3N7DA

Crystal structure of copk bound to cu(i) and cu(ii)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
59
structure length
59
Chain Sequence
NVVKTYDLQDGSKVHVFKDGKMGMENKFGKSMNMPEGKVMETRDGTKIIMKGNEIFRLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper resistance protein K
publication title Two new crystal forms of copper resistance protein CopK
rcsb
source organism Cupriavidus metallidurans
molecule tags Metal binding protein
total genus 12
structure length 59
sequence length 59
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11525 CopK Copper resistance protein K
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.300 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3n7dA00
2KM0A 3N7EA 3DSOA 2K0QA 2LELA 3N7DA 3DSPA
chains in the Genus database with same CATH superfamily
3UUZA 1O3HA 3S69A 1C2DA 7KMEH 2QCYA 1YCPH 1NTPA 4IGDA 1YPHC 2ZG0H 1TX8A 2ZEBA 3Q3XA 1L1NA 3NCLA 4OS4A 2BDHA 3KF2A 3B23B 3VXFH 4JYUH 4D76A 3ELAH 1TMTH 1YBWA 2VINA 4CREA 1GG6C 2ZDAH 2ZFPH 1C2HA 2H2ZA 4JYTA 5F03A 3RXIA 1P2KA 5T6DA 5IK2D 1Z1JA 4DIIH 4CRBA 1DE7H 4FU7A 5EXLA 3DFJA 3GYLB 1D6RA 1S83A 4FVDA 1C1SA 2IN2A 2G5NA 3SJOA 2GV7A 5EPNA 1SGIB 3FN8A 2VWOA 4WXVA 3ZVGA 3RMNH 4ZMAH 3T25A 3P8GA 2FTLE 3U1IB 1DUEA 2F9BH 3RDZA 1Z7KA 1YLCA 1OWIA 1EATA 4NZQA 4X2VA 5DO4H 1P11E 4H6TA 5T6FA 4M7GA 5DN6D 2YNAA 1O3AA 1THSH 2B7DH 4TY6A 4RI0A 3RMOH 2Y7ZA 1O2RA 1LKAA 1F5RA 2BY9X 4VGCC 5IYTA 1S5SA 2PTCE 3SBKA 2BY5X 1O2SA 1AVGH 1GG6B 4A92A 2Z9IA 3FO8D 1ZSLA 3A7XA 3PM3A 2XC0A 9LPRA 1ANBA 1HGTH 1FIWA 2XYAA 4K1EA 1IQMA 3QDZB 1SGCA 5DGJA 3RMLH 1H9IE 2GTBA 3A87A 4P00A 3VB7A 2C8WB 2Y5HA 2SFAA 5C20A 2CF9H 1PPEE 1Y3YA 3CNRA 1FUJA 2CHAB 3UIRA 1O32A 3CP7A 2DUCA 2YMSB 1ZPBA 1JIMA 3OAAD 3LDXH 1TBRH 2WINI 3MWIU 4E7RG 4I86A 4VGCB 1CA8B 5AHGH 1QY6A 2G00A 2PKAA 2F91A 2QAAA 2QV1A 1ZTLA 1AHTH 3I78A 3RP2A 1F0SA 1XUHA 2A5KA 2XOKD 1O2OA 5FPYA 1VCQA 3RU4E 4I8GA 1SGDE 2D1JA 3A7VA 5DK1A 2NU1E 2GCTC 1DITH 2J9NA 4TY7A 3HKJB 1NM6A 1K2I1 2AFQB 4KELA 4ACAA 1DT2A 1DLKB 1SOTA 4NSVA 3RXEA 3BEFB 4UFEH 4AOQA 2JDID 4F55A 1TWXB 2OC0A 1MCTA 1SFQB 4BXWA 1NO9H 1M9UA 3JZ2B 1SLXB 1T8LA 1C2LA 2G8TA 1SLVB 1EAIA 2ZZUH 1PJPA 4BAQB 1EPTA 1KIGH 2FDAA 2AYWA 3SNBA 4ZXYH 2V3OH 1E35B 1TOCB 4KTUA 1BDAA 1P2JA 3FAOA 1C9TA 2Y82A 3GCTG 1AZ8A 2V3HH 2GCTB 2AEIH 1T8MA 2ODPA 4ZHMU 4D7FA 3EA7A 4YO9A 2BD8A 3OE7D 3KQEA 4IN2A 2HVXA 4WXIA 4JZEH 3BTGE 1GGDB 2W7SA 1F0UA 1O30A 3BEUA 5C0TA 4ABBA 6GCHG 2R2MB 3PLPA 1O5EH 5FPTA 2BY8X 1MTNB 3LKWA 4AYVB 2A0QB 2AMQA 3ATMA 3L33A 3LGTA 1OOKB 3S7HB 1A1RA 3SNCA 2A1DB 1EB2A 4XE4A 4A5TS 3P95A 3TVJB 1TX7A 1TBZH 6CHAC 2BDCA 4U01A 4NWLA 1KDQB 2WYJA 1G2LA 3NK8A 3W95A 1C1VH 1HUTH 1C2EA 4CBNA 5A09A 1MKXH 4OS5A 3H5CB 2HNTC 3SOSA 1IOEA 1ZGIA 3UPEA 1V2VT 1YC0A 1EJNA 4INHA 1OHHD 1BTWA 2WPJS 2AH4X 4Z1MD 3SU5A 2ALVA 1QZ8A 3SNDA 3SJKA 3SORA 1W7GH 2BLWA 1LHFH 3I77A 1C5TA 2FOHA 3ATWA 2BDBA 4M9FA 1O5BB 3TITA 1KDQA 3RXVA 1O5AB 1LDTT 3MNXA 1UVUH 5DG6A 2G81E 2BD5A 1NRNH 1AVXA 1DOJA 1LVYA 1P8VC 3GS9A 3E90B 3DHKH 4GHTA 4WJG2 4Y6DA 4Y8YA 6CHAB 1VKYA 3QLPH 3P8NA 1ESTA 3ZVBA 4YM9A 3HGNA 3KEEA 3T2NA 1PQ8A 4K2YA 4FUIA 1MU6B 1BMMH 1G32B 3MU1A 4ISIH 2J5UA 1O5FH 2VIVA 4D8NA 1C5SA 1C2KA 6GCHF 4O9VA 2QXHA 1ZPCA 1E0FD 1FY5A 1TMUH 4Q4LA 1ZMJA 4THNH 1VITG 1LPKB 1GMHG 2C4FH 1QBOA 3Q00A 3BIUH 1GHAG 1FDPA 1SG8B 1Z6JH 1BHXF 1QJ1B 1GDQA 1F5KU 1O3IA 3ZZ6A 1TGCA 2AIPA 1QJ6B 5SGAE 1O35A 3LPRA 3M3TA 3ZZ5A 1HBTH 1WXRA 2Z3CA 5DKMA 3BTME 1ELVA 5DP3A 1XKAC 2SGQE 1HJAB 1PQAA 2OINA 2ZA5A 4MLFB 4AYYB 1FV9A 3RXDA 1P05A 2V6NA 2VB0A 4GHQA 2SNWA 1QBNA 1UVTH 2H9EH 1UTNA 3M5LA 5GJ4B 5CDFE 2BX4A 3RLWH 1DFPA 1KYNA 5DP4A 3AK5A 3SJ8A 2FOBA 1D3TB 1AD8H 4ABDA 1Q3XA 1NPMA 1IQEA 1EFRD 4IBLH 1QRWA 5G4BA 1ELFA 2C8YB 1T4VH 5L6NH 3LC3A 1AY6H 3V12A 4NWKA 3TGKE 3A81A 2WPHS 3PYHA 1O5GH 5I25A 2XBYA 2BXTH 4I8LA 2VU8E 2WV9A 3A85A 1FY3A 4FETA 1S0QA 5E2OA 3FANA 1KXFA 4DIHH 3R0FA 4LZ4B 1LTOA 3SU0A 1ELBA 4OS6A 4BAMB 1AUJA 1C5ZB 1GJ8B 2HRVA 4MVNA 7GCHG 2KZ4A 4F48B 3OY6U 1Q2WA 1B5GH 3BEIB 1WSSH 3SN8A 1XMNB 1A2CH 3UNRA 1ABJH 1INCA 2QA9E 2ZPQA 4IMQA 4MQAA 2BD4A 1GMHF 2Y5GA 1EZUC 1GHAF 3F2GA 2AGEX 2XXLA 2JH6D 1MCVA 3TK5A 5TCCA 1QRZA 4ZH8A 3P92A 2ZFSA 3KNXA 1DWDH 1KMHB 1AB9B 1T7CA 3WW7A 3MNSA 2GZ8A 3RXGA 4OS2A 2A5AA 1ZOMA 2HLDD 1TMBH 3RUOA 4E7NA 2STAE 1D4PB 4NFEA 5GIBA 3RU4T 1UTJA 3T5FH 1DWEH 1CT4E 1ZSKA 4B76A 3SJ9A 1GJCB 2FI5E 2XNDD 1HPGA 1EAXA 2PGBB 3NXPA 2QE7D 4MNVA 5GCHF 1GL0E 4DOQA 3FZDA 3OEHD 1J8AA 2CK3D 3A84A 1W2KH 1O3BA 3DFLA 3S9CA 1DVAH 5JDUB 2EEKA 2WPKS 3TJVA 1C1RA 5LH8A 5GNDA 1O3OA 2GZ9A 2ZFRH 1JRSA 1FXYA 3MFJA 3T28A 4XBBA 3HKIB 4X6PA 1MTWA 1AMHA 4AG1A 1PQ5A 2C8ZB 4YESB 3SQHE 2FLRH 5PTPA 2ZGBH 1BMFD 2UUYA 3NKKA 1TPOA 3PRDA 3PWCA 1ELEE 1ESBA 1SB1H 1PPZA 2ZU1A 3DSPA 3A82A 8LPRA 1SGRE 3PTBA 3M61U 1DY8A 2FXRA 1O36A 2EI7A 1GJAB 4Y79A 4J1YA 1C2GA 2Z3EA 1GI0A 2BOKA 1BTUA 5ETXA 2QC2A 2AIQA 1AFQC 2ZFFH 2YMSD 1J15A 1AO5A 3ZVDA 4AZ2B 1QA7A 1SI5H 1S81A 4CH8B 1BIOA 1T32A 3NZIA 2FEQH 5DP6A 4MPWA 4ZKOU 5DP8A 1ZJDA 1BRUP 3MQKC 3L3TA 2AS9A 4I8HA 5C17A 4TWYA 1IQNA 3E6PH 1GHZA 3N7DA 4CRAA 1ETSH 4RKJB 4TWWA 3R3GB 4A1TA 2QXIA 5ABWA 3TK9A 1ACBE 2ZU4A 5L30H 4NSYA 1DSUA 2AMPA 3BTFE 4FUBA 1NC6A 1CGHA 1C2JA 1ORFA 1QBVH 3HATH 2F9PA 2PSXA 3AASA 2XCFA 2HWLB 3ZVCA 4P02A 4AB8A 2HALA 4MDSA 3CENA 3KQ5A 1PYTC 1QB1A 4WY3A 3FZZA 2GDEH 4FUFA 4D9RA 4RT0A 1DDJA 3P6ZB 5JBBS 5F8TA 4XBCA 1V2WT 3VGCC 2PSYA 1Y5UT 3LU9B 1SGFA 3BTHE 3IITA 1N8OC 3IG6B 1IHTH 2CN0H 2J38A 2BLQA 1W0JD 4KTCA 2HGTH 2IJOB 5KEDA 1FQ3A 1FONA 5B6LA 4LOYH 1NN6A 1TA6A 1T8NA 2ZDVH 2ZQ1A 5EQRA 3RXLA 3H09A 4A1XA 1DUAA 1C4V2 4B73A 1ID5H 4GCHG 3F9EA 1V2NT 3STIA 1O2XA 1SQAA 1T31A 4AG2A 3F2FA 4ISNA 1DANH 1ETTH 2ZU3A 4B2BA 3MOCA 3TLOA 1IQHA 1QURH 1P9UA 1V3XA 1BHXB 2FTMA 5EQSA 2ZI2H 3OU0A 4X1QU 4O97A 1SVPA 3BF6H 2BDAA 1NRPH 3A89A 1DWBH 2SNVA 4MTBA 1C5WB 3VB4A 2YOLA 2Q6DA 1KTSB 3VGCB 1W11U 1C2MA 4Y7AA 3SGBE 1HAVA 2IPQX 3BTTE 1N8OB 2OD3B 2BVRH 1FAKH 1RXPA 1O2UA 1GCTC 1UTQA 2R3YA 2WHXA 2EQNA 1IQIA 1SGQE 2F9OA 2ZTYA 1C5LH 5T1VA 3F9HA 1BJUA 2AHME 3FKSD 1PPGE 1C1OA 2C93B 1TABE 2ASUB 2VJ1A 2ZGXH 3M7UA 3M7TA 2A7HA 2V35A 2A2XH 1MKWK 1J17T 1SOZA 5JYIA 1MTUA 1WCZA 2ANKH 3DT0H 4IN1A 3TH4H 5A8YA 1GI1A 2L6OA 5FL7D 1EX3A 1GI8B 2SGFE 1BMNH 2VNTA 3OSYA 2BVSH 3SO3A 1O39A 3N7OA 3ZIAD 5IDKA 1MBMA 1E34B 2BZAA 3PMJA 2GT7A 4E06H 3OY5U 2QIQA 2KCOA 1YP9A 4X0WU 4RSPA 3GY4A 3P70B 2OBOA 4KTSA 3E16B 4BANB 3QK1A 1BBRK 1RIWC 1JIRA 2FLBH 2QF3A 2ZGHA 1LPZB 3EE7A 1TQ7B 1ZJKA 4CR9A 2PGQB 3WWFA 3GICB 4H6SB 4GCHF 1SGPE 3BG4C 1HAOH 4AFZA 2Z9LA 3KQBA 3MYWA 1CSOE 4FVBA 3ZV9A 2A2QH 2PW8H 1KXCA 3RC4A 2VIQA 3GY2A 4WF8A 3RXAA 1RGQA 2Z3DA 3GCOA 2Q1JA 2ZNKH 5L2ZH 4DG4A 1OWJA 3PLBA 3LGIA 2J97A 1V6DA 2O8TA 3KYGA 4UD9H 1TPPA 4CRDA 4I7YH 2LP6A 2F4LA 2J4IA 1UJ1A 2ODYB 1O3FA 1DLEA 1NFUA 5DSFA 1C5NH 1O2PA 3ZZCA 4YT7H 2ZHQH 5CHAC 4GUXA 1O2KA 2ANWA 1ANEA 2HNTF 2QYIA 2XCNA 1GBTA 1NU9A 3UR9A 1YPEH 2R9PA 4K8BA 4CR5A 2VIPA 4Y8XA 1ZMNA 5J4SA 3F0PA 4B2CA 2VGCC 4YOJA 1EASA 1MMJN 1BITA 3GCNA 2XBXA 2JKHA 1SBWA 1SPJA 2EY4C 2FOFA 4R0IA 1V2RT 3D23A 1OPHB 4I32A 1O5CB 3RXOA 2JIZD 3LGWA 2ZCLP 3LJOA 3OEED 2AERH 1C1NA 2F43B 2G5VA 8ESTE 1AIXH 4IC5A 1BBRE 3A83A 5BPEA 1G36A 1LPGB 2W3KA 1UO6A 1V2JT 1ELTA 3K6YA 3DSOA 3SZNA 1SKYE 1NY22 2FOGA 2WZQA 1G3EA 2HLCA 1K1IA 4ZKRU 3UNQA 1BQYA 2UUJB 2NU4E 3D62A 2XC5A 1DS2E 1GJ4H 3PV5A 1H8DH 2QN5T 9ESTA 1T4UH 2FMJA 1O2NA 1C9PA 4ABHA 1KTTB 1O37A 2ZFQH 3PO1C 4MNWA 2DE8A 5EW1H 4Y0YE 4U30A 1Z8IB 4MPXA 3KN2A 2BMGB 2ZDMA 3TH2H 5AF9H 2R3UA 1YF4A 2RDLA 1N6YA 2QF0A 3BTQE 1UTOA 5C3NA 1AZZA 3VXEH 2BLOA 4AORA 5K7RA 4ISHH 1TALA 4FUEA 4AFUA 4R8TB 1HXEH 3SV2H 1ARBA 1TRYA 1G3DA 1L4ZA 1UK4A 2P16A 2KAIB 2BDGA 1TNGA 1W12U 2ESTE 3SW2B 1OYTH 1TBQH 1YPMH 1L1JA 2CGAA 3EDXB 2ULLA 4NGAH 1HAGE 3VB6A 1B0FA 1JOUB 3UFAA 1XXFA 5HIYA 4DGJA 3M5MA 1HNEE 2M2AA 2CMYA 2K1QA 1AN1E 1SGFG 2KX4A 1EOJA 1UVPA 1OSSA 4Y8ZA 2GMTC 3EAJA 2BD7A 2UWLA 3KQDA 3P8FA 1GBKA 3URCA 3PO1B 3E0PB 5AFZH 1GBMA 3C1KA 1O3NA 4OS7A 2DE9A 2IJD1 3PMHB 3T27A 1SQRA 4ZHLU 1YPGH 1MH0A 5C1YA 1MKXK 1YWUA 3P8OA 2KAIA 4YT6H 1A0HB 5C1XA 2Q6GA 1KXEA 3RM2H 1L2EA 4ISOA 2TGDA 2VVVA 1SHHB 2A4RA 5F53A 3CS7A 1SHYA 4ABGA 5ESBA 1TONA 2FP7B 1GI9B 3KHVA 2HOBA 3OFND 1YGCH 2FZZA 1ABIH 1WOFA 5C94A 3W94A 1FY4A 4K1TA 2FIRH 4I8KA 1UTMA 1O3DA 3SU1A 1DICA 1UVSH 4X1PU 3GOVB 4Z0KA 1G3BA 1O2MA 4B74A 3O8RA 4Y76A 3LC5A 3AW1A 3SV9A 3EA9A 2BX3A 3N99A 2FYQA 2P3TB 1TPSA 1O2QA 1CBWC 4J2YB 1JRTA 1GI6A 3A7ZA 3QUMP 4ZCNA 4Y7BA 3K2UA 1OP8A 1C5UA 2NU0E 2JJ2D 3K9XB 2WSSD 3SGAE 1KXAA 1BMAA 1RFNA 1BCUH 1EJAA 1ELGA 5B6OA 2GD4B 1NBME 3QGNB 4UFGH 5FCKA 1P0SH 3VFEA 3M7QA 2SGAA 1T8OA 4XRNA 3AAVA 1YPKH 3GISB 1ESAA 1UK2A 3U8TH 4TT3D 1GHWH 3MU5A 3U9AH 3OX7U 4H42U 3U28C 1HV7A 3F0OA 4K5ZA 1J14A 2UUFB 2FOCA 5C5NA 5F8XA 2ZTZA 1TGNA 1DY9A 1HJ9A 4RN6A 2SGEE 1V2MT 2OK5A 3TIUA 1C5QA 3BTKE 2I6SA 4LK4A 3M5NA 4ZKNU 1FI8A 2D2DA 1K1NA 1L1GA 1E1RD 3MH5A 3SU4A 4KP0A 5EJ1A 1JBUH 3ATKA 4JZ1A 1EB1H 2SGPE 1GI4A 2P8OC 4B1TA 3UY9A 3BSQA 1FY8E 2WPMS 1C2IA 1TQ0B 1A61H 1TYNA 1TX6A 3JZ1B 1ZRKA 2PFEA 2TRMA 2C8XB 2B0FA 1Z6EA 2NWNA 1CHGA 1L4DA 3T62A 1W0KD 4JK5A 4UFDH 4NIWA 1AE8H 4FUDA 1A7SA 1FJSA 3UQVA 1QTFA 1QL8A 2CXVA 1K0HA 2FO9A 3U8RH 2H9TH 5EGMA 1ZYOA 1BB0B 2WYGA 2R0LA 5A8ZA 4MNYA 1P03A 5TCAA 6ESTA 1W0YH 5C5OA 1J16A 1SLWB 1FY1A 3ZZ9A 3S0NA 2F3CE 2IOTA 3A7WA 4CRCA 1MQ5A 1OKXA 4DVAU 3A86A 3WY8A 2A7CA 1K1OA 1OX1A 4X8VH 4CRGA 3AVZA 1TGTA 2GZ7A 5GCHG 4B6FA 1CHOF 4WMDA 2PWXA 2K8IA 1JMOH 3MMGA 3U69H 3E0NB 2GP9B 2GV6A 3FFGA 3A7YA 3MO9A 3MHWU 1LKBA 4Q63A 2ZF0H 5GXPA 5LPRA 2I6QA 1ZSJA 1OP0A 5FPSA 5FHTA 2BDIA 1FMGA 2A45B 4MG3A 1OWKA 3IWMA 1P57B 1Z71A 1EAWA 1TNJA 3L6PA 3UOUA 3DA9B 2V7QD 1ZPZA 1NFYA 1CGJE 3A8AA 1XUKA 1Y5AT 1D3PB 3RXTA 3FP7E 1CQQA 3A8BA 2OC8A 1FN6A 3FVFB 2BD2A 1BA8B 4IW4E 3ESTA 2C3SA 4UFFH 2STBE 5EPYA 4HTCH 3ZZDA 3ATLA 2FWWA 5GDSH 4JYVH 4RKOB 2D26C 2XNIA 1C5PA 1HAHH 1SQOA 1TLDA 3SUFA 3ENSB 1O3EA 2O8WA 3EA8A 3PMAB 1A5IA 2A7JA 2OP9A 1MABB 4X6OA 4A7IB 4AGKA 4LZ1H 1ELAA 2AMDA 1XUGA 2Q6FA 1PPBH 2JJ1D 1VJAU 2GJGA 3SNEA 1P2NA 2KFWA 4GSOA 4AX9H 1AWFH 1E36B 2XW9A 3SHCH 3UTUH 5CMXH 4NIYA 2G4UA 1C5YB 2PUXB 3B9FH 3MU0A 1GBAA 1GWAA 4NIXA 4ABFA 4UE7H 2G55A 1NU7B 1HFDA 1C1QA 1GL1A 2Y6TA 3GDSA 2UUKB 2NU3E 3KGPA 2H5DA 3M36A 1HYLA 3MH4A 3F1SB 1ETRH 3U98H 1HAPH 2CF8H 1GVKB 1EAUA 1Y59T 2ZPSA 1MU8B 5F6MA 1VGCC 5E0JA 2ZECA 1V2PT 2PKSC 4HG6A 2ZQ2A 1F0RA 2YNBA 4YLQH 2PHBA 1XVMA 1P2OA 3STJA 3FP8E 3HK3B 3K65B 3CS0A 1QHRB 5HKKD 1CVWH 1UTPA 1F5LA 1A0JA 3A8CA 2O8LA 3MO6A 1A0LA 4BOHA 1O3PB 2XWAA 2ILNA 1HAZB 1EQ9A 5FX5A 2ZU2A 1C1UH 1W3CA 1XXDA 1A3BH 2A32A 1S6HA 4XDEA 1DWCH 1P09A 3RXQA 1P10A 2NU2E 2D8WA 1GJ7B 1PPFE 2J2UA 1CU1A 1TAWA 2LNCA 1D3QB 4CH2B 4Y11E 1ZHMA 3QTOH 3MU8A 1E37B 1A46H 2BYAX 2WPDD 3RXUA 1YKTA 3ZVFA 4Q2KA 3RXRA 1YPLH 2BM2A 1FLEE 1W7XH 1KLTA 1BTZA 1YCPM 4NA8A 4XBDA 3ZV8A 1MD7A 1OWEA 2F9NA 1C4Y2 1G9IE 1AFQB 4ACBA 2QY0B 3O8DA 1XUFA 2LPRA 1SSXA 1QB9A 4NZLA 4Q7ZA 3QX5H 5HM9A 1DSTA 4AB9A 2FPZA 1P12E 3KCGH 1LO6A 4JZFH 1PFXC 2RA3A 1A4WH 3ZZ4A 1CA0C 4Y71A 1SFIA 2W6JD 4K8YA 2FOEA 3MO3A 2Y80A 2FS9A 1EP6A 1MZAA 3RC5A 4MNXA 8KME2 1KXDA 3DCLA 1F0TA 1UCYK 4AGJA 3UWJH 4E05H 3GDUA 3M35A 2W26A 3TGJE 4DY7B 1QFKH 2JETC 2OC1A 2BZ6H 4HFPB 1P3EA 3A80A 1QNJA 1TNIA 4OGXA 1MD8A 2J94A 1SGNE 2TGTA 3SUDA 1O3JA 1XUJA 2JH5D 2ZP0H 2J92A 4IMZA 3SUGA 3TK6A 2P95A 1U6QA 3ITIA 4I8JA 1HCGA 1THRH 2FESH 3MNBA 4ABEA 1VCWA 1RD3B 1C5XB 2RG3A 3QZRA 2Z7FE 2RDEA 3E1XB 3PB1E 4AN7A 2KCPA 1EP5A 3M3VA 1YCPK 1BZXE 1VITH 1BJVA 3QO6A 4WWYA 2ZC9H 2P59A 3G01A 3OTPA 1W0ZU 1VR1H 2GGVB 1QB6A 3VEQB 1ZGVA 2BQ7B 1OS8A 1UMAH 2TIOA 1MUEB 1DPOA 2CV3A 2VIOA 2FX6A 1XVOA 3ZYEA 3RXFA 3MH7A 3ZZAA 2Z9GA 2O8MA 5FBIA 1QIXB 3SV8A 3TJOA 1S82A 4UONA 4BTUB 1OP2A 2ZHWH 1YPHE 4ISLA 2FODA 1NROH 3UREA 2PR3A 1GMCF 3T29A 4DCDA 2HVYB 3LGVA 2A4OA 3TPIZ 1UCYE 1WV7H 1A3EH 2GDDA 1D6WA 2WV4A 1H9HE 3SU2A 1GBCA 1YPJH 2BLVA 4I33A 3SHAH 1ZR0A 3E8LA 2P94A 3QZQA 3GY7A 4ABAA 1QGFA 2FM2A 1DXPA 2VH0A 1LVOA 1S85A 4GVUA 3N7EA 4ASHA 3OYPA 1QQ4A 1GJBB 1SQTA 3SI3H 1COWD 1WYKA 5GPIB 1GCTB 1RTFB 3RXPA 3PV4A 5FX6A 2H5CA 4Q80A 4ZHAA 1GBIA 1GVZA 2BOHB 2VWNA 5HGGA 1WAYB 1Z8GA 2J98B 3V0XA 1GMDG 1BT7A 1LVBA 1Y3XA 3LT3A 1Z1IA 1IQJA 1ZTJA 3TJUA 1DXWA 1G2MA 4XSKU 3GY3A 4Q7YA 2R2WU 5KECA 2Y5FA 2Y7XA 2H9HA 4KKDA 5EODA 2QGRA 4WMEA 1ZTKA 2GX4A 1EZQA 3VB5A 5A2MH 1TGSZ 2W3IA 3PTNA 4JZIA 1THPB 2VVUA 2ZFTA 1O3GA 5KGOA 1SGYE 5E2PA 2GT8A 1BUIA 4BTIB 4TSFD 1RIWB 1RJXB 2GKVE 1NRSH 2O8UA 1B7XB 1WTHD 2PLXA 5HIZA 5HMAA 1NBMD 1H9LB 1K22H 2VWMA 4FUHA 2A5IA 3BG4B 3DUXH 2J98A 1GHBF 3T26A 2V0BA 1MKWH 4JK6A 4MPUA 3KQCA 1MTVA 1FX0B 4Y10E 4D9QA 4HZHA 2G52A 2TBSA 1D9IA 4ASUD 1C4U2 2OQ5A 4DURA 1HB0B 4O03A 3PMBB 4NA7A 1AQ7A 2AGGX 1V2KT 5TJXA 3SV6A 4CRFA 2J95A 4ZROA 2CHAC 4QT8C 3LONA 2W5EA 3HK6B 5HM2A 2Z9JA 2YMSC 4DW2U 3FP6E 4YZUA 5CHAB 1SGEE 1YLNA 1W8BH 1BBRH 2AGIX 2OUAA 5DP9A 3DSGA 2ALPA 1MBQA 1W10U 5LPFA 1QA0A 2VGCB 4U2WA 1AFEH 2XTTB 2Z94A 3D49H 2GCHF 1GMDF 2H6MA 4GPGA 1EPTC 4AC9A 5AFYH 5EJLA 2THFB 1EJMA 2PKAB 1LQEA 3QWCH 1BRAA 3Q3KA 3ZVEA 4AFQA 4A1VA 3M5OA 2K0QA 5FXLA 2P3UB 1O2WA 4OS1A 1AVWA 1XKBC 2QXJA 1O3LA 3VG8A 1EZSC 1GHVH 1GBFA 4YXWD 4CBOA 1TPAE 3NWUA 3QGJA 1O31A 2PP6A 3KYFA 5EW2H 2ANYA 4K69A 4CHAC 2BXUH 4SGBE 2G4TA 4X6NA 3D65E 1HAIH 2BQ6B 1TB6H 2KCAA 3Q76A 1P3CA 1FPHH 2FOMB 5F8ZA 5C2ZA 4ZAEA 1BTHH 4JMYA 4TPIZ 1EPTB 4FUJA 2ZIQH 2XBVA 4HGCA 1BTPA 1L0ZA 4DT4A 1CE5A 1CT2E 1IQKA 3OTJE 1AU8A 2VIWA 1GHYH 2ZKSA 1GGDC 2W7UA 3QN7A 3A8DA 3BTEE 3I29A 2L74A 3LOXA 2W6ID 2RA0A 1GBDA 1WUNH 1MTNC 1O2JA 1FZZA 1D3DB 3TNSA 2XBWA 1RRKA 3S7KB 1P9SA 1EZXC 2KM0A 4CHAB 1HJ8A 4NIVA 2ZU5A 1O2VA 1GJ9B 1DX5M 1GI7B 3AW0A 3RXBA 1QL7A 2GMTB 3GY5A 1WDIA 2PUQH 1C1WH 1G37A 2HNTE 4B71A 5EXMA 3PROA 3PV2A 3RXCA 1HXFH 1FAXA 3GY6A 4X6MA 1S6LA 3M37A 1W13U 1S0RA 2A4GA 3Q77A 1O3MA 8GCHG 1SL3A 5EJZA 1NZQH 4ABJA 3M3SA 1MZDA 1SC8U 4H4FA 2BB4A 3F9GA 4X8SH 2BY6X 2M5TA 3MH6A 1G30B 1HRTH 2PV9B 1LHDH 1O0DH 1ZMLA 1O2TA 5DPAA 4DJZB 3HPTB 1ELCA 3SJIA 1GBLA 3TGIE 1IQGA 2PTNA 3LGUA 1GBHA 4Y0ZE 1N1LA 1E1QD 1GBJA 3O8BA 1GHXH 7LPRA 5LGOA 1AGJA 1CHOG 1SGTA 2ANMH 1MQ6A 1PQ7A 1G3CA 3MNCA 2ZHFH 3DD2H 1GBBA 4X2WA 1OWHA 3F68H 2XC4A 1F7ZA 2ZTXA 2VH6A 5J4QA 4X8UH 1O34A 1UK3A 4B6EA 3FOAA 2OXSA 1P01A 5A0BA 1BRCE 4XD7D 1CBWB 2OQUA 1TGBA 1GI5A 1UTKA 5I46H 4ZUHA 2BHGA 4BTTB 1VZQH 2VWLA 1HIAB 1QQUA 7ESTE 3LH3A 2IPHA 5ESTE 4HI3A 1PYTD 1ELDE 1S6FA 4K3JA 2KCYA 2RFKC 1P02A 3URDA 5EOKA 1TA2A 1HJAC 2EI8A 3GCTF 4GLYA 1AWHB 1LMWB 1P2IA 4FUGA 1P2QA 4TPYA 1VCPA 8GCHF 1GCDA 2B5TB 5E0HA 2ZHEH 1HDTH 1Y3VA 3F9FA 1AUTC 3SU3A 3SGQE 1BTXA 1FNIA 1O2ZA 1F2SE 1ZZZA 3EE0B 2BTCE 2F9UA 1MAYA 1HIAA 1LHCH 2ODQA 4A6LA 2OBQA 2WPLS 4IC6A 1GDNA 3LJJA 3WWBA 3LIWA 1GJ6A 3LGYA 2P8OB 1ANCA 2FOAA 2ZDNA 1LCYA 4YOGA 3PLKA 1LQDB 4K60A 5A0CA 5HYOA 1EXFA 2EI6A 3GCHC 1V2ST 2BD9A 4X8TH 1SMFE 4X1RU 1V2OT 4BNRA 1H4WA 1MTSA 1SR5C 2FI4E 1AE5A 2ZGCA 1GJ5H 1WBGB 4NG9H 1LHEH 1QL9A 4OGYA 1QCPA 1QR3E 5BRRE 1E38B 2OCVB 1OXGA 3RC6A 2ZHDA 3F6UH 3UOPA 4INLA 3UAIC 1UTLM 3ZVAA 4TYDA 3NUMA 1AB9C 2VVCA 1ZHRA 1Y3WA 3ZZ8A 1C5VA 3SI4H 4JCNA 1A5GH 1TRNA 2ZDKA 3V7TA 3GDVA 1YLDA 3UR6A 1IHSH 4O3TA 1UHBB 5JPMH 1BOQA 1Z8RA 5K0HA 3ZYDA 2FX4A 5HXFA 1K28D 1GI2A 1CGIE 4F4OC 2ZGJA 1UVOA 3SV7A 1H8HD 2ZCHP 1AKSB 4YTAA 3GCHB 2EC9H 2J34A 5T3HA 1EOLA 3TH3H 3NRLA 3SUEA 1K1LA 3RXSA 1HLTH 4B2AA 1J9CH 1C5RA 1V2UT 4BAHB 3GYMA 1FN8A 4MPVA 1CO7E 2P93A 4O3UA 4ABIA 3S9BA 4ESTE 1NESE 1V2LT 2F9VA 1VITF 4I31A 3TU7H 1ANDA 2C90B 3NPSA 2BVXH 3A88A 2OLGA 4FUCA 1H8IH 1GI3A 4INKA 3MI4A 1KLJH 1UHBA 2UWPA 1XX9A 2Z6BD 1GPZA 2RCEA 4UEHH 3UWIA 3U8OH 1TNKA 1AKSA 1NFWA 1O2YA 1A5HA 3SNAA 4AFSA 4IS5A 1QJ7B 3SU6A 1YYY1 2TGPZ 1KSNA 1GBEA 1O5DH 4YOIA 3RLYH 5JB9S 4NA9H 1NT1A 1O33A 2OC7A 3SQEE 5JBTA 1E79D 3F3BA 4U32A 5CE1A 2LELA 1KXBA 2WUCA 3B8JA 4DT7B 5EU8A 4LXBH 5LPEA 4BXSA 5DP5A 1BMLA 1V2QT 1Y8TA 2WUBA 1C5OH 1S84A 5GWZA 2ZWLH 5A0AE 3EYDA 5DJ7A 3QTVH 1O3CA 2B8OH 4FU8A 1GJDB 3P17H 2VIDA 3EQ0H 4F49A 1PPHE 3PWBA 1HAYB 4XOJA 2BY7X 2HPPH 1K1JA 4X2XA 2QF5A 3V13A 1X7AC 1YM0A 1EUFA 3K6ZA 5E0GA 3RXHA 1GVLA 1KLIH 4WH8A 1ZHPA 2BDYA 7GCHF 1TOMH 1MAXA 1VJ9U 5H4IB 3ZZ7A 1O2GH 1N6XA 1Y3UA 1RTLA 2FYRA 3RXJA 1WTGH 1TNLA 4NCYA 2WV5A 4KGAA 4WH6A 1VGCB 2F83A 1O38A 4XFQA 3EGKH 2ZDLA 3ZZBA 2PKSB 1YY3A 3BTDE 4FOUC 3W1EA 2WPIS 3A7TA 3BG8A 4Q7XA 1FIZA 3ODFA 1V2TT 4FXGH 3BV9B 4JZDH 1HAXB 5DP7A 1WQSA 5EQQA 1K21H 1GMCG 4X2YA 1CT0E 5C67A 1O3KA 1TRMA 2FI3E 4RT1A 2BQWB 4X1NU 3VB3A 5A8XA 2Z9KA 1IQFA 3H7OA 4OM9A 1ZLRA 1JWTA 3KL6A 1C5MD 5JB8S 1IQLA 3ATIA 3SZEA 5FCRA 4SGAE 1FPCH 1P04A 2V3MA 1RS0A 2KR7A 3KIDU 2ZO3H 1LHGH 1Y5BT 6LPRA 1PPCE 3RMMH 1ZRBA 3TNTA 3UB0A 5E8EH 1OWDA 1GDUA 1EKBB 1HAVB 1BRBE 2O9QA 1H1BA 1TNHA 2QF4A 2VBCA 2P3FH 1O2HA 4BAKB 4BAOB 5T6GA 3UNSA 4X1SU 2CJIA 2XWBI 3AAUA 2BD3A 2UWOA 5EG4A 1NRQH 3BTWE 1W14U 3ZZ3A 3MU4A 3MTYA 4FU9A 4WVPE 1O2LA 3H7TA 2QXGA 3E3TA 1TIOA 4K1SA 4UDWH 4D7GA 1LVMA 2TGAA 1OYQA 1WU1A 1CA0B 1QRXA 2EA3A 5C0UA 3S9AA 1Z8JB 2R0KA 3C27B 4B75A 1KY9A 1AI8H 4Z6AH 5C1UA 1IAUA 1XM1A 4WMFA 2OTVA 3O8CA 3LH1A 5CHBA 2FS8A 3RXKA 2JETB 4PROA 3PRBA 3RXMA 3RM0H 3GY8A 5EIYA 3BN9A 1B0EA 4ZXXH 2TPIZ 1K9OE 1GHBG 2A31A 3ODDA 2B9LA 3RU4D 3UQOA 1ARCA 4YLUA 1NS3A 1JXPA 2Y81A 1F92A 3V3MA 1DM4B 2H1UA 2G51A 1WQVH 1P2MA 1K1PA 3BIVH 1NFXA 2HPQH 1BTYA 3E91A 3HGPA 3SYJA 2ZCKP 2JH0D 3VPKA 5JBCS 4GAWA 1UW7A 1C1TA 5L2YH 5JBAS 1O2IA 2XRCA 3U1JB 1H8ED 1UCYH 5EXNA 1C2FA 5AVDA 4ZKSU 2A4QA 1C1PA 1K1MA 1TE0A 4NFFA 2GCHG 2GVFA 1Q31A 3Q3YA 5FBEA 1P06A 2SGDE 3F2HA 3TJNA 1SLUB 1TFXA 1NRRH 2ZPRA 1XUIA 5FAHA 1RTKA 1C1MA
chains in the Genus database with same CATH topology
4A1TA 3SV9A 1FX0B 2QV1A 4FETA 1OHHD 3N99A 2KR7A 2K8IA 3ZIAD 2P59A 3N7DA 5IDKA 4ASUD 3OTPA 2XOKD 3SU0A 4Z1MD 2GGVB 5FPYA 3SU5A 2KM0A 3SU3A 3KN2A 3KF2A 3UB0A 4Q63A 2KZ4A 4ZCNA 2KCOA 3SV6A 5HKKD 2JJ2D 3LONA 2OBOA 2WSSD 2F9UA 2XCFA 4M9FA 2QF4A 2YMSC 5FPSA 2VBCA 4B71A 3SU6A 2O8MA 1NBME 2OBQA 4R8TB 3SV8A 3F2GA 5IK2D 3GS9A 3E90B 3PV2A 1W3CA 3WWFA 3WWBA 2OC7A 3P8NA 2JDID 3L6PA 1E79D 1S6LA 2OC0A 2V7QD 3KNXA 4F55A 1KMHB 3F3BA 2LELA 3KEEA 3RC4A 2A4GA 3WW7A 4WF8A 5EPNA 3FN8A 1RGQA 5C0UA 2HLDD 4TT3D 1CU1A 2J5UA 3SU2A 1W0JD 4KTCA 4B75A 3M5MA 4B76A 3EYDA 3U1IB 2IJOB 2OC8A 2XNDD 2M2AA 3F0OA 2K1QA 4I33A 2F4LA 2WPDD 5B6LA 3O8CA 1DY9A 5DSFA 5EPYA 2FM2A 1DXPA 2QE7D 4Q4LA 2OK5A 5CHBA 4A1VA 5DN6D 3PRBA 3OEHD 3N7EA 2CK3D 3M5OA 3OYPA 2QF5A 2K0QA 3M5NA 4RI0A 5EQRA 1COWD 5GPIB 4A1XA 3H09A 2XNIA 1E1RD 4B73A 3SUFA 4WH8A 3O8DA 3RC6A 2IJD1 3SU4A 1N1LA 2XCNA 1E1QD 1NS3A 3O8BA 1JXPA 5GNDA 3VG8A 4K8BA 3F2FA 4YXWD 4TYDA 3F0PA 5H4IB 4A92A 1MABB 3P8OA 3OE7D 1WXRA 1BT7A 1RTLA 3FO8D 2JJ1D 2W6JD 5EQSA 1DXWA 1BMFD 2OINA 2KFWA 3PRDA 3SYJA 4I32A 3RC5A 4WH6A 5C0TA 2JIZD 5FPTA 3DCLA 2YOLA 2A4RA 1W0KD 3LKWA 4B6EA 3FOAA 2KCAA 5F53A 3OEED 3M5LA 3DSPA 5ESBA 2FOMB 5GJ4B 3W1EA 2F43B 1A1RA 2FP7B 3U1JB 5CDFE 2OC1A 1DY8A 1H8ED 4XD7D 4JMYA 1H8HD 3SV7A 3OFND 3AK5A 5ETXA 2A4QA 3NRLA 3SUEA 5EQQA 2WHXA 2YMSD 4NWLA 4U01A 3DSOA 1EFRD 3SUDA 4TSFD 1SKYE 4DT4A 2YMSB 2GVFA 2WZQA 3SUGA 5T1VA 3OAAD 2AHME 3FKSD 4OM9A 2KCYA 3F2HA 2F9VA 1NBMD 3SU1A 4NWKA 4I31A 5C17A 4B74A 2KCPA 3O8RA 2L6OA 3PV5A 3SZEA 5FL7D 3LOXA 2W6ID 2WV9A 4B6FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KM0 A;  3N7E A;  3DSO A;  2K0Q A;  2LEL A;  3N7D A;  3DSP A; 
#chains in the Genus database with same CATH topology
 3UUZ A;  1O3H A;  3S69 A;  1C2D A;  7KME H;  2QCY A;  1YCP H;  1NTP A;  4IGD A;  1YPH C;  2ZG0 H;  1TX8 A;  2ZEB A;  3Q3X A;  1L1N A;  3NCL A;  4OS4 A;  2BDH A;  3KF2 A;  3B23 B;  3VXF H;  4JYU H;  4D76 A;  3ELA H;  1TMT H;  1YBW A;  2VIN A;  4CRE A;  1GG6 C;  2ZDA H;  2ZFP H;  1C2H A;  2H2Z A;  4JYT A;  5F03 A;  3RXI A;  1P2K A;  5T6D A;  5IK2 D;  1Z1J A;  4DII H;  4CRB A;  1DE7 H;  4FU7 A;  5EXL A;  3DFJ A;  3GYL B;  1D6R A;  1S83 A;  4FVD A;  1C1S A;  2IN2 A;  2G5N A;  3SJO A;  2GV7 A;  5EPN A;  1SGI B;  3FN8 A;  2VWO A;  4WXV A;  3ZVG A;  3RMN H;  4ZMA H;  3T25 A;  3P8G A;  2FTL E;  3U1I B;  1DUE A;  2F9B H;  3RDZ A;  1Z7K A;  1YLC A;  1OWI A;  1EAT A;  4NZQ A;  4X2V A;  5DO4 H;  1P11 E;  4H6T A;  5T6F A;  4M7G A;  5DN6 D;  2YNA A;  1O3A A;  1THS H;  2B7D H;  4TY6 A;  4RI0 A;  3RMO H;  2Y7Z A;  1O2R A;  1LKA A;  1F5R A;  2BY9 X;  4VGC C;  5IYT A;  1S5S A;  2PTC E;  3SBK A;  2BY5 X;  1O2S A;  1AVG H;  1GG6 B;  4A92 A;  2Z9I A;  3FO8 D;  1ZSL A;  3A7X A;  3PM3 A;  2XC0 A;  9LPR A;  1ANB A;  1HGT H;  1FIW A;  2XYA A;  4K1E A;  1IQM A;  3QDZ B;  1SGC A;  5DGJ A;  3RML H;  1H9I E;  2GTB A;  3A87 A;  4P00 A;  3VB7 A;  2C8W B;  2Y5H A;  2SFA A;  5C20 A;  2CF9 H;  1PPE E;  1Y3Y A;  3CNR A;  1FUJ A;  2CHA B;  3UIR A;  1O32 A;  3CP7 A;  2DUC A;  2YMS B;  1ZPB A;  1JIM A;  3OAA D;  3LDX H;  1TBR H;  2WIN I;  3MWI U;  4E7R G;  4I86 A;  4VGC B;  1CA8 B;  5AHG H;  1QY6 A;  2G00 A;  2PKA A;  2F91 A;  2QAA A;  2QV1 A;  1ZTL A;  1AHT H;  3I78 A;  3RP2 A;  1F0S A;  1XUH A;  2A5K A;  2XOK D;  1O2O A;  5FPY A;  1VCQ A;  3RU4 E;  4I8G A;  1SGD E;  2D1J A;  3A7V A;  5DK1 A;  2NU1 E;  2GCT C;  1DIT H;  2J9N A;  4TY7 A;  3HKJ B;  1NM6 A;  1K2I 1;  2AFQ B;  4KEL A;  4ACA A;  1DT2 A;  1DLK B;  1SOT A;  4NSV A;  3RXE A;  3BEF B;  4UFE H;  4AOQ A;  2JDI D;  4F55 A;  1TWX B;  2OC0 A;  1MCT A;  1SFQ B;  4BXW A;  1NO9 H;  1M9U A;  3JZ2 B;  1SLX B;  1T8L A;  1C2L A;  2G8T A;  1SLV B;  1EAI A;  2ZZU H;  1PJP A;  4BAQ B;  1EPT A;  1KIG H;  2FDA A;  2AYW A;  3SNB A;  4ZXY H;  2V3O H;  1E35 B;  1TOC B;  4KTU A;  1BDA A;  1P2J A;  3FAO A;  1C9T A;  2Y82 A;  3GCT G;  1AZ8 A;  2V3H H;  2GCT B;  2AEI H;  1T8M A;  2ODP A;  4ZHM U;  4D7F A;  3EA7 A;  4YO9 A;  2BD8 A;  3OE7 D;  3KQE A;  4IN2 A;  2HVX A;  4WXI A;  4JZE H;  3BTG E;  1GGD B;  2W7S A;  1F0U A;  1O30 A;  3BEU A;  5C0T A;  4ABB A;  6GCH G;  2R2M B;  3PLP A;  1O5E H;  5FPT A;  2BY8 X;  1MTN B;  3LKW A;  4AYV B;  2A0Q B;  2AMQ A;  3ATM A;  3L33 A;  3LGT A;  1OOK B;  3S7H B;  1A1R A;  3SNC A;  2A1D B;  1EB2 A;  4XE4 A;  4A5T S;  3P95 A;  3TVJ B;  1TX7 A;  1TBZ H;  6CHA C;  2BDC A;  4U01 A;  4NWL A;  1KDQ B;  2WYJ A;  1G2L A;  3NK8 A;  3W95 A;  1C1V H;  1HUT H;  1C2E A;  4CBN A;  5A09 A;  1MKX H;  4OS5 A;  3H5C B;  2HNT C;  3SOS A;  1IOE A;  1ZGI A;  3UPE A;  1V2V T;  1YC0 A;  1EJN A;  4INH A;  1OHH D;  1BTW A;  2WPJ S;  2AH4 X;  4Z1M D;  3SU5 A;  2ALV A;  1QZ8 A;  3SND A;  3SJK A;  3SOR A;  1W7G H;  2BLW A;  1LHF H;  3I77 A;  1C5T A;  2FOH A;  3ATW A;  2BDB A;  4M9F A;  1O5B B;  3TIT A;  1KDQ A;  3RXV A;  1O5A B;  1LDT T;  3MNX A;  1UVU H;  5DG6 A;  2G81 E;  2BD5 A;  1NRN H;  1AVX A;  1DOJ A;  1LVY A;  1P8V C;  3GS9 A;  3E90 B;  3DHK H;  4GHT A;  4WJG 2;  4Y6D A;  4Y8Y A;  6CHA B;  1VKY A;  3QLP H;  3P8N A;  1EST A;  3ZVB A;  4YM9 A;  3HGN A;  3KEE A;  3T2N A;  1PQ8 A;  4K2Y A;  4FUI A;  1MU6 B;  1BMM H;  1G32 B;  3MU1 A;  4ISI H;  2J5U A;  1O5F H;  2VIV A;  4D8N A;  1C5S A;  1C2K A;  6GCH F;  4O9V A;  2QXH A;  1ZPC A;  1E0F D;  1FY5 A;  1TMU H;  4Q4L A;  1ZMJ A;  4THN H;  1VIT G;  1LPK B;  1GMH G;  2C4F H;  1QBO A;  3Q00 A;  3BIU H;  1GHA G;  1FDP A;  1SG8 B;  1Z6J H;  1BHX F;  1QJ1 B;  1GDQ A;  1F5K U;  1O3I A;  3ZZ6 A;  1TGC A;  2AIP A;  1QJ6 B;  5SGA E;  1O35 A;  3LPR A;  3M3T A;  3ZZ5 A;  1HBT H;  1WXR A;  2Z3C A;  5DKM A;  3BTM E;  1ELV A;  5DP3 A;  1XKA C;  2SGQ E;  1HJA B;  1PQA A;  2OIN A;  2ZA5 A;  4MLF B;  4AYY B;  1FV9 A;  3RXD A;  1P05 A;  2V6N A;  2VB0 A;  4GHQ A;  2SNW A;  1QBN A;  1UVT H;  2H9E H;  1UTN A;  3M5L A;  5GJ4 B;  5CDF E;  2BX4 A;  3RLW H;  1DFP A;  1KYN A;  5DP4 A;  3AK5 A;  3SJ8 A;  2FOB A;  1D3T B;  1AD8 H;  4ABD A;  1Q3X A;  1NPM A;  1IQE A;  1EFR D;  4IBL H;  1QRW A;  5G4B A;  1ELF A;  2C8Y B;  1T4V H;  5L6N H;  3LC3 A;  1AY6 H;  3V12 A;  4NWK A;  3TGK E;  3A81 A;  2WPH S;  3PYH A;  1O5G H;  5I25 A;  2XBY A;  2BXT H;  4I8L A;  2VU8 E;  2WV9 A;  3A85 A;  1FY3 A;  4FET A;  1S0Q A;  5E2O A;  3FAN A;  1KXF A;  4DIH H;  3R0F A;  4LZ4 B;  1LTO A;  3SU0 A;  1ELB A;  4OS6 A;  4BAM B;  1AUJ A;  1C5Z B;  1GJ8 B;  2HRV A;  4MVN A;  7GCH G;  2KZ4 A;  4F48 B;  3OY6 U;  1Q2W A;  1B5G H;  3BEI B;  1WSS H;  3SN8 A;  1XMN B;  1A2C H;  3UNR A;  1ABJ H;  1INC A;  2QA9 E;  2ZPQ A;  4IMQ A;  4MQA A;  2BD4 A;  1GMH F;  2Y5G A;  1EZU C;  1GHA F;  3F2G A;  2AGE X;  2XXL A;  2JH6 D;  1MCV A;  3TK5 A;  5TCC A;  1QRZ A;  4ZH8 A;  3P92 A;  2ZFS A;  3KNX A;  1DWD H;  1KMH B;  1AB9 B;  1T7C A;  3WW7 A;  3MNS A;  2GZ8 A;  3RXG A;  4OS2 A;  2A5A A;  1ZOM A;  2HLD D;  1TMB H;  3RUO A;  4E7N A;  2STA E;  1D4P B;  4NFE A;  5GIB A;  3RU4 T;  1UTJ A;  3T5F H;  1DWE H;  1CT4 E;  1ZSK A;  4B76 A;  3SJ9 A;  1GJC B;  2FI5 E;  2XND D;  1HPG A;  1EAX A;  2PGB B;  3NXP A;  2QE7 D;  4MNV A;  5GCH F;  1GL0 E;  4DOQ A;  3FZD A;  3OEH D;  1J8A A;  2CK3 D;  3A84 A;  1W2K H;  1O3B A;  3DFL A;  3S9C A;  1DVA H;  5JDU B;  2EEK A;  2WPK S;  3TJV A;  1C1R A;  5LH8 A;  5GND A;  1O3O A;  2GZ9 A;  2ZFR H;  1JRS A;  1FXY A;  3MFJ A;  3T28 A;  4XBB A;  3HKI B;  4X6P A;  1MTW A;  1AMH A;  4AG1 A;  1PQ5 A;  2C8Z B;  4YES B;  3SQH E;  2FLR H;  5PTP A;  2ZGB H;  1BMF D;  2UUY A;  3NKK A;  1TPO A;  3PRD A;  3PWC A;  1ELE E;  1ESB A;  1SB1 H;  1PPZ A;  2ZU1 A;  3DSP A;  3A82 A;  8LPR A;  1SGR E;  3PTB A;  3M61 U;  1DY8 A;  2FXR A;  1O36 A;  2EI7 A;  1GJA B;  4Y79 A;  4J1Y A;  1C2G A;  2Z3E A;  1GI0 A;  2BOK A;  1BTU A;  5ETX A;  2QC2 A;  2AIQ A;  1AFQ C;  2ZFF H;  2YMS D;  1J15 A;  1AO5 A;  3ZVD A;  4AZ2 B;  1QA7 A;  1SI5 H;  1S81 A;  4CH8 B;  1BIO A;  1T32 A;  3NZI A;  2FEQ H;  5DP6 A;  4MPW A;  4ZKO U;  5DP8 A;  1ZJD A;  1BRU P;  3MQK C;  3L3T A;  2AS9 A;  4I8H A;  5C17 A;  4TWY A;  1IQN A;  3E6P H;  1GHZ A;  3N7D A;  4CRA A;  1ETS H;  4RKJ B;  4TWW A;  3R3G B;  4A1T A;  2QXI A;  5ABW A;  3TK9 A;  1ACB E;  2ZU4 A;  5L30 H;  4NSY A;  1DSU A;  2AMP A;  3BTF E;  4FUB A;  1NC6 A;  1CGH A;  1C2J A;  1ORF A;  1QBV H;  3HAT H;  2F9P A;  2PSX A;  3AAS A;  2XCF A;  2HWL B;  3ZVC A;  4P02 A;  4AB8 A;  2HAL A;  4MDS A;  3CEN A;  3KQ5 A;  1PYT C;  1QB1 A;  4WY3 A;  3FZZ A;  2GDE H;  4FUF A;  4D9R A;  4RT0 A;  1DDJ A;  3P6Z B;  5JBB S;  5F8T A;  4XBC A;  1V2W T;  3VGC C;  2PSY A;  1Y5U T;  3LU9 B;  1SGF A;  3BTH E;  3IIT A;  1N8O C;  3IG6 B;  1IHT H;  2CN0 H;  2J38 A;  2BLQ A;  1W0J D;  4KTC A;  2HGT H;  2IJO B;  5KED A;  1FQ3 A;  1FON A;  5B6L A;  4LOY H;  1NN6 A;  1TA6 A;  1T8N A;  2ZDV H;  2ZQ1 A;  5EQR A;  3RXL A;  3H09 A;  4A1X A;  1DUA A;  1C4V 2;  4B73 A;  1ID5 H;  4GCH G;  3F9E A;  1V2N T;  3STI A;  1O2X A;  1SQA A;  1T31 A;  4AG2 A;  3F2F A;  4ISN A;  1DAN H;  1ETT H;  2ZU3 A;  4B2B A;  3MOC A;  3TLO A;  1IQH A;  1QUR H;  1P9U A;  1V3X A;  1BHX B;  2FTM A;  5EQS A;  2ZI2 H;  3OU0 A;  4X1Q U;  4O97 A;  1SVP A;  3BF6 H;  2BDA A;  1NRP H;  3A89 A;  1DWB H;  2SNV A;  4MTB A;  1C5W B;  3VB4 A;  2YOL A;  2Q6D A;  1KTS B;  3VGC B;  1W11 U;  1C2M A;  4Y7A A;  3SGB E;  1HAV A;  2IPQ X;  3BTT E;  1N8O B;  2OD3 B;  2BVR H;  1FAK H;  1RXP A;  1O2U A;  1GCT C;  1UTQ A;  2R3Y A;  2WHX A;  2EQN A;  1IQI A;  1SGQ E;  2F9O A;  2ZTY A;  1C5L H;  5T1V A;  3F9H A;  1BJU A;  2AHM E;  3FKS D;  1PPG E;  1C1O A;  2C93 B;  1TAB E;  2ASU B;  2VJ1 A;  2ZGX H;  3M7U A;  3M7T A;  2A7H A;  2V35 A;  2A2X H;  1MKW K;  1J17 T;  1SOZ A;  5JYI A;  1MTU A;  1WCZ A;  2ANK H;  3DT0 H;  4IN1 A;  3TH4 H;  5A8Y A;  1GI1 A;  2L6O A;  5FL7 D;  1EX3 A;  1GI8 B;  2SGF E;  1BMN H;  2VNT A;  3OSY A;  2BVS H;  3SO3 A;  1O39 A;  3N7O A;  3ZIA D;  5IDK A;  1MBM A;  1E34 B;  2BZA A;  3PMJ A;  2GT7 A;  4E06 H;  3OY5 U;  2QIQ A;  2KCO A;  1YP9 A;  4X0W U;  4RSP A;  3GY4 A;  3P70 B;  2OBO A;  4KTS A;  3E16 B;  4BAN B;  3QK1 A;  1BBR K;  1RIW C;  1JIR A;  2FLB H;  2QF3 A;  2ZGH A;  1LPZ B;  3EE7 A;  1TQ7 B;  1ZJK A;  4CR9 A;  2PGQ B;  3WWF A;  3GIC B;  4H6S B;  4GCH F;  1SGP E;  3BG4 C;  1HAO H;  4AFZ A;  2Z9L A;  3KQB A;  3MYW A;  1CSO E;  4FVB A;  3ZV9 A;  2A2Q H;  2PW8 H;  1KXC A;  3RC4 A;  2VIQ A;  3GY2 A;  4WF8 A;  3RXA A;  1RGQ A;  2Z3D A;  3GCO A;  2Q1J A;  2ZNK H;  5L2Z H;  4DG4 A;  1OWJ A;  3PLB A;  3LGI A;  2J97 A;  1V6D A;  2O8T A;  3KYG A;  4UD9 H;  1TPP A;  4CRD A;  4I7Y H;  2LP6 A;  2F4L A;  2J4I A;  1UJ1 A;  2ODY B;  1O3F A;  1DLE A;  1NFU A;  5DSF A;  1C5N H;  1O2P A;  3ZZC A;  4YT7 H;  2ZHQ H;  5CHA C;  4GUX A;  1O2K A;  2ANW A;  1ANE A;  2HNT F;  2QYI A;  2XCN A;  1GBT A;  1NU9 A;  3UR9 A;  1YPE H;  2R9P A;  4K8B A;  4CR5 A;  2VIP A;  4Y8X A;  1ZMN A;  5J4S A;  3F0P A;  4B2C A;  2VGC C;  4YOJ A;  1EAS A;  1MMJ N;  1BIT A;  3GCN A;  2XBX A;  2JKH A;  1SBW A;  1SPJ A;  2EY4 C;  2FOF A;  4R0I A;  1V2R T;  3D23 A;  1OPH B;  4I32 A;  1O5C B;  3RXO A;  2JIZ D;  3LGW A;  2ZCL P;  3LJO A;  3OEE D;  2AER H;  1C1N A;  2F43 B;  2G5V A;  8EST E;  1AIX H;  4IC5 A;  1BBR E;  3A83 A;  5BPE A;  1G36 A;  1LPG B;  2W3K A;  1UO6 A;  1V2J T;  1ELT A;  3K6Y A;  3DSO A;  3SZN A;  1SKY E;  1NY2 2;  2FOG A;  2WZQ A;  1G3E A;  2HLC A;  1K1I A;  4ZKR U;  3UNQ A;  1BQY A;  2UUJ B;  2NU4 E;  3D62 A;  2XC5 A;  1DS2 E;  1GJ4 H;  3PV5 A;  1H8D H;  2QN5 T;  9EST A;  1T4U H;  2FMJ A;  1O2N A;  1C9P A;  4ABH A;  1KTT B;  1O37 A;  2ZFQ H;  3PO1 C;  4MNW A;  2DE8 A;  5EW1 H;  4Y0Y E;  4U30 A;  1Z8I B;  4MPX A;  3KN2 A;  2BMG B;  2ZDM A;  3TH2 H;  5AF9 H;  2R3U A;  1YF4 A;  2RDL A;  1N6Y A;  2QF0 A;  3BTQ E;  1UTO A;  5C3N A;  1AZZ A;  3VXE H;  2BLO A;  4AOR A;  5K7R A;  4ISH H;  1TAL A;  4FUE A;  4AFU A;  4R8T B;  1HXE H;  3SV2 H;  1ARB A;  1TRY A;  1G3D A;  1L4Z A;  1UK4 A;  2P16 A;  2KAI B;  2BDG A;  1TNG A;  1W12 U;  2EST E;  3SW2 B;  1OYT H;  1TBQ H;  1YPM H;  1L1J A;  2CGA A;  3EDX B;  2ULL A;  4NGA H;  1HAG E;  3VB6 A;  1B0F A;  1JOU B;  3UFA A;  1XXF A;  5HIY A;  4DGJ A;  3M5M A;  1HNE E;  2M2A A;  2CMY A;  2K1Q A;  1AN1 E;  1SGF G;  2KX4 A;  1EOJ A;  1UVP A;  1OSS A;  4Y8Z A;  2GMT C;  3EAJ A;  2BD7 A;  2UWL A;  3KQD A;  3P8F A;  1GBK A;  3URC A;  3PO1 B;  3E0P B;  5AFZ H;  1GBM A;  3C1K A;  1O3N A;  4OS7 A;  2DE9 A;  2IJD 1;  3PMH B;  3T27 A;  1SQR A;  4ZHL U;  1YPG H;  1MH0 A;  5C1Y A;  1MKX K;  1YWU A;  3P8O A;  2KAI A;  4YT6 H;  1A0H B;  5C1X A;  2Q6G A;  1KXE A;  3RM2 H;  1L2E A;  4ISO A;  2TGD A;  2VVV A;  1SHH B;  2A4R A;  5F53 A;  3CS7 A;  1SHY A;  4ABG A;  5ESB A;  1TON A;  2FP7 B;  1GI9 B;  3KHV A;  2HOB A;  3OFN D;  1YGC H;  2FZZ A;  1ABI H;  1WOF A;  5C94 A;  3W94 A;  1FY4 A;  4K1T A;  2FIR H;  4I8K A;  1UTM A;  1O3D A;  3SU1 A;  1DIC A;  1UVS H;  4X1P U;  3GOV B;  4Z0K A;  1G3B A;  1O2M A;  4B74 A;  3O8R A;  4Y76 A;  3LC5 A;  3AW1 A;  3SV9 A;  3EA9 A;  2BX3 A;  3N99 A;  2FYQ A;  2P3T B;  1TPS A;  1O2Q A;  1CBW C;  4J2Y B;  1JRT A;  1GI6 A;  3A7Z A;  3QUM P;  4ZCN A;  4Y7B A;  3K2U A;  1OP8 A;  1C5U A;  2NU0 E;  2JJ2 D;  3K9X B;  2WSS D;  3SGA E;  1KXA A;  1BMA A;  1RFN A;  1BCU H;  1EJA A;  1ELG A;  5B6O A;  2GD4 B;  1NBM E;  3QGN B;  4UFG H;  5FCK A;  1P0S H;  3VFE A;  3M7Q A;  2SGA A;  1T8O A;  4XRN A;  3AAV A;  1YPK H;  3GIS B;  1ESA A;  1UK2 A;  3U8T H;  4TT3 D;  1GHW H;  3MU5 A;  3U9A H;  3OX7 U;  4H42 U;  3U28 C;  1HV7 A;  3F0O A;  4K5Z A;  1J14 A;  2UUF B;  2FOC A;  5C5N A;  5F8X A;  2ZTZ A;  1TGN A;  1DY9 A;  1HJ9 A;  4RN6 A;  2SGE E;  1V2M T;  2OK5 A;  3TIU A;  1C5Q A;  3BTK E;  2I6S A;  4LK4 A;  3M5N A;  4ZKN U;  1FI8 A;  2D2D A;  1K1N A;  1L1G A;  1E1R D;  3MH5 A;  3SU4 A;  4KP0 A;  5EJ1 A;  1JBU H;  3ATK A;  4JZ1 A;  1EB1 H;  2SGP E;  1GI4 A;  2P8O C;  4B1T A;  3UY9 A;  3BSQ A;  1FY8 E;  2WPM S;  1C2I A;  1TQ0 B;  1A61 H;  1TYN A;  1TX6 A;  3JZ1 B;  1ZRK A;  2PFE A;  2TRM A;  2C8X B;  2B0F A;  1Z6E A;  2NWN A;  1CHG A;  1L4D A;  3T62 A;  1W0K D;  4JK5 A;  4UFD H;  4NIW A;  1AE8 H;  4FUD A;  1A7S A;  1FJS A;  3UQV A;  1QTF A;  1QL8 A;  2CXV A;  1K0H A;  2FO9 A;  3U8R H;  2H9T H;  5EGM A;  1ZYO A;  1BB0 B;  2WYG A;  2R0L A;  5A8Z A;  4MNY A;  1P03 A;  5TCA A;  6EST A;  1W0Y H;  5C5O A;  1J16 A;  1SLW B;  1FY1 A;  3ZZ9 A;  3S0N A;  2F3C E;  2IOT A;  3A7W A;  4CRC A;  1MQ5 A;  1OKX A;  4DVA U;  3A86 A;  3WY8 A;  2A7C A;  1K1O A;  1OX1 A;  4X8V H;  4CRG A;  3AVZ A;  1TGT A;  2GZ7 A;  5GCH G;  4B6F A;  1CHO F;  4WMD A;  2PWX A;  2K8I A;  1JMO H;  3MMG A;  3U69 H;  3E0N B;  2GP9 B;  2GV6 A;  3FFG A;  3A7Y A;  3MO9 A;  3MHW U;  1LKB A;  4Q63 A;  2ZF0 H;  5GXP A;  5LPR A;  2I6Q A;  1ZSJ A;  1OP0 A;  5FPS A;  5FHT A;  2BDI A;  1FMG A;  2A45 B;  4MG3 A;  1OWK A;  3IWM A;  1P57 B;  1Z71 A;  1EAW A;  1TNJ A;  3L6P A;  3UOU A;  3DA9 B;  2V7Q D;  1ZPZ A;  1NFY A;  1CGJ E;  3A8A A;  1XUK A;  1Y5A T;  1D3P B;  3RXT A;  3FP7 E;  1CQQ A;  3A8B A;  2OC8 A;  1FN6 A;  3FVF B;  2BD2 A;  1BA8 B;  4IW4 E;  3EST A;  2C3S A;  4UFF H;  2STB E;  5EPY A;  4HTC H;  3ZZD A;  3ATL A;  2FWW A;  5GDS H;  4JYV H;  4RKO B;  2D26 C;  2XNI A;  1C5P A;  1HAH H;  1SQO A;  1TLD A;  3SUF A;  3ENS B;  1O3E A;  2O8W A;  3EA8 A;  3PMA B;  1A5I A;  2A7J A;  2OP9 A;  1MAB B;  4X6O A;  4A7I B;  4AGK A;  4LZ1 H;  1ELA A;  2AMD A;  1XUG A;  2Q6F A;  1PPB H;  2JJ1 D;  1VJA U;  2GJG A;  3SNE A;  1P2N A;  2KFW A;  4GSO A;  4AX9 H;  1AWF H;  1E36 B;  2XW9 A;  3SHC H;  3UTU H;  5CMX H;  4NIY A;  2G4U A;  1C5Y B;  2PUX B;  3B9F H;  3MU0 A;  1GBA A;  1GWA A;  4NIX A;  4ABF A;  4UE7 H;  2G55 A;  1NU7 B;  1HFD A;  1C1Q A;  1GL1 A;  2Y6T A;  3GDS A;  2UUK B;  2NU3 E;  3KGP A;  2H5D A;  3M36 A;  1HYL A;  3MH4 A;  3F1S B;  1ETR H;  3U98 H;  1HAP H;  2CF8 H;  1GVK B;  1EAU A;  1Y59 T;  2ZPS A;  1MU8 B;  5F6M A;  1VGC C;  5E0J A;  2ZEC A;  1V2P T;  2PKS C;  4HG6 A;  2ZQ2 A;  1F0R A;  2YNB A;  4YLQ H;  2PHB A;  1XVM A;  1P2O A;  3STJ A;  3FP8 E;  3HK3 B;  3K65 B;  3CS0 A;  1QHR B;  5HKK D;  1CVW H;  1UTP A;  1F5L A;  1A0J A;  3A8C A;  2O8L A;  3MO6 A;  1A0L A;  4BOH A;  1O3P B;  2XWA A;  2ILN A;  1HAZ B;  1EQ9 A;  5FX5 A;  2ZU2 A;  1C1U H;  1W3C A;  1XXD A;  1A3B H;  2A32 A;  1S6H A;  4XDE A;  1DWC H;  1P09 A;  3RXQ A;  1P10 A;  2NU2 E;  2D8W A;  1GJ7 B;  1PPF E;  2J2U A;  1CU1 A;  1TAW A;  2LNC A;  1D3Q B;  4CH2 B;  4Y11 E;  1ZHM A;  3QTO H;  3MU8 A;  1E37 B;  1A46 H;  2BYA X;  2WPD D;  3RXU A;  1YKT A;  3ZVF A;  4Q2K A;  3RXR A;  1YPL H;  2BM2 A;  1FLE E;  1W7X H;  1KLT A;  1BTZ A;  1YCP M;  4NA8 A;  4XBD A;  3ZV8 A;  1MD7 A;  1OWE A;  2F9N A;  1C4Y 2;  1G9I E;  1AFQ B;  4ACB A;  2QY0 B;  3O8D A;  1XUF A;  2LPR A;  1SSX A;  1QB9 A;  4NZL A;  4Q7Z A;  3QX5 H;  5HM9 A;  1DST A;  4AB9 A;  2FPZ A;  1P12 E;  3KCG H;  1LO6 A;  4JZF H;  1PFX C;  2RA3 A;  1A4W H;  3ZZ4 A;  1CA0 C;  4Y71 A;  1SFI A;  2W6J D;  4K8Y A;  2FOE A;  3MO3 A;  2Y80 A;  2FS9 A;  1EP6 A;  1MZA A;  3RC5 A;  4MNX A;  8KME 2;  1KXD A;  3DCL A;  1F0T A;  1UCY K;  4AGJ A;  3UWJ H;  4E05 H;  3GDU A;  3M35 A;  2W26 A;  3TGJ E;  4DY7 B;  1QFK H;  2JET C;  2OC1 A;  2BZ6 H;  4HFP B;  1P3E A;  3A80 A;  1QNJ A;  1TNI A;  4OGX A;  1MD8 A;  2J94 A;  1SGN E;  2TGT A;  3SUD A;  1O3J A;  1XUJ A;  2JH5 D;  2ZP0 H;  2J92 A;  4IMZ A;  3SUG A;  3TK6 A;  2P95 A;  1U6Q A;  3ITI A;  4I8J A;  1HCG A;  1THR H;  2FES H;  3MNB A;  4ABE A;  1VCW A;  1RD3 B;  1C5X B;  2RG3 A;  3QZR A;  2Z7F E;  2RDE A;  3E1X B;  3PB1 E;  4AN7 A;  2KCP A;  1EP5 A;  3M3V A;  1YCP K;  1BZX E;  1VIT H;  1BJV A;  3QO6 A;  4WWY A;  2ZC9 H;  2P59 A;  3G01 A;  3OTP A;  1W0Z U;  1VR1 H;  2GGV B;  1QB6 A;  3VEQ B;  1ZGV A;  2BQ7 B;  1OS8 A;  1UMA H;  2TIO A;  1MUE B;  1DPO A;  2CV3 A;  2VIO A;  2FX6 A;  1XVO A;  3ZYE A;  3RXF A;  3MH7 A;  3ZZA A;  2Z9G A;  2O8M A;  5FBI A;  1QIX B;  3SV8 A;  3TJO A;  1S82 A;  4UON A;  4BTU B;  1OP2 A;  2ZHW H;  1YPH E;  4ISL A;  2FOD A;  1NRO H;  3URE A;  2PR3 A;  1GMC F;  3T29 A;  4DCD A;  2HVY B;  3LGV A;  2A4O A;  3TPI Z;  1UCY E;  1WV7 H;  1A3E H;  2GDD A;  1D6W A;  2WV4 A;  1H9H E;  3SU2 A;  1GBC A;  1YPJ H;  2BLV A;  4I33 A;  3SHA H;  1ZR0 A;  3E8L A;  2P94 A;  3QZQ A;  3GY7 A;  4ABA A;  1QGF A;  2FM2 A;  1DXP A;  2VH0 A;  1LVO A;  1S85 A;  4GVU A;  3N7E A;  4ASH A;  3OYP A;  1QQ4 A;  1GJB B;  1SQT A;  3SI3 H;  1COW D;  1WYK A;  5GPI B;  1GCT B;  1RTF B;  3RXP A;  3PV4 A;  5FX6 A;  2H5C A;  4Q80 A;  4ZHA A;  1GBI A;  1GVZ A;  2BOH B;  2VWN A;  5HGG A;  1WAY B;  1Z8G A;  2J98 B;  3V0X A;  1GMD G;  1BT7 A;  1LVB A;  1Y3X A;  3LT3 A;  1Z1I A;  1IQJ A;  1ZTJ A;  3TJU A;  1DXW A;  1G2M A;  4XSK U;  3GY3 A;  4Q7Y A;  2R2W U;  5KEC A;  2Y5F A;  2Y7X A;  2H9H A;  4KKD A;  5EOD A;  2QGR A;  4WME A;  1ZTK A;  2GX4 A;  1EZQ A;  3VB5 A;  5A2M H;  1TGS Z;  2W3I A;  3PTN A;  4JZI A;  1THP B;  2VVU A;  2ZFT A;  1O3G A;  5KGO A;  1SGY E;  5E2P A;  2GT8 A;  1BUI A;  4BTI B;  4TSF D;  1RIW B;  1RJX B;  2GKV E;  1NRS H;  2O8U A;  1B7X B;  1WTH D;  2PLX A;  5HIZ A;  5HMA A;  1NBM D;  1H9L B;  1K22 H;  2VWM A;  4FUH A;  2A5I A;  3BG4 B;  3DUX H;  2J98 A;  1GHB F;  3T26 A;  2V0B A;  1MKW H;  4JK6 A;  4MPU A;  3KQC A;  1MTV A;  1FX0 B;  4Y10 E;  4D9Q A;  4HZH A;  2G52 A;  2TBS A;  1D9I A;  4ASU D;  1C4U 2;  2OQ5 A;  4DUR A;  1HB0 B;  4O03 A;  3PMB B;  4NA7 A;  1AQ7 A;  2AGG X;  1V2K T;  5TJX A;  3SV6 A;  4CRF A;  2J95 A;  4ZRO A;  2CHA C;  4QT8 C;  3LON A;  2W5E A;  3HK6 B;  5HM2 A;  2Z9J A;  2YMS C;  4DW2 U;  3FP6 E;  4YZU A;  5CHA B;  1SGE E;  1YLN A;  1W8B H;  1BBR H;  2AGI X;  2OUA A;  5DP9 A;  3DSG A;  2ALP A;  1MBQ A;  1W10 U;  5LPF A;  1QA0 A;  2VGC B;  4U2W A;  1AFE H;  2XTT B;  2Z94 A;  3D49 H;  2GCH F;  1GMD F;  2H6M A;  4GPG A;  1EPT C;  4AC9 A;  5AFY H;  5EJL A;  2THF B;  1EJM A;  2PKA B;  1LQE A;  3QWC H;  1BRA A;  3Q3K A;  3ZVE A;  4AFQ A;  4A1V A;  3M5O A;  2K0Q A;  5FXL A;  2P3U B;  1O2W A;  4OS1 A;  1AVW A;  1XKB C;  2QXJ A;  1O3L A;  3VG8 A;  1EZS C;  1GHV H;  1GBF A;  4YXW D;  4CBO A;  1TPA E;  3NWU A;  3QGJ A;  1O31 A;  2PP6 A;  3KYF A;  5EW2 H;  2ANY A;  4K69 A;  4CHA C;  2BXU H;  4SGB E;  2G4T A;  4X6N A;  3D65 E;  1HAI H;  2BQ6 B;  1TB6 H;  2KCA A;  3Q76 A;  1P3C A;  1FPH H;  2FOM B;  5F8Z A;  5C2Z A;  4ZAE A;  1BTH H;  4JMY A;  4TPI Z;  1EPT B;  4FUJ A;  2ZIQ H;  2XBV A;  4HGC A;  1BTP A;  1L0Z A;  4DT4 A;  1CE5 A;  1CT2 E;  1IQK A;  3OTJ E;  1AU8 A;  2VIW A;  1GHY H;  2ZKS A;  1GGD C;  2W7U A;  3QN7 A;  3A8D A;  3BTE E;  3I29 A;  2L74 A;  3LOX A;  2W6I D;  2RA0 A;  1GBD A;  1WUN H;  1MTN C;  1O2J A;  1FZZ A;  1D3D B;  3TNS A;  2XBW A;  1RRK A;  3S7K B;  1P9S A;  1EZX C;  2KM0 A;  4CHA B;  1HJ8 A;  4NIV A;  2ZU5 A;  1O2V A;  1GJ9 B;  1DX5 M;  1GI7 B;  3AW0 A;  3RXB A;  1QL7 A;  2GMT B;  3GY5 A;  1WDI A;  2PUQ H;  1C1W H;  1G37 A;  2HNT E;  4B71 A;  5EXM A;  3PRO A;  3PV2 A;  3RXC A;  1HXF H;  1FAX A;  3GY6 A;  4X6M A;  1S6L A;  3M37 A;  1W13 U;  1S0R A;  2A4G A;  3Q77 A;  1O3M A;  8GCH G;  1SL3 A;  5EJZ A;  1NZQ H;  4ABJ A;  3M3S A;  1MZD A;  1SC8 U;  4H4F A;  2BB4 A;  3F9G A;  4X8S H;  2BY6 X;  2M5T A;  3MH6 A;  1G30 B;  1HRT H;  2PV9 B;  1LHD H;  1O0D H;  1ZML A;  1O2T A;  5DPA A;  4DJZ B;  3HPT B;  1ELC A;  3SJI A;  1GBL A;  3TGI E;  1IQG A;  2PTN A;  3LGU A;  1GBH A;  4Y0Z E;  1N1L A;  1E1Q D;  1GBJ A;  3O8B A;  1GHX H;  7LPR A;  5LGO A;  1AGJ A;  1CHO G;  1SGT A;  2ANM H;  1MQ6 A;  1PQ7 A;  1G3C A;  3MNC A;  2ZHF H;  3DD2 H;  1GBB A;  4X2W A;  1OWH A;  3F68 H;  2XC4 A;  1F7Z A;  2ZTX A;  2VH6 A;  5J4Q A;  4X8U H;  1O34 A;  1UK3 A;  4B6E A;  3FOA A;  2OXS A;  1P01 A;  5A0B A;  1BRC E;  4XD7 D;  1CBW B;  2OQU A;  1TGB A;  1GI5 A;  1UTK A;  5I46 H;  4ZUH A;  2BHG A;  4BTT B;  1VZQ H;  2VWL A;  1HIA B;  1QQU A;  7EST E;  3LH3 A;  2IPH A;  5EST E;  4HI3 A;  1PYT D;  1ELD E;  1S6F A;  4K3J A;  2KCY A;  2RFK C;  1P02 A;  3URD A;  5EOK A;  1TA2 A;  1HJA C;  2EI8 A;  3GCT F;  4GLY A;  1AWH B;  1LMW B;  1P2I A;  4FUG A;  1P2Q A;  4TPY A;  1VCP A;  8GCH F;  1GCD A;  2B5T B;  5E0H A;  2ZHE H;  1HDT H;  1Y3V A;  3F9F A;  1AUT C;  3SU3 A;  3SGQ E;  1BTX A;  1FNI A;  1O2Z A;  1F2S E;  1ZZZ A;  3EE0 B;  2BTC E;  2F9U A;  1MAY A;  1HIA A;  1LHC H;  2ODQ A;  4A6L A;  2OBQ A;  2WPL S;  4IC6 A;  1GDN A;  3LJJ A;  3WWB A;  3LIW A;  1GJ6 A;  3LGY A;  2P8O B;  1ANC A;  2FOA A;  2ZDN A;  1LCY A;  4YOG A;  3PLK A;  1LQD B;  4K60 A;  5A0C A;  5HYO A;  1EXF A;  2EI6 A;  3GCH C;  1V2S T;  2BD9 A;  4X8T H;  1SMF E;  4X1R U;  1V2O T;  4BNR A;  1H4W A;  1MTS A;  1SR5 C;  2FI4 E;  1AE5 A;  2ZGC A;  1GJ5 H;  1WBG B;  4NG9 H;  1LHE H;  1QL9 A;  4OGY A;  1QCP A;  1QR3 E;  5BRR E;  1E38 B;  2OCV B;  1OXG A;  3RC6 A;  2ZHD A;  3F6U H;  3UOP A;  4INL A;  3UAI C;  1UTL M;  3ZVA A;  4TYD A;  3NUM A;  1AB9 C;  2VVC A;  1ZHR A;  1Y3W A;  3ZZ8 A;  1C5V A;  3SI4 H;  4JCN A;  1A5G H;  1TRN A;  2ZDK A;  3V7T A;  3GDV A;  1YLD A;  3UR6 A;  1IHS H;  4O3T A;  1UHB B;  5JPM H;  1BOQ A;  1Z8R A;  5K0H A;  3ZYD A;  2FX4 A;  5HXF A;  1K28 D;  1GI2 A;  1CGI E;  4F4O C;  2ZGJ A;  1UVO A;  3SV7 A;  1H8H D;  2ZCH P;  1AKS B;  4YTA A;  3GCH B;  2EC9 H;  2J34 A;  5T3H A;  1EOL A;  3TH3 H;  3NRL A;  3SUE A;  1K1L A;  3RXS A;  1HLT H;  4B2A A;  1J9C H;  1C5R A;  1V2U T;  4BAH B;  3GYM A;  1FN8 A;  4MPV A;  1CO7 E;  2P93 A;  4O3U A;  4ABI A;  3S9B A;  4EST E;  1NES E;  1V2L T;  2F9V A;  1VIT F;  4I31 A;  3TU7 H;  1AND A;  2C90 B;  3NPS A;  2BVX H;  3A88 A;  2OLG A;  4FUC A;  1H8I H;  1GI3 A;  4INK A;  3MI4 A;  1KLJ H;  1UHB A;  2UWP A;  1XX9 A;  2Z6B D;  1GPZ A;  2RCE A;  4UEH H;  3UWI A;  3U8O H;  1TNK A;  1AKS A;  1NFW A;  1O2Y A;  1A5H A;  3SNA A;  4AFS A;  4IS5 A;  1QJ7 B;  3SU6 A;  1YYY 1;  2TGP Z;  1KSN A;  1GBE A;  1O5D H;  4YOI A;  3RLY H;  5JB9 S;  4NA9 H;  1NT1 A;  1O33 A;  2OC7 A;  3SQE E;  5JBT A;  1E79 D;  3F3B A;  4U32 A;  5CE1 A;  2LEL A;  1KXB A;  2WUC A;  3B8J A;  4DT7 B;  5EU8 A;  4LXB H;  5LPE A;  4BXS A;  5DP5 A;  1BML A;  1V2Q T;  1Y8T A;  2WUB A;  1C5O H;  1S84 A;  5GWZ A;  2ZWL H;  5A0A E;  3EYD A;  5DJ7 A;  3QTV H;  1O3C A;  2B8O H;  4FU8 A;  1GJD B;  3P17 H;  2VID A;  3EQ0 H;  4F49 A;  1PPH E;  3PWB A;  1HAY B;  4XOJ A;  2BY7 X;  2HPP H;  1K1J A;  4X2X A;  2QF5 A;  3V13 A;  1X7A C;  1YM0 A;  1EUF A;  3K6Z A;  5E0G A;  3RXH A;  1GVL A;  1KLI H;  4WH8 A;  1ZHP A;  2BDY A;  7GCH F;  1TOM H;  1MAX A;  1VJ9 U;  5H4I B;  3ZZ7 A;  1O2G H;  1N6X A;  1Y3U A;  1RTL A;  2FYR A;  3RXJ A;  1WTG H;  1TNL A;  4NCY A;  2WV5 A;  4KGA A;  4WH6 A;  1VGC B;  2F83 A;  1O38 A;  4XFQ A;  3EGK H;  2ZDL A;  3ZZB A;  2PKS B;  1YY3 A;  3BTD E;  4FOU C;  3W1E A;  2WPI S;  3A7T A;  3BG8 A;  4Q7X A;  1FIZ A;  3ODF A;  1V2T T;  4FXG H;  3BV9 B;  4JZD H;  1HAX B;  5DP7 A;  1WQS A;  5EQQ A;  1K21 H;  1GMC G;  4X2Y A;  1CT0 E;  5C67 A;  1O3K A;  1TRM A;  2FI3 E;  4RT1 A;  2BQW B;  4X1N U;  3VB3 A;  5A8X A;  2Z9K A;  1IQF A;  3H7O A;  4OM9 A;  1ZLR A;  1JWT A;  3KL6 A;  1C5M D;  5JB8 S;  1IQL A;  3ATI A;  3SZE A;  5FCR A;  4SGA E;  1FPC H;  1P04 A;  2V3M A;  1RS0 A;  2KR7 A;  3KID U;  2ZO3 H;  1LHG H;  1Y5B T;  6LPR A;  1PPC E;  3RMM H;  1ZRB A;  3TNT A;  3UB0 A;  5E8E H;  1OWD A;  1GDU A;  1EKB B;  1HAV B;  1BRB E;  2O9Q A;  1H1B A;  1TNH A;  2QF4 A;  2VBC A;  2P3F H;  1O2H A;  4BAK B;  4BAO B;  5T6G A;  3UNS A;  4X1S U;  2CJI A;  2XWB I;  3AAU A;  2BD3 A;  2UWO A;  5EG4 A;  1NRQ H;  3BTW E;  1W14 U;  3ZZ3 A;  3MU4 A;  3MTY A;  4FU9 A;  4WVP E;  1O2L A;  3H7T A;  2QXG A;  3E3T A;  1TIO A;  4K1S A;  4UDW H;  4D7G A;  1LVM A;  2TGA A;  1OYQ A;  1WU1 A;  1CA0 B;  1QRX A;  2EA3 A;  5C0U A;  3S9A A;  1Z8J B;  2R0K A;  3C27 B;  4B75 A;  1KY9 A;  1AI8 H;  4Z6A H;  5C1U A;  1IAU A;  1XM1 A;  4WMF A;  2OTV A;  3O8C A;  3LH1 A;  5CHB A;  2FS8 A;  3RXK A;  2JET B;  4PRO A;  3PRB A;  3RXM A;  3RM0 H;  3GY8 A;  5EIY A;  3BN9 A;  1B0E A;  4ZXX H;  2TPI Z;  1K9O E;  1GHB G;  2A31 A;  3ODD A;  2B9L A;  3RU4 D;  3UQO A;  1ARC A;  4YLU A;  1NS3 A;  1JXP A;  2Y81 A;  1F92 A;  3V3M A;  1DM4 B;  2H1U A;  2G51 A;  1WQV H;  1P2M A;  1K1P A;  3BIV H;  1NFX A;  2HPQ H;  1BTY A;  3E91 A;  3HGP A;  3SYJ A;  2ZCK P;  2JH0 D;  3VPK A;  5JBC S;  4GAW A;  1UW7 A;  1C1T A;  5L2Y H;  5JBA S;  1O2I A;  2XRC A;  3U1J B;  1H8E D;  1UCY H;  5EXN A;  1C2F A;  5AVD A;  4ZKS U;  2A4Q A;  1C1P A;  1K1M A;  1TE0 A;  4NFF A;  2GCH G;  2GVF A;  1Q31 A;  3Q3Y A;  5FBE A;  1P06 A;  2SGD E;  3F2H A;  3TJN A;  1SLU B;  1TFX A;  1NRR H;  2ZPR A;  1XUI A;  5FAH A;  1RTK A;  1C1M A; 
#chains in the Genus database with same CATH homology
 4A1T A;  3SV9 A;  1FX0 B;  2QV1 A;  4FET A;  1OHH D;  3N99 A;  2KR7 A;  2K8I A;  3ZIA D;  2P59 A;  3N7D A;  5IDK A;  4ASU D;  3OTP A;  2XOK D;  3SU0 A;  4Z1M D;  2GGV B;  5FPY A;  3SU5 A;  2KM0 A;  3SU3 A;  3KN2 A;  3KF2 A;  3UB0 A;  4Q63 A;  2KZ4 A;  4ZCN A;  2KCO A;  3SV6 A;  5HKK D;  2JJ2 D;  3LON A;  2OBO A;  2WSS D;  2F9U A;  2XCF A;  4M9F A;  2QF4 A;  2YMS C;  5FPS A;  2VBC A;  4B71 A;  3SU6 A;  2O8M A;  1NBM E;  2OBQ A;  4R8T B;  3SV8 A;  3F2G A;  5IK2 D;  3GS9 A;  3E90 B;  3PV2 A;  1W3C A;  3WWF A;  3WWB A;  2OC7 A;  3P8N A;  2JDI D;  3L6P A;  1E79 D;  1S6L A;  2OC0 A;  2V7Q D;  3KNX A;  4F55 A;  1KMH B;  3F3B A;  2LEL A;  3KEE A;  3RC4 A;  2A4G A;  3WW7 A;  4WF8 A;  5EPN A;  3FN8 A;  1RGQ A;  5C0U A;  2HLD D;  4TT3 D;  1CU1 A;  2J5U A;  3SU2 A;  1W0J D;  4KTC A;  4B75 A;  3M5M A;  4B76 A;  3EYD A;  3U1I B;  2IJO B;  2OC8 A;  2XND D;  2M2A A;  3F0O A;  2K1Q A;  4I33 A;  2F4L A;  2WPD D;  5B6L A;  3O8C A;  1DY9 A;  5DSF A;  5EPY A;  2FM2 A;  1DXP A;  2QE7 D;  4Q4L A;  2OK5 A;  5CHB A;  4A1V A;  5DN6 D;  3PRB A;  3OEH D;  3N7E A;  2CK3 D;  3M5O A;  3OYP A;  2QF5 A;  2K0Q A;  3M5N A;  4RI0 A;  5EQR A;  1COW D;  5GPI B;  4A1X A;  3H09 A;  2XNI A;  1E1R D;  4B73 A;  3SUF A;  4WH8 A;  3O8D A;  3RC6 A;  2IJD 1;  3SU4 A;  1N1L A;  2XCN A;  1E1Q D;  1NS3 A;  3O8B A;  1JXP A;  5GND A;  3VG8 A;  4K8B A;  3F2F A;  4YXW D;  4TYD A;  3F0P A;  5H4I B;  4A92 A;  1MAB B;  3P8O A;  3OE7 D;  1WXR A;  1BT7 A;  1RTL A;  3FO8 D;  2JJ1 D;  2W6J D;  5EQS A;  1DXW A;  1BMF D;  2OIN A;  2KFW A;  3PRD A;  3SYJ A;  4I32 A;  3RC5 A;  4WH6 A;  5C0T A;  2JIZ D;  5FPT A;  3DCL A;  2YOL A;  2A4R A;  1W0K D;  3LKW A;  4B6E A;  3FOA A;  2KCA A;  5F53 A;  3OEE D;  3M5L A;  3DSP A;  5ESB A;  2FOM B;  5GJ4 B;  3W1E A;  2F43 B;  1A1R A;  2FP7 B;  3U1J B;  5CDF E;  2OC1 A;  1DY8 A;  1H8E D;  4XD7 D;  4JMY A;  1H8H D;  3SV7 A;  3OFN D;  3AK5 A;  5ETX A;  2A4Q A;  3NRL A;  3SUE A;  5EQQ A;  2WHX A;  2YMS D;  4NWL A;  4U01 A;  3DSO A;  1EFR D;  3SUD A;  4TSF D;  1SKY E;  4DT4 A;  2YMS B;  2GVF A;  2WZQ A;  3SUG A;  5T1V A;  3OAA D;  2AHM E;  3FKS D;  4OM9 A;  2KCY A;  3F2H A;  2F9V A;  1NBM D;  3SU1 A;  4NWK A;  4I31 A;  5C17 A;  4B74 A;  2KCP A;  3O8R A;  2L6O A;  3PV5 A;  3SZE A;  5FL7 D;  3LOX A;  2W6I D;  2WV9 A;  4B6F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...