2VIPA

Fragment-based discovery of mexiletine derivatives as orally bioavailable inhibitors of urokinase-type plasminogen activator
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTISLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR CHAIN B
publication title Fragment-Based Discovery of Mexiletine Derivatives as Orally Bioavailable Inhibitors of Urokinase-Type Plasminogen Activator
pubmed doi rcsb
source organism Homo sapiens
total genus 60
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2007-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2vipA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2vipA01
3DFLA 4ABFA 1PQAA 1ZHPA 5GIBA 3OU0A 1HIAA 4D7GA 1WYKA 1FY3A 3GY7A 3CP7A 1JIMA 1K1JA 1JRTA 1G3EA 2WINI 3HKJB 4JK6A 4AFSA 3SHAH 1AKSB 1O2JA 1SPJA 5AFZH 2BHGA 4H4FA 3D49H 2Y5HA 4PROA 1F7ZA 1QJ7B 2G52A 9LPRA 3FAOA 1Z6EA 4TPIZ 1OWEA 1GDNA 1GBIA 3K9XB 1W2KH 1T31A 3PV4A 3RU4D 1LDTT 3TH2H 5HYOA 2AMQA 3SJKA 1WCZA 2O8LA 4WF8A 1NRRH 1FPHH 2TGDA 1V2LT 4OGYA 1F0TA 2VGCC 1TIOA 3VXFH 2ZDNA 3MMGA 2QIQA 3ZVGA 1EAIA 2BDBA 2Z9IA 3E1XB 3RLYH 1AFQB 3TNSA 5LPEA 2AS9A 1VZQH 3M3SA 1C1UH 5FBIA 4CRDA 1K9OE 1O0DH 1W11U 3QGJA 1G2LA 1EJAA 1FV9A 1Y5UT 2JH6D 4IMQA 1SSXA 3HPTB 2B8OH 3MNSA 1OKXA 1FZZA 1YBWA 1EXFA 1J15A 1C5MD 4NWKA 4ESTE 4INHA 1UTQA 7GCHG 2ZHDA 3BEIB 3GY4A 2UWLA 1ZSLA 4DT7B 2VINA 1K1PA 1DSTA 2FYQA 4IN1A 4ZKOU 3OYPA 1GI3A 2VIDA 2A7JA 1P2QA 3ZZ6A 1V2OT 2PR3A 1V6DA 1A1RA 1TONA 3FVFB 2A0QB 1BJVA 1C1OA 1L2EA 2TGTA 4A92A 2FMJA 1EZXC 1SBWA 3AAUA 4YO9A 3RXGA 5I46H 3STIA 2F91A 4IMZA 3RP2A 4GSOA 3U98H 1AO5A 4YOGA 1NFXA 1LVBA 1HAVB 3BEFB 2Z6BD 5FCKA 2F9NA 2ANYA 1INCA 1GGDC 2UWPA 1DDJA 4CBNA 4OS6A 4OS4A 1O3GA 1EZQA 1C1TA 2Z9LA 1NRSH 3KN2A 2FLRH 1Z1IA 3E6PH 4NGAH 1PPCE 4KTSA 1GPZA 2FOBA 1N6YA 1C2EA 1EP6A 1XUJA 4NA9H 4CRFA 1GMDG 3LT3A 3SU6A 1O2WA 2VH6A 1BQYA 5JYIA 1PPFE 3A80A 1HDTH 1KXAA 3V7TA 1O2KA 2H6MA 5CHAC 2XWAA 1C9TA 3AW0A 1EZUC 4FUFA 1CO7E 1LVOA 3LONA 1BHXF 1ZPBA 1TLDA 1TPOA 4FUDA 2CJIA 5DJ7A 4I8HA 3LKWA 4X8TH 1ORFA 1BRUP 1TRYA 3OSYA 3A85A 3HK6B 2OC8A 3U8RH 2ZCLP 2IN2A 1GI0A 2ZDKA 1MD7A 2I6SA 1O5GH 1O2OA 1V2NT 4X8VH 2ZGHA 4MLFB 4Q7ZA 9ESTA 1OYTH 4ABHA 2DUCA 1P3CA 4I33A 1ZR0A 1P02A 1ANCA 3VB3A 5GXPA 5T6FA 4CBOA 3Q3XA 2H1UA 1VCQA 3QX5H 3KF2A 2ZHFH 1CGHA 1SGRE 2Q6FA 1SGCA 3IITA 1O38A 2YNBA 5TJXA 1O5EH 2AGIX 3B8JA 1J17T 2SGQE 3Q00A 5F8TA 3U8OH 1W10U 1ZMJA 5L30H 2A5AA 1CBWC 3Q76A 1EQ9A 3PMBB 4FUBA 4DIHH 1FUJA 4WY3A 1DE7H 1MKXK 1GDQA 3VXEH 1O3CA 1IQNA 1NM6A 2PGQB 1SGFG 5EXLA 3BTME 2BVXH 2CV3A 5E0JA 2OUAA 3A82A 2HNTE 4HZHA 3GYLB 5T3HA 4IBLH 2A7HA 1QQUA 1HAOH 1C5TA 3LU9B 3P8FA 1HAYB 2V6NA 2TGPZ 1M9UA 6ESTA 3SHCH 2NU1E 1OYQA 1B0FA 1C1WH 1G30B 3R3GB 4NSYA 4U01A 2PTNA 3QGNB 1Y5AT 5E2OA 2ZDLA 2BZ6H 2CN0H 2OCVB 4CH8B 1DWBH 1IQGA 4DGJA 1P03A 2A32A 4WXVA 1QA7A 4Y8XA 1HYLA 2HNTC 4NG9H 4A5TS 2BOHB 1GJAB 4VGCC 2BYAX 1AB9B 2YOLA 3KQBA 3F9GA 4CHAC 3FP6E 4DCDA 2FOEA 1OWIA 3RXBA 1GJ8B 3A88A 1KLJH 1O3FA 2FESH 2VWNA 3EA9A 4H6SB 1O3MA 2QXHA 2P3FH 5LPFA 2BD4A 1QR3E 5AFYH 4ISOA 1EZSC 2HALA 4YM9A 1BUIA 1QFKH 1TGSZ 2OLGA 2GP9B 3PTNA 3MO6A 1YPGH 2FXRA 3UIRA 6GCHF 5EXNA 3V0XA 2Y80A 2WPJS 4E05H 1LMWB 1HB0B 1MAXA 3A81A 3FANA 4OGXA 5F6MA 1EB2A 1Q3XA 2FPZA 2UUFB 3SGQE 3L33A 2PFEA 3M3VA 1ZLRA 4D7FA 1GBTA 1Z6JH 1P12E 1UHBB 2OQUA 1KXBA 3DD2H 5ESTE 2P94A 5I25A 2B5TB 2JKHA 2ZECA 4NSVA 4Y7BA 3TIUA 3MH4A 1O2IA 1Y3VA 2EI7A 1VJ9U 2Y7ZA 3SJOA 3OY6U 4CR5A 1DICA 5DP8A 3P6ZB 3PYHA 2ZTXA 2QF0A 5FCRA 4D8NA 4KGAA 4WMFA 3PWCA 2NU4E 2AFQB 1SR5C 3SV8A 3A7ZA 3QUMP 5C5OA 1ABJH 3U8TH 1BRBE 3UQVA 2IOTA 3F9HA 4BOHA 4U32A 5E8EH 4BTIB 1KDQA 2LNCA 3ZZCA 2ANMH 3PMJA 1P06A 4CRGA 2Y82A 4MPXA 1SLUB 2PUXB 4AG1A 1IQJA 4HGCA 1V3XA 1T4UH 4ISNA 1C9PA 1YPJH 3GDVA 3PO1B 2F9OA 2PLXA 2GMTB 2BD3A 2QC2A 4K3JA 3UOUA 1C5PA 4CRCA 1A0LA 5SGAE 4X2VA 3ATMA 2XBYA 2C93B 3ZZBA 2J94A 1QHRB 4NZQA 1QGFA 3GCOA 2QN5T 5EPYA 5L6NH 2A45B 4ZUHA 1GVZA 3SV9A 2XC0A 2FEQH 1C1SA 1MCVA 1V2TT 4B2BA 4H42U 1HAVA 4NA8A 1GMCG 1SLVB 2BX4A 4UFEH 1GJ5H 2I6QA 2BLQA 1SLXB 4FU9A 3MO3A 1AWHB 5FHTA 3UQOA 4LZ1H 1SI5H 1P3EA 1A7SA 3F9EA 4ABIA 1LVYA 1JMOH 1AFQC 1QY6A 1C1QA 3FZDA 3ZZ4A 1DANH 1FLEE 1GGDB 2JETC 1DWEH 1RS0A 1TOMH 5E2PA 4BNRA 3AAVA 4I7YH 3HATH 2GCTC 1ZZZA 3E16B 1CGJE 4WVPE 1YCPH 1K1LA 1JWTA 1O3AA 1B7XB 1WV7H 1C5WB 2O9QA 4JZFH 1Z8IB 3STJA 1TNGA 2ZU4A 5ETXA 3UNQA 3WY8A 2F83A 3RXEA 4UFGH 1O3NA 1O3DA 2G5VA 3BTHE 2ANKH 4FXGH 3ZZDA 2ASUB 1CQQA 4NIVA 4X1RU 1EP5A 3GOVB 1DWCH 3L3TA 1OWJA 1ZOMA 2QGRA 2IPHA 1QURH 5EU8A 3SBKA 1CVWH 3P70B 2CF9H 1HNEE 4FUIA 1D3TB 1DFPA 4ABEA 2FLBH 2R2WU 5GCHG 1VJAU 1T8NA 7KMEH 2H9HA 3T5FH 5FPYA 5FBEA 3ZVBA 1L4ZA 1QB6A 4RKOB 1F5KU 3SV6A 4MQAA 5PTPA 1FQ3A 1PJPA 2GCHF 2ZO3H 2FTMA 3M5LA 4YOJA 2RA0A 4AOQA 1SHHB 1C5ZB 3A7YA 1GBMA 1QNJA 2A31A 1ZTLA 3ZZ9A 3ESTA 4YOIA 2ZKSA 1KXEA 1O35A 1LPKB 1H9IE 3GCHB 4BAOB 3MU0A 1FONA 1Y3XA 1NRPH 1ANEA 1QB9A 3UNSA 4NZLA 1FPCH 1DUAA 1Y8TA 2ZGJA 1RTFB 5A8ZA 4XBDA 1BMLA 4QT8C 3A7XA 1TMUH 4I8LA 4X0WU 1NZQH 2ZU3A 2HVXA 4ISIH 4MG3A 4ZXXH 3UFAA 3P8GA 4FVBA 3AVZA 4K1TA 3UREA 1ELFA 1UVSH 1VGCB 1HAZB 1ZPZA 1ETTH 1T4VH 3KGPA 1O3PB 1O39A 1UTKA 2XCFA 4X1SU 1ELCA 2D8WA 3MU1A 1RFNA 5EQSA 4B2CA 1NFUA 3OY5U 3ATLA 1CHOG 1NN6A 1TOCB 4AGJA 1S5SA 2XBWA 2OP9A 1TNKA 3ITIA 1N8OB 3SQEE 5DP9A 2R3UA 1IQEA 3T62A 4CHAB 3MOCA 2BOKA 2BDAA 4MTBA 3KQDA 1SVPA 3RU4T 1L1NA 1SQAA 1K21H 1BTYA 3MWIU 3Q3YA 2ZQ1A 2AMPA 3GY2A 5J4QA 1UCYE 2FOMB 4NFEA 1V2ST 1DPOA 1GMDF 1XKBC 1GVKB 3M5OA 1MBQA 4H6TA 4ZHAA 1SGPE 3AW1A 2ANWA 4WH8A 5HM9A 1UHBA 3ZYEA 4A1VA 1FY1A 5A8YA 3IWMA 3GISB 2UUJB 1VITG 1WU1A 3SV2H 4AFZA 2FODA 1S0RA 1K28D 2FX4A 1BIOA 4WH6A 3N7OA 2C8ZB 1E36B 3EDXB 3RXVA 2GGVB 4B71A 1BTPA 2G55A 4TPYA 7ESTE 4J1YA 1CT2E 1WTGH 1Z8JB 1AB9C 3ATIA 4CREA 1KXCA 2AIPA 5DPAA 1ANDA 1O5CB 1HCGA 4DY7B 1OP2A 2H2ZA 2OD3B 3VB4A 1AZZA 1E35B 5JPMH 1O5BB 3CENA 1O37A 3PM3A 1YPEH 1FN8A 1UK3A 1GBHA 2JH0D 3LPRA 4TY6A 1ZTKA 1TB6H 1PYTD 2OTVA 3B23B 3URCA 1XVMA 4LK4A 2OC0A 2P3TB 3O8DA 1C5OH 4O03A 2R3YA 4Q2KA 3M35A 4AFQA 1AHTH 2SNWA 1NESE 1RD3B 1TNIA 4MNWA 2VB0A 2PV9B 3GY3A 4JYUH 4RKJB 1O3BA 2B7DH 2G4TA 3ZVEA 1V2WT 1BBRK 1O2LA 4Y6DA 2Q6GA 1TABE 2ZU1A 1UK2A 4YESB 5EG4A 1NFWA 3SUEA 3TGKE 2J95A 4Y0YE 5EW2H 1NU7B 3RXKA 2AEIH 1CU1A 1GHBF 3D62A 3S7KB 4GAWA 1ZRKA 4B76A 1SGTA 3A84A 2GD4B 1TX8A 2GVFA 5HM2A 1HJ8A 2HNTF 3BTWE 3NXPA 2BY9X 1WBGB 1S83A 1GCDA 2C4FH 5JB8S 3NKKA 2D1JA 4BAQB 3A7VA 2XBXA 2QXGA 3OX7U 2W26A 1H8DH 2JETB 5EXMA 1GBFA 1QL8A 1IQLA 1ZGVA 4RN6A 1V2UT 1KDQB 3S7HB 1Z8RA 1O2SA 1O5AB 5GDSH 2GV7A 3M5NA 1MUEB 4LZ4B 1XXFA 2GCTB 2FOGA 2GTBA 1O2NA 3Q77A 1GBJA 2B0FA 2EA3A 3CS7A 3FP8E 3PO1C 2P59A 2GMTC 1KYNA 4R8TB 4JZEH 4UDWH 2ZU5A 3SNBA 2XXLA 4JK5A 1UCYH 1HAPH 1AVGH 1HJAB 1JXPA 3P8OA 4KTUA 1O2XA 3PMAB 5DG6A 2ZFQH 1THPB 2J2UA 1MKWK 5E0GA 1BB0B 1GHVH 2ULLA 3C1KA 4E06H 3MTYA 2DE8A 1AWFH 1CT4E 4B2AA 4GPGA 2FI3E 1RXPA 1Z71A 2AMDA 1H8IH 3UR9A 3ZV8A 2GV6A 3OTJE 1DSUA 4O97A 1K1NA 1Y59T 1FY4A 1C5XB 1MMJN 3A7TA 3RU4E 2GT7A 1MU6B 1W0ZU 1FMGA 1KY9A 1HV7A 3V12A 3A87A 1P10A 2BZAA 1DOJA 3GY5A 1Y3WA 5DK1A 3GY6A 3FZZA 1SQOA 1XVOA 1LQDB 3PTBA 1FNIA 5L2YH 3W94A 1H9HE 2AGGX 4UFDH 3LDXH 2BTCE 1C2KA 1S0QA 1SGFA 5F8ZA 3ZZ7A 1BOQA 4YT7H 1W12U 1C5YB 1YF4A 3HGPA 1AMHA 2VWOA 4B1TA 2BLVA 4R0IA 3MHWU 3RXHA 1T32A 1RTKA 1L1JA 4YTAA 3MH6A 3TGIE 1C5SA 3MNBA 3VB6A 3SGAE 1XM1A 2BY8X 1SQTA 1TALA 1P05A 1AE8H 3ZVDA 1DY8A 1YYY1 5B6OA 2BX3A 1OP8A 1IHTH 2ZG0H 3DT0H 3GDUA 3TVJB 1GMHF 2A2QH 8GCHG 2BY6X 1ZJDA 4UD9H 1P2JA 2WYJA 1ZYOA 4KKDA 2A1DB 4BAHB 5DO4H 1OWKA 1GJDB 2Z7FE 3MNXA 4FUHA 3RMOH 2SGEE 2ZA5A 1YM0A 3HK3B 1PPBH 5FPSA 4ZKNU 3PLKA 1O2PA 3SU2A 1YPMH 1MU8B 3MH5A 3GCHC 3MO9A 5DP7A 2A4RA 1A5GH 1SL3A 1D3DB 1EPTA 2FOFA 3U1IB 1NRNH 3PMHB 3GCTF 1QCPA 1ELBA 2QYIA 1GBLA 2SFAA 4FUEA 3P95A 3RXCA 2QY0B 1SGEE 1P01A 1P09A 1W8BH 4HI3A 5FX5A 2ZFRH 1AE5A 2TRMA 2ALVA 1HXEH 1GJ4H 2HWLB 1IQKA 1WTHD 1MTWA 2TIOA 2BQWB 1O3HA 8LPRA 1VGCC 1IAUA 1GI6A 2QXJA 5JBAS 3GICB 5LH8A 2BY5X 5HGGA 2BDIA 1A5IA 1TPAE 4Q80A 1EAUA 4D76A 4XFQA 1CA8B 1AZ8A 4MNXA 1N8OC 3LH3A 3HGNA 3PLBA 4MPVA 3LJOA 1G3CA 1SGIB 3UNRA 1DXPA 3M3TA 1RIWB 3SU1A 8KME2 2R9PA 4JYTA 2BMGB 3QTOH 5IDKA 4FUCA 1GHAF 2NU3E 3RMNH 1A0JA 2QF3A 4LXBH 1P9SA 1EPTC 1TQ0B 1UTPA 1W3CA 2V3OH 4GUXA 2A5IA 4TY7A 3KL6A 4IGDA 1BA8B 4GHTA 4INLA 3V3MA 1YC0A 5C3NA 2BD5A 4Y11E 1ELVA 3NK8A 1GBAA 1BMAA 1CE5A 1O2ZA 2QA9E 1DS2E 2ZU2A 3LC3A 2F9VA 1TRNA 1H4WA 3L6PA 5C1XA 1ACBE 1KLTA 1KTSB 4JCNA 4GCHF 4YLQH 1PFXC 3A86A 4X2XA 1OWDA 4SGAE 1FXYA 1TMBH 4LOYH 4MVNA 3S9AA 1LKBA 1LTOA 1TNJA 4X1PU 3P17H 1YPHE 1QTFA 1BT7A 1JOUB 4TWYA 1AVXA 1RRKA 2XYAA 2ZHEH 2VVCA 4Q7XA 3SU5A 2AH4X 1D6RA 3KIDU 2OQ5A 4D9RA 4AN7A 5T6DA 3F6UH 2ZDAH 5K7RA 4I32A 1AGJA 1O3IA 1GI4A 1SMFE 1GL1A 1C4Y2 1SFQB 2STBE 5FAHA 3E91A 2PW8H 2PSXA 3RXPA 2ZDVH 4DIIH 1GJBB 1EJMA 1YPHC 2ZNKH 4X6MA 4J2YB 1P04A 1DT2A 5HXFA 1NT1A 1EJNA 3PLPA 1OSSA 4ABJA 1F5LA 4WMDA 2PKAB 4GHQA 2QCYA 2QXIA 2OXSA 5CE1A 3MI4A 4JZDH 2OINA 1J9CH 2ZDMA 2BXTH 5DP4A 1P2NA 1O2UA 2D2DA 5EPNA 4BAKB 1S6HA 4ISHH 1BZXE 1GBEA 4IC6A 1LHDH 1C5RA 2BDYA 1LPZB 1O31A 1V2KT 2G00A 1YCPK 3RXOA 5EODA 2ZP0H 1XUGA 1AVWA 2ZFFH 1VCWA 5DP5A 2EI8A 2CGAA 2A7CA 3RMLH 1P0SH 4X8SH 1GVLA 2LPRA 1GI2A 1HJAC 3S9CA 1HBTH 2BQ6B 2GDDA 1LPGB 1EUFA 1BTXA 1UVUH 2O8WA 1UVOA 4K1SA 2FZZA 2W3KA 3RXSA 3TITA 3E90B 1C5LH 3MU8A 1V2RT 1W14U 3QZQA 3SU3A 3UUZA 1F0RA 1K1MA 3LGYA 2PWXA 4UONA 2UUYA 1FDPA 3A83A 1QQ4A 1PPGE 3M7UA 1A4WH 3BTFE 4XBCA 1YLDA 1DVAH 1JBUH 2GKVE 2RDLA 1TGNA 3ATWA 3QN7A 3LGUA 2KAIB 1LQEA 1CA0C 1F5RA 4U30A 1ZRBA 3UR6A 3BEUA 1DWDH 3SJ9A 1F2SE 1GG6B 1TNLA 2FP7B 2FDAA 1KTTB 3BG8A 3EYDA 1T8MA 1HAXB 1E37B 1BDAA 1A61H 1B0EA 1HXFH 1SGYE 1P11E 1ABIH 4K5ZA 3M7TA 1UVTH 2FTLE 2FWWA 3BG4B 2Q6DA 2FS9A 4ZAEA 3T25A 2BD8A 3TH3H 3T2NA 4ABBA 5A09A 1C2FA 3SI3H 1SC8U 3W95A 1UTOA 2ILNA 2WPKS 1GJ7B 2ZFPH 3D23A 1AD8H 2WYGA 4UEHH 3SI4H 2R0KA 3TJVA 7GCHF 2ZHQH 1ZTJA 6GCHG 3QWCH 3M61U 2J34A 1BMMH 3H5CB 1FIZA 3MNCA 6CHAB 2H9EH 4K1EA 2ZZUH 2PSYA 3SNCA 4ZHLU 3VB7A 3U9AH 2FYRA 2RA3A 3RXAA 3ZVAA 2JH5D 4AB8A 1T7CA 3RLWH 5FX6A 1BBRE 3SV7A 1D6WA 4I8GA 1XUHA 1LHCH 2ZWLH 3MFJA 1C1VH 1X7AC 3BSQA 4D9QA 3RXFA 4MPWA 5C1UA 1W0YH 1J16A 1OS8A 1ZHRA 5C20A 2W3IA 4Q7YA 2W7UA 1HAIH 1ARBA 3SN8A 4NIWA 2A4QA 4E7NA 1IQHA 4Y71A 1A46H 2XTTB 3AASA 1O3EA 1BITA 5JB9S 5TCCA 3SO3A 1GBBA 2RG3A 2CHAB 1Q31A 1E38B 1HGTH 1HRTH 2ZPSA 1EPTB 1V2VT 3DFJA 3GY8A 5BPEA 5C67A 1ELEE 4JZIA 2EEKA 2WV4A 1GCTC 4XE4A 5AF9H 1YCPM 4O3TA 3VGCB 1O3JA 2Y5FA 1P8VC 2ZPQA 4FU7A 5LPRA 1C1NA 2EC9H 1BTZA 3S69A 3T29A 2BVRH 1TGCA 3E0NB 4HFPB 3A8CA 2BD2A 3RMMH 2UUKB 2VU8E 3I77A 1AIXH 4IC5A 4AORA 2ZI2H 3RC5A 1ARCA 1P2IA 4F49A 1OX1A 2ZFTA 3LOXA 3H7TA 1CT0E 4AX9H 1RIWC 2J9NA 4FUJA 1UK4A 2G4UA 5A0CA 1N6XA 3FFGA 2A5KA 2FS8A 2O8UA 1CHGA 2BDGA 3VEQB 1OP0A 5H4IB 5FXLA 2BLWA 1G9IE 2BVSH 1E34B 2B9LA 1NROH 1A0HB 1MH0A 3UWJH 5TCAA 1TGTA 1UTJA 1TPSA 3NWUA 1QL7A 2WPMS 3QZRA 3B9FH 2XCNA 1ELTA 1D3QB 3MU5A 1ELAA 1KSNA 3BF6H 1GI1A 1GHXH 5A2MH 1DM4B 1SGQE 1HAGE 1TAWA 2VH0A 1O3OA 2PKAA 2FM2A 3DUXH 3EAJA 1P2KA 3ZYDA 3K2UA 1YP9A 2C8YB 4DW2U 2GZ7A 1GL0E 3ODDA 4AGKA 2VIPA 3MU4A 3F1SB 3TNTA 1BHXB 4AG2A 3BIVH 3RXRA 5K0HA 4JYVH 2HPPH 1QRXA 2XC4A 1EB1H 1ETRH 4Z0KA 1QA0A 2J4IA 4B74A 1OOKB 1BBRH 3RXIA 3FP7E 1TBQH 2BB4A 4WXIA 5C5NA 1SG8B 1TA6A 2J38A 4BANB 3NUMA 4U2WA 1HLTH 3G01A 1TQ7B 3SUFA 4A6LA 4AFUA 3ELAH 2GCHG 3VPKA 3TK5A 2ZF0H 1UCYK 1D3PB 1QBVH 4JZ1A 4A1XA 2P8OB 1DITH 1VITH 1NRQH 3RXMA 3R0FA 3TH4H 2R2MB 4BTUB 1RTLA 1TRMA 3C27B 5HMAA 4CRAA 2OBOA 4AYYB 3ZV9A 4A1TA 1SFIA 1D9IA 4OS7A 2G81E 1C2DA 1GHWH 5C2ZA 1AUTC 1GWAA 2V0BA 1TPPA 4CRBA 1GHYH 3SNEA 1QB1A 1T8LA 1ETSH 4O3UA 2VIOA 1O2YA 1W13U 2G8TA 2KAIA 3SW2B 1DUEA 2XWBI 1CGIE 1S81A 2F9BH 3A8DA 1PYTC 3GDSA 5BRRE 3S0NA 4XSKU 1CA0B 2OC7A 4IW4E 1MKWH 1V2PT 1WQVH 2TBSA 1Y3UA 3TK6A 1MTSA 3SNAA 4BAMB 3TK9A 3UPEA 4BXSA 2ODQA 1DXWA 4I8JA 5AVDA 2Y6TA 1S82A 2QV1A 1MTUA 1G36A 1A3EH 3SUDA 1BTHH 5GJ4B 2G51A 2P95A 5EQRA 4ZKRU 2Y7XA 2F9UA 4E7RG 4A7IB 1THSH 1O5DH 1C2HA 2VVUA 1C5VA 1THRH 3SGBE 2H5CA 1TX6A 2BLOA 2FIRH 6LPRA 3RXTA 2RCEA 3CS0A 3SOSA 2D26C 3KNXA 2O8TA 2XBVA 5EGMA 1FN6A 1C2MA 1XUKA 8ESTE 4XDEA 3DA9B 4FVDA 1AY6H 1O3KA 3URDA 2HGTH 1GMCF 1H9LB 4XBBA 1GI8B 1ESAA 2ZTZA 1AI8H 1GG6C 1UO6A 1VR1H 4OS1A 1BTWA 3SORA 1MTNC 1ELDE 4WJG2 2GZ8A 4Y8ZA 1U6QA 5JBCS 2R0LA 3SU4A 4MNYA 2P3UB 2Z3EA 3QLPH 1PPEE 4Y10E 3RDZA 4CH2B 3BG4C 5A0AE 3UWIA 2A4GA 1WQSA 1GJ9B 3SQHE 5A8XA 4X2WA 4RSPA 4MNVA 2ALPA 3S9BA 1EOJA 1NS3A 5FPTA 1IHSH 2THFB 1FY8E 1L4DA 1QJ6B 2Y5GA 3K6ZA 1TA2A 3ZVFA 4ZMAH 3P8NA 1SGDE 4NFFA 3RUOA 4B73A 5A0BA 1MCTA 1PPHE 1AU8A 2Z3DA 3KEEA 1BJUA 1FAXA 1FIWA 1GCTB 1NU9A 2CMYA 2BD9A 2FX6A 2ZC9H 3TU7H 3ZZ5A 6CHAC 5F8XA 1B5GH 1L1GA 1MKXH 5AHGH 2ESTE 1SLWB 4ASHA 4K8BA 3U1JB 1EKBB 1EAWA 2G5NA 3PB1E 1K1IA 4TYDA 1DLEA 1LO6A 1ZMNA 5GCHF 2AGEX 1GHBG 1A2CH 1MD8A 1MTVA 2ODPA 4YT6H 1PPZA 4DJZB 1ZSJA 1QL9A 1MQ6A 4GLYA 1L0ZA 1O2TA 3UTUH 3D65E 1UMAH 4YLUA 3M5MA 5DKMA 1WSSH 4ZROA 4MDSA 1UTMA 3DHKH 1IQMA 2ZFSA 3F68H 2AYWA 4X6OA 1GJ6A 1ID5H 2ZGCA 5IYTA 4I31A 5G4BA 2Q1JA 3BTEE 2CHAC 4OS5A 3SU0A 4KELA 4KTCA 1YGCH 2STAE 2GX4A 5EQQA 1A3BH 3BTGE 2EI6A 3E0PB 2BQ7B 7LPRA 1O2RA 3TLOA 2ZIQH 1UJ1A 2C3SA 4B75A 3VGCC 2BDHA 3QDZB 1K1OA 1K2I1 5T6GA 3TGJE 3ZZAA 2F9PA 1PQ7A 2PGBB 1WOFA 1AUJA 3SJIA 1C2GA 4X6NA 1AKSA 1QJ1B 2HLCA 2VIQA 2VJ1A 3O8BA 1XMNB 3JZ2B 2WPIS 1O2QA 3KCGH 4X2YA 3BN9A 2O8MA 1ESBA 1RGQA 1Y5BT 2BY7X 1OWHA 4HTCH 2ODYB 5DP6A 1PQ8A 3RC6A 3ODFA 1S84A 5JDUB 1XX9A 1UTNA 1CHOF 1O2HA 3MH7A 1C4U2 3I78A 3PWBA 1J14A 1Z7KA 3JZ1B 4K2YA 1KXFA 2GT8A 1TFXA 1KIGH 4AYVB 2W5EA 2SGDE 3QK1A 1GI7B 2AERH 3LIWA 1UTLM 1K22H 2VGCB 3A7WA 1C5UA 3IG6B 1MBMA 4NIXA 3UOPA 3NPSA 1F92A 1LKAA 4ABDA 2OBQA 3LGTA 1DX5M 5GPIB 3VFEA 2NU0E 4DOQA 5E0HA 5EOKA 1FY5A 2PKSC 3ZVCA 1MZAA 4DVAU 2WPLS 4CR9A 5F03A 2VVVA 1P57B 3M7QA 1NY22 1TMTH 1DLKB 1GI5A 4X1NU 4ZXYH 4INKA 3T26A 4WWYA 1YKTA 1G3DA 4X1QU 4Y79A 2CF8H 5LGOA 3MYWA 2SGPE 5C1YA 4Y8YA 1MAYA 4XOJA 4DURA 1AFEH 1E0FD 1VITF 2TGAA 3LJJA 1JRSA 1HIAB 4JMYA 1IQIA 1QRWA 1G32B 4IN2A 1Z8GA 3NCLA 2J92A 1G3BA 2P16A 3SUGA 2M5TA 1SOZA 1N1LA 1J8AA 2NWNA 1IQFA 1O32A 1QIXB 1F0SA 1QRZA 1GMHG 1WUNH 2P93A 1ZJKA 3RXLA 2PHBA 4ABGA 1O2GH 1C2LA 4Y0ZE 1S85A 3Q3KA 1C2JA 1UVPA 2SGFE 1MQ5A 2BM2A 3EA7A 5ESBA 4BXWA 1D4PB 3U69H 2AIQA 3UY9A 2P8OC 1TGBA 1AQ7A 2HRVA 4K69A 1GBDA 4BTTB 1NPMA 3A8BA 2DE9A 1IOEA 2FOAA 4K60A 4MPUA 2FOCA 5JBBS 4SGBE 1BRAA 1JIRA 1TNHA 1H1BA 2IJOB 3GCTG 1S6FA 5L2ZH 1P2OA 4ZKSU 1GJCB 1P9UA 2NU2E 1O2VA 1GBCA 4ISLA 1EX3A 2C90B 5GWZA 3LGWA 5CHAB 2H5DA 1HUTH 1AN1E 1C1MA 1LCYA 2ZTYA 1FAKH 4I8KA 3A8AA 1TE0A 3M37A 2C8XB 1Z1JA 2HPQH 2ZPRA 1OPHB 2W7SA 4ABAA 3RM2H 4FUGA 3P92A 1GI9B 3EGKH 2XNIA 1C5QA 1A5HA 1LHEH 3BTTE 4F4OC 1MTNB 3K6YA 2WPHS 3SZNA 1LVMA 1TWXB 1YLCA 2H9TH 2QAAA 3K65B 3RM0H 4Y7AA 1G2MA 2HOBA 1XKAC 1FJSA 1SHYA 1QBNA 1SOTA 1XXDA 2V3HH 4X8UH 2A2XH 2ZEBA 4FU8A 1Q2WA 3LH1A 2TPIZ 1GDUA 1W7GH 3M36A 4NCYA 1GHAG 3RXDA 1XUIA 2F3CE 3NZIA 4OS2A 1CBWB 1V2MT 1F0UA 2WUBA 3BTKE 3GCNA 1O5FH 1BCUH 2ZGXH 1EATA 2YNAA 1O3LA 2SGAA 2VNTA 1KXDA 2XW9A 3T28A 1NC6A 1KLIH 1ZGIA 1V2QT 4GVUA 1LHFH 5ABWA 1HPGA 2XRCA 2ZCHP 2CXVA 1ZHMA 5DP3A 3T27A 4AB9A 4K8YA 1FI8A 1O34A 4X6PA 3QO6A 4GCHG 2SNVA 3O8RA 1C1RA 2VWMA 1C2IA 2Z94A 1EOLA 1BMNH 1Y3YA 4KP0A 3E8LA 4AZ2B 1O30A 4UFFH 1OXGA 1P2MA 3ENSB 3VB5A 1ESTA 3V13A 1G37A 2VIVA 1CSOE 1GHZA 2WUCA 4YZUA 1O33A 1HJ9A 3QTVH 1QBOA 4VGCB 2BD7A 2Z3CA 4NIYA 2OC1A 3ATKA 5EW1H 3BTDE 2XC5A 3HKIB 4M7GA 4Z6AH 2Z9GA 2PUQH 2VIWA 2BXUH 4WMEA 5DGJA 1YPLH 3A89A 2GZ9A 1O36A 3TPIZ 2VWLA 1C5NH 4ZHMU 1T8OA 3SNDA 1RJXB 3RXUA 1PQ5A 1MZDA 1ZSKA 2FOHA 1V2JT 3LC5A 3ZZ3A 1TBRH 5J4SA 1NO9H 3ZZ8A 3H7OA 3O8CA 3BIUH 1XUFA 5JBTA 1VCPA 1NFYA 3BV9B 1EAXA 2A4OA 3KQEA 2ZQ2A 1LHGH 1ZMLA 2FO9A 2PTCE 3LGIA 2Y81A 2ZHWH 3GYMA 1HFDA 1TBZH 2WV5A 1HAHH 3BTQE 2K1QA 3EE0B 1C4V2 4Y76A 3E3TA 4TWWA 8GCHF 3RC4A 2ZCKP 1WAYB 3SJ8A 1C1PA 1SGNE 3EQ0H 3EA8A 3KHVA 4NA7A 4NWLA 2V35A 3PROA 3TJUA 4THNH 1ANBA 1DY9A 1SB1H 2GDEH 3I29A 3F9FA 1NTPA 2BDCA 1ZPCA 2Z9KA 1TX7A 4DG4A 2FI5E 3RXJA 4ZH8A 2FI4E 1GBKA 1O2MA 2UWOA 1W7XH 3KQCA 2ZGBH 4IS5A 4O9VA 3LGVA 1BRCE 3RXQA 1TYNA 2PKSB 5CMXH 3TJNA 4UE7H 1BTUA 1EASA 2C8WB 3TJOA 1YPKH 1ELGA 2Z9JA
chains in the Genus database with same CATH superfamily
3DFLA 4ABFA 1PQAA 1ZHPA 5GIBA 3OU0A 1E79D 1HIAA 4D7GA 1WYKA 1FY3A 3GY7A 3CP7A 1JIMA 1K1JA 1JRTA 1G3EA 2WINI 3HKJB 4JK6A 4AFSA 3SHAH 1AKSB 1O2JA 1SPJA 5AFZH 2BHGA 4H4FA 3D49H 2Y5HA 4PROA 1F7ZA 1QJ7B 2G52A 2J97A 9LPRA 3FAOA 1Z6EA 4TPIZ 1OWEA 1GDNA 1GBIA 3K9XB 1W2KH 1T31A 3PV4A 3RU4D 1LDTT 3TH2H 5HYOA 2AMQA 3SJKA 1WCZA 2O8LA 4WF8A 1NRRH 1FPHH 2TGDA 1V2LT 4OGYA 1F0TA 2VGCC 1TIOA 3VXFH 2ZDNA 3MMGA 2QIQA 3ZVGA 1EAIA 2BDBA 2Z9IA 3E1XB 3RLYH 1AFQB 3TNSA 5LPEA 2AS9A 1VZQH 3M3SA 1C1UH 5FBIA 4CRDA 1K9OE 4TT3D 1O0DH 1W11U 3QGJA 1G2LA 1EJAA 1FV9A 1Y5UT 2JH6D 4IMQA 1SSXA 3HPTB 2B8OH 3MNSA 1OKXA 1FZZA 1YBWA 1EXFA 4YXWD 1J15A 3GS9A 1C5MD 4NWKA 4ESTE 4INHA 1UTQA 7GCHG 2ZHDA 3BEIB 3GY4A 2UWLA 1ZSLA 3OAAD 4DT7B 2VINA 1K1PA 1DSTA 2FYQA 4IN1A 4ZKOU 3OYPA 1GI3A 2VIDA 2A7JA 1P2QA 3ZZ6A 1V2OT 2PR3A 1QZ8A 1V6DA 1A1RA 1TONA 4Z1MD 3DSPA 3FVFB 2A0QB 1BJVA 1C1OA 1L2EA 2TGTA 4A92A 2FMJA 1EZXC 1SBWA 3AAUA 4YO9A 3RXGA 3N7DA 2KR7A 5I46H 3STIA 3DSGA 2F91A 3WW7A 4IMZA 3RP2A 4GSOA 3U98H 1AO5A 4YOGA 1NFXA 1LVBA 1HAVB 3BEFB 2Z6BD 5FCKA 2F9NA 2ANYA 1INCA 2YMSB 1GGDC 2UWPA 1DDJA 4CBNA 4OS6A 4OS4A 1O3GA 1EZQA 1C1TA 2Z9LA 1NRSH 3KN2A 2FLRH 3FO8D 1Z1IA 3E6PH 4NGAH 1PPCE 4KTSA 2KCPA 1GPZA 2FOBA 1N6YA 1C2EA 1EP6A 1XUJA 4NA9H 4CRFA 1GMDG 3LT3A 3SU6A 1O2WA 2VH6A 1BQYA 5JYIA 1PPFE 3A80A 2RDEA 1HDTH 1KXAA 3V7TA 1O2KA 2H6MA 5CHAC 2XWAA 1C9TA 3AW0A 1EZUC 4FUFA 1CO7E 1LVOA 3LONA 1BHXF 1ZPBA 1TLDA 1TPOA 4FUDA 2CJIA 5DJ7A 4I8HA 3LKWA 4X8TH 1ORFA 1BRUP 1TRYA 3OSYA 3A85A 1E1RD 3HK6B 2OC8A 3U8RH 2ZCLP 2IN2A 1GI0A 2ZDKA 2V3MA 4FETA 1MD7A 2I6SA 1O5GH 1O2OA 1V2NT 4X8VH 2ZGHA 2F43B 4MLFB 4Q7ZA 9ESTA 1OYTH 4ABHA 2DUCA 1KMHB 1P3CA 4I33A 1ZR0A 1P02A 1ANCA 3VB3A 5GXPA 5T6FA 4CBOA 3Q3XA 2H1UA 1VCQA 3QX5H 3KF2A 2ZHFH 1CGHA 1SGRE 2Q6FA 1SGCA 3IITA 1O38A 2YNBA 5TJXA 1O5EH 2AGIX 3B8JA 1J17T 2SGQE 3Q00A 5F8TA 3U8OH 1W10U 1ZMJA 5L30H 2A5AA 1CBWC 3Q76A 1EQ9A 3PMBB 4FUBA 2OK5A 4DIHH 1FUJA 4WY3A 1DE7H 1MKXK 1GDQA 3VXEH 1O3CA 1IQNA 1NM6A 2PGQB 1SGFG 5EXLA 3BTME 2BVXH 2CV3A 5F53A 5E0JA 2OUAA 3A82A 2HNTE 4HZHA 3GYLB 5T3HA 4IBLH 2JIZD 1WXRA 2A7HA 1QQUA 1HAOH 1C5TA 3LU9B 3P8FA 1HAYB 2V6NA 2TGPZ 1M9UA 6ESTA 3SHCH 2NU1E 1OYQA 1B0FA 1C1WH 1G30B 3R3GB 4NSYA 4U01A 2PTNA 3QGNB 1Y5AT 5E2OA 2ZDLA 2BZ6H 2CN0H 2OCVB 4CH8B 1DWBH 1IQGA 4DGJA 1P03A 2A32A 4WXVA 1QA7A 4Y8XA 1HYLA 2HNTC 4NG9H 4A5TS 2BOHB 1GJAB 4VGCC 2BYAX 1AB9B 2YOLA 3KQBA 3F9GA 4CHAC 3FP6E 4DCDA 2FOEA 1OWIA 3RXBA 1GJ8B 3A88A 1KLJH 1O3FA 2FESH 2VWNA 3EA9A 4H6SB 1O3MA 2QXHA 2P3FH 5LPFA 2BD4A 1QR3E 5AFYH 4ISOA 1EZSC 2HALA 4YM9A 1BUIA 1QFKH 1TGSZ 2OLGA 2GP9B 3PTNA 3MO6A 1YPGH 2FXRA 3UIRA 6GCHF 5EXNA 3V0XA 2Y80A 2WPJS 4E05H 1LMWB 1HB0B 1MAXA 3A81A 3FANA 4OGXA 5F6MA 1EB2A 1Q3XA 2FPZA 2UUFB 3SGQE 3L33A 2PFEA 3M3VA 1ZLRA 4D7FA 1GBTA 1Z6JH 1P12E 1UHBB 2OQUA 1KXBA 3DD2H 4DT4A 5ESTE 2P94A 5I25A 2B5TB 2JKHA 2ZECA 4NSVA 4Y7BA 3TIUA 3MH4A 1O2IA 1Y3VA 2EI7A 1VJ9U 2Y7ZA 3SJOA 3OY6U 4CR5A 1DICA 5DP8A 3P6ZB 3PYHA 2ZTXA 2QF0A 5FCRA 4D8NA 4KGAA 4WMFA 3PWCA 2NU4E 2AFQB 1SR5C 3SV8A 3A7ZA 3QUMP 5C5OA 1ABJH 3U8TH 1BRBE 5EJ1A 3UQVA 2IOTA 3F9HA 4BOHA 4U32A 5E8EH 4BTIB 1KDQA 2LNCA 3ZZCA 3PRBA 2ANMH 3PMJA 1P06A 4CRGA 2Y82A 4MPXA 1SLUB 2PUXB 2K0QA 4AG1A 3NRLA 1IQJA 4HGCA 3KQ5A 1V3XA 1T4UH 4ISNA 3U28C 1C9PA 1YPJH 3GDVA 3PO1B 2F9OA 2PLXA 2GMTB 2BD3A 1MABB 2QC2A 2W6ID 4K3JA 3UOUA 1C5PA 4CRCA 1A0LA 5SGAE 4X2VA 3ATMA 2XBYA 2C93B 3ZZBA 2J94A 1QHRB 4NZQA 1QGFA 3GCOA 2QN5T 5EPYA 5L6NH 2A45B 4ZUHA 1GVZA 3SV9A 2XC0A 2FEQH 1C1SA 1MCVA 1V2TT 4B2BA 4H42U 1HAVA 4NA8A 1GMCG 1SLVB 2BX4A 4UFEH 1GJ5H 2I6QA 2BLQA 1SLXB 4FU9A 3MO3A 1AWHB 5FHTA 3UQOA 4LZ1H 1SI5H 1P3EA 1A7SA 3F9EA 4ABIA 1LVYA 1JMOH 1AFQC 1QY6A 1C1QA 3FZDA 3ZZ4A 1DANH 1FLEE 1GGDB 2JETC 2EY4C 1DWEH 1RS0A 1TOMH 5E2PA 4BNRA 3AAVA 4I7YH 3HATH 2GCTC 1ZZZA 3E16B 1CGJE 4WVPE 2JJ1D 1YCPH 1K1LA 1JWTA 1O3AA 1B7XB 1WV7H 1C5WB 2O9QA 4JZFH 1Z8IB 3STJA 1TNGA 2ZU4A 5ETXA 3UNQA 3WY8A 5KECA 2F83A 3RXEA 4UFGH 1O3NA 1O3DA 2G5VA 3BTHE 2ANKH 4FXGH 3ZZDA 2ASUB 1CQQA 4NIVA 4X1RU 1EP5A 3GOVB 1DWCH 3L3TA 1H8ED 1OWJA 1ZOMA 2QGRA 2IPHA 1QURH 5EU8A 3SBKA 1CVWH 3P70B 2CF9H 1HNEE 4FUIA 1D3TB 1DFPA 4ABEA 2FLBH 2R2WU 5GCHG 1VJAU 1T8NA 7KMEH 2H9HA 3T5FH 5FPYA 5FBEA 2YMSC 3ZVBA 1L4ZA 3FKSD 1QB6A 4RKOB 1F5KU 3SV6A 4MQAA 5PTPA 1FQ3A 1PJPA 2GCHF 2ZO3H 2FTMA 3M5LA 4YOJA 2RA0A 4AOQA 1SHHB 1C5ZB 3A7YA 1GBMA 1QNJA 2A31A 1ZTLA 3ZZ9A 3ESTA 4YOIA 2ZKSA 1KXEA 1O35A 1LPKB 1H9IE 3GCHB 4M9FA 2V7QD 4BAOB 3MU0A 1FONA 1Y3XA 1NRPH 1ANEA 1QB9A 3UNSA 4NZLA 1FPCH 1DUAA 1Y8TA 2ZGJA 4RI0A 5C94A 1RTFB 5A8ZA 4XBDA 1BMLA 4QT8C 3A7XA 1TMUH 4I8LA 4X0WU 1NZQH 2ZU3A 2HVXA 4ISIH 4MG3A 4OM9A 4ZXXH 3P8GA 4FVBA 3UFAA 3AVZA 4K1TA 3UREA 1ELFA 1YWUA 1UVSH 1VGCB 1HAZB 2WSSD 1ZPZA 1ETTH 1T4VH 3KGPA 1O3PB 1O39A 1UTKA 2XCFA 4X1SU 1ELCA 2D8WA 3MU1A 1RFNA 5EQSA 4B2CA 1NFUA 3OY5U 3ATLA 1CHOG 1NN6A 1TOCB 4AGJA 1S5SA 2XBWA 2OP9A 1TNKA 3ITIA 1N8OB 3SQEE 5DP9A 2R3UA 1IQEA 3T62A 4CHAB 3MOCA 2BOKA 2BDAA 4MTBA 3AK5A 3KQDA 1SVPA 3RU4T 2PP6A 1L1NA 4ACBA 1SQAA 1K21H 1BTYA 3MWIU 3Q3YA 2ZQ1A 2AMPA 3PRDA 3GY2A 5J4QA 1UCYE 2FOMB 4NFEA 1V2ST 1DPOA 1GMDF 1XKBC 1GVKB 3M5OA 1MBQA 4H6TA 4ZHAA 1SGPE 5EJLA 3AW1A 2ANWA 4WH8A 5HM9A 1UHBA 3ZYEA 4A1VA 5DN6D 1FY1A 5A8YA 3IWMA 5HIZA 3GISB 2UUJB 1VITG 1WU1A 3SV2H 4AFZA 2FODA 1S0RA 3OEED 1K28D 2FX4A 1BIOA 4WH6A 3N7OA 2C8ZB 1E36B 3EDXB 3RXVA 1W0JD 2GGVB 4B71A 1BTPA 2G55A 4TPYA 7ESTE 4J1YA 2KX4A 1BMFD 1CT2E 1WTGH 1Z8JB 1AB9C 2J98A 3ATIA 4CREA 1KXCA 2AIPA 4Q63A 5DPAA 1ANDA 1O5CB 1HCGA 4DY7B 1OP2A 2H2ZA 5KEDA 2KCAA 2OD3B 3VB4A 1AZZA 1E35B 5JPMH 1O5BB 3CENA 1O37A 3PM3A 1YPEH 1FN8A 1UK3A 1GBHA 2JH0D 3LPRA 4TY6A 1ZTKA 2GJGA 1TB6H 1PYTD 2OTVA 3B23B 3URCA 1FX0B 1XVMA 4LK4A 2OC0A 2P3TB 3O8DA 1C5OH 4O03A 2R3YA 4Q2KA 2WZQA 3M35A 4AFQA 1AHTH 2SNWA 1NESE 1RD3B 1TNIA 4MNWA 2VB0A 2PV9B 1NBME 3GY3A 4JYUH 4RKJB 1O3BA 2B7DH 2G4TA 3ZVEA 1V2WT 1BBRK 1O2LA 4Y6DA 2Q6GA 1TABE 3PV2A 2ZU1A 1UK2A 4YESB 5EG4A 1NFWA 3SUEA 3TGKE 2J95A 4Y0YE 5EW2H 1NU7B 3RXKA 2AEIH 1CU1A 1GHBF 3D62A 3S7KB 4GAWA 1ZRKA 4B76A 1SGTA 3A84A 2GD4B 1TX8A 2GVFA 5HM2A 1HJ8A 2HNTF 3BTWE 3NXPA 2BY9X 1WBGB 3F2FA 1S83A 1GCDA 2C4FH 5JB8S 2KZ4A 3NKKA 2D1JA 4BAQB 1COWD 3A7VA 2XBXA 2QXGA 3OX7U 2W26A 1H8DH 2JETB 5EXMA 1GBFA 1QL8A 1IQLA 1ZGVA 4RN6A 3PV5A 1V2UT 1KDQB 3S7HB 1Z8RA 1O2SA 1O5AB 5GDSH 2GV7A 3M5NA 1MUEB 4LZ4B 1XXFA 2GCTB 2FOGA 2GTBA 1O2NA 3Q77A 1GBJA 2B0FA 2EA3A 3CS7A 3FP8E 3PO1C 5CHBA 2P59A 2GMTC 1KYNA 4R8TB 2WPDD 4JZEH 4UDWH 2ZU5A 3H09A 2IJD1 2XXLA 3SNBA 4JK5A 1UCYH 1HAPH 1AVGH 1HJAB 1JXPA 3P8OA 4KTUA 1O2XA 3PMAB 5DG6A 2ZFQH 1THPB 2J2UA 1MKWK 5E0GA 1BB0B 1GHVH 2ULLA 1YLNA 3C1KA 4E06H 3MTYA 5HKKD 2DE8A 1AWFH 1CT4E 4B2AA 4GPGA 2FI3E 1RXPA 1Z71A 2AMDA 4Q4LA 1H8IH 3UR9A 3ZV8A 1W0KD 2GV6A 3OTJE 1DSUA 4O97A 1K1NA 1Y59T 1FY4A 1C5XB 1MMJN 3A7TA 3RU4E 2GT7A 1MU6B 1W0ZU 1FMGA 1SKYE 1KY9A 1HV7A 3V12A 3A87A 1P10A 2BZAA 1DOJA 3GY5A 2HVYB 1Y3WA 2IPQX 5DK1A 3GY6A 3FZZA 1SQOA 1XVOA 1LQDB 3PTBA 1FNIA 5L2YH 3W94A 1H9HE 2AGGX 4UFDH 2KCYA 2J5UA 3LDXH 2BTCE 1C2KA 1S0QA 1SGFA 5F8ZA 3ZZ7A 1BOQA 2QF5A 4YT7H 1W12U 1C5YB 1YF4A 3HGPA 1AMHA 2VWOA 4B1TA 2BLVA 4R0IA 3MHWU 3RXHA 1T32A 1RTKA 1L1JA 4YTAA 3MH6A 3TGIE 1C5SA 3MNBA 2QE7D 3VB6A 3SGAE 1XM1A 2BY8X 1SQTA 1TALA 1P05A 1AE8H 3ZVDA 1DY8A 1YYY1 5B6OA 2BX3A 1OP8A 1IHTH 2ZG0H 3DT0H 3GDUA 3TVJB 1GMHF 2A2QH 8GCHG 2BY6X 1ZJDA 5HIYA 4UD9H 1P2JA 2CK3D 3F0PA 2WYJA 1ZYOA 4KKDA 2A1DB 4BAHB 5DO4H 1OWKA 1GJDB 2Z7FE 3MNXA 4FUHA 3RMOH 2SGEE 2ZA5A 1YM0A 3HK3B 1PPBH 5FPSA 4ZKNU 3PLKA 1O2PA 3SU2A 1YPMH 1MU8B 3MH5A 3GCHC 3MO9A 5DP7A 2A4RA 1A5GH 1SL3A 1D3DB 1EPTA 2FOFA 3U1IB 1NRNH 3PMHB 3GCTF 1QCPA 1ELBA 2QYIA 1GBLA 2SFAA 4FUEA 3P95A 3RXCA 2QY0B 1SGEE 2HLDD 1P01A 1P09A 1W8BH 4HI3A 5FX5A 2ZFRH 1AE5A 2TRMA 2ALVA 1HXEH 1GJ4H 2HWLB 1IQKA 1WTHD 1MTWA 1VKYA 2TIOA 2BQWB 1O3HA 8LPRA 1VGCC 1E1QD 1IAUA 1GI6A 2QXJA 3F3BA 5JBAS 3GICB 5LH8A 2BY5X 5HGGA 2BDIA 5KGOA 1A5IA 1S6LA 1TPAE 2JDID 4Q80A 1EAUA 4D76A 4XFQA 1CA8B 1AZ8A 4MNXA 1N8OC 3LH3A 3HGNA 3PLBA 1YY3A 4MPVA 3LJOA 1G3CA 1SGIB 3UNRA 1DXPA 3M3TA 1RIWB 3SU1A 8KME2 2R9PA 4JYTA 2BMGB 3WWFA 3QTOH 5IDKA 4FUCA 1GHAF 2NU3E 3RMNH 1A0JA 2WV9A 2QF3A 4LXBH 1P9SA 1EPTC 1TQ0B 1UTPA 1W3CA 2V3OH 4GUXA 2A5IA 4TY7A 3KL6A 4IGDA 1BA8B 4GHTA 4INLA 3V3MA 1YC0A 5C3NA 2L74A 2BD5A 4Y11E 1ELVA 2M2AA 3N99A 3NK8A 1GBAA 1BMAA 1CE5A 1O2ZA 2QA9E 1DS2E 2ZU2A 3LC3A 2F9VA 1TRNA 1H4WA 3L6PA 5C1XA 1ACBE 1KLTA 1KTSB 4JCNA 4GCHF 4YLQH 1PFXC 3A86A 4X2XA 1OWDA 4SGAE 1FXYA 1TMBH 4LOYH 4MVNA 3S9AA 1LKBA 1LTOA 1TNJA 4X1PU 3P17H 1YPHE 1QTFA 1BT7A 2J98B 1JOUB 4TWYA 1AVXA 3UB0A 1RRKA 2XYAA 2ZHEH 2VVCA 4Q7XA 3SU5A 2AH4X 1D6RA 3KIDU 2OQ5A 4D9RA 4AN7A 5T6DA 3F6UH 2ZDAH 5K7RA 4I32A 1AGJA 1O3IA 1GI4A 1WDIA 1SMFE 1GL1A 1C4Y2 1SFQB 2STBE 5FAHA 3E91A 2PW8H 2PSXA 3RXPA 2ZDVH 4F48B 4DIIH 2JJ2D 1H8HD 1GJBB 1EJMA 1YPHC 2ZNKH 4X6MA 4J2YB 1P04A 1DT2A 5HXFA 1NT1A 1EJNA 3PLPA 1OSSA 4ABJA 1F5LA 4WMDA 2PKAB 4GHQA 2QCYA 2QXIA 2OXSA 5CE1A 3MI4A 4JZDH 2OINA 1J9CH 2ZDMA 2BXTH 5DP4A 1P2NA 1O2UA 2D2DA 5EPNA 4BAKB 1S6HA 4ISHH 1BZXE 1GBEA 4IC6A 1LHDH 1C5RA 1SQRA 2BDYA 1LPZB 1O31A 1V2KT 3VG8A 2G00A 1EFRD 1YCPK 3RXOA 5EODA 2ZP0H 1XUGA 1AVWA 2ZFFH 1VCWA 3F0OA 5DP5A 2EI8A 2CGAA 2A7CA 3RMLH 1P0SH 4X8SH 1GVLA 2LPRA 1GI2A 1HJAC 3S9CA 1HBTH 2BQ6B 2GDDA 1LPGB 1EUFA 1BTXA 1UVUH 2O8WA 1UVOA 4K1SA 2FZZA 2W3KA 3RXSA 3TITA 3FOAA 3E90B 1C5LH 3MU8A 4AC9A 1V2RT 1W14U 3QZQA 3SU3A 3UUZA 1F0RA 1K1MA 3LGYA 2PWXA 4UONA 2UUYA 1FDPA 3A83A 1QQ4A 1PPGE 3M7UA 1A4WH 3BTFE 4XBCA 5GNDA 1YLDA 1DVAH 1JBUH 2GKVE 2RDLA 1TGNA 3ATWA 3QN7A 3LGUA 2KAIB 1LQEA 1CA0C 1F5RA 4U30A 1ZRBA 3UR6A 3BEUA 1DWDH 3SJ9A 1F2SE 1GG6B 1TNLA 2FP7B 2FDAA 1KTTB 3BG8A 3EYDA 5EJZA 1T8MA 1HAXB 1E37B 1BDAA 1A61H 1B0EA 1HXFH 1SGYE 1P11E 1ABIH 4K5ZA 3M7TA 1UVTH 2FTLE 2FWWA 2AHME 2Q6DA 3BG4B 3EE7A 2FS9A 4ZAEA 3T25A 2BD8A 3TH3H 3T2NA 4ABBA 5A09A 1C2FA 3SI3H 1SC8U 3W95A 1UTOA 2ILNA 3F2HA 2WPKS 1GJ7B 2ZFPH 3D23A 1AD8H 2WYGA 4UEHH 3SI4H 2R0KA 3TJVA 7GCHF 2ZHQH 1ZTJA 6GCHG 3QWCH 3M61U 2J34A 1BMMH 3H5CB 1FIZA 3MNCA 6CHAB 2H9EH 4K1EA 2ZZUH 2PSYA 3SNCA 4ZHLU 3VB7A 3U9AH 3KYFA 2FYRA 2RA3A 3RXAA 3ZVAA 4I86A 2JH5D 4AB8A 1T7CA 3RLWH 5FX6A 1BBRE 3SV7A 1D6WA 4I8GA 1XUHA 1LHCH 2ZWLH 3F2GA 3MFJA 1C1VH 1X7AC 3BSQA 4D9QA 3RXFA 4MPWA 5C1UA 1W0YH 1J16A 1OS8A 1ZHRA 5C20A 2W3IA 4Q7YA 2W7UA 1HAIH 1ARBA 3SN8A 4FOUC 4NIWA 2A4QA 4E7NA 1IQHA 4Y71A 1A46H 2XTTB 3AASA 1O3EA 1BITA 5JB9S 5TCCA 3SO3A 1GBBA 2RG3A 2CHAB 1Q31A 1E38B 1HGTH 1HRTH 2ZPSA 1EPTB 1V2VT 3DFJA 3GY8A 5BPEA 5C67A 1ELEE 4JZIA 3UAIC 2EEKA 2WV4A 1GCTC 4XE4A 5AF9H 1YCPM 4O3TA 3VGCB 1O3JA 2Y5FA 1P8VC 2ZPQA 4FU7A 5LPRA 1C1NA 2EC9H 1BTZA 3S69A 3T29A 2BVRH 1TGCA 3E0NB 4HFPB 3A8CA 2BD2A 3RMMH 2UUKB 2VU8E 3I77A 1AIXH 4IC5A 2LP6A 4AORA 2ZI2H 3RC5A 1ARCA 2K8IA 1P2IA 4F49A 1OX1A 2ZFTA 3DSOA 3LOXA 3H7TA 1CT0E 4AX9H 1RIWC 2J9NA 4FUJA 1UK4A 2G4UA 5A0CA 1N6XA 3FFGA 2A5KA 4ASUD 2FS8A 2O8UA 1CHGA 2BDGA 3VEQB 3ZIAD 1OP0A 5H4IB 5FXLA 2BLWA 1G9IE 2BVSH 1E34B 3CNRA 3DCLA 2B9LA 1NROH 1A0HB 1MH0A 3UWJH 5TCAA 1TGTA 1UTJA 1TPSA 3NWUA 1QL7A 2WPMS 3QZRA 3B9FH 2XCNA 1ELTA 1D3QB 3MU5A 1ELAA 1KSNA 3BF6H 5IK2D 1GI1A 4ZCNA 1GHXH 5A2MH 1DM4B 1SGQE 1HAGE 1TAWA 2VH0A 1O3OA 2PKAA 2FM2A 3DUXH 3EAJA 1P2KA 3ZYDA 3K2UA 1YP9A 2C8YB 4DW2U 2GZ7A 1GL0E 3ODDA 3N7EA 4AGKA 2VIPA 3MU4A 3F1SB 3TNTA 1BHXB 4AG2A 3BIVH 3RXRA 5K0HA 4JYVH 2HPPH 1QRXA 2XC4A 1EB1H 1ETRH 4Z0KA 1QA0A 2J4IA 4B74A 1OOKB 1BBRH 3RXIA 3FP7E 1TBQH 2BB4A 4WXIA 5C5NA 1SG8B 1TA6A 2J38A 1OHHD 4BANB 3NUMA 4U2WA 1HLTH 3G01A 1TQ7B 3SUFA 4A6LA 4AFUA 3ELAH 2GCHG 3VPKA 3TK5A 2ZF0H 1UCYK 1D3PB 1QBVH 4JZ1A 4A1XA 2P8OB 1DITH 1VITH 1NRQH 3RXMA 3R0FA 3TH4H 2R2MB 4BTUB 1RTLA 1TRMA 3C27B 5HMAA 4CRAA 2OBOA 4AYYB 3ZV9A 4A1TA 1SFIA 1D9IA 4OS7A 2G81E 1C2DA 1GHWH 5C2ZA 1AUTC 1GWAA 2V0BA 3OEHD 1TPPA 4CRBA 1GHYH 3SNEA 1QB1A 1T8LA 1ETSH 4O3UA 2VIOA 1O2YA 1W13U 2G8TA 2KAIA 3SW2B 1DUEA 2XWBI 1CGIE 1S81A 2F9BH 3A8DA 1PYTC 3GDSA 5BRRE 3S0NA 4XSKU 1CA0B 2L6OA 2OC7A 4IW4E 1MKWH 1V2PT 1WQVH 2TBSA 1Y3UA 3TK6A 4RT1A 1MTSA 3SNAA 4BAMB 3TK9A 3UPEA 4BXSA 2ODQA 1DXWA 4I8JA 5AVDA 2Y6TA 1S82A 2QV1A 1MTUA 1G36A 1A3EH 3SUDA 1BTHH 5GJ4B 2G51A 2P95A 5EQRA 4ZKRU 2Y7XA 2F9UA 4E7RG 4A7IB 1THSH 5FL7D 1O5DH 1C2HA 4XRNA 2VVUA 1C5VA 1THRH 3SGBE 2H5CA 1TX6A 2BLOA 2FIRH 2QF4A 3RXTA 6LPRA 2RCEA 3CS0A 3SOSA 2D26C 3KNXA 2O8TA 2XBVA 5EGMA 1FN6A 1C2MA 1XUKA 8ESTE 4XDEA 3DA9B 4FVDA 5C0TA 1AY6H 1O3KA 3URDA 2HGTH 1GMCF 1H9LB 4XBBA 1GI8B 1ESAA 2ZTZA 1AI8H 1GG6C 1UO6A 1VR1H 2XNDD 1BTWA 4OS1A 3SORA 1MTNC 1ELDE 4WJG2 2GZ8A 4Y8ZA 1U6QA 5JBCS 2R0LA 2KCOA 3SU4A 4MNYA 2P3UB 2Z3EA 3QLPH 1PPEE 4Y10E 3RDZA 3FN8A 4CH2B 3BG4C 5A0AE 3UWIA 2A4GA 1WQSA 1GJ9B 3SQHE 5A8XA 4X2WA 4RSPA 4MNVA 2ALPA 3S9BA 1EOJA 1NS3A 5FPTA 1IHSH 2THFB 1FY8E 1L4DA 1QJ6B 2Y5GA 3K6ZA 1TA2A 3ZVFA 4ZMAH 3P8NA 1SGDE 4NFFA 3RUOA 4B73A 5A0BA 1MCTA 1PPHE 1AU8A 2Z3DA 3KEEA 1BJUA 1FAXA 1FIWA 1GCTB 1NU9A 2CMYA 2BD9A 2FX6A 2ZC9H 3TU7H 3ZZ5A 6CHAC 3MQKC 5F8XA 1B5GH 1L1GA 1MKXH 5AHGH 2ESTE 1SLWB 4ASHA 4K8BA 3U1JB 1EKBB 1EAWA 2G5NA 4F55A 3PB1E 1K1IA 4TYDA 4P00A 1DLEA 1LO6A 1ZMNA 2LELA 5GCHF 2AGEX 1GHBG 1A2CH 1MD8A 1MTVA 2ODPA 4YT6H 1PPZA 4ACAA 4DJZB 1ZSJA 1QL9A 1MQ6A 4GLYA 1L0ZA 1O2TA 3UTUH 3D65E 1UMAH 4YLUA 3M5MA 5DKMA 1WSSH 4ZROA 4MDSA 1UTMA 3DHKH 1IQMA 2ZFSA 3F68H 2AYWA 4X6OA 1GJ6A 1ID5H 2ZGCA 5IYTA 4I31A 5G4BA 5T1VA 2Q1JA 3BTEE 2CHAC 4OS5A 3SU0A 4KELA 4KTCA 1YGCH 2STAE 2GX4A 5EQQA 1A3BH 3BTGE 2EI6A 3E0PB 2BQ7B 7LPRA 1O2RA 3TLOA 4P02A 2ZIQH 5C17A 1UJ1A 2C3SA 4B75A 3VGCC 2BDHA 4TSFD 3QDZB 1K1OA 1K2I1 5T6GA 3TGJE 3ZZAA 1K0HA 2F9PA 1PQ7A 3OE7D 2PGBB 1WOFA 1AUJA 3SJIA 1C2GA 4X6NA 1AKSA 1QJ1B 2HLCA 2VIQA 2VJ1A 3O8BA 1XMNB 3JZ2B 2WPIS 1O2QA 3KCGH 4X2YA 3BN9A 2O8MA 1ESBA 1RGQA 1Y5BT 1UW7A 2BY7X 1OWHA 4HTCH 2XOKD 2ODYB 5DP6A 1PQ8A 3RC6A 3ODFA 1S84A 5JDUB 1XX9A 1UTNA 1CHOF 1O2HA 3MH7A 1C4U2 3I78A 3PWBA 1J14A 1Z7KA 3JZ1B 4K2YA 1KXFA 2GT8A 1TFXA 1KIGH 4AYVB 2W5EA 2SGDE 3QK1A 1GI7B 2AERH 3LIWA 2W6JD 1UTLM 1K22H 2VGCB 3A7WA 3OTPA 1C5UA 3IG6B 1MBMA 4NIXA 3UOPA 3NPSA 1F92A 1LKAA 4ABDA 2OBQA 4B6EA 3LGTA 1DX5M 5GPIB 3VFEA 2NU0E 4DOQA 5E0HA 5EOKA 1FY5A 2PKSC 3ZVCA 1MZAA 4DVAU 2WPLS 4CR9A 5F03A 2YMSD 2VVVA 1P57B 3M7QA 1NY22 1TMTH 1DLKB 1GI5A 4X1NU 4ZXYH 4INKA 3T26A 4WWYA 5C0UA 1YKTA 1G3DA 4X1QU 4Y79A 3OFND 2CF8H 5LGOA 3MYWA 2EQNA 2SGPE 5C1YA 4Y8YA 1MAYA 4XOJA 4DURA 1AFEH 1E0FD 1VITF 2TGAA 3LJJA 1JRSA 1HIAB 4JMYA 1IQIA 1QRWA 1G32B 4IN2A 1Z8GA 3NCLA 2J92A 1G3BA 2P16A 3SUGA 2M5TA 1SOZA 1N1LA 1J8AA 2NWNA 1IQFA 5EIYA 1O32A 5B6LA 1QIXB 1F0SA 1QRZA 1GMHG 1WUNH 2P93A 1ZJKA 3RXLA 2PHBA 4ABGA 1O2GH 1C2LA 2RFKC 4Y0ZE 1S85A 3Q3KA 1C2JA 1UVPA 2SGFE 1MQ5A 2BM2A 3EA7A 5ESBA 4BXWA 1D4PB 3U69H 2AIQA 3UY9A 2P8OC 1TGBA 1AQ7A 2HRVA 4K69A 1GBDA 4BTTB 1NPMA 3A8BA 2DE9A 1IOEA 2FOAA 4K60A 4MPUA 2FOCA 5JBBS 4SGBE 1BRAA 1JIRA 1TNHA 1H1BA 2IJOB 3GCTG 1S6FA 5L2ZH 1P2OA 4ZKSU 1GJCB 1P9UA 2NU2E 1O2VA 1GBCA 4ISLA 1EX3A 2C90B 5GWZA 3LGWA 5CHAB 2H5DA 1HUTH 1AN1E 1C1MA 1LCYA 2ZTYA 1FAKH 4I8KA 3A8AA 1TE0A 3M37A 2C8XB 1Z1JA 2HPQH 2ZPRA 1OPHB 2VBCA 4HG6A 2W7SA 4ABAA 3RM2H 4FUGA 4B6FA 2KM0A 3P92A 1GI9B 3EGKH 2XNIA 1C5QA 1A5HA 1LHEH 3BTTE 4F4OC 1MTNB 3K6YA 2WPHS 3SZNA 1LVMA 1TWXB 1YLCA 2H9TH 2QAAA 3K65B 3RM0H 4Y7AA 1G2MA 2HOBA 1XKAC 1FJSA 1SHYA 1QBNA 1SOTA 1XXDA 2V3HH 4X8UH 2A2XH 2ZEBA 4FU8A 1Q2WA 3LH1A 2TPIZ 1GDUA 1W7GH 3M36A 4NCYA 1GHAG 3RXDA 1XUIA 2F3CE 3NZIA 4OS2A 1CBWB 1V2MT 1F0UA 2WUBA 3BTKE 3GCNA 1O5FH 1BCUH 2WHXA 2ZGXH 1EATA 2YNAA 1O3LA 2SGAA 2VNTA 1KXDA 2XW9A 3SZEA 3T28A 1NC6A 3SYJA 1KLIH 1ZGIA 1V2QT 4GVUA 1LHFH 5DSFA 5ABWA 1HPGA 2XRCA 2ZCHP 2CXVA 1ZHMA 5DP3A 3T27A 4AB9A 4K8YA 1FI8A 1O34A 4X6PA 3QO6A 4GCHG 2SNVA 3O8RA 1C1RA 2VWMA 1C2IA 2Z94A 1EOLA 1BMNH 1Y3YA 4KP0A 3E8LA 4AZ2B 1O30A 4UFFH 1OXGA 1P2MA 3ENSB 3VB5A 1ESTA 3V13A 1G37A 2VIVA 1CSOE 1GHZA 2WUCA 4YZUA 1O33A 1HJ9A 3QTVH 1QBOA 4VGCB 2BD7A 2Z3CA 4NIYA 2OC1A 3ATKA 5EW1H 3BTDE 2XC5A 2F4LA 3HKIB 4M7GA 4Z6AH 2Z9GA 2PUQH 2VIWA 2BXUH 4WMEA 4XD7D 5DGJA 1YPLH 3A89A 2GZ9A 1O36A 3TPIZ 2VWLA 1C5NH 4ZHMU 1T8OA 3SNDA 1RJXB 3RXUA 1NBMD 1PQ5A 1MZDA 1ZSKA 2FOHA 1V2JT 3LC5A 4RT0A 3ZZ3A 1TBRH 5J4SA 1NO9H 3ZZ8A 3H7OA 3W1EA 3O8CA 3BIUH 1XUFA 5JBTA 1VCPA 1NFYA 3BV9B 5CDFE 1EAXA 2A4OA 3KQEA 2ZQ2A 1LHGH 1ZMLA 2FO9A 2PTCE 3LGIA 2Y81A 2ZHWH 3GYMA 1HFDA 1TBZH 2WV5A 1HAHH 3BTQE 2K1QA 3EE0B 1C4V2 4Y76A 3E3TA 2KFWA 4TWWA 8GCHF 3RC4A 2ZCKP 1WAYB 3SJ8A 1C1PA 1SGNE 3EQ0H 3EA8A 3KHVA 4NA7A 4NWLA 2V35A 3WWBA 3PROA 3TJUA 4THNH 1ANBA 1DY9A 1SB1H 2GDEH 3I29A 3F9FA 1NTPA 2BDCA 1ZPCA 2Z9KA 1TX7A 4DG4A 2FI5E 3RXJA 4ZH8A 2FI4E 1GBKA 1O2MA 2UWOA 1W7XH 3KQCA 2ZGBH 4IS5A 4O9VA 3LGVA 1BRCE 3KYGA 3RXQA 1TYNA 2PKSB 5CMXH 3TJNA 4UE7H 1BTUA 1EASA 2C8WB 3TJOA 1YPKH 1ELGA 2Z9JA
chains in the Genus database with same CATH topology
3DFLA 4ABFA 1PQAA 1ZHPA 5GIBA 3OU0A 1HIAA 4D7GA 1WYKA 1FY3A 3GY7A 3CP7A 1JIMA 1K1JA 1JRTA 1G3EA 2WINI 3HKJB 4JK6A 4AFSA 3SHAH 1AKSB 1O2JA 1SPJA 5AFZH 2BHGA 4H4FA 3D49H 2Y5HA 4PROA 1F7ZA 1QJ7B 2G52A 9LPRA 3FAOA 1Z6EA 4TPIZ 1OWEA 1GDNA 1GBIA 3K9XB 1W2KH 1T31A 3PV4A 3RU4D 1LDTT 3TH2H 5HYOA 2AMQA 3SJKA 1WCZA 2O8LA 4WF8A 1NRRH 1FPHH 2TGDA 1V2LT 4OGYA 1F0TA 2VGCC 1TIOA 3VXFH 2ZDNA 3MMGA 2QIQA 3ZVGA 1EAIA 2BDBA 2Z9IA 3E1XB 3RLYH 1AFQB 3TNSA 5LPEA 2AS9A 1VZQH 3M3SA 1C1UH 5FBIA 4CRDA 1K9OE 1O0DH 1W11U 3QGJA 1G2LA 1EJAA 1FV9A 1Y5UT 2JH6D 4IMQA 1SSXA 3HPTB 2B8OH 3MNSA 1OKXA 1FZZA 1YBWA 1EXFA 1J15A 1C5MD 4NWKA 4ESTE 4INHA 1UTQA 7GCHG 2ZHDA 3BEIB 3GY4A 2UWLA 1ZSLA 4DT7B 2VINA 1K1PA 1DSTA 2FYQA 4IN1A 4ZKOU 3OYPA 1GI3A 2VIDA 2A7JA 1P2QA 3ZZ6A 1V2OT 2PR3A 1V6DA 1A1RA 1TONA 3FVFB 2A0QB 1BJVA 1C1OA 1L2EA 2TGTA 4A92A 2FMJA 1EZXC 1SBWA 3AAUA 4YO9A 3RXGA 5I46H 3STIA 2F91A 4IMZA 3RP2A 4GSOA 3U98H 1AO5A 4YOGA 1NFXA 1LVBA 1HAVB 3BEFB 2Z6BD 5FCKA 2F9NA 2ANYA 1INCA 1GGDC 2UWPA 1DDJA 4CBNA 4OS6A 4OS4A 1O3GA 1EZQA 1C1TA 2Z9LA 1NRSH 3KN2A 2FLRH 1Z1IA 3E6PH 4NGAH 1PPCE 4KTSA 1GPZA 2FOBA 1N6YA 1C2EA 1EP6A 1XUJA 4NA9H 4CRFA 1GMDG 3LT3A 3SU6A 1O2WA 2VH6A 1BQYA 5JYIA 1PPFE 3A80A 1HDTH 1KXAA 3V7TA 1O2KA 2H6MA 5CHAC 2XWAA 1C9TA 3AW0A 1EZUC 4FUFA 1CO7E 1LVOA 3LONA 1BHXF 1ZPBA 1TLDA 1TPOA 4FUDA 2CJIA 5DJ7A 4I8HA 3LKWA 4X8TH 1ORFA 1BRUP 1TRYA 3OSYA 3A85A 3HK6B 2OC8A 3U8RH 2ZCLP 2IN2A 1GI0A 2ZDKA 1MD7A 2I6SA 1O5GH 1O2OA 1V2NT 4X8VH 2ZGHA 4MLFB 4Q7ZA 9ESTA 1OYTH 4ABHA 2DUCA 1P3CA 4I33A 1ZR0A 1P02A 1ANCA 3VB3A 5GXPA 5T6FA 4CBOA 3Q3XA 2H1UA 1VCQA 3QX5H 3KF2A 2ZHFH 1CGHA 1SGRE 2Q6FA 1SGCA 3IITA 1O38A 2YNBA 5TJXA 1O5EH 2AGIX 3B8JA 1J17T 2SGQE 3Q00A 5F8TA 3U8OH 1W10U 1ZMJA 5L30H 2A5AA 1CBWC 3Q76A 1EQ9A 3PMBB 4FUBA 4DIHH 1FUJA 4WY3A 1DE7H 1MKXK 1GDQA 3VXEH 1O3CA 1IQNA 1NM6A 2PGQB 1SGFG 5EXLA 3BTME 2BVXH 2CV3A 5E0JA 2OUAA 3A82A 2HNTE 4HZHA 3GYLB 5T3HA 4IBLH 2A7HA 1QQUA 1HAOH 1C5TA 3LU9B 3P8FA 1HAYB 2V6NA 2TGPZ 1M9UA 6ESTA 3SHCH 2NU1E 1OYQA 1B0FA 1C1WH 1G30B 3R3GB 4NSYA 4U01A 2PTNA 3QGNB 1Y5AT 5E2OA 2ZDLA 2BZ6H 2CN0H 2OCVB 4CH8B 1DWBH 1IQGA 4DGJA 1P03A 2A32A 4WXVA 1QA7A 4Y8XA 1HYLA 2HNTC 4NG9H 4A5TS 2BOHB 1GJAB 4VGCC 2BYAX 1AB9B 2YOLA 3KQBA 3F9GA 4CHAC 3FP6E 4DCDA 2FOEA 1OWIA 3RXBA 1GJ8B 3A88A 1KLJH 1O3FA 2FESH 2VWNA 3EA9A 4H6SB 1O3MA 2QXHA 2P3FH 5LPFA 2BD4A 1QR3E 5AFYH 4ISOA 1EZSC 2HALA 4YM9A 1BUIA 1QFKH 1TGSZ 2OLGA 2GP9B 3PTNA 3MO6A 1YPGH 2FXRA 3UIRA 6GCHF 5EXNA 3V0XA 2Y80A 2WPJS 4E05H 1LMWB 1HB0B 1MAXA 3A81A 3FANA 4OGXA 5F6MA 1EB2A 1Q3XA 2FPZA 2UUFB 3SGQE 3L33A 2PFEA 3M3VA 1ZLRA 4D7FA 1GBTA 1Z6JH 1P12E 1UHBB 2OQUA 1KXBA 3DD2H 5ESTE 2P94A 5I25A 2B5TB 2JKHA 2ZECA 4NSVA 4Y7BA 3TIUA 3MH4A 1O2IA 1Y3VA 2EI7A 1VJ9U 2Y7ZA 3SJOA 3OY6U 4CR5A 1DICA 5DP8A 3P6ZB 3PYHA 2ZTXA 2QF0A 5FCRA 4D8NA 4KGAA 4WMFA 3PWCA 2NU4E 2AFQB 1SR5C 3SV8A 3A7ZA 3QUMP 5C5OA 1ABJH 3U8TH 1BRBE 3UQVA 2IOTA 3F9HA 4BOHA 4U32A 5E8EH 4BTIB 1KDQA 2LNCA 3ZZCA 2ANMH 3PMJA 1P06A 4CRGA 2Y82A 4MPXA 1SLUB 2PUXB 4AG1A 1IQJA 4HGCA 1V3XA 1T4UH 4ISNA 1C9PA 1YPJH 3GDVA 3PO1B 2F9OA 2PLXA 2GMTB 2BD3A 2QC2A 4K3JA 3UOUA 1C5PA 4CRCA 1A0LA 5SGAE 4X2VA 3ATMA 2XBYA 2C93B 3ZZBA 2J94A 1QHRB 4NZQA 1QGFA 3GCOA 2QN5T 5EPYA 5L6NH 2A45B 4ZUHA 1GVZA 3SV9A 2XC0A 2FEQH 1C1SA 1MCVA 1V2TT 4B2BA 4H42U 1HAVA 4NA8A 1GMCG 1SLVB 2BX4A 4UFEH 1GJ5H 2I6QA 2BLQA 1SLXB 4FU9A 3MO3A 1AWHB 5FHTA 3UQOA 4LZ1H 1SI5H 1P3EA 1A7SA 3F9EA 4ABIA 1LVYA 1JMOH 1AFQC 1QY6A 1C1QA 3FZDA 3ZZ4A 1DANH 1FLEE 1GGDB 2JETC 1DWEH 1RS0A 1TOMH 5E2PA 4BNRA 3AAVA 4I7YH 3HATH 2GCTC 1ZZZA 3E16B 1CGJE 4WVPE 1YCPH 1K1LA 1JWTA 1O3AA 1B7XB 1WV7H 1C5WB 2O9QA 4JZFH 1Z8IB 3STJA 1TNGA 2ZU4A 5ETXA 3UNQA 3WY8A 2F83A 3RXEA 4UFGH 1O3NA 1O3DA 2G5VA 3BTHE 2ANKH 4FXGH 3ZZDA 2ASUB 1CQQA 4NIVA 4X1RU 1EP5A 3GOVB 1DWCH 3L3TA 1OWJA 1ZOMA 2QGRA 2IPHA 1QURH 5EU8A 3SBKA 1CVWH 3P70B 2CF9H 1HNEE 4FUIA 1D3TB 1DFPA 4ABEA 2FLBH 2R2WU 5GCHG 1VJAU 1T8NA 7KMEH 2H9HA 3T5FH 5FPYA 5FBEA 3ZVBA 1L4ZA 1QB6A 4RKOB 1F5KU 3SV6A 4MQAA 5PTPA 1FQ3A 1PJPA 2GCHF 2ZO3H 2FTMA 3M5LA 4YOJA 2RA0A 4AOQA 1SHHB 1C5ZB 3A7YA 1GBMA 1QNJA 2A31A 1ZTLA 3ZZ9A 3ESTA 4YOIA 2ZKSA 1KXEA 1O35A 1LPKB 1H9IE 3GCHB 4BAOB 3MU0A 1FONA 1Y3XA 1NRPH 1ANEA 1QB9A 3UNSA 4NZLA 1FPCH 1DUAA 1Y8TA 2ZGJA 1RTFB 5A8ZA 4XBDA 1BMLA 4QT8C 3A7XA 1TMUH 4I8LA 4X0WU 1NZQH 2ZU3A 2HVXA 4ISIH 4MG3A 4ZXXH 3UFAA 3P8GA 4FVBA 3AVZA 4K1TA 3UREA 1ELFA 1UVSH 1VGCB 1HAZB 1ZPZA 1ETTH 1T4VH 3KGPA 1O3PB 1O39A 1UTKA 2XCFA 4X1SU 1ELCA 2D8WA 3MU1A 1RFNA 5EQSA 4B2CA 1NFUA 3OY5U 3ATLA 1CHOG 1NN6A 1TOCB 4AGJA 1S5SA 2XBWA 2OP9A 1TNKA 3ITIA 1N8OB 3SQEE 5DP9A 2R3UA 1IQEA 3T62A 4CHAB 3MOCA 2BOKA 2BDAA 4MTBA 3KQDA 1SVPA 3RU4T 1L1NA 1SQAA 1K21H 1BTYA 3MWIU 3Q3YA 2ZQ1A 2AMPA 3GY2A 5J4QA 1UCYE 2FOMB 4NFEA 1V2ST 1DPOA 1GMDF 1XKBC 1GVKB 3M5OA 1MBQA 4H6TA 4ZHAA 1SGPE 3AW1A 2ANWA 4WH8A 5HM9A 1UHBA 3ZYEA 4A1VA 1FY1A 5A8YA 3IWMA 3GISB 2UUJB 1VITG 1WU1A 3SV2H 4AFZA 2FODA 1S0RA 1K28D 2FX4A 1BIOA 4WH6A 3N7OA 2C8ZB 1E36B 3EDXB 3RXVA 2GGVB 4B71A 1BTPA 2G55A 4TPYA 7ESTE 4J1YA 1CT2E 1WTGH 1Z8JB 1AB9C 3ATIA 4CREA 1KXCA 2AIPA 5DPAA 1ANDA 1O5CB 1HCGA 4DY7B 1OP2A 2H2ZA 2OD3B 3VB4A 1AZZA 1E35B 5JPMH 1O5BB 3CENA 1O37A 3PM3A 1YPEH 1FN8A 1UK3A 1GBHA 2JH0D 3LPRA 4TY6A 1ZTKA 1TB6H 1PYTD 2OTVA 3B23B 3URCA 1XVMA 4LK4A 2OC0A 2P3TB 3O8DA 1C5OH 4O03A 2R3YA 4Q2KA 3M35A 4AFQA 1AHTH 2SNWA 1NESE 1RD3B 1TNIA 4MNWA 2VB0A 2PV9B 3GY3A 4JYUH 4RKJB 1O3BA 2B7DH 2G4TA 3ZVEA 1V2WT 1BBRK 1O2LA 4Y6DA 2Q6GA 1TABE 2ZU1A 1UK2A 4YESB 5EG4A 1NFWA 3SUEA 3TGKE 2J95A 4Y0YE 5EW2H 1NU7B 3RXKA 2AEIH 1CU1A 1GHBF 3D62A 3S7KB 4GAWA 1ZRKA 4B76A 1SGTA 3A84A 2GD4B 1TX8A 2GVFA 5HM2A 1HJ8A 2HNTF 3BTWE 3NXPA 2BY9X 1WBGB 1S83A 1GCDA 2C4FH 5JB8S 3NKKA 2D1JA 4BAQB 3A7VA 2XBXA 2QXGA 3OX7U 2W26A 1H8DH 2JETB 5EXMA 1GBFA 1QL8A 1IQLA 1ZGVA 4RN6A 1V2UT 1KDQB 3S7HB 1Z8RA 1O2SA 1O5AB 5GDSH 2GV7A 3M5NA 1MUEB 4LZ4B 1XXFA 2GCTB 2FOGA 2GTBA 1O2NA 3Q77A 1GBJA 2B0FA 2EA3A 3CS7A 3FP8E 3PO1C 2P59A 2GMTC 1KYNA 4R8TB 4JZEH 4UDWH 2ZU5A 3SNBA 2XXLA 4JK5A 1UCYH 1HAPH 1AVGH 1HJAB 1JXPA 3P8OA 4KTUA 1O2XA 3PMAB 5DG6A 2ZFQH 1THPB 2J2UA 1MKWK 5E0GA 1BB0B 1GHVH 2ULLA 3C1KA 4E06H 3MTYA 2DE8A 1AWFH 1CT4E 4B2AA 4GPGA 2FI3E 1RXPA 1Z71A 2AMDA 1H8IH 3UR9A 3ZV8A 2GV6A 3OTJE 1DSUA 4O97A 1K1NA 1Y59T 1FY4A 1C5XB 1MMJN 3A7TA 3RU4E 2GT7A 1MU6B 1W0ZU 1FMGA 1KY9A 1HV7A 3V12A 3A87A 1P10A 2BZAA 1DOJA 3GY5A 1Y3WA 5DK1A 3GY6A 3FZZA 1SQOA 1XVOA 1LQDB 3PTBA 1FNIA 5L2YH 3W94A 1H9HE 2AGGX 4UFDH 3LDXH 2BTCE 1C2KA 1S0QA 1SGFA 5F8ZA 3ZZ7A 1BOQA 4YT7H 1W12U 1C5YB 1YF4A 3HGPA 1AMHA 2VWOA 4B1TA 2BLVA 4R0IA 3MHWU 3RXHA 1T32A 1RTKA 1L1JA 4YTAA 3MH6A 3TGIE 1C5SA 3MNBA 3VB6A 3SGAE 1XM1A 2BY8X 1SQTA 1TALA 1P05A 1AE8H 3ZVDA 1DY8A 1YYY1 5B6OA 2BX3A 1OP8A 1IHTH 2ZG0H 3DT0H 3GDUA 3TVJB 1GMHF 2A2QH 8GCHG 2BY6X 1ZJDA 4UD9H 1P2JA 2WYJA 1ZYOA 4KKDA 2A1DB 4BAHB 5DO4H 1OWKA 1GJDB 2Z7FE 3MNXA 4FUHA 3RMOH 2SGEE 2ZA5A 1YM0A 3HK3B 1PPBH 5FPSA 4ZKNU 3PLKA 1O2PA 3SU2A 1YPMH 1MU8B 3MH5A 3GCHC 3MO9A 5DP7A 2A4RA 1A5GH 1SL3A 1D3DB 1EPTA 2FOFA 3U1IB 1NRNH 3PMHB 3GCTF 1QCPA 1ELBA 2QYIA 1GBLA 2SFAA 4FUEA 3P95A 3RXCA 2QY0B 1SGEE 1P01A 1P09A 1W8BH 4HI3A 5FX5A 2ZFRH 1AE5A 2TRMA 2ALVA 1HXEH 1GJ4H 2HWLB 1IQKA 1WTHD 1MTWA 2TIOA 2BQWB 1O3HA 8LPRA 1VGCC 1IAUA 1GI6A 2QXJA 5JBAS 3GICB 5LH8A 2BY5X 5HGGA 2BDIA 1A5IA 1TPAE 4Q80A 1EAUA 4D76A 4XFQA 1CA8B 1AZ8A 4MNXA 1N8OC 3LH3A 3HGNA 3PLBA 4MPVA 3LJOA 1G3CA 1SGIB 3UNRA 1DXPA 3M3TA 1RIWB 3SU1A 8KME2 2R9PA 4JYTA 2BMGB 3QTOH 5IDKA 4FUCA 1GHAF 2NU3E 3RMNH 1A0JA 2QF3A 4LXBH 1P9SA 1EPTC 1TQ0B 1UTPA 1W3CA 2V3OH 4GUXA 2A5IA 4TY7A 3KL6A 4IGDA 1BA8B 4GHTA 4INLA 3V3MA 1YC0A 5C3NA 2BD5A 4Y11E 1ELVA 3NK8A 1GBAA 1BMAA 1CE5A 1O2ZA 2QA9E 1DS2E 2ZU2A 3LC3A 2F9VA 1TRNA 1H4WA 3L6PA 5C1XA 1ACBE 1KLTA 1KTSB 4JCNA 4GCHF 4YLQH 1PFXC 3A86A 4X2XA 1OWDA 4SGAE 1FXYA 1TMBH 4LOYH 4MVNA 3S9AA 1LKBA 1LTOA 1TNJA 4X1PU 3P17H 1YPHE 1QTFA 1BT7A 1JOUB 4TWYA 1AVXA 1RRKA</