2VIPA

Fragment-based discovery of mexiletine derivatives as orally bioavailable inhibitors of urokinase-type plasminogen activator
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTISLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR CHAIN B
publication title Fragment-Based Discovery of Mexiletine Derivatives as Orally Bioavailable Inhibitors of Urokinase-Type Plasminogen Activator
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 60
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2007-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2vipA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2vipA01
1OWHA 1C2FA 2TGPZ 1HJ9A 6GCHG 3MTYA 4CRGA 2G52A 1DY8A 4VGCC 3MU5A 4TY6A 4CRDA 5JYIA 1MTVA 3PO1B 2P3FH 1O3KA 2DE9A 1J15A 2A1DB 4X2WA 2ZFTA 3TJOA 1SG8B 1LHDH 2PR3A 3FP6E 2XNIA 3CENA 1SGPE 2WPHS 3SV8A 2GV7A 5IYTA 1Q3XA 3HKIB 1C2KA 1V2MT 4MNVA 4NCYA 5EW2H 4UONA 4NA9H 5C1YA 1Y3WA 5I46H 1OPHB 2A5AA 1PPZA 3TGJE 1LHFH 1YPHE 3RXIA 3PWCA 2A4GA 9ESTA 5C1UA 4MG3A 3I29A 5GDSH 1D3QB 2ZDMA 2V6NA 3PTBA 5AHGH 3DHKH 5LPEA 3SHCH 3URDA 1SR5C 1XXFA 3R0FA 1S0QA 3IG6B 3KF2A 4H4FA 3PB1E 3ZVBA 1DOJA 3QLPH 3ZZ7A 3A87A 1O2XA 2WUCA 3FFGA 3GCHC 2O8MA 5A8YA 4JZFH 1OWJA 2ZIQH 2FOAA 1A5HA 1ETRH 1V2UT 1AZ8A 1EAWA 1GJ4H 1P10A 2C8YB 3S9AA 4F4OC 1VITH 4K1SA 3E0PB 3O8RA 1RIWC 3RM2H 1GHAF 1OX1A 2QYIA 3TVJB 1F0SA 1Z8JB 2O8TA 3A80A 1GPZA 4OS2A 2ANYA 3LIWA 4I33A 4FVDA 2FOBA 1KLJH 4Y76A 2W3KA 3UR9A 1C5ZB 1C5RA 2EI7A 1ZGVA 4INKA 4D9RA 3ATKA 1ELVA 1HV7A 3RXKA 4B2BA 2K1QA 1YCPK 1ZOMA 1YBWA 1C2MA 1W11U 2FI4E 3HK6B 3MO3A 3SV9A 2ZFSA 4AFZA 5JBTA 4Y71A 3D62A 4MNYA 2Y6TA 1S84A 2XBYA 1CHOF 2Y82A 4X6MA 3TNTA 1DE7H 1E0FD 1O2GH 1G36A 4RSPA 2AMQA 2R0LA 3VB3A 5C67A 2XW9A 2SGFE 3W95A 1ARCA 1RTKA 3SV7A 1K1PA 4R8TB 1SC8U 3QTOH 3TU7H 2R2WU 1T7CA 1OSSA 1S82A 3LH1A 1V6DA 5FCKA 1UVSH 1GMHF 1Y3UA 5FX5A 4D7FA 6ESTA 1Y3YA 4LZ4B 2WPLS 3TK5A 1K1IA 2BDAA 3GY2A 4ZKRU 2WYJA 4WMEA 4MNWA 4NIVA 2G81E 1THRH 1TPOA 3ZZ3A 4E05H 5FXLA 3VPKA 3O8DA 3VFEA 2NU3E 4BXWA 5GPIB 3LJJA 4ZKNU 2ODPA 1HBTH 2A2QH 1U6QA 2GP9B 2EC9H 5E2OA 3BG8A 4NWLA 2FS8A 2AGIX 1AKSA 2FLRH 2ZECA 1TNLA 2FZZA 1ZPCA 5PTPA 3EGKH 3TK9A 2GCHF 1F5RA 1KYNA 1HJAB 1NFXA 1AWFH 3GICB 2LPRA 5H4IB 1BBRK 2J4IA 5T6FA 4IN2A 1QR3E 4AX9H 1O2SA 4GLYA 2BX3A 4DIIH 1EATA 1C1RA 2QCYA 2GVFA 1C2IA 1PQ8A 2SFAA 1UK4A 1MU6B 8GCHG 1O5GH 1MBQA 2ANMH 4NSYA 4ZH8A 3BG4C 1CBWC 3A8DA 2ULLA 5EXLA 1S5SA 4K2YA 1SQOA 1T4UH 1A0LA 1EP5A 1S6HA 3BTME 4MPWA 3RXHA 5CMXH 2ZHWH 4OS6A 1LPKB 1O2YA 1FZZA 3B8JA 3NKKA 3GOVB 2AH4X 1VCPA 2H2ZA 3IWMA 5C5NA 3DT0H 3MU8A 4JYVH 1YCPH 5FCRA 3M61U 1J14A 4GCHF 3WY8A 3RP2A 1KXFA 3FP8E 2C4FH 1G3CA 3BTEE 1G32B 3RLWH 1QY6A 5EXNA 5DP6A 4ZXXH 1JXPA 1GG6B 5EPNA 1QB6A 1QB1A 3TGIE 3A83A 1CSOE 1QL7A 2A7HA 4GSOA 1FDPA 3RXRA 2Z3EA 3BTFE 2EEKA 1GDUA 1XKAC 3KQEA 4JCNA 2FOGA 2HOBA 5JBCS 1N8OC 4H42U 1BUIA 1TQ7B 1CT2E 4NG9H 1YKTA 2D8WA 2AERH 2ZU3A 1X7AC 2Y5GA 1SGIB 1Z6EA 1AFEH 1LPZB 1O2PA 1FAXA 1FI8A 4NFEA 1O3OA 1RRKA 3MNBA 2H9EH 1K1OA 3MNXA 1Z6JH 1BTWA 2AIPA 4OS1A 3BTTE 1YP9A 3GCOA 1P03A 1NO9H 2UWOA 1FN8A 1OP0A 3UY9A 2Y81A 1GCTC 1YPHC 2O9QA 5CHAC 1GJAB 2CN0H 2ZZUH 1MQ5A 1JMOH 2XCNA 1AVWA 1NZQH 4XBDA 1P3CA 4MVNA 4A1XA 4JZDH 3EQ0H 1GHAG 4BAHB 2BXTH 1A7SA 4ZHAA 2HPPH 3SU3A 3ZV9A 1ZYOA 4Q2KA 2CV3A 4XBBA 2ZDKA 1DSTA 3SNCA 1UTKA 2CXVA 3L6PA 3SJIA 3GYMA 4E06H 3GDUA 1GI9B 1NTPA 1ELGA 3RMMH 5E0JA 1PPEE 2QXGA 2Z3CA 3KEEA 1D6WA 1C5YB 3NZIA 3ZZ9A 1O5FH 2FI3E 4I7YH 1QRXA 2PKAA 1TX8A 1PPGE 3V7TA 4CR9A 4XSKU 1CHOG 4X6PA 3TH4H 4Z6AH 1GBDA 1O5BB 4B73A 1XVOA 5EW1H 1BRCE 1W10U 1SGFG 3K6YA 1BHXB 1MMJN 1NRSH 2O8WA 3KIDU 1KXDA 1O3JA 6GCHF 5L2ZH 4Q7XA 3NK8A 5DJ7A 2PTNA 1OP2A 4YM9A 1UVPA 1V2RT 2FMJA 2ZHEH 1YPGH 1P57B 2YNAA 1GHWH 1GMHG 1A4WH 1QURH 2BVXH 1LVYA 1GI1A 5DK1A 1GI0A 1YPMH 3RXTA 3SW2B 2FYQA 2R3UA 1ZLRA 4BXSA 1ESBA 2P8OB 3RXPA 2QC2A 1GMCF 3M37A 2BHGA 2V35A 2QF0A 4ZAEA 5ABWA 3U8OH 2FS9A 2WV4A 1EJAA 4NSVA 1LQDB 5C3NA 1BTYA 3S7KB 4ABHA 3VEQB 1LKAA 1GJ9B 1EAIA 1QJ7B 5TJXA 1W13U 4BAQB 5A8XA 2CHAB 1ZSKA 4KGAA 1MQ6A 3ELAH 1E34B 2VWNA 2HNTF 3SGBE 2ZHDA 2NU1E 3M5NA 4Q7YA 1P0SH 4CBOA 1TBZH 1O2HA 7KMEH 1W0YH 1HNEE 1NN6A 4ABDA 3U69H 1XUKA 1GL0E 1O2ZA 1GJDB 1G3BA 3RXBA 4AG1A 3A86A 2FX4A 2A0QB 2VIWA 5DPAA 3FVFB 2QXIA 2FOCA 2ZA5A 3UFAA 1L1GA 2OLGA 1VGCC 1GI6A 1IQIA 2FDAA 1G37A 4WVPE 1TNHA 1ACBE 2XBXA 1WQSA 1DWEH 1CA0B 1OWKA 2WUBA 4YLQH 1D3TB 1EZUC 3BTHE 4WWYA 4X2VA 2BD4A 3SJOA 1O2TA 2ZF0H 3ODFA 2CMYA 3QZQA 1LTOA 1O2LA 3P8OA 2KAIA 2QV1A 2P93A 2ZP0H 3AAUA 1P9SA 1G30B 3TPIZ 1LCYA 3NXPA 3KN2A 3U8RH 1IQNA 2ANKH 1YPKH 4GCHG 2F9NA 4KKDA 1SHYA 4I8HA 3LGYA 2G5VA 5FPYA 1IQMA 2CJIA 1AKSB 4CHAC 1OWEA 2NWNA 3M7QA 2PUQH 5F6MA 2F9VA 3SZNA 7GCHF 1F5KU 1KXEA 4X8SH 1PQAA 3LGIA 4ZUHA 1KXCA 3QTVH 4MPVA 5TCCA 4B74A 1W3CA 1O3CA 1KIGH 2Y7ZA 2ZTXA 2VGCC 1MTNB 2I6QA 1ZPZA 1CT0E 1ARBA 2ZI2H 2BY5X 1O3DA 1TX6A 4UFEH 1UCYE 2GCTB 1TPSA 2BLVA 2OC0A 2ZFFH 2OP9A 4INHA 1VJAU 1NROH 2FOFA 4FUHA 1EPTC 3KL6A 4Y8ZA 2XBWA 3SV6A 1O35A 1QBVH 2VIPA 2P3TB 3Q3XA 1P05A 5C1XA 1O3MA 3QGNB 3EA9A 4DOQA 2Q6DA 1ELEE 2FTMA 2Z9LA 5GIBA 2Z6BD 3BIUH 3RU4E 4CBNA 2CF8H 1ZGIA 2A31A 2O8LA 1EOLA 2DE8A 3ATIA 3CP7A 1GI8B 2TPIZ 1P2JA 4AYYB 1ABJH 2A5IA 4HZHA 3LGTA 1ZTLA 4GPGA 1QL8A 2DUCA 3EE0B 4DGJA 3SHAH 2FLBH 1MZAA 4NA8A 3MHWU 2H9HA 1CE5A 4A92A 1HIAA 3SNDA 4WH8A 1BJUA 1O2KA 2WPMS 3MH5A 1UJ1A 2VU8E 2F9BH 3BTGE 4JYUH 1GHYH 2YOLA 5I25A 1LVMA 2W7UA 1UTJA 2BMGB 1K21H 1GI5A 1THSH 1DICA 3T25A 3UWIA 3EA8A 2VIOA 4WXVA 4ABAA 3P70B 4K60A 3HGNA 4A6LA 1O37A 5A0BA 1GBHA 2G00A 1V2PT 1GI2A 1YPJH 3LJOA 1WV7H 2BD7A 3GDSA 3MU4A 1T31A 1BMLA 1UTLM 3LONA 4GHQA 5HXFA 2W26A 1KDQA 1XUGA 3M7UA 4IC5A 3A8CA 5L30H 2Y5FA 2XWAA 4O9VA 5GWZA 1GBAA 2SGEE 2R0KA 4IS5A 1DSUA 1FIZA 4E7RG 2ALVA 4MNXA 3B9FH 2H9TH 1O3LA 2WV5A 3LU9B 3ATMA 5FPSA 1GMCG 1ELTA 1LHEH 1BMNH 3O8CA 2G4UA 5J4SA 2FXRA 1TRYA 1FY3A 3PWBA 3E3TA 1GJCB 1Y59T 3UNSA 2OCVB 1C5VA 1LHGH 8LPRA 5HM2A 4I8KA 1K1NA 2OBQA 2H1UA 4B2AA 1TGSZ 1L4DA 1DWBH 5BRRE 3LT3A 4Z0KA 2PTCE 1QBOA 3IITA 2FM2A 3RXAA 2FOMB 1FIWA 1HCGA 2PKAB 1G2LA 4CH8B 3RLYH 4TPIZ 4AN7A 2A7JA 1F5LA 2BOHB 4JZEH 1TNGA 1Z1IA 1GDQA 3VXEH 3SU1A 2PKSC 4X2YA 2EI8A 4O3TA 1UO6A 3RXJA 1O38A 1O3GA 2FODA 1DWCH 5T3HA 2BOKA 1QFKH 1MH0A 4ESTE 1VJ9U 1JIRA 2SNVA 4WMFA 3ZZBA 4Y8YA 1O5DH 1GCDA 2VVVA 3T2NA 3OY6U 2BVRH 3PO1C 2FTLE 1YYY1 3F9EA 2IPHA 5T6DA 2LNCA 4ZXYH 3GY5A 1EP6A 1Q31A 3K6ZA 1ESTA 4FUBA 3U1IB 1Z8GA 1SLVB 1GBTA 1GHVH 1AQ7A 1BIOA 1GBCA 3SUGA 1EJNA 3MU0A 3A7ZA 3BEUA 2C3SA 1BCUH 3SV2H 2BQ7B 7LPRA 2G55A 2QGRA 3B23B 1TRMA 1TFXA 1T8NA 1AGJA 1K1LA 1QQUA 1ABIH 1SQTA 1UCYH 2TGAA 4AGKA 2W3IA 4X8UH 4ZROA 4Y0ZE 2BLQA 1C5OH 4U2WA 4X1RU 1IHTH 2ZQ1A 1BTPA 1LDTT 7GCHG 1C4U2 2AMPA 4Y8XA 1BBRE 3SOSA 1ZZZA 3V3MA 1AO5A 1F2SE 3SJKA 3SNEA 2ZTYA 2PWXA 1NPMA 2OD3B 1SSXA 2O8UA 2QAAA 4PROA 3GYLB 4ISOA 4U01A 3UREA 3RDZA 3HATH 3A7XA 5A2MH 2F91A 1BITA 1GGDB 3Q00A 1SOZA 2GT8A 1V2NT 2ZNKH 4AG2A 1AZZA 1Y8TA 1P8VC 4FUGA 2ZU1A 1JOUB 1EPTA 1NESE 4F49A 1IOEA 2UWLA 4JMYA 4JZ1A 3NCLA 1GHBF 3AAVA 1EAUA 2OC1A 2Z9JA 1P2IA 3TK6A 4AORA 2XTTB 1C5LH 1UHBA 3BG4B 2BY6X 1BDAA 1O2MA 3QDZB 3FZZA 1TONA 2C90B 1G3DA 2KAIB 1GVLA 2D26C 2GZ7A 1EZQA 1MUEB 1UTQA 3STIA 4YOIA 1GI7B 1W7XH 1AUJA 2OXSA 4DJZB 1HAYB 1BOQA 1WUNH 2ZFRH 3E90B 1BHXF 3V0XA 3F1SB 3LGUA 1O33A 2ZDNA 3W94A 4X6NA 4MPUA 2BDYA 2ZG0H 1S0RA 1ZRBA 1SGEE 1D3DB 1L1NA 2ZPQA 4ABJA 1TOCB 2A45B 3SUEA 4ISHH 2STBE 1DUEA 3MYWA 4WMDA 4E7NA 2QY0B 2THFB 1W0ZU 3MU1A 1N6XA 3P92A 1N8OB 1MU8B 1MKWK 1SGCA 4ISNA 4IN1A 4AB9A 4WXIA 5C5OA 3PYHA 4K8YA 3S0NA 1O2JA 1V2WT 3A8AA 1ANEA 2VIQA 8ESTE 4A7IB 2FOEA 3GY8A 4OGXA 2FIRH 1ANCA 1LKBA 4UFDH 3NPSA 3TJNA 1TALA 5FX6A 1GHZA 3PV4A 3TJUA 2AFQB 5A09A 2ZWLH 5EXMA 1C2LA 1Y3VA 4ABFA 1L1JA 2PFEA 2M5TA 2VIDA 4XBCA 1GJ5H 4FUEA 3AW0A 1GI4A 1HFDA 1BA8B 2ZHQH 4FU9A 2FP7B 1SBWA 2ZHFH 1O30A 3TJVA 3SU0A 1P2NA 1GBLA 1SI5H 4HI3A 4K5ZA 2PUXB 1MD7A 5DKMA 1SGDE 5DP8A 1PPCE 2TRMA 1C1TA 1FY1A 1C2JA 3ZZDA 2OINA 1IQLA 1HIAB 1W8BH 3K65B 3RMOH 1D4PB 1NU7B 2VINA 3KQCA 1RFNA 1SOTA 1C2HA 1EASA 2F3CE 3LOXA 2HRVA 1TBRH 3BSQA 1DANH 4ISIH 1C1WH 1GBJA 3VGCC 1ID5H 1IQFA 1S6FA 1O34A 3A7WA 1P11E 7ESTE 1GBKA 2VH6A 3DUXH 1EZSC 1MTWA 1T8OA 1Y3XA 4YT7H 1TWXB 1UTNA 2FEQH 3RXQA 2AGGX 4UFGH 1ELCA 1PJPA 1MKXK 1TGTA 1TB6H 1C4Y2 3GCTF 1V2TT 2ESTE 3BEIB 1O2WA 3P17H 3RXOA 2UUJB 3SU6A 3ATLA 1FQ3A 1ZMLA 1KDQB 2TGDA 5FBIA 1UMAH 1NFUA 1OP8A 1AFQB 1FN6A 3UQVA 4IGDA 2JH5D 2ZFQH 3GY6A 3ZVDA 2Z94A 1GJ8B 4U32A 2Z3DA 3LC3A 5EU8A 1BBRH 4AZ2B 4ZKSU 3QO6A 1JRSA 4NGAH 1PYTC 4MQAA 1AU8A 3TIUA 1K9OE 4OS5A 2QA9E 2R2MB 3VB7A 1THPB 2XWBI 1UVOA 1D6RA 2Y5HA 1CQQA 1IQKA 1DS2E 3TGKE 1C5SA 1ANBA 4NWKA 5ESBA 3MNCA 1IQGA 2SGQE 3E8LA 2V3OH 3QX5H 3ZYEA 2BYAX 3PMJA 2RDLA 2BDIA 1IQHA 5EQRA 3GY4A 1C1VH 5JB8S 2BXUH 1LPGB 2BLOA 2P59A 3UUZA 4NZQA 1UTPA 2W7SA 3MMGA 4YO9A 2VWLA 4YOJA 2G8TA 3MFJA 2JH0D 2EA3A 3H7TA 1OS8A 1EKBB 3ZZ4A 1T32A 4WF8A 4B1TA 3ZZAA 5AFYH 1OKXA 1AE5A 1HGTH 1O2IA 1KTSB 2XC5A 1B0EA 2BDGA 1N6YA 2TIOA 2AGEX 1J9CH 1GHBG 1P09A 3K2UA 2HNTE 3ZZ8A 1YM0A 2ZGHA 4JK6A 1CGHA 3EDXB 1HAOH 2QXHA 1AIXH 1IHSH 3BTKE 1A61H 1RTFB 1CVWH 2FX6A 4YLUA 5ESTE 3D65E 3RXGA 3BF6H 4KTCA 2ZQ2A 1TAWA 1Y5UT 3FP7E 3ZZ5A 3MNSA 3QGJA 2GX4A 4AOQA 1C1QA 1SMFE 1AHTH 1V2LT 4CHAB 3QN7A 3S9CA 4TY7A 1O0DH 3LGWA 1O3BA 1QQ4A 1C9TA 3U8TH 2BDHA 2AS9A 1HPGA 1ZTJA 1TPPA 1P2MA 4FVBA 4WJG2 4LXBH 3ZVGA 2HPQH 1NT1A 1DDJA 2BD5A 1TIOA 2ZGJA 5B6OA 2PLXA 1XXDA 4DURA 4IMQA 1F7ZA 1HXFH 5TCAA 3Q3YA 1Q2WA 1NRNH 3A85A 1O3PB 1J16A 2PW8H 2XBVA 1WAYB 1ZHPA 1A5IA 1C2GA 3PMBB 3AW1A 1TGBA 1EPTB 1QNJA 2WPJS 1WOFA 3R3GB 5JBAS 1LO6A 1FLEE 6CHAC 1GJ7B 1UHBB 3SBKA 3SI3H 3UOUA 3RM0H 5E2PA 4BNRA 2B5TB 3A84A 4K1EA 1TMTH 3E6PH 1P12E 4RN6A 5GJ4B 3DD2H 1F0UA 1M9UA 2CHAC 2OBOA 1C5WB 1GBFA 2CF9H 2ZCLP 4FUCA 1VZQH 1C1PA 2YNBA 3F9GA 5JBBS 3DFJA 3C27B 1DWDH 1ORFA 4X2XA 1PQ5A 3OSYA 3SU5A 2UUFB 1V2ST 4BAMB 1DUAA 2IN2A 1O3IA 1TYNA 1P3EA 4I8GA 1O32A 1ZHMA 2VB0A 1DITH 3I77A 1BRUP 1S81A 1FV9A 1RJXB 1VITF 1SGYE 1WCZA 1UTOA 1O5CB 3MO9A 1LVBA 3ENSB 1QCPA 1QGFA 4BTTB 4YT6H 1QA7A 1CA0C 4CR5A 1EX3A 3RC5A 1UTMA 5DP4A 2QIQA 1A2CH 4INLA 2WYGA 3JZ1B 1BTXA 2ZU2A 3VB6A 4AFSA 4THNH 2TBSA 4YZUA 4BTIB 1C5TA 1XVMA 3TH3H 3A89A 1TLDA 2A4OA 4X1NU 5DGJA 2ZU5A 1G3EA 3GCTG 5BPEA 1OWIA 1VR1H 1JWTA 1ZJDA 1C1NA 1NRRH 5IDKA 2ODQA 2ASUB 3LDXH 4HGCA 3SNBA 3M3TA 4VGCB 1A3EH 1O2RA 4ZKOU 1KSNA 1O2NA 1O2QA 1P02A 1RGQA 3KQDA 1C5XB 1TBQH 4Y79A 1SVPA 1UVTH 1CU1A 1K28D 1HAPH 3GY7A 2Y80A 3KQBA 1PPHE 4GAWA 4ABIA 1KLIH 2GDDA 2WPKS 2QXJA 3UNQA 4AYVB 4D9QA 1P2QA 1N1LA 1FMGA 1B5GH 2ZCHP 2RCEA 2GCTC 1EXFA 4H6SB 3PROA 1C4V2 3OY5U 1HRTH 1NY22 3LC5A 3UOPA 2UWPA 4LOYH 2GMTC 1Z7KA 4J1YA 2BY9X 1EJMA 2VVCA 1WTGH 4BAOB 2J92A 4OGYA 5T6GA 4IW4E 4ABGA 2AEIH 2ZFPH 3GCHB 1GWAA 2RA3A 4KTUA 3DA9B 2PKSB 1WU1A 1Z8RA 1T8MA 2QF3A 5DO4H 2PSXA 2IOTA 1O3NA 2RG3A 1RIWB 4GUXA 1CT4E 1K1MA 1TGNA 3SQEE 1YLDA 3RU4D 1SHHB 4I31A 5E0GA 3T5FH 4RKJB 2GDEH 5LPRA 5EPYA 1E37B 1V2KT 4FXGH 1S83A 1F0RA 1XM1A 2R3YA 1NRQH 1OYTH 5HYOA 1JBUH 1G9IE 2W5EA 1O2UA 1D9IA 5DP3A 1PFXC 4IMZA 1BQYA 3RXMA 1INCA 2B8OH 1AVXA 1O3HA 4IBLH 3T62A 4XDEA 2BQWB 1A3BH 1L0ZA 3KHVA 2H6MA 4NZLA 1CA8B 4HFPB 5E8EH 4KELA 3UWJH 1SPJA 5AFZH 3RXEA 1AB9C 4X1QU 1TGCA 5FAHA 3F6UH 5F03A 1NC6A 1O5AB 2A7CA 2FOHA 2HNTC 2ALPA 3L33A 4DIHH 1ELDE 1O36A 2JETC 4FUJA 2G5NA 1GBBA 4WH6A 1BT7A 4BANB 3AASA 3PLPA 1HAIH 2TGTA 2OUAA 1RS0A 1HLTH 1T8LA 2PV9B 1QRWA 3GDVA 4MPXA 1HAVA 2B7DH 1NFYA 2OTVA 3CS7A 1O39A 4Y0YE 1T4VH 1YCPM 1MTUA 1V2VT 3TITA 3UNRA 3BIVH 1C5PA 1HAHH 1NM6A 2A2XH 2ZPRA 1PQ7A 3SO3A 1H9LB 4MTBA 3ODDA 2ANWA 1TMBH 1LHCH 1V2OT 3LKWA 1FY8E 1SFQB 3VB4A 3RXLA 1NU9A 2ZGXH 1PPBH 1GBMA 3MOCA 4I8JA 3KGPA 3RXVA 3VXFH 5F8XA 4FU7A 1EB1H 1W2KH 2JKHA 1DLEA 4X1SU 2XRCA 2Z9GA 3UIRA 1MBMA 1IQEA 5LH8A 9LPRA 3RXDA 2C8WB 2VWMA 3V13A 8KME2 4A5TS 5DG6A 4Y7BA 3N7OA 1IQJA 2ZTZA 3M5MA 1QL9A 2BY8X 1GBEA 3RU4T 3M5LA 1TMUH 5EODA 5EG4A 5EQSA 5C20A 3RXSA 1CO7E 1LVOA 2NU4E 1OWDA 1TQ0B 3SGQE 3URCA 5DP5A 4DY7B 1VITG 2P3UB 2HALA 2FPZA 4IC6A 4TPYA 3SNAA 1DXPA 4ZHMU 1PYTD 1L2EA 3GY3A 5G4BA 2ZDLA 1J17T 2GKVE 1HAXB 2A5KA 4KP0A 4DG4A 2ZGCA 2J34A 1XUHA 1CBWB 1AD8H 1YC0A 1C1SA 2VIVA 3SORA 4R0IA 5A0AE 2GTBA 1A0HB 1AWHB 2ODYB 5EOKA 1F0TA 3PMAB 2BTCE 1O3AA 4K1TA 1KXAA 3SUFA 5DP9A 3RXFA 2P95A 2WINI 2HGTH 3MWIU 3FAOA 1ESAA 3P6ZB 5FBEA 2BDBA 2BZAA 3ZZCA 2ZEBA 1BRBE 2RA0A 4NFFA 2F83A 1HXEH 4B2CA 4D76A 1BRAA 1HJ8A 2WPIS 3HKJB 4JK5A 3S7HB 3ITIA 2R9PA 4ASHA 2Y7XA 3RMNH 1SGQE 2OQUA 2BZ6H 1QBNA 4X6OA 1H9IE 1ETSH 4GHTA 1P01A 3H5CB 3RMLH 1H4WA 1TA2A 1XUFA 1K1JA 2GZ9A 5K7RA 1TPAE 1MAYA 2SGAA 5AF9H 4UFFH 1DPOA 1C1OA 4O3UA 1G2MA 2ILNA 1DLKB 1GGDC 1OYQA 1Z71A 4CH2B 1TRNA 5C2ZA 1ZSJA 5FHTA 1TNKA 4AB8A 1GJ6A 3TNSA 1ANDA 5A0CA 2HWLB 1SFIA 4O03A 1AN1E 3VGCB 3ZVFA 5ETXA 3BTDE 2B9LA 3ZVAA 1TNJA 2ZKSA 2ZC9H 1FY5A 2A32A 2BD2A 1Z1JA 3GCNA 3M36A 1SGTA 3I78A 3ZYDA 4UD9H 2SNWA 3AVZA 1GCTB 1B0FA 1MCTA 1W14U 5CHAB 1DVAH 2J9NA 1YGCH 3U98H 1DY9A 4NA7A 1EZXC 1HAZB 1L4ZA 3Q3KA 3STJA 2FO9A 4BTUB 2HLCA 2VH0A 1RXPA 2BDCA 3OYPA 2IJOB 1HJAC 1O2OA 3T27A 5EGMA 1EB2A 4LZ1H 1FJSA 3L3TA 1YPEH 4TYDA 2GZ8A 1JIMA 2BD8A 1JRTA 1ZTKA 3QK1A 2A4RA 4XOJA 1AI8H 3KCGH 3M3SA 2PGQB 2BM2A 1AY6H 3GISB 2J2UA 3Q76A 1EOJA 3SJ9A 3TLOA 3OTJE 5LPFA 3UQOA 2ZCKP 1C1MA 1KXBA 4SGBE 3ZVCA 5A8ZA 5AVDA 3PTNA 1ZSLA 4Q7ZA 4BAKB 4Y6DA 3T26A 2BD9A 3D49H 1XMNB 3A7TA 1NFWA 1MAXA 4ISLA 4BOHA 3ZV8A 1FXYA 2FWWA 4J2YB 5LGOA 1V2JT 4MLFB 1WYKA 1XX9A 1SLWB 4NIXA 1ETTH 2J38A 1QA0A 1QRZA 1ZR0A 3T28A 1A1RA 1F92A 1GMDF 3ZZ6A 1V2QT 4X1PU 5JB9S 1KLTA 1SLUB 1FNIA 1O3FA 4JZIA 4AGJA 1E36B 1GG6C 2ZDVH 3K9XB 1E38B 4NIWA 1SQAA 1AUTC 4KTSA 6LPRA 1ELAA 1NRPH 1ZMNA 3E91A 1BMMH 3PM3A 2CGAA 4FUIA 1DT2A 2C8XB 1YLCA 1TNIA 1FPHH 1ELFA 2PGBB 3MO6A 1Z8IB 4ABBA 1MKWH 4Y11E 4RKOB 5J4QA 3CS0A 3U9AH 1O31A 3QUMP 5HM9A 3UTUH 3BTWE 1DFPA 4I32A 1RD3B 3SGAE 2VWOA 5GCHF 2H5CA 1QB9A 3BTQE 3FANA 2BQ6B 2G4TA 1HAGE 3VB5A 2SGPE 1ZMJA 2Q1JA 1GVKB 1QHRB 1SL3A 2B0FA 3PLBA 3M35A 4GVUA 1KY9A 3S69A 3P8NA 4CRBA 2AIQA 3OU0A 4FUFA 1FY4A 1ZHRA 4K3JA 5HGGA 3RC4A 4Y10E 1A5GH 1AMHA 1BJVA 4D7GA 1AE8H 4YOGA 1LMWB 1CGJE 3RC6A 1VGCB 5HMAA 3C1KA 1QTFA 2ZU4A 1J8AA 2BB4A 2F9UA 4HTCH 1AFQC 1HAVB 1TABE 3NUMA 1OXGA 3T29A 3OX7U 3SU2A 1EUFA 1XUJA 2Z7FE 3HGPA 1DM4B 2J94A 3UR6A 4CRAA 3BN9A 3F9FA 3S9BA 1Y5AT 1SLXB 1LQEA 2V0BA 1TA6A 1GBIA 2BD3A 2Z9KA 4WY3A 1KTTB 1EAXA 1AVGH 1YF4A 2ZGBH 2Q6GA 3KNXA 1MZDA 1FAKH 4X8VH 1EQ9A 2GGVB 3BV9B 6CHAB 2QN5T 4OS7A 1WSSH 4MDSA 3LPRA 1K22H 3A82A 2GD4B 2C93B 4A1TA 3O8BA 2HVXA 4M7GA 4CRFA 2SGDE 1P9UA 1BTZA 1VCWA 3Q77A 1TOMH 4Y7AA 5GXPA 4FU8A 4OS4A 1DX5M 1FPCH 1TE0A 4SGAE 1NS3A 1MKXH 3MI4A 3DFLA 3A7VA 3H7OA 2GCHG 3EAJA 3M7TA 1IAUA 4ZHLU 3E1XB 1QIXB 1E35B 1C2DA 1WQVH 2G51A 3EYDA 2V3HH 2VGCB 3SN8A 1C9PA 1SB1H 2P8OC 1OOKB 2BLWA 2ZDAH 1P2OA 5F8ZA 2XC0A 1C2EA 4ABEA 1BTHH 2FYRA 3A81A 2FI5E 1UK2A 3M3VA 2JH6D 4ZMAH 3SI4H 1GVZA 2P16A 4TWYA 1DXWA 1MD8A 4K69A 4AFQA 1S85A 1O5EH 3F9HA 4QT8C 1HDTH 3TH2H 3RXUA 2Z9IA 1W12U 1HB0B 4UE7H 1MTSA 1C5NH 2UUYA 1BMAA 1CGIE 5FPTA 4TWWA 2PSYA 3P8GA 4O97A 2UUKB 3ESTA 4DW2U 2NU0E 2Q6FA 1WBGB 1XUIA 3SU4A 2VJ1A 2ZPSA 1VCQA 3SJ8A 1BTUA 2BY7X 3EA7A 4X0WU 2I6SA 1UVUH 4I8LA 2OC8A 2PHBA 2STAE 4LK4A 5DP7A 5F8TA 2AMDA 1K2I1 2OQ5A 1O2VA 1P2KA 2VNTA 2D1JA 4UDWH 1UK3A 3MH6A 1FONA 2XYAA 1SGRE 1PPFE 2AYWA 4CRCA 1QJ1B 2NU2E 2D2DA 1C5MD 2VVUA 1B7XB 3BEFB 4H6TA 3E16B 1ELBA 4K8BA 2XXLA 2OC7A 4DCDA 3QWCH 3P95A 1ZPBA 2BX4A 3RXCA 2ZO3H 2C8ZB 1O3EA 2XCFA 1C5QA 2GV6A 1BZXE 1GI3A 4AFUA 5SGAE 2GMTB 3QZRA 1Y5BT 2F9PA 2H5DA 4YTAA 5JDUB 5JPMH 1YPLH 4DT7B 3LH3A 1GMDG 5E0HA 3U1JB 1TX7A 2GT7A 3P8FA 4XFQA 1QJ6B 1RTLA 4A1VA 1MCVA 5K0HA 3A8BA 3JZ2B 1GHXH 1GJBB 3ZVEA 1A0JA 1GDNA 1ZJKA 1C1UH 1H9HE 2FESH 3SUDA 3F68H 3PMHB 4DVAU 4YESB 2BVSH 4FUDA 3RUOA 3LGVA 1GL1A 1H8IH 2F9OA 3M5OA 1V3XA 2J95A 2XC4A 3NWUA 1A46H 4B71A 5L6NH 4X8TH 1MTNC 1BB0B 1HUTH 3D23A 1XKBC 3HK3B 1P04A 1FUJA 4Q80A 4D8NA 5CE1A 1H1BA 3FZDA 3V12A 5GCHG 2A4QA 1D3PB 1WTHD 4CREA 1SGNE 3PLKA 3MH4A 4NIYA 4U30A 4XE4A 3UPEA 8GCHF 3A88A 5EQQA 1UCYK 1W7GH 3SQHE 1HYLA 3ATWA 1AB9B 1ZRKA 4B76A 1SGFA 4B75A 3A7YA 3MH7A 4UEHH 1P06A 1C5UA 2EI6A 3G01A 1CHGA 2JETB 1H8DH 2P94A 3E0NB 5L2YH 3HPTB 4JYTA
chains in the Genus database with same CATH superfamily
1OWHA 1C2FA 2TGPZ 4AC9A 1HJ9A 2WSSD 6GCHG 3MTYA 4CRGA 2G52A 1DY8A 4VGCC 4B6FA 3MU5A 4TY6A 4CRDA 5JYIA 1MTVA 3PO1B 4ASUD 2P3FH 1O3KA 2DE9A 1J15A 2A1DB 4X2WA 2ZFTA 3TJOA 1SG8B 1LHDH 2PR3A 3FP6E 2XNIA 3CENA 1SGPE 2WPHS 3SV8A 2GV7A 5IYTA 1Q3XA 3HKIB 1C2KA 1V2MT 4MNVA 4NCYA 5EW2H 4UONA 4NA9H 5KGOA 5C1YA 1Y3WA 5I46H 1OPHB 2A5AA 1PPZA 3TGJE 1LHFH 1YPHE 3RXIA 3PWCA 2A4GA 9ESTA 5C1UA 4MG3A 3I29A 5GDSH 1D3QB 2ZDMA 4XRNA 2V6NA 3PTBA 5AHGH 3DHKH 5LPEA 3SHCH 3URDA 1SR5C 1XXFA 5F53A 3R0FA 4DT4A 1S0QA 3IG6B 3KF2A 4H4FA 3PB1E 3ZVBA 1DOJA 3QLPH 3ZZ7A 4F48B 3A87A 1O2XA 2WUCA 3FFGA 3GCHC 2O8MA 5A8YA 4JZFH 1OWJA 2ZIQH 2FOAA 1A5HA 1ETRH 1V2UT 3WW7A 1AZ8A 1EAWA 1GJ4H 1P10A 2C8YB 3S9AA 4F4OC 1VITH 4K1SA 3E0PB 3O8RA 1RIWC 3RM2H 1GHAF 1SKYE 1OX1A 2QYIA 3TVJB 1F0SA 1Z8JB 5HIYA 2O8TA 3A80A 1GPZA 4OS2A 2ANYA 3LIWA 4I33A 2J98A 4FVDA 2FOBA 1KLJH 4Y76A 5T1VA 2W3KA 3UR9A 1C5ZB 1C5RA 2EI7A 5HKKD 1ZGVA 4INKA 4D9RA 3ATKA 1ELVA 1HV7A 3RXKA 5DN6D 4B2BA 2K1QA 1YCPK 1ZOMA 1YBWA 1C2MA 1W11U 2FI4E 3HK6B 3MO3A 3SV9A 2ZFSA 4AFZA 5JBTA 4Y71A 3D62A 4MNYA 2Y6TA 1S84A 2XBYA 1CHOF 2Y82A 4X6MA 3TNTA 1DE7H 1E0FD 1O2GH 1G36A 4RSPA 2AMQA 2R0LA 3VB3A 5C67A 2XW9A 2SGFE 3W95A 1ARCA 1RTKA 3SV7A 1K1PA 4R8TB 1SC8U 3QTOH 3TU7H 2R2WU 1T7CA 1OSSA 1H8ED 2KR7A 1S82A 3LH1A 1V6DA 5FCKA 1UVSH 1GMHF 1Y3UA 5FX5A 4D7FA 6ESTA 1Y3YA 4LZ4B 2WPLS 3TK5A 1K1IA 2BDAA 3GY2A 4ZKRU 2WYJA 4WMEA 4MNWA 4NIVA 1WXRA 2G81E 1THRH 1TPOA 3ZZ3A 4E05H 5FXLA 3VPKA 3O8DA 3VFEA 2NU3E 4BXWA 5GPIB 3LJJA 4ZKNU 2ODPA 1HBTH 2A2QH 1U6QA 2GP9B 2EC9H 5E2OA 3BG8A 4NWLA 2FS8A 2AGIX 5IK2D 1AKSA 2FLRH 2ZECA 1TNLA 2XNDD 2FZZA 1ZPCA 5PTPA 3EGKH 3TK9A 2GCHF 1F5RA 1KYNA 1HJAB 1NFXA 1AWFH 3GICB 2LPRA 2J5UA 5H4IB 1BBRK 2J4IA 5T6FA 4IN2A 1QR3E 4AX9H 2IPQX 1O2SA 4GLYA 2BX3A 4DIIH 1EATA 1C1RA 2QCYA 2GVFA 1C2IA 1PQ8A 2SFAA 1UK4A 1MU6B 8GCHG 1O5GH 1MBQA 2ANMH 4NSYA 4ZH8A 3BG4C 1CBWC 3A8DA 3VG8A 2ULLA 5EXLA 1S5SA 4K2YA 1SQOA 1T4UH 1A0LA 1EP5A 1S6HA 3BTME 4MPWA 3RXHA 5CMXH 2ZHWH 4OS6A 1LPKB 1O2YA 1FZZA 3B8JA 3NKKA 3OEHD 3GOVB 2AH4X 2RDEA 1VCPA 2H2ZA 3IWMA 5C5NA 3DT0H 3MU8A 4JYVH 1YCPH 5FCRA 3M61U 1J14A 4GCHF 3WY8A 3RP2A 1KXFA 3FP8E 2C4FH 1G3CA 3BTEE 1G32B 3RLWH 1QY6A 5EXNA 5DP6A 4ZXXH 1JXPA 1GG6B 5EPNA 1QB6A 1QB1A 3TGIE 3A83A 1CSOE 1QL7A 2A7HA 4GSOA 1FDPA 3RXRA 2Z3EA 3BTFE 2EEKA 1GDUA 1XKAC 3KQEA 4JCNA 2FOGA 2HOBA 5JBCS 1N8OC 3PRDA 4H42U 1BUIA 1TQ7B 1CT2E 4NG9H 1YKTA 2D8WA 2AERH 2ZU3A 1X7AC 2Y5GA 1SGIB 1Z6EA 1AFEH 1LPZB 1BMFD 1O2PA 1FAXA 1FI8A 4NFEA 1O3OA 1RRKA 3MNBA 2H9EH 4P00A 5GNDA 1K1OA 3MNXA 1Z6JH 1BTWA 2AIPA 4OS1A 3BTTE 1YP9A 3GCOA 1P03A 1NO9H 2UWOA 1FN8A 1OP0A 3UY9A 2Y81A 1GCTC 1VKYA 1YPHC 2O9QA 5CHAC 1GJAB 2CN0H 2ZZUH 1MQ5A 1JMOH 2XCNA 1AVWA 1NZQH 4XBDA 1P3CA 4MVNA 4A1XA 4JZDH 3EQ0H 1GHAG 4BAHB 2BXTH 1A7SA 4ZHAA 2HPPH 3SU3A 3ZV9A 1ZYOA 4Q2KA 2CV3A 4XBBA 2ZDKA 1DSTA 3SNCA 1UTKA 2CXVA 3L6PA 3SJIA 3GYMA 4E06H 3GDUA 1GI9B 1NTPA 1ELGA 3RMMH 5E0JA 1PPEE 2QXGA 2Z3CA 3KEEA 1D6WA 1C5YB 3NZIA 3ZZ9A 1O5FH 2FI3E 4I7YH 1QRXA 2PKAA 4TSFD 1TX8A 1PPGE 3V7TA 4CR9A 4XSKU 1CHOG 4X6PA 3TH4H 4Z6AH 2AHME 1GBDA 1O5BB 4B73A 1XVOA 3H09A 5EW1H 1BRCE 1W10U 1SGFG 3K6YA 1BHXB 1MMJN 1NRSH 4FOUC 2O8WA 3KIDU 1KXDA 1O3JA 6GCHF 5L2ZH 4Q7XA 3NK8A 5DJ7A 2PTNA 1OP2A 4YM9A 1UVPA 1V2RT 2FMJA 2ZHEH 1YPGH 1P57B 2YNAA 1GHWH 1GMHG 1A4WH 1QURH 2BVXH 1LVYA 1GI1A 5DK1A 1GI0A 1YPMH 3RXTA 3SW2B 2FYQA 2R3UA 1ZLRA 4BXSA 1ESBA 2P8OB 3RXPA 2QC2A 1WDIA 1GMCF 4ZCNA 3M37A 2BHGA 2V35A 2QF0A 2V7QD 4ZAEA 5ABWA 3U8OH 2FS9A 2WV4A 1EJAA 4NSVA 1LQDB 5C3NA 1BTYA 2J98B 3S7KB 4ABHA 3VEQB 1LKAA 1GJ9B 1EAIA 1QJ7B 5TJXA 1W13U 4BAQB 5A8XA 2CHAB 1ZSKA 4KGAA 1MQ6A 3ELAH 1E34B 2VWNA 2HNTF 3SGBE 3ZIAD 2ZHDA 2NU1E 3M5NA 4Q7YA 1P0SH 4CBOA 1TBZH 1O2HA 7KMEH 1W0YH 1HNEE 1NN6A 4ABDA 3U69H 3SZEA 1XUKA 1GL0E 1O2ZA 1GJDB 1G3BA 3RXBA 4AG1A 3A86A 2FX4A 2A0QB 2VIWA 5DPAA 3FVFB 2M2AA 2QXIA 2FOCA 2ZA5A 3UFAA 1L1GA 2OLGA 1E79D 1VGCC 1GI6A 1IQIA 2FDAA 1G37A 4WVPE 1TNHA 1ACBE 2XBXA 1WQSA 2L6OA 1DWEH 1CA0B 1OWKA 2WUBA 4YLQH 1D3TB 1EZUC 3BTHE 4WWYA 4X2VA 2BD4A 3SJOA 1O2TA 2ZF0H 3ODFA 2CMYA 3QZQA 1LTOA 1O2LA 3P8OA 2KAIA 2XOKD 2QV1A 2P93A 2ZP0H 3AAUA 1P9SA 1G30B 3TPIZ 1LCYA 3NXPA 4F55A 3KN2A 3U8RH 1IQNA 2ANKH 1YPKH 4GCHG 2F9NA 4KKDA 1SHYA 4I8HA 3LGYA 2G5VA 5FPYA 1IQMA 2CJIA 1AKSB 4CHAC 1OWEA 2NWNA 3M7QA 2PUQH 5F6MA 2F9VA 3SZNA 7GCHF 1F5KU 1KXEA 4X8SH 1PQAA 3LGIA 4P02A 1KXCA 3QTVH 4MPVA 4ZUHA 5TCCA 1COWD 4B74A 1W3CA 1O3CA 1KIGH 2Y7ZA 2ZTXA 2VGCC 1MTNB 2I6QA 1ZPZA 1CT0E 1ARBA 2ZI2H 2BY5X 1O3DA 1TX6A 4OM9A 4UFEH 1UCYE 2GCTB 1TPSA 2BLVA 2OC0A 2ZFFH 2OP9A 4INHA 1VJAU 1NROH 2FOFA 4FUHA 1EPTC 3KL6A 4Y8ZA 2XBWA 3FKSD 3SV6A 1O35A 1QBVH 2VIPA 2P3TB 3Q3XA 1P05A 5C1XA 1O3MA 3QGNB 2QE7D 3EA9A 4DOQA 2Q6DA 1ELEE 2FTMA 2Z9LA 5GIBA 2Z6BD 3BIUH 3RU4E 4CBNA 2CF8H 1ZGIA 2A31A 2O8LA 1EOLA 2DE8A 3ATIA 3CP7A 1GI8B 2TPIZ 1P2JA 4AYYB 1ABJH 2A5IA 4HZHA 3LGTA 1ZTLA 4GPGA 1QL8A 2DUCA 3EE0B 3OTPA 4DGJA 3SHAH 2FLBH 1MZAA 4NA8A 3MHWU 2H9HA 1CE5A 4A92A 1HIAA 3SNDA 4WH8A 1BJUA 1O2KA 2WPMS 3MH5A 1UJ1A 2VU8E 2F9BH 3BTGE 4JYUH 1GHYH 2YOLA 2KCYA 5I25A 1LVMA 2W7UA 1UTJA 2BMGB 1K21H 1GI5A 1THSH 1DICA 3T25A 3UWIA 3EA8A 2VIOA 4WXVA 4ABAA 3P70B 4K60A 3HGNA 4A6LA 2OK5A 1O37A 5A0BA 1GBHA 2G00A 1V2PT 1GI2A 1YPJH 3LJOA 4ACAA 1WV7H 2BD7A 3GDSA 3MU4A 1T31A 1BMLA 1UTLM 3LONA 4GHQA 1E1QD 5HXFA 2W26A 1KDQA 1XUGA 3M7UA 4IC5A 3A8CA 5L30H 2Y5FA 2XWAA 4O9VA 5GWZA 1GBAA 2SGEE 2EY4C 2R0KA 4Z1MD 4IS5A 1DSUA 1FIZA 4E7RG 2ALVA 4MNXA 3B9FH 2H9TH 1O3LA 2WV5A 3LU9B 3ATMA 5FPSA 1GMCG 1ELTA 1LHEH 1BMNH 3O8CA 2G4UA 5J4SA 2FXRA 1TRYA 1FY3A 3PWBA 3E3TA 1GJCB 1Y59T 3UNSA 2OCVB 1C5VA 1LHGH 8LPRA 5HM2A 4I8KA 1K1NA 2OBQA 2H1UA 4B2AA 1TGSZ 1L4DA 1DWBH 5BRRE 3LT3A 4Z0KA 3N7DA 2PTCE 1QBOA 3IITA 2FM2A 3RXAA 2FOMB 1FIWA 1HCGA 2PKAB 1G2LA 4CH8B 3RLYH 4TPIZ 4AN7A 2A7JA 1F5LA 2BOHB 4JZEH 1TNGA 3F3BA 1Z1IA 1GDQA 3VXEH 3SU1A 2KCAA 2PKSC 4RT1A 2EI8A 4X2YA 4O3TA 1UO6A 3RXJA 1O38A 1O3GA 2FODA 1DWCH 5T3HA 2BOKA 1QFKH 1MH0A 3OEED 4ESTE 1VJ9U 1JIRA 2SNVA 4WMFA 2JDID 3ZZBA 4Y8YA 3OFND 2W6JD 1O5DH 1GCDA 2VVVA 3T2NA 3OY6U 2BVRH 3PO1C 2FTLE 1YYY1 3F9EA 2IPHA 5T6DA 2LNCA 4ZXYH 3GY5A 1EP6A 1Q31A 3K6ZA 1ESTA 4FUBA 3U1IB 1Z8GA 1SLVB 1GBTA 1GHVH 1AQ7A 1BIOA 1GBCA 3SUGA 1EJNA 3MU0A 3A7ZA 3BEUA 2C3SA 1BCUH 3SV2H 2BQ7B 7LPRA 2G55A 2QGRA 3B23B 1TRMA 1TFXA 1T8NA 1AGJA 1K1LA 1QQUA 1ABIH 1SQTA 1UCYH 2TGAA 4AGKA 2W3IA 4X8UH 4ZROA 4Y0ZE 2BLQA 1C5OH 4U2WA 4X1RU 1IHTH 2ZQ1A 1BTPA 1LDTT 7GCHG 1C4U2 2AMPA 4Y8XA 1BBRE 3SOSA 1ZZZA 3V3MA 1AO5A 1F2SE 3SJKA 3SNEA 2ZTYA 2PWXA 1NPMA 2OD3B 1SSXA 2O8UA 2QAAA 4PROA 3GYLB 4ISOA 2WV9A 4U01A 3UREA 3RDZA 3HATH 3A7XA 5A2MH 4TT3D 2F91A 1BITA 1GGDB 3Q00A 1SOZA 2GJGA 2GT8A 1V2NT 2ZNKH 4AG2A 1AZZA 1Y8TA 1P8VC 4FUGA 2ZU1A 1JOUB 1EPTA 1NESE 4F49A 1IOEA 2UWLA 4JMYA 4JZ1A 3NCLA 1GHBF 3AAVA 1EAUA 2OC1A 2Z9JA 1P2IA 3TK6A 4AORA 2XTTB 1C5LH 1UHBA 3BG4B 2BY6X 1BDAA 1O2MA 3QDZB 3FZZA 1NBME 1TONA 2C90B 1G3DA 2KAIB 1GVLA 2D26C 2GZ7A 1EZQA 1MUEB 1UTQA 3STIA 4YOIA 1GI7B 1W7XH 1AUJA 2OXSA 4DJZB 3UB0A 1HAYB 1BOQA 1WUNH 2ZFRH 3E90B 1BHXF 3V0XA 3F1SB 3LGUA 1O33A 2ZDNA 3W94A 3N99A 4X6NA 4RI0A 4MPUA 2BDYA 2ZG0H 1S0RA 1ZRBA 1SGEE 1D3DB 1L1NA 2ZPQA 4ABJA 1TOCB 2A45B 3SUEA 4ISHH 2STBE 1DUEA 3MYWA 4WMDA 4E7NA 2QY0B 2THFB 5KECA 1W0ZU 3MU1A 1N6XA 3P92A 1N8OB 1MU8B 1MKWK 1SGCA 4ISNA 4IN1A 4AB9A 4WXIA 5C5OA 3PYHA 4K8YA 3S0NA 1O2JA 1V2WT 3A8AA 1ANEA 2VIQA 8ESTE 4A7IB 2FOEA 3GY8A 4OGXA 2FIRH 1ANCA 1LKBA 4UFDH 3NPSA 3GS9A 3TJNA 1TALA 5FX6A 1GHZA 3PV4A 3TJUA 2AFQB 5A09A 2ZWLH 5EXMA 1C2LA 1Y3VA 4ABFA 1L1JA 2PFEA 2M5TA 2VIDA 4XBCA 1GJ5H 4FUEA 3AW0A 1GI4A 1HFDA 1BA8B 2ZHQH 4FU9A 2FP7B 1SBWA 2ZHFH 1O30A 3TJVA 3SU0A 1P2NA 1GBLA 1SI5H 4HI3A 4K5ZA 2PUXB 1MD7A 5DKMA 1SGDE 2VBCA 5DP8A 1PPCE 2TRMA 1C1TA 1FY1A 1C2JA 3ZZDA 1IQLA 1HIAB 2OINA 1W8BH 2QF4A 3K65B 1D4PB 1NU7B 3RMOH 2VINA 3KQCA 2K0QA 2WHXA 1RFNA 1SOTA 1C2HA 1EASA 2F3CE 3LOXA 2HRVA 1TBRH 3BSQA 1DANH 4ISIH 1C1WH 1GBJA 3VGCC 1ID5H 1IQFA 1S6FA 1O34A 3A7WA 1P11E 4XD7D 7ESTE 1GBKA 2VH6A 3DUXH 1EZSC 1MTWA 1T8OA 1Y3XA 4YT7H 1TWXB 1UTNA 2FEQH 3RXQA 2AGGX 2KM0A 4UFGH 1ELCA 1PJPA 1MKXK 1TGTA 1TB6H 1C4Y2 3GCTF 1V2TT 2ESTE 1YWUA 3BEIB 1O2WA 3P17H 3RXOA 2UUJB 3SU6A 3ATLA 1FQ3A 1ZMLA 1KDQB 2TGDA 5FBIA 3FO8D 1UMAH 1NFUA 1OP8A 1AFQB 1FN6A 3UQVA 4IGDA 2JH5D 2ZFQH 3GY6A 3ZVDA 2Z94A 1GJ8B 4U32A 4YXWD 2Z3DA 3OAAD 3LC3A 5EU8A 1BBRH 4AZ2B 4ZKSU 2JJ2D 3QO6A 1JRSA 4NGAH 1PYTC 4MQAA 1AU8A 3TIUA 1K9OE 4OS5A 2QA9E 2R2MB 3VB7A 1THPB 2XWBI 1UVOA 1D6RA 2Y5HA 1CQQA 1IQKA 1DS2E 3TGKE 1C5SA 1ANBA 4NWKA 5ESBA 3MNCA 1IQGA 2SGQE 3E8LA 2V3OH 3QX5H 3ZYEA 2BYAX 3PMJA 2RDLA 2BDIA 1IQHA 5EQRA 3GY4A 1C1VH 5JB8S 2BXUH 1YLNA 1LPGB 2BLOA 2P59A 2YMSC 3UUZA 4NZQA 1UTPA 2W7SA 3MMGA 4YO9A 2VWLA 4YOJA 2G8TA 3MFJA 2JH0D 2EA3A 3H7TA 1OS8A 1EKBB 3ZZ4A 1T32A 4WF8A 4B1TA 3ZZAA 1E1RD 5AFYH 1OKXA 1AE5A 1HGTH 1O2IA 1KTSB 2XC5A 1B0EA 2BDGA 1N6YA 2TIOA 2AGEX 1J9CH 1GHBG 1P09A 3K2UA 2HNTE 3ZZ8A 1YM0A 2ZGHA 4JK6A 1CGHA 1H8HD 3EDXB 1HAOH 2QXHA 1AIXH 1IHSH 3BTKE 1A61H 1UW7A 1RTFB 1CVWH 2FX6A 4YLUA 5ESTE 5B6LA 3D65E 3RXGA 3BF6H 4KTCA 2ZQ2A 1TAWA 1Y5UT 2L74A 2EQNA 3FP7E 3ZZ5A 3MNSA 3QGJA 2GX4A 4AOQA 1C1QA 3U28C 1SMFE 1AHTH 1V2LT 4CHAB 3QN7A 3S9CA 4TY7A 1O0DH 3LGWA 1O3BA 1QQ4A 1C9TA 3U8TH 2BDHA 2AS9A 1HPGA 1ZTJA 1TPPA 1P2MA 4FVBA 2F43B 4LXBH 4WJG2 2HPQH 1NT1A 5EJZA 3ZVGA 1DDJA 2BD5A 1TIOA 2ZGJA 5B6OA 2PLXA 1XXDA 4DURA 4IMQA 1F7ZA 1HXFH 5TCAA 3Q3YA 1Q2WA 1NRNH 3A85A 1O3PB 1J16A 2PW8H 2XBVA 1WAYB 1ZHPA 1A5IA 1C2GA 3PMBB 3AW1A 1TGBA 2W6ID 1EPTB 1QNJA 2WPJS 1WOFA 3R3GB 5JBAS 3DSGA 1LO6A 5DSFA 1FLEE 5CDFE 6CHAC 1GJ7B 1UHBB 3SBKA 3SI3H 3UOUA 3RM0H 5E2PA 4BNRA 2B5TB 3A84A 4B6EA 4K1EA 1TMTH 3E6PH 1P12E 4RN6A 5GJ4B 3DD2H 1F0UA 1M9UA 2CHAC 2OBOA 1C5WB 3F0OA 1GBFA 3KYGA 2CF9H 3AK5A 2ZCLP 4FUCA 1VZQH 1C1PA 2YNBA 3F9GA 5JBBS 3DFJA 3C27B 1DWDH 1ORFA 4X2XA 1PQ5A 3OSYA 3SU5A 2UUFB 1V2ST 4BAMB 1DUAA 2LELA 2IN2A 1O3IA 1TYNA 1P3EA 4I8GA 1YY3A 1O32A 1ZHMA 2VB0A 1DITH 3I77A 1BRUP 1S81A 1FV9A 1RJXB 1VITF 2KCOA 1SGYE 1WCZA 1UTOA 1O5CB 3MO9A 5FL7D 1LVBA 3ENSB 1QCPA 1QGFA 4BTTB 4YT6H 1QA7A 1CA0C 4CR5A 1EX3A 3RC5A 1UTMA 5DP4A 2QIQA 1A2CH 4INLA 2WYGA 3JZ1B 1BTXA 2ZU2A 3VB6A 4AFSA 4THNH 2RFKC 2TBSA 4YZUA 4BTIB 1C5TA 1XVMA 4Q4LA 2V3MA 3TH3H 2IJD1 3A89A 1TLDA 2A4OA 4X1NU 5DGJA 2ZU5A 1G3EA 3GCTG 5BPEA 1OWIA 1VR1H 1JWTA 1ZJDA 1C1NA 1NRRH 5IDKA 2ODQA 2ASUB 3LDXH 4HGCA 3SNBA 3M3TA 4VGCB 1A3EH 1O2RA 4ZKOU 1KSNA 1O2NA 1O2QA 1P02A 1RGQA 3KQDA 1C5XB 1TBQH 4Y79A 1SVPA 1UVTH 1CU1A 1K28D 1HAPH 3GY7A 2KCPA 2Y80A 3KQBA 1PPHE 4GAWA 4ABIA 1KLIH 2GDDA 2WPKS 2QXJA 3UNQA 4AYVB 2WZQA 4D9QA 1P2QA 1N1LA 1FMGA 1B5GH 2ZCHP 2RCEA 2GCTC 1EXFA 4H6SB 3PROA 1C4V2 3OY5U 1HRTH 1NY22 3LC5A 3UOPA 2UWPA 4LOYH 2GMTC 1Z7KA 4J1YA 2BY9X 1EJMA 2VVCA 1WTGH 2PP6A 4BAOB 2J92A 4OGYA 5T6GA 4IW4E 4ABGA 2AEIH 2ZFPH 3GCHB 1GWAA 2RA3A 4KTUA 3DA9B 2PKSB 1WU1A 1Z8RA 1T8MA 2QF3A 5DO4H 2PSXA 2IOTA 1O3NA 5C17A 2RG3A 1RIWB 4GUXA 1CT4E 1K1MA 1TGNA 3SQEE 1YLDA 3PRBA 1SHHB 4I31A 5E0GA 3RU4D 3T5FH 4RKJB 2GDEH 5LPRA 5EPYA 1E37B 1V2KT 4FXGH 1S83A 1F0RA 1XM1A 3WWFA 2R3YA 1NRQH 1OYTH 5HYOA 1JBUH 1G9IE 2W5EA 1O2UA 1D9IA 5DP3A 1PFXC 4IMZA 1BQYA 3RXMA 1INCA 2B8OH 1AVXA 1O3HA 4IBLH 3T62A 4XDEA 3F2GA 2BQWB 1A3BH 1L0ZA 3KHVA 2H6MA 4NZLA 1CA8B 4HFPB 5E8EH 4KELA 3UWJH 1SPJA 5AFZH 3RXEA 1AB9C 4X1QU 1TGCA 5FAHA 3F6UH 5F03A 1NC6A 1O5AB 2A7CA 2FOHA 2HNTC 2ALPA 3L33A 4DIHH 1ELDE 4Q63A 1O36A 2JETC 4FUJA 2G5NA 1GBBA 4WH6A 1BT7A 4BANB 3AASA 3PLPA 1HAIH 2TGTA 2OUAA 1RS0A 1HLTH 1T8LA 2PV9B 1QRWA 3GDVA 4MPXA 1HAVA 2B7DH 1NFYA 2OTVA 2HVYB 3CS7A 1O39A 4Y0YE 1T4VH 1YCPM 1MTUA 1V2VT 3TITA 3FOAA 3UNRA 3BIVH 1C5PA 1HAHH 1NM6A 2A2XH 2ZPRA 1PQ7A 3SO3A 1H9LB 4MTBA 3ODDA 2ANWA 1TMBH 1LHCH 1V2OT 3KYFA 3LKWA 1FY8E 1SFQB 3VB4A 3RXLA 1NU9A 2ZGXH 1PPBH 1GBMA 3MOCA 4I8JA 3KGPA 3RXVA 5EJ1A 3VXFH 5F8XA 4FU7A 1EB1H 1W2KH 2JKHA 1DLEA 4X1SU 2XRCA 2Z9GA 3UIRA 1MBMA 3DCLA 1IQEA 5LH8A 1OHHD 9LPRA 3RXDA 2C8WB 2VWMA 3V13A 8KME2 4A5TS 5C0UA 5DG6A 4Y7BA 3N7OA 1IQJA 2ZTZA 3M5MA 1QL9A 2BY8X 1GBEA 3RU4T 3M5LA 1TMUH 5EODA 5EG4A 5EQSA 5C20A 3RXSA 1CO7E 1LVOA 2NU4E 1OWDA 1TQ0B 3SGQE 5C0TA 3URCA 5DP5A 4DY7B 1VITG 2P3UB 2HALA 2FPZA 4IC6A 4TPYA 3SNAA 1DXPA 4ZHMU 1PYTD 4FETA 1L2EA 3GY3A 5G4BA 2ZDLA 1J17T 2GKVE 1HAXB 2A5KA 4KP0A 4DG4A 2ZGCA 3OE7D 3KQ5A 2J34A 1XUHA 1CBWB 1AD8H 1YC0A 1C1SA 2VIVA 3SORA 4R0IA 5A0AE 2GTBA 1A0HB 1AWHB 5HIZA 2ODYB 5EOKA 1F0TA 4ACBA 3PMAB 2BTCE 1O3AA 4K1TA 1KXAA 3SUFA 5DP9A 3RXFA 2P95A 2WINI 2HGTH 3MWIU 3FAOA 1ESAA 3P6ZB 5FBEA 2BDBA 4I86A 2BZAA 3ZZCA 2ZEBA 1BRBE 2RA0A 4RT0A 4NFFA 2F83A 1HXEH 2YMSD 4B2CA 2HLDD 4D76A 1BRAA 1HJ8A 2WPIS 3HKJB 4JK5A 3S7HB 3ITIA 2R9PA 4ASHA 2Y7XA 3RMNH 1SGQE 2OQUA 2BZ6H 1QBNA 4X6OA 1H9IE 1ETSH 4GHTA 1P01A 3H5CB 3RMLH 1H4WA 1TA2A 1XUFA 1K1JA 2GZ9A 5K7RA 1TPAE 1MAYA 2SGAA 5AF9H 2JJ1D 4UFFH 1DPOA 1C1OA 4O3UA 1G2MA 2ILNA 1DLKB 1GGDC 1OYQA 1Z71A 4CH2B 1TRNA 5C2ZA 1ZSJA 5FHTA 1TNKA 4AB8A 1GJ6A 3TNSA 1ANDA 5A0CA 2HWLB 5KEDA 1SFIA 4O03A 1AN1E 3VGCB 3ZVFA 5ETXA 3BTDE 2B9LA 3ZVAA 1TNJA 2ZKSA 2ZC9H 1FY5A 2A32A 2BD2A 1Z1JA 3GCNA 3M36A 1SGTA 3I78A 3ZYDA 4UD9H 2SNWA 3AVZA 1GCTB 1B0FA 1MCTA 1W14U 5CHAB 1DVAH 2J9NA 1YGCH 3U98H 1NBMD 1DY9A 4NA7A 3N7EA 1EZXC 1HAZB 1L4ZA 3Q3KA 3STJA 2FO9A 4BTUB 2HLCA 2VH0A 1RXPA 2BDCA 2KFWA 3OYPA 2IJOB 1HJAC 1O2OA 3T27A 5EGMA 1EB2A 4LZ1H 1FJSA 3L3TA 3F2FA 1YPEH 4TYDA 2GZ8A 1JIMA 2BD8A 1JRTA 1ZTKA 3QK1A 2A4RA 5C94A 4XOJA 1AI8H 3KCGH 3M3SA 2PGQB 2J97A 2BM2A 3FN8A 1AY6H 3GISB 2J2UA 3Q76A 1EOJA 3SJ9A 3TLOA 3OTJE 5LPFA 3UQOA 2ZCKP 1C1MA 1KXBA 4SGBE 3ZVCA 5A8ZA 5AVDA 3F2HA 3PTNA 1ZSLA 4Q7ZA 4BAKB 4Y6DA 3T26A 2BD9A 3D49H 1XMNB 2KZ4A 3A7TA 1NFWA 1MAXA 4ISLA 4BOHA 3ZV8A 1FXYA 2FWWA 4J2YB 5LGOA 1V2JT 1MABB 4MLFB 1WYKA 1XX9A 2WPDD 1W0KD 1SLWB 4NIXA 2YMSB 1ETTH 2J38A 1QA0A 1QRZA 1ZR0A 3T28A 1A1RA 1F92A 1GMDF 3ZZ6A 1V2QT 4X1PU 5JB9S 3DSPA 4HG6A 1KLTA 1SLUB 3DSOA 1FNIA 1O3FA 4JZIA 4AGJA 1E36B 1GG6C 2ZDVH 1SQRA 3K9XB 1E38B 4NIWA 1SQAA 1AUTC 4KTSA 6LPRA 1ELAA 1NRPH 1ZMNA 3E91A 1BMMH 3PM3A 2CGAA 4FUIA 1DT2A 2C8XB 5CHBA 1YLCA 1TNIA 1FPHH 1ELFA 2PGBB 3MO6A 1Z8IB 4ABBA 1MKWH 4Y11E 4RKOB 5J4QA 3CS0A 3U9AH 1O31A 3QUMP 5HM9A 3UTUH 3BTWE 1DFPA 4I32A 1RD3B 3SGAE 2VWOA 5GCHF 2H5CA 1QB9A 3BTQE 3FANA 2BQ6B 2G4TA 1HAGE 3VB5A 2SGPE 1ZMJA 2Q1JA 1GVKB 1QHRB 1SL3A 2B0FA 3PLBA 3M35A 4GVUA 1KY9A 3S69A 3P8NA 4CRBA 2AIQA 3OU0A 3SYJA 4FUFA 1FY4A 1ZHRA 4K3JA 5HGGA 3RC4A 4Y10E 1A5GH 1AMHA 1S6LA 1BJVA 4D7GA 1AE8H 4YOGA 1LMWB 1CGJE 3RC6A 1VGCB 5HMAA 3C1KA 1QTFA 2ZU4A 1J8AA 2BB4A 2F9UA 4HTCH 1AFQC 1HAVB 1TABE 3NUMA 1OXGA 3T29A 3OX7U 3SU2A 1EUFA 1XUJA 2Z7FE 3HGPA 1DM4B 2KX4A 2J94A 3UR6A 4CRAA 3BN9A 3F9FA 3S9BA 1QZ8A 1Y5AT 1SLXB 1LQEA 2V0BA 1TA6A 1GBIA 2BD3A 2Z9KA 4WY3A 1KTTB 1EAXA 1AVGH 1YF4A 2ZGBH 2Q6GA 3KNXA 1MZDA 1FAKH 4X8VH 2K8IA 1EQ9A 2GGVB 3BV9B 6CHAB 2QN5T 4OS7A 5EJLA 2LP6A 1WSSH 4MDSA 3LPRA 1K22H 3A82A 2GD4B 2C93B 4A1TA 3O8BA 2HVXA 4M7GA 2CK3D 4CRFA 2SGDE 1P9UA 1BTZA 1VCWA 1W0JD 3Q77A 1TOMH 4Y7AA 5GXPA 4FU8A 4OS4A 1DX5M 1FPCH 1TE0A 4SGAE 1NS3A 1MKXH 3MI4A 3DFLA 3A7VA 3H7OA 2GCHG 3EAJA 3M7TA 1IAUA 4ZHLU 3E1XB 1QIXB 1E35B 1C2DA 1WQVH 4M9FA 2G51A 3EYDA 2V3HH 2VGCB 3SN8A 1C9PA 1SB1H 2P8OC 1OOKB 2BLWA 2ZDAH 1P2OA 5F8ZA 2F4LA 2XC0A 1C2EA 3PV2A 4ABEA 1BTHH 2FYRA 3A81A 2FI5E 1EFRD 3PV5A 1UK2A 3M3VA 2JH6D 4ZMAH 3SI4H 1FX0B 1GVZA 2P16A 4TWYA 1DXWA 1MD8A 4K69A 4AFQA 1S85A 1O5EH 3F9HA 4QT8C 1HDTH 3TH2H 3RXUA 2Z9IA 1W12U 1HB0B 4UE7H 1MTSA 1C5NH 3W1EA 2UUYA 3EE7A 1BMAA 1CGIE 5FPTA 4TWWA 2PSYA 3P8GA 4O97A 2UUKB 3ESTA 4DW2U 2NU0E 2Q6FA 1WBGB 1XUIA 3SU4A 2VJ1A 2ZPSA 1VCQA 3WWBA 2QF5A 3SJ8A 1BTUA 2BY7X 3EA7A 4X0WU 2I6SA 5EIYA 1UVUH 4I8LA 2OC8A 2PHBA 2STAE 4LK4A 5DP7A 5F8TA 2AMDA 1K2I1 2OQ5A 1O2VA 1P2KA 2VNTA 2D1JA 4UDWH 3UAIC 1UK3A 3MH6A 1FONA 3MQKC 2XYAA 1SGRE 1PPFE 2AYWA 1KMHB 4CRCA 1QJ1B 2NU2E 2D2DA 1C5MD 2VVUA 1B7XB 3BEFB 4H6TA 3E16B 1ELBA 4K8BA 2XXLA 2OC7A 4DCDA 1K0HA 3QWCH 3P95A 1ZPBA 2BX4A 3RXCA 2ZO3H 2C8ZB 1O3EA 2XCFA 1C5QA 2GV6A 1BZXE 1GI3A 4AFUA 5SGAE 2GMTB 3QZRA 1Y5BT 2F9PA 2H5DA 4YTAA 5JDUB 5JPMH 1YPLH 3NRLA 4DT7B 3LH3A 1GMDG 5E0HA 3U1JB 1TX7A 2GT7A 3P8FA 4XFQA 1QJ6B 1RTLA 4A1VA 1MCVA 5K0HA 3A8BA 3JZ2B 3CNRA 1GHXH 1GJBB 3ZVEA 1A0JA 1GDNA 1ZJKA 1C1UH 1H9HE 2FESH 3SUDA 3F0PA 3F68H 3PMHB 4DVAU 4YESB 2BVSH 4FUDA 3RUOA 3LGVA 1GL1A 1H8IH 2F9OA 3M5OA 1V3XA 2JIZD 2J95A 2XC4A 3NWUA 1A46H 4B71A 5L6NH 4X8TH 1MTNC 1BB0B 1HUTH 3D23A 1XKBC 3HK3B 1P04A 1FUJA 4Q80A 4D8NA 5CE1A 1H1BA 3FZDA 3V12A 5GCHG 2A4QA 1D3PB 1WTHD 4CREA 1SGNE 3PLKA 3MH4A 4NIYA 4U30A 4XE4A 3UPEA 8GCHF 3A88A 5EQQA 1UCYK 1W7GH 3SQHE 1HYLA 3ATWA 1AB9B 1ZRKA 4B76A 1SGFA 4B75A 3A7YA 3MH7A 4UEHH 1P06A 1C5UA 2EI6A 3G01A 1CHGA 2JETB 1H8DH 2P94A 3E0NB 5L2YH 3HPTB 4JYTA
chains in the Genus database with same CATH topology
1OWHA 1C2FA 2TGPZ 1HJ9A 6GCHG 3MTYA 4CRGA 2G52A 1DY8A 4VGCC 3MU5A 4TY6A 4CRDA 5JYIA 1MTVA 3PO1B 2P3FH 1O3KA 2DE9A 1J15A 2A1DB 4X2WA 2ZFTA 3TJOA 1SG8B 1LHDH 2PR3A 3FP6E 2XNIA 3CENA 1SGPE 2WPHS 3SV8A 2GV7A 5IYTA 1Q3XA 3HKIB 1C2KA 1V2MT 4MNVA 4NCYA 5EW2H 4UONA 4NA9H 5C1YA 1Y3WA 5I46H 1OPHB 2A5AA 1PPZA 3TGJE 1LHFH 1YPHE 3RXIA 3PWCA 2A4GA 9ESTA 5C1UA 4MG3A 3I29A 5GDSH 1D3QB 2ZDMA 2V6NA 3PTBA 5AHGH 3DHKH 5LPEA 3SHCH 3URDA 1SR5C 1XXFA 3R0FA 1S0QA 3IG6B 3KF2A 4H4FA 3PB1E 3ZVBA 1DOJA 3QLPH 3ZZ7A 3A87A 1O2XA 2WUCA 3FFGA 3GCHC 2O8MA 5A8YA 4JZFH 1OWJA 2ZIQH 2FOAA 1A5HA 1ETRH 1V2UT 1AZ8A 1EAWA 1GJ4H 1P10A 2C8YB 3S9AA 4F4OC 1VITH 4K1SA 3E0PB 3O8RA 1RIWC 3RM2H 1GHAF 1OX1A 2QYIA 3TVJB 1F0SA 1Z8JB 2O8TA 3A80A 1GPZA 4OS2A 2ANYA 3LIWA 4I33A 4FVDA 2FOBA 1KLJH 4Y76A 2W3KA 3UR9A 1C5ZB 1C5RA 2EI7A 1ZGVA 4INKA 4D9RA 3ATKA 1ELVA 1HV7A 3RXKA 4B2BA 2K1QA 1YCPK 1ZOMA 1YBWA 1C2MA 1W11U 2FI4E 3HK6B 3MO3A 3SV9A 2ZFSA 4AFZA 5JBTA 4Y71A 3D62A 4MNYA 2Y6TA 1S84A 2XBYA 1CHOF 2Y82A 4X6MA 3TNTA 1DE7H 1E0FD 1O2GH 1G36A 4RSPA 2AMQA 2R0LA 3VB3A 5C67A 2XW9A 2SGFE 3W95A 1ARCA 1RTKA 3SV7A 1K1PA 4R8TB 1SC8U 3QTOH 3TU7H 2R2WU 1T7CA 1OSSA 1S82A 3LH1A 1V6DA 5FCKA 1UVSH 1GMHF 1Y3UA 5FX5A 4D7FA 6ESTA 1Y3YA 4LZ4B 2WPLS 3TK5A 1K1IA 2BDAA 3GY2A 4ZKRU 2WYJA 4WMEA 4MNWA 4NIVA 2G81E 1THRH 1TPOA 3ZZ3A 4E05H 5FXLA 3VPKA 3O8DA 3VFEA 2NU3E 4BXWA 5GPIB 3LJJA 4ZKNU 2ODPA 1HBTH 2A2QH 1U6QA 2GP9B 2EC9H 5E2OA 3BG8A 4NWLA 2FS8A 2AGIX 1AKSA 2FLRH 2ZECA 1TNLA 2FZZA 1ZPCA 5PTPA 3EGKH 3TK9A 2GCHF 1F5RA 1KYNA 1HJAB 1NFXA 1AWFH 3GICB 2LPRA 5H4IB 1BBRK 2J4IA 5T6FA 4IN2A 1QR3E 4AX9H 1O2SA 4GLYA 2BX3A 4DIIH 1EATA 1C1RA 2QCYA 2GVFA 1C2IA 1PQ8A 2SFAA 1UK4A 1MU6B 8GCHG 1O5GH 1MBQA 2ANMH 4NSYA 4ZH8A 3BG4C 1CBWC 3A8DA 2ULLA 5EXLA 1S5SA 4K2YA 1SQOA 1T4UH 1A0LA 1EP5A 1S6HA 3BTME 4MPWA 3RXHA 5CMXH 2ZHWH 4OS6A 1LPKB 1O2YA 1FZZA 3B8JA 3NKKA 3GOVB 2AH4X 1VCPA 2H2ZA 3IWMA 5C5NA 3DT0H 3MU8A 4JYVH 1YCPH 5FCRA 3M61U 1J14A 4GCHF 3WY8A 3RP2A 1KXFA 3FP8E 2C4FH 1G3CA 3BTEE 1G32B 3RLWH 1QY6A 5EXNA 5DP6A 4ZXXH 1JXPA 1GG6B 5EPNA 1QB6A 1QB1A 3TGIE 3A83A 1CSOE 1QL7A 2A7HA 4GSOA 1FDPA 3RXRA 2Z3EA 3BTFE 2EEKA 1GDUA 1XKAC 3KQEA 4JCNA 2FOGA 2HOBA 5JBCS 1N8OC 4H42U 1BUIA 1TQ7B 1CT2E 4NG9H 1YKTA 2D8WA 2AERH 2ZU3A 1X7AC 2Y5GA 1SGIB 1Z6EA 1AFEH 1LPZB 1O2PA 1FAXA 1FI8A 4NFEA 1O3OA 1RRKA 3MNBA 2H9EH 1K1OA 3MNXA 1Z6JH 1BTWA 2AIPA 4OS1A 3BTTE 1YP9A 3GCOA 1P03A 1NO9H 2UWOA 1FN8A 1OP0A 3UY9A 2Y81A 1GCTC 1YPHC 2O9QA 5CHAC 1GJAB 2CN0H 2ZZUH 1MQ5A 1JMOH 2XCNA 1AVWA 1NZQH 4XBDA 1P3CA 4MVNA 4A1XA 4JZDH 3EQ0H 1GHAG 4BAHB 2BXTH 1A7SA 4ZHAA 2HPPH 3SU3A 3ZV9A 1ZYOA 4Q2KA 2CV3A 4XBBA 2ZDKA 1DSTA 3SNCA 1UTKA 2CXVA 3L6PA 3SJIA 3GYMA 4E06H 3GDUA 1GI9B 1NTPA 1ELGA 3RMMH 5E0JA 1PPEE 2QXGA 2Z3CA 3KEEA 1D6WA 1C5YB 3NZIA 3ZZ9A 1O5FH 2FI3E 4I7YH 1QRXA 2PKAA 1TX8A 1PPGE 3V7TA 4CR9A 4XSKU 1CHOG 4X6PA 3TH4H 4Z6AH 1GBDA 1O5BB 4B73A 1XVOA 5EW1H 1BRCE 1W10U 1SGFG 3K6YA 1BHXB 1MMJN 1NRSH 2O8WA 3KIDU 1KXDA 1O3JA 6GCHF 5L2ZH 4Q7XA 3NK8A 5DJ7A 2PTNA 1OP2A 4YM9A 1UVPA 1V2RT 2FMJA 2ZHEH 1YPGH 1P57B 2YNAA 1GHWH 1GMHG 1A4WH 1QURH 2BVXH 1LVYA 1GI1A 5DK1A 1GI0A 1YPMH 3RXTA 3SW2B 2FYQA 2R3UA 1ZLRA 4BXSA 1ESBA 2P8OB 3RXPA 2QC2A 1GMCF 3M37A 2BHGA 2V35A 2QF0A 4ZAEA 5ABWA 3U8OH 2FS9A 2WV4A 1EJAA 4NSVA 1LQDB 5C3NA 1BTYA 3S7KB 4ABHA 3VEQB 1LKAA 1GJ9B 1EAIA 1QJ7B 5TJXA 1W13U 4BAQB 5A8XA 2CHAB 1ZSKA 4KGAA 1MQ6A 3ELAH 1E34B 2VWNA 2HNTF 3SGBE 2ZHDA 2NU1E 3M5NA 4Q7YA 1P0SH 4CBOA 1TBZH 1O2HA 7KMEH 1W0YH 1HNEE 1NN6A 4ABDA 3U69H 1XUKA 1GL0E 1O2ZA 1GJDB 1G3BA 3RXBA 4AG1A 3A86A 2FX4A 2A0QB 2VIWA 5DPAA 3FVFB 2QXIA 2FOCA 2ZA5A 3UFAA 1L1GA 2OLGA 1VGCC 1GI6A 1IQIA 2FDAA 1G37A 4WVPE 1TNHA 1ACBE 2XBXA 1WQSA 1DWEH 1CA0B 1OWKA 2WUBA 4YLQH 1D3TB 1EZUC 3BTHE 4WWYA 4X2VA 2BD4A 3SJOA 1O2TA 2ZF0H 3ODFA 2CMYA 3QZQA 1LTOA 1O2LA 3P8OA 2KAIA 2QV1A 2P93A 2ZP0H 3AAUA 1P9SA 1G30B 3TPIZ 1LCYA 3NXPA 3KN2A 3U8RH 1IQNA 2ANKH 1YPKH 4GCHG 2F9NA 4KKDA 1SHYA 4I8HA 3LGYA 2G5VA 5FPYA 1IQMA 2CJIA 1AKSB 4CHAC 1OWEA 2NWNA 3M7QA 2PUQH 5F6MA 2F9VA 3SZNA 7GCHF 1F5KU 1KXEA 4X8SH 1PQAA 3LGIA 4ZUHA 1KXCA 3QTVH 4MPVA 5TCCA 4B74A 1W3CA 1O3CA 1KIGH 2Y7ZA 2ZTXA 2VGCC 1MTNB 2I6QA 1ZPZA 1CT0E 1ARBA 2ZI2H 2BY5X 1O3DA 1TX6A 4UFEH 1UCYE 2GCTB 1TPSA 2BLVA 2OC0A 2ZFFH 2OP9A 4INHA 1VJAU 1NROH 2FOFA 4FUHA 1EPTC 3KL6A 4Y8ZA 2XBWA 3SV6A 1O35A 1QBVH 2VIPA 2P3TB 3Q3XA 1P05A 5C1XA 1O3MA 3QGNB 3EA9A 4DOQA 2Q6DA 1ELEE 2FTMA 2Z9LA 5GIBA 2Z6BD 3BIUH 3RU4E 4CBNA 2CF8H 1ZGIA 2A31A 2O8LA 1EOLA 2DE8A 3ATIA 3CP7A 1GI8B 2TPIZ 1P2JA 4AYYB 1ABJH 2A5IA 4HZHA 3LGTA 1ZTLA 4GPGA 1QL8A 2DUCA 3EE0B 4DGJA 3SHAH 2FLBH 1MZAA 4NA8A 3MHWU 2H9HA 1CE5A 4A92A 1HIAA 3SNDA 4WH8A 1BJUA 1O2KA 2WPMS 3MH5A 1UJ1A 2VU8E 2F9BH 3BTGE 4JYUH 1GHYH 2YOLA 5I25A 1LVMA 2W7UA 1UTJA 2BMGB 1K21H 1GI5A 1THSH 1DICA 3T25A 3UWIA 3EA8A 2VIOA 4WXVA 4ABAA 3P70B 4K60A 3HGNA 4A6LA 1O37A 5A0BA 1GBHA 2G00A 1V2PT 1GI2A 1YPJH 3LJOA 1WV7H 2BD7A 3GDSA 3MU4A 1T31A 1BMLA 1UTLM 3LONA 4GHQA 5HXFA 2W26A 1KDQA 1XUGA 3M7UA 4IC5A 3A8CA 5L30H 2Y5FA 2XWAA 4O9VA 5GWZA 1GBAA 2SGEE 2R0KA 4IS5A 1DSUA 1FIZA 4E7RG 2ALVA 4MNXA 3B9FH 2H9TH 1O3LA 2WV5A 3LU9B 3ATMA 5FPSA 1GMCG 1ELTA 1LHEH 1BMNH 3O8CA 2G4UA 5J4SA 2FXRA 1TRYA 1FY3A 3PWBA 3E3TA 1GJCB 1Y59T 3UNSA 2OCVB 1C5VA 1LHGH 8LPRA 5HM2A 4I8KA 1K1NA 2OBQA 2H1UA 4B2AA 1TGSZ 1L4DA 1DWBH 5BRRE 3LT3A 4Z0KA 2PTCE 1QBOA 3IITA 2FM2A 3RXAA 2FOMB 1FIWA 1HCGA 2PKAB 1G2LA 4CH8B 3RLYH 4TPIZ 4AN7A 2A7JA 1F5LA 2BOHB 4JZEH 1TNGA 1Z1IA 1GDQA 3VXEH 3SU1A 2PKSC 4X2YA 2EI8A 4O3TA 1UO6A 3RXJA 1O38A 1O3GA 2FODA 1DWCH 5T3HA 2BOKA 1QFKH 1MH0A 4ESTE 1VJ9U 1JIRA 2SNVA 4WMFA 3ZZBA 4Y8YA 1O5DH 1GCDA 2VVVA 3T2NA 3OY6U 2BVRH 3PO1C 2FTLE 1YYY1 3F9EA 2IPHA 5T6DA 2LNCA 4ZXYH 3GY5A 1EP6A 1Q31A 3K6ZA 1ESTA 4FUBA 3U1IB 1Z8GA 1SLVB 1GBTA 1GHVH 1AQ7A 1BIOA 1GBCA 3SUGA 1EJNA 3MU0A 3A7ZA 3BEUA 2C3SA 1BCUH 3SV2H 2BQ7B 7LPRA 2G55A 2QGRA 3B23B 1TRMA 1TFXA 1T8NA 1AGJA 1K1LA 1QQUA 1ABIH 1SQTA 1UCYH 2TGAA 4AGKA 2W3IA 4X8UH 4ZROA 4Y0ZE 2BLQA 1C5OH 4U2WA 4X1RU 1IHTH 2ZQ1A 1BTPA 1LDTT 7GCHG 1C4U2 2AMPA 4Y8XA 1BBRE 3SOSA 1ZZZA 3V3MA 1AO5A 1F2SE 3SJKA 3SNEA 2ZTYA 2PWXA 1NPMA 2OD3B 1SSXA 2O8UA 2QAAA 4PROA 3GYLB 4ISOA 4U01A 3UREA 3RDZA 3HATH 3A7XA 5A2MH 2F91A 1BITA 1GGDB 3Q00A 1SOZA 2GT8A 1V2NT 2ZNKH 4AG2A 1AZZA 1Y8TA 1P8VC 4FUGA 2ZU1A 1JOUB 1EPTA 1NESE 4F49A 1IOEA 2UWLA 4JMYA 4JZ1A 3NCLA 1GHBF 3AAVA 1EAUA 2OC1A 2Z9JA 1P2IA 3TK6A 4AORA 2XTTB 1C5LH 1UHBA 3BG4B 2BY6X 1BDAA 1O2MA 3QDZB 3FZZA 1TONA 2C90B 1G3DA 2KAIB 1GVLA 2D26C 2GZ7A 1EZQA 1MUEB 1UTQA 3STIA 4YOIA 1GI7B 1W7XH 1AUJA 2OXSA 4DJZB 1HAYB 1BOQA 1WUNH 2ZFRH 3E90B 1BHXF 3V0XA 3F1SB 3LGUA 1O33A 2ZDNA 3W94A 4X6NA 4MPUA 2BDYA 2ZG0H 1S0RA 1ZRBA 1SGEE 1D3DB 1L1NA 2ZPQA 4ABJA 1TOCB 2A45B 3SUEA 4ISHH 2STBE 1DUEA 3MYWA 4WMDA 4E7NA 2QY0B 2THFB 1W0ZU 3MU1A 1N6XA 3P92A 1N8OB 1MU8B 1MKWK 1SGCA 4ISNA 4IN1A 4AB9A 4WXIA 5C5OA 3PYHA 4K8YA 3S0NA 1O2JA 1V2WT 3A8AA 1ANEA 2VIQA 8ESTE 4A7IB 2FOEA 3GY8A 4OGXA 2FIRH 1ANCA 1LKBA 4UFDH 3NPSA 3TJNA 1TALA 5FX6A 1GHZA 3PV4A 3TJUA 2AFQB 5A09A 2ZWLH 5EXMA 1C2LA 1Y3VA 4ABFA 1L1JA 2PFEA 2M5TA 2VIDA 4XBCA 1GJ5H 4FUEA 3AW0A 1GI4A 1HFDA 1BA8B 2ZHQH 4FU9A 2FP7B 1SBWA 2ZHFH 1O30A 3TJVA 3SU0A 1P2NA 1GBLA 1SI5H 4HI3A 4K5ZA 2PUXB 1MD7A 5DKMA 1SGDE 5DP8A 1PPCE 2TRMA 1C1TA 1FY1A 1C2JA 3ZZDA 2OINA 1IQLA 1HIAB 1W8BH 3K65B 3RMOH 1D4PB 1NU7B 2VINA 3KQCA 1RFNA 1SOTA 1C2HA 1EASA 2F3CE 3LOXA 2HRVA 1TBRH 3BSQA 1DANH 4ISIH 1C1WH 1GBJA 3VGCC 1ID5H 1IQFA 1S6FA 1O34A 3A7WA 1P11E 7ESTE 1GBKA 2VH6A 3DUXH 1EZSC 1MTWA 1T8OA 1Y3XA 4YT7H 1TWXB 1UTNA 2FEQH 3RXQA 2AGGX 4UFGH 1ELCA 1PJPA 1MKXK 1TGTA 1TB6H 1C4Y2 3GCTF 1V2TT 2ESTE 3BEIB 1O2WA 3P17H 3RXOA 2UUJB 3SU6A 3ATLA 1FQ3A 1ZMLA 1KDQB 2TGDA 5FBIA 1UMAH 1NFUA 1OP8A 1AFQB 1FN6A 3UQVA 4IGDA 2JH5D 2ZFQH 3GY6A 3ZVDA 2Z94A 1GJ8B 4U32A 2Z3DA 3LC3A 5EU8A 1BBRH 4AZ2B 4ZKSU 3QO6A 1JRSA 4NGAH 1PYTC 4MQAA 1AU8A 3TIUA 1K9OE 4OS5A 2QA9E 2R2MB 3VB7A 1THPB 2XWBI