2VIPA

Fragment-based discovery of mexiletine derivatives as orally bioavailable inhibitors of urokinase-type plasminogen activator
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTISLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fragment-Based Discovery of Mexiletine Derivatives as Orally Bioavailable Inhibitors of Urokinase-Type Plasminogen Activator
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR CHAIN B
total genus 60
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2007-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2vipA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2vipA01
1TGCA 3QDZB 4X8TH 1MU8B 5DK1A 1J17T 1JRTA 3E90B 1D9IA 5EQQA 1QQ4A 4NA7A 4ABFA 5I46H 5LGOA 1O2UA 3HGNA 2Q6FA 4OGYA 1EX3A 3S7HB 5DO4H 2VIWA 3PV4A 2AH4X 4UFDH 4NCYA 2NWNA 2JETC 5EW1H 2A31A 1Z8IB 3P8FA 1SL3A 5FHTA 1VZQH 1ZZZA 3TK6A 4O97A 1XUHA 2FS8A 1NTPA 2JH0D 4FUIA 4J1YA 3M61U 2BY9X 3P8OA 1TOMH 1Z1JA 2G55A 3TPIZ 1T8NA 1FAXA 2SGDE 7KMEH 2G5VA 3ZYDA 1G3CA 4B1TA 3LONA 1AKSB 1F0SA 1BMAA 4U2WA 2ZDLA 3SHCH 4JYUH 5FBEA 1EASA 1MKXH 2EA3A 1YPMH 1L1JA 1OWKA 2C8WB 4ZHAA 3E8LA 5C20A 2Y7XA 2OCVB 7LPRA 1HAGE 1HYLA 1V2PT 1AWHB 2TBSA 4CBOA 1W7GH 1PYTC 3GY3A 1VCPA 5ESBA 2PUXB 4ZKNU 1RRKA 3BTWE 1NZQH 2FS9A 4X6OA 5FPTA 1GBBA 2FXRA 2G4UA 3FP6E 3MU4A 5LPEA 5CHAB 4NIXA 2AFQB 4KTCA 5FX5A 3T5FH 3UNRA 2YNAA 1C1WH 3LGYA 1GHZA 3SV6A 4X1SU 1CT2E 1QBOA 4UE7H 4GCHF 1AB9C 1VGCB 1Z8GA 2CHAC 1AFQB 4DVAU 1CSOE 3ZZCA 4IGDA 1GJ6A 3UQOA 3HPTB 4X6MA 1SVPA 1WCZA 1PPEE 1ZPBA 1TABE 1CBWC 1NN6A 4X2XA 1A0HB 4YOIA 1ZSLA 3T2NA 1TX8A 2F9NA 1HFDA 2ZF0H 1O31A 3NXPA 5FXLA 1V3XA 4B76A 4CR5A 2ZU4A 3ZVFA 5EW2H 2KAIA 1BRAA 2OQ5A 1NROH 1GJDB 3ZVDA 3SI3H 1YPHE 1SPJA 1Y3VA 4BAHB 1EAUA 4K8BA 1O5GH 1C1OA 1WSSH 1UMAH 3T26A 5CHAC 2FESH 1SHYA 1DM4B 4ZHMU 1UVPA 1T8MA 1SMFE 4CH8B 2WPLS 3UR6A 3M7QA 4AX9H 5EG4A 1SLWB 1HJAB 1FDPA 1O2VA 1N8OC 4B74A 1ETTH 1EKBB 3TNSA 3CS0A 5JBTA 3SJOA 2FOFA 1W11U 3GCHC 3RDZA 1P2KA 2BDGA 4FU9A 2AIQA 1QFKH 4K5ZA 1P2NA 4D9QA 2PGQB 1XUFA 2RCEA 5A09A 2OD3B 4GLYA 5DPAA 1AI8H 3MU1A 2Y7ZA 1DDJA 1TPOA 2JH5D 1BMNH 1ZHRA 4X8VH 1QURH 1GDQA 1AVWA 1YPHC 1KXEA 4MQAA 1L1GA 3BTHE 1UTPA 2SGPE 3SNAA 1SB1H 1GJ8B 2R0KA 1IOEA 1DWCH 3ATKA 4A92A 1INCA 3ZZBA 1GJ7B 2EC9H 1NFUA 1KIGH 1VJAU 2Q6DA 4ISLA 3MO9A 1N1LA 3BV9B 1HBTH 2A7HA 2FOEA 1GGDC 3E91A 1BTPA 1O2MA 1GBFA 2QXHA 1RFNA 2RG3A 1SGFG 2Z9JA 3ZZAA 4Y8XA 3A89A 4K3JA 1BTWA 4YTAA 1W12U 3BTME 2QCYA 3QTVH 4ISNA 3SUGA 1EZXC 1H8IH 4MPXA 3ZZ4A 3GDSA 4AB8A 2GTBA 1H8DH 1O3DA 2J9NA 3D62A 5A8YA 5DJ7A 1UVOA 5L6NH 4INLA 1GWAA 2XWAA 4FUGA 2XRCA 3PROA 5T3HA 1E36B 1WAYB 1YCPK 1PPCE 3IG6B 2ZKSA 5FPYA 1F2SE 3M37A 1GJAB 4NSYA 1KLJH 3RXMA 2DUCA 4X8UH 1PJPA 1IQHA 1TMTH 4BANB 3UNSA 1O3CA 3M5MA 3DFJA 4RN6A 3TITA 5TJXA 1BTXA 3SZNA 3EYDA 1UCYK 3GCNA 2OINA 2VB0A 1GI1A 4GPGA 3SU3A 2CMYA 4Y0ZE 5EXLA 1AIXH 1GMCF 1EJNA 1FN6A 1L2EA 1O2JA 5EQSA 1ZJKA 1XKAC 1G2MA 4ZUHA 3W95A 3SNDA 3LT3A 2FIRH 3SUEA 1D3TB 1BTUA 2XBWA 3EDXB 5LH8A 3VXFH 1Z8RA 1IQKA 1EP6A 1YM0A 1GMHF 2J2UA 4R8TB 2P16A 4DW2U 2OBOA 1AGJA 1RD3B 2ZGHA 2VWNA 4K2YA 1P12E 4AYYB 4B75A 1GHAF 3RXDA 3ELAH 1NO9H 3ZVEA 2PHBA 1KLIH 2BVRH 4MNXA 3QO6A 1DY9A 4YT7H 4JZDH 3P92A 2BDYA 2A7JA 3GOVB 1GI9B 3SU0A 1KXBA 1OWDA 3KQCA 4ZROA 1P2IA 3A87A 4ESTE 2GV6A 3MH4A 3UY9A 2VNTA 1P0SH 1YBWA 4CHAC 2QF0A 2ZFPH 1T4VH 2FX4A 2G00A 2FOHA 5F6MA 4JYVH 2J94A 4JZIA 1C2JA 1J14A 2SNVA 2EI6A 3LH3A 1H4WA 1Y8TA 3GY5A 3VB3A 1QRWA 1Y3XA 1SLUB 3V7TA 2F9VA 2C90B 3UPEA 4FUCA 2ZA5A 1SI5H 3ESTA 1T4UH 3RM0H 3RXFA 2XNIA 1S6FA 3SV7A 3M5LA 5L2ZH 2P3TB 1TBZH 2IPHA 3H7TA 1YPLH 8LPRA 4Y79A 1AUJA 2PKAB 1C5OH 1LTOA 3ZZ3A 1K1IA 2ZGBH 4I7YH 4MDSA 2FMJA 1C5SA 1XX9A 3SJ9A 1BTZA 5GIBA 1VITH 1HCGA 3RC4A 2V6NA 3B23B 2C8YB 3SU2A 1D6RA 1FUJA 4BAMB 3FANA 1UTNA 2ZU5A 3BG4B 3VGCC 4JZ1A 1C5YB 2Z6BD 2HWLB 2OTVA 2ZFRH 3NPSA 4CRBA 1QY6A 1NT1A 1J9CH 5HM9A 3BSQA 4FUEA 1A61H 2UWOA 1V2MT 2H2ZA 3RXLA 2QXIA 2UUYA 1EJMA 1TQ7B 4XE4A 1C2FA 4NWKA 3FAOA 1GMDF 2PR3A 2VINA 3SI4H 4R0IA 3LGWA 4DIHH 5LPRA 2XC5A 4DG4A 1PQ7A 1Z8JB 2ANMH 4KTUA 1DPOA 1GBAA 1GI6A 2AMPA 1FIZA 5EXNA 3HGPA 1QQUA 1NU7B 5DP3A 1WOFA 1GBMA 1C5WB 1OWEA 1HAOH 3MOCA 2FI5E 1QRZA 1HIAA 1W7XH 1KXFA 1QBNA 1UCYH 3U1IB 5E2PA 3FZDA 1LKAA 2R0LA 4KKDA 1GI4A 3A8DA 2BD7A 1D3PB 3AAVA 4I32A 3KQEA 3SJ8A 4WY3A 4AG2A 1E38B 3QZQA 1EAWA 1A3BH 3SNBA 2BY8X 1LHGH 1GGDB 2DE9A 4WMDA 4GCHG 3URCA 1MTUA 1F0UA 1PQ5A 1LQDB 2O8LA 1UTJA 1KTSB 1TGNA 1AY6H 4WMEA 1DE7H 1IHSH 1YPJH 2BD4A 3E6PH 3C1KA 2CJIA 4MNVA 1TRMA 1PQ8A 1LDTT 1HAPH 2BD5A 3NUMA 4XSKU 2P94A 3MO3A 6LPRA 2ZDMA 4RKJB 2BX4A 1IQLA 1C5VA 3UQVA 2HOBA 1DT2A 2FOAA 4Y7BA 2GCTB 1K2I1 1M9UA 3URDA 1HNEE 1MAXA 1F0RA 2XC4A 4ISHH 1ZR0A 2UUJB 2NU4E 4WF8A 2RA3A 2HPQH 1VR1H 3PB1E 3O8CA 1TMUH 1HAVA 3K65B 5G4BA 3DHKH 1MD7A 1S6HA 3SQEE 2CF8H 3VFEA 1NRRH 1BMLA 2ZDNA 1GCDA 1P2MA 1D3QB 1RIWB 4KGAA 5FAHA 1FY4A 2GT8A 4X0WU 2WPHS 4RSPA 1ZGIA 3LGTA 2ZCHP 1IQMA 3MFJA 4WWYA 1AZZA 3RUOA 2BM2A 2NU2E 4X2YA 3LIWA 2XBXA 5GDSH 3SGQE 2A4OA 3RXAA 3E1XB 5EU8A 3IWMA 1AE8H 3TJVA 1SHHB 4KELA 8GCHF 1GG6C 2O9QA 3VB6A 1C2HA 1BHXF 3GICB 1GBEA 3WY8A 2UUFB 4E7NA 1O3GA 6ESTA 2G5NA 1MTNB 2BX3A 4B2CA 1ANEA 1UTKA 2VWLA 3B8JA 3PWBA 2F91A 4IN1A 1FPHH 4A1VA 1OWIA 2GCHF 3CS7A 2W7SA 3SU5A 1IHTH 1SLVB 4GHTA 1C2IA 3MYWA 3L3TA 1G3BA 1MU6B 2Y6TA 2ZU3A 1O5AB 2J34A 3I78A 4X1QU 3SUDA 3N7OA 2D2DA 4NA9H 2W7UA 4X6PA 1GJ9B 4CH2B 1QGFA 2STBE 2ZNKH 1FPCH 2ZECA 2CV3A 1UTMA 3ZVGA 1O2KA 2YNBA 2PSXA 2Y82A 1EPTC 8ESTE 1ZSJA 2HNTE 3TVJB 3IITA 1OP0A 5EPYA 3EA7A 1LVYA 2ALPA 1TNGA 1A46H 1XM1A 5HXFA 3P6ZB 1TNHA 3NWUA 4UFFH 1GHVH 5JBBS 4NFEA 1ZMJA 5FPSA 1OKXA 4XBDA 4D76A 2WUBA 1AZ8A 1Z6JH 1O2HA 2ALVA 5EQRA 2STAE 1O5BB 2I6QA 1GPZA 5AF9H 2BZ6H 2JETB 4YESB 4O3TA 1K21H 1LO6A 1MZAA 2PUQH 2QA9E 3PMJA 5JBAS 1F5LA 3DT0H 1NRPH 5HGGA 1S81A 4YLQH 3F9GA 4PROA 2FM2A 1D4PB 1O3HA 2QF3A 1O39A 2QV1A 1BIOA 1LPZB 1V2JT 5HMAA 3S69A 4B2BA 4X2VA 3S7KB 2NU3E 1C4V2 2O8WA 2ILNA 3FP7E 1DANH 3MNBA 2C3SA 2PTNA 4OS6A 1CGIE 4YOGA 1DSTA 1RXPA 3QGNB 1IQJA 1NS3A 1GVZA 3EGKH 4JMYA 6GCHG 1SGTA 4GUXA 4ZAEA 3OX7U 2ZP0H 3A85A 2J4IA 4AFQA 3DFLA 3NZIA 1W0ZU 3FFGA 5E0GA 4FVDA 2VIQA 2C93B 1S82A 3MH6A 1DXWA 3A88A 4HTCH 3Q00A 2BQWB 2AEIH 3U8RH 3UWJH 3SO3A 1QJ1B 1QL8A 2G52A 4X1NU 3EQ0H 1AUTC 2P59A 3A7YA 2WUCA 1HAHH 2FTLE 3RC5A 4E05H 3F9HA 1BRBE 1C5XB 1OOKB 3U9AH 2O8UA 2ANYA 3M7UA 5GCHF 5EPNA 3AAUA 1F0TA 4DY7B 4SGAE 2BY5X 1XVMA 2GCHG 1BMMH 1WQVH 4K1EA 1MBMA 2BD3A 1LPKB 1P04A 2YOLA 1CBWB 7ESTE 1EZQA 5SGAE 2Z7FE 3FZZA 2Y5FA 4ZH8A 1MKXK 3ZV8A 1FAKH 2XW9A 3MO6A 1KDQA 4TY7A 1C4U2 3UWIA 1PPFE 1O37A 4ABAA 2ZFSA 2PSYA 1LHDH 3GYMA 3PWCA 3VEQB 1PYTD 4H6SB 3PO1C 1GI8B 2Y5HA 1NRSH 3U69H 1DITH 2XTTB 2AIPA 1HAZB 1TNJA 2A32A 3V13A 2P93A 1BCUH 1S0RA 1C1VH 1CO7E 2D26C 1C5UA 1NRQH 2ZPQA 2VWMA 1FQ3A 1RTKA 2OC1A 3D65E 3R3GB 1BTYA 3BG4C 3VGCB 5C2ZA 2PV9B 1P10A 3GDUA 3I29A 4B73A 1KXCA 1GBCA 5K7RA 1UHBA 1WV7H 1GBLA 2ZG0H 1GBHA 2GMTC 2VGCB 3E16B 4K8YA 2Q6GA 3MHWU 1P06A 3KNXA 4B2AA 4WH8A 5C3NA 1O2QA 1QB1A 1GJ4H 3M5OA 2GV7A 1O2IA 1BBRK 1TWXB 3PLPA 1RJXB 1CHOF 3F9FA 1FLEE 1F7ZA 1O3EA 3TH2H 1CVWH 4H6TA 1JOUB 1E0FD 2P3UB 5F8ZA 1HAIH 2KAIB 2A7CA 3GY8A 4I8LA 1P05A 4KTSA 1C1MA 3MU5A 1AWFH 4CRFA 1HXEH 1P9UA 1YYY1 2Z3CA 3ODDA 4XBBA 2VVUA 1ANBA 1Q3XA 1C2KA 2B9LA 1OSSA 1Q2WA 4LXBH 4NA8A 1UVTH 2BDCA 3U1JB 5GWZA 3MI4A 1O3OA 2HPPH 3R0FA 2A5KA 2VIOA 2WINI 5DGJA 1XMNB 2PKSB 1FONA 5T6FA 3A80A 3RU4T 2AS9A 1HXFH 3P17H 4DT7B 1GDUA 4NZLA 1CE5A 4WJG2 1W2KH 1O35A 2A4GA 5B6OA 2BDBA 1N6YA 2ESTE 2F9PA 3ENSB 1C5LH 3TU7H 3LPRA 1SR5C 2ZCKP 1L1NA 1O2GH 1FY5A 4WXVA 2G81E 4O9VA 3LC3A 3S9BA 3HK3B 2H6MA 1W8BH 1A1RA 3M3TA 1YC0A 5ABWA 1EQ9A 3BTGE 3LU9B 5C1UA 2ZTZA 1Y5BT 5L30H 1UCYE 3A81A 2WYJA 5JYIA 2BDHA 1IQGA 1TALA 4D7GA 1ETSH 1O3PB 2QGRA 3STIA 2HALA 3GY2A 1AHTH 4K69A 1ZPCA 2W5EA 2B8OH 1FMGA 1DX5M 2JKHA 2XXLA 3NKKA 4MG3A 4XFQA 3JZ1B 1O0DH 2ZU2A 1SGYE 1TPAE 3QK1A 1BJVA 4I31A 1G32B 1Y59T 5K0HA 4YT6H 2BY6X 1O5FH 2EI8A 3OU0A 2ZFTA 2GCTC 1O2TA 4OS1A 2D1JA 2FDAA 5A0AE 1NFYA 2BD9A 1LVBA 1BBRH 3U8OH 2AMQA 1GHBF 1LHEH 3UOPA 1EZUC 4ABBA 2A5IA 3AW1A 5F8XA 3W94A 1XUIA 3RU4D 1WUNH 1O30A 5EODA 2QXJA 1UTLM 4GSOA 1F5KU 1AN1E 3BEFB 1EZSC 3OSYA 1SSXA 3QZRA 3QWCH 2OBQA 5GJ4B 2FODA 1LQEA 1SFQB 1X7AC 1O33A 4FU8A 1YKTA 2F3CE 1AD8H 1TA2A 1UK3A 1XVOA 4OS5A 1NPMA 1O3MA 3UOUA 1SOZA 4BXSA 3HATH 2GD4B 3RLWH 1C5NH 4IS5A 1BB0B 4ABEA 1SGPE 5PTPA 8GCHG 4Y7AA 3UREA 3LGUA 1V2KT 4LZ4B 2P95A 1V2ST 5IDKA 1VCWA 2C8ZB 2ZHFH 1GJ5H 5ESTE 2FX6A 3A8BA 1MH0A 3SGAE 2SGEE 1TMBH 2GDEH 1CA0C 1ZHMA 1TB6H 2ZWLH 1O32A 4UFEH 3RXRA 2FI4E 1BJUA 2WYGA 3M36A 4NSVA 2GZ7A 1QTFA 1VITF 1VITG 1ZOMA 3BTEE 3RXQA 1SGNE 4AFUA 2B7DH 1EPTB 3RLYH 1TFXA 3E0PB 5JBCS 1MMJN 1QB6A 2UUKB 2H5CA 1EJAA 3ATIA 2Y80A 5L2YH 1O3FA 1IAUA 1K1JA 4CREA 4SGBE 4F4OC 2JH6D 1ZMNA 2FOBA 3DUXH 3SHAH 2FLRH 2GT7A 1YLCA 1YPKH 2PKSC 3P8GA 2SGAA 3EAJA 2XC0A 1GL1A 1UK2A 1HAXB 1EB1H 2Z9IA 7GCHG 3UFAA 1O3LA 1ANDA 1ACBE 3TK9A 1OWHA 1FI8A 1BDAA 2W3IA 1JXPA 1CHGA 2CF9H 1Z1IA 1O5EH 3KHVA 4RKOB 1ELDE 2V35A 4BTTB 2VU8E 2ZQ1A 4DJZB 1EATA 4J2YB 4TWWA 1KYNA 1AU8A 1TA6A 4CRAA 5TCCA 1A0LA 2VIDA 4K1TA 1THPB 1DFPA 4CR9A 2VWOA 1P9SA 1IQIA 1C5QA 1GMCG 2XCFA 2BD2A 3A7TA 4Y0YE 1QL7A 2Y81A 1E37B 1SLXB 1O2ZA 3ZZ9A 1SGIB 1GCTB 3RXKA 1ESTA 4CRGA 1ZLRA 1O2SA 3ZV9A 3SV2H 3A82A 2BYAX 2A4RA 2OXSA 2AMDA 5A0BA 2CN0H 1B0FA 3RMMH 1F92A 2ZHDA 4ZKRU 3M3SA 4YOJA 2LNCA 1V2TT 1C1PA 1JWTA 2A45B 1JRSA 1KTTB 2ZTYA 3TJUA 3AVZA 1MTVA 3L33A 4Y8ZA 4BXWA 3SBKA 9ESTA 1ZTLA 2TGAA 1E35B 1MQ6A 3EE0B 5HYOA 5DP8A 2FTMA 3BEIB 5JB9S 1TRYA 4LK4A 4K1SA 1S85A 3F68H 1P2JA 4AOQA 1CQQA 1BA8B 4AG1A 1DXPA 2QC2A 2PFEA 3MMGA 4AFSA 1O38A 1TX7A 2TRMA 1OS8A 4ZHLU 3M35A 1ID5H 1SGCA 1TNLA 2PKAA 1P11E 1MTNC 2H1UA 2ZEBA 3ZZDA 1TONA 5E2OA 3L6PA 5C67A 3SV8A 2H5DA 4X1RU 2BLOA 1MUEB 3PO1B 2ZIQH 1GHXH 4WMFA 1DVAH 5AFYH 2IJOB 4O03A 5HM2A 2BVSH 2FP7B 3RP2A 1UTOA 2SGFE 1T31A 1UK4A 4IMZA 4JK5A 4QT8C 1DWBH 4MTBA 4NIYA 1YLDA 4UD9H 3RXPA 1C2EA 4OGXA 1AO5A 1C1UH 1KDQB 3P8NA 3O8DA 3DD2H 2WPKS 3U8TH 1C1QA 1TRNA 1GI5A 4AYVB 2CHAB 4MNYA 1QRXA 5FCRA 1ARBA 4GAWA 1C1NA 2XBVA 2CGAA 3K9XB 3D23A 2B5TB 2VJ1A 1TGBA 1MD8A 1JIRA 2GZ9A 1QR3E 4K60A 1ZMLA 9LPRA 1FN8A 1C9TA 1G9IE 4Q7YA 5FX6A 1ZSKA 2BOHB 3AW0A 3SU1A 2BXUH 4ASHA 3I77A 2Y5GA 4NFFA 1L4ZA 1O36A 4NZQA 4AB9A 1UJ1A 3K6ZA 3RXBA 5LPFA 1P2QA 1AVGH 4VGCC 1O3IA 3STJA 2PWXA 3GY4A 2Z9KA 3SORA 1C4Y2 4CBNA 4IMQA 2R2WU 3UTUH 2BQ6B 3V12A 5EGMA 5E0JA 4BAQB 1MKWK 4FUBA 1HAYB 5DP4A 3LKWA 2BMGB 1CA0B 1K22H 3RXEA 1A5HA 3GCHB 3GCOA 3A86A 1DSUA 3E0NB 1EAXA 1GHBG 1AFQC 2O8TA 2BOKA 1EUFA 3ZVBA 3A7ZA 4TYDA 2Z94A 2BDIA 5IYTA 1QCPA 3LGIA 1ABIH 1ZTJA 3CENA 4ZKOU 4XOJA 1OP8A 2ZDAH 3BTDE 3H7OA 1Z6EA 2VVCA 4Q80A 3RXSA 1QJ7B 5EOKA 1K1NA 4AORA 2F9BH 4X1PU 1TBQH 1MZDA 2VVVA 3PMHB 2GZ8A 3M5NA 3TH4H 3A7XA 1A5IA 2HRVA 1NESE 6GCHF 2LPRA 2A5AA 4ABGA 1XUGA 5F03A 1G36A 1O34A 1C5PA 2WPJS 1AE5A 1W3CA 3T25A 1HB0B 1O2YA 2GMTB 3SUFA 1ELGA 2C8XB 1MCTA 4WH6A 4AN7A 2A2XH 2J38A 1AKSA 4KP0A 1PPZA 5BRRE 2QN5T 1QJ6B 3PMBB 2FOMB 2G4TA 2BXTH 1HRTH 3TH3H 4Y6DA 3ATLA 1A5GH 4D9RA 3KQBA 1A2CH 1SFIA 4UDWH 1Y5AT 4Y71A 2GP9B 1IQNA 1DOJA 1K9OE 2V3OH 1D3DB 1TQ0B 1BRUP 4IC6A 3RMLH 4I8KA 4DOQA 3RXTA 1EXFA 4JZFH 3MNXA 4NGAH 1J15A 4Q2KA 1QBVH 4CRDA 1ESBA 4BOHA 1EB2A 2FLBH 1Y3YA 2PLXA 4CHAB 1GJCB 1C5RA 2BLVA 4NWLA 2ZTXA 2Z3EA 3SNEA 1B7XB 1BQYA 3GYLB 4HGCA 5BPEA 3A7WA 1C5TA 2FEQH 4INHA 5JDUB 3E3TA 2A4QA 4ISIH 2SGQE 4JK6A 1P3EA 4H42U 3MNCA 3T27A 3BIVH 2BB4A 5CE1A 1JBUH 3SGBE 2VGCC 8KME2 3H5CB 1O2OA 1HDTH 1NY22 1DLEA 1SGQE 3SJIA 1V6DA 4MPVA 3V3MA 4B71A 4HI3A 1P8VC 2FOGA 3ZZ6A 4BAOB 6CHAB 1O2NA 1OYTH 1XXDA 3GCTF 1TIOA 4TWYA 3LOXA 1P57B 1U6QA 5JB8S 3MH7A 4YLUA 3Q3YA 1G2LA 5GPIB 1BBRE 3Q77A 3PTNA 3PLBA 2RDLA 4MNWA 1KSNA 3SOSA 4I8JA 5F8TA 2TGTA 4OS7A 3UUZA 4WXIA 3K2UA 1EAIA 1YPGH 2OUAA 1Y5UT 4BNRA 5J4QA 1LVOA 4TY6A 3RXIA 2WV5A 1O5CB 2BQ7B 3T28A 1WTGH 2V0BA 3SU4A 5EXMA 5DP9A 2BHGA 1P03A 2C4FH 2IOTA 1QIXB 2ZHQH 1GMHG 2ZGCA 1QA7A 2TIOA 2OLGA 5C1XA 3LGVA 4GHQA 2NU0E 2BZAA 3LDXH 1ESAA 1N8OB 3ATWA 4Z6AH 2QIQA 1G3EA 5H4IB 1C9PA 3SN8A 3SJKA 1AB9B 2FI3E 1GBJA 3ZVAA 2WPIS 1G37A 1QL9A 1O3JA 1P2OA 1AFEH 1NFWA 3BTTE 5AHGH 1THSH 2AGIX 2XYAA 4Y11E 4BTIB 1FZZA 2A0QB 1TE0A 5A8XA 2ODQA 2PTCE 1FNIA 4H4FA 1MAYA 1PFXC 3S9AA 1HUTH 3O8RA 1DUEA 1F5RA 1TAWA 1GG6B 1MTWA 4U30A 1GI0A 3VPKA 3RU4E 4I8GA 2TPIZ 3SW2B 2BVXH 4YZUA 3RXGA 1QB9A 1OXGA 2XBYA 3TGIE 3LJOA 3SNCA 1GMDG 1WYKA 1GI3A 5ETXA 1UTQA 1GL0E 2FZZA 2WV4A 2P8OB 4FVBA 3M3VA 1WBGB 1GBKA 1C2GA 1TBRH 3RC6A 1G3DA 3GDVA 4BTUB 3EA8A 3PTBA 1ZJDA 4A7IB 3VXEH 2P3FH 2HNTF 5A2MH 1C2MA 1LVMA 3GISB 3ODFA 5DP7A 3HK6B 3ZZ8A 3Q76A 4A1XA 2AERH 3A8AA 1HJ8A 1LCYA 1NC6A 4OS2A 3RM2H 3ZZ7A 1O2LA 1HGTH 1P3CA 3T62A 5I25A 1O3BA 1Q31A 4X8SH 2ZC9H 5AVDA 3S9CA 2BD8A 2H9HA 1BTHH 1HIAB 1DWEH 7GCHF 2VH6A 1BITA 4BAKB 3TJOA 2F83A 4FUJA 1P01A 2SFAA 1C1RA 1AVXA 3G01A 1CA8B 1ELAA 1RTLA 4OS4A 5AFZH 1Y3WA 1SGDE 1GVKB 1LHFH 1BRCE 2VH0A 4FUHA 2QXGA 3FP8E 1SC8U 4FUDA 3ITIA 1E34B 2PW8H 3KEEA 2ULLA 1ORFA 1PQAA 2ODPA 3BTQE 1V2WT 1OX1A 1N6XA 2TGDA 3QN7A 1KLTA 1C5MD 2ZPRA 2FO9A 2FOCA 2ZU1A 1BZXE 5FCKA 2R3UA 3MTYA 3BTFE 1XKBC 1ZRKA 2Q1JA 4IC5A 1V2VT 1DS2E 2ZCLP 1FXYA 1BHXB 2UWLA 1BOQA 1MTSA 1H9IE 1TLDA 1HJ9A 1MQ5A 5CMXH 1T8LA 4HFPB 1A0JA 2Z9LA 5E0HA 1C1TA 2UWPA 5C5NA 1NU9A 1TNKA 2BLQA 3KCGH 2K1QA 4I33A 1YP9A 1SGFA 3RXJA 1W0YH 2SNWA 2ZI2H 4UONA 3BN9A 4AGJA 2GVFA 1FY3A 3SU6A 2P8OC 3TIUA 1V2RT 2OC0A 2RA0A 3HKIB 2Z9GA 3MU8A 3QUMP 4XDEA 1SQTA 2R3YA 4JZEH 2H9EH 3TLOA 2XCNA 1AMHA 1S0QA 2BDAA 2ZO3H 1Z7KA 4INKA 4YO9A 1WQSA 4NG9H 2BTCE 1JMOH 1IQFA 1QNJA 1UVSH 1GBIA 3OY6U 1VGCC 1O2PA 3BG8A 2CXVA 1O3NA 1K1OA 3MU0A 5J4SA 1V2UT 3NCLA 2ZZUH 1P09A 3RMNH 1HLTH 3KQDA 2Z3DA 1J16A 2ZDVH 4FUFA 2FWWA 2XWBI 3UNQA 6CHAC 2EEKA 3DA9B 4AGKA 1FJSA 4FXGH 2ZGJA 2THFB 1FIWA 2EI7A 2J92A 1YGCH 3QGJA 1NFXA 3TGJE 1Z71A 1OP2A 3QX5H 4TPYA 3S0NA 2O8MA 1TPPA 1YF4A 5T6DA 1CT0E 1SGRE 4DURA 1O5DH 1KY9A 4JCNA 4DGJA 3KL6A 1K1MA 1ELCA 1P02A 3BIUH 2GX4A 3TK5A 1SBWA 3OTJE 2BY7X 4Q7XA 4YM9A 2VIVA 1O3AA 3O8BA 2QAAA 3CP7A 1L4DA 1O2WA 2OC7A 3KGPA 1LHCH 1SG8B 1W10U 1HPGA 4ABJA 3M7TA 1MKWH 1GI2A 5FBIA 3ZVCA 1FV9A 1ZYOA 2H9TH 3LJJA 4MPWA 1O2RA 1CGJE 4ZXYH 1FY1A 2A1DB 2G8TA 1V2LT 1MCVA 2ZDKA 2PGBB 4A5TS 4ZXXH 3KIDU 1LMWB 4NIWA 3RXOA 3UR9A 5DG6A 3P70B 2NU1E 4U32A 3ZYEA 4Y10E 1WTHD 3FVFB 4THNH 2ZHWH 3LH1A 1S5SA 1V2OT 1TPSA 4DCDA 1HV7A 2M5TA 1XUJA 1H9LB 1YCPM 1H9HE 2ASUB 2ZHEH 4UFGH 3A84A 1GBDA 3BTKE 1ANCA 1GBTA 3VB4A 1O2XA 1UHBB 3Q3XA 1QA0A 1T7CA 1UO6A 1YPEH 2QY0B 1DUAA 1TOCB 1H1BA 3T29A 2W26A 2GDDA 2OP9A 4LZ1H 3QTOH 1C2DA 1EOJA 1ETRH 3AASA 3RXVA 1ELEE 1THRH 4D7FA 2ZPSA 1W13U 2AGEX 2G51A 1OPHB 1ZRBA 2F9OA 1VJ9U 1A3EH 1ELBA 1W14U 2HVXA 4M7GA 3UIRA 4NIVA 4Q7ZA 4FU7A 5T6GA 5DP5A 1J8AA 5A0CA 1TNIA 1DY8A 3K6YA 1B5GH 3PM3A 1LKBA 3GY7A 1A7SA 1BUIA 1LPGB 3NK8A 1GJBB 4F49A 1C1SA 1AQ7A 3RXUA 4ABDA 1QHRB 3MNSA 2J95A 3A7VA 1K1LA 3KF2A 2ZFFH 2HLCA 1KXAA 1TX6A 2ANWA 3VB7A 2DE8A 4MLFB 1NM6A 3MH5A 4D8NA 1ELVA 1G30B 3SV9A 1CU1A 3TGKE 2QYIA 2GKVE 3PMAB 1RIWC 5GCHG 3PLKA 3PYHA 3F6UH 1SQAA 3F1SB 1L0ZA 2FYRA 1SOTA 4XBCA 3RMOH 1ZPZA 1V2NT 1BT7A 1D6WA 4JYTA 1K28D 1YCPH 4O3UA 3F9EA 3BEUA 2IN2A 1OWJA 4A1TA 2TGPZ 2W3KA 1ZGVA 1ARCA 1K1PA 1PPBH 1EOLA 2FYQA 3ATMA 1XXFA 3HKJB 4GVUA 4X6NA 4Z0KA 3C27B 2HGTH 1TYNA 3RXHA 1MBQA 3OY5U 5A8ZA 1RS0A 1GHAG 1JIMA 5DKMA 1C5ZB 4IW4E 3RXCA 1GVLA 4ABIA 3TNTA 1ZTKA 5GXPA 1HJAC 2OC8A 2VIPA 1GDNA 1FY8E 1TGSZ 3OYPA 5TCAA 1CGHA 4I8HA 2FPZA 1WU1A 4AZ2B 3JZ2B 2F9UA 1GCTC 5E8EH 3MWIU 2R9PA 4A6LA 1EPTA 3ZZ5A 2ZFQH 1PPGE 4WVPE 5DP6A 1C2LA 1NRNH 1S84A 2I6SA 4LOYH 1VCQA 1T32A 3EA9A 2GGVB 4E7RG 1V2QT 1ELFA 1B0EA 2D8WA 2WPMS 2ANKH 1O3KA 3A8CA 3GCTG 2BLWA 3LC5A 4TPIZ 3KN2A 1GHYH 4DIIH 1RGQA 3U98H 1CHOG 4VGCB 4Y76A 4AFZA 1ABJH 1GHWH 4HZHA 2ZGXH 2ZQ2A 3P95A 4UEHH 1EP5A 3V0XA 2AYWA 1Y3UA 2AGGX 1T8OA 2V3HH 1RTFB 3A83A 3D49H 1OYQA 3QLPH 4ZMAH 4IBLH 2B0FA 1A4WH 1CT4E 4ZKSU 4IN2A 4U01A 4E06H 1XUKA 1IQEA 5C1YA 3B9FH 2ODYB 4MVNA 2A2QH 1DLKB 4CRCA 4X2WA 5JPMH 1S83A 1TGTA 3SQHE 1HAVB 4ABHA 1UVUH 3VB5A 1ZHPA 1SQOA 4MPUA 4Y8YA 1ELTA 1PPHE 1KXDA 1DWDH 2R2MB 1SGEE 2OQUA 3Q3KA 3BF6H 3GY6A 3TJNA 1GI7B 1DICA 2HNTC 5C5OA 4ISOA
chains in the Genus database with same CATH superfamily
1TGCA 3QDZB 4X8TH 1MU8B 5DK1A 1J17T 1JRTA 3E90B 1D9IA 5EQQA 1QQ4A 4NA7A 4ABFA 5I46H 5LGOA 3KYGA 1O2UA 3HGNA 2Q6FA 4Q4LA 4OGYA 1EX3A 3S7HB 2K0QA 5DO4H 2VIWA 3PV4A 2AH4X 4UFDH 4NCYA 2NWNA 2JETC 5EW1H 2A31A 2J97A 1Z8IB 3P8FA 1SL3A 5FHTA 1VZQH 1ZZZA 3TK6A 4O97A 1COWD 1XUHA 2FS8A 1NTPA 2JH0D 4FUIA 4J1YA 3M61U 2BY9X 3F3BA 3P8OA 1TOMH 1Z1JA 2G55A 3TPIZ 1T8NA 1FAXA 2SGDE 7KMEH 2G5VA 3ZYDA 1MABB 1G3CA 4B1TA 3LONA 1AKSB 1F0SA 3PV2A 1BMAA 4U2WA 2ZDLA 3SHCH 4JYUH 4P02A 5FBEA 1EASA 1MKXH 2EA3A 1YPMH 1L1JA 1OWKA 2C8WB 4ZHAA 3E8LA 5C20A 2Y7XA 2OCVB 4YXWD 7LPRA 1HAGE 1HYLA 1V2PT 1AWHB 2TBSA 4CBOA 1W7GH 1PYTC 3GY3A 1VCPA 5ESBA 2PUXB 4ZKNU 1RRKA 3BTWE 1NZQH 2FS9A 4X6OA 5FPTA 1GBBA 2FXRA 2G4UA 3FP6E 4RT0A 3MU4A 5LPEA 5CHAB 4NIXA 2AFQB 4KTCA 5FX5A 3T5FH 3UNRA 2YNAA 1C1WH 3LGYA 1GHZA 3SV6A 4X1SU 1CT2E 1QBOA 4UE7H 4GCHF 1AB9C 1VGCB 1Z8GA 2CHAC 1AFQB 4DVAU 1CSOE 3ZZCA 4IGDA 3F2GA 1GJ6A 3UQOA 3HPTB 4X6MA 1SVPA 1WCZA 1PPEE 1ZPBA 1TABE 1CBWC 1NN6A 4X2XA 1A0HB 4YOIA 1ZSLA 3T2NA 1TX8A 2F9NA 1HFDA 2ZF0H 3UB0A 1O31A 3NXPA 3F0PA 5FXLA 1V3XA 4B76A 4CR5A 2ZU4A 3ZVFA 5EW2H 2KAIA 1BRAA 2OQ5A 1NROH 1GJDB 3ZVDA 3SI3H 1YPHE 1SPJA 1Y3VA 4BAHB 1EAUA 4K8BA 1O5GH 1C1OA 1WSSH 2QF5A 1UMAH 3T26A 5CHAC 2FESH 1SHYA 1DM4B 3N7DA 1UVPA 4ZHMU 1T8MA 1SMFE 4CH8B 2WPLS 3UR6A 3M7QA 4AX9H 5EG4A 1SLWB 1HJAB 1FDPA 1O2VA 1N8OC 4B74A 1ETTH 1EKBB 3TNSA 3CS0A 2HVYB 5JBTA 3SJOA 2FOFA 1W11U 3GCHC 3RDZA 1P2KA 2BDGA 4FU9A 2AIQA 1QFKH 4K5ZA 2OK5A 1P2NA 4D9QA 2PGQB 1XUFA 2RCEA 5A09A 2OD3B 4GLYA 5DPAA 1AI8H 3MU1A 2Y7ZA 1DDJA 1TPOA 2JH5D 1BMNH 1ZHRA 4X8VH 1QURH 1GDQA 1AVWA 1YPHC 1KXEA 4MQAA 1L1GA 3BTHE 1UTPA 2SGPE 3SNAA 3U28C 1SB1H 1GJ8B 2R0KA 1IOEA 1DWCH 3ATKA 4A92A 1INCA 3ZZBA 1GJ7B 3OFND 2EC9H 1NFUA 1KIGH 1VJAU 2Q6DA 4ISLA 3MO9A 1N1LA 3BV9B 1HBTH 4Q63A 2A7HA 2FOEA 1GGDC 3E91A 1BTPA 1O2MA 1GBFA 2QXHA 1RFNA 2RG3A 1SGFG 2Z9JA 3ZZAA 4Y8XA 3A89A 4K3JA 1BTWA 4YTAA 1W12U 3BTME 2QCYA 3QTVH 4ISNA 3SUGA 1EZXC 1H8IH 2F4LA 4MPXA 2KM0A 3ZZ4A 3GDSA 4AB8A 2GTBA 1H8DH 3DSOA 1O3DA 2J9NA 5HIYA 3D62A 5A8YA 5DJ7A 1UVOA 5L6NH 3PRBA 4INLA 1GWAA 2XWAA 4FUGA 4XRNA 2XRCA 3PROA 5T3HA 1E36B 1WAYB 1YCPK 1PPCE 3IG6B 2ZKSA 5FPYA 1F2SE 3M37A 1NBME 3NRLA 1GJAB 4NSYA 1KLJH 3RXMA 2DUCA 4X8UH 1PJPA 2M2AA 1IQHA 1TMTH 4BANB 3F2HA 3UNSA 1O3CA 3M5MA 3DFJA 4RN6A 3TITA 5TJXA 1BTXA 3N7EA 3SZNA 3EYDA 1UCYK 3GCNA 2OINA 2VB0A 1GI1A 2QF4A 4GPGA 5CHBA 3SU3A 2CMYA 4Y0ZE 5EXLA 1AIXH 5EJLA 1GMCF 1EJNA 1FN6A 2XNDD 1L2EA 1O2JA 5EQSA 1ZJKA 1XKAC 1G2MA 4ZUHA 3W95A 3SNDA 3LT3A 2FIRH 3SUEA 1D3TB 1BTUA 2XBWA 3EDXB 5LH8A 3VXFH 1Z8RA 1IQKA 1EP6A 1YM0A 1GMHF 2J2UA 4R8TB 2P16A 4DW2U 2OBOA 1AGJA 1RD3B 2ZGHA 2VWNA 4K2YA 1P12E 4AYYB 4B75A 1GHAF 2KR7A 3RXDA 3ELAH 1NO9H 3ZVEA 2PHBA 1KLIH 2BVRH 4MNXA 3QO6A 1DY9A 4YT7H 4JZDH 3P92A 2BDYA 2A7JA 3GOVB 1GI9B 3SU0A 1KXBA 1OWDA 2L6OA 5C17A 3KQCA 4ZROA 1P2IA 3A87A 4ESTE 2GV6A 3MH4A 3UY9A 1P0SH 1YBWA 2EQNA 2VNTA 4CHAC 2QF0A 2ZFPH 1T4VH 2FX4A 4F55A 4ACAA 2G00A 2FOHA 5F6MA 4JYVH 2J94A 3OEED 4JZIA 1C2JA 1J14A 2SNVA 2EI6A 3LH3A 1H4WA 1Y8TA 3GY5A 3VB3A 1QRWA 1Y3XA 1SLUB 3V7TA 2F9VA 2KCAA 2C90B 3UPEA 4FUCA 2ZA5A 1SI5H 3ESTA 1T4UH 3RM0H 3RXFA 2XNIA 1S6FA 3FKSD 3SV7A 3M5LA 5L2ZH 2P3TB 1TBZH 2IPHA 3H7TA 1YPLH 8LPRA 4Y79A 1AUJA 2PKAB 1C5OH 1LTOA 3ZZ3A 1K1IA 2ZGBH 4I7YH 4MDSA 2FMJA 1C5SA 1XX9A 3SJ9A 1BTZA 5GIBA 1VITH 1HCGA 3RC4A 2V6NA 3B23B 2C8YB 3SU2A 1D6RA 1FUJA 4BAMB 3FANA 1UTNA 2ZU5A 3DCLA 3BG4B 3VGCC 4JZ1A 5EJ1A 1C5YB 2Z6BD 4F48B 2HWLB 2EY4C 2OTVA 2ZFRH 3NPSA 4CRBA 1QY6A 1NT1A 1J9CH 5HM9A 3BSQA 4FUEA 1A61H 2UWOA 1V2MT 2H2ZA 3RXLA 2QXIA 2UUYA 1EJMA 1TQ7B 4XE4A 1C2FA 4NWKA 3FAOA 1GMDF 2PR3A 2VINA 3SI4H 4R0IA 3LGWA 4DIHH 5LPRA 2XC5A 4DG4A 1PQ7A 1Z8JB 2ANMH 4KTUA 1DPOA 1GBAA 1GI6A 1W0KD 2AMPA 1FIZA 5EXNA 3HGPA 5C0TA 1QQUA 1NU7B 5DP3A 1WOFA 1GBMA 1C5WB 1OWEA 1HAOH 3MOCA 2FI5E 1QRZA 1HIAA 1W7XH 1KXFA 1QBNA 1UCYH 3U1IB 5E2PA 3FZDA 1LKAA 2R0LA 3ZIAD 4KKDA 1GI4A 3A8DA 2BD7A 1D3PB 3AAVA 4I32A 2KX4A 3KQEA 3SJ8A 4WY3A 4AG2A 1E38B 3QZQA 1EAWA 1A3BH 3SNBA 2BY8X 1LHGH 1GGDB 2DE9A 4WMDA 4GCHG 3URCA 1MTUA 3WWBA 1F0UA 1PQ5A 1LQDB 2O8LA 1UTJA 1KTSB 1TGNA 1AY6H 4WMEA 1DE7H 1IHSH 1YPJH 2BD4A 3E6PH 3C1KA 2CJIA 4MNVA 1TRMA 1PQ8A 1LDTT 1HAPH 2BD5A 3NUMA 3DSPA 4XSKU 2P94A 3MO3A 6LPRA 2ZDMA 4RKJB 3KQ5A 2BX4A 1IQLA 1C5VA 3UQVA 2HOBA 1DT2A 2FOAA 4Y7BA 2GCTB 1K2I1 1M9UA 3URDA 1HNEE 1MAXA 1F0RA 2V3MA 2XC4A 4ISHH 1ZR0A 2UUJB 2NU4E 4RI0A 2RA3A 4WF8A 2HPQH 1VR1H 3PB1E 3O8CA 1TMUH 1HAVA 1YWUA 3K65B 5G4BA 3DHKH 1MD7A 1S6HA 3SQEE 2CF8H 2PP6A 3VFEA 1NRRH 1BMLA 2ZDNA 1GCDA 1P2MA 1D3QB 1RIWB 4KGAA 2VBCA 5FAHA 1FY4A 2GT8A 4X0WU 2WPHS 4RSPA 1ZGIA 3LGTA 2ZCHP 1IQMA 3MFJA 4WWYA 1AZZA 3RUOA 2BM2A 2NU2E 4X2YA 3LIWA 2XBXA 5GDSH 3SGQE 2A4OA 3RXAA 3E1XB 5EU8A 3IWMA 1AE8H 3TJVA 1SHHB 3PRDA 4KELA 8GCHF 1GG6C 2O9QA 3VB6A 1SKYE 1C2HA 1BHXF 3GICB 5IK2D 1GBEA 4FOUC 3WY8A 2UUFB 4E7NA 1O3GA 6ESTA 2G5NA 1MTNB 2BX3A 4B2CA 1ANEA 1UTKA 3MQKC 2VWLA 1YLNA 3B8JA 5C94A 3PWBA 2F91A 4IN1A 1FPHH 4A1VA 1OWIA 2GCHF 3CS7A 2W7SA 3SU5A 1IHTH 1SLVB 4GHTA 1C2IA 3MYWA 3L3TA 5EIYA 1G3BA 1MU6B 5T1VA 2Y6TA 2ZU3A 1O5AB 2J34A 3I78A 4X1QU 3SUDA 3N7OA 2D2DA 4NA9H 2W7UA 4X6PA 1GJ9B 4CH2B 1QGFA 2STBE 2ZNKH 1FPCH 2ZECA 2CV3A 1UTMA 3ZVGA 1O2KA 2YNBA 2PSXA 2Y82A 1EPTC 8ESTE 1ZSJA 2HNTE 3TVJB 3IITA 1OP0A 5EPYA 3EA7A 1LVYA 2ALPA 1TNGA 1QZ8A 1A46H 1XM1A 5HXFA 3P6ZB 4B6EA 1TNHA 3PV5A 5CDFE 3NWUA 4UFFH 1GHVH 5JBBS 4NFEA 1ZMJA 5FPSA 1OKXA 4XBDA 4D76A 2WUBA 1AZ8A 1Z6JH 1O2HA 2ALVA 5EQRA 2STAE 1O5BB 2I6QA 1GPZA 5AF9H 2BZ6H 2JETB 4YESB 4O3TA 1K21H 1LO6A 1MZAA 2PUQH 2QA9E 3PMJA 5JBAS 1F5LA 3DT0H 1NRPH 4XD7D 5HGGA 1S81A 4YLQH 2XOKD 3F9GA 4PROA 2FM2A 1D4PB 1FX0B 1O3HA 2QF3A 1O39A 2QV1A 1BIOA 1LPZB 1V2JT 5HMAA 3S69A 4B2BA 4X2VA 3S7KB 2NU3E 1C4V2 2O8WA 2ILNA 3FP7E 1DANH 3MNBA 3OE7D 2C3SA 4DT4A 2PTNA 4OS6A 1CGIE 4YOGA 1DSTA 1RXPA 3QGNB 1IQJA 1NS3A 1GVZA 3EGKH 4JMYA 6GCHG 1SGTA 4GUXA 4ZAEA 3OX7U 2ZP0H 3A85A 2J4IA 4AFQA 3DFLA 1KMHB 3NZIA 1W0ZU 3FFGA 5E0GA 4FVDA 2VIQA 2C93B 1S82A 3MH6A 1DXWA 3A88A 4HTCH 3Q00A 2BQWB 2AEIH 3U8RH 3UWJH 3SO3A 1QJ1B 1QL8A 2G52A 4X1NU 3EQ0H 1AUTC 2P59A 3A7YA 2WUCA 1HAHH 2FTLE 3RC5A 4E05H 3F9HA 1BRBE 1C5XB 1OOKB 3H09A 3U9AH 2O8UA 2ANYA 3M7UA 5GCHF 5EPNA 3AAUA 1F0TA 4DY7B 4SGAE 2BY5X 3AK5A 1XVMA 2GCHG 1BMMH 1WQVH 4K1EA 3CNRA 1MBMA 2BD3A 1LPKB 1P04A 2YOLA 1CBWB 7ESTE 1EZQA 5SGAE 2Z7FE 3FZZA 2Y5FA 4ZH8A 1MKXK 3ZV8A 1FAKH 2XW9A 3MO6A 1KDQA 4TY7A 1C4U2 3UWIA 1PPFE 1O37A 4ABAA 2ZFSA 2PSYA 1LHDH 3GYMA 3PWCA 3VEQB 1PYTD 4H6SB 3PO1C 1GI8B 2Y5HA 1NRSH 4P00A 3U69H 1DITH 2XTTB 2AIPA 1HAZB 1TNJA 2A32A 3V13A 2P93A 1BCUH 1S0RA 1C1VH 1CO7E 2D26C 1C5UA 1NRQH 2ZPQA 2VWMA 1FQ3A 1RTKA 2OC1A 3D65E 2JJ1D 3R3GB 1BTYA 3BG4C 3VGCB 5C2ZA 2PV9B 2KCYA 1P10A 3GDUA 3I29A 4B73A 1KXCA 1GBCA 5K7RA 1UHBA 1WV7H 1GBLA 2ZG0H 1GBHA 2GMTC 2VGCB 3E16B 4K8YA 2Q6GA 3MHWU 1P06A 3KNXA 4B2AA 4WH8A 5C3NA 1O2QA 1QB1A 1GJ4H 3M5OA 2GV7A 1O2IA 1BBRK 1TWXB 3PLPA 1RJXB 1CHOF 3F9FA 1FLEE 1F7ZA 1O3EA 3TH2H 2KCPA 1CVWH 4H6TA 1JOUB 1E0FD 2P3UB 5F8ZA 1HAIH 2KAIB 2A7CA 3GY8A 4I8LA 1P05A 4KTSA 1C1MA 3MU5A 1AWFH 4CRFA 1HXEH 1P9UA 1YYY1 2Z3CA 3ODDA 4XBBA 2VVUA 1ANBA 1Q3XA 1C2KA 2B9LA 1OSSA 1Q2WA 4LXBH 4NA8A 1UVTH 2BDCA 3U1JB 5GWZA 3MI4A 1O3OA 2HPPH 3R0FA 2A5KA 2VIOA 2WINI 5DGJA 1XMNB 2PKSB 1FONA 5T6FA 3A80A 3RU4T 2AS9A 1HXFH 3P17H 4DT7B 1GDUA 4NZLA 1CE5A 4WJG2 1W2KH 1O35A 2A4GA 5B6OA 2BDBA 1N6YA 2ESTE 2F9PA 3ENSB 1C5LH 3TU7H 3LPRA 1SR5C 2ZCKP 1L1NA 1O2GH 1FY5A 4WXVA 2G81E 4O9VA 3LC3A 3S9BA 3HK3B 2H6MA 1W8BH 1A1RA 3M3TA 1YC0A 5ABWA 1EQ9A 3BTGE 3SZEA 3LU9B 5C1UA 2ZTZA 1Y5BT 5L30H 2GJGA 1UCYE 3A81A 2WYJA 5JYIA 2BDHA 1IQGA 1TALA 4D7GA 1ETSH 1O3PB 2QGRA 3STIA 2HALA 1UW7A 3GY2A 1AHTH 4K69A 1ZPCA 2W5EA 2B8OH 1FMGA 3SYJA 2J5UA 1DX5M 2JKHA 2XXLA 2JJ2D 3NKKA 4MG3A 4XFQA 2J98A 1O0DH 3JZ1B 2ZU2A 1SGYE 1TPAE 3QK1A 1BJVA 4I31A 1G32B 1Y59T 5K0HA 4YT6H 2BY6X 1O5FH 2EI8A 3OU0A 2ZFTA 2GCTC 1O2TA 4OS1A 2D1JA 2FDAA 5A0AE 1NFYA 2BD9A 1LVBA 1BBRH 3U8OH 2AMQA 1GHBF 1LHEH 3UOPA 1EZUC 4ABBA 2A5IA 3AW1A 5F8XA 3W94A 1YY3A 1XUIA 3RU4D 1WUNH 1O30A 5EODA 2QXJA 1UTLM 4GSOA 1F5KU 2W6ID 1AN1E 3BEFB 1EZSC 3OSYA 1SSXA 3QZRA 3QWCH 2OBQA 3OEHD 5GJ4B 2FODA 1LQEA 1SFQB 1X7AC 1O33A 4FU8A 1YKTA 2F3CE 1AD8H 1TA2A 1UK3A 1XVOA 4OS5A 1NPMA 1O3MA 3UOUA 1SOZA 4BXSA 3HATH 2GD4B 3RLWH 1C5NH 4IS5A 1BB0B 4ABEA 1SGPE 5PTPA 8GCHG 4Y7AA 3UREA 3LGUA 1V2KT 4LZ4B 2P95A 1V2ST 5IDKA 1VCWA 2C8ZB 2ZHFH 2RDEA 1GJ5H 5ESTE 2FX6A 2CK3D 3A8BA 1MH0A 3SGAE 2SGEE 1TMBH 2GDEH 1CA0C 1ZHMA 1TB6H 2ZWLH 1O32A 4UFEH 3RXRA 2FI4E 1BJUA 2WYGA 3M36A 4NSVA 2GZ7A 1QTFA 1VITF 1VITG 1ZOMA 3BTEE 3RXQA 1SGNE 4AFUA 2B7DH 1EPTB 5EJZA 3RLYH 1TFXA 3E0PB 5JBCS 1MMJN 1QB6A 2UUKB 2H5CA 1EJAA 3ATIA 2Y80A 5L2YH 1O3FA 1IAUA 1K1JA 4CREA 4SGBE 4F4OC 2JH6D 1ZMNA 2FOBA 3DUXH 3SHAH 2FLRH 2GT7A 1YLCA 1YPKH 2PKSC 3P8GA 2SGAA 3EAJA 2XC0A 1GL1A 1UK2A 1HAXB 1EB1H 2Z9IA 7GCHG 3UFAA 1O3LA 1ANDA 1ACBE 3TK9A 1OWHA 1FI8A 1BDAA 1JXPA 2W3IA 1CHGA 2CF9H 1Z1IA 1O5EH 3KHVA 4RKOB 1ELDE 2V35A 4BTTB 2VU8E 2ZQ1A 4DJZB 1EATA 4Z1MD 4J2YB 4TWWA 1KYNA 1AU8A 1TA6A 4CRAA 5TCCA 1A0LA 2VIDA 4K1TA 1THPB 1DFPA 4CR9A 2VWOA 1P9SA 1IQIA 1C5QA 1GMCG 2XCFA 2BD2A 5KEDA 3A7TA 4Y0YE 1QL7A 2Y81A 3F2FA 1E37B 1SLXB 1O2ZA 3ZZ9A 1SGIB 1GCTB 3RXKA 1ESTA 4CRGA 1ZLRA 1O2SA 3ZV9A 3SV2H 3A82A 2BYAX 2A4RA 2OXSA 2AMDA 5A0BA 2CN0H 1B0FA 3KYFA 3RMMH 1F92A 2ZHDA 2KFWA 4ZKRU 3M3SA 4YOJA 3F0OA 2LNCA 1V2TT 1C1PA 1JWTA 2A45B 1JRSA 1KTTB 2ZTYA 3TJUA 4FETA 3AVZA 2YMSC 1MTVA 3L33A 4Y8ZA 4BXWA 3SBKA 9ESTA 1ZTLA 2WV9A 2TGAA 1E35B 1MQ6A 3EE0B 5HYOA 5HIZA 5DP8A 2FTMA 3BEIB 3DSGA 1TRYA 4LK4A 5JB9S 4K1SA 1S85A 3F68H 1P2JA 4AOQA 1CQQA 1BA8B 4AG1A 1DXPA 2QC2A 2PFEA 3MMGA 4AFSA 1O38A 1TX7A 2TRMA 1OS8A 4ZHLU 3M35A 1ID5H 1SGCA 5KECA 1TNLA 2PKAA 1P11E 1MTNC 2H1UA 2K8IA 2ZEBA 3ZZDA 1K0HA 1TONA 5E2OA 3L6PA 5C67A 3SV8A 2H5DA 4X1RU 2BLOA 1MUEB 3PO1B 2ZIQH 1GHXH 4WMFA 1DVAH 5AFYH 2IJOB 4O03A 5HM2A 2BVSH 2FP7B 3RP2A 1UTOA 4ACBA 2SGFE 1T31A 1UK4A 4IMZA 4JK5A 4QT8C 1DWBH 4MTBA 4NIYA 1YLDA 4UD9H 3RXPA 1C2EA 3OAAD 4OGXA 3GS9A 1AO5A 1C1UH 1KDQB 3P8NA 3O8DA 3DD2H 2WPKS 3U8TH 1C1QA 1TRNA 1GI5A 4AYVB 2CHAB 4MNYA 1QRXA 5FCRA 1ARBA 4GAWA 1C1NA 2XBVA 2CGAA 3K9XB 3D23A 2B5TB 2VJ1A 1TGBA 3N99A 1MD8A 1JIRA 2GZ9A 2LP6A 1QR3E 4K60A 1ZMLA 4B6FA 1FN8A 1C9TA 9LPRA 1G9IE 4Q7YA 5FX6A 1ZSKA 2BOHB 3AW0A 3SU1A 2BXUH 4ASHA 3I77A 2WHXA 2Y5GA 4NFFA 1L4ZA 1O36A 4NZQA 4AB9A 1UJ1A 3K6ZA 3RXBA 5LPFA 1P2QA 1AVGH 4VGCC 1O3IA 3STJA 2PWXA 3GY4A 2Z9KA 3SORA 1C4Y2 4CBNA 4IMQA 2R2WU 3UTUH 2BQ6B 3V12A 5EGMA 5E0JA 4BAQB 1MKWK 4FUBA 1HAYB 5DP4A 1SQRA 3LKWA 2BMGB 1CA0B 2W6JD 1K22H 3RXEA 1A5HA 3GCHB 3GCOA 3A86A 1DSUA 3E0NB 1EAXA 1GHBG 1AFQC 2O8TA 2BOKA 1EUFA 3ZVBA 3A7ZA 4TYDA 2Z94A 2BDIA 5IYTA 1QCPA 3LGIA 1ABIH 1ZTJA 3CENA 4ZKOU 4XOJA 1OP8A 2ZDAH 3BTDE 3H7OA 4RT1A 1Z6EA 2VVCA 4Q80A 3RXSA 1QJ7B 5EOKA 1K1NA 4AORA 2F9BH 4X1PU 1TBQH 1MZDA 2VVVA 3PMHB 2GZ8A 3M5NA 3TH4H 3A7XA 1A5IA 2HRVA 1NESE 4ZCNA 6GCHF 2LPRA 2A5AA 4ABGA 1XUGA 5F03A 1G36A 1O34A 1H8ED 1C5PA 2WPJS 1AE5A 1W3CA 3T25A 1HB0B 1O2YA 2GMTB 3SUFA 1ELGA 2C8XB 1MCTA 4WH6A 4AN7A 2A2XH 1WXRA 2J38A 1AKSA 4KP0A 1PPZA 5BRRE 2QN5T 1QJ6B 3PMBB 2FOMB 2G4TA 2BXTH 1HRTH 3TH3H 4Y6DA 3ATLA 1A5GH 4D9RA 3KQBA 1A2CH 1SFIA 4UDWH 2L74A 1Y5AT 4Y71A 2GP9B 1IQNA 1DOJA 2WPDD 1K9OE 2V3OH 1D3DB 1TQ0B 1BRUP 4IC6A 3RMLH 4I8KA 4DOQA 3RXTA 1EXFA 3FO8D 4JZFH 3MNXA 4NGAH 1J15A 4Q2KA 1QBVH 4CRDA 1ESBA 4BOHA 5DN6D 1EB2A 2FLBH 1Y3YA 2PLXA 4CHAB 1GJCB 1C5RA 2BLVA 4NWLA 2ZTXA 2Z3EA 3SNEA 1B7XB 1BQYA 3GYLB 4HGCA 5BPEA 3A7WA 2F43B 1C5TA 2FEQH 4INHA 5JDUB 3E3TA 2A4QA 4ISIH 2SGQE 4JK6A 1P3EA 4H42U 3MNCA 3T27A 3BIVH 2BB4A 5CE1A 1WDIA 1JBUH 3SGBE 2VGCC 8KME2 3H5CB 1O2OA 1HDTH 1NY22 1DLEA 1SGQE 3SJIA 1V6DA 1VKYA 4MPVA 3V3MA 4B71A 4HI3A 1P8VC 2FOGA 3ZZ6A 4BAOB 6CHAB 1O2NA 1EFRD 1OYTH 1XXDA 3GCTF 1TIOA 4TWYA 3LOXA 1P57B 1U6QA 5JB8S 3MH7A 4YLUA 3Q3YA 1G2LA 5GPIB 1BBRE 3Q77A 3PTNA 3PLBA 2RDLA 4MNWA 1KSNA 3SOSA 4I8JA 5F8TA 2TGTA 2RFKC 4OS7A 3UUZA 4WXIA 3K2UA 2OUAA 1EAIA 1YPGH 1Y5UT 4BNRA 5J4QA 1LVOA 4TY6A 3RXIA 2WV5A 1O5CB 2BQ7B 5KGOA 1WTGH 3T28A 2V0BA 3SU4A 5EXMA 5DP9A 2BHGA 1P03A 2C4FH 2IOTA 1QIXB 2ZHQH 1GMHG 2ZGCA 1QA7A 2TIOA 2OLGA 5C1XA 3LGVA 4GHQA 2NU0E 2BZAA 3LDXH 1ESAA 1N8OB 3ATWA 4Z6AH 2QIQA 1G3EA 5H4IB 1C9PA 3SN8A 3SJKA 1AB9B 2FI3E 1GBJA 3ZVAA 2WPIS 1G37A 1QL9A 1O3JA 1P2OA 1AFEH 5GNDA 1NFWA 3BTTE 4M9FA 5AHGH 1THSH 2AGIX 2XYAA 4Y11E 4TSFD 4BTIB 1FZZA 2A0QB 1TE0A 5A8XA 2ODQA 2J98B 2PTCE 1FNIA 4H4FA 1MAYA 1PFXC 3FN8A 3S9AA 1HUTH 3O8RA 1DUEA 1F5RA 1TAWA 5B6LA 1GG6B 1MTWA 4U30A 1GI0A 3VPKA 3RU4E 4I8GA 2TPIZ 3SW2B 2BVXH 4YZUA 3RXGA 1QB9A 1OXGA 2XBYA 3TGIE 3LJOA 3SNCA 1GMDG 1E1RD 1WYKA 1GI3A 5ETXA 1UTQA 1GL0E 2FZZA 2WV4A 2P8OB 4FVBA 3M3VA 1WBGB 1GBKA 1C2GA 1TBRH 3RC6A 1G3DA 3GDVA 4BTUB 3WW7A 3EA8A 3PTBA 1ZJDA 4A7IB 3VXEH 2P3FH 2HNTF 5A2MH 1C2MA 1LVMA 3GISB 3ODFA 5DP7A 3HK6B 3ZZ8A 3Q76A 4A1XA 2AERH 3A8AA 1HJ8A 1LCYA 1NC6A 4OS2A 3RM2H 3ZZ7A 1O2LA 1HGTH 1P3CA 3T62A 5I25A 1O3BA 1Q31A 4X8SH 2ZC9H 5AVDA 3S9CA 2BD8A 2H9HA 1BTHH 1HIAB 1DWEH 7GCHF 2VH6A 1BITA 4BAKB 3TJOA 2F83A 4FUJA 1P01A 2SFAA 1C1RA 1AVXA 3G01A 1CA8B 1ELAA 1RTLA 4OS4A 5AFZH 1Y3WA 2JIZD 1SGDE 2IJD1 1GVKB 1LHFH 1BRCE 2VH0A 4FUHA 2QXGA 3FP8E 1SC8U 4FUDA 3ITIA 1E34B 2PW8H 3KEEA 2ULLA 1ORFA 1PQAA 2ODPA 3BTQE 1V2WT 1NBMD 1OX1A 1N6XA 2TGDA 3QN7A 1KLTA 1C5MD 2ZPRA 2FO9A 2HLDD 2FOCA 2ZU1A 1BZXE 4I86A 5FCKA 2R3UA 3MTYA 3BTFE 1XKBC 1ZRKA 2Q1JA 4IC5A 1V2VT 1DS2E 2ZCLP 1FXYA 1BHXB 2UWLA 1BOQA 1MTSA 1H9IE 1TLDA 1HJ9A 1MQ5A 5CMXH 1T8LA 4HFPB 1A0JA 2Z9LA 5E0HA 1C1TA 2UWPA 5C5NA 1NU9A 1TNKA 2BLQA 3KCGH 2K1QA 4I33A 1YP9A 1SGFA 3RXJA 1W0YH 2SNWA 2ZI2H 4UONA 3BN9A 4AGJA 2GVFA 1FY3A 3SU6A 2P8OC 3TIUA 1V2RT 2IPQX 2OC0A 2RA0A 3HKIB 2Z9GA 3MU8A 3QUMP 4XDEA 1SQTA 2R3YA 2YMSB 2KZ4A 4JZEH 2H9EH 3TLOA 1AMHA 1S0QA 2XCNA 2BDAA 2ZO3H 1Z7KA 4INKA 4YO9A 1WQSA 4NG9H 2BTCE 1JMOH 1IQFA 1QNJA 1UVSH 1GBIA 3OY6U 1VGCC 1O2PA 3BG8A 2CXVA 2LELA 1O3NA 1K1OA 3MU0A 5J4SA 1V2UT 3NCLA 2ZZUH 1P09A 3RMNH 1HLTH 3KQDA 3OTPA 2Z3DA 1J16A 2ZDVH 4FUFA 2FWWA 2XWBI 3UNQA 6CHAC 2EEKA 3DA9B 4AGKA 3FOAA 1FJSA 5F53A 4FXGH 2ZGJA 3EE7A 2THFB 1FIWA 2EI7A 2J92A 1YGCH 3QGJA 1NFXA 3TGJE 1Z71A 1OP2A 3QX5H 4TPYA 3S0NA 2O8MA 1TPPA 1YF4A 5T6DA 1CT0E 1SGRE 4DURA 1O5DH 1KY9A 4JCNA 4DGJA 3KL6A 2AHME 1K1MA 1ELCA 1P02A 3BIUH 2GX4A 3TK5A 1SBWA 3OTJE 2BY7X 4Q7XA 4YM9A 2VIVA 1O3AA 3O8BA 2QAAA 3CP7A 5FL7D 1L4DA 1O2WA 2OC7A 3KGPA 1LHCH 1SG8B 1W10U 1HPGA 4ABJA 3M7TA 1MKWH 1GI2A 5FBIA 3ZVCA 4HG6A 1FV9A 1ZYOA 2H9TH 3LJJA 4MPWA 1O2RA 1CGJE 4ZXYH 1FY1A 2A1DB 2G8TA 1V2LT 1MCVA 2ZDKA 2PGBB 4A5TS 4ZXXH 3KIDU 1LMWB 4NIWA 3RXOA 3UR9A 5DG6A 3P70B 2NU1E 4U32A 3ZYEA 4Y10E 1WTHD 3FVFB 4THNH 2ZHWH 3LH1A 1S5SA 1V2OT 1TPSA 4DCDA 1HV7A 2M5TA 1XUJA 1H9LB 1YCPM 1H9HE 2ASUB 2ZHEH 4UFGH 3A84A 1GBDA 3BTKE 3UAIC 1ANCA 1GBTA 3VB4A 1O2XA 1UHBB 3Q3XA 1QA0A 1T7CA 1UO6A 1YPEH 2QY0B 1DUAA 1TOCB 1H1BA 4AC9A 3T29A 2W26A 2GDDA 2OP9A 4LZ1H 1S6LA 3QTOH 1C2DA 1EOJA 3W1EA 1ETRH 3AASA 3RXVA 1ELEE 1THRH 2KCOA 4D7FA 2ZPSA 1W13U 2AGEX 2G51A 1OPHB 1ZRBA 2F9OA 1VJ9U 3VG8A 1A3EH 1ELBA 1W14U 2HVXA 4M7GA 3UIRA 4NIVA 4Q7ZA 4FU7A 5T6GA 5DP5A 1J8AA 5A0CA 1TNIA 1DY8A 3K6YA 1B5GH 3PM3A 1LKBA 5DSFA 3GY7A 1A7SA 1BUIA 1LPGB 3NK8A 1GJBB 4F49A 1C1SA 1AQ7A 3RXUA 4ABDA 1QHRB 3MNSA 2J95A 3A7VA 1K1LA 3KF2A 2ZFFH 2HLCA 1KXAA 1TX6A 2ANWA 3VB7A 2DE8A 4MLFB 1NM6A 3MH5A 4D8NA 1ELVA 1G30B 3SV9A 1CU1A 3TGKE 2QYIA 2GKVE 3PMAB 4ASUD 1RIWC 5GCHG 3PLKA 2JDID 3PYHA 3F6UH 1SQAA 3F1SB 2QE7D 1L0ZA 2FYRA 1SOTA 4XBCA 3RMOH 1ZPZA 1V2NT 1BT7A 1D6WA 4JYTA 1K28D 2WZQA 1YCPH 4O3UA 1BMFD 3BEUA 2IN2A 3F9EA 1OWJA 4A1TA 2TGPZ 2W3KA 1ZGVA 1ARCA 1K1PA 1PPBH 1EOLA 2FYQA 3ATMA 1XXFA 3HKJB 4GVUA 4X6NA 4Z0KA 3C27B 2HGTH 1TYNA 3RXHA 1MBQA 3OY5U 5A8ZA 1RS0A 1GHAG 1JIMA 5DKMA 1C5ZB 2YMSD 4IW4E 3RXCA 5HKKD 1GVLA 5C0UA 4ABIA 3TNTA 1ZTKA 5GXPA 2OC8A 1HJAC 2VIPA 1GDNA 1FY8E 1TGSZ 3OYPA 5TCAA 1CGHA 4I8HA 2FPZA 1H8HD 1WU1A 4AZ2B 3JZ2B 2F9UA 1GCTC 5E8EH 3MWIU 4OM9A 2R9PA 4A6LA 1EPTA 3ZZ5A 2ZFQH 1PPGE 4WVPE 1OHHD 5DP6A 1C2LA 1NRNH 1S84A 2I6SA 4LOYH 1VCQA 1W0JD 1T32A 3EA9A 2GGVB 4E7RG 1V2QT 1ELFA 1B0EA 2D8WA 2WPMS 2ANKH 1O3KA 3A8CA 3GCTG 2BLWA 3LC5A 4TPIZ 3KN2A 1GHYH 4DIIH 1E1QD 1RGQA 3U98H 1CHOG 4VGCB 4Y76A 4AFZA 1ABJH 1GHWH 4HZHA 2ZGXH 2ZQ2A 3P95A 4UEHH 1EP5A 3V0XA 2AYWA 1Y3UA 2AGGX 1T8OA 2V3HH 1RTFB 3A83A 3D49H 4TT3D 1OYQA 2WSSD 3QLPH 4ZMAH 4IBLH 2B0FA 1A4WH 1CT4E 4ZKSU 4IN2A 4U01A 4E06H 1XUKA 1IQEA 5C1YA 3B9FH 2ODYB 4MVNA 2A2QH 1DLKB 4CRCA 4X2WA 5JPMH 1S83A 1TGTA 2V7QD 3SQHE 1HAVB 4ABHA 1UVUH 3VB5A 1ZHPA 1SQOA 4MPUA 4Y8YA 1ELTA 1PPHE 1KXDA 1DWDH 2R2MB 1SGEE 2OQUA 3Q3KA 3BF6H 3GY6A 3TJNA 1GI7B 1DICA 2HNTC 3WWFA 5C5OA 4ISOA 1E79D
chains in the Genus database with same CATH topology
1TGCA 3QDZB 4X8TH 1MU8B 5DK1A 1J17T 1JRTA 3E90B 1D9IA 5EQQA 1QQ4A 4NA7A 4ABFA 5I46H 5LGOA 1O2UA 3HGNA 2Q6FA 4OGYA 1EX3A 3S7HB 5DO4H 2VIWA 3PV4A 2AH4X 4UFDH 4NCYA 2NWNA 2JETC 5EW1H 2A31A 1Z8IB 3P8FA 1SL3A 5FHTA 1VZQH 1ZZZA 3TK6A 4O97A 1XUHA 2FS8A 1NTPA 2JH0D 4FUIA 4J1YA 3M61U 2BY9X 3P8OA 1TOMH 1Z1JA 2G55A 3TPIZ 1T8NA 1FAXA 2SGDE 7KMEH 2G5VA 3ZYDA 1G3CA 4B1TA 3LONA 1AKSB 1F0SA 1BMAA 4U2WA 2ZDLA 3SHCH 4JYUH 5FBEA 1EASA 1MKXH 2EA3A 1YPMH 1L1JA 1OWKA 2C8WB 4ZHAA 3E8LA 5C20A 2Y7XA 2OCVB 7LPRA 1HAGE 1HYLA 1V2PT 1AWHB 2TBSA 4CBOA 1W7GH 1PYTC 3GY3A 1VCPA 5ESBA 2PUXB 4ZKNU 1RRKA 3BTWE 1NZQH 2FS9A 4X6OA 5FPTA 1GBBA 2FXRA 2G4UA 3FP6E 3MU4A 5LPEA 5CHAB 4NIXA 2AFQB 4KTCA 5FX5A 3T5FH 3UNRA 2YNAA 1C1WH 3LGYA 1GHZA 3SV6A 4X1SU 1CT2E 1QBOA 4UE7H 4GCHF 1AB9C 1VGCB 1Z8GA 2CHAC 1AFQB 4DVAU 1CSOE 3ZZCA 4IGDA 1GJ6A 3UQOA 3HPTB 4X6MA 1SVPA 1WCZA 1PPEE 1ZPBA 1TABE 1CBWC 1NN6A 4X2XA 1A0HB 4YOIA 1ZSLA 3T2NA 1TX8A 2F9NA 1HFDA 2ZF0H 1O31A 3NXPA 5FXLA 1V3XA 4B76A 4CR5A 2ZU4A 3ZVFA 5EW2H 2KAIA 1BRAA 2OQ5A 1NROH 1GJDB 3ZVDA 3SI3H 1YPHE 1SPJA 1Y3VA 4BAHB 1EAUA 4K8BA 1O5GH 1C1OA 1WSSH 1UMAH 3T26A 5CHAC 2FESH 1SHYA 1DM4B 4ZHMU 1UVPA 1T8MA 1SMFE 4CH8B 2WPLS 3UR6A 3M7QA 4AX9H 5EG4A 1SLWB 1HJAB 1FDPA 1O2VA 1N8OC 4B74A 1ETTH 1EKBB 3TNSA 3CS0A 5JBTA 3SJOA 2FOFA 1W11U 3GCHC 3RDZA 1P2KA 2BDGA 4FU9A 2AIQA 1QFKH 4K5ZA 1P2NA 4D9QA 2PGQB 1XUFA 2RCEA 5A09A 2OD3B 4GLYA 5DPAA 1AI8H 3MU1A 2Y7ZA 1DDJA 1TPOA 2JH5D 1BMNH 1ZHRA 4X8VH 1QURH 1GDQA 1AVWA 1YPHC 1KXEA 4MQAA 1L1GA 3BTHE 1UTPA 2SGPE 3SNAA 1SB1H 1GJ8B 2R0KA 1IOEA 1DWCH 3ATKA 4A92A 1INCA 3ZZBA 1GJ7B 2EC9H 1NFUA 1KIGH 1VJAU 2Q6DA 4ISLA 3MO9A 1N1LA 3BV9B 1HBTH 2A7HA 2FOEA 1GGDC 3E91A 1BTPA 1O2MA 1GBFA 2QXHA 1RFNA 2RG3A 1SGFG 2Z9JA 3ZZAA 4Y8XA 3A89A 4K3JA 1BTWA 4YTAA 1W12U 3BTME 2QCYA 3QTVH 4ISNA 3SUGA 1EZXC 1H8IH 4MPXA 3ZZ4A 3GDSA 4AB8A 2GTBA 1H8DH 1O3DA 2J9NA 3D62A 5A8YA 5DJ7A 1UVOA 5L6NH 4INLA 1GWAA 2XWAA 4FUGA 2XRCA 3PROA 5T3HA 1E36B 1WAYB 1YCPK 1PPCE 3IG6B 2ZKSA 5FPYA 1F2SE 3M37A 1GJAB 4NSYA 1KLJH 3RXMA 2DUCA 4X8UH 1PJPA 1IQHA 1TMTH 4BANB 3UNSA 1O3CA 3M5MA 3DFJA 4RN6A 3TITA 5TJXA 1BTXA 3SZNA 3EYDA 1UCYK 3GCNA 2OINA 2VB0A 1GI1A 4GPGA 3SU3A 2CMYA 4Y0ZE 5EXLA 1AIXH 1GMCF 1EJNA 1FN6A 1L2EA 1O2JA 5EQSA 1ZJKA 1XKAC 1G2MA 4ZUHA 3W95A 3SNDA 3LT3A 2FIRH 3SUEA 1D3TB 1BTUA 2XBWA 3EDXB 5LH8A 3VXFH 1Z8RA 1IQKA 1EP6A 1YM0A 1GMHF 2J2UA 4R8TB 2P16A 4DW2U 2OBOA 1AGJA 1RD3B 2ZGHA 2VWNA 4K2YA 1P12E 4AYYB 4B75A 1GHAF 3RXDA 3ELAH 1NO9H 3ZVEA 2PHBA 1KLIH 2BVRH 4MNXA 3QO6A 1DY9A 4YT7H 4JZDH 3P92A 2BDYA 2A7JA 3GOVB 1GI9B 3SU0A 1KXBA 1OWDA 3KQCA 4ZROA 1P2IA 3A87A 4ESTE 2GV6A 3MH4A 3UY9A 2VNTA 1P0SH 1YBWA 4CHAC 2QF0A 2ZFPH 1T4VH 2FX4A 2G00A 2FOHA 5F6MA 4JYVH 2J94A 4JZIA 1C2JA 1J14A 2SNVA 2EI6A 3LH3A 1H4WA 1Y8TA 3GY5A 3VB3A 1QRWA 1Y3XA 1SLUB 3V7TA 2F9VA 2C90B 3UPEA 4FUCA 2ZA5A 1SI5H 3ESTA 1T4UH 3RM0H 3RXFA 2XNIA 1S6FA 3SV7A 3M5LA 5L2ZH 2P3TB 1TBZH 2IPHA 3H7TA 1YPLH 8LPRA 4Y79A 1AUJA 2PKAB 1C5OH 1LTOA 3ZZ3A 1K1IA 2ZGBH 4I7YH 4MDSA 2FMJA 1C5SA 1XX9A 3SJ9A 1BTZA 5GIBA 1VITH 1HCGA 3RC4A 2V6NA 3B23B 2C8YB 3SU2A 1D6RA 1FUJA 4BAMB 3FANA 1UTNA 2ZU5A 3BG4B 3VGCC 4JZ1A 1C5YB 2Z6BD 2HWLB 2OTVA 2ZFRH 3NPSA 4CRBA 1QY6A 1NT1A 1J9CH 5HM9A 3BSQA 4FUEA 1A61H 2UWOA 1V2MT 2H2ZA 3RXLA 2QXIA 2UUYA 1EJMA 1TQ7B 4XE4A 1C2FA 4NWKA 3FAOA 1GMDF 2PR3A 2VINA 3SI4H 4R0IA 3LGWA 4DIHH 5LPRA 2XC5A 4DG4A 1PQ7A 1Z8JB 2ANMH 4KTUA 1DPOA 1GBAA 1GI6A 2AMPA 1FIZA 5EXNA 3HGPA 1QQUA 1NU7B 5DP3A 1WOFA 1GBMA 1C5WB 1OWEA 1HAOH 3MOCA 2FI5E 1QRZA 1HIAA 1W7XH 1KXFA 1QBNA 1UCYH 3U1IB 5E2PA 3FZDA 1LKAA 2R0LA 4KKDA 1GI4A 3A8DA 2BD7A 1D3PB 3AAVA 4I32A 3KQEA 3SJ8A 4WY3A 4AG2A 1E38B 3QZQA 1EAWA 1A3BH 3SNBA 2BY8X 1LHGH 1GGDB 2DE9A 4WMDA 4GCHG 3URCA 1MTUA 1F0UA 1PQ5A 1LQDB 2O8LA 1UTJA 1KTSB 1TGNA 1AY6H 4WMEA 1DE7H 1IHSH 1YPJH 2BD4A 3E6PH 3C1KA 2CJIA 4MNVA 1TRMA 1PQ8A 1LDTT 1HAPH 2BD5A 3NUMA 4XSKU 2P94A 3MO3A 6LPRA 2ZDMA 4RKJB 2BX4A 1IQLA 1C5VA 3UQVA 2HOBA 1DT2A 2FOAA 4Y7BA 2GCTB 1K2I1 1M9UA 3URDA 1HNEE 1MAXA 1F0RA 2XC4A 4ISHH 1ZR0A 2UUJB 2NU4E 4WF8A 2RA3A 2HPQH 1VR1H 3PB1E 3O8CA 1TMUH 1HAVA 3K65B 5G4BA 3DHKH 1MD7A 1S6HA 3SQEE 2CF8H 3VFEA 1NRRH 1BMLA 2ZDNA 1GCDA 1P2MA 1D3QB 1RIWB 4KGAA 5FAHA 1FY4A 2GT8A 4X0WU 2WPHS 4RSPA 1ZGIA 3LGTA 2ZCHP 1IQMA 3MFJA 4WWYA 1AZZA 3RUOA 2BM2A 2NU2E 4X2YA 3LIWA 2XBXA 5GDSH 3SGQE 2A4OA 3RXAA 3E1XB 5EU8A 3IWMA 1AE8H 3TJVA 1SHHB 4KELA 8GCHF 1GG6C 2O9QA 3VB6A 1C2HA 1BHXF 3GICB 1GBEA 3WY8A 2UUFB 4E7NA 1O3GA 6ESTA 2G5NA 1MTNB 2BX3A 4B2CA 1ANEA 1UTKA 2VWLA 3B8JA 3PWBA 2F91A 4IN1A 1FPHH 4A1VA 1OWIA 2GCHF 3CS7A 2W7SA 3SU5A 1IHTH 1SLVB 4GHTA 1C2IA 3MYWA 3L3TA 1G3BA 1MU6B 2Y6TA 2ZU3A 1O5AB 2J34A 3I78A 4X1QU 3SUDA 3N7OA 2D2DA 4NA9H 2W7UA 4X6PA 1GJ9B 4CH2B 1QGFA 2STBE 2ZNKH 1FPCH 2ZECA 2CV3A 1UTMA 3ZVGA 1O2KA 2YNBA 2PSXA 2Y82A 1EPTC 8ESTE 1ZSJA 2HNTE 3TVJB 3IITA 1OP0A 5EPYA 3EA7A 1LVYA 2ALPA 1TNGA 1A46H 1XM1A 5HXFA 3P6ZB 1TNHA 3NWUA 4UFFH 1GHVH 5JBBS 4NFEA 1ZMJA 5FPSA 1OKXA 4XBDA 4D76A 2WUBA 1AZ8A 1Z6JH 1O2HA 2ALVA 5EQRA 2STAE 1O5BB 2I6QA 1GPZA 5AF9H 2BZ6H 2JETB 4YESB 4O3TA 1K21H 1LO6A 1MZAA 2PUQH 2QA9E 3PMJA 5JBAS 1F5LA 3DT0H 1NRPH 5HGGA 1S81A 4YLQH 3F9GA 4PROA 2FM2A 1D4PB 1O3HA 2QF3A 1O39A 2QV1A 1BIOA 1LPZB 1V2JT 5HMAA 3S69A 4B2BA 4X2VA 3S7KB 2NU3E 1C4V2 2O8WA 2ILNA 3FP7E 1DANH 3MNBA 2C3SA 2PTNA 4OS6A 1CGIE 4YOGA 1DSTA 1RXPA 3QGNB 1IQJA 1NS3A 1GVZA 3EGKH 4JMYA 6GCHG 1SGTA 4GUXA 4ZAEA 3OX7U 2ZP0H 3A85A 2J4IA 4AFQA 3DFLA 3NZIA 1W0ZU 3FFGA 5E0GA 4FVDA 2VIQA 2C93B 1S82A 3MH6A 1DXWA 3A88A 4HTCH 3Q00A 2BQWB 2AEIH 3U8RH 3UWJH 3SO3A 1QJ1B 1QL8A 2G52A 4X1NU 3EQ0H 1AUTC 2P59A 3A7YA 2WUCA 1HAHH 2FTLE 3RC5A 4E05H 3F9HA 1BRBE 1C5XB 1OOKB 3U9AH 2O8UA 2ANYA 3M7UA 5GCHF 5EPNA 3AAUA 1F0TA 4DY7B 4SGAE 2BY5X 1XVMA 2GCHG 1BMMH 1WQVH 4K1EA 1MBMA 2BD3A 1LPKB 1P04A 2YOLA 1CBWB 7ESTE 1EZQA 5SGAE 2Z7FE 3FZZA 2Y5FA 4ZH8A 1MKXK 3ZV8A 1FAKH 2XW9A 3MO6A 1KDQA 4TY7A 1C4U2 3UWIA 1PPFE 1O37A 4ABAA 2ZFSA 2PSYA 1LHDH 3GYMA 3PWCA 3VEQB 1PYTD 4H6SB 3PO1C 1GI8B 2Y5HA 1NRSH 3U69H 1DITH 2XTTB 2AIPA 1HAZB 1TNJA 2A32A 3V13A 2P93A 1BCUH 1S0RA 1C1VH 1CO7E 2D26C 1C5UA 1NRQH 2ZPQA 2VWMA 1FQ3A 1RTKA 2OC1A 3D65E 3R3GB 1BTYA 3BG4C 3VGCB 5C2ZA 2PV9B 1P10A 3GDUA 3I29A 4B73A 1KXCA 1GBCA 5K7RA 1UHBA 1WV7H 1GBLA 2ZG0H 1GBHA 2GMTC 2VGCB 3E16B 4K8YA 2Q6GA 3MHWU 1P06A 3KNXA 4B2AA 4WH8A 5C3NA 1O2QA 1QB1A 1GJ4H 3M5OA 2GV7A 1O2IA 1BBRK 1TWXB 3PLPA 1RJXB 1CHOF 3F9FA 1FLEE 1F7ZA 1O3EA 3TH2H 1CVWH 4H6TA 1JOUB 1E0FD 2P3UB 5F8ZA 1HAIH 2KAIB 2A7CA 3GY8A 4I8LA 1P05A 4KTSA 1C1MA 3MU5A 1AWFH 4CRFA 1HXEH 1P9UA 1YYY1 2Z3CA 3ODDA 4XBBA 2VVUA 1ANBA 1Q3XA 1C2KA 2B9LA 1OSSA 1Q2WA 4LXBH 4NA8A 1UVTH 2BDCA 3U1JB 5GWZA 3MI4A 1O3OA 2HPPH 3R0FA 2A5KA 2VIOA 2WINI 5DGJA 1XMNB 2PKSB 1FONA 5T6FA 3A80A 3RU4T 2AS9A 1HXFH 3P17H 4DT7B 1GDUA 4NZLA 1CE5A 4WJG2 1W2KH 1O35A 2A4GA 5B6OA 2BDBA 1N6YA 2ESTE 2F9PA 3ENSB 1C5LH 3TU7H 3LPRA 1SR5C 2ZCKP 1L1NA 1O2GH 1FY5A 4WXVA 2G81E 4O9VA 3LC3A 3S9BA 3HK3B 2H6MA 1W8BH 1A1RA 3M3TA 1YC0A 5ABWA 1EQ9A 3BTGE 3LU9B 5C1UA 2ZTZA 1Y5BT 5L30H 1UCYE 3A81A 2WYJA 5JYIA 2BDHA 1IQGA 1TALA 4D7GA 1ETSH 1O3PB 2QGRA 3STIA 2HALA 3GY2A 1AHTH 4K69A 1ZPCA 2W5EA 2B8OH 1FMGA 1DX5M 2JKHA 2XXLA 3NKKA 4MG3A 4XFQA 3JZ1B 1O0DH 2ZU2A 1SGYE 1TPAE 3QK1A 1BJVA 4I31A 1G32B 1Y59T 5K0HA 4YT6H 2BY6X 1O5FH 2EI8A 3OU0A 2ZFTA 2GCTC 1O2TA 4OS1A 2D1JA 2FDAA 5A0AE 1NFYA 2BD9A 1LVBA 1BBRH 3U8OH 2AMQA 1GHBF 1LHEH 3UOPA 1EZUC 4ABBA 2A5IA 3AW1A 5F8XA 3W94A 1XUIA 3RU4D 1WUNH 1O30A 5EODA 2QXJA 1UTLM 4GSOA 1F5KU 1AN1E 3BEFB 1EZSC 3OSYA 1SSXA 3QZRA 3QWCH 2OBQA 5GJ4B 2FODA 1LQEA 1SFQB 1X7AC 1O33A 4FU8A 1YKTA 2F3CE 1AD8H 1TA2A 1UK3A 1XVOA 4OS5A 1NPMA 1O3MA 3UOUA 1SOZA 4BXSA 3HATH 2GD4B 3RLWH 1C5NH 4IS5A 1BB0B 4ABEA 1SGPE 5PTPA 8GCHG 4Y7AA 3UREA 3LGUA 1V2KT 4LZ4B 2P95A 1V2ST 5IDKA 1VCWA 2C8ZB 2ZHFH 1GJ5H 5ESTE 2FX6A 3A8BA 1MH0A 3SGAE 2SGEE 1TMBH 2GDEH 1CA0C 1ZHMA 1TB6H 2ZWLH 1O32A 4UFEH 3RXRA 2FI4E 1BJUA