2VIPA

Fragment-based discovery of mexiletine derivatives as orally bioavailable inhibitors of urokinase-type plasminogen activator
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
247
structure length
247
Chain Sequence
b'IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTISLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR CHAIN B
publication title Fragment-Based Discovery of Mexiletine Derivatives as Orally Bioavailable Inhibitors of Urokinase-Type Plasminogen Activator
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 60
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2007-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2vipA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2vipA01
2V3HH 1C5NH 1JMOH 2PTCE 1GVZA 2Q1JA 5AFYH 3RXMA 3E91A 3MYWA 1V3XA 4MPVA 4D9RA 1GG6C 1ELDE 2FS9A 1SBWA 2AMQA 2RA3A 3UY9A 4E06H 1XXDA 2AFQB 3GY5A 2BVRH 2YNAA 1B0EA 5E2OA 1OKXA 1BQYA 1RGQA 4O03A 1W10U 1ZLRA 2RA0A 1SQTA 3PLKA 1K1OA 4CBNA 5AF9H 2BY8X 3ZVBA 1LQEA 2ALPA 3OTJE 3KN2A 2YOLA 3SJ8A 4JZDH 1C2LA 4ZXYH 1NU9A 1H9IE 4WXVA 1ZTLA 4NA9H 1K1LA 4NIXA 1OWJA 1ZPZA 4LXBH 3T5FH 2TIOA 2BQWB 4H4FA 2BD3A 3U8RH 4NIYA 3SUGA 2PFEA 3M3TA 2TGPZ 3SNBA 1FONA 4BNRA 4JZFH 4K60A 2D8WA 3EYDA 3A8BA 2TRMA 1JIMA 3MHWU 4ASHA 1GBIA 1JRTA 3BG8A 2GX4A 5E0GA 5A0AE 2FPZA 2A7JA 2H2ZA 2F9UA 4BAHB 3QK1A 2HOBA 4ZROA 2FOHA 2QF0A 3SJOA 2A5IA 1ZJKA 2VVUA 2H9HA 1Q2WA 1O2VA 2Q6GA 5GDSH 2Z9IA 2ZTYA 3BF6H 6ESTA 1K1NA 1HAVA 4AOQA 1S0QA 1YGCH 1C1WH 3E0NB 1AMHA 5AHGH 2UWPA 2PTNA 4IN1A 1P2NA 2FOGA 2G8TA 2K1QA 2FOEA 1K1IA 1D6RA 3NK8A 5T6DA 4X2YA 3RXQA 1P2JA 2G00A 1IHTH 2CJIA 1HJ8A 2G52A 3A81A 2BD4A 4Q7ZA 1MTUA 1HAYB 3TNSA 3SJKA 1TX7A 2FOAA 5GPIB 4D9QA 2SGQE 2VB0A 1IQHA 1T8MA 1O2SA 2O8LA 4J2YB 3G01A 1HV7A 3TK9A 1YP9A 3KGPA 3TPIZ 3S0NA 2P8OC 2HVXA 3K9XB 1O5CB 4MNWA 5E0HA 3UR6A 1V2UT 3SU4A 3FFGA 3LGIA 2EC9H 1GGDB 5EW2H 1DFPA 3OY6U 3VXEH 7KMEH 3V0XA 2P93A 2QXIA 2W26A 3A8CA 2ZPSA 3RU4E 2XBXA 1UO6A 1S5SA 2A31A 1GBAA 2Z9JA 3ATIA 3HGNA 3RLYH 4BTUB 2BQ6B 4VGCB 3SGBE 1L1JA 1QCPA 4MDSA 2O8TA 2V6NA 2ZFSA 2BYAX 1H8DH 3CP7A 5J4SA 1V2NT 2GZ9A 3IWMA 4R0IA 3FZZA 3RMMH 4K1TA 1XXFA 1C2KA 5LGOA 1CGIE 1O3BA 1O2WA 1TBRH 2Y6TA 4Y79A 1P0SH 5DP4A 3NKKA 3SUFA 2VVVA 3ZZCA 4NSYA 3SGAE 4DG4A 2D2DA 1Y3UA 2OBOA 1ELEE 1ELVA 1C2EA 3BG4B 5A8XA 3KF2A 4ZHAA 1EP6A 3RLWH 3KNXA 1FMGA 4ZKOU 1O5EH 1F2SE 3SQEE 2NU2E 4IGDA 1AHTH 1LVMA 1G3BA 2VVCA 2VU8E 1QBNA 1F0TA 3L3TA 1ETSH 1GI5A 3TK5A 4YLUA 3TGKE 4MPXA 2BX3A 1F92A 2IN2A 3M36A 4WJG2 1NPMA 2FX4A 1XUHA 5K0HA 3ZZ3A 2G81E 1TNHA 1XKAC 1Z8IB 4FUGA 2ZCKP 1DSUA 3LKWA 3TJVA 1FIZA 2ZGXH 1AUJA 1CE5A 1Y5AT 3VB4A 2QAAA 4I8GA 2Z3DA 4DVAU 3LGVA 4RKJB 1P3EA 3ENSB 1TNJA 4U32A 4X0WU 2H5CA 1QA7A 4RSPA 3QN7A 5A0CA 1C5UA 1LDTT 1ACBE 3E90B 4FUDA 4IC6A 1C2HA 2WYGA 3P70B 4B2AA 1A4WH 4AN7A 4GAWA 1KXFA 5FAHA 2VINA 3AW1A 1LKAA 1AFQB 1WTHD 3SQHE 1DWEH 1LPGB 3VPKA 2WPIS 3R3GB 1AY6H 1C1PA 1K28D 2RG3A 1GI3A 1QRXA 1N8OB 3GCHC 1SGPE 2GCTC 1C5SA 4ISHH 1GVKB 1F7ZA 3ZYEA 4TPYA 3ZVEA 1ZZZA 1MCTA 2BOHB 5ETXA 2AERH 4B71A 1AVXA 4BOHA 2UUYA 1TMUH 5T3HA 5HM2A 4NFEA 2WINI 3TK6A 3PO1C 1D3TB 4X2WA 2KAIA 1S84A 1G3CA 1MU8B 2SGPE 3A7VA 1S81A 3MU1A 1O2KA 1QFKH 2R2WU 2ZTZA 1YPJH 5JBBS 3RXOA 3M5NA 1UK2A 1CBWB 4UE7H 1FY3A 2BDYA 3PROA 2WYJA 4UFGH 5DGJA 2ZU5A 2O8WA 3RM0H 1SLXB 3ITIA 1E34B 1OWDA 1OWHA 3RXPA 4Z0KA 3GY3A 1W2KH 1A61H 1MKXH 2VWOA 1O3HA 1WOFA 1LTOA 2XBYA 3FVFB 3KQBA 1ZHRA 2BX4A 4FUFA 5A0BA 3MU4A 1SGNE 5DP6A 2HRVA 2LNCA 2CF8H 1TMTH 1H8IH 3LPRA 1WSSH 2ZCLP 3CS0A 3HK3B 1FZZA 1G37A 1RTKA 1LHCH 4OS4A 3HKIB 1A7SA 2VH0A 3UREA 3K2UA 3FZDA 5EPNA 5GCHG 1P2IA 3I77A 4BANB 1ANBA 1EUFA 3MNCA 2Z9GA 3P95A 3URCA 3VXFH 3PMJA 4JCNA 2BB4A 1QBVH 3LJOA 4FUHA 5CE1A 2QIQA 3TIUA 1DANH 1RRKA 1O32A 1MUEB 2OC7A 2ZGCA 3DHKH 1N1LA 1G3EA 3A7XA 4YLQH 2J92A 3PM3A 3PLBA 2XC4A 1A1RA 1DUAA 1OS8A 5JBAS 1XUGA 1OP2A 3ZZAA 4ABIA 1EB2A 2ZKSA 1ZOMA 5L30H 1QBOA 1K1JA 2SNWA 2J2UA 1F0RA 3ATMA 2W3IA 3QWCH 3SNAA 2ZGBH 4UONA 1CT4E 1D6WA 1ELFA 4GLYA 1O37A 2GT7A 5EXMA 3M7UA 1C1QA 4NSVA 1LVYA 1SI5H 2OUAA 1TLDA 4CRCA 2ILNA 1O2GH 1S82A 2PV9B 2FI5E 1AO5A 3SI3H 4TWWA 4AGJA 4Y0YE 3UOUA 4UD9H 3DD2H 4OS2A 3QGJA 1BTXA 3KEEA 1TPOA 3KCGH 2F3CE 3ZYDA 5HXFA 1GI9B 4TPIZ 1OWEA 1XM1A 1GHWH 3M61U 1GGDC 1OPHB 4F4OC 4SGBE 3I29A 1BZXE 3F9FA 2VGCB 1YPEH 4Q7YA 1A3BH 1YF4A 1O2QA 4B75A 1T31A 5L2YH 4ABFA 4FU8A 2FOCA 1QL7A 3BTWE 3QZRA 1RS0A 1HRTH 5JDUB 1GHBG 3RXGA 3SI4H 1TQ0B 1XUFA 1GBEA 2SFAA 4CRGA 3U9AH 1CA0B 2H9TH 3KIDU 1C2MA 3A8DA 4CHAC 1F5KU 4XE4A 1O3OA 4VGCC 2TGAA 1VJAU 1KYNA 1WBGB 2IOTA 1XX9A 2QXGA 1HAGE 4NA8A 2C8YB 1MCVA 2XXLA 2C4FH 2FEQH 1YPLH 1O3GA 1Z8GA 2BXTH 1MMJN 5DK1A 1HPGA 1LPKB 2Z3CA 1GI6A 1PPZA 1ABJH 2G4TA 1C5WB 3NZIA 1EJMA 2PKAA 3BG4C 1FPCH 1SB1H 5BRRE 4FU9A 4DW2U 1VCPA 1UTNA 8GCHG 3T25A 4A1VA 1DPOA 2V3OH 1TNLA 5C1YA 1C5ZB 4X1SU 4H42U 7GCHG 4O3TA 4CH8B 1YCPK 2CHAB 3GYMA 4WVPE 4QT8C 4MNVA 3ATLA 2ZQ1A 5FPYA 1UTMA 2QXJA 2WPJS 6CHAB 1YC0A 2W5EA 3Q76A 1K2I1 1P9UA 3M3VA 1FNIA 1GJ8B 3HKJB 2Z9KA 5F6MA 1CU1A 1DY9A 2BLQA 1HDTH 1O3FA 4GUXA 2DUCA 4ABDA 3AAUA 3LGTA 3GY8A 2I6SA 3PMHB 1C5RA 4OS1A 1MTNB 2XWAA 1OP8A 5B6OA 1DXPA 3L33A 2FS8A 2GMTB 1AKSB 1QL9A 4UEHH 3ZVCA 1DSTA 2CXVA 1O2HA 1UCYK 2ZG0H 1CGJE 2FO9A 4FXGH 1OX1A 1TPPA 3GICB 3SU2A 2NU4E 4BAQB 1GMCF 3NWUA 1B7XB 1MD8A 1NRSH 3PWCA 4ZMAH 1LKBA 1ID5H 1UHBB 2M5TA 2FI4E 2ODPA 2OC8A 4KTCA 1C5MD 2Y7XA 1RXPA 2PGBB 5LPFA 1IQLA 1BRBE 2NWNA 1TE0A 2FX6A 1EQ9A 1EZXC 1MH0A 1UTPA 2FESH 3DFLA 2P16A 5FX6A 3SORA 1CHOG 2AGIX 4OGYA 5FPTA 2ZU4A 3M5LA 4X1PU 2Z3EA 3RXBA 4Y7BA 3STJA 1NS3A 4X1NU 1A5HA 1NROH 1H9HE 4OS6A 1O3AA 3UOPA 1ELGA 1UVOA 1QB9A 2BD5A 1OOKB 2Z9LA 1CBWC 5SGAE 3ZVGA 1ZGVA 5EOKA 2WPLS 1LPZB 1VGCC 3RC4A 3RXFA 1U6QA 2XRCA 3RXUA 2ZFQH 1P8VC 2BZ6H 1FJSA 3U69H 2OLGA 2ZWLH 1D4PB 4OS5A 4R8TB 1C2DA 2A7CA 4FUBA 1P06A 3P92A 1A3EH 2AGEX 4BTIB 1GBLA 5JBTA 1W3CA 4XSKU 4DURA 3LU9B 1GPZA 1KXDA 1C1OA 1S0RA 4ZXXH 2SGDE 4A1TA 3UQVA 5TCAA 2FYRA 1ETRH 4Y8XA 1WV7H 9LPRA 1GDQA 4GVUA 2F9OA 1VITH 3GOVB 1HJ9A 1QY6A 1IQMA 2R3UA 1BA8B 2QGRA 1UMAH 2Y82A 1UVUH 1FUJA 3GY2A 2GCHF 1QQ4A 1O36A 1SGYE 3LH3A 1GHAF 1W11U 1QR3E 1BHXF 3RMOH 3UWJH 4NIWA 4JK6A 1GBJA 3ZVFA 3A83A 3ODDA 3MO6A 2BDHA 3EAJA 3T29A 3VB7A 4MPUA 3A7TA 1NZQH 8ESTE 4UFDH 3MO9A 4GHTA 1C9PA 3EE0B 1EPTA 2BY6X 3TJUA 1VITF 1ZMNA 1H9LB 1BRAA 1ZSJA 1CSOE 2OQUA 1QA0A 4NWLA 2HPPH 1C4V2 1NRRH 4YT7H 4BAMB 3GISB 1K9OE 3RU4T 1PPGE 4Y76A 3DUXH 1AFEH 4WF8A 2XWBI 2GDDA 4Y8YA 1YPMH 1GI4A 1TX6A 3OU0A 2D1JA 2F9VA 1J17T 4JZIA 1CO7E 2Y5FA 2OBQA 1G3DA 1WCZA 1HAZB 2JETB 3BEUA 5ESTE 3PMAB 2AEIH 1FI8A 2CN0H 1O38A 1C1RA 2ZU1A 2FOBA 4CBOA 3B9FH 2ZDLA 1KLTA 2BOKA 4MPWA 3U98H 3UNRA 3MU0A 1Y59T 2PW8H 2BQ7B 1ZPCA 2VGCC 3A7WA 3KQEA 2JH5D 5IYTA 3GDSA 1SGDE 3SNEA 1HXEH 5C2ZA 1X7AC 1TRYA 1GMHF 1RTFB 4B76A 3K6ZA 4LZ4B 2C8ZB 1PJPA 5EQQA 1CA0C 1P11E 1VZQH 2NU0E 3SO3A 1O31A 1T8NA 2P94A 5FCKA 1ZJDA 2PR3A 1YPKH 2EA3A 2EI7A 2UUFB 1TGTA 2D26C 5AVDA 4YO9A 3MNSA 3MNBA 3EGKH 1UK4A 1F0UA 4THNH 2GDEH 1GL1A 1O3NA 1YPHE 3V3MA 3TGIE 4WY3A 3V7TA 4Y11E 1EB1H 1KIGH 2ZTXA 2R9PA 1TONA 4WXIA 3UR9A 2GKVE 1C5XB 2ZHFH 1EXFA 4Y7AA 1GCTB 4A92A 3HPTB 1PPBH 1Y3WA 1L4DA 1K22H 3A8AA 2AIQA 1J8AA 1UTOA 2BY7X 4I7YH 4B74A 1HIAA 3RP2A 3P8FA 3MOCA 6CHAC 3UQOA 1IAUA 2WPKS 5EXNA 3O8BA 3AVZA 1PQ7A 1P03A 1JBUH 2BDIA 1S6FA 1HAPH 2XCFA 1UK3A 1F0SA 1DDJA 1NESE 5JBCS 1O39A 3LDXH 1SLVB 1KDQA 3SHAH 3NPSA 2BDGA 1O2RA 3D49H 3IITA 3LIWA 4YOJA 1KXEA 2ZEBA 1MTNC 4A6LA 2Y5HA 1J9CH 1EJNA 4WH6A 3MU5A 1FY8E 4D8NA 4HFPB 3F9HA 4AYVB 3GDUA 1E0FD 1NFUA 1WAYB 1V2MT 3U8OH 1DE7H 1C4Y2 2UWLA 5FCRA 1GHYH 2PHBA 5CHAB 5LPEA 1UVTH 3MMGA 5F8ZA 3SZNA 4ZAEA 4Y0ZE 2SGAA 5FBEA 4Y8ZA 4CRDA 3F9GA 2C93B 5I46H 1ESAA 2WV5A 5A8YA 4AB9A 3B23B 4X6MA 3MNXA 2Y5GA 1SGTA 3BTME 1ARBA 3M37A 1P10A 3A88A 3SU1A 1T7CA 2TGTA 1MZAA 1TBZH 3FP8E 5AFZH 3LOXA 1SHHB 1BCUH 3V13A 1BTHH 1ORFA 3BEFB 1O2YA 2LPRA 1S83A 4Y6DA 1O3JA 4AB8A 4U2WA 2FI3E 3PYHA 3SN8A 1C2IA 1D3DB 2I6QA 2J38A 2FOMB 5GWZA 1N6XA 1NN6A 1HAOH 2A45B 3SJIA 1TRMA 5LPRA 4AFUA 2V35A 2HGTH 1KLIH 1V2LT 5EW1H 2VJ1A 1W0ZU 2VH6A 3BTTE 2FIRH 1BTUA 1GBFA 3ZZ9A 4X8SH 1GMDG 2CV3A 2ZCHP 2A4GA 2B8OH 2FOFA 5BPEA 3N7OA 2SNVA 1J16A 1HNEE 1FLEE 1O2IA 1C4U2 1ZR0A 4TYDA 3M7TA 4NWKA 1MTWA 1QRZA 2XBVA 4YTAA 4KTSA 2BY5X 4YZUA 4MNXA 4ZHMU 3O8RA 5EG4A 4J1YA 1OWKA 1TX8A 3OSYA 2A4QA 1GI7B 1C5YB 3VB5A 4BAKB 3BTEE 3ZV9A 1GVLA 1CVWH 4GPGA 2G5NA 4IBLH 4FVBA 1BHXB 1DM4B 1L4ZA 1O5BB 1V2TT 1W8BH 2BVXH 3KQCA 4IW4E 4YOGA 2ZFPH 3A84A 2P59A 4KKDA 4B2BA 3OY5U 8KME2 1RTLA 3RXIA 3S7KB 1D9IA 1YYY1 1TA2A 2ZQ2A 1GBBA 2GGVB 1DY8A 5E0JA 4O3UA 3TH4H 2F83A 4CH2B 3GY4A 4CR9A 1THRH 3U1IB 2AYWA 3GY7A 5DP8A 2VIPA 1SGRE 1K1MA 2P95A 3GY6A 1HBTH 4KELA 2ZI2H 1P09A 1IOEA 2R0LA 2C8XB 2PUQH 1C1SA 1TRNA 2A32A 6LPRA 2BD8A 1BRUP 2H6MA 2BD2A 1W7GH 1BITA 1ZSLA 1HFDA 1T4UH 3K65B 3Q3KA 2A5AA 2ZECA 1W12U 1NT1A 1SGEE 1TGCA 1V2WT 5C5OA 1QJ1B 1UTQA 2JETC 1TA6A 4ZKSU 1HAVB 2Q6DA 3UPEA 1XKBC 3NCLA 4UDWH 1LHGH 4DCDA 1C5LH 1FAKH 1UTKA 3LGUA 5DKMA 5C67A 1O3CA 3P8GA 4D7GA 2Y80A 3D23A 4GCHF 3W94A 1E37B 1EATA 2GVFA 2BTCE 3MH5A 1NC6A 1GBDA 1GJDB 1DWDH 2PLXA 5G4BA 1FDPA 1TFXA 3T27A 4U01A 1O3DA 1NO9H 1SMFE 4X2VA 4TWYA 3RU4D 1V2VT 2IJOB 1TNIA 2ZHQH 2DE9A 1O5FH 1P05A 3PWBA 1HB0B 2CF9H 1ESBA 2FZZA 2EEKA 1TNGA 1XVMA 2TBSA 3QTOH 1BMAA 3VFEA 4AFZA 2R0KA 2OCVB 1SGCA 2BD9A 1P2OA 3S69A 1P3CA 1TALA 4KGAA 1FQ3A 4E05H 3Q00A 2F9NA 4MQAA 1F5LA 2VIWA 3SW2B 4ZHLU 1FXYA 5DP3A 4CRBA 4WWYA 1ZTJA 3AAVA 4YT6H 2P3UB 1NFXA 3RUOA 1MAYA 4X2XA 3UTUH 1P12E 2BMGB 2B0FA 1UJ1A 1EAXA 1ZSKA 4Q7XA 2BDBA 5HYOA 3R0FA 1MZDA 4A1XA 1UTLM 1Y5BT 2ULLA 1AWFH 1VJ9U 1GCTC 5A8ZA 1RIWB 1W0YH 3A85A 2ZNKH 1ARCA 1P02A 1BBRK 5HM9A 1EZSC 7LPRA 2WUCA 1HAIH 3RXEA 1DICA 4Y10E 2W3KA 1PQ5A 2QV1A 1Z6EA 3M5MA 1O2NA 2HLCA 3PMBB 1IQNA 5ESBA 2BLVA 1O3IA 4O97A 1NFYA 3MTYA 2DE8A 3RXJA 1GI0A 3M3SA 1GJ5H 4UFFH 2AGGX 1NRNH 1EKBB 1TB6H 1O0DH 3P6ZB 3SUDA 3MU8A 1O2XA 3FP7E 1C5VA 4BXWA 1LMWB 1EX3A 4NFFA 3E16B 1BB0B 1EAIA 2PWXA 1KLJH 2CGAA 2HNTF 2HPQH 4JK5A 2Z94A 2W7SA 4NZLA 1GJ4H 4X6OA 4YM9A 4SGAE 1VCWA 4ISOA 1BTWA 2PKSB 1GI1A 3GCTF 4CRAA 2JKHA 2OXSA 2QCYA 3BIUH 4AFSA 1GJ9B 2HNTE 4OGXA 2FMJA 3BTHE 1OYTH 1W7XH 3TVJB 2SGFE 3LH1A 1DLKB 2ZPQA 3SUEA 3RXAA 3ZZ8A 1N6YA 1NFWA 1WYKA 4FUIA 3PTNA 2BM2A 1SOZA 1T8OA 3HATH 1EOJA 4KP0A 1FIWA 1BJUA 2WPHS 4H6SB 1SHYA 3EDXB 5A09A 2QYIA 2ZZUH 1T32A 3BV9B 1ZHMA 1Y3VA 1Z7KA 1PPHE 1A0HB 3PV4A 3RXHA 1DX5M 3JZ2B 2FLBH 1SG8B 1AFQC 1C5PA 4INKA 1Z8RA 5C1UA 1AI8H 3RXLA 3EA9A 1BTPA 3QTVH 2EI8A 1CHGA 1N8OC 3BEIB 1IQJA 3PTBA 5F8TA 5GJ4B 1THSH 1GBHA 7GCHF 2XC0A 2KAIB 1E35B 5FX5A 1BUIA 1MTSA 1NM6A 2J9NA 4JZ1A 4NGAH 3FANA 3LONA 3UIRA 2ZU2A 2JH0D 3A86A 3SV2H 3O8CA 4K69A 1T4VH 1ZMJA 2RCEA 4YOIA 1ZGIA 1MD7A 1A46H 1Y3XA 2XNIA 5TJXA 3LGWA 1YCPH 1AZZA 1GL0E 1EOLA 1IHSH 1NU7B 3B8JA 2EI6A 1CT2E 1O33A 1Z1IA 5ABWA 1TQ7B 3ZZ7A 1SVPA 5EODA 3EA8A 2BLOA 4DGJA 2C8WB 2GCHG 3BTQE 2THFB 2ZFFH 1L1NA 1GHAG 4BAOB 2ANKH 2FP7B 1A5GH 1XUKA 2JH6D 3ATWA 5EGMA 1WTGH 1BMMH 3URDA 4BXSA 1WQSA 1BIOA 1AE8H 2YNBA 4ABJA 1THPB 5DP5A 2RDLA 2ZDMA 1TOMH 2OINA 4ZKRU 2UUJB 1AIXH 1AQ7A 1O2MA 1KTTB 1BTZA 4IMQA 1HYLA 1HLTH 1VITG 3RXDA 1PFXC 1QL8A 5F03A 8LPRA 4CREA 3C1KA 1UCYH 1PYTC 2CMYA 3PB1E 2PSYA 2QF3A 1O3MA 1BMLA 1MQ6A 1TGNA 1BJVA 1Z71A 3E8LA 1CGHA 1YM0A 1TPSA 3UWIA 1O3KA 1QGFA 1JWTA 4AFQA 3BTFE 2G4UA 3D65E 1HAHH 1HGTH 1XVOA 2ODYB 1FY5A 4UFEH 1O30A 1D3PB 2BZAA 3UFAA 4LOYH 4D7FA 1CA8B 2A2QH 1EZQA 1SOTA 1O3LA 3ZZ5A 4YESB 4I8JA 1INCA 4I31A 3VGCB 2SGEE 1IQEA 4FUJA 3TLOA 1BOQA 1MTVA 2ZO3H 4MNYA 3U1JB 4DIHH 4HTCH 2R3YA 6GCHF 4TY7A 2FYQA 1YPHC 3MWIU 1SQOA 1TNKA 1GMHG 3RC5A 3T28A 3E0PB 1IQKA 2Z6BD 2B7DH 1QQUA 2BXUH 1DXWA 3E6PH 4B1TA 2TGDA 1GI8B 1UCYE 2PUXB 1TPAE 1L0ZA 1GJ6A 4NZQA 1M9UA 1Y3YA 1P2MA 2FODA 3TITA 2QXHA 3ZZ6A 4CR5A 3KL6A 3KQDA 3QO6A 4DJZB 3ZV8A 5E2PA 1KXCA 2ZGHA 1HUTH 2GD4B 4K1SA 4H6TA 1GCDA 4ABGA 3BTKE 5T6GA 1MBQA 1A0LA 3MFJA 4A5TS 2UUKB 4HZHA 1C5OH 3DFJA 2H9EH 3JZ1B 2VIDA 1GBKA 5TCCA 5L6NH 3SU5A 2UWOA 1C2FA 3ESTA 1AU8A 1RIWC 3W95A 2P3TB 2C3SA 1GDNA 1TAWA 5DP7A 1D3QB 4B2CA 1H1BA 3ZVDA 4CRFA 4K2YA 3ZZ4A 2XC5A 3U8TH 3H7TA 1O2UA 1YCPM 2V0BA 4JYUH 1O2JA 2PKAB 1SGIB 3H7OA 3UNQA 2FTLE 2AIPA 3BTGE 3RXCA 3T62A 1RFNA 1BT7A 2ZDKA 1DT2A 1C2GA 2WUBA 4LZ1H 4U30A 1L1GA 1TGBA 3A7YA 1GI2A 4XOJA 4HGCA 1EJAA 1WU1A 1EASA 2WV4A 1Z1JA 5EPYA 4NG9H 1DWBH 1BMNH 1G2LA 1QTFA 2GZ8A 1B5GH 3SNDA 4ISNA 3LGYA 1AVGH 4MG3A 1MQ5A 1O34A 2CHAC 4GSOA 3SNCA 4INHA 1XUJA 2PKSC 3TNTA 5DP9A 1IQFA 1O2ZA 4X6NA 1WUNH 3KHVA 1TWXB 2XCNA 4BTTB 3A7ZA 2ALVA 1W13U 9ESTA 2VNTA 4JYTA 1MAXA 3SV9A 3K6YA 5J4QA 1BTYA 1IQGA 5H4IB 1V2PT 1HCGA 1HAXB 1FY4A 1P9SA 2W7UA 1MU6B 3H5CB 4ABAA 2ZHDA 2GV6A 3ATKA 2VIQA 1SL3A 3RXRA 4CHAB 1ESTA 2XW9A 1CT0E 4FUCA 1Y5UT 1V2KT 4NIVA 1SQAA 1AVWA 3AASA 2ZDVH 2GMTC 1QHRB 2J34A 2OD3B 3SU0A 3QX5H 3RM2H 3DA9B 2ZFRH 2QA9E 3RMLH 1GHXH 1K1PA 1TIOA 3L6PA 4M7GA 2ZDNA 5F8XA 4ISLA 1HJAB 4O9VA 1AUTC 1DUEA 2FLRH 2ZIQH 4K8BA 1AB9B 1C1TA 2QN5T 3MH4A 1S85A 1LO6A 2ZHWH 5EQRA 3SBKA 3V12A 2G55A 2A1DB 3DT0H 3M5OA 4X6PA 3E1XB 3SHCH 4AGKA 2H5DA 1K21H 2H1UA 2XBWA 1XUIA 1Z8JB 2ZDAH 4A7IB 4Z6AH 1Z6JH 3CENA 1SGQE 1QIXB 4PROA 1DWCH 3A82A 3SGQE 1DVAH 1ANDA 1QB1A 3F68H 1C9TA 4D76A 1GJCB 1TOCB 3IG6B 4XBCA 1GHZA 2ESTE 1MKXK 5DJ7A 1LHEH 2BLWA 5GIBA 3D62A 3SU6A 5CMXH 2FM2A 3GCNA 3QDZB 2OC1A 4I8KA 1GJAB 2ASUB 3M35A 2GT8A 5FHTA 4E7NA 1G36A 1F5RA 1UVPA 2O9QA 1BDAA 3FP6E 1O5GH 1SFQB 5IDKA 1AKSA 3O8DA 3P8NA 4FVDA 3M7QA 1B0FA 3OX7U 4AORA 1ELCA 1QRWA 1SSXA 5JB9S 1LQDB 3LC3A 2ZU3A 1ELBA 3BTDE 4I8LA 1O2OA 2ODQA 2STBE 2HALA 1PPFE 1UHBA 1SGFG 1C5QA 3MH6A 1RD3B 5JYIA 3MO3A 1G2MA 1YPGH 1P2QA 4WMEA 3WY8A 2R2MB 3QGNB 1ZTKA 1TBQH 3RXSA 3ZZDA 1EPTB 4RN6A 2ZC9H 3Q77A 1OSSA 2A0QB 4F49A 1PYTD 1C1NA 3GYLB 2ZFTA 3Q3XA 5FPSA 4IC5A 3LT3A 1YLDA 1AE5A 1V2RT 1DLEA 1P04A 1MKWK 1SFIA 3TJNA 2FTMA 1JRSA 1VGCB 5EXLA 3VGCC 2OQ5A 4GCHG 1OXGA 1KXAA 1S6HA 3FAOA 2GTBA 1PQ8A 3S7HB 2XTTB 2GP9B 1NRQH 5E8EH 1GMDF 4NCYA 5EQSA 1O2PA 1C5TA 3HK6B 1GJ7B 3Q3YA 1QJ7B 1KSNA 1V6DA 2A2XH 1C1UH 3TH2H 4ZH8A 1A0JA 1ELAA 4AZ2B 5HMAA 5DG6A 1Q31A 1E38B 4Q80A 1NRPH 4INLA 3UUZA 1QNJA 1OYQA 2NU1E 1GG6B 2GV7A 1P57B 3C27B 1SGFA 2O8UA 1MBMA 3AW0A 1PPCE 4RKOB 1BRCE 2OTVA 3NUMA 4ESTE 1GBTA 1YLCA 5DO4H 1EZUC 2VWLA 2B5TB 5PTPA 2ZF0H 1FN8A 4I32A 1DOJA 1O2LA 2ZGJA 4AYYB 2AS9A 3ZVAA 2OP9A 4X8VH 3RXKA 3TGJE 1AWHB 1KTSB 4X8TH 1E36B 2BD7A 1GWAA 3EA7A 3SOSA 2VIVA 3NXPA 2F9BH 1ZRKA 4DT7B 2TPIZ 3SJ9A 3S9AA 3BIVH 2A5KA 2ZHEH 1JXPA 3A80A 1MKWH 3ELAH 1J14A 1IQIA 5GCHF 3A89A 1GDUA 5L2ZH 2HNTC 2A4OA 4FUEA 1Q3XA 2FWWA 4K3JA 1EP5A 1OP0A 1FAXA 1VR1H 1ZHPA 3TH3H 3VB3A 1TABE 3SV7A 3STIA 1HIAB 4MTBA 4XBDA 2BHGA 4ABHA 1NTPA 3LC5A 3SV8A 4TY6A 3QLPH 4IS5A 2C90B 3RXVA 3RDZA 3ZZBA 2FXRA 4K5ZA 5C5NA 3VB6A 4ABBA 3GCTG 1AD8H 4AG1A 1KDQB 1P01A 2BDAA 1GHVH 1C1VH 1L2EA 5A2MH 2ANYA 4WH8A 1PQAA 1SPJA 4NA7A 2Y81A 3GCOA 2G51A 1EAUA 1V2QT 3P17H 3F1SB 4FU7A 1QURH 1VCQA 3RXTA 2STAE 4I33A 2P8OB 4ISIH 1AZ8A 1ZMLA 3SU3A 1P2KA 1GBCA 4E7RG 1HJAC 2AH4X 2XYAA 5CHAC 1GMCG 1AB9C 4OS7A 1UTJA 3QUMP 3OYPA 4MLFB 4MVNA 5I25A 3MH7A 1V2OT 1DS2E 2ANWA 2OC0A 1EAWA 1GHBF 3F6UH 3RMNH 4XFQA 2ANMH 1TGSZ 1A2CH 4AG2A 5HGGA 3P8OA 2A7HA 1V2ST 4K8YA 5JPMH 3VEQB 1FV9A 2Y7ZA 1FPHH 3QZQA 1FN6A 4Q2KA 2BVSH 2P3FH 1ZYOA 2ZA5A 2QC2A 2FDAA 1BBRH 1H4WA 1TYNA 1FY1A 5K7RA 2BDCA 4X1QU 5FXLA 2AMDA 1XMNB 2F9PA 1ABIH 1O5AB 4DIIH 1J15A 1G30B 3BSQA 3TU7H 3UNSA 1ANEA 4JYVH 2VWNA 2WPMS 1ETTH 4IN2A 5DPAA 4ZKNU 2ZPRA 1O5DH 4I8HA 2PSXA 4DOQA 2VIOA 4JZEH 8GCHF 1LVOA 1KY9A 2HWLB 1RJXB 4K1EA 1JOUB 1WQVH 1NY22 2A4RA 3T26A 5C20A 4IMZA 4HI3A 5EU8A 1ZRBA 2B9LA 4WMFA 1SR5C 4Y71A 1LHFH 2J4IA 4WMDA 1ANCA 5C3NA 3SV6A 1AGJA 1YBWA 2ZP0H 1T8LA 4KTUA 2G5VA 2BY9X 2QY0B 1OWIA 2Z7FE 4GHQA 5FBIA 5JB8S 3TJOA 1O35A 1W14U 1Y8TA 1PPEE 3I78A 7ESTE 1GJBB 5LH8A 4AX9H 1LHDH 3ODFA 1GBMA 3HGPA 1G9IE 1SC8U 5C1XA 1KXBA 1BBRE 2VWMA 1ZPBA 1LCYA 1QB6A 1HXFH 1A5IA 1G32B 2Q6FA 1EPTC 1AN1E 2AMPA 1C1MA 1O3EA 4XDEA 4JMYA 1JIRA 3PLPA 3S9BA 4XBBA 2PGQB 5T6FA 3BN9A 2J95A 1QJ6B 1UVSH 1V2JT 1O2TA 3GDVA 3RC6A 2IPHA 4DY7B 2GZ7A 1LVBA 3MI4A 4B73A 3EQ0H 3LJJA 2F91A 4X1RU 5GXPA 3GCHB 2O8MA 2GCTB 1CHOF 1SLUB 1YKTA 2J94A 6GCHG 1C2JA 3CS7A 2NU3E 3S9CA 3A87A 3T2NA 4X8UH 3E3TA 3F9EA 4ABEA 1O3PB 1SLWB 4LK4A 1DITH 1CQQA 1ELTA 3PO1B 4ZUHA 1TMBH
chains in the Genus database with same CATH superfamily
2V3HH 1C5NH 1JMOH 2PTCE 1GVZA 2Q1JA 5AFYH 3RXMA 3E91A 3MYWA 1V3XA 4MPVA 4D9RA 1GG6C 1ELDE 2FS9A 1SBWA 2AMQA 2RA3A 3UY9A 4E06H 1XXDA 2AFQB 3GY5A 2BVRH 2YNAA 1B0EA 5E2OA 1OKXA 1BQYA 3H09A 1RGQA 4O03A 1W10U 1ZLRA 2RA0A 1SQTA 3PLKA 1K1OA 4CBNA 5AF9H 2BY8X 3ZVBA 1LQEA 2ALPA 3OTJE 3KN2A 2YOLA 3SJ8A 4JZDH 1C2LA 4ZXYH 1NU9A 2PP6A 1H9IE 4WXVA 5T1VA 1ZTLA 4NA9H 1K1LA 4NIXA 1OWJA 1ZPZA 4LXBH 3T5FH 2TIOA 2BQWB 4H4FA 2BD3A 3U8RH 4NIYA 3SUGA 2PFEA 3M3TA 2TGPZ 3SNBA 1FONA 4BNRA 4JZFH 4K60A 2D8WA 3EYDA 3A8BA 2TRMA 1JIMA 3MHWU 4ASHA 1GBIA 1JRTA 3BG8A 2GX4A 5E0GA 5A0AE 2FPZA 2A7JA 2H2ZA 2F9UA 4BAHB 3QK1A 2HOBA 4ZROA 2FOHA 2QF0A 3SJOA 2A5IA 1ZJKA 2VVUA 2H9HA 1Q2WA 1O2VA 2Q6GA 5GDSH 2Z9IA 2ZTYA 3BF6H 6ESTA 2W6JD 1K1NA 1HAVA 4AOQA 1S0QA 1YGCH 1C1WH 3E0NB 1AMHA 5AHGH 2UWPA 2PTNA 4IN1A 1P2NA 2FOGA 2G8TA 2K1QA 2FOEA 1K1IA 5CDFE 1D6RA 3NK8A 5T6DA 4X2YA 3RXQA 1P2JA 2G00A 1IHTH 2CJIA 1HJ8A 2G52A 3A81A 2BD4A 4Q7ZA 1MTUA 1HAYB 3TNSA 3SJKA 1TX7A 2FOAA 5GPIB 4D9QA 2SGQE 2VB0A 1IQHA 1T8MA 1O2SA 4P00A 2WV9A 2O8LA 4J2YB 3G01A 1HV7A 1FX0B 3TK9A 1YP9A 3KGPA 3TPIZ 3S0NA 1UW7A 2P8OC 2HVXA 3K9XB 1O5CB 4MNWA 5E0HA 3UAIC 3UR6A 1V2UT 3SU4A 2GJGA 3FFGA 3LGIA 2EC9H 1GGDB 5EW2H 1DFPA 3OY6U 3VXEH 7KMEH 3V0XA 2P93A 2QXIA 2W26A 3A8CA 2ZPSA 4M9FA 3RU4E 1SKYE 2XBXA 1UO6A 1S5SA 2A31A 1GBAA 2Z9JA 3ATIA 3HGNA 3RLYH 4BTUB 2BQ6B 4VGCB 3SGBE 1L1JA 1QCPA 4MDSA 2O8TA 2V6NA 2ZFSA 2BYAX 1H8DH 3CP7A 5J4SA 1V2NT 2GZ9A 3IWMA 4R0IA 3FZZA 3RMMH 4K1TA 1XXFA 1C2KA 2XOKD 5LGOA 1CGIE 1O3BA 1O2WA 1TBRH 2Y6TA 4Y79A 1P0SH 5DP4A 3NKKA 3SUFA 2VVVA 3ZZCA 4NSYA 3SGAE 1E1QD 4DG4A 2D2DA 1Y3UA 2OBOA 1ELEE 1ELVA 1C2EA 3BG4B 5A8XA 3KF2A 4ZHAA 1EP6A 3RLWH 2HLDD 3KNXA 1FMGA 3EE7A 4ZKOU 1O5EH 1F2SE 3SQEE 2NU2E 4IGDA 1AHTH 1LVMA 1G3BA 2VVCA 1E1RD 2VU8E 1QBNA 1F0TA 3L3TA 4B6EA 1ETSH 1GI5A 3TK5A 4YLUA 3TGKE 4MPXA 2BX3A 1F92A 2IN2A 3M36A 4WJG2 1NPMA 2FX4A 1XUHA 5K0HA 3ZZ3A 3VG8A 2G81E 1TNHA 1XKAC 1Z8IB 4FUGA 2ZCKP 1DSUA 3LKWA 3TJVA 1FIZA 3WW7A 3WWBA 2ZGXH 1AUJA 2F4LA 1CE5A 1Y5AT 3VB4A 2QAAA 4I8GA 2Z3DA 4DVAU 3LGVA 4RKJB 1P3EA 3ENSB 1TNJA 4U32A 4X0WU 2H5CA 2JJ2D 1QA7A 3W1EA 4RSPA 3QN7A 5A0CA 1C5UA 1LDTT 1ACBE 3E90B 4FUDA 4IC6A 1C2HA 2WYGA 3P70B 4B2AA 1A4WH 4AN7A 4GAWA 1KXFA 5FAHA 2VINA 3AW1A 1LKAA 1AFQB 1WTHD 3SQHE 1DWEH 1LPGB 3VPKA 2WPIS 3R3GB 1AY6H 5B6LA 1C1PA 1K28D 2RG3A 1GI3A 1QRXA 3WWFA 1N8OB 3GCHC 1SGPE 2GCTC 1C5SA 4ISHH 1GVKB 1F7ZA 3ZYEA 4TPYA 3ZVEA 1ZZZA 1MCTA 2BOHB 5ETXA 2AERH 4B71A 1AVXA 4BOHA 2UUYA 1TMUH 5T3HA 5HM2A 4NFEA 2WINI 3TK6A 2J97A 3PO1C 1D3TB 4X2WA 2KAIA 1S84A 1G3CA 1MU8B 2SGPE 3A7VA 1S81A 3MU1A 1O2KA 1QFKH 2R2WU 2ZTZA 1YPJH 5JBBS 3RXOA 3M5NA 4DT4A 1UK2A 1CBWB 3DSPA 4UE7H 1FY3A 2BDYA 3PROA 2WYJA 4UFGH 5DGJA 2ZU5A 2O8WA 3RM0H 1SLXB 3ITIA 1E34B 1OWDA 1OWHA 3RXPA 4Z0KA 3GY3A 1W2KH 3PRDA 1A61H 1MKXH 2VWOA 1O3HA 1WOFA 1LTOA 2XBYA 3FVFB 3KQBA 1ZHRA 4Z1MD 2BX4A 4FUFA 2RDEA 3MU4A 1SGNE 5DP6A 5A0BA 2HRVA 2LNCA 2CF8H 1TMTH 1H8IH 3LPRA 1WSSH 2ZCLP 3CS0A 3HK3B 3SZEA 1FZZA 1G37A 1RTKA 1LHCH 4OS4A 3HKIB 1A7SA 3PV2A 1YLNA 2VH0A 3UREA 3K2UA 3FZDA 5EPNA 2JIZD 5GCHG 1P2IA 3I77A 4BANB 1ANBA 1EUFA 3MNCA 2Z9GA 3P95A 3URCA 3VXFH 3PMJA 4JCNA 2BB4A 1QBVH 3LJOA 3OEED 4FUHA 5CE1A 2QIQA 3TIUA 1DANH 1RRKA 1O32A 1MUEB 2OC7A 2ZGCA 3DHKH 1N1LA 1G3EA 3A7XA 4YLQH 2J92A 3PM3A 3PLBA 2XC4A 1A1RA 1DUAA 1OS8A 5JBAS 1XUGA 1OP2A 3ZZAA 4ABIA 1EB2A 2ZKSA 1ZOMA 5L30H 1QBOA 1K1JA 2SNWA 2J2UA 2W6ID 1F0RA 3ATMA 2W3IA 3QWCH 3SNAA 2ZGBH 4UONA 1CT4E 1D6WA 1ELFA 4GLYA 1O37A 2GT7A 3F3BA 5EXMA 3M7UA 1C1QA 4NSVA 1LVYA 1SI5H 1TLDA 2OUAA 4CRCA 2ILNA 1O2GH 1S82A 2PV9B 2FI5E 1AO5A 3SI3H 4TWWA 4AGJA 4Y0YE 3UOUA 4UD9H 3DD2H 4OS2A 3QGJA 1BTXA 3KEEA 1TPOA 3KCGH 2F3CE 2QE7D 3ZYDA 5HXFA 1GI9B 4TPIZ 1OWEA 1XM1A 1GHWH 3M61U 1GGDC 1OPHB 4F4OC 2JDID 4SGBE 3I29A 1BZXE 3F9FA 2VGCB 1YPEH 4Q7YA 1A3BH 1YF4A 1O2QA 4B75A 1T31A 5L2YH 4ABFA 4FU8A 2FOCA 1QL7A 3BTWE 3QZRA 1RS0A 1HRTH 5JDUB 1GHBG 3RXGA 3SI4H 1TQ0B 1XUFA 3OEHD 1GBEA 2SFAA 4CRGA 3U9AH 1CA0B 2H9TH 3KIDU 1C2MA 3A8DA 3F0PA 4CHAC 1F5KU 4XE4A 1O3OA 4VGCC 2TGAA 2WHXA 1VJAU 1KYNA 1WBGB 2IOTA 1XX9A 2QXGA 1HAGE 4NA8A 2C8YB 1MCVA 2XXLA 2C4FH 2FEQH 1YPLH 1O3GA 1Z8GA 2BXTH 1MMJN 5DK1A 1HPGA 1LPKB 3AK5A 2Z3CA 4F55A 1GI6A 1PPZA 1ABJH 2G4TA 1C5WB 3NZIA 1EJMA 2PKAA 5FL7D 3BG4C 1FPCH 1SB1H 5BRRE 4FU9A 4DW2U 1VCPA 1BMFD 1UTNA 8GCHG 1NBMD 3T25A 4A1VA 1DPOA 2V3OH 1TNLA 5C1YA 1C5ZB 4X1SU 4H42U 7GCHG 4O3TA 4CH8B 1YCPK 2CHAB 3GYMA 4WVPE 4QT8C 1EFRD 4MNVA 3ATLA 2ZQ1A 5FPYA 1UTMA 2QXJA 2WPJS 6CHAB 1YC0A 2W5EA 3Q76A 1K2I1 1P9UA 3M3VA 1FNIA 1GJ8B 3HKJB 2Z9KA 5F6MA 1CU1A 1DY9A 2BLQA 1HDTH 1O3FA 4GUXA 3DCLA 2DUCA 4ABDA 3AAUA 3LGTA 3GY8A 2I6SA 3PMHB 1C5RA 4OS1A 1MTNB 2XWAA 1OP8A 5B6OA 1DXPA 3L33A 2FS8A 2GMTB 1AKSB 1QL9A 4UEHH 2KM0A 3ZVCA 1DSTA 2CXVA 1O2HA 1UCYK 2ZG0H 1CGJE 2FO9A 4FXGH 1OX1A 1TPPA 3GICB 3SU2A 2NU4E 4BAQB 1GMCF 3NWUA 1B7XB 1MD8A 1NRSH 3PWCA 4ZMAH 1LKBA 1ID5H 1UHBB 2M5TA 2FI4E 2ODPA 2OC8A 4KTCA 1C5MD 2Y7XA 1RXPA 4YXWD 2PGBB 5LPFA 1IQLA 1BRBE 2NWNA 1TE0A 2FX6A 1EQ9A 1EZXC 1MH0A 1UTPA 2FESH 3DFLA 2P16A 5FX6A 3SORA 1CHOG 2AGIX 4OGYA 5FPTA 2ZU4A 3M5LA 4X1PU 2Z3EA 3RXBA 4Y7BA 3STJA 1NS3A 4X1NU 1A5HA 1NROH 1H9HE 4OS6A 1O3AA 3UOPA 1ELGA 1UVOA 1QB9A 2BD5A 1OOKB 2Z9LA 1CBWC 5SGAE 3ZVGA 1ZGVA 5EOKA 2WPLS 1LPZB 1VGCC 3RC4A 3RXFA 1U6QA 2V3MA 2XRCA 3RXUA 2ZFQH 1P8VC 2BZ6H 1FJSA 3U69H 2OLGA 2ZWLH 1D4PB 4OS5A 4R8TB 1MABB 1C2DA 2A7CA 4FUBA 1P06A 1QZ8A 1A3EH 2AGEX 3P92A 4BTIB 1GBLA 5JBTA 1W3CA 4XSKU 4DURA 3LU9B 1GPZA 1KXDA 1C1OA 1S0RA 4ZXXH 2SGDE 4A1TA 3UQVA 5TCAA 3OAAD 2FYRA 1ETRH 5KEDA 4Y8XA 1WV7H 9LPRA 1GDQA 4GVUA 2F9OA 1VITH 3GOVB 1HJ9A 1QY6A 1IQMA 2R3UA 1BA8B 2QGRA 1UMAH 2Y82A 1UVUH 1FUJA 3GY2A 2GCHF 1QQ4A 1O36A 1SGYE 3LH3A 1GHAF 2J98B 1W11U 1QR3E 1BHXF 3RMOH 3UWJH 4NIWA 4JK6A 1GBJA 3ZVFA 3A83A 3ODDA 3MO6A 2BDHA 3EAJA 3T29A 3VB7A 4MPUA 3A7TA 1NZQH 8ESTE 4UFDH 3MO9A 4GHTA 3SYJA 1C9PA 3EE0B 1EPTA 2BY6X 3TJUA 1VITF 1ZMNA 1H9LB 1BRAA 1ZSJA 1CSOE 2OQUA 1QA0A 4NWLA 2HPPH 1C4V2 1NRRH 4YT7H 4BAMB 3GISB 1K9OE 3RU4T 1PPGE 4Y76A 3DUXH 1AFEH 4WF8A 2XWBI 2GDDA 4Y8YA 1YPMH 1GI4A 1TX6A 3OU0A 2D1JA 2F9VA 1J17T 4JZIA 1CO7E 2Y5FA 2OBQA 1G3DA 1WCZA 1HAZB 2JETB 3BEUA 5ESTE 3PMAB 2AEIH 1FI8A 2CN0H 1O38A 1C1RA 2ZU1A 2FOBA 4CBOA 3B9FH 2ZDLA 1KLTA 2BOKA 4MPWA 3U98H 1W0JD 3UNRA 3MU0A 1Y59T 2PW8H 2BQ7B 1H8HD 1ZPCA 2VGCC 3A7WA 3KQEA 2JH5D 5IYTA 3GDSA 1SGDE 3SNEA 1HXEH 5C2ZA 1X7AC 1TRYA 1GMHF 1RTFB 4B76A 3K6ZA 3OFND 4LZ4B 2C8ZB 1PJPA 5EQQA 1CA0C 1P11E 1VZQH 2NU0E 3SO3A 1O31A 1T8NA 2P94A 5FCKA 1ZJDA 2PR3A 1YPKH 2EA3A 2EI7A 2UUFB 1TGTA 2D26C 5AVDA 4Q63A 4YO9A 3MNSA 3MNBA 3EGKH 1UK4A 1F0UA 4THNH 2GDEH 1GL1A 1O3NA 1YPHE 3V3MA 3TGIE 4WY3A 3V7TA 4Y11E 2OK5A 1EB1H 1KIGH 2ZTXA 2R9PA 1S6LA 1YWUA 1TONA 4WXIA 3UR9A 2GKVE 1C5XB 2ZHFH 1EXFA 4Y7AA 1GCTB 4A92A 3HPTB 1PPBH 1Y3WA 3ZIAD 1L4DA 1K22H 3A8AA 2AIQA 1J8AA 1UTOA 2BY7X 4I7YH 4B74A 1HIAA 3RP2A 3P8FA 3MOCA 6CHAC 3UQOA 1IAUA 2WPKS 5EXNA 3O8BA 3AVZA 1PQ7A 1P03A 1JBUH 2BDIA 1S6FA 1HAPH 2XCFA 1UK3A 1F0SA 3FOAA 1DDJA 1NESE 3N7DA 5JBCS 1O39A 3LDXH 1SLVB 1KDQA 3SHAH 3NPSA 2BDGA 1O2RA 3D49H 3IITA 3LIWA 4YOJA 1KXEA 2ZEBA 1MTNC 4A6LA 2Y5HA 5CHBA 1J9CH 1EJNA 3FO8D 4WH6A 3MU5A 1FY8E 4D8NA 4HFPB 3F9HA 4AYVB 3GDUA 1E0FD 1NFUA 1WAYB 1V2MT 3U8OH 1DE7H 3DSGA 1C4Y2 2UWLA 5FCRA 1GHYH 2PHBA 5CHAB 5LPEA 1UVTH 3MMGA 5F8ZA 3SZNA 4ZAEA 4Y0ZE 2SGAA 5FBEA 4Y8ZA 4CRDA 3F9GA 2C93B 5I46H 1ESAA 4B6FA 2WV5A 5A8YA 4AB9A 3B23B 4X6MA 3MNXA 2Y5GA 1SGTA 3BTME 3CNRA 1ARBA 3M37A 1P10A 3A88A 3SU1A 1T7CA 2TGTA 1MZAA 1TBZH 4TSFD 3FP8E 5AFZH 3LOXA 1SHHB 1BCUH 3V13A 1BTHH 1ORFA 3BEFB 1O2YA 2LPRA 1S83A 4Y6DA 1O3JA 4AB8A 2YMSB 4U2WA 2FI3E 3PYHA 3SN8A 1C2IA 1D3DB 2I6QA 2J38A 2FOMB 5GWZA 1N6XA 1NN6A 1HAOH 2A45B 3SJIA 1TRMA 5LPRA 4AFUA 2V35A 2HGTH 1KLIH 1V2LT 5EW1H 2VJ1A 1W0ZU 2VH6A 3BTTE 2FIRH 1BTUA 2WSSD 1GBFA 3ZZ9A 2XNDD 4X8SH 1GMDG 2CV3A 2ZCHP 2B8OH 2A4GA 2FOFA 5BPEA 3N7OA 2SNVA 1J16A 1HNEE 1FLEE 1O2IA 1C4U2 1ZR0A 3F2FA 4TYDA 3M7TA 4NWKA 1MTWA 1QRZA 2XBVA 4RT1A 4YTAA 4KTSA 2BY5X 4YZUA 4MNXA 4ZHMU 3O8RA 5EG4A 4J1YA 1OWKA 1TX8A 3OSYA 2A4QA 1GI7B 1C5YB 4F48B 3VB5A 4BAKB 3BTEE 3ZV9A 1GVLA 1CVWH 4GPGA 2G5NA 4IBLH 4FVBA 5C17A 2AHME 1BHXB 1DM4B 1L4ZA 1O5BB 1V2TT 1W8BH 2BVXH 3KQCA 4IW4E 4YOGA 3U28C 2ZFPH 3A84A 2P59A 4KKDA 4B2BA 3OY5U 3KYGA 2KCYA 8KME2 1RTLA 3RXIA 3S7KB 1D9IA 1YYY1 1TA2A 2ZQ2A 1GBBA 2GGVB 1DY8A 2RFKC 5E0JA 4O3UA 3TH4H 2F83A 4CH2B 3GY4A 4CR9A 1THRH 3U1IB 2AYWA 3GY7A 5DP8A 2VIPA 1SGRE 1K1MA 2P95A 3GY6A 1HBTH 4KELA 2ZI2H 1P09A 1IOEA 2R0LA 2C8XB 2PUQH 2QF5A 1C1SA 1TRNA 2A32A 6LPRA 2BD8A 1BRUP 2H6MA 2BD2A 1W7GH 1BITA 1ZSLA 1HFDA 1T4UH 2IJD1 3K65B 3KQ5A 3Q3KA 2A5AA 2ZECA 1W12U 1NT1A 1SGEE 1TGCA 1V2WT 5C5OA 1QJ1B 1UTQA 2JETC 1TA6A 4ZKSU 1HAVB 2Q6DA 3UPEA 1XKBC 3NCLA 4UDWH 2J5UA 1LHGH 1WXRA 4DCDA 1C5LH 1FAKH 1UTKA 3LGUA 5DKMA 5C67A 1O3CA 3P8GA 4D7GA 2Y80A 3D23A 4GCHF 3W94A 1E37B 1EATA 2GVFA 2BTCE 3MH5A 1NC6A 1GBDA 1GJDB 1DWDH 2PLXA 5G4BA 1FDPA 1TFXA 3T27A 4U01A 1O3DA 1NO9H 1SMFE 4X2VA 4TWYA 3RU4D 1V2VT 2IJOB 1TNIA 2ZHQH 2DE9A 1O5FH 1P05A 3PWBA 1HB0B 2CF9H 3UB0A 1ESBA 2FZZA 2EEKA 1TNGA 1XVMA 2TBSA 3QTOH 1BMAA 3VFEA 4AFZA 2R0KA 2OCVB 1SGCA 2BD9A 1P2OA 3S69A 1P3CA 1TALA 4KGAA 1FQ3A 4E05H 3Q00A 2F9NA 4MQAA 1F5LA 2VIWA 3SW2B 4ZHLU 1FXYA 5DP3A 4CRBA 4WWYA 1ZTJA 3AAVA 4YT6H 2P3UB 1NFXA 3RUOA 1MAYA 4X2XA 3UTUH 1P12E 2BMGB 2B0FA 1UJ1A 1EAXA 1ZSKA 4Q7XA 2BDBA 5HYOA 3R0FA 1MZDA 2M2AA 4A1XA 1UTLM 1Y5BT 2ULLA 1AWFH 1VJ9U 1GCTC 5A8ZA 3DSOA 1RIWB 1W0YH 3A85A 2ZNKH 1ARCA 1P02A 1BBRK 1COWD 5HM9A 1EZSC 7LPRA 2WUCA 1HAIH 3RXEA 1DICA 4Y10E 2W3KA 1PQ5A 4RT0A 2QV1A 1Z6EA 3M5MA 1O2NA 2HLCA 3F2GA 3PMBB 1IQNA 5ESBA 2BLVA 1O3IA 4O97A 1NFYA 3MTYA 2DE8A 3RXJA 1GI0A 3M3SA 1GJ5H 4UFFH 2AGGX 1NRNH 1EKBB 1TB6H 1O0DH 3P6ZB 3SUDA 3MU8A 1O2XA 3FP7E 1C5VA 4BXWA 1LMWB 1EX3A 4NFFA 3E16B 1BB0B 1EAIA 2PWXA 1KLJH 3N7EA 2CGAA 5F53A 2HNTF 2HPQH 4JK5A 2Z94A 2W7SA 4NZLA 1GJ4H 4X6OA 1VKYA 4YM9A 4SGAE 1VCWA 4ISOA 4AC9A 1BTWA 2PKSB 1GI1A 3GCTF 4CRAA 2JKHA 2OXSA 2QCYA 3BIUH 4AFSA 1GJ9B 2HNTE 4OGXA 2FMJA 3BTHE 1OYTH 1W7XH 1WDIA 3TVJB 2SGFE 3LH1A 1DLKB 2ZPQA 3SUEA 3RXAA 3ZZ8A 1N6YA 1NFWA 1WYKA 4FUIA 3PTNA 2BM2A 1SOZA 1T8OA 3HATH 1EOJA 4KP0A 1FIWA 1BJUA 2WPHS 4H6SB 4FOUC 1SHYA 3EDXB 5A09A 2QYIA 2ZZUH 1T32A 3BV9B 1ZHMA 2YMSC 1Y3VA 1Z7KA 1PPHE 1A0HB 3PV4A 3RXHA 1K0HA 1DX5M 3JZ2B 2FLBH 1KMHB 1SG8B 1AFQC 1C5PA 4INKA 1Z8RA 5C1UA 1AI8H 3RXLA 3EA9A 1BTPA 3QTVH 4ASUD 2EI8A 1CHGA 1N8OC 3BEIB 1IQJA 3PTBA 5F8TA 2F43B 5GJ4B 1THSH 1GBHA 7GCHF 2XC0A 2KAIB 1E35B 5FX5A 1BUIA 1MTSA 4HG6A 1NM6A 2J9NA 4JZ1A 4NGAH 2LP6A 3FANA 3LONA 3UIRA 2ZU2A 2JH0D 3A86A 3SV2H 3O8CA 4K69A 1T4VH 1ZMJA 2RCEA 4YOIA 1ZGIA 1MD7A 1A46H 1Y3XA 2VBCA 2XNIA 5TJXA 3LGWA 1YCPH 1AZZA 1GL0E 1EOLA 1IHSH 1NU7B 3B8JA 2EY4C 2EI6A 1CT2E 1O33A 1Z1IA 5ABWA 1TQ7B 3ZZ7A 1SVPA 5EODA 3EA8A 2BLOA 4DGJA 2C8WB 2GCHG 3BTQE 3N99A 2THFB 2ZFFH 1L1NA 1GHAG 4BAOB 2ANKH 2FP7B 1A5GH 1XUKA 2JH6D 3ATWA 5EGMA 1WTGH 1BMMH 3URDA 4BXSA 1WQSA 1BIOA 1AE8H 2YNBA 2KFWA 4ABJA 1THPB 5DP5A 2RDLA 2ZDMA 1TOMH 2OINA 4ZKRU 2UUJB 1AIXH 1AQ7A 1O2MA 1KTTB 1BTZA 4IMQA 1HYLA 1HLTH 1VITG 3RXDA 1PFXC 1QL8A 5F03A 8LPRA 4CREA 3C1KA 1UCYH 1PYTC 2CMYA 3PB1E 2PSYA 5HIYA 2QF3A 1O3MA 1BMLA 1MQ6A 1TGNA 1BJVA 1Z71A 3E8LA 1CGHA 1YM0A 1TPSA 3UWIA 1O3KA 1QGFA 1JWTA 4AFQA 3BTFE 2G4UA 3D65E 1HAHH 1HGTH 1XVOA 2ODYB 1FY5A 4UFEH 1O30A 1D3PB 2BZAA 3UFAA 4LOYH 4D7FA 1CA8B 2A2QH 1EZQA 1SOTA 1O3LA 3ZZ5A 4YESB 4I8JA 1INCA 5KECA 2KCAA 4I31A 3VGCB 2SGEE 3MQKC 1IQEA 4FUJA 3TLOA 1BOQA 1MTVA 2ZO3H 3OE7D 4MNYA 3U1JB 4DIHH 4HTCH 2R3YA 6GCHF 4TY7A 2FYQA 1YPHC 3MWIU 4OM9A 1SQOA 1TNKA 1GMHG 3RC5A 3T28A 3E0PB 1IQKA 2Z6BD 2B7DH 1QQUA 2BXUH 1DXWA 3E6PH 4B1TA 2TGDA 1GI8B 1UCYE 2PUXB 1TPAE 1L0ZA 1GJ6A 4NZQA 1M9UA 1Y3YA 1P2MA 2FODA 3TITA 2QXHA 4XRNA 3ZZ6A 4CR5A 3KL6A 3KQDA 3QO6A 4DJZB 3ZV8A 5E2PA 1KXCA 2ZGHA 4FETA 1HUTH 2GD4B 4XD7D 4K1SA 4H6TA 1GCDA 4ABGA 3BTKE 5T6GA 1MBQA 1A0LA 3MFJA 4A5TS 2UUKB 4HZHA 5DN6D 1C5OH 3DFJA 2H9EH 3JZ1B 2VIDA 1GBKA 5TCCA 5L6NH 3SU5A 2UWOA 1C2FA 3ESTA 1AU8A 1RIWC 3W95A 2P3TB 2C3SA 1GDNA 1TAWA 5DP7A 1D3QB 4B2CA 1H1BA 3ZVDA 4CRFA 4K2YA 3ZZ4A 2XC5A 2EQNA 3U8TH 3H7TA 1O2UA 1YCPM 2V0BA 4JYUH 1O2JA 2PKAB 1SGIB 3H7OA 3UNQA 2FTLE 2AIPA 3BTGE 3RXCA 3T62A 1RFNA 1BT7A 2ZDKA 1DT2A 1C2GA 2WUBA 4LZ1H 4U30A 1L1GA 1TGBA 3A7YA 1GI2A 4XOJA 4HGCA 1EJAA 1WU1A 3KYFA 1EASA 2WV4A 1Z1JA 5EPYA 4NG9H 1DWBH 1BMNH 1G2LA 1QTFA 2GZ8A 1B5GH 3SNDA 4ISNA 3PRBA 3LGYA 1AVGH 4MG3A 1MQ5A 1O34A 2CHAC 4GSOA 3SNCA 4INHA 1XUJA 2PKSC 3TNTA 5DP9A 1IQFA 1O2ZA 4X6NA 2WPDD 1WUNH 3KHVA 1TWXB 2XCNA 4BTTB 3A7ZA 2ALVA 1W13U 9ESTA 2VNTA 4JYTA 1MAXA 3SV9A 3K6YA 5IK2D 5J4QA 1BTYA 1IQGA 5H4IB 1V2PT 1HCGA 1E79D 1HAXB 1FY4A 1P9SA 2W7UA 1MU6B 3H5CB 4ABAA 2ZHDA 2GV6A 2L74A 2VIQA 1SL3A 3ATKA 3RXRA 4CHAB 1ESTA 2XW9A 1CT0E 2KCPA 4FUCA 1Y5UT 1V2KT 4NIVA 1SQAA 1AVWA 3AASA 5EJZA 2ZDVH 2GMTC 1QHRB 2J34A 2OD3B 3SU0A 3QX5H 3RM2H 3DA9B 2ZFRH 2QA9E 3RMLH 1GHXH 1K1PA 1TIOA 3L6PA 4M7GA 2ZDNA 5F8XA 4ISLA 1HJAB 4O9VA 1AUTC 1DUEA 2FLRH 2ZIQH 4K8BA 1AB9B 1C1TA 2QN5T 3MH4A 1S85A 1LO6A 2ZHWH 5EQRA 3SBKA 3V12A 2G55A 2A1DB 3DT0H 3M5OA 4X6PA 3E1XB 3SHCH 4AGKA 2H5DA 2YMSD 1K21H 4ACBA 2H1UA 2XBWA 1XUIA 1Z8JB 2ZDAH 4A7IB 4Z6AH 1Z6JH 3CENA 1SGQE 1QIXB 4PROA 1DWCH 3A82A 3SGQE 5DSFA 1DVAH 1ANDA 5C0UA 1QB1A 3F68H 1C9TA 4D76A 1GJCB 1TOCB 3GS9A 3IG6B 4XBCA 1GHZA 2ESTE 1MKXK 5DJ7A 1LHEH 2BLWA 5EJ1A 5GIBA 3D62A 3SU6A 5CMXH 2FM2A 3GCNA 2WZQA 3QDZB 2OC1A 4I8KA 1GJAB 2ASUB 3M35A 2GT8A 5FHTA 4E7NA 1G36A 3F2HA 1NBME 1F5RA 1UVPA 2O9QA 1BDAA 3FP6E 1O5GH 1SFQB 5IDKA 1AKSA 3O8DA 3P8NA 4FVDA 3M7QA 1B0FA 3OX7U 4AORA 1ELCA 1QRWA 1SSXA 5JB9S 5KGOA 2KX4A 1LQDB 3LC3A 2ZU3A 1ELBA 3BTDE 4I8LA 1O2OA 2ODQA 2STBE 2HALA 1PPFE 1UHBA 1SGFG 1C5QA 3MH6A 1RD3B 5JYIA 3MO3A 1G2MA 1YPGH 4RI0A 1P2QA 4WMEA 5EIYA 3WY8A 2R2MB 3QGNB 1ZTKA 1TBQH 3RXSA 3ZZDA 1EPTB 4RN6A 2ZC9H 3Q77A 1OSSA 2A0QB 4F49A 1PYTD 1C1NA 3GYLB 2ZFTA 3Q3XA 5FPSA 4IC5A 3LT3A 1YLDA 1AE5A 1V2RT 1DLEA 1P04A 1MKWK 1SFIA 3TJNA 2FTMA 1JRSA 1VGCB 5EXLA 5GNDA 3VGCC 2OQ5A 4GCHG 1OXGA 1KXAA 1S6HA 3FAOA 2GTBA 1PQ8A 3FKSD 3S7HB 2XTTB 2GP9B 1NRQH 5E8EH 1GMDF 4NCYA 5EQSA 1O2PA 1C5TA 3HK6B 1GJ7B 3Q3YA 1QJ7B 1KSNA 1V6DA 2A2XH 1C1UH 3OTPA 3TH2H 5HIZA 4ZH8A 1A0JA 1ELAA 4AZ2B 5HMAA 5DG6A 5C94A 2QF4A 1Q31A 1E38B 4Q80A 1NRPH 4INLA 2LELA 3UUZA 1QNJA 4ZCNA 1OYQA 2NU1E 1GG6B 2GV7A 1P57B 3C27B 1SGFA 2O8UA 1MBMA 4Q4LA 3AW0A 1PPCE 4RKOB 1BRCE 2OTVA 3NUMA 4ESTE 1GBTA 1YLCA 5DO4H 1EZUC 2VWLA 2B5TB 5PTPA 2ZF0H 1FN8A 4I32A 1DOJA 1O2LA 2ZGJA 4AYYB 2AS9A 3ZVAA 2J98A 2OP9A 4X8VH 3RXKA 3TGJE 1AWHB 1KTSB 4X8TH 1E36B 2BD7A 1GWAA 3EA7A 3SOSA 2VIVA 3NXPA 2F9BH 1ZRKA 4DT7B 2TPIZ 3SJ9A 3S9AA 3BIVH 2A5KA 5HKKD 2ZHEH 1JXPA 3A80A 1MKWH 3ELAH 1J14A 1IQIA 5GCHF 3A89A 1GDUA 5L2ZH 2HNTC 2A4OA 4FUEA 1Q3XA 2FWWA 4K3JA 1EP5A 1OP0A 1FAXA 1VR1H 1ZHPA 3TH3H 3VB3A 2IPQX 1TABE 3SV7A 3STIA 1HIAB 3NRLA 4MTBA 4XBDA 2BHGA 4ABHA 1NTPA 3LC5A 3PV5A 4TY6A 3SV8A 3QLPH 4IS5A 2C90B 3RXVA 3RDZA 3ZZBA 2FXRA 4K5ZA 5C5NA 3VB6A 4ABBA 3GCTG 1AD8H 4AG1A 1KDQB 4ACAA 1P01A 3F0OA 1OHHD 2BDAA 1GHVH 1C1VH 1L2EA 4I86A 5A2MH 2ANYA 4WH8A 2KR7A 1PQAA 1SPJA 2JJ1D 4NA7A 2Y81A 3GCOA 2G51A 1EAUA 1V2QT 3P17H 3F1SB 4FU7A 1QURH 1VCQA 3RXTA 2STAE 4I33A 2P8OB 4ISIH 1AZ8A 1ZMLA 3SU3A 1P2KA 1GBCA 4E7RG 2HVYB 1HJAC 2AH4X 2XYAA 5CHAC 1GMCG 1AB9C 4OS7A 1UTJA 3QUMP 3OYPA 4MLFB 4MVNA 2KZ4A 5I25A 3MH7A 1V2OT 1DS2E 2ANWA 2OC0A 1EAWA 2KCOA 5C0TA 1GHBF 3F6UH 3RMNH 4XFQA 2ANMH 1TGSZ 1A2CH 4AG2A 1H8ED 5HGGA 3P8OA 2A7HA 1YY3A 1V2ST 2V7QD 4K8YA 5JPMH 3VEQB 1FV9A 2Y7ZA 1FPHH 3QZQA 1FN6A 4Q2KA 2L6OA 2BVSH 2P3FH 1ZYOA 2ZA5A 2QC2A 2FDAA 1BBRH 1H4WA 1TYNA 1FY1A 5K7RA 1SQRA 2BDCA 4X1QU 5FXLA 2K0QA 2AMDA 1XMNB 2F9PA 1ABIH 1O5AB 4DIIH 1J15A 1G30B 3BSQA 3TU7H 3UNSA 1ANEA 4JYVH 2VWNA 2WPMS 1ETTH 4IN2A 5DPAA 4ZKNU 2ZPRA 1O5DH 4I8HA 2PSXA 4DOQA 2VIOA 4JZEH 8GCHF 1LVOA 1KY9A 2HWLB 1RJXB 4K1EA 1JOUB 1WQVH 1NY22 2A4RA 3T26A 5C20A 4IMZA 4HI3A 5EU8A 1ZRBA 2B9LA 4WMFA 1SR5C 4Y71A 1LHFH 2J4IA 4WMDA 1ANCA 5C3NA 3SV6A 1AGJA 1YBWA 2ZP0H 1T8LA 4KTUA 2G5VA 2BY9X 2QY0B 1OWIA 2Z7FE 4GHQA 5FBIA 5JB8S 3TJOA 1O35A 1W14U 1Y8TA 1PPEE 3I78A 4P02A 1GJBB 7ESTE 5LH8A 4AX9H 4TT3D 1LHDH 3ODFA 1GBMA 3HGPA 1G9IE 1SC8U 5C1XA 1KXBA 1BBRE 2VWMA 1ZPBA 5EJLA 1LCYA 1QB6A 1HXFH 1A5IA 1W0KD 3FN8A 1G32B 2Q6FA 1EPTC 1AN1E 2AMPA 1C1MA 1O3EA 4XDEA 4JMYA 1JIRA 3PLPA 3S9BA 4XBBA 2CK3D 2PGQB 5T6FA 3BN9A 2J95A 1QJ6B 1UVSH 1V2JT 1O2TA 3GDVA 3RC6A 2IPHA 4DY7B 2K8IA 2GZ7A 1LVBA 3MI4A 4B73A 3EQ0H 3LJJA 2F91A 4X1RU 5GXPA 3GCHB 2O8MA 2GCTB 1CHOF 1SLUB 1YKTA 2J94A 6GCHG 1C2JA 3CS7A 2NU3E 3S9CA 3A87A 3T2NA 4X8UH 3E3TA 3F9EA 4ABEA 1O3PB 1SLWB 4LK4A 1DITH 1CQQA 1ELTA 3PO1B 4ZUHA 1TMBH
chains in the Genus database with same CATH topology
2V3HH 1C5NH 1JMOH 2PTCE 1GVZA 2Q1JA 5AFYH 3RXMA 3E91A 3MYWA 1V3XA 4MPVA 4D9RA 1GG6C 1ELDE 2FS9A 1SBWA 2AMQA 2RA3A 3UY9A 4E06H 1XXDA 2AFQB 3GY5A 2BVRH 2YNAA 1B0EA 5E2OA 1OKXA 1BQYA 1RGQA 4O03A 1W10U 1ZLRA 2RA0A 1SQTA 3PLKA 1K1OA 4CBNA 5AF9H 2BY8X 3ZVBA 1LQEA 2ALPA 3OTJE 3KN2A 2YOLA 3SJ8A 4JZDH 1C2LA 4ZXYH 1NU9A 1H9IE 4WXVA 1ZTLA 4NA9H 1K1LA 4NIXA 1OWJA 1ZPZA 4LXBH 3T5FH 2TIOA 2BQWB 4H4FA 2BD3A 3U8RH 4NIYA 3SUGA 2PFEA 3M3TA 2TGPZ 3SNBA 1FONA 4BNRA 4JZFH 4K60A 2D8WA 3EYDA 3A8BA 2TRMA 1JIMA 3MHWU 4ASHA 1GBIA 1JRTA 3BG8A 2GX4A 5E0GA 5A0AE 2FPZA 2A7JA 2H2ZA 2F9UA 4BAHB 3QK1A 2HOBA 4ZROA 2FOHA 2QF0A 3SJOA 2A5IA 1ZJKA 2VVUA 2H9HA 1Q2WA 1O2VA 2Q6GA 5GDSH 2Z9IA 2ZTYA 3BF6H 6ESTA 1K1NA 1HAVA 4AOQA 1S0QA 1YGCH 1C1WH 3E0NB 1AMHA 5AHGH 2UWPA 2PTNA 4IN1A 1P2NA 2FOGA 2G8TA 2K1QA 2FOEA 1K1IA 1D6RA 3NK8A 5T6DA 4X2YA 3RXQA 1P2JA 2G00A 1IHTH 2CJIA 1HJ8A 2G52A 3A81A 2BD4A 4Q7ZA 1MTUA 1HAYB 3TNSA 3SJKA 1TX7A 2FOAA 5GPIB 4D9QA 2SGQE 2VB0A 1IQHA 1T8MA 1O2SA 2O8LA 4J2YB 3G01A 1HV7A 3TK9A 1YP9A 3KGPA 3TPIZ 3S0NA 2P8OC 2HVXA 3K9XB 1O5CB 4MNWA 5E0HA 3UR6A 1V2UT 3SU4A 3FFGA 3LGIA 2EC9H 1GGDB 5EW2H 1DFPA 3OY6U 3VXEH 7KMEH 3V0XA 2P93A 2QXIA 2W26A 3A8CA 2ZPSA 3RU4E 2XBXA 1UO6A 1S5SA 2A31A 1GBAA 2Z9JA 3ATIA 3HGNA 3RLYH 4BTUB 2BQ6B 4VGCB 3SGBE 1L1JA 1QCPA 4MDSA 2O8TA 2V6NA 2ZFSA 2BYAX 1H8DH 3CP7A 5J4SA 1V2NT 2GZ9A 3IWMA 4R0IA 3FZZA 3RMMH 4K1TA 1XXFA 1C2KA 5LGOA 1CGIE 1O3BA 1O2WA 1TBRH 2Y6TA 4Y79A 1P0SH 5DP4A 3NKKA 3SUFA 2VVVA 3ZZCA 4NSYA 3SGAE 4DG4A 2D2DA 1Y3UA 2OBOA 1ELEE 1ELVA 1C2EA 3BG4B 5A8XA 3KF2A 4ZHAA 1EP6A 3RLWH 3KNXA 1FMGA 4ZKOU 1O5EH 1F2SE 3SQEE 2NU2E 4IGDA 1AHTH 1LVMA 1G3BA 2VVCA 2VU8E 1QBNA 1F0TA 3L3TA 1ETSH 1GI5A 3TK5A 4YLUA 3TGKE 4MPXA 2BX3A 1F92A 2IN2A 3M36A 4WJG2 1NPMA 2FX4A 1XUHA 5K0HA 3ZZ3A 2G81E 1TNHA 1XKAC 1Z8IB 4FUGA 2ZCKP 1DSUA 3LKWA 3TJVA 1FIZA 2ZGXH 1AUJA 1CE5A 1Y5AT 3VB4A 2QAAA 4I8GA 2Z3DA 4DVAU 3LGVA 4RKJB 1P3EA 3ENSB 1TNJA 4U32A 4X0WU 2H5CA 1QA7A 4RSPA 3QN7A 5A0CA 1C5UA 1LDTT 1ACBE 3E90B 4FUDA 4IC6A 1C2HA 2WYGA 3P70B 4B2AA 1A4WH 4AN7A 4GAWA 1KXFA 5FAHA 2VINA 3AW1A 1LKAA 1AFQB 1WTHD 3SQHE 1DWEH 1LPGB 3VPKA 2WPIS 3R3GB 1AY6H 1C1PA 1K28D 2RG3A 1GI3A 1QRXA 1N8OB 3GCHC 1SGPE 2GCTC 1C5SA 4ISHH 1GVKB 1F7ZA 3ZYEA 4TPYA 3ZVEA 1ZZZA 1MCTA 2BOHB 5ETXA 2AERH 4B71A 1AVXA 4BOHA 2UUYA 1TMUH 5T3HA 5HM2A 4NFEA 2WINI 3TK6A 3PO1C 1D3TB 4X2WA 2KAIA 1S84A 1G3CA 1MU8B 2SGPE 3A7VA 1S81A 3MU1A 1O2KA 1QFKH 2R2WU 2ZTZA 1YPJH 5JBBS 3RXOA 3M5NA 1UK2A 1CBWB 4UE7H 1FY3A 2BDYA 3PROA 2WYJA 4UFGH 5DGJA 2ZU5A 2O8WA 3RM0H 1SLXB 3ITIA 1E34B 1OWDA 1OWHA 3RXPA 4Z0KA 3GY3A 1W2KH 1A61H 1MKXH 2VWOA 1O3HA 1WOFA 1LTOA 2XBYA 3FVFB 3KQBA 1ZHRA 2BX4A 4FUFA 5A0BA 3MU4A 1SGNE 5DP6A 2HRVA 2LNCA 2CF8H 1TMTH 1H8IH 3LPRA 1WSSH 2ZCLP 3CS0A 3HK3B 1FZZA 1G37A 1RTKA 1LHCH 4OS4A 3HKIB 1A7SA 2VH0A 3UREA 3K2UA 3FZDA 5EPNA 5GCHG 1P2IA 3I77A 4BANB 1ANBA 1EUFA 3MNCA 2Z9GA 3P95A 3URCA 3VXFH 3PMJA 4JCNA 2BB4A 1QBVH 3LJOA 4FUHA 5CE1A 2QIQA 3TIUA 1DANH 1RRKA 1O32A 1MUEB 2OC7A 2ZGCA 3DHKH 1N1LA 1G3EA 3A7XA 4YLQH 2J92A 3PM3A 3PLBA 2XC4A 1A1RA 1DUAA 1OS8A 5JBAS 1XUGA 1OP2A 3ZZAA 4ABIA 1EB2A 2ZKSA 1ZOMA 5L30H 1QBOA 1K1JA 2SNWA 2J2UA 1F0RA 3ATMA 2W3IA 3QWCH 3SNAA 2ZGBH 4UONA 1CT4E 1D6WA 1ELFA 4GLYA 1O37A 2GT7A 5EXMA 3M7UA 1C1QA 4NSVA 1LVYA 1SI5H 2OUAA 1TLDA 4CRCA 2ILNA 1O2GH 1S82A 2PV9B 2FI5E 1AO5A 3SI3H 4TWWA 4AGJA 4Y0YE 3UOUA 4UD9H 3DD2H 4OS2A 3QGJA 1BTXA 3KEEA 1TPOA 3KCGH 2F3CE 3ZYDA 5HXFA 1GI9B 4TPIZ 1OWEA 1XM1A 1GHWH 3M61U 1GGDC 1OPHB 4F4OC 4SGBE 3I29A 1BZXE 3F9FA 2VGCB 1YPEH 4Q7YA 1A3BH 1YF4A 1O2QA 4B75A 1T31A 5L2YH 4ABFA 4FU8A 2FOCA 1QL7A 3BTWE 3QZRA 1RS0A 1HRTH 5JDUB 1GHBG 3RXGA 3SI4H 1TQ0B 1XUFA 1GBEA 2SFAA 4CRGA 3U9AH 1CA0B 2H9TH 3KIDU 1C2MA 3A8DA 4CHAC 1F5KU 4XE4A 1O3OA 4VGCC 2TGAA 1VJAU 1KYNA 1WBGB 2IOTA 1XX9A 2QXGA 1HAGE 4NA8A 2C8YB 1MCVA 2XXLA 2C4FH 2FEQH 1YPLH 1O3GA 1Z8GA 2BXTH 1MMJN 5DK1A 1HPGA 1LPKB 2Z3CA 1GI6A 1PPZA 1ABJH 2G4TA 1C5WB 3NZIA 1EJMA 2PKAA 3BG4C 1FPCH 1SB1H 5BRRE 4FU9A 4DW2U 1VCPA 1UTNA 8GCHG 3T25A 4A1VA 1DPOA 2V3OH 1TNLA 5C1YA 1C5ZB 4X1SU 4H42U 7GCHG 4O3TA 4CH8B 1YCPK 2CHAB 3GYMA 4WVPE 4QT8C 4MNVA 3ATLA 2ZQ1A 5FPYA 1UTMA 2QXJA 2WPJS 6CHAB 1YC0A 2W5EA 3Q76A 1K2I1 1P9UA 3M3VA 1FNIA 1GJ8B 3HKJB 2Z9KA 5F6MA 1CU1A 1DY9A 2BLQA 1HDTH 1O3FA 4GUXA 2DUCA 4ABDA 3AAUA 3LGTA 3GY8A 2I6SA 3PMHB 1C5RA 4OS1A 1MTNB 2XWAA 1OP8A 5B6OA 1DXPA 3L33A 2FS8A 2GMTB 1AKSB 1QL9A 4UEHH 3ZVCA 1DSTA 2CXVA 1O2HA 1UCYK 2ZG0H 1CGJE 2FO9A 4FXGH 1OX1A 1TPPA 3GICB 3SU2A 2NU4E 4BAQB 1GMCF 3NWUA 1B7XB 1MD8A 1NRSH 3PWCA 4ZMAH 1LKBA 1ID5H 1UHBB 2M5TA 2FI4E 2ODPA 2OC8A 4KTCA 1C5MD 2Y7XA 1RXPA 2PGBB 5LPFA 1IQLA 1BRBE 2NWNA 1TE0A 2FX6A 1EQ9A 1EZXC 1MH0A 1UTPA 2FESH 3DFLA 2P16A 5FX6A 3SORA 1CHOG 2AGIX 4OGYA 5FPTA 2ZU4A 3M5LA 4X1PU 2Z3EA 3RXBA 4Y7BA 3STJA 1NS3A 4X1NU 1A5HA 1NROH 1H9HE 4OS6A 1O3AA 3UOPA 1ELGA 1UVOA 1QB9A 2BD5A 1OOKB 2Z9LA 1CBWC 5SGAE 3ZVGA 1ZGVA 5EOKA 2WPLS 1LPZB 1VGCC 3RC4A 3RXFA 1U6QA 2XRCA 3RXUA 2ZFQH 1P8VC 2BZ6H 1FJSA 3U69H 2OLGA 2ZWLH 1D4PB 4OS5A 4R8TB 1C2DA 2A7CA 4FUBA 1P06A 3P92A 1A3EH 2AGEX 4BTIB 1GBLA 5JBTA 1W3CA 4XSKU 4DURA 3LU9B 1GPZA 1KXDA 1C1OA 1S0RA 4ZXXH 2SGDE 4A1TA 3UQVA 5TCAA 2FYRA 1ETRH 4Y8XA 1WV7H 9LPRA 1GDQA 4GVUA 2F9OA 1VITH 3GOVB 1HJ9A 1QY6A 1IQMA 2R3UA 1BA8B 2QGRA 1UMAH 2Y82A 1UVUH 1FUJA 3GY2A 2GCHF 1QQ4A 1O36A 1SGYE 3LH3A 1GHAF 1W11U 1QR3E 1BHXF 3RMOH 3UWJH 4NIWA 4JK6A 1GBJA 3ZVFA 3A83A 3ODDA 3MO6A 2BDHA 3EAJA 3T29A 3VB7A 4MPUA 3A7TA 1NZQH 8ESTE 4UFDH 3MO9A 4GHTA 1C9PA 3EE0B 1EPTA 2BY6X 3TJUA 1VITF 1ZMNA 1H9LB 1BRAA 1ZSJA 1CSOE 2OQUA 1QA0A 4NWLA 2HPPH 1C4V2 1NRRH 4YT7H 4BAMB 3GISB 1K9OE 3RU4T 1PPGE 4Y76A 3DUXH 1AFEH 4WF8A 2XWBI 2GDDA 4Y8YA 1YPMH 1GI4A 1TX6A 3OU0A 2D1JA 2F9VA 1J17T 4JZIA 1CO7E 2Y5FA 2OBQA 1G3DA 1WCZA 1HAZB 2JETB 3BEUA 5ESTE 3PMAB 2AEIH 1FI8A 2CN0H 1O38A 1C1RA 2ZU1A 2FOBA 4CBOA 3B9FH 2ZDLA 1KLTA 2BOKA 4MPWA 3U98H 3UNRA 3MU0A 1Y59T 2PW8H 2BQ7B 1ZPCA 2VGCC 3A7WA 3KQEA 2JH5D 5IYTA 3GDSA 1SGDE 3SNEA 1HXEH 5C2ZA 1X7AC 1TRYA 1GMHF 1RTFB 4B76A 3K6ZA 4LZ4B 2C8ZB 1PJPA 5EQQA 1CA0C 1P11E 1VZQH 2NU0E 3SO3A 1O31A 1T8NA 2P94A 5FCKA 1ZJDA 2PR3A 1YPKH 2EA3A 2EI7A 2UUFB 1TGTA 2D26C 5AVDA 4YO9A 3MNSA 3MNBA 3EGKH 1UK4A 1F0UA 4THNH 2GDEH 1GL1A 1O3NA 1YPHE 3V3MA 3TGIE 4WY3A 3V7TA 4Y11E 1EB1H 1KIGH 2ZTXA 2R9PA 1TONA 4WXIA 3UR9A 2GKVE 1C5XB 2ZHFH 1EXFA 4Y7AA 1GCTB 4A92A 3HPTB 1PPBH 1Y3WA 1L4DA 1K22H 3A8AA 2AIQA 1J8AA 1UTOA 2BY7X 4I7YH 4B74A 1HIAA 3RP2A 3P8FA 3MOCA 6CHAC 3UQOA 1IAUA 2WPKS 5EXNA 3O8BA 3AVZA 1PQ7A 1P03A 1JBUH 2BDIA 1S6FA 1HAPH 2XCFA 1UK3A 1F0SA 1DDJA 1NESE 5JBCS 1O39A 3LDXH 1SLVB 1KDQA 3SHAH 3NPSA 2BDGA 1O2RA 3D49H 3IITA 3LIWA 4YOJA 1KXEA 2ZEBA 1MTNC 4A6LA 2Y5HA 1J9CH 1EJNA 4WH6A 3MU5A 1FY8E 4D8NA 4HFPB 3F9HA 4AYVB 3GDUA 1E0FD 1NFUA 1WAYB 1V2MT 3U8OH 1DE7H 1C4Y2 2UWLA 5FCRA 1GHYH 2PHBA 5CHAB 5LPEA 1UVTH 3MMGA 5F8ZA 3SZNA 4ZAEA 4Y0ZE 2SGAA 5FBEA 4Y8ZA 4CRDA 3F9GA 2C93B 5I46H 1ESAA 2WV5A 5A8YA 4AB9A 3B23B 4X6MA 3MNXA 2Y5GA 1SGTA 3BTME 1ARBA 3M37A 1P10A 3A88A 3SU1A 1T7CA 2TGTA 1MZAA 1TBZH 3FP8E 5AFZH 3LOXA 1SHHB 1BCUH 3V13A 1BTHH 1ORFA 3BEFB 1O2YA 2LPRA 1S83A 4Y6DA 1O3JA 4AB8A 4U2WA 2FI3E 3PYHA 3SN8A 1C2IA 1D3DB 2I6QA 2J38A 2FOMB 5GWZA 1N6XA 1NN6A 1HAOH 2A45B 3SJIA 1TRMA 5LPRA 4AFUA 2V35A 2HGTH 1KLIH 1V2LT 5EW1H 2VJ1A 1W0ZU 2VH6A 3BTTE 2FIRH 1BTUA 1GBFA 3ZZ9A 4X8SH 1GMDG 2CV3A 2ZCHP 2A4GA 2B8OH 2FOFA 5BPEA 3N7OA 2SNVA 1J16A 1HNEE 1FLEE 1O2IA 1C4U2 1ZR0A 4TYDA 3M7TA 4NWKA 1MTWA 1QRZA 2XBVA 4YTAA 4KTSA 2BY5X 4YZUA 4MNXA 4ZHMU 3O8RA 5EG4A 4J1YA 1OWKA 1TX8A 3OSYA 2A4QA 1GI7B 1C5YB 3VB5A 4BAKB 3BTEE 3ZV9A 1GVLA 1CVWH 4GPGA 2G5NA 4IBLH 4FVBA 1BHXB 1DM4B 1L4ZA 1O5BB 1V2TT 1W8BH 2BVXH 3KQCA 4IW4E 4YOGA 2ZFPH 3A84A 2P59A 4KKDA 4B2BA 3OY5U 8KME2 1RTLA 3RXIA 3S7KB 1D9IA 1YYY1 1TA2A 2ZQ2A 1GBBA 2GGVB 1DY8A 5E0JA 4O3UA 3TH4H 2F83A 4CH2B 3GY4A 4CR9A 1THRH 3U1IB 2AYWA 3GY7A 5DP8A 2VIPA 1SGRE 1K1MA 2P95A 3GY6A<