 1TMBH 5B6OA 1EOJA 4FUDA 1S84A 3NZIA 4I8LA 5EJLA 4A1XA 2HLDD 2GJGA 3PO1B 1ESTA 1IHTH 3BN9A 3FN8A 4BAQB 3ZZ8A 3DSGA 3TK6A 1S85A 1Z71A 4Q2KA 5H4IB 4Q63A 4IC5A 1C5LH 1MTNB 1P57B 1VGCB 1CO7E 5DPAA 1MAXA 4IS5A 2EA3A 1MKWH 2BDAA 1P03A 1C2GA 1MD7A 2TGAA 2BZ6H 1ELEE 2AFQB 8KME2 1SC8U 4BTUB 2FOBA 1XUFA 5ETXA 1V2RT 6CHAB 2ZGHA 1GI1A 1HAVB 2BD8A 2QXGA 4ISHH 5GNDA 1DUEA 4I8KA 3BSQA 4K3JA 1V2MT 2QN5T 1S6FA 4K1SA 3GY7A 2OK5A 4UEHH 1GJ4H 1F0UA 3RXHA 1QY6A 4E05H 2A4OA 1GCDA 1DWBH 1FN6A 3F2GA 5DP4A 1GHVH 3E91A 2ZA5A 1C5MD 1LHEH 1H1BA 1E1RD 2J9NA 3MH5A 1G2LA 4JZFH 2KAIA 3RMMH 2OC0A 1E34B 1RS0A 1J9CH 1BMFD 1PPHE 4GSOA 1MZDA 1C5QA 3MH7A 4IW4E 2UUKB 3QX5H 2KCOA 1LHCH 1UHBB 4ZROA 2VGCC 1ZZZA 4O97A 3ZVAA 1O3OA 4E7RG 4P02A 5FPSA 5LPEA 3MU0A 2VU8E 3T62A 3TGIE 3OSYA 3N7EA 2P3FH 1K9OE 1D9IA 2IPHA 1N1LA 2FX4A 5GDSH 3F1SB 1HUTH 1YPLH 1EAUA 2I6SA 3ZVGA 4TYDA 1GBHA 2V3OH 1P3CA 4FETA 3SORA 1SGNE 3M5LA 1PYTD 3CS0A 3T29A 3O8DA 1D4PB 5DG6A 1GGDB 2ZHWH 1EUFA 2FOMB 1BTUA 4ABHA 3QZRA 4ZKSU 3ODDA 2R2MB 1T4VH 2ASUB 3VGCC 1F0SA 1NS3A 4NZLA 4U2WA 1F2SE 2RDLA 1O3FA 3WY8A 2ANKH 3E8LA 3VG8A 4O03A 1C4U2 3T28A 3UQVA 4NIWA 1MUEB 1SQAA 2Z7FE 2FYRA 3RXUA 1XKBC 1LMWB 1QB1A 1L1NA 3SNBA 2D26C 2F9OA 2RFKC 4ABBA 2GMTC 1C5SA 3RXRA 3U98H 3GY3A 1B5GH 1K1IA 2K8IA 5HGGA 1IOEA 4MDSA 1V2QT 2GP9B 1CA8B 1P01A 2FTLE 5T1VA 1XX9A 5C2ZA 3ZVFA 2XBYA 1HFDA 1PQ7A 3U1JB 3GY4A 3SHCH 1UMAH 1AB9B 5A0CA 1QQUA 2Q6FA 1AO5A 2LPRA 1YCPM 4FUIA 2PP6A 2ZCKP 2ANYA 4LK4A 4CBNA 6LPRA 1OSSA 4I31A 4I8GA 2XRCA 5ESTE 3RXDA 5T6GA 2ZFFH 1W12U 2Z9LA 1HLTH 1KDQA 1MU6B 1ZTLA 2JETB 1W13U 2G55A 2VIQA 4U30A 1LPGB 2QAAA 1GI9B 3EA9A 1V2VT 1JWTA 2R2WU 3MNSA 1A0JA 1G30B 2XWBI 2W26A 5E0JA 1NU9A 5E2PA 5DP5A 1ETTH 3AW0A 1YPJH 4D9RA 2PKAA 4GVUA 3C1KA 1O39A 5A0BA 3SGAE 1TPSA 4BXWA 1ZSLA 1ELDE 1QA7A 4GCHG 1YM0A 1MKXK 1LO6A 2RA0A 3KL6A 3SZEA 4F4OC 1LVMA 6GCHG 5BRRE 4D7FA 3GCOA 5J4SA 4RN6A 4IN2A 4Q4LA 1EJNA 1SLXB 1V2NT 5DP6A 2PUQH 3Q3YA 3RLWH 5F8TA 1ETRH 2FX6A 3U28C 4DT7B 4I8HA 3PO1C 2AHME 1SGPE 4Y0ZE 2QA9E 2TRMA 1G2MA 4YTAA 1THSH 4WVPE 2FLBH 3PLKA 1VKYA 1MTNC 3UNRA 3FFGA 1QB9A 1RFNA 2NU4E 2C8XB 1SBWA 1MABB 2GCTB 3M35A 3A7TA 4ZCNA 1ZRBA 1TALA 1FY8E 3HGNA 4MPWA 3UAIC 3E3TA 1HIAA 5JBCS 2PKAB 3OE7D 3E6PH 1NFYA 3I78A 6CHAC 1G3EA 1UTJA 2M5TA 2PGQB 1DE7H 2UUYA 4O3UA 2CXVA 1SLWB 2BD5A 3W1EA 1FJSA 1OYTH 1W14U 3BF6H 1CVWH 2PSXA 1O34A 2PUXB 4Q7XA 4BANB 2CN0H 4AGJA 4AN7A 3SHAH 1A1RA 4ZH8A 1EATA 3PM3A 1ZHPA 4IC6A 4IMZA 1X7AC 2ZGBH 2QCYA 1C5WB 3SGBE 4K60A 1UCYE 3BG4B 2UUFB 1V2LT 3E90B 1AKSB 4OS1A 5T6DA 4BOHA 4TSFD 4X8UH 5KEDA 3GY5A 1K2I1 2XYAA 5IDKA 3BTQE 1O3BA 1DWCH 1S82A 2A2QH 2AIPA 4GPGA 1GCTC 3UIRA 4A5TS 3A7VA 1JIRA 1MH0A 1MBMA 2YMSB 1VCQA 1A3BH 1ETSH 1N8OB 2AMQA 2ZECA 5FHTA 1AZZA 3MQKC 2Z9KA 2A1DB 3OTJE 1GBBA 1GGDC 1YPEH 1BBRE 5EJZA 1F5KU 2BDYA 1NROH 1LVOA 1EQ9A 3KQCA 1TNHA 5TCCA 1UJ1A 4ISLA 3LKWA 2ZIQH 1Z7KA 3OY6U 5C3NA 3NUMA 1QR3E 1V2OT 4NIVA 2STBE 3SNEA 1K1OA 4XSKU 2O8WA 1TE0A 4IMQA 1AIXH 3PRBA 1IQIA 1AQ7A 1MU8B 4I86A 3A85A 5CHBA 2FS8A 2XNIA 1GBAA 3MTYA 3SNAA 1EASA 4BAOB 3U9AH 3SQHE 4RT1A 1BBRH 2EI6A 1Z8JB 1GHBG 4AFSA 2ZFPH 1FI8A 4D9QA 4X2VA 3M36A 1BJVA 1CT0E 4FXGH 2A7JA 2FS9A 4LZ4B 1J15A 4RSPA 1TQ0B 2HNTF 1ZMJA 1S81A 1O35A 1FV9A 3WWBA 3N7OA 4ABAA 1EB1H 1GJAB 1BTXA 1V2KT 1CGIE 1O3KA 4DG4A 1QHRB 2A7HA 3FVFB 1GHYH 2ZHQH 1AWFH 4P00A 3AVZA 2WV9A 3FP8E 3KN2A 1IQEA 2C4FH 2GZ8A 2TBSA 5GCHF 2LELA 3HPTB 2O8UA 1W10U 1SLUB 1UVPA 1QQ4A 1ANDA 1E37B 1QTFA 2JETC 4KTSA 4R8TB 5L2YH 1QJ7B 3LGYA 1DWDH 1BMNH 3DUXH 1SOZA 4F49A 2F9PA 1O2SA 1ZHRA 3RM2H 2Q6GA 1RGQA 2QF4A 4YT7H 2BDHA 1AN1E 1AMHA 2FOGA 3P17H 1O2XA 1BA8B 2G5VA 4A7IB 2JKHA 2WUCA 3ELAH 1UTLM 3S69A 1TRMA 3GISB 2F9UA 2W3IA 3EA8A 2FDAA 1J14A 4TPYA 1YCPK 1GHAF 4TWYA 5LPFA 2BHGA 3SJOA 2F83A 1G3BA 1TNIA 1SB1H 1P11E 2ZHDA 4F55A 2H6MA 2RG3A 1O38A 4MPVA 2B8OH 3EGKH 2WPKS 3PTNA 1PQAA 1TGSZ 2PV9B 3U69H 3A8CA 1P05A 2M2AA 4RKJB 1FLEE 3RXJA 4DIHH 2GZ9A 5K0HA 1IQLA 1K1JA 2ZF0H 2WPJS 4AFUA 1NBME 2BY8X 2ODPA 4DOQA 1GI3A 1QBOA 1NRSH 1VITH 2J95A 3DSOA 1VCPA 5T6FA 1GPZA 5HXFA 1L4ZA 5LH8A 1GBKA 4XBCA 1TA2A 1DSUA 2ANWA 1XMNB 2W5EA 3TH2H 2VVVA 3IITA 1T8NA 1C1MA 3RXKA 1P09A 2ZPSA 4B73A 1L2EA 1P2JA 1AI8H 4U32A 2O8MA 1AGJA 3DA9B 1AFQB 1O3DA 1YF4A 4A1VA 5EPYA 1BB0B 2F43B 4AZ2B 3A8DA 4MLFB 1PPGE 4UFEH 1E35B 3RU4T 3Q76A 3RXSA 1THPB 1VR1H 5A8ZA 4AGKA 3MI4A 1ID5H 1XUKA 1C5YB 2OINA 3BG4C 3LGIA 4NA9H 3H7OA 3TNTA 3P8FA 1O2IA 1EAIA 1GMDF 1T7CA 5FCRA 1LPKB 3RU4D 3SW2B 2BVRH 4YZUA 1K22H 3WWFA 4SGBE 2NU2E 1TABE 2EC9H 2YMSC 1N8OC 7LPRA 5L6NH 4MQAA 3SUDA 2BQWB 3ZZDA 3Q3KA 3V3MA 4E06H 1TOMH 2OC7A 4XBBA 1HPGA 3D23A 2J98A 3BTKE 1XUJA 1BMAA 3TIUA 3TJUA 3PB1E 1PQ5A 1G3DA 3TU7H 4MNVA 5FPTA 1TLDA 4CR9A 1V2WT 5HIYA 1NTPA 1KXDA 1GVKB 2BD4A 2VNTA 1BMMH 3RXTA 4KP0A 1DICA 2RA3A 5EQSA 4LXBH 1CT4E 1ZMLA 1MKXH 4Y79A 1FMGA 1SGTA 1GJ7B 3EDXB 4YXWD 2QF0A 1NFWA 1KLIH 1ACBE 1FX0B 3UTUH 3SJKA 1HNEE 5HYOA 4HFPB 4XFQA 1YPKH 4A6LA 4TY7A 4Y8ZA 4I7YH 1Y3UA 3LPRA 2P59A 1LQEA 3DCLA 1Z8GA 3ZVCA 1BRAA 4XDEA 2YNBA 1O36A 2AH4X 1GHZA 1QA0A 1ZRKA 1OXGA 3LC3A 4WMFA 1BITA 4B2AA 1MQ5A 4BAHB 3I77A 3L33A 4YOIA 4X2YA 1GMCG 1HXEH 3GYLB 3SBKA 1O2MA 1A0LA 3DFLA 2BQ7B 3V7TA 3ZZ9A 4YM9A 1RJXB 1EKBB 1E0FD 2JJ2D 5ESBA 4CRDA 1SL3A 1TIOA 1GI5A 1O3AA 4OGXA 2QF3A 1D3PB 2CHAB 1C5UA 1SGIB 4IGDA 1SHHB 2VWMA 1C5NH 3V12A 1MZAA 1LQDB 3BEFB 1GHWH 2NU0E 1NRQH 2EY4C 2FOFA 3LOXA 3P95A 5C5OA 1TNKA 3LIWA 5GXPA 3TITA 1LDTT 1O3CA 1FAKH 1LVBA 3P92A 3MU8A 1F5LA 1HAVA 3FO8D 4K1EA 1TMTH 4NA8A 1E36B 1RXPA 1CHOF 3OAAD 1SSXA 2BLWA 3O8RA 3SV6A 1DM4B 3HGPA 3G01A 3P8OA 2A7CA 2VIWA 1DPOA 4JYVH 3EAJA 1HAPH 2FP7B 1NBMD 2STAE 2HPQH 2PHBA 5FBEA 1O3LA 4M9FA 3LDXH 4UFFH 5FL7D 1O31A 1GI2A 3SN8A 1KY9A 1EB2A 1AVGH 1UHBA 1TRNA 4FUGA 2FOCA 1N6YA 1ZGVA 3MHWU 3VB3A 3UOPA 3ATLA 3JZ1B 1ANBA 2YMSD 4KELA 3RXLA 2GKVE 1GI4A 4H6SB 1UW7A 1YPGH 2F9VA 1QL9A 4GHTA 1BIOA 1OS8A 1HJAC 3AASA 1CQQA 1QIXB 4TPIZ 1C1NA 1RIWB 1SG8B 2CV3A 3B9FH 2GDDA 1EOLA 3GDSA 1T4UH 4UFDH 2BVXH 2OBQA 1H8ED 3OU0A 2J34A 1SGFA 1E1QD 4X6PA 4CRFA 1QRWA 2Z9JA 3UR6A 2GCHG 2FOAA 2V7QD 3QUMP 2CF9H 5K7RA 2WUBA 1Y3XA 1T8OA 2BD3A 4NGAH 2R3YA 5EJ1A 2ZI2H 3K6ZA 3BV9B 2Q1JA 3TJOA 1PPEE 1NN6A 1EAXA 2UWPA 2ZPQA 3FZZA 2BOHB 4MNYA 1KXBA 1A2CH 4Q80A 1DOJA 2Q6DA 3GCHB 1GI8B 1O5EH 4OS6A 5FCKA 5HIZA 1IQNA 2ZDKA 1RTLA 4INHA 1BUIA 5DO4H 2FZZA 2JH5D 4TY6A 2R0LA 7GCHG 1P2MA 4ABEA 1O5FH 3P8NA 1SPJA 2L6OA 5EOKA 4OS2A 3UR9A 4KKDA 4K2YA 4RT0A 1NT1A 2EQNA 2FMJA 3STJA 2XCNA 1NPMA 5G4BA 1O37A 2WPIS 1GHBF 4DGJA 1TPPA 1OP0A 2PTNA 1W2KH 1C1PA 1Q3XA 3A8AA 4FUEA 5DKMA 1O32A 1Z1IA 4GAWA 1P02A 2QIQA 3GY2A 4WMDA 1XVOA 1HB0B 3ATWA 5GJ4B 1V2UT 1QURH 2F91A 1LHFH 4IN1A 2PKSB 2DE8A 1DFPA 1ARBA 2G8TA 2XWAA 3FANA 4AFQA 3PV5A 1GBMA 3F0OA 2BLVA 1HAZB 4Y0YE 1MQ6A 2O8LA 1E79D 4MG3A 4JK6A 3URCA 1WV7H 3N99A 1HGTH 1F92A 2P8OB 2HPPH 3RC6A 1QFKH 2P3UB 2B7DH 3MMGA 1YCPH 5EGMA 1ABJH 1G37A 2ZP0H 1AHTH 3PROA 4WY3A 2ZO3H 1N6XA 1HDTH 5C5NA 1C2MA 1BHXF 1FN8A 1SVPA 3RMOH 3LGWA 2KR7A 3ESTA 4JMYA 1JIMA 2AGIX 2BY9X 1VITF 2AGEX 3TH4H 2PWXA 4ASUD 1MTWA 1KTSB 1XXFA 2ALPA 2FIRH 3M3SA 2WPMS 2NWNA 4YT6H 3A83A 1SMFE 4WXIA 1ZGIA 3ZZ5A 2P94A 2NU3E 1Z8RA 1TMUH 1WXRA 3B8JA 4MNWA 1EPTB 1MTVA 1WQVH 4DCDA 1SQTA 3AW1A 5A8YA 5AF9H 1C2KA 4X8SH 3QN7A 2CHAC 1QJ6B 2I6QA 3SOSA
chains in the Genus database with same CATH topology
1MD8A 2PR3A 1QB6A 1AVWA 1IQFA 2ZU5A 2R0KA 5SGAE 1HAIH 2P95A 3AAVA 4UE7H 7ESTE 1EZSC 4ZAEA 4CBOA 1T32A 2SGEE 3T27A 1KTTB 4UDWH 4X2XA 4BTTB 2ZDLA 1SHYA 2ZTZA 2JH6D 1ZTJA 4Y6DA 4FVDA 4GLYA 2SFAA 5CMXH 2BLQA 4JZ1A 5EODA 3K9XB 5GPIB 8GCHF 3Q3XA 2BXUH 1FY5A 3LJOA 1C5RA 3M5NA 1CBWB 4AYVB 1TBQH 1KXEA 2WPLS 2VIPA 1RTKA 1P2OA 2XC0A 1TOCB 1TQ7B 3BEUA 2FI5E 2ZU3A 1UVOA 1QCPA 4AB9A 1YPHE 1O3MA 1C2LA 1ELGA 3NWUA 1O2TA 1TYNA 2P16A 3EQ0H 1VGCC 4FUFA 1B0EA 1O3GA 1XUHA 3SNCA 1TPAE 3LH1A 1AKSA 3UNQA 2ODQA 1WCZA 2ZDAH 3GICB 1DSTA 1O2GH 1O3PB 2GDEH 4NG9H 1YYY1 4X6OA 1C1SA 3PMJA 5L30H 2ODYB 1RIWC 2ZFQH 3P6ZB 3RXFA 3SU1A 1O3HA 3BTGE 5EXLA 2G4UA 1O2NA 4WXVA 3JZ2B 2TGTA 3RXBA 2IJOB 3C27B 2V35A 1IQHA 1K21H 3B23B 1C1QA 3LJJA 1TGBA 2BY5X 1S0QA 3FAOA 5A09A 1SGFG 2Z94A 3KF2A 5JBTA 2D8WA 4INKA 3W95A 2QGRA 1YPHC 2ZTXA 2ZNKH 1UVUH 2ZKSA 1UTOA 3BTFE 3K2UA 1UO6A 4I33A 3GCHC 1NRRH 5JPMH 2AMDA 2OLGA 3R3GB 3V13A 1DUAA 1FIWA 3SV2H 3PMHB 1CU1A 3ZVEA 1S5SA 1KXAA 1A5GH 1D3QB 1HJ9A 1BZXE 1OWKA 2VJ1A 3DHKH 1MCTA 1DS2E 3NPSA 3UQOA 3GY6A 1LHGH 3U1IB 4Y7BA 1NRNH 1TWXB 1H9LB 1EJAA 2H9TH 1FONA 3TPIZ 1H8DH 3PLBA 4ISIH 2FOEA 2D2DA 1PFXC 4X1QU 1C9PA 2O8TA 2VVCA 2FLRH 1BTYA 1KLTA 1O3JA 1HJ8A 4ZUHA 5C67A 1UK4A 1LVYA 1BJUA 1HRTH 5TJXA 3DFJA 4AB8A 1TONA 4BAMB 2A2XH 3DT0H 3KEEA 1IQKA 2PKSC 5HM9A 1FIZA 2A4GA 2C93B 3RXCA 3PYHA 2ZWLH 2J38A 3SU3A 4HZHA 1TBZH 2Z9IA 4OS5A 2P8OC 1A0HB 4FU9A 2SGPE 1C2HA 4HI3A 1BRUP 2BXTH 3MWIU 1YPMH 4Y10E 1AB9C 3MH4A 4O3TA 1Y59T 2O9QA 2QC2A 2XC5A 1C5XB 4ASHA 2AERH 3SGQE 1O5BB 4B2CA 2G5NA 5FX6A 1PQ8A 1ZLRA 4ABDA 2BD9A 5TCAA 2BY7X 1YBWA 2PGBB 3HKIB 3RXAA 3MNXA 3RC5A 4B71A 1EPTC 5GIBA 3S0NA 1JBUH 2P3TB 1GWAA 1U6QA 2G00A 5FBIA 4ZHMU 3SU6A 4ABIA 1SGDE 1GL0E 1ZSKA 4RKOB 1P10A 3BG8A 3U8TH 1OP2A 4ESTE 1TGCA 2Y5GA 1A46H 1AY6H 1GJ8B 4WF8A 1P9SA 3A7ZA 1Z6EA 3QDZB 3A88A 2EEKA 1V3XA 1WTHD 1Y3YA 1O0DH 1CA0B 1P04A 1KIGH 2ZHFH 1HV7A 3VXFH 1FXYA 1C2EA 1P2QA 1ZOMA 3T2NA 3A7XA 3VB5A 1L1JA 3A82A 3UPEA 2XBXA 1DXPA 4J2YB 1SI5H 3ZYEA 1GVLA 1ELVA 1OOKB 4BNRA 2GV7A 5EU8A 4AORA 1GL1A 4TWWA 5DP3A 2ZPRA 4WH6A 1T31A 1Z6JH 2C8YB 3HK3B 2GCTC 3KQEA 2ZGJA 1BRCE 3ATIA 3QWCH 1WBGB 3QGJA 2W7UA 4JZIA 3RMLH 1UTKA 1SFIA 1V2JT 2ZC9H 4WJG2 2BZAA 3GYMA 1IAUA 3I29A 3A86A 1BTPA 5AFZH 3P8GA 4NZQA 1QJ1B 2SGDE 3VPKA 2FI4E 7GCHF 1OWEA 3SU4A 4K8YA 2B5TB 3SUEA 1P2NA 2C8ZB 2HRVA 2Y80A 2VINA 1J16A 1Y5UT 2LNCA 3RXPA 1XUIA 1O33A 1ZHMA 2VB0A 5A8XA 1P12E 4ISOA 2AGGX 5E0GA 3ZZCA 1BTWA 2BD2A 3TLOA 3O8CA 4BTIB 3BTDE 5I25A 2OQ5A 1ZJDA 1GJ5H 1GBIA 1TPOA 2SGFE 1EAWA 2FM2A 1TNLA 4X1SU 3F9EA 2FTMA 2BDBA 4Q7ZA 5DK1A 1ELAA 5AHGH 3ODFA 4YO9A 3SU2A 1MAYA 3M37A 1H9HE 1EZXC 1A7SA 3UFAA 2DUCA 5FXLA 1O2KA 2ZHEH 1FUJA 1UTQA 1O2YA 4Y76A 2IOTA 3S9CA 1F7ZA 1HAYB 1HAXB 1J8AA 3SUGA 2ZFRH 5A0AE 2AS9A 2ZFTA 1QL8A 1SGEE 1FY3A 4ZXYH 1JXPA 3T26A 2BX4A 3F6UH 1XKAC 3ZV9A 1DWEH 1DT2A 3BTEE 1BQYA 3E16B 3F9GA 3SI3H 1JOUB 2AYWA 1DLEA 1FZZA 3BTME 2BOKA 1TA6A 4AFZA 3TJVA 1NM6A 2Z3EA 2UWLA 1GG6B 3RMNH 4YOJA 1TFXA 1C1TA 4JZEH 1G9IE 2GVFA 1AFEH 2OD3B 1CSOE 3LU9B 1V2PT 2ZEBA 1BRBE 3FP6E 4YOGA 3V0XA 1GBFA 1GMHG 2BM2A 3VFEA 3M7QA 2OC8A 2XCFA 1XXDA 1C1VH 2VVUA 4HTCH 3GY8A 1ZR0A 2TGPZ 5FX5A 3S7KB 4BXSA 2ILNA 1ELBA 5JDUB 1G32B 1MCVA 1F0RA 1AD8H 2SNWA 4B2BA 4AOQA 1IHSH 4GCHF 4OGYA 3QTVH 1DY9A 8ESTE 2PW8H 6GCHF 4GUXA 3LH3A 3LC5A 2OXSA 2TIOA 4D8NA 1Z8IB 1A3EH 1NFUA 1GBJA 1QL7A 1MTUA 5EPNA 4R0IA 3HK6B 4MVNA 4CRAA 2C3SA 1W7GH 3NCLA 1D6WA 1LPZB 4M7GA 2Z6BD 1IQMA 2ZCLP 3SUFA 1SLVB 1HBTH 3QLPH 1HYLA 2OBOA 3KIDU 3UREA 3P70B 3CP7A 1RTFB 1TNGA 1UCYK 3SZNA 2CMYA 2HNTE 2ZU1A 1UK3A 3GCTG 4H6TA 1NY22 1LTOA 1CA0C 3SJIA 3M3TA 2OQUA 2GD4B 1DX5M 9ESTA 2XBWA 4FVBA 2V3HH 4D7GA 3ENSB 1OKXA 1SGQE 3ZZ6A 4Z6AH 2ZU4A 3QTOH 1TGTA 1OX1A 3ZZ3A 2WPHS 5GCHG 1BBRK 3MO3A 3HKJB 3SNDA 5IYTA 3VB7A 5CE1A 1OP8A 3QK1A 4X1NU 2DE9A 1JMOH 3SJ9A 3ZVBA 2BB4A 4MNXA 1PJPA 3KCGH 2V6NA 1EZQA 2CJIA 5T3HA 3UWJH 1GJBB 3VEQB 1ZPZA 2WYGA 5E2OA 2HNTC 1TBRH 3BTWE 2FEQH 4FU8A 4VGCB 4CH8B 2ZGCA 3SV8A 3ZZBA 1LCYA 1P8VC 1C4Y2 4CH2B 4UONA 3PWBA 2ESTE 2H9EH 4AYYB 1GHAG 1O3EA 1LKAA 1AFQC 1K1LA 1K1PA 3PMAB 4INLA 1YLDA 2QXJA 1ELTA 2Z3CA 3TK5A 1AWHB 2F9BH 3W94A 2GX4A 1TNJA 3STIA 4CHAB 1BT7A 1Y3VA 1C2DA 1WTGH 5JYIA 1VCWA 3H7TA 1MBQA 1DVAH 1O2UA 1O5AB 1VZQH 2WYJA 5EXNA 3RDZA 1L4DA 1FY1A 4K8BA 3ATMA 1QBNA 2J4IA 1P0SH 1ESBA 4FU7A 1WYKA 3KGPA 1DXWA 2ZU2A 3MOCA 4YESB 3A8BA 1BDAA 1IQJA 2VH0A 1O3NA 3RXGA 1ZTKA 1GBDA 2D1JA 1MTSA 1GCTB 4NWLA 1FPHH 2C90B 1YP9A 1C2FA 1A4WH 2FI3E 2G51A 1EPTA 1Y5BT 4X6NA 4ZMAH 1THRH 2Z3DA 2BYAX 1A61H 2ALVA 4FUHA 1C5TA 2CF8H 1UVTH 4B75A 1GG6C 1AZ8A 5EQQA 2FPZA 3A89A 4KTUA 2AEIH 1O2LA 2AMPA 1Z1JA 2KAIB 1EZUC 1C2IA 3ATKA 4JK5A 4ABFA 1GMDG 3QO6A 3MU1A 5DJ7A 2FOHA 1CGJE 3MO9A 3MU4A 3MH6A 1QGFA 1S83A 3RC4A 1HAGE 3LGTA 3Q00A 4LOYH 2BTCE 2OP9A 4ZXXH 1UVSH 1QRZA 3UNSA 4NFFA 4OS4A 1FPCH 3R0FA 1SFQB 2ZCHP 1DANH 1GJ6A 4UD9H 3URDA 3M3VA 2BVSH 5ABWA 4XBDA 5DGJA 4CRBA 4JYTA 1W0ZU 3ITIA 4NSVA 2R9PA 4FUJA 3A80A 3RXMA 1O2ZA 1O2HA 3TGJE 3VB4A 3NK8A 4X1RU 1SQOA 3OYPA 1C1WH 1INCA 1TX7A 3RLYH 4NIYA 2OTVA 4CR5A 5FPYA 3BIUH 1SGRE 1KSNA 2HWLB 4PROA 2UWOA 2EI7A 3IG6B 4K1TA 1O2WA 1CHGA 1P3EA 1SGCA 4CREA 3RXIA 2Y5FA 2BD7A 4X2WA 2F9NA 3IWMA 1D3DB 2H2ZA 2NU1E 1YC0A 2SGAA 5L2ZH 2TGDA 3SQEE 3EE0B 2CGAA 1RD3B 1C1OA 3GOVB 1ZPBA 3TVJB 1ARCA 1H9IE 1GI0A 3KHVA 1C5PA 5BPEA 5LGOA 4NWKA 3O8BA 1BMLA 1O5GH 1OPHB 2XXLA 2OCVB 3SU5A 1KLJH 1FQ3A 4CRGA 1AU8A 1TX8A 3NXPA 1YKTA 8LPRA 4DURA 3MYWA 4MTBA 2GT8A 2Y81A 2FYQA 1TGNA 1LKBA 1O2QA 3KQBA 1ELCA 1ELFA 1KDQB 4DJZB 1BHXB 1OYQA 3E0PB 1DITH 4X6MA 1NO9H 2VWOA 5F8ZA 1S0RA 2FODA 4VGCC 3U8OH 1F5RA 1DDJA 2GT7A 1K1MA 2ZDNA 2QYIA 3GCNA 1CHOG 1O5DH 3RXVA 2A0QB 4NA7A 5CHAB 3F9FA 2A5IA 1P2IA 1PPFE 4KTCA 1W3CA 2G52A 2GZ7A 1D3TB 1EXFA 2B0FA 4DIIH 2WV5A 4I32A 3BEIB 4JCNA 5EXMA 3U8RH 4Y71A 1EP6A 2HALA 4CHAC 4A92A 2Y6TA 3TJNA 2PLXA 1V2TT 2GGVB 4O9VA 3GDVA 2EI8A 2J92A 1NFXA 1JRTA 3LGVA 4ZKOU 1SOTA 1SGYE 2Y7ZA 2XTTB 3F68H 6ESTA 2VH6A 4J1YA 1H4WA 3L3TA 1K28D 2ZFSA 3RM0H 1W8BH 3UUZA 1GJDB 2BDGA 5EG4A 2SGQE 1HAHH 1D6RA 1Q2WA 1KXCA 1NRPH 1WQSA 4B74A 1C4V2 1HIAB 1FAXA 5C20A 1MKWK 1GMHF 1ZPCA 3D65E 5DP9A 4WWYA 1A5HA 3K65B 2G81E 1GDNA 3VB6A 4NFEA 2HGTH 1WSSH 2H1UA 1BCUH 2G4TA 3A84A 3A87A 5JB8S 3H5CB 1XUGA 4Q7YA 4JZDH 1GMCF 1OWDA 1QNJA 5E8EH 1UCYH 1TB6H 1GBEA 1F0TA 3OY5U 1VJ9U 1WOFA 1B0FA 1NU7B 3RU4E 1M9UA 4ZHLU 3CENA 2YOLA 1O2RA 2V0BA 1TRYA 1P06A 2A4QA 2THFB 4ZHAA 9LPRA 2A32A 1WU1A 4ABGA 1S6HA 4K69A 4CRCA 2ZQ2A 2BMGB 1KXFA 4Y8XA 5F03A 3TGKE 3M7TA 1AUJA 3K6YA 4NCYA 2A4RA 3ZZ7A 2JH0D 1ORFA 1OWHA 1O5CB 4X8VH 3SI4H 3GCTF 2F3CE 2VWLA 3LONA 2VIVA 1DLKB 4E7NA 2FESH 4NSYA 4IBLH 2H5DA 1W11U 3TH3H 1P9UA 1QRXA 1J17T 1UK2A 1ZYOA 2XC4A 1GI6A 3M5MA 1PPCE 2VIDA 1TX6A 1C5OH 1OWJA 4A1TA 1C2JA 3D49H 3MO6A 2Z9GA 3T25A 1W7XH 2AIQA 4YLUA 1T8LA 5F8XA 2QXHA 2GTBA 2WV4A 1G3CA 3M5OA 3TNSA 3ZV8A 2UUJB 1GI7B 1ZJKA 1A5IA 1VJAU 2ZGXH 4SGAE 2HLCA 2P93A 2ZTYA 2A5KA 1XVMA 2BQ6B 5HM2A 1VITG 2A45B 1O2OA 2QV1A 3ZZAA 3BTHE 1CBWC 2ZQ1A 3SJ8A 1YGCH 2BDIA 1UTNA 1AVXA 5EW2H 2GCHF 5DP7A 2BDCA 1Q31A 4Y7AA 3MNBA 3KNXA 5EQRA 1Y5AT 3RXOA 5I46H 1H8IH 3FZDA 1P2KA 2VIOA 1GJCB 1XM1A 3LGUA 3PMBB 4THNH 1L0ZA 3DD2H 1GBCA 1QBVH 1ESAA 1ANCA 3PWCA 5EW1H 4H42U 4LZ1H 1UTMA 1AE8H 3QGNB 4HGCA 2SNVA 1C9TA 4AG2A 2TPIZ 1UTPA 3SV7A 3MNCA 2ZDMA 1SR5C 3S9BA 5HMAA 5PTPA 2HOBA 3QZQA 2J2UA 1C1RA 1K1NA 4QT8C 2OUAA 4U01A 3BTTE 1HJAB 1G36A 1V6DA 4X8TH 2ZZUH 1HCGA 4JYUH 8GCHG 5CHAC 7KMEH 2HVXA 2W7SA 1FDPA 3UWIA 2Y82A 2PFEA 1CT2E 3S9AA 1O2VA 1FNIA 2QY0B 1HAOH 3LT3A 2H9HA 2R3UA 4X1PU 4ZKRU 4Y11E 1T8MA 5F6MA 2FXRA 1BTZA 3T5FH 3A7WA 1Y8TA 5C1XA 2H5CA 3PV4A 3SO3A 5DP8A 5C1YA 2VGCB 1TAWA 1GBLA 3E0NB 3TK9A 4FUBA 4GHQA 2WINI 4ISNA 4FUCA 3E1XB 5E0HA 1BTHH 2VWNA 3MU5A 4Z0KA 4H4FA 1PPBH 3EA7A 1ABIH 2J94A 3RXQA 4NIXA 3UOUA 4YLQH 1V2ST 2B9LA 3GDUA 2FO9A 1GVZA 3S7HB 4AX9H 1HXFH 3KQDA 1EP5A 2PTCE 3ZVDA 1ZMNA 1WUNH 3Q77A 2BLOA 2OC1A 3VGCB 1NC6A 4DY7B 1PPZA 2XBVA