3N7DA

Crystal structure of copk bound to cu(i) and cu(ii)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
59
structure length
59
Chain Sequence
NVVKTYDLQDGSKVHVFKDGKMGMENKFGKSMNMPEGKVMETRDGTKIIMKGNEIFRLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Copper resistance protein K
publication title Two new crystal forms of copper resistance protein CopK
rcsb
source organism Cupriavidus metallidurans
total genus 12
structure length 59
sequence length 59
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11525 CopK Copper resistance protein K
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.300 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3n7dA00
3DSOA 2LELA 2KM0A 3DSPA 3N7DA 2K0QA 3N7EA
chains in the Genus database with same CATH superfamily
1WOFA 3NRLA 1QJ1B 3QK1A 1D3QB 2B0FA 3RMMH 2QXGA 5DP6A 1O5AB 1C1VH 1BCUH 1GJBB 1TOMH 1HXEH 1P57B 3IG6B 1V2UT 2B5TB 1GHAG 2XOKD 3ATIA 1S5SA 4DCDA 3SU6A 2HPQH 2FS9A 1G3BA 2KX4A 1BRBE 2K8IA 3ZYEA 2F43B 4NA7A 3S7KB 1SL3A 2AHME 2XNIA 3KN2A 4M9FA 3UB0A 1TABE 1SGTA 1LQEA 1MTWA 1FPHH 4I7YH 5CHBA 1LKBA 1QHRB 3OYPA 2ZEBA 3LGUA 3OSYA 3PO1C 3ZVCA 3QUMP 4ABGA 1CBWB 2FMJA 1L1NA 1ABJH 3D65E 1ZJDA 1S6LA 2TRMA 3PMJA 5DP8A 5CE1A 1DLKB 1P01A 1HPGA 1PQ8A 1B5GH 1THSH 2WHXA 4A6LA 1HJAC 3PWCA 1ARCA 1OWDA 2A7HA 1GI4A 1OP8A 2IJOB 1EJNA 1PPFE 3TJOA 4YO9A 1RTFB 1V2ST 2G52A 3ATWA 3RXTA 5JBTA 3K2UA 2JJ2D 1C1OA 1V2RT 3SU1A 2C8WB 4AFZA 2NU2E 3VEQB 4XD7D 4ZCNA 3TU7H 2AIPA 2A31A 1BRAA 5FPYA 3ZYDA 3VXFH 4LZ4B 1T7CA 1GMCG 3B8JA 2UUYA 4FVDA 4INHA 1IQHA 5C94A 3QX5H 1ZGIA 2GZ7A 2ZU2A 1Y8TA 5FX5A 2PKAB 4I33A 1XMNB 1O3KA 3MNSA 2ANKH 2HNTF 2K0QA 3VB4A 1EP6A 4X6OA 4F4OC 2ZTZA 1NN6A 3UQOA 1LQDB 2Y5FA 5TCAA 5LPRA 1FDPA 2CK3D 3A86A 4B2BA 1C1TA 1RJXB 4K5ZA 3DSGA 4HFPB 1SFIA 1FV9A 1SPJA 5LPEA 1YGCH 4Q2KA 2V7QD 4X8TH 1D4PB 2CGAA 1GG6B 1GBKA 2VIPA 3A7TA 3MWIU 4Y8ZA 4UE7H 1NRQH 1GBMA 1FIWA 4ABBA 3Q00A 2P93A 2G5VA 4FUJA 3RXMA 4JZDH 3GICB 3PMHB 1T4UH 2CHAC 1NFWA 3ZVFA 2STBE 4KTSA 1RS0A 2G81E 1AZZA 2QXIA 2ZFRH 1UTQA 1ZTKA 4GHTA 3PMAB 1TGSZ 3LIWA 3UTUH 2QC2A 1B0FA 4DG4A 4WMFA 1ARBA 3QGJA 4ABIA 1TGNA 1F92A 2TGAA 1GDQA 1TNGA 4OGYA 2ILNA 5E0JA 4DT4A 3F3BA 2A5AA 3BTTE 3TK9A 2FEQH 1QJ7B 3TPIZ 4YZUA 1BTUA 3MU1A 1W7XH 1E1RD 2BDBA 1ZTJA 3R3GB 3KYGA 3ATMA 1L4ZA 1GI6A 1WDIA 1ESAA 2BY6X 1BBRH 4CHAB 4J1YA 2DE8A 2BDGA 3UUZA 1O3IA 2NU4E 3UOUA 3MOCA 1ZPBA 2BY9X 3BIUH 2RA3A 1YLNA 1YPEH 1EAIA 4LZ1H 1MCVA 1O37A 1ZHPA 4K69A 4XFQA 1N6XA 2J95A 2PKSB 2J94A 6GCHF 2QF3A 3CP7A 2SGPE 4ZHMU 2QCYA 3SNCA 4IW4E 1Y3UA 2JKHA 1O2SA 2FOEA 4CR9A 3QWCH 2WPDD 3GYLB 2XYAA 1PPBH 1YPGH 3I29A 2Y82A 3BSQA 1GPZA 2GDEH 5DSFA 2H5CA 2Y7XA 1MCTA 1OWKA 3V12A 4ZHLU 1VJ9U 1VCQA 2ZECA 2F9NA 3OE7D 4A7IB 1HAVA 3STJA 5A8ZA 5JDUB 1S84A 5JBBS 1UTLM 2EA3A 1GGDC 2ZU1A 3TJVA 5FAHA 4OGXA 1QIXB 1UJ1A 1XKBC 2A4OA 2F9OA 5GJ4B 4X1NU 5IK2D 2VIDA 3GS9A 3F2GA 3SZNA 5LGOA 1TQ0B 3PO1B 2FP7B 4RT1A 4OS6A 2PKAA 4VGCC 2HOBA 3KNXA 2EI6A 1J9CH 3Q3KA 1O2LA 1DWBH 4NSVA 3UIRA 1AVWA 3A84A 8KME2 3RXCA 2A7JA 5AVDA 1EFRD 1IQLA 3O8BA 2VIOA 1TAWA 1F2SE 1KDQA 3E1XB 2W3IA 1PPGE 4K1TA 4XBBA 5I25A 2CN0H 2BDHA 5E2PA 1AU8A 5F8TA 1P0SH 3FN8A 1C5YB 4P00A 2GP9B 4ISNA 1C4V2 2J2UA 1LHCH 1O3BA 4X8SH 1HB0B 1HAZB 4NIYA 3AVZA 3K6ZA 1D9IA 4GAWA 4RKJB 4A92A 1CA8B 1QL7A 3P8OA 1AVXA 5GDSH 3U8RH 3GCNA 4NFFA 1CSOE 3BTFE 1YYY1 4WVPE 1O3CA 3A7VA 1CGIE 1HJ9A 3RMOH 2ODQA 1A5GH 4Y7BA 4TYDA 1DWEH 3F9EA 3FP8E 2PW8H 5EODA 1H8HD 3RC6A 2R2WU 3SV2H 4HZHA 5DK1A 5C5OA 2ZCHP 2J38A 1KXDA 3GCTG 3V0XA 1NRRH 3MH4A 3SUFA 4TY6A 1QFKH 4CR5A 3DFLA 1ELTA 2Z3DA 1FLEE 2PSYA 3GDUA 1NZQH 1YPLH 2A4GA 2P8OB 2O8UA 3A80A 6LPRA 3F0PA 1MKWH 2ZU5A 2P3FH 4THNH 1DM4B 1NS3A 3F9GA 1ZMNA 4TPIZ 2QF0A 5DP5A 3CS0A 1ELAA 1TOCB 2A4RA 2FOAA 2BLQA 3QTOH 6CHAC 2O8WA 1TIOA 3SOSA 1NTPA 1EB1H 1UVTH 3URCA 1GI1A 3LKWA 2ESTE 3FP6E 4B71A 2LPRA 4JZ1A 4D9QA 2ZHEH 5HIZA 1O2NA 2C90B 2LELA 1O2QA 1EUFA 3BTGE 3KQBA 9ESTA 2QAAA 2XBXA 1C1MA 1O2IA 1AY6H 2ALPA 4ISIH 4XOJA 5ESTE 2A4QA 3U9AH 4NFEA 3MO6A 3VGCC 2BTCE 4E05H 1KLJH 1TB6H 1C5UA 1LKAA 3ATLA 3SJIA 2VINA 1OXGA 1YLCA 5EQQA 1SQTA 1IHTH 1Y5UT 4RI0A 4FU7A 4B6FA 2A0QB 2VWLA 2SGDE 1O2VA 2FX6A 3NWUA 3SV7A 2UWOA 1DANH 2ZTXA 4ESTE 4AB9A 5FCRA 4DIHH 1QBVH 1EZXC 1V2WT 1C2IA 5DN6D 2M2AA 1MQ6A 1SGFG 1JMOH 2Q6DA 1GVZA 2FLRH 1NESE 1YBWA 4X2VA 1P2NA 1O2XA 5KEDA 1C4U2 3U8TH 2TPIZ 1O39A 2WV9A 3DUXH 1ACBE 2BY5X 1ORFA 2YNAA 1L1JA 3C1KA 4I8LA 4ZXYH 1ELFA 1ZRKA 1COWD 1EKBB 4JYTA 3SU5A 5L30H 5A0BA 4A1VA 3ENSB 1QZ8A 2WV5A 4BAQB 2OQ5A 4UFGH 3A7YA 3OEHD 1O5GH 1ZLRA 1P09A 3MH5A 1O2JA 2AEIH 1G9IE 2XRCA 1AUTC 2OD3B 1CBWC 1P3CA 1SOZA 3DHKH 3SUEA 4O97A 2ZU4A 3GY3A 4D9RA 3TIUA 4MPWA 3BEFB 2HNTC 1OP2A 3LH1A 2BX4A 3FAOA 1GVLA 4H42U 1S81A 3TGJE 1O2KA 3UAIC 1FN6A 3DT0H 3VFEA 3P8NA 2NU0E 2JIZD 2C8XB 1SGPE 4WH8A 1AFQB 1BOQA 1OWHA 3T29A 1ANCA 5EPNA 8GCHG 1PFXC 1ZJKA 2ZGXH 4K8BA 5T6FA 2Y81A 1SVPA 4CRDA 1P03A 3W1EA 1TLDA 2BMGB 2CF8H 5JB9S 4H6TA 4CRGA 4VGCB 2SFAA 5T6GA 2PTNA 1YCPM 1UK4A 3EAJA 1RTLA 1NBMD 2ZDMA 3OX7U 1SGYE 2ALVA 1O2WA 3BEUA 1DY8A 1TNKA 1ETRH 1QB1A 3ZZ5A 3V7TA 1QA0A 4AG2A 1O3EA 1AMHA 1HFDA 5T3HA 2ZFQH 3RXOA 3QZRA 1DX5M 3MU5A 1BMFD 1BTHH 4ABFA 1GBCA 3D62A 4Y76A 2AFQB 2VU8E 3RU4T 3AAVA 5CHAC 3ESTA 4I8JA 4H6SB 2FOBA 1S6HA 1CGJE 3T28A 1HYLA 1PPEE 1EJAA 1TNIA 1PPZA 1C5ZB 3D23A 1NBME 4ABEA 2PUXB 1UTKA 1DICA 3GDVA 1YLDA 1C9TA 2C8YB 2OINA 2GTBA 2EQNA 1EP5A 3R0FA 1IHSH 1CA0C 1O5FH 2Z6BD 3I78A 4WWYA 5FPSA 4AZ2B 1WYKA 1GG6C 2F4LA 3GISB 1KXEA 2G8TA 1W2KH 1JRSA 1J14A 5KECA 3RXFA 1OSSA 1ZMJA 2WSSD 5KGOA 4XDEA 3TK5A 2UWLA 2YMSB 2OBQA 1HDTH 4AG1A 2AGIX 1V6DA 1TNHA 3I77A 3P92A 4YESB 3B9FH 1O2TA 2GCTB 1O2PA 5EXMA 1J17T 4YT6H 5DG6A 3RLWH 1HBTH 1HAGE 1RXPA 1C5MD 1UTMA 3GY7A 1OWJA 5J4SA 1GBTA 2HNTE 5EJZA 3RXQA 5EIYA 1UCYK 2QY0B 3SU3A 1GL0E 1ELGA 1IAUA 3BTDE 1QNJA 5L6NH 5LPFA 3HGNA 2R3UA 2WZQA 1O3PB 1FMGA 5SGAE 1MU8B 5DP4A 3VGCB 3M5LA 1IQEA 2QGRA 3Q77A 1A3EH 1P8VC 3ZZCA 1C5NH 1SLXB 5JPMH 3M3VA 1LHFH 3FO8D 1W10U 3RXLA 2XXLA 3ODDA 2ZTYA 1HAIH 2OQUA 4AORA 1TA2A 2W7UA 3BV9B 3ZVBA 1W0JD 4O3UA 1FUJA 2VVCA 1GHBG 1BRUP 1V2QT 2PUQH 3L6PA 2KAIB 1C5XB 1W0KD 2RFKC 5C1XA 1WSSH 1FY4A 2FTMA 2F3CE 4B2AA 1C5PA 2ZFPH 4KELA 3LOXA 3KQ5A 4E7RG 2FYRA 2SNVA 2SNWA 2UWPA 3E91A 4X2XA 3OTJE 1FQ3A 1DY9A 3A88A 4HGCA 1KXBA 3KQCA 3LONA 1U6QA 3TK6A 1O5EH 3RM0H 1TPOA 1HXFH 2RDLA 5AF9H 2ZQ2A 2SGEE 1O3MA 4YM9A 1NRPH 4ACBA 2Q1JA 3UR9A 1RTKA 2GD4B 3FANA 1P2JA 1GMDF 1HLTH 4YLUA 1AFEH 1NM6A 4ASUD 2FOCA 2GT7A 2ZWLH 3AW1A 1MKXH 1G2MA 1T8OA 2KFWA 4ZKRU 1S82A 1A4WH 2DE9A 2J92A 5FPTA 4F55A 1XXFA 4RKOB 2UUFB 1K22H 4GUXA 2L6OA 2G4UA 1RFNA 4BAOB 3A8AA 4F49A 3SQEE 1RIWC 1XUIA 3LPRA 1FJSA 3SO3A 2GCHF 4BTUB 2V6NA 5EXLA 5A8XA 2BDAA 5DPAA 3SJ9A 4X1PU 3PTBA 3SV6A 1HRTH 3KGPA 1EPTA 1B0EA 1V2MT 3GY4A 4NWLA 1DFPA 4OM9A 3S9CA 1GVKB 2ZKSA 1V3XA 1XUJA 2ZHFH 1ZHMA 2CMYA 1HAVB 2A5KA 2BB4A 3C27B 1K1PA 5GCHF 1UO6A 1O2OA 1L1GA 7ESTE 2ZG0H 1QBOA 5E8EH 3M7TA 1ZPCA 1HAYB 1PYTC 4AFUA 2W6ID 4MPXA 1SMFE 2BDCA 2ZF0H 1FI8A 2XCNA 3DD2H 3WY8A 4OS2A 1QL9A 1K2I1 5CHAB 1CT2E 1ETTH 4K1SA 1Z71A 5HGGA 1AUJA 2B7DH 1UHBA 2M5TA 2HLDD 1UVPA 2BQ6B 2P8OC 1KDQB 1GHXH 1OWEA 2PSXA 2R0LA 3NPSA 1CA0B 3U1JB 5K0HA 3LT3A 5IYTA 3RMLH 1ZSJA 1C1PA 1O5BB 2KCOA 3ZVAA 1IQJA 1OP0A 3ATKA 1P2KA 2GZ8A 1P9SA 1YC0A 2WPMS 1A3BH 1O2ZA 3T2NA 1H8ED 4GLYA 1AHTH 1ESBA 1GJ4H 4A1XA 1FIZA 2EC9H 1A7SA 2PR3A 1GJCB 2KAIA 4BXWA 2AMQA 5EGMA 1QB9A 1YF4A 2EI7A 4UONA 2GT8A 2WPIS 1XUHA 3QDZB 1EOJA 3UWIA 1MMJN 3E6PH 5GIBA 2F9BH 2VWOA 2KCYA 3GY8A 1WQSA 3ZVEA 3RUOA 3DSPA 3UNQA 1LPGB 1HUTH 2NU3E 1PYTD 3L33A 4Y11E 2TGPZ 5GWZA 2IN2A 3KIDU 1VCPA 2ZO3H 4Q63A 2J9NA 2RG3A 2VIQA 1GDNA 2BOHB 5GXPA 1SGQE 3HGPA 3ZZ4A 2OP9A 3RP2A 3RMNH 2AYWA 1YY3A 5DP9A 1DS2E 1XX9A 5J4QA 1BBRK 2ZA5A 1XUGA 2HGTH 2BM2A 1ZHRA 3RXEA 1EASA 1W7GH 5IDKA 1HAOH 1H8DH 1TMBH 3UNSA 3BG8A 1ZR0A 1TPSA 5ESBA 1OWIA 3NK8A 3A8DA 2UUJB 4WXVA 2ZI2H 1AWHB 1O5CB 1DLEA 2WYJA 4CRBA 3CNRA 4FETA 2FX4A 5B6OA 3AAUA 8ESTE 1Y59T 2FOFA 3SI4H 1NRSH 1AE5A 2J5UA 3PRDA 4U2WA 4IGDA 4CREA 3ELAH 4AGJA 3MMGA 5JBAS 3PLBA 1L2EA 1C5VA 4ABAA 1J16A 5DP3A 1F5RA 1QTFA 2FPZA 1G3CA 2C93B 1YP9A 2ZC9H 4GVUA 2BZ6H 1LVYA 2GV6A 3SGQE 2Z9GA 1TFXA 1CO7E 3PM3A 1H1BA 4XE4A 1WU1A 2XTTB 2AGGX 1UK2A 1YWUA 2JETC 3A81A 1L0ZA 2XC5A 3KEEA 1MQ5A 1AFQC 2QE7D 1OHHD 1ANBA 1BZXE 2CJIA 1TBQH 4ISLA 1A1RA 3FFGA 5F53A 3UWJH 3SU2A 4ABDA 1D3DB 2QN5T 2GJGA 5FHTA 2VGCC 3MO3A 5G4BA 4GPGA 1GWAA 5E0HA 3O8RA 1BTYA 3QZQA 3T26A 3LGIA 2SGAA 1HIAA 5AHGH 1W3CA 3LC3A 1RIWB 4JZEH 2FOMB 2IPQX 3S9BA 3V13A 1DWDH 3GY2A 4MVNA 2A2XH 1P2IA 1UVUH 4MQAA 1UTNA 6GCHG 2BD5A 1C1RA 3PYHA 5DP7A 3P95A 2F9PA 1T31A 2Z9IA 1C1SA 4OS7A 4BTIB 1CHOF 1JBUH 2G5NA 1MD8A 1V2OT 1C5TA 3M5NA 4FUCA 1ZYOA 6ESTA 2CV3A 1SI5H 3OEED 1FN8A 2OTVA 3Q3YA 2FESH 3F1SB 1XUKA 1OOKB 5AFZH 2B8OH 4DVAU 1TRYA 3KQDA 1W14U 1OS8A 3RXGA 1GBJA 2VIWA 1F0SA 1H8IH 1CVWH 2F9VA 3SHCH 1MTVA 4A5TS 1KSNA 4ZROA 4BANB 3RXBA 5BRRE 1SR5C 4IMQA 1EPTC 1O0DH 2Q6GA 3M5MA 2A45B 1LHGH 1O35A 1OYTH 2O8TA 2BD4A 3MU8A 3A7ZA 1O2MA 3ZZ8A 5JB8S 2YMSC 4UFDH 4JK6A 3S69A 1MAYA 1SG8B 1TRNA 1FAKH 5ETXA 4AYYB 1S85A 2A5IA 3MO9A 1IQKA 3U8OH 2GCTC 3SI3H 2GV7A 1ESTA 1XM1A 4Y0YE 1E37B 1SSXA 2XWAA 5CDFE 1OX1A 1MKWK 4U32A 2ZPRA 3D49H 1XUFA 4ISHH 3P17H 1KLTA 1WBGB 2Z9KA 3PTNA 1P04A 1XVMA 4I8KA 2PV9B 1ELBA 1O2RA 4TPYA 4OS1A 4JMYA 4AOQA 1E35B 1JOUB 2FI4E 1GMHF 4ZKSU 1GJ6A 2VVUA 2ANWA 1Y3WA 4YOGA 1IQNA 3E3TA 1UCYE 2FDAA 4E06H 2Y5HA 1IOEA 2VB0A 4XBCA 1NU9A 1YPKH 3FZZA 3MH7A 5A2MH 1VKYA 5A09A 2EI8A 4R8TB 1MUEB 4B2CA 1QA7A 1DXWA 3SNDA 1SQOA 4B76A 1KYNA 1SKYE 1C2HA 1TBZH 1YPHC 3RLYH 7GCHF 3PROA 4INLA 2ZCLP 1HV7A 2O8LA 1BMMH 1P2QA 5HYOA 2YMSD 3HPTB 4MLFB 1TPAE 3UFAA 1TGBA 1BIOA 4B73A 1K1JA 3DSOA 4I32A 4JK5A 4KKDA 3OTPA 4X0WU 2GX4A 1Y3XA 3HK3B 4P02A 4PROA 3RXSA 1ELCA 1GL1A 4O3TA 1WUNH 5TJXA 1C2GA 4FUGA 2FO9A 3GCHB 4OS4A 3RU4D 4HG6A 1THRH 2WINI 2PTCE 3PRBA 4YOJA 3RC4A 1VGCB 4FUIA 1CU1A 1C2KA 2ZNKH 4BAKB 1WQVH 1D3PB 3M5OA 3S9AA 4FUHA 1CHGA 3KL6A 1ETSH 3SNEA 3AK5A 3G01A 2P95A 1GCDA 1TGCA 1N8OC 2SGFE 2W6JD 1FY1A 3MU0A 1GJ9B 4MNWA 5E0GA 3TH2H 5HXFA 4X6MA 2BY7X 3K9XB 1ZOMA 2OXSA 4ABJA 2A32A 3SUDA 3M61U 2P59A 1J8AA 2JETB 2FXRA 2ZZUH 3KCGH 4D76A 2A1DB 3RDZA 4ZKNU 2AS9A 3ZV8A 2TBSA 1H9LB 4CRCA 1QRWA 3RU4E 3BG4B 1NU7B 2BX3A 4DW2U 4UFEH 1H9HE 1GHWH 1VITF 2AIQA 1JRTA 3HKIB 4CRFA 1E79D 2QIQA 2VGCB 2R9PA 4Y8YA 1AIXH 3RXIA 3GDSA 2BHGA 2R2MB 3MI4A 1QBNA 1J15A 1P2MA 2H9EH 1TBRH 2BD9A 3E16B 1BTPA 3E0PB 5F6MA 4ZXXH 2NU1E 4DJZB 3LGWA 4NIVA 1CT4E 2WUBA 2ZP0H 5T1VA 3LJOA 2JDID 3HATH 1RRKA 3PWBA 2HRVA 2G51A 4TT3D 4IMZA 4WY3A 4M7GA 1EX3A 2ZHWH 1OYQA 1G37A 1F0UA 1GBHA 3F68H 2OBOA 2VVVA 3N7DA 4K1EA 4NZQA 1MZAA 1C1WH 4KGAA 1YPHE 5FBIA 1H9IE 5HIYA 5EJ1A 1KTTB 3EE7A 4FUEA 4CH2B 1E38B 1V2PT 1QRZA 2C4FH 1Z6EA 1NPMA 1UW7A 1A2CH 4IS5A 1ZGVA 4KP0A 2Y7ZA 1KY9A 1EPTB 1A46H 1GI2A 1SC8U 2STAE 2Y6TA 8LPRA 1NROH 4O03A 3A7WA 3BTWE 3DFJA 4Y8XA 4I31A 4MTBA 3IITA 1PPHE 3QN7A 1VITG 3EA8A 4Q80A 1QCPA 4ZHAA 2BLVA 1SQAA 1BB0B 4Q7YA 3HK6B 1C5RA 2XC0A 4OS5A 2Z94A 1JWTA 1E1QD 2GMTB 1AGJA 3EQ0H 3SN8A 3PV4A 2BXTH 2ANYA 2Z3CA 4Y7AA 1P02A 5B6LA 1BRCE 2BOKA 4DY7B 1O3FA 2QV1A 4ACAA 3DA9B 3SU0A 1VCWA 5FBEA 2SGQE 2ZPSA 3HKJB 4ZUHA 3S7HB 4NSYA 5HMAA 4GSOA 1ZRBA 2THFB 4ZAEA 1F0TA 1PPCE 1NFUA 4Y10E 1WTHD 2I6SA 5K7RA 1Q31A 1FNIA 2R0KA 1V2VT 2ZGCA 3STIA 4WH6A 1UHBB 2KCAA 2OC8A 3VB3A 3WWBA 4CH8B 1FAXA 1DE7H 2JH6D 3H7TA 1YCPH 1UCYH 3BF6H 1LMWB 1GHAF 1DOJA 1Z8IB 1BTZA 1KTSB 3ZZ9A 2RDEA 5E2OA 4D8NA 3BIVH 1KLIH 1SHHB 1TRMA 2HLCA 1FY8E 1QQUA 1PJPA 1N1LA 1SOTA 5EQSA 1T8NA 4Z0KA 1D6RA 1A0JA 1GJDB 1GBLA 3ITIA 3H7OA 1NC6A 1Z6JH 1RD3B 1TONA 4H4FA 4AFQA 1VZQH 4HI3A 1T8LA 1L4DA 3VPKA 3A82A 2ANMH 2JH0D 3F2HA 1O3JA 1A0LA 1EZSC 1GI9B 3EA7A 2A7CA 5FXLA 1BITA 4MNVA 3F9FA 1KXCA 4Y6DA 2Z9LA 1QB6A 1LTOA 1AQ7A 1MTUA 2J4IA 1THPB 4MNYA 1BQYA 2FODA 3LU9B 1BMNH 4BAHB 3A89A 4WJG2 2TGTA 2ZGHA 1C5LH 1MBMA 3MYWA 3PV2A 1MU6B 2OUAA 2XCFA 2D2DA 2FI5E 1QJ6B 3U1IB 1LPKB 1AKSB 3A83A 1C4Y2 2W26A 1FY5A 2IJD1 1O30A 5C3NA 3LGYA 1TNLA 3LC5A 1W0ZU 2ZHDA 3EGKH 1GMCF 4R0IA 4Y79A 1UVOA 1ELVA 1TALA 2QXJA 2WPJS 1FY3A 1N8OB 4B6EA 4JZIA 2GGVB 2GZ9A 1P06A 2W5EA 1UTJA 3UOPA 2ZDAH 1MKXK 2QA9E 3M3TA 3SYJA 1P3EA 2ZFTA 1DWCH 1HCGA 1QL8A 2WPKS 3GY5A 4F48B 3TH3H 4X8UH 1Z1IA 2VBCA 1M9UA 1E0FD 1NFYA 2ZDLA 4FUBA 3SBKA 3MH6A 4K60A 5EU8A 1O32A 1AB9C 4Q7ZA 1FX0B 1GBDA 1TA6A 3MNXA 5EXNA 1EJMA 2VH6A 4X1QU 3SJKA 1CGHA 1H4WA 1O2UA 3QTVH 3SU4A 1G32B 1E36B 4NGAH 1G36A 1YKTA 1WAYB 4WXIA 1C9PA 3UNRA 2XBVA 1DDJA 3TNTA 1KXAA 5C1UA 2BQ7B 1TE0A 3SNAA 1A61H 1Z7KA 3U28C 2J34A 2ZHQH 5GPIB 4XRNA 3VB6A 4TWWA 2D26C 4NA8A 2QYIA 3BEIB 2ZQ1A 2NWNA 3QLPH 1DITH 4MG3A 2YNBA 1VR1H 3F6UH 1GMDG 1GDUA 4Y0ZE 1X7AC 1GCTC 1TQ7B 2BD2A 2WPLS 1HIAB 3RXAA 1UMAH 1UTOA 1Y3VA 1SLWB 1DSUA 2HPPH 1AO5A 3TJNA 3ZVGA 3ZIAD 5FL7D 4YXWD 3U69H 1DXPA 2JJ1D 1C5SA 1ANEA 4I8GA 2GCHG 3H5CB 2BY8X 4TWYA 2Z7FE 2DUCA 1Q3XA 1EAWA 1TWXB 1BDAA 4K8YA 2RA0A 1IQMA 2EEKA 4X2YA 2VIVA 3TNSA 3URDA 4YOIA 3FKSD 1P12E 2ZFSA 3LGTA 2AGEX 1SLUB 1UVSH 1P05A 4FOUC 1WTGH 1PQ5A 4MDSA 1NFXA 1GHYH 1AD8H 2WYGA 5A8YA 5GCHG 4X1RU 4MPVA 3MTYA 5EG4A 3KF2A 1K1MA 1LHEH 4FVBA 4BAMB 4MNXA 4RSPA 1W13U 1F5KU 1S6FA 1GBAA 1NT1A 1ZSKA 3E0NB 4K3JA 2BD8A 1MTSA 3TITA 3SZEA 1LHDH 1C2EA 3GY6A 1AKSA 3S0NA 1BTXA 2GKVE 3W95A 1BA8B 4TSFD 3CS7A 5FX6A 1OKXA 2BD7A 3RXVA 4I8HA 4RT0A 1O38A 4BNRA 1TNJA 1CQQA 2UUKB 1F5LA 3ZVDA 3BN9A 1A5IA 1F7ZA 3RM2H 3OFND 4B75A 2PFEA 3GCHC 2QF4A 4Z1MD 4KTCA 4CRAA 3M7QA 3E90B 1XKAC 4LOYH 2FYQA 1GJ5H 2K1QA 1VGCC 3MFJA 1T4VH 2BYAX 1Y5BT 3LDXH 1P10A 2GDDA 2W7SA 3M36A 3A8CA 3QGNB 3IWMA 1BMAA 1C5OH 1O3AA 4SGBE 4B74A 4JZFH 4AC9A 1V2NT 3O8DA 3QO6A 2G00A 1O5DH 4ZH8A 1T32A 3MNCA 1OPHB 2O8MA 1LVMA 2HWLB 1BJVA 1HGTH 1K1LA 1C5WB 2BXUH 4Z6AH 1GBBA 3CENA 3T25A 2G4TA 2Y5GA 3NZIA 3TJUA 4IC5A 5EPYA 2PLXA 2A2QH 2OC7A 2PP6A 3O8CA 3ZZAA 3VXEH 3BG4C 1ZSLA 1BMLA 2LP6A 2FIRH 4X8VH 2BVSH 4AB8A 4A1TA 1Y3YA 1SGRE 2ZGBH 3M37A 3F9HA 5CMXH 4DGJA 2H1UA 1N6YA 1LCYA 1TMUH 2ZU3A 5DO4H 1Z8JB 1GI7B 2W3KA 2OC0A 1WV7H 1MH0A 2CF9H 5C0TA 1QY6A 2XWBI 1P11E 2ODPA 1O3NA 2ASUB 5EW1H 7LPRA 1G3EA 2FTLE 1HNEE 1P9UA 5JYIA 1MTNC 2V3MA 3BTEE 1O33A 3A85A 3GCTF 4GHQA 1IQFA 3BTHE 1W11U 1DSTA 3RXKA 2V35A 1DUEA 4NCYA 4Q7XA 1AB9B 2BD3A 1GI3A 2J98B 3RXDA 2LNCA 1KIGH 4FUFA 1JIRA 1O31A 2XBWA 4X2WA 3ZV9A 1K0HA 3A8BA 1D3TB 1IQGA 1HJAB 3MU4A 3LH3A 1SGEE 2ZIQH 2KR7A 1PQ7A 4O9VA 3BTKE 3MQKC 3L3TA 3RXUA 1SBWA 1MBQA 3E8LA 4JCNA 3OY6U 2OK5A 1AN1E 2H9HA 2HALA 1ANDA 1EAUA 4AGKA 3Q3XA 1UTPA 2I6QA 4J2YB 4K2YA 1GI0A 3GCOA 2ZPQA 5AFYH 1GCTB 5JBCS 4XSKU 3LJJA 4I86A 1A5HA 4CBNA 1O36A 5F8XA 2C3SA 4UFFH 2GMTC 3ZZBA 3PV5A 1GI5A 1AZ8A 2F9UA 1QURH 4UD9H 5F8ZA 1SGNE 1K1NA 2AMDA 3V3MA 1EZUC 4SGAE 1K1OA 3RXRA 3PLPA 5F03A 2AH4X 2ZDKA 3RXHA 1HAHH 4D7FA 2IPHA 2BZAA 3ZZ7A 1C2DA 1XXDA 2BVRH 2R3YA 3KYFA 1Z1JA 4IN2A 1EZQA 1CHOG 1SGDE 4DURA 4YT7H 5TCCA 2L74A 1P2OA 3GOVB 2CXVA 3NKKA 1C2JA 3NXPA 2KCPA 1BT7A 2FS8A 4RN6A 2Y80A 2HVXA 1O3HA 3SJ8A 1C1UH 3A87A 5HM9A 5I46H 3RXPA 1O3LA 1SGCA 1QRXA 2YOLA 1QQ4A 2FZZA 2B9LA 4X6NA 3PMBB 2PGBB 3GYMA 1YPJH 1YM0A 3M7UA 2ZDVH 3FZDA 3N7EA 4B1TA 2CHAB 2Z9JA 3T5FH 4JYVH 4IC6A 2G55A 5BPEA 1ABIH 2ULLA 2HVYB 4NIWA 2P16A 3P70B 2O9QA 2V3HH 1EATA 2AERH 3U98H 3FP7E 1AVGH 2JH5D 1HJ8A 1AI8H 3OAAD 2PGQB 1BUIA 2BLWA 3WWFA 5DGJA 3RC5A 2AMPA 1Z8RA 1LVOA 1V2KT 4E7NA 5C17A 2OLGA 2Z3EA 3SW2B 3UY9A 4ASHA 5C5NA 3DCLA 1S0QA 3Q76A 8GCHF 3LGVA 3F0OA 5FCKA 2QF5A 1S0RA 1V2TT 1DVAH 3F2FA 1MABB 3ZZDA 1O2GH 1QR3E 3UR6A 3AW0A 1ZZZA 4LXBH 1GJAB 2WPHS 2ODYB 3UPEA 1CE5A 3KHVA 1VJAU 1GI8B 3VG8A 4FUDA 4BTTB 1Y5AT 2ZFFH 4NG9H 1D6WA 4D7GA 2J98A 3SGAE 1GMHG 1W8BH 1BHXB 1Q2WA 1BJUA 1G2LA 1SB1H 3JZ1B 3SUGA 1K9OE 5C1YA 3SGBE 3TLOA 5ABWA 1TX6A 1IQIA 4WF8A 5EQRA 1QGFA 4MPUA 1KMHB 1SGFA 4WMDA 2F83A 2V3OH 2GVFA 1NO9H 1XVOA 1HAXB 5A0CA 3A7XA 3NCLA 4NZLA 3SQHE 4U30A 1V2JT 5H4IB 2FM2A 1FONA 4WMEA 2KZ4A 1A0HB 1O2HA 2VH0A 3TGIE 1LO6A 7GCHG 1KXFA 1YPMH 1S83A 3EYDA 1BTWA 2ZGJA 2FWWA 3BTME 4GCHF 4JYUH 1SLVB 1WCZA 3UREA 2FOHA 1HAPH 2Q6FA 1DPOA 5C20A 3SJOA 3UQVA 3EA9A 1GGDB 3PLKA 1B7XB 2H2ZA 1G30B 1TGTA 1MTNB 3SV8A 3VB5A 2BDIA 5C67A 4XBDA 1SQRA 2WUCA 1E34B 3TH4H 2QXHA 5GNDA 1GHVH 3K6YA 1BHXF 1W12U 3B23B 4CBOA 2V0BA 1W0YH 2XW9A 2FOGA 1K28D 1UK3A 5PTPA 3SORA 5LH8A 2H9TH 4LK4A 2J97A 3ZZ3A 1LDTT 3MHWU 2BVXH 2OCVB 3K65B 3SNBA 3JZ2B 3P8FA 4BXSA 4ISOA 4ZMAH 1TYNA 1VITH 3WW7A 1TPPA 1F0RA 5L2ZH 1O3OA 1MZDA 5HKKD 4BOHA 4DIIH 3EDXB 1V2LT 4YTAA 5HM2A 1K1IA 1MD7A 1FXYA 3VB7A 4NIXA 3P6ZB 1NRNH 2OC1A 1SHYA 2PHBA 1C2MA 1EAXA 1PQAA 2BDYA 4FXGH 4YLQH 5T6DA 2ZDNA 2ZCKP 4INKA 3N7OA 1WXRA 4DOQA 5DKMA 2BLOA 4UDWH 1LVBA 1ZMLA 3BTQE 1O3DA 1SGIB 2H6MA 5EOKA 2BQWB 2VJ1A 4IBLH 4UEHH 2P3UB 3H09A 4GCHG 1INCA 3KQEA 2XC4A 3FOAA 3EE0B 3SV9A 3TGKE 1C5QA 4ZKOU 1GHBF 2VWNA 1ID5H 3TVJB 5C0UA 1O3GA 2D8WA 7KMEH 3P8GA 4NA9H 3T62A 1C2FA 1G3DA 5A0AE 1GHZA 1T8MA 1CT0E 1ZTLA 1GBFA 1JXPA 2WV4A 3RXJA 4TY7A 1EB2A 2TGDA 4KTUA 2D1JA 4Q4LA 3SHAH 1K21H 1NY22 4AN7A 4AYVB 5EW2H 5DJ7A 4IN1A 3M3SA 3AASA 4DT7B 2FI3E 1RGQA 2VWMA 2C8ZB 1JIMA 2VNTA 1DT2A 1FPCH 4X1SU 6CHAB 5L2YH 2XBYA 3M35A 5C2ZA 4FU8A 2RCEA 1YCPK 3ZZ6A 1ZPZA 4X6PA 3OU0A 3NUMA 1C1QA 1GJ8B 1ELEE 1TMTH 4ABHA 5EJLA 4CHAC 4AFSA 3ODFA 4Y71A 2PWXA 3MNBA 3PB1E 1MAXA 1Z8GA 3FVFB 1AWFH 4NWKA 1SFQB 2H5DA 1GBIA 1BBRE 1GBEA 1EQ9A 3N99A 4FU9A 1C1NA 3W94A 2FLBH 2XNDD 1GJ7B 2KM0A 1TX7A 4HTCH 2IOTA 1O2YA 1EOLA 2EY4C 1AE8H 1LPZB 2PKSC 4U01A 2F91A 4AX9H 1O34A 3T27A 1DUAA 3OY5U 1EXFA 2P3TB 2TIOA 1TX8A 1C2LA 4QT8C 9LPRA 1FZZA 2P94A 1ELDE
chains in the Genus database with same CATH topology
3SU0A 2LELA 4FETA 3FO8D 2OC1A 3NRLA 3SZEA 3DCLA 2VBCA 4B71A 2KR7A 1RTLA 2W6JD 2V7QD 1NBMD 2YMSC 2J5UA 2QF5A 3F0OA 3PRDA 5GJ4B 5IK2D 2W6ID 2A4QA 1FX0B 1W0JD 1WXRA 3F2FA 3GS9A 1MABB 3F2GA 4TSFD 5ETXA 3SUDA 2XOKD 2P59A 2XCNA 1DY8A 4WH6A 3L6PA 2KCAA 3SU6A 2FP7B 1W0KD 2OC8A 2OK5A 3WWBA 3SU4A 5EQQA 2K8IA 2F43B 3LOXA 4RI0A 2AHME 3H09A 5CDFE 2XNIA 3AK5A 3KN2A 4M9FA 3UB0A 3VG8A 3FOAA 4B6FA 3KNXA 3SV9A 2HLDD 1E79D 1BMFD 3SV7A 3OFND 4B75A 5C0UA 5CHBA 2QF4A 4Z1MD 3OYPA 4KTCA 1DY9A 3E90B 5GPIB 3U1JB 1JXPA 1N1LA 3KEEA 5EQSA 3LONA 3SUGA 1EFRD 2K1QA 4DT4A 3O8BA 3PV5A 3F3BA 2QE7D 1S6LA 4Q4LA 1OHHD 2KCOA 2F9UA 4WF8A 5EQRA 5DN6D 1A1RA 2M2AA 4JMYA 5F53A 1KMHB 3SU2A 1NBME 2GVFA 2WHXA 1E1RD 3FN8A 5T1VA 4B74A 2OINA 1H8ED 2JDID 3O8DA 2WV9A 4A1XA 3O8RA 3F2HA 5FPSA 1RGQA 5H4IB 2O8MA 2IJOB 2FM2A 3ZIAD 5FL7D 4TT3D 2F4LA 2KZ4A 4YXWD 1W3CA 4A92A 2FOMB 1DXPA 3P8OA 2JJ1D 3EYDA 4R8TB 4ASUD 2JJ2D 5EPYA 3SU1A 1COWD 2KFWA 2OC7A 3O8CA 2OBOA 2WSSD 4XD7D 1BT7A 2KCPA 2KCYA 3N7DA 3SU5A 4ZCNA 1DXWA 5FPTA 4TYDA 4B76A 4F55A 1SKYE 4A1VA 2YMSB 2OBQA 3DSPA 2L6OA 1H8HD 3RC6A 3SV8A 2YOLA 4A1TA 3PV2A 3OEHD 2XCFA 5FPYA 2YMSD 3M5NA 3FKSD 3U1IB 4NWKA 4Q63A 3N7EA 3OEED 2OC0A 4B73A 5GNDA 3DSOA 4I32A 3SUFA 3SUEA 5C0TA 3OTPA 3N99A 2IJD1 2WPDD 2XNDD 2A4GA 4I31A 2KM0A 4I33A 3F0PA 3SV6A 1NS3A 2K0QA 3KF2A 3PRBA 2F9VA 3SU3A 3P8NA 4NWLA 4U01A 5DSFA 3RC4A 1E1QD 2JIZD 2WZQA 3OAAD 4OM9A 5IDKA 4B6EA 4WH8A 3WWFA 1CU1A 2GGVB 3RC5A 2A4RA 3WW7A 5EPNA 4K8BA 2CK3D 3SYJA 3M5OA 5ESBA 5B6LA 5HKKD 5C17A 3M5LA 3M5MA 3LKWA 3W1EA 2QV1A 3OE7D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DSO A;  2LEL A;  2KM0 A;  3DSP A;  3N7D A;  2K0Q A;  3N7E A; 
#chains in the Genus database with same CATH topology
 1WOF A;  3NRL A;  1QJ1 B;  3QK1 A;  1D3Q B;  2B0F A;  3RMM H;  2QXG A;  5DP6 A;  1O5A B;  1C1V H;  1BCU H;  1GJB B;  1TOM H;  1HXE H;  1P57 B;  3IG6 B;  1V2U T;  2B5T B;  1GHA G;  2XOK D;  3ATI A;  1S5S A;  4DCD A;  3SU6 A;  2HPQ H;  2FS9 A;  1G3B A;  2KX4 A;  1BRB E;  2K8I A;  3ZYE A;  2F43 B;  4NA7 A;  3S7K B;  1SL3 A;  2AHM E;  2XNI A;  3KN2 A;  4M9F A;  3UB0 A;  1TAB E;  1SGT A;  1LQE A;  1MTW A;  1FPH H;  4I7Y H;  5CHB A;  1LKB A;  1QHR B;  3OYP A;  2ZEB A;  3LGU A;  3OSY A;  3PO1 C;  3ZVC A;  3QUM P;  4ABG A;  1CBW B;  2FMJ A;  1L1N A;  1ABJ H;  3D65 E;  1ZJD A;  1S6L A;  2TRM A;  3PMJ A;  5DP8 A;  5CE1 A;  1DLK B;  1P01 A;  1HPG A;  1PQ8 A;  1B5G H;  1THS H;  2WHX A;  4A6L A;  1HJA C;  3PWC A;  1ARC A;  1OWD A;  2A7H A;  1GI4 A;  1OP8 A;  2IJO B;  1EJN A;  1PPF E;  3TJO A;  4YO9 A;  1RTF B;  1V2S T;  2G52 A;  3ATW A;  3RXT A;  5JBT A;  3K2U A;  2JJ2 D;  1C1O A;  1V2R T;  3SU1 A;  2C8W B;  4AFZ A;  2NU2 E;  3VEQ B;  4XD7 D;  4ZCN A;  3TU7 H;  2AIP A;  2A31 A;  1BRA A;  5FPY A;  3ZYD A;  3VXF H;  4LZ4 B;  1T7C A;  1GMC G;  3B8J A;  2UUY A;  4FVD A;  4INH A;  1IQH A;  5C94 A;  3QX5 H;  1ZGI A;  2GZ7 A;  2ZU2 A;  1Y8T A;  5FX5 A;  2PKA B;  4I33 A;  1XMN B;  1O3K A;  3MNS A;  2ANK H;  2HNT F;  2K0Q A;  3VB4 A;  1EP6 A;  4X6O A;  4F4O C;  2ZTZ A;  1NN6 A;  3UQO A;  1LQD B;  2Y5F A;  5TCA A;  5LPR A;  1FDP A;  2CK3 D;  3A86 A;  4B2B A;  1C1T A;  1RJX B;  4K5Z A;  3DSG A;  4HFP B;  1SFI A;  1FV9 A;  1SPJ A;  5LPE A;  1YGC H;  4Q2K A;  2V7Q D;  4X8T H;  1D4P B;  2CGA A;  1GG6 B;  1GBK A;  2VIP A;  3A7T A;  3MWI U;  4Y8Z A;  4UE7 H;  1NRQ H;  1GBM A;  1FIW A;  4ABB A;  3Q00 A;  2P93 A;  2G5V A;  4FUJ A;  3RXM A;  4JZD H;  3GIC B;  3PMH B;  1T4U H;  2CHA C;  1NFW A;  3ZVF A;  2STB E;  4KTS A;  1RS0 A;  2G81 E;  1AZZ A;  2QXI A;  2ZFR H;  1UTQ A;  1ZTK A;  4GHT A;  3PMA B;  1TGS Z;  3LIW A;  3UTU H;  2QC2 A;  1B0F A;  4DG4 A;  4WMF A;  1ARB A;  3QGJ A;  4ABI A;  1TGN A;  1F92 A;  2TGA A;  1GDQ A;  1TNG A;  4OGY A;  2ILN A;  5E0J A;  4DT4 A;  3F3B A;  2A5A A;  3BTT E;  3TK9 A;  2FEQ H;  1QJ7 B;  3TPI Z;  4YZU A;  1BTU A;  3MU1 A;  1W7X H;  1E1R D;  2BDB A;  1ZTJ A;  3R3G B;  3KYG A;  3ATM A;  1L4Z A;  1GI6 A;  1WDI A;  1ESA A;  2BY6 X;  1BBR H;  4CHA B;  4J1Y A;  2DE8 A;  2BDG A;  3UUZ A;  1O3I A;  2NU4 E;  3UOU A;  3MOC A;  1ZPB A;  2BY9 X;  3BIU H;  2RA3 A;  1YLN A;  1YPE H;  1EAI A;  4LZ1 H;  1MCV A;  1O37 A;  1ZHP A;  4K69 A;  4XFQ A;  1N6X A;  2J95 A;  2PKS B;  2J94 A;  6GCH F;  2QF3 A;  3CP7 A;  2SGP E;  4ZHM U;  2QCY A;  3SNC A;  4IW4 E;  1Y3U A;  2JKH A;  1O2S A;  2FOE A;  4CR9 A;  3QWC H;  2WPD D;  3GYL B;  2XYA A;  1PPB H;  1YPG H;  3I29 A;  2Y82 A;  3BSQ A;  1GPZ A;  2GDE H;  5DSF A;  2H5C A;  2Y7X A;  1MCT A;  1OWK A;  3V12 A;  4ZHL U;  1VJ9 U;  1VCQ A;  2ZEC A;  2F9N A;  3OE7 D;  4A7I B;  1HAV A;  3STJ A;  5A8Z A;  5JDU B;  1S84 A;  5JBB S;  1UTL M;  2EA3 A;  1GGD C;  2ZU1 A;  3TJV A;  5FAH A;  4OGX A;  1QIX B;  1UJ1 A;  1XKB C;  2A4O A;  2F9O A;  5GJ4 B;  4X1N U;  5IK2 D;  2VID A;  3GS9 A;  3F2G A;  3SZN A;  5LGO A;  1TQ0 B;  3PO1 B;  2FP7 B;  4RT1 A;  4OS6 A;  2PKA A;  4VGC C;  2HOB A;  3KNX A;  2EI6 A;  1J9C H;  3Q3K A;  1O2L A;  1DWB H;  4NSV A;  3UIR A;  1AVW A;  3A84 A;  8KME 2;  3RXC A;  2A7J A;  5AVD A;  1EFR D;  1IQL A;  3O8B A;  2VIO A;  1TAW A;  1F2S E;  1KDQ A;  3E1X B;  2W3I A;  1PPG E;  4K1T A;  4XBB A;  5I25 A;  2CN0 H;  2BDH A;  5E2P A;  1AU8 A;  5F8T A;  1P0S H;  3FN8 A;  1C5Y B;  4P00 A;  2GP9 B;  4ISN A;  1C4V 2;  2J2U A;  1LHC H;  1O3B A;  4X8S H;  1HB0 B;  1HAZ B;  4NIY A;  3AVZ A;  3K6Z A;  1D9I A;  4GAW A;  4RKJ B;  4A92 A;  1CA8 B;  1QL7 A;  3P8O A;  1AVX A;  5GDS H;  3U8R H;  3GCN A;  4NFF A;  1CSO E;  3BTF E;  1YYY 1;  4WVP E;  1O3C A;  3A7V A;  1CGI E;  1HJ9 A;  3RMO H;  2ODQ A;  1A5G H;  4Y7B A;  4TYD A;  1DWE H;  3F9E A;  3FP8 E;  2PW8 H;  5EOD A;  1H8H D;  3RC6 A;  2R2W U;  3SV2 H;  4HZH A;  5DK1 A;  5C5O A;  2ZCH P;  2J38 A;  1KXD A;  3GCT G;  3V0X A;  1NRR H;  3MH4 A;  3SUF A;  4TY6 A;  1QFK H;  4CR5 A;  3DFL A;  1ELT A;  2Z3D A;  1FLE E;  2PSY A;  3GDU A;  1NZQ H;  1YPL H;  2A4G A;  2P8O B;  2O8U A;  3A80 A;  6LPR A;  3F0P A;  1MKW H;  2ZU5 A;  2P3F H;  4THN H;  1DM4 B;  1NS3 A;  3F9G A;  1ZMN A;  4TPI Z;  2QF0 A;  5DP5 A;  3CS0 A;  1ELA A;  1TOC B;  2A4R A;  2FOA A;  2BLQ A;  3QTO H;  6CHA C;  2O8W A;  1TIO A;  3SOS A;  1NTP A;  1EB1 H;  1UVT H;  3URC A;  1GI1 A;  3LKW A;  2EST E;  3FP6 E;  4B71 A;  2LPR A;  4JZ1 A;  4D9Q A;  2ZHE H;  5HIZ A;  1O2N A;  2C90 B;  2LEL A;  1O2Q A;  1EUF A;  3BTG E;  3KQB A;  9EST A;  2QAA A;  2XBX A;  1C1M A;  1O2I A;  1AY6 H;  2ALP A;  4ISI H;  4XOJ A;  5EST E;  2A4Q A;  3U9A H;  4NFE A;  3MO6 A;  3VGC C;  2BTC E;  4E05 H;  1KLJ H;  1TB6 H;  1C5U A;  1LKA A;  3ATL A;  3SJI A;  2VIN A;  1OXG A;  1YLC A;  5EQQ A;  1SQT A;  1IHT H;  1Y5U T;  4RI0 A;  4FU7 A;  4B6F A;  2A0Q B;  2VWL A;  2SGD E;  1O2V A;  2FX6 A;  3NWU A;  3SV7 A;  2UWO A;  1DAN H;  2ZTX A;  4EST E;  4AB9 A;  5FCR A;  4DIH H;  1QBV H;  1EZX C;  1V2W T;  1C2I A;  5DN6 D;  2M2A A;  1MQ6 A;  1SGF G;  1JMO H;  2Q6D A;  1GVZ A;  2FLR H;  1NES E;  1YBW A;  4X2V A;  1P2N A;  1O2X A;  5KED A;  1C4U 2;  3U8T H;  2TPI Z;  1O39 A;  2WV9 A;  3DUX H;  1ACB E;  2BY5 X;  1ORF A;  2YNA A;  1L1J A;  3C1K A;  4I8L A;  4ZXY H;  1ELF A;  1ZRK A;  1COW D;  1EKB B;  4JYT A;  3SU5 A;  5L30 H;  5A0B A;  4A1V A;  3ENS B;  1QZ8 A;  2WV5 A;  4BAQ B;  2OQ5 A;  4UFG H;  3A7Y A;  3OEH D;  1O5G H;  1ZLR A;  1P09 A;  3MH5 A;  1O2J A;  2AEI H;  1G9I E;  2XRC A;  1AUT C;  2OD3 B;  1CBW C;  1P3C A;  1SOZ A;  3DHK H;  3SUE A;  4O97 A;  2ZU4 A;  3GY3 A;  4D9R A;  3TIU A;  4MPW A;  3BEF B;  2HNT C;  1OP2 A;  3LH1 A;  2BX4 A;  3FAO A;  1GVL A;  4H42 U;  1S81 A;  3TGJ E;  1O2K A;  3UAI C;  1FN6 A;  3DT0 H;  3VFE A;  3P8N A;  2NU0 E;  2JIZ D;  2C8X B;  1SGP E;  4WH8 A;  1AFQ B;  1BOQ A;  1OWH A;  3T29 A;  1ANC A;  5EPN A;  8GCH G;  1PFX C;  1ZJK A;  2ZGX H;  4K8B A;  5T6F A;  2Y81 A;  1SVP A;  4CRD A;  1P03 A;  3W1E A;  1TLD A;  2BMG B;  2CF8 H;  5JB9 S;  4H6T A;  4CRG A;  4VGC B;  2SFA A;  5T6G A;  2PTN A;  1YCP M;  1UK4 A;  3EAJ A;  1RTL A;  1NBM D;  2ZDM A;  3OX7 U;  1SGY E;  2ALV A;  1O2W A;  3BEU A;  1DY8 A;  1TNK A;  1ETR H;  1QB1 A;  3ZZ5 A;  3V7T A;  1QA0 A;  4AG2 A;  1O3E A;  1AMH A;  1HFD A;  5T3H A;  2ZFQ H;  3RXO A;  3QZR A;  1DX5 M;  3MU5 A;  1BMF D;  1BTH H;  4ABF A;  1GBC A;  3D62 A;  4Y76 A;  2AFQ B;  2VU8 E;  3RU4 T;  3AAV A;  5CHA C;  3EST A;  4I8J A;  4H6S B;  2FOB A;  1S6H A;  1CGJ E;  3T28 A;  1HYL A;  1PPE E;  1EJA A;  1TNI A;  1PPZ A;  1C5Z B;  3D23 A;  1NBM E;  4ABE A;  2PUX B;  1UTK A;  1DIC A;  3GDV A;  1YLD A;  1C9T A;  2C8Y B;  2OIN A;  2GTB A;  2EQN A;  1EP5 A;  3R0F A;  1IHS H;  1CA0 C;  1O5F H;  2Z6B D;  3I78 A;  4WWY A;  5FPS A;  4AZ2 B;  1WYK A;  1GG6 C;  2F4L A;  3GIS B;  1KXE A;  2G8T A;  1W2K H;  1JRS A;  1J14 A;  5KEC A;  3RXF A;  1OSS A;  1ZMJ A;  2WSS D;  5KGO A;  4XDE A;  3TK5 A;  2UWL A;  2YMS B;  2OBQ A;  1HDT H;  4AG1 A;  2AGI X;  1V6D A;  1TNH A;  3I77 A;  3P92 A;  4YES B;  3B9F H;  1O2T A;  2GCT B;  1O2P A;  5EXM A;  1J17 T;  4YT6 H;  5DG6 A;  3RLW H;  1HBT H;  1HAG E;  1RXP A;  1C5M D;  1UTM A;  3GY7 A;  1OWJ A;  5J4S A;  1GBT A;  2HNT E;  5EJZ A;  3RXQ A;  5EIY A;  1UCY K;  2QY0 B;  3SU3 A;  1GL0 E;  1ELG A;  1IAU A;  3BTD E;  1QNJ A;  5L6N H;  5LPF A;  3HGN A;  2R3U A;  2WZQ A;  1O3P B;  1FMG A;  5SGA E;  1MU8 B;  5DP4 A;  3VGC B;  3M5L A;  1IQE A;  2QGR A;  3Q77 A;  1A3E H;  1P8V C;  3ZZC A;  1C5N H;  1SLX B;  5JPM H;  3M3V A;  1LHF H;  3FO8 D;  1W10 U;  3RXL A;  2XXL A;  3ODD A;  2ZTY A;  1HAI H;  2OQU A;  4AOR A;  1TA2 A;  2W7U A;  3BV9 B;  3ZVB A;  1W0J D;  4O3U A;  1FUJ A;  2VVC A;  1GHB G;  1BRU P;  1V2Q T;  2PUQ H;  3L6P A;  2KAI B;  1C5X B;  1W0K D;  2RFK C;  5C1X A;  1WSS H;  1FY4 A;  2FTM A;  2F3C E;  4B2A A;  1C5P A;  2ZFP H;  4KEL A;  3LOX A;  3KQ5 A;  4E7R G;  2FYR A;  2SNV A;  2SNW A;  2UWP A;  3E91 A;  4X2X A;  3OTJ E;  1FQ3 A;  1DY9 A;  3A88 A;  4HGC A;  1KXB A;  3KQC A;  3LON A;  1U6Q A;  3TK6 A;  1O5E H;  3RM0 H;  1TPO A;  1HXF H;  2RDL A;  5AF9 H;  2ZQ2 A;  2SGE E;  1O3M A;  4YM9 A;  1NRP H;  4ACB A;  2Q1J A;  3UR9 A;  1RTK A;  2GD4 B;  3FAN A;  1P2J A;  1GMD F;  1HLT H;  4YLU A;  1AFE H;  1NM6 A;  4ASU D;  2FOC A;  2GT7 A;  2ZWL H;  3AW1 A;  1MKX H;  1G2M A;  1T8O A;  2KFW A;  4ZKR U;  1S82 A;  1A4W H;  2DE9 A;  2J92 A;  5FPT A;  4F55 A;  1XXF A;  4RKO B;  2UUF B;  1K22 H;  4GUX A;  2L6O A;  2G4U A;  1RFN A;  4BAO B;  3A8A A;  4F49 A;  3SQE E;  1RIW C;  1XUI A;  3LPR A;  1FJS A;  3SO3 A;  2GCH F;  4BTU B;  2V6N A;  5EXL A;  5A8X A;  2BDA A;  5DPA A;  3SJ9 A;  4X1P U;  3PTB A;  3SV6 A;  1HRT H;  3KGP A;  1EPT A;  1B0E A;  1V2M T;  3GY4 A;  4NWL A;  1DFP A;  4OM9 A;  3S9C A;  1GVK B;  2ZKS A;  1V3X A;  1XUJ A;  2ZHF H;  1ZHM A;  2CMY A;  1HAV B;  2A5K A;  2BB4 A;  3C27 B;  1K1P A;  5GCH F;  1UO6 A;  1O2O A;  1L1G A;  7EST E;  2ZG0 H;  1QBO A;  5E8E H;  3M7T A;  1ZPC A;  1HAY B;  1PYT C;  4AFU A;  2W6I D;  4MPX A;  1SMF E;  2BDC A;  2ZF0 H;  1FI8 A;  2XCN A;  3DD2 H;  3WY8 A;  4OS2 A;  1QL9 A;  1K2I 1;  5CHA B;  1CT2 E;  1ETT H;  4K1S A;  1Z71 A;  5HGG A;  1AUJ A;  2B7D H;  1UHB A;  2M5T A;  2HLD D;  1UVP A;  2BQ6 B;  2P8O C;  1KDQ B;  1GHX H;  1OWE A;  2PSX A;  2R0L A;  3NPS A;  1CA0 B;  3U1J B;  5K0H A;  3LT3 A;  5IYT A;  3RML H;  1ZSJ A;  1C1P A;  1O5B B;  2KCO A;  3ZVA A;  1IQJ A;  1OP0 A;  3ATK A;  1P2K A;  2GZ8 A;  1P9S A;  1YC0 A;  2WPM S;  1A3B H;  1O2Z A;  3T2N A;  1H8E D;  4GLY A;  1AHT H;  1ESB A;  1GJ4 H;  4A1X A;  1FIZ A;  2EC9 H;  1A7S A;  2PR3 A;  1GJC B;  2KAI A;  4BXW A;  2AMQ A;  5EGM A;  1QB9 A;  1YF4 A;  2EI7 A;  4UON A;  2GT8 A;  2WPI S;  1XUH A;  3QDZ B;  1EOJ A;  3UWI A;  1MMJ N;  3E6P H;  5GIB A;  2F9B H;  2VWO A;  2KCY A;  3GY8 A;  1WQS A;  3ZVE A;  3RUO A;  3DSP A;  3UNQ A;  1LPG B;  1HUT H;  2NU3 E;  1PYT D;  3L33 A;  4Y11 E;  2TGP Z;  5GWZ A;  2IN2 A;  3KID U;  1VCP A;  2ZO3 H;  4Q63 A;  2J9N A;  2RG3 A;  2VIQ A;  1GDN A;  2BOH B;  5GXP A;  1SGQ E;  3HGP A;  3ZZ4 A;  2OP9 A;  3RP2 A;  3RMN H;  2AYW A;  1YY3 A;  5DP9 A;  1DS2 E;  1XX9 A;  5J4Q A;  1BBR K;  2ZA5 A;  1XUG A;  2HGT H;  2BM2 A;  1ZHR A;  3RXE A;  1EAS A;  1W7G H;  5IDK A;  1HAO H;  1H8D H;  1TMB H;  3UNS A;  3BG8 A;  1ZR0 A;  1TPS A;  5ESB A;  1OWI A;  3NK8 A;  3A8D A;  2UUJ B;  4WXV A;  2ZI2 H;  1AWH B;  1O5C B;  1DLE A;  2WYJ A;  4CRB A;  3CNR A;  4FET A;  2FX4 A;  5B6O A;  3AAU A;  8EST E;  1Y59 T;  2FOF A;  3SI4 H;  1NRS H;  1AE5 A;  2J5U A;  3PRD A;  4U2W A;  4IGD A;  4CRE A;  3ELA H;  4AGJ A;  3MMG A;  5JBA S;  3PLB A;  1L2E A;  1C5V A;  4ABA A;  1J16 A;  5DP3 A;  1F5R A;  1QTF A;  2FPZ A;  1G3C A;  2C93 B;  1YP9 A;  2ZC9 H;  4GVU A;  2BZ6 H;  1LVY A;  2GV6 A;  3SGQ E;  2Z9G A;  1TFX A;  1CO7 E;  3PM3 A;  1H1B A;  4XE4 A;  1WU1 A;  2XTT B;  2AGG X;  1UK2 A;  1YWU A;  2JET C;  3A81 A;  1L0Z A;  2XC5 A;  3KEE A;  1MQ5 A;  1AFQ C;  2QE7 D;  1OHH D;  1ANB A;  1BZX E;  2CJI A;  1TBQ H;  4ISL A;  1A1R A;  3FFG A;  5F53 A;  3UWJ H;  3SU2 A;  4ABD A;  1D3D B;  2QN5 T;  2GJG A;  5FHT A;  2VGC C;  3MO3 A;  5G4B A;  4GPG A;  1GWA A;  5E0H A;  3O8R A;  1BTY A;  3QZQ A;  3T26 A;  3LGI A;  2SGA A;  1HIA A;  5AHG H;  1W3C A;  3LC3 A;  1RIW B;  4JZE H;  2FOM B;  2IPQ X;  3S9B A;  3V13 A;  1DWD H;  3GY2 A;  4MVN A;  2A2X H;  1P2I A;  1UVU H;  4MQA A;  1UTN A;  6GCH G;  2BD5 A;  1C1R A;  3PYH A;  5DP7 A;  3P95 A;  2F9P A;  1T31 A;  2Z9I A;  1C1S A;  4OS7 A;  4BTI B;  1CHO F;  1JBU H;  2G5N A;  1MD8 A;  1V2O T;  1C5T A;  3M5N A;  4FUC A;  1ZYO A;  6EST A;  2CV3 A;  1SI5 H;  3OEE D;  1FN8 A;  2OTV A;  3Q3Y A;  2FES H;  3F1S B;  1XUK A;  1OOK B;  5AFZ H;  2B8O H;  4DVA U;  1TRY A;  3KQD A;  1W14 U;  1OS8 A;  3RXG A;  1GBJ A;  2VIW A;  1F0S A;  1H8I H;  1CVW H;  2F9V A;  3SHC H;  1MTV A;  4A5T S;  1KSN A;  4ZRO A;  4BAN B;  3RXB A;  5BRR E;  1SR5 C;  4IMQ A;  1EPT C;  1O0D H;  2Q6G A;  3M5M A;  2A45 B;  1LHG H;  1O35 A;  1OYT H;  2O8T A;  2BD4 A;  3MU8 A;  3A7Z A;  1O2M A;  3ZZ8 A;  5JB8 S;  2YMS C;  4UFD H;  4JK6 A;  3S69 A;  1MAY A;  1SG8 B;  1TRN A;  1FAK H;  5ETX A;  4AYY B;  1S85 A;  2A5I A;  3MO9 A;  1IQK A;  3U8O H;  2GCT C;  3SI3 H;  2GV7 A;  1EST A;  1XM1 A;  4Y0Y E;  1E37 B;  1SSX A;  2XWA A;  5CDF E;  1OX1 A;  1MKW K;  4U32 A;  2ZPR A;  3D49 H;  1XUF A;  4ISH H;  3P17 H;  1KLT A;  1WBG B;  2Z9K A;  3PTN A;  1P04 A;  1XVM A;  4I8K A;  2PV9 B;  1ELB A;  1O2R A;  4TPY A;  4OS1 A;  4JMY A;  4AOQ A;  1E35 B;  1JOU B;  2FI4 E;  1GMH F;  4ZKS U;  1GJ6 A;  2VVU A;  2ANW A;  1Y3W A;  4YOG A;  1IQN A;  3E3T A;  1UCY E;  2FDA A;  4E06 H;  2Y5H A;  1IOE A;  2VB0 A;  4XBC A;  1NU9 A;  1YPK H;  3FZZ A;  3MH7 A;  5A2M H;  1VKY A;  5A09 A;  2EI8 A;  4R8T B;  1MUE B;  4B2C A;  1QA7 A;  1DXW A;  3SND A;  1SQO A;  4B76 A;  1KYN A;  1SKY E;  1C2H A;  1TBZ H;  1YPH C;  3RLY H;  7GCH F;  3PRO A;  4INL A;  2ZCL P;  1HV7 A;  2O8L A;  1BMM H;  1P2Q A;  5HYO A;  2YMS D;  3HPT B;  4MLF B;  1TPA E;  3UFA A;  1TGB A;  1BIO A;  4B73 A;  1K1J A;  3DSO A;  4I32 A;  4JK5 A;  4KKD A;  3OTP A;  4X0W U;  2GX4 A;  1Y3X A;  3HK3 B;  4P02 A;  4PRO A;  3RXS A;  1ELC A;  1GL1 A;  4O3T A;  1WUN H;  5TJX A;  1C2G A;  4FUG A;  2FO9 A;  3GCH B;  4OS4 A;  3RU4 D;  4HG6 A;  1THR H;  2WIN I;  2PTC E;  3PRB A;  4YOJ A;  3RC4 A;  1VGC B;  4FUI A;  1CU1 A;  1C2K A;  2ZNK H;  4BAK B;  1WQV H;  1D3P B;  3M5O A;  3S9A A;  4FUH A;  1CHG A;  3KL6 A;  1ETS H;  3SNE A;  3AK5 A;  3G01 A;  2P95 A;  1GCD A;  1TGC A;  1N8O C;  2SGF E;  2W6J D;  1FY1 A;  3MU0 A;  1GJ9 B;  4MNW A;  5E0G A;  3TH2 H;  5HXF A;  4X6M A;  2BY7 X;  3K9X B;  1ZOM A;  2OXS A;  4ABJ A;  2A32 A;  3SUD A;  3M61 U;  2P59 A;  1J8A A;  2JET B;  2FXR A;  2ZZU H;  3KCG H;  4D76 A;  2A1D B;  3RDZ A;  4ZKN U;  2AS9 A;  3ZV8 A;  2TBS A;  1H9L B;  4CRC A;  1QRW A;  3RU4 E;  3BG4 B;  1NU7 B;  2BX3 A;  4DW2 U;  4UFE H;  1H9H E;  1GHW H;  1VIT F;  2AIQ A;  1JRT A;  3HKI B;  4CRF A;  1E79 D;  2QIQ A;  2VGC B;  2R9P A;  4Y8Y A;  1AIX H;  3RXI A;  3GDS A;  2BHG A;  2R2M B;  3MI4 A;  1QBN A;  1J15 A;  1P2M A;  2H9E H;  1TBR H;  2BD9 A;  3E16 B;  1BTP A;  3E0P B;  5F6M A;  4ZXX H;  2NU1 E;  4DJZ B;  3LGW A;  4NIV A;  1CT4 E;  2WUB A;  2ZP0 H;  5T1V A;  3LJO A;  2JDI D;  3HAT H;  1RRK A;  3PWB A;  2HRV A;  2G51 A;  4TT3 D;  4IMZ A;  4WY3 A;  4M7G A;  1EX3 A;  2ZHW H;  1OYQ A;  1G37 A;  1F0U A;  1GBH A;  3F68 H;  2OBO A;  2VVV A;  3N7D A;  4K1E A;  4NZQ A;  1MZA A;  1C1W H;  4KGA A;  1YPH E;  5FBI A;  1H9I E;  5HIY A;  5EJ1 A;  1KTT B;  3EE7 A;  4FUE A;  4CH2 B;  1E38 B;  1V2P T;  1QRZ A;  2C4F H;  1Z6E A;  1NPM A;  1UW7 A;  1A2C H;  4IS5 A;  1ZGV A;  4KP0 A;  2Y7Z A;  1KY9 A;  1EPT B;  1A46 H;  1GI2 A;  1SC8 U;  2STA E;  2Y6T A;  8LPR A;  1NRO H;  4O03 A;  3A7W A;  3BTW E;  3DFJ A;  4Y8X A;  4I31 A;  4MTB A;  3IIT A;  1PPH E;  3QN7 A;  1VIT G;  3EA8 A;  4Q80 A;  1QCP A;  4ZHA A;  2BLV A;  1SQA A;  1BB0 B;  4Q7Y A;  3HK6 B;  1C5R A;  2XC0 A;  4OS5 A;  2Z94 A;  1JWT A;  1E1Q D;  2GMT B;  1AGJ A;  3EQ0 H;  3SN8 A;  3PV4 A;  2BXT H;  2ANY A;  2Z3C A;  4Y7A A;  1P02 A;  5B6L A;  1BRC E;  2BOK A;  4DY7 B;  1O3F A;  2QV1 A;  4ACA A;  3DA9 B;  3SU0 A;  1VCW A;  5FBE A;  2SGQ E;  2ZPS A;  3HKJ B;  4ZUH A;  3S7H B;  4NSY A;  5HMA A;  4GSO A;  1ZRB A;  2THF B;  4ZAE A;  1F0T A;  1PPC E;  1NFU A;  4Y10 E;  1WTH D;  2I6S A;  5K7R A;  1Q31 A;  1FNI A;  2R0K A;  1V2V T;  2ZGC A;  3STI A;  4WH6 A;  1UHB B;  2KCA A;  2OC8 A;  3VB3 A;  3WWB A;  4CH8 B;  1FAX A;  1DE7 H;  2JH6 D;  3H7T A;  1YCP H;  1UCY H;  3BF6 H;  1LMW B;  1GHA F;  1DOJ A;  1Z8I B;  1BTZ A;  1KTS B;  3ZZ9 A;  2RDE A;  5E2O A;  4D8N A;  3BIV H;  1KLI H;  1SHH B;  1TRM A;  2HLC A;  1FY8 E;  1QQU A;  1PJP A;  1N1L A;  1SOT A;  5EQS A;  1T8N A;  4Z0K A;  1D6R A;  1A0J A;  1GJD B;  1GBL A;  3ITI A;  3H7O A;  1NC6 A;  1Z6J H;  1RD3 B;  1TON A;  4H4F A;  4AFQ A;  1VZQ H;  4HI3 A;  1T8L A;  1L4D A;  3VPK A;  3A82 A;  2ANM H;  2JH0 D;  3F2H A;  1O3J A;  1A0L A;  1EZS C;  1GI9 B;  3EA7 A;  2A7C A;  5FXL A;  1BIT A;  4MNV A;  3F9F A;  1KXC A;  4Y6D A;  2Z9L A;  1QB6 A;  1LTO A;  1AQ7 A;  1MTU A;  2J4I A;  1THP B;  4MNY A;  1BQY A;  2FOD A;  3LU9 B;  1BMN H;  4BAH B;  3A89 A;  4WJG 2;  2TGT A;  2ZGH A;  1C5L H;  1MBM A;  3MYW A;  3PV2 A;  1MU6 B;  2OUA A;  2XCF A;  2D2D A;  2FI5 E;  1QJ6 B;  3U1I B;  1LPK B;  1AKS B;  3A83 A;  1C4Y 2;  2W26 A;  1FY5 A;  2IJD 1;  1O30 A;  5C3N A;  3LGY A;  1TNL A;  3LC5 A;  1W0Z U;  2ZHD A;  3EGK H;  1GMC F;  4R0I A;  4Y79 A;  1UVO A;  1ELV A;  1TAL A;  2QXJ A;  2WPJ S;  1FY3 A;  1N8O B;  4B6E A;  4JZI A;  2GGV B;  2GZ9 A;  1P06 A;  2W5E A;  1UTJ A;  3UOP A;  2ZDA H;  1MKX K;  2QA9 E;  3M3T A;  3SYJ A;  1P3E A;  2ZFT A;  1DWC H;  1HCG A;  1QL8 A;  2WPK S;  3GY5 A;  4F48 B;  3TH3 H;  4X8U H;  1Z1I A;  2VBC A;  1M9U A;  1E0F D;  1NFY A;  2ZDL A;  4FUB A;  3SBK A;  3MH6 A;  4K60 A;  5EU8 A;  1O32 A;  1AB9 C;  4Q7Z A;  1FX0 B;  1GBD A;  1TA6 A;  3MNX A;  5EXN A;  1EJM A;  2VH6 A;  4X1Q U;  3SJK A;  1CGH A;  1H4W A;  1O2U A;  3QTV H;  3SU4 A;  1G32 B;  1E36 B;  4NGA H;  1G36 A;  1YKT A;  1WAY B;  4WXI A;  1C9P A;  3UNR A;  2XBV A;  1DDJ A;  3TNT A;  1KXA A;  5C1U A;  2BQ7 B;  1TE0 A;  3SNA A;  1A61 H;  1Z7K A;  3U28 C;  2J34 A;  2ZHQ H;  5GPI B;  4XRN A;  3VB6 A;  4TWW A;  2D26 C;  4NA8 A;  2QYI A;  3BEI B;  2ZQ1 A;  2NWN A;  3QLP H;  1DIT H;  4MG3 A;  2YNB A;  1VR1 H;  3F6U H;  1GMD G;  1GDU A;  4Y0Z E;  1X7A C;  1GCT C;  1TQ7 B;  2BD2 A;  2WPL S;  1HIA B;  3RXA A;  1UMA H;  1UTO A;  1Y3V A;  1SLW B;  1DSU A;  2HPP H;  1AO5 A;  3TJN A;  3ZVG A;  3ZIA D;  5FL7 D;  4YXW D;  3U69 H;  1DXP A;  2JJ1 D;  1C5S A;  1ANE A;  4I8G A;  2GCH G;  3H5C B;  2BY8 X;  4TWY A;  2Z7F E;  2DUC A;  1Q3X A;  1EAW A;  1TWX B;  1BDA A;  4K8Y A;  2RA0 A;  1IQM A;  2EEK A;  4X2Y A;  2VIV A;  3TNS A;  3URD A;  4YOI A;  3FKS D;  1P12 E;  2ZFS A;  3LGT A;  2AGE X;  1SLU B;  1UVS H;  1P05 A;  4FOU C;  1WTG H;  1PQ5 A;  4MDS A;  1NFX A;  1GHY H;  1AD8 H;  2WYG A;  5A8Y A;  5GCH G;  4X1R U;  4MPV A;  3MTY A;  5EG4 A;  3KF2 A;  1K1M A;  1LHE H;  4FVB A;  4BAM B;  4MNX A;  4RSP A;  1W13 U;  1F5K U;  1S6F A;  1GBA A;  1NT1 A;  1ZSK A;  3E0N B;  4K3J A;  2BD8 A;  1MTS A;  3TIT A;  3SZE A;  1LHD H;  1C2E A;  3GY6 A;  1AKS A;  3S0N A;  1BTX A;  2GKV E;  3W95 A;  1BA8 B;  4TSF D;  3CS7 A;  5FX6 A;  1OKX A;  2BD7 A;  3RXV A;  4I8H A;  4RT0 A;  1O38 A;  4BNR A;  1TNJ A;  1CQQ A;  2UUK B;  1F5L A;  3ZVD A;  3BN9 A;  1A5I A;  1F7Z A;  3RM2 H;  3OFN D;  4B75 A;  2PFE A;  3GCH C;  2QF4 A;  4Z1M D;  4KTC A;  4CRA A;  3M7Q A;  3E90 B;  1XKA C;  4LOY H;  2FYQ A;  1GJ5 H;  2K1Q A;  1VGC C;  3MFJ A;  1T4V H;  2BYA X;  1Y5B T;  3LDX H;  1P10 A;  2GDD A;  2W7S A;  3M36 A;  3A8C A;  3QGN B;  3IWM A;  1BMA A;  1C5O H;  1O3A A;  4SGB E;  4B74 A;  4JZF H;  4AC9 A;  1V2N T;  3O8D A;  3QO6 A;  2G00 A;  1O5D H;  4ZH8 A;  1T32 A;  3MNC A;  1OPH B;  2O8M A;  1LVM A;  2HWL B;  1BJV A;  1HGT H;  1K1L A;  1C5W B;  2BXU H;  4Z6A H;  1GBB A;  3CEN A;  3T25 A;  2G4T A;  2Y5G A;  3NZI A;  3TJU A;  4IC5 A;  5EPY A;  2PLX A;  2A2Q H;  2OC7 A;  2PP6 A;  3O8C A;  3ZZA A;  3VXE H;  3BG4 C;  1ZSL A;  1BML A;  2LP6 A;  2FIR H;  4X8V H;  2BVS H;  4AB8 A;  4A1T A;  1Y3Y A;  1SGR E;  2ZGB H;  3M37 A;  3F9H A;  5CMX H;  4DGJ A;  2H1U A;  1N6Y A;  1LCY A;  1TMU H;  2ZU3 A;  5DO4 H;  1Z8J B;  1GI7 B;  2W3K A;  2OC0 A;  1WV7 H;  1MH0 A;  2CF9 H;  5C0T A;  1QY6 A;  2XWB I;  1P11 E;  2ODP A;  1O3N A;  2ASU B;  5EW1 H;  7LPR A;  1G3E A;  2FTL E;  1HNE E;  1P9U A;  5JYI A;  1MTN C;  2V3M A;  3BTE E;  1O33 A;  3A85 A;  3GCT F;  4GHQ A;  1IQF A;  3BTH E;  1W11 U;  1DST A;  3RXK A;  2V35 A;  1DUE A;  4NCY A;  4Q7X A;  1AB9 B;  2BD3 A;  1GI3 A;  2J98 B;  3RXD A;  2LNC A;  1KIG H;  4FUF A;  1JIR A;  1O31 A;  2XBW A;  4X2W A;  3ZV9 A;  1K0H A;  3A8B A;  1D3T B;  1IQG A;  1HJA B;  3MU4 A;  3LH3 A;  1SGE E;  2ZIQ H;  2KR7 A;  1PQ7 A;  4O9V A;  3BTK E;  3MQK C;  3L3T A;  3RXU A;  1SBW A;  1MBQ A;  3E8L A;  4JCN A;  3OY6 U;  2OK5 A;  1AN1 E;  2H9H A;  2HAL A;  1AND A;  1EAU A;  4AGK A;  3Q3X A;  1UTP A;  2I6Q A;  4J2Y B;  4K2Y A;  1GI0 A;  3GCO A;  2ZPQ A;  5AFY H;  1GCT B;  5JBC S;  4XSK U;  3LJJ A;  4I86 A;  1A5H A;  4CBN A;  1O36 A;  5F8X A;  2C3S A;  4UFF H;  2GMT C;  3ZZB A;  3PV5 A;  1GI5 A;  1AZ8 A;  2F9U A;  1QUR H;  4UD9 H;  5F8Z A;  1SGN E;  1K1N A;  2AMD A;  3V3M A;  1EZU C;  4SGA E;  1K1O A;  3RXR A;  3PLP A;  5F03 A;  2AH4 X;  2ZDK A;  3RXH A;  1HAH H;  4D7F A;  2IPH A;  2BZA A;  3ZZ7 A;  1C2D A;  1XXD A;  2BVR H;  2R3Y A;  3KYF A;  1Z1J A;  4IN2 A;  1EZQ A;  1CHO G;  1SGD E;  4DUR A;  4YT7 H;  5TCC A;  2L74 A;  1P2O A;  3GOV B;  2CXV A;  3NKK A;  1C2J A;  3NXP A;  2KCP A;  1BT7 A;  2FS8 A;  4RN6 A;  2Y80 A;  2HVX A;  1O3H A;  3SJ8 A;  1C1U H;  3A87 A;  5HM9 A;  5I46 H;  3RXP A;  1O3L A;  1SGC A;  1QRX A;  2YOL A;  1QQ4 A;  2FZZ A;  2B9L A;  4X6N A;  3PMB B;  2PGB B;  3GYM A;  1YPJ H;  1YM0 A;  3M7U A;  2ZDV H;  3FZD A;  3N7E A;  4B1T A;  2CHA B;  2Z9J A;  3T5F H;  4JYV H;  4IC6 A;  2G55 A;  5BPE A;  1ABI H;  2ULL A;  2HVY B;  4NIW A;  2P16 A;  3P70 B;  2O9Q A;  2V3H H;  1EAT A;  2AER H;  3U98 H;  3FP7 E;  1AVG H;  2JH5 D;  1HJ8 A;  1AI8 H;  3OAA D;  2PGQ B;  1BUI A;  2BLW A;  3WWF A;  5DGJ A;  3RC5 A;  2AMP A;  1Z8R A;  1LVO A;  1V2K T;  4E7N A;  5C17 A;  2OLG A;  2Z3E A;  3SW2 B;  3UY9 A;  4ASH A;  5C5N A;  3DCL A;  1S0Q A;  3Q76 A;  8GCH F;  3LGV A;  3F0O A;  5FCK A;  2QF5 A;  1S0R A;  1V2T T;  1DVA H;  3F2F A;  1MAB B;  3ZZD A;  1O2G H;  1QR3 E;  3UR6 A;  3AW0 A;  1ZZZ A;  4LXB H;  1GJA B;  2WPH S;  2ODY B;  3UPE A;  1CE5 A;  3KHV A;  1VJA U;  1GI8 B;  3VG8 A;  4FUD A;  4BTT B;  1Y5A T;  2ZFF H;  4NG9 H;  1D6W A;  4D7G A;  2J98 A;  3SGA E;  1GMH G;  1W8B H;  1BHX B;  1Q2W A;  1BJU A;  1G2L A;  1SB1 H;  3JZ1 B;  3SUG A;  1K9O E;  5C1Y A;  3SGB E;  3TLO A;  5ABW A;  1TX6 A;  1IQI A;  4WF8 A;  5EQR A;  1QGF A;  4MPU A;  1KMH B;  1SGF A;  4WMD A;  2F83 A;  2V3O H;  2GVF A;  1NO9 H;  1XVO A;  1HAX B;  5A0C A;  3A7X A;  3NCL A;  4NZL A;  3SQH E;  4U30 A;  1V2J T;  5H4I B;  2FM2 A;  1FON A;  4WME A;  2KZ4 A;  1A0H B;  1O2H A;  2VH0 A;  3TGI E;  1LO6 A;  7GCH G;  1KXF A;  1YPM H;  1S83 A;  3EYD A;  1BTW A;  2ZGJ A;  2FWW A;  3BTM E;  4GCH F;  4JYU H;  1SLV B;  1WCZ A;  3URE A;  2FOH A;  1HAP H;  2Q6F A;  1DPO A;  5C20 A;  3SJO A;  3UQV A;  3EA9 A;  1GGD B;  3PLK A;  1B7X B;  2H2Z A;  1G30 B;  1TGT A;  1MTN B;  3SV8 A;  3VB5 A;  2BDI A;  5C67 A;  4XBD A;  1SQR A;  2WUC A;  1E34 B;  3TH4 H;  2QXH A;  5GND A;  1GHV H;  3K6Y A;  1BHX F;  1W12 U;  3B23 B;  4CBO A;  2V0B A;  1W0Y H;  2XW9 A;  2FOG A;  1K28 D;  1UK3 A;  5PTP A;  3SOR A;  5LH8 A;  2H9T H;  4LK4 A;  2J97 A;  3ZZ3 A;  1LDT T;  3MHW U;  2BVX H;  2OCV B;  3K65 B;  3SNB A;  3JZ2 B;  3P8F A;  4BXS A;  4ISO A;  4ZMA H;  1TYN A;  1VIT H;  3WW7 A;  1TPP A;  1F0R A;  5L2Z H;  1O3O A;  1MZD A;  5HKK D;  4BOH A;  4DII H;  3EDX B;  1V2L T;  4YTA A;  5HM2 A;  1K1I A;  1MD7 A;  1FXY A;  3VB7 A;  4NIX A;  3P6Z B;  1NRN H;  2OC1 A;  1SHY A;  2PHB A;  1C2M A;  1EAX A;  1PQA A;  2BDY A;  4FXG H;  4YLQ H;  5T6D A;  2ZDN A;  2ZCK P;  4INK A;  3N7O A;  1WXR A;  4DOQ A;  5DKM A;  2BLO A;  4UDW H;  1LVB A;  1ZML A;  3BTQ E;  1O3D A;  1SGI B;  2H6M A;  5EOK A;  2BQW B;  2VJ1 A;  4IBL H;  4UEH H;  2P3U B;  3H09 A;  4GCH G;  1INC A;  3KQE A;  2XC4 A;  3FOA A;  3EE0 B;  3SV9 A;  3TGK E;  1C5Q A;  4ZKO U;  1GHB F;  2VWN A;  1ID5 H;  3TVJ B;  5C0U A;  1O3G A;  2D8W A;  7KME H;  3P8G A;  4NA9 H;  3T62 A;  1C2F A;  1G3D A;  5A0A E;  1GHZ A;  1T8M A;  1CT0 E;  1ZTL A;  1GBF A;  1JXP A;  2WV4 A;  3RXJ A;  4TY7 A;  1EB2 A;  2TGD A;  4KTU A;  2D1J A;  4Q4L A;  3SHA H;  1K21 H;  1NY2 2;  4AN7 A;  4AYV B;  5EW2 H;  5DJ7 A;  4IN1 A;  3M3S A;  3AAS A;  4DT7 B;  2FI3 E;  1RGQ A;  2VWM A;  2C8Z B;  1JIM A;  2VNT A;  1DT2 A;  1FPC H;  4X1S U;  6CHA B;  5L2Y H;  2XBY A;  3M35 A;  5C2Z A;  4FU8 A;  2RCE A;  1YCP K;  3ZZ6 A;  1ZPZ A;  4X6P A;  3OU0 A;  3NUM A;  1C1Q A;  1GJ8 B;  1ELE E;  1TMT H;  4ABH A;  5EJL A;  4CHA C;  4AFS A;  3ODF A;  4Y71 A;  2PWX A;  3MNB A;  3PB1 E;  1MAX A;  1Z8G A;  3FVF B;  1AWF H;  4NWK A;  1SFQ B;  2H5D A;  1GBI A;  1BBR E;  1GBE A;  1EQ9 A;  3N99 A;  4FU9 A;  1C1N A;  3W94 A;  2FLB H;  2XND D;  1GJ7 B;  2KM0 A;  1TX7 A;  4HTC H;  2IOT A;  1O2Y A;  1EOL A;  2EY4 C;  1AE8 H;  1LPZ B;  2PKS C;  4U01 A;  2F91 A;  4AX9 H;  1O34 A;  3T27 A;  1DUA A;  3OY5 U;  1EXF A;  2P3T B;  2TIO A;  1TX8 A;  1C2L A;  4QT8 C;  9LPR A;  1FZZ A;  2P94 A;  1ELD E; 
#chains in the Genus database with same CATH homology
 3SU0 A;  2LEL A;  4FET A;  3FO8 D;  2OC1 A;  3NRL A;  3SZE A;  3DCL A;  2VBC A;  4B71 A;  2KR7 A;  1RTL A;  2W6J D;  2V7Q D;  1NBM D;  2YMS C;  2J5U A;  2QF5 A;  3F0O A;  3PRD A;  5GJ4 B;  5IK2 D;  2W6I D;  2A4Q A;  1FX0 B;  1W0J D;  1WXR A;  3F2F A;  3GS9 A;  1MAB B;  3F2G A;  4TSF D;  5ETX A;  3SUD A;  2XOK D;  2P59 A;  2XCN A;  1DY8 A;  4WH6 A;  3L6P A;  2KCA A;  3SU6 A;  2FP7 B;  1W0K D;  2OC8 A;  2OK5 A;  3WWB A;  3SU4 A;  5EQQ A;  2K8I A;  2F43 B;  3LOX A;  4RI0 A;  2AHM E;  3H09 A;  5CDF E;  2XNI A;  3AK5 A;  3KN2 A;  4M9F A;  3UB0 A;  3VG8 A;  3FOA A;  4B6F A;  3KNX A;  3SV9 A;  2HLD D;  1E79 D;  1BMF D;  3SV7 A;  3OFN D;  4B75 A;  5C0U A;  5CHB A;  2QF4 A;  4Z1M D;  3OYP A;  4KTC A;  1DY9 A;  3E90 B;  5GPI B;  3U1J B;  1JXP A;  1N1L A;  3KEE A;  5EQS A;  3LON A;  3SUG A;  1EFR D;  2K1Q A;  4DT4 A;  3O8B A;  3PV5 A;  3F3B A;  2QE7 D;  1S6L A;  4Q4L A;  1OHH D;  2KCO A;  2F9U A;  4WF8 A;  5EQR A;  5DN6 D;  1A1R A;  2M2A A;  4JMY A;  5F53 A;  1KMH B;  3SU2 A;  1NBM E;  2GVF A;  2WHX A;  1E1R D;  3FN8 A;  5T1V A;  4B74 A;  2OIN A;  1H8E D;  2JDI D;  3O8D A;  2WV9 A;  4A1X A;  3O8R A;  3F2H A;  5FPS A;  1RGQ A;  5H4I B;  2O8M A;  2IJO B;  2FM2 A;  3ZIA D;  5FL7 D;  4TT3 D;  2F4L A;  2KZ4 A;  4YXW D;  1W3C A;  4A92 A;  2FOM B;  1DXP A;  3P8O A;  2JJ1 D;  3EYD A;  4R8T B;  4ASU D;  2JJ2 D;  5EPY A;  3SU1 A;  1COW D;  2KFW A;  2OC7 A;  3O8C A;  2OBO A;  2WSS D;  4XD7 D;  1BT7 A;  2KCP A;  2KCY A;  3N7D A;  3SU5 A;  4ZCN A;  1DXW A;  5FPT A;  4TYD A;  4B76 A;  4F55 A;  1SKY E;  4A1V A;  2YMS B;  2OBQ A;  3DSP A;  2L6O A;  1H8H D;  3RC6 A;  3SV8 A;  2YOL A;  4A1T A;  3PV2 A;  3OEH D;  2XCF A;  5FPY A;  2YMS D;  3M5N A;  3FKS D;  3U1I B;  4NWK A;  4Q63 A;  3N7E A;  3OEE D;  2OC0 A;  4B73 A;  5GND A;  3DSO A;  4I32 A;  3SUF A;  3SUE A;  5C0T A;  3OTP A;  3N99 A;  2IJD 1;  2WPD D;  2XND D;  2A4G A;  4I31 A;  2KM0 A;  4I33 A;  3F0P A;  3SV6 A;  1NS3 A;  2K0Q A;  3KF2 A;  3PRB A;  2F9V A;  3SU3 A;  3P8N A;  4NWL A;  4U01 A;  5DSF A;  3RC4 A;  1E1Q D;  2JIZ D;  2WZQ A;  3OAA D;  4OM9 A;  5IDK A;  4B6E A;  4WH8 A;  3WWF A;  1CU1 A;  2GGV B;  3RC5 A;  2A4R A;  3WW7 A;  5EPN A;  4K8B A;  2CK3 D;  3SYJ A;  3M5O A;  5ESB A;  5B6L A;  5HKK D;  5C17 A;  3M5L A;  3M5M A;  3LKW A;  3W1E A;  2QV1 A;  3OE7 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...