2VIPA

Fragment-based discovery of mexiletine derivatives as orally bioavailable inhibitors of urokinase-type plasminogen activator
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTISLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR CHAIN B
publication title Fragment-Based Discovery of Mexiletine Derivatives as Orally Bioavailable Inhibitors of Urokinase-Type Plasminogen Activator
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 60
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2007-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2vipA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2vipA01
4Q7ZA 3SJOA 1C1TA 2VIOA 1ZRKA 1E34B 2PGQB 4GLYA 2WUCA 2B7DH 3FVFB 3RMMH 2A5AA 1HYLA 2EI7A 4DVAU 1O5CB 3SU5A 4UE7H 4AFQA 2CGAA 1GG6C 1ZYOA 2Z6BD 4JK6A 1XVOA 2BDYA 2Y5FA 4WXVA 4IN2A 1K2I1 3CS7A 4A5TS 1HAGE 1P04A 1SL3A 1C1PA 1GMDG 2BLWA 1Y59T 1WUNH 1Y3VA 4MNXA 1HPGA 1QHRB 2CF9H 3BTTE 1CA0C 1TB6H 1TPPA 4Q80A 2FYQA 1UTMA 1LHFH 1SLXB 3WY8A 1V2LT 3SU1A 4LZ4B 4B75A 1FY8E 2HNTE 1RGQA 2C3SA 1NO9H 4HTCH 5JYIA 1GBIA 1H9IE 1UVPA 3NCLA 1P9SA 5FCRA 3UUZA 3GY2A 1HAZB 2ZCHP 1C1RA 5EPYA 1C2KA 1GHAG 3K6ZA 1YLCA 1O3MA 1W12U 2F9NA 3P8OA 3W95A 1QBOA 1O2OA 3ZZAA 1MTNB 2H9TH 2OCVB 1D4PB 3M5OA 3NKKA 1N6YA 3RXCA 4BANB 2VVCA 2QXIA 1NC6A 1D9IA 4IMZA 1TGNA 2FM2A 3F1SB 2Z9GA 1KXFA 1SOTA 2BQWB 3MH4A 2ZGBH 1BRCE 3OY5U 5E0HA 2C4FH 1O3FA 1G36A 2FYRA 4ZXYH 3KHVA 1NRQH 1OWIA 3LC3A 1PPZA 4I8HA 3S7KB 1XUFA 3MU4A 1Z8IB 1XX9A 1E0FD 1HXFH 1LQEA 2VVVA 1EOLA 2JKHA 3L3TA 2VWLA 2WPKS 3SJIA 4X1PU 4ABIA 5K0HA 1IQJA 3TGKE 1SGQE 4NWLA 3ATMA 1GVKB 2CHAC 3ZVBA 3S9CA 1G3CA 1ZGIA 3DFLA 1NROH 4UFEH 2AGGX 4AYYB 2F9VA 4D7GA 1O2SA 3SUFA 3SI4H 4K8BA 2O8UA 2R2WU 5EW2H 1VITF 7LPRA 4ISHH 3UNRA 4GSOA 1ARBA 1MKXH 1K9OE 3BTKE 4Y6DA 4DJZB 3FP7E 3SGQE 2A0QB 1O2TA 2IN2A 1DWBH 2GZ9A 1BUIA 4MPWA 3EA7A 1P11E 3B23B 4WMDA 5LPRA 2J92A 2BDGA 1O2UA 2NU1E 1L1NA 3EYDA 3GCHC 1PPGE 5EQRA 1NRNH 2ZHEH 4TWYA 4CR9A 1TGTA 1P2JA 2FTLE 4FU8A 5E8EH 1BB0B 5EQQA 3CS0A 1LPKB 3A89A 2ZFFH 2GCTB 3A8DA 4NIXA 3P95A 1RIWB 5T3HA 1ETTH 1QBVH 3PYHA 1MKXK 3S69A 6LPRA 1CHOF 2G00A 1NESE 1IQFA 2Z7FE 1TA2A 2NU3E 1Z71A 4CRCA 4X2VA 3A85A 4NIWA 2BDIA 3RXIA 4AFSA 3TJNA 2JETB 3KGPA 1P3EA 3S9BA 1SGEE 2Z94A 1C5MD 3RU4T 1HGTH 1KY9A 2GT7A 2QV1A 4E05H 1ELAA 5EOKA 1BHXF 1EB2A 2BDCA 4KELA 1VJ9U 1XUKA 1A5IA 4I31A 2BVSH 2SGAA 3UNQA 3HKJB 2OD3B 3A8CA 1O3IA 5TCCA 3HKIB 4F49A 3PO1C 1GJ5H 3V13A 1DICA 1QRZA 2PWXA 1VCWA 2FWWA 3QGJA 4JZEH 2RDLA 1DSUA 3RXKA 1ANEA 2H5DA 5FX5A 4X8TH 1HDTH 1KIGH 1HIAB 3SBKA 3M5NA 2NU0E 2VIWA 1A0JA 1FMGA 3NPSA 1CHGA 3SJ8A 5ESBA 2OBOA 1AUTC 1QB6A 2BLOA 4INHA 1C5UA 3BG4C 4YZUA 3RXTA 4ESTE 1C2IA 2BD8A 1UVSH 3SZNA 5DP8A 4NCYA 1S84A 3Q3YA 3BV9B 3BTFE 4I32A 1SGDE 4MVNA 2O9QA 2AFQB 2ZFSA 4IC6A 4DIHH 3VB3A 1O3BA 1NY22 1K1IA 1YYY1 5A8ZA 3UNSA 4ASHA 1E38B 1MZAA 1XUGA 4IN1A 3VXEH 2FOCA 1TIOA 4DY7B 1EASA 2XWBI 1UTNA 2A5IA 1AGJA 1C5PA 3R0FA 3URCA 1EPTB 2ZGJA 4I8JA 1BIOA 1K1MA 5E0GA 1FAKH 2HGTH 1NFUA 4U32A 2FOGA 2FI5E 1UK2A 3GY6A 1KSNA 3BTHE 1ELBA 3LIWA 4I8KA 1EZQA 4TWWA 2PR3A 1EZSC 3SJKA 1ZOMA 1OWHA 1QL8A 1TOCB 1FY5A 3HGNA 3OY6U 2R9PA 1S81A 2QC2A 4B71A 1P12E 1FN6A 1C2MA 4JK5A 1O2HA 1S85A 4GPGA 2SGQE 3MO6A 3P70B 2P8OC 1D6RA 1TRYA 4MNVA 1N6XA 2NWNA 2BQ7B 1ZHPA 2FESH 1F0SA 1O35A 1MTSA 3GDUA 2G81E 4X1QU 1GBBA 4E7RG 3ZVFA 3P8GA 4JMYA 3UTUH 3RLYH 4B2AA 5DKMA 1ZSLA 1EAUA 1SBWA 1FZZA 1MKWH 3HPTB 2BOHB 1V2JT 1W13U 5EW1H 2KAIA 1BTUA 5F8ZA 1DSTA 3EGKH 1HAIH 6CHAC 3K9XB 3E3TA 4XBBA 1GCDA 1O5GH 1SC8U 1YCPH 5HMAA 4NA8A 1KLTA 2J34A 2V3HH 3RXGA 1P57B 3NWUA 4WVPE 1PQ7A 3SV6A 2Y81A 1UK3A 1AWFH 3BTDE 8GCHG 4ZHMU 1ELTA 3O8RA 4QT8C 1TBRH 1Y5UT 1C1VH 2UUJB 1K28D 2HNTC 1SGRE 1NFYA 3GY3A 3MNSA 3P8FA 2SGEE 1O32A 1EJNA 1ZLRA 2P93A 1MKWK 1UVUH 4D9RA 5JBAS 2FOAA 3UPEA 5DP9A 1GI0A 3LGYA 1F92A 3P8NA 5HGGA 3STIA 4AG2A 2ZDNA 5GCHF 1GHXH 4NIVA 4I8LA 1ARCA 3RXBA 1YCPK 1EJAA 2QCYA 2VWOA 1ZMJA 1LDTT 1V2VT 2D8WA 2BY6X 5IDKA 4MQAA 1GJ4H 1JRSA 3GY7A 4BTUB 1ABIH 2TIOA 3FAOA 1WBGB 4Y0YE 1SLVB 1ELGA 4A6LA 4DCDA 2M5TA 3SU6A 3MH7A 5GWZA 1QY6A 3Q77A 4R8TB 2H2ZA 5C2ZA 3ITIA 1SGCA 2ZQ1A 1FDPA 2WPLS 5EQSA 1V3XA 1AE8H 3VPKA 3V12A 4YESB 2ZNKH 4HGCA 3E0PB 4NA9H 2GCHG 3ELAH 2NU4E 1SR5C 4Y8XA 1V2NT 1ZGVA 1GPZA 4MDSA 1LCYA 1E37B 1DVAH 4AZ2B 3KQCA 3A86A 3P17H 2XBVA 5C1YA 1A2CH 4ZH8A 2OC0A 4AOQA 1J15A 2G55A 3U1JB 1G2LA 3UR9A 4AFUA 3RDZA 3UIRA 1AU8A 4FU7A 3W94A 2BDHA 3EE0B 2PKSC 1O33A 1NT1A 1WQSA 4X2XA 1KXBA 4RKOB 1O34A 1Q2WA 3RC4A 2ZI2H 1O2ZA 3RMNH 1VITG 3VGCC 3QTVH 2A7JA 3QZRA 1G3DA 2FI4E 1CE5A 3LGVA 3RXVA 2A32A 1CQQA 2Y6TA 1SQOA 2W7SA 1O3DA 2BX3A 1BTHH 1TFXA 1TWXB 2BB4A 1P8VC 2OC7A 1C4V2 3BIVH 1ELDE 2GMTC 3TGJE 2OINA 1OWKA 1CSOE 4X2WA 3OSYA 2W26A 5ETXA 1EXFA 1MAXA 1C9PA 1T32A 3LU9B 4YLQH 5BPEA 3ZVEA 1K1OA 1GI1A 4FUGA 2ALPA 3RMOH 1QB9A 1EP5A 1O2GH 3MU8A 1T31A 1SGTA 3OU0A 1EQ9A 1EATA 3SV7A 4CBNA 2GD4B 1F5LA 4GAWA 3EA8A 3GDVA 3UOUA 1A3EH 3DHKH 3SU0A 2XRCA 4THNH 4ABEA 1KXCA 2FODA 1TQ0B 5A0AE 3SORA 5HM2A 1W10U 2Z9JA 1DX5M 3F9GA 1OX1A 1VCPA 1ZRBA 2O8WA 1VJAU 3SO3A 1TBZH 4ZHAA 1SQAA 2GZ8A 1HAVB 2SFAA 3KQEA 2ZDVH 3VB6A 1RS0A 3Q00A 3DUXH 1DITH 1FIWA 2Z3EA 4AX9H 1QNJA 1ZR0A 2R3UA 2PKAA 4WWYA 1HAHH 1TNKA 2PFEA 3ESTA 3VXFH 3VB7A 2Z3CA 1SQTA 4VGCC 3UQVA 3UY9A 1YLDA 2BZAA 4ABDA 7KMEH 2VVUA 4BNRA 1UJ1A 1A0HB 1GMHF 4K60A 3DT0H 5GJ4B 4BAMB 5HYOA 1TONA 4TY6A 2A4OA 5FPYA 3PROA 1B0FA 1G3BA 2ZHFH 1DDJA 1EAIA 3RXSA 1TNLA 3ZZ8A 1K1LA 1AFQB 3QGNB 5C5OA 2PSXA 3ZVDA 2CJIA 3A87A 2H9EH 5FX6A 4ISNA 2G51A 8GCHF 3M3TA 1XVMA 2CV3A 5T6GA 3T5FH 3ODDA 5DG6A 1HJ8A 2F91A 1IQIA 3MFJA 2BMGB 5GPIB 1TPOA 1FIZA 3SU4A 2D26C 5A0BA 3T25A 4KKDA 1AVXA 2XC4A 1H9HE 3A7YA 3LJOA 1P06A 4ZKSU 1D3QB 4CRGA 5JBCS 5E2OA 1GHYH 1DS2E 2ILNA 1KLJH 1NU7B 3TNTA 4JYVH 5T6FA 1HAOH 1RFNA 1PYTD 2FI3E 3GYLB 2UWLA 3KIDU 2ODPA 1DT2A 1CBWC 1PJPA 1HXEH 1S82A 2QY0B 3ZYEA 5DP4A 1MZDA 1ESAA 2QAAA 1JIRA 2J9NA 5A09A 2B9LA 3ZZCA 4HFPB 2EEKA 1LHEH 1LMWB 1GI8B 2SNWA 1OWJA 5L2ZH 4K5ZA 1IQMA 1A5HA 1K1NA 1MD8A 1XXFA 2EA3A 3LH3A 2VGCB 4FUJA 1AKSA 2BD4A 2Y82A 1HUTH 1TMUH 3QO6A 2P3TB 3EQ0H 1CA8B 2GCHF 3PB1E 1ANBA 1CU1A 1NU9A 1MBQA 4A92A 5GXPA 4B1TA 2ZKSA 4Y76A 4YOGA 4I33A 1FI8A 1O2RA 1THRH 1CO7E 1RD3B 3BTWE 1BOQA 2Y7XA 2ZU5A 2ZFTA 3UR6A 1FV9A 1P3CA 2OTVA 5DK1A 1DANH 4CREA 1PPCE 2QN5T 1F0RA 1K1JA 1WTHD 2FOFA 2SGFE 4NWKA 1O2QA 3ZV8A 1DPOA 2GDDA 2GV6A 3GCTG 4FUHA 1NM6A 2HOBA 4OGYA 1NTPA 3LONA 2TGAA 1QR3E 1DUEA 2BVXH 1QFKH 1YPHE 1O2YA 4ABBA 1MTUA 1IOEA 3UQOA 1HAPH 1W2KH 3D23A 6GCHG 1PPHE 3GY4A 3ZVCA 1BRUP 1HBTH 1J16A 4Y0ZE 3PMBB 1XKBC 2XBWA 3D62A 3GYMA 5GIBA 5ESTE 3RU4E 1OYTH 1ETRH 1GG6B 2AIQA 2ZPSA 3N7OA 3EAJA 2ZA5A 5GCHG 4CRBA 3MH6A 1EZXC 2XCFA 2BZ6H 3SV2H 4H6TA 1UO6A 2BLQA 1N8OC 4XFQA 1Q31A 1CGHA 1PQ5A 4XOJA 5AF9H 1O3NA 4Y7AA 1QQ4A 1SHYA 1EAXA 4ABAA 2BX4A 1CA0B 2BD9A 3LJJA 1Z1IA 4FUIA 1XUHA 2DUCA 3TH2H 3HK3B 4ABHA 5CHAC 4DG4A 1FLEE 3KEEA 5G4BA 5C1UA 1OP0A 1J17T 3RXQA 1CGIE 1GDQA 2I6SA 1HFDA 3RXPA 1WV7H 3F68H 1CBWB 1OYQA 1UTPA 2FS8A 1JMOH 1GL1A 1SI5H 1HJAC 3PTNA 3S7HB 2WPIS 4ZMAH 1ZJDA 4RKJB 3T62A 4GHTA 3SU2A 5L6NH 1DM4B 5EU8A 3PV4A 1OP8A 3LKWA 2B0FA 1HLTH 1BJUA 5JBTA 4HI3A 1BCUH 5DJ7A 1HCGA 2DE8A 2H9HA 1S6FA 1TGSZ 2PTNA 4MTBA 3SHAH 3OYPA 1YP9A 1NFWA 3RXEA 2BYAX 1TYNA 4A1XA 9LPRA 4ISOA 5B6OA 1TAWA 2ZIQH 2ANMH 4WJG2 3BN9A 1SMFE 3F9FA 2BLVA 3A82A 2BY9X 2QYIA 2AH4X 4UD9H 4UFFH 2WUBA 2BXUH 3TLOA 1KDQB 3H7OA 1UHBB 1DUAA 2FLBH 1TNGA 2FS9A 2EI6A 4BAOB 3ZZ4A 4CHAC 3BTEE 2STBE 2ZDLA 2CHAB 5FBIA 3A8BA 3AASA 3KNXA 3AVZA 1ETSH 1P2KA 3UOPA 5JPMH 3KL6A 2RA0A 2FP7B 4O3TA 1SB1H 3TVJB 1C2JA 1XUIA 3ATKA 1OWEA 2BQ6B 4CBOA 2C93B 4B2BA 5DP7A 1QURH 3NK8A 3RXLA 4FU9A 4NIYA 2ANKH 2VIVA 4UFGH 5DP5A 1PQ8A 1XUJA 3SN8A 1P0SH 2ZTYA 3SUGA 1DE7H 2H6MA 1AB9C 1DWCH 1XXDA 3GCHB 4JZIA 4X1NU 1GBHA 1RXPA 2FTMA 4IC5A 1QIXB 1ELFA 1N8OB 1V2RT 2PUXB 1UMAH 2F3CE 4UDWH 1C2EA 1GGDC 1EP6A 2TRMA 4LOYH 2AEIH 4DT7B 3HGPA 3PWCA 3MU5A 4LXBH 1T4UH 1DLEA 1FAXA 4Z6AH 1F7ZA 3MYWA 1TPSA 3ODFA 4JYTA 4K1SA 4DIIH 1FY4A 3A83A 4TYDA 1W7XH 3MTYA 4XE4A 1O5FH 3VB5A 3A7TA 2ZU1A 1CT2E 4WMFA 4O3UA 5A0CA 1VITH 1HIAA 3M36A 1YPJH 2FLRH 4CRDA 4D8NA 1P9UA 1QRXA 2GX4A 1GDUA 3BIUH 1Y8TA 1TALA 3AAVA 2P59A 1O5DH 1ID5H 1GMHG 1WAYB 1ANDA 2OC1A 1AO5A 1TRNA 1O2IA 2O8TA 1GCTC 3GCOA 3M7QA 3O8BA 5HXFA 1O31A 1O5AB 1SFQB 4Y7BA 4NA7A 1GJCB 3PLBA 2WPHS 1DLKB 1ESBA 4ZKRU 3PO1B 4O9VA 1BBRE 2QIQA 3GY8A 1TABE 1AMHA 1O30A 2VNTA 2ZDKA 3GCTF 3L33A 5EG4A 3SNBA 1A46H 2W3IA 3ZVAA 4KP0A 1DFPA 1D3DB 1V2TT 4SGBE 1FN8A 3TJVA 2VWMA 1JWTA 1BTZA 1HJ9A 1XMNB 1Z6JH 5C20A 1IQHA 3A7VA 2OP9A 3TIUA 3BG4B 2AMPA 4FUFA 1ZPZA 1IHSH 1BMAA 1NRPH 1C1QA 6GCHF 4ZROA 3FP6E 1EPTA 4ZHLU 3A80A 1WTGH 1DY8A 2ZG0H 1DWEH 3U8TH 5FPSA 4D7FA 5EXNA 3DD2H 4NZLA 2WPJS 1KXAA 3AAUA 1W0ZU 3STJA 1A3BH 2BHGA 2IJOB 3T29A 4M7GA 1P2MA 1LHDH 3TK5A 2ZDMA 4AORA 5EPNA 5C1XA 3UREA 2XW9A 4WH8A 1O2WA 1TMBH 2A5KA 1MQ5A 5TCAA 1AB9B 2ZHWH 1ZSKA 1HB0B 2EC9H 4J2YB 1GBJA 1O38A 1O2KA 2UUKB 3BTGE 1L0ZA 1WYKA 4NSVA 3ZZBA 4FUCA 4B76A 5FCKA 1O39A 1EJMA 1WOFA 5H4IB 3U8RH 3UWIA 2A2XH 4SGAE 1GHBG 4FUEA 1A1RA 2TGPZ 4GHQA 1C2GA 1C5LH 2TPIZ 4E06H 1JBUH 3T2NA 4JZDH 3QWCH 1BMLA 2ODQA 1O2JA 4R0IA 3RC6A 1C9TA 1GBCA 4AB8A 1YGCH 1U6QA 4ZAEA 2PSYA 4YLUA 2P8OB 3SV9A 1XKAC 4BOHA 1W0YH 4Y8ZA 1GBMA 1GJAB 2RG3A 1O2PA 1GMCG 1TNHA 4TY7A 4IW4E 1YPHC 2EI8A 4X6MA 1C5ZB 4E7NA 3R3GB 2SNVA 1IQGA 1YPMH 3P92A 3MOCA 3TK9A 5F8XA 1L2EA 3PMAB 4DW2U 5T6DA 2JH5D 2V3OH 2Y5HA 1ZTKA 3T28A 1C1MA 2QXGA 3IWMA 6CHAB 1YC0A 3BTME 1ANCA 1SGYE 4H4FA 1O3LA 1T8MA 5F03A 1VCQA 5ABWA 2XWAA 3OX7U 2ESTE 4FVDA 1YM0A 2FPZA 1TOMH 4GCHF 1O2LA 3V3MA 2R3YA 2SGDE 3RXAA 4X8VH 4U2WA 1WQVH 1F2SE 1CT0E 4YO9A 4ISIH 4KTSA 4K1TA 1AQ7A 3GDSA 1FNIA 1TNIA 2HVXA 1MBMA 3TH3H 3SNEA 3I77A 1V2OT 1IQKA 2ALVA 2ODYB 5EXMA 1OOKB 2AERH 2CMYA 1MD7A 4TPIZ 2ZTXA 5I25A 4MG3A 2GVFA 2SGPE 2XTTB 4X1SU 5LGOA 1LPZB 1C5RA 3ATIA 3PTBA 1SSXA 3GCNA 3ZZDA 1ELCA 2BD5A 2QXJA 3RLWH 6ESTA 1ABJH 3FZZA 4DOQA 2D1JA 1BQYA 2PV9B 3B8JA 1GHVH 1GI3A 1J14A 1B0EA 4AG1A 1ZPCA 1DXWA 4DGJA 3E90B 2G5VA 4AYVB 1H8DH 2FO9A 4K69A 1FONA 2Y80A 3BEIB 1ZTLA 2V6NA 1FPCH 4K2YA 1KXEA 1SGIB 1D3TB 1A0LA 1YBWA 1YPLH 2AGEX 1QL9A 1KTTB 1MTNC 1QGFA 5K7RA 4B73A 2J94A 1PFXC 1S0QA 1PYTC 1V2ST 3JZ1B 2ZU3A 1FY3A 3GISB 2GV7A 4WH6A 3A88A 4NSYA 2P3FH 1DWDH 3SNDA 1EOJA 1JXPA 1QB1A 4H6SB 3A8AA 1GI6A 4X2YA 2PGBB 3QDZB 5FAHA 4ZKOU 4Q7YA 2A31A 5CE1A 5DGJA 1A5GH 1NPMA 1WCZA 2P94A 4NZQA 1T8OA 3ZZ6A 1NN6A 3C1KA 2GGVB 3Q76A 2TBSA 2ZQ2A 1A7SA 4LK4A 4YM9A 3NUMA 4X8SH 1ZMLA 1F5KU 5TJXA 3A84A 1GJ9B 2Y7ZA 2FIRH 1AZZA 1J9CH 2J2UA 5J4QA 4DURA 5I46H 4XDEA 1FUJA 1AIXH 1SGFG 2PUQH 2ZFRH 3E91A 1AZ8A 1JRTA 4IS5A 2PKSB 3SQEE 1O2VA 2F9OA 3LGUA 1TBQH 3M3SA 1AHTH 3QK1A 3VGCB 1GHWH 1HNEE 4X1RU 1UCYE 1E36B 1OP2A 1D3PB 1BRBE 2DE9A 1HV7A 2UWPA 3U98H 1QJ7B 4BAKB 3M7UA 5FXLA 1C1SA 1GI9B 4AGJA 1H8IH 2VINA 1GBLA 4BAHB 1NFXA 3RXFA 1AFEH 2VJ1A 1BT7A 3D49H 2PHBA 1T8NA 2GMTB 2VIPA 2BXTH 1THPB 4YT6H 1SGPE 3MNXA 1C1OA 1VR1H 2W7UA 3LDXH 4Y8YA 1LHGH 4BTIB 5A8XA 2FOBA 2FOMB 2TGTA 4I7YH 2THFB 1HAVA 2WYGA 2ZEBA 1FQ3A 4MLFB 4HZHA 1C4U2 1NRRH 1MQ6A 1KLIH 3SQHE 1BRAA 1TGBA 4TPYA 3SUDA 2GCTC 1BBRH 1RIWC 7ESTE 1YF4A 2FOEA 2R0KA 2FXRA 1LKBA 4U01A 5EXLA 1H1BA 5AVDA 7GCHG 1MTVA 4X8UH 1GJBB 1QTFA 2O8MA 2YNAA 2AGIX 3ATWA 2CXVA 3TJOA 2K1QA 1P02A 1SGFA 3TITA 1G3EA 1GHBF 1Y3YA 4IGDA 4KGAA 1C5OH 1W3CA 2JETC 4K1EA 5LH8A 4JZFH 3A7WA 2BOKA 1ZJKA 3KQBA 2ZFQH 1DXPA 3B9FH 1C5QA 1JIMA 2Z9LA 1TX8A 1GJ6A 1MMJN 2HRVA 4IBLH 1ORFA 3SNAA 3S0NA 1C5TA 1ELEE 3I29A 2P16A 2G4UA 3MNCA 3M35A 3IITA 1GMCF 2ZWLH 1AY6H 1IHTH 5E2PA 1BBRK 1MAYA 2ZCKP 2PTCE 3G01A 4VGCB 1S83A 1A4WH 4RSPA 2C8ZB 2O8LA 1V2MT 2C90B 3NXPA 4AN7A 1UVTH 1CT4E 2G4TA 1RRKA 3BF6H 5FBEA 4D9QA 3BEUA 1OXGA 1TRMA 3RXOA 1ZMNA 8ESTE 1LVMA 1C1NA 2BVRH 1GI5A 3BG8A 1C1UH 2F9UA 3RXJA 1VGCC 1TA6A 4OS1A 3F6UH 1JOUB 5IYTA 1LPGB 1O3HA 2D2DA 3U8OH 1S5SA 1DY9A 1CVWH 2R0LA 2Z9KA 3MNBA 3LT3A 1Z6EA 1VZQH 5CMXH 2GP9B 4Y79A 1Y3XA 2OUAA 1BZXE 5C3NA 2HLCA 4ZKNU 2FOHA 3MU1A 2ZGHA 1QQUA 1AVGH 3QLPH 1O3KA 2VIDA 2JH0D 3V7TA 1V2KT 4I8GA 1K22H 3MO3A 5AFZH 1AUJA 2XCNA 2XC0A 1S6HA 1NZQH 1GL0E 3PMJA 1T8LA 2G52A 1AVWA 2ZGXH 3MH5A 4X6PA 1O2NA 1HAXB 3M3VA 1LHCH 2HNTF 5FHTA 1QL7A 1Z8RA 2Q6GA 3RM2H 4CH2B 1MU6B 3GICB 1QA0A 1QJ6B 1EPTC 4XSKU 4KTUA 2LNCA 1W7GH 1L4ZA 1H4WA 4X6NA 3M5MA 3V0XA 3F9HA 1SPJA 1J8AA 4Y11E 5A8YA 1W14U 2F9PA 2A45B 1IQEA 2AIPA 1BDAA 1ESTA 1W8BH 2YOLA 3QZQA 3SHCH 1Y5BT 1Z8JB 3RXMA 2A4RA 1LQDB 3CP7A 3U9AH 3EA9A 1C2LA 4GUXA 3ENSB 1Q3XA 5JBBS 2FZZA 2ZECA 2ANYA 2TGDA 1PPEE 3LGIA 4YOIA 1V2PT 3SNCA 2BD3A 4WF8A 2BDAA 1AWHB 1EUFA 4LZ1H 2ZU4A 2Q6FA 1P2IA 5L2YH 2QGRA 2XBYA 2BTCE 4MPUA 2VH6A 4NGAH 1ZPBA 1B5GH 5AFYH 4BXWA 4NFEA 1P03A 3PLKA 2RA3A 3BSQA 4CRAA 3A7ZA 1CGJE 5C67A 1V2QT 4MNYA 2V0BA 1Y5AT 1AN1E 2STAE 5C5NA 3Q3KA 1QCPA 5GDSH 2B8OH 2ZF0H 1UTKA 1AD8H 1TPAE 1O36A 4GCHG 1O3PB 1EKBB 4MNWA 1RTLA 2VB0A 3M37A 3RXRA 1O0DH 3QTOH 1MCTA 5JB8S 2A7HA 4GVUA 4B2CA 1C5YB 2Y5GA 1HRTH 4JZ1A 2VU8E 3RM0H 1VGCB 3M7TA 3MHWU 1BA8B 3E8LA 1PPBH 4OS2A 1KYNA 1W11U 1NRSH 2KAIB 1SLWB 1Z8GA 2HALA 4AFZA 1P2OA 3SOSA 3TJUA 4OS6A 2WV5A 3QX5H 1GJ8B 1KTSB 1O3JA 1SOZA 2ZDAH 3KCGH 4OS7A 3MO9A 3LGTA 1GHZA 3SGBE 4XBDA 4AGKA 3HK6B 1GMDF 3JZ2B 2XBXA 1TNJA 2GKVE 3LC5A 2PW8H 4JYUH 3KQDA 5F8TA 1TQ7B 1A61H 3TH4H 1FXYA 5CHAB 4Q2KA 1P09A 4K8YA 1UK4A 1GBAA 2Z9IA 3RXUA 1G37A 1AE5A 3EDXB 2GT8A 1GJDB 1H9LB 2ZCLP 4MPVA 1UTLM 4ZUHA 4Y10E 1GI7B 1HJAB 1KXDA 4CRFA 2J4IA 3QUMP 3RP2A 7GCHF 1SG8B 5AHGH 2UWOA 1BMNH 1EAWA 4K3JA 1UCYH 3SW2B 2BD2A 4FUDA 1GHAF 1C2HA 4O03A 9ESTA 2XNIA 3UWJH 4ISLA 3ZZ3A 1GWAA 4UFDH 2OQUA 3K65B 1KDQA 1GBTA 1UHBA 5FPTA 2FX6A 1OWDA 1G32B 4J1YA 4OGXA 3GY5A 2ZP0H 5DO4H 1IQLA 1K21H 3OTJE 1AI8H 1SHHB 3SUEA 3RXHA 1BTPA 2B5TB 1FPHH 1LVYA 1WSSH 1ACBE 1YCPM 5DP6A 4YOJA 1Y3UA 4BAQB 3VFEA 2W3KA 2ZU2A 2OXSA 2FEQH 1GBDA 1IQNA 3BTQE 3M5LA 3VEQB 1O2XA 1UCYK 3MMGA 4FUBA 2BY7X 1N1LA 1P10A 2JH6D 1SLUB 3ZVGA 3AW1A 1TX7A 1L4DA 3PWBA 4Q7XA 4NFFA 2XC5A 2NU2E 1SVPA 1YPKH 2ZZUH 1V2UT 1V2WT 1TX6A 4CHAB 3RC5A 4NG9H 1F5RA 2Q6DA 1P2NA 2A7CA 1TE0A 2J38A 3TU7H 1P05A 3SGAE 2F83A 3O8CA 1C5WB 2RCEA 1T4VH 3LGWA 4X6OA 1V6DA 3E6PH 2ZHQH 1K1PA 1OS8A 5HM9A 2GDEH 5DPAA 1LVOA 1BJVA 1QA7A 2XYAA 1QRWA 1Y3WA 2CF8H 4XBCA 3UFAA 2VIQA 1EB1H 4UEHH 2IPHA 3MI4A 3RMLH 1C5SA 1G30B 1P2QA 3SJ9A 2G5NA 4ABJA 3GOVB 1OKXA 5E0JA 8KME2 2A4GA 3LOXA 2A2QH 1ZTJA 3E16B 3O8DA 1GGDB 1BTWA 2GZ7A 3VB4A 3U1IB 1UTJA 1RTKA 1G9IE 1BMMH 2VWNA 3P6ZB 2ULLA 4A1TA 3MWIU 1C5VA 2P3UB 1SFIA 2FDAA 3SI3H 3MU0A 1MH0A 2P95A 4INLA 4ABGA 1C5XB 1SGNE 2OBQA 2VH0A 1D6WA 2C8YB 3TNSA 4BTTB 2W5EA 3ZZ9A 1GJ7B 2QF3A 3E1XB 2OLGA 1THSH 1XM1A 2WV4A 5A2MH 5BRRE 1F0TA 2HWLB 4BXSA 1ZHMA 1ELVA 2PLXA 2AMQA 1ZZZA 3RXDA 4FVBA 3U69H 2C8WB 2WINI 3DA9B 1RTFB 1EX3A 2ZC9H 4PROA 1OPHB 1TLDA 2CN0H 3S9AA 2Q1JA 3C27B 4WXIA 5EGMA 3RUOA 1O2MA 2FMJA 1LO6A 2BM2A 3FZDA 4UONA 1GBEA 3ZV9A 2YNBA 3QN7A 1GCTB 3LH1A 2WPMS 1HAYB 1O3GA 2ZPRA 1YPEH 2A1DB 3A81A 1MU8B 3KF2A 4OS5A 4IMQA 1PPFE 1L1GA 3ATLA 3IG6B 1TGCA 4Y71A 5L30H 2R2MB 1YPGH 1QJ1B 2ANWA 4O97A 4A1VA 4H42U 8LPRA 1AFQC 3HATH 3ZYDA 1B7XB 1GVZA 2PKAB 1O3OA 3PM3A 1E35B 1LTOA 1O5BB 1C2DA 5PTPA 1C4Y2 2BDBA 2QXHA 2V35A 1WU1A 4MPXA 1X7AC 2HPQH 4F4OC 2C8XB 3M61U 4ZXXH 3ZZ7A 1MTWA 3L6PA 3TK6A 3Q3XA 2ZO3H 4AB9A 3PMHB 5SGAE 4Z0KA 2ZFPH 5DP3A 4YT7H 3FFGA 2I6QA 2H5CA 1LVBA 2F9BH 3A7XA 2QA9E 3BEFB 1DOJA 4ABFA 4X0WU 2ZGCA 3CENA 4KTCA 1GDNA 1P01A 1BITA 1UVOA 4CH8B 4WMEA 1ZSJA 4WY3A 3AW0A 5EODA 3T27A 3LPRA 3FANA 4YTAA 3TPIZ 3FP8E 2QF0A 3NZIA 2FX4A 2OQ5A 5J4SA 1FY1A 4OS4A 2IOTA 1CHOG 1C1WH 5JDUB 3H5CB 1FJSA 3ZZ5A 5LPFA 1NS3A 1O3AA 1INCA 1TMTH 2UUYA 1BHXB 2H1UA 2BD7A 2XXLA 5LPEA 2ZTZA 1GBFA 2VGCC 1GI2A 3SU3A 1ZHRA 4RN6A 1M9UA 1O3EA 1S0RA 1LKAA 2AMDA 1GI4A 2UUFB 1G2MA 4CR5A 1YKTA 3D65E 1IAUA 1L1JA 5JB9S 2A4QA 4D76A 3RU4D 2HPPH 2WYJA 1C5NH 4INKA 3SV8A 2AYWA 3PLPA 3I78A 2J95A 1T7CA 3E0NB 3KN2A 1O3CA 3K6YA 1O5EH 2Z3DA 3URDA 1GVLA 1OSSA 1PQAA 2ZHDA 3H7TA 4JCNA 1EZUC 1GBKA 1Z1JA 1UTQA 2AS9A 4B74A 4A7IB 2GTBA 2BY5X 3TGIE 1AKSB 3DFJA 1MCVA 1QBNA 1C2FA 3K2UA 1BTYA 1UTOA 2ZPQA 2G8TA 4U30A 3T26A 1MUEB 4FXGH 2ASUB 3F9EA 1F0UA 1Z7KA 1BTXA 1RJXB 2LPRA 2OC8A 1O37A 5F6MA 2BY8X
chains in the Genus database with same CATH superfamily
4Q7ZA 3SJOA 1C1TA 2VIOA 1ZRKA 1E34B 2PGQB 4GLYA 2WUCA 2B7DH 3FVFB 3RMMH 2PP6A 3EE7A 2A5AA 1HYLA 2EI7A 4DVAU 1O5CB 3SU5A 4UE7H 4AFQA 2CGAA 1GG6C 1ZYOA 2Z6BD 4JK6A 1XVOA 4B6EA 2BDYA 2Y5FA 4WXVA 4IN2A 1K2I1 3CS7A 4A5TS 1HAGE 1P04A 1SL3A 1C1PA 1GMDG 3W1EA 2BLWA 1Y59T 1WUNH 1Y3VA 4MNXA 1HPGA 1QHRB 2CF9H 3BTTE 1CA0C 1TB6H 1TPPA 4Q80A 2FYQA 1UTMA 1LHFH 1SLXB 3WY8A 1V2LT 3SU1A 4LZ4B 4RI0A 4B75A 1FY8E 2HNTE 1RGQA 2C3SA 1NO9H 4HTCH 5JYIA 1GBIA 3CNRA 1H9IE 1UVPA 3NCLA 1P9SA 5FCRA 3UUZA 3GY2A 1HAZB 2ZCHP 1C1RA 5EPYA 2RFKC 1C2KA 1GHAG 3K6ZA 1YLCA 1O3MA 3AK5A 1W12U 2F9NA 3P8OA 3W95A 1QBOA 1O2OA 3ZZAA 1MTNB 2H9TH 2OCVB 1D4PB 2KCOA 3M5OA 3NKKA 1N6YA 3RXCA 4BANB 2VVCA 2QXIA 1NC6A 3F2GA 1D9IA 4IMZA 1TGNA 2FM2A 3F1SB 2Z9GA 1KXFA 1SOTA 2BQWB 3MH4A 2ZGBH 3UAIC 1BRCE 3OY5U 5HIZA 5E0HA 2C4FH 1O3FA 1G36A 2FYRA 4ZXYH 3KHVA 1NRQH 1OWIA 3LC3A 4YXWD 1PPZA 4I8HA 3S7KB 1XUFA 3MU4A 1Z8IB 1XX9A 1E0FD 1HXFH 1LQEA 2VVVA 1EOLA 5EIYA 2JKHA 3L3TA 2VWLA 2WPKS 3SJIA 4X1PU 5HKKD 4ABIA 5K0HA 1IQJA 3TGKE 1SGQE 4NWLA 3ATMA 1GVKB 2YMSB 2CHAC 3ZVBA 3S9CA 1G3CA 1ZGIA 3DFLA 1NROH 4UFEH 2AGGX 4AYYB 2F9VA 4D7GA 1O2SA 3SUFA 3SI4H 4K8BA 2O8UA 2R2WU 5EW2H 4XRNA 1VITF 7LPRA 4ISHH 3UNRA 4GSOA 1ARBA 1MKXH 1K9OE 3BTKE 4Y6DA 4DJZB 3FP7E 3SGQE 2A0QB 1O2TA 2IN2A 1DWBH 2GZ9A 1BUIA 4MPWA 3EA7A 1P11E 3B23B 4WMDA 5LPRA 2J92A 2BDGA 1O2UA 2NU1E 1L1NA 3EYDA 3GCHC 1PPGE 5EQRA 1NRNH 2ZHEH 4TWYA 4CR9A 1TGTA 5GNDA 1P2JA 2FTLE 4FU8A 5E8EH 1BB0B 5EQQA 3CS0A 1LPKB 3A89A 2ZFFH 2GCTB 3A8DA 4NIXA 3P95A 1RIWB 5T3HA 1ETTH 1QBVH 3PYHA 1MKXK 1K0HA 3S69A 6LPRA 1CHOF 1E79D 2G00A 1NESE 1IQFA 2Z7FE 1TA2A 2NU3E 1Z71A 4CRCA 4X2VA 3A85A 4NIWA 2BDIA 3RXIA 4AFSA 3TJNA 2JETB 4TSFD 3KGPA 1P3EA 3S9BA 1SGEE 2Z94A 1C5MD 3RU4T 1HGTH 1KY9A 2GT7A 2QV1A 3DCLA 4E05H 1ELAA 5EOKA 1BHXF 1EB2A 2BDCA 4KELA 1VJ9U 1XUKA 1A5IA 4I31A 2BVSH 2GJGA 2SGAA 3UNQA 3HKJB 2OD3B 3A8CA 1O3IA 5TCCA 3HKIB 4F49A 3PO1C 1GJ5H 3V13A 1DICA 1QRZA 2PWXA 1VCWA 2FWWA 3QGJA 4JZEH 2RDLA 1DSUA 3RXKA 1ANEA 2H5DA 5FX5A 4X8TH 1HDTH 1KIGH 1HIAB 3SBKA 3M5NA 2NU0E 2VIWA 1A0JA 1FMGA 3NPSA 5C94A 1CHGA 3SJ8A 5ESBA 2OBOA 1AUTC 1QB6A 2BLOA 4INHA 1C5UA 3BG4C 4YZUA 3RXTA 4ESTE 1C2IA 2BD8A 1UVSH 3SZNA 5DP8A 4NCYA 3F2FA 1S84A 3Q3YA 3BV9B 3BTFE 4I32A 1SGDE 1H8ED 4MVNA 2O9QA 2AFQB 2ZFSA 4IC6A 3F2HA 5B6LA 4DIHH 3VB3A 1O3BA 1NY22 1K1IA 1YYY1 5A8ZA 3UNSA 4ASHA 1E38B 1MZAA 1XUGA 4IN1A 3VXEH 2FOCA 1TIOA 4DY7B 1EASA 2XWBI 1UTNA 2A5IA 1AGJA 1C5PA 3U28C 3R0FA 3URCA 1EPTB 2ZGJA 1QZ8A 4I8JA 1BIOA 1K1MA 5E0GA 1FAKH 2HGTH 1NFUA 4U32A 2FOGA 2FI5E 1UK2A 3GY6A 1KSNA 3BTHE 1ELBA 3LIWA 4I8KA 2JIZD 1EZQA 4TWWA 2PR3A 1EZSC 3DSGA 3SJKA 1H8HD 1ZOMA 1OWHA 1QL8A 1TOCB 2HVYB 1FY5A 3HGNA 3OY6U 2R9PA 1S81A 2QC2A 4B71A 1P12E 1FN6A 1C2MA 4JK5A 1O2HA 1S85A 4GPGA 2SGQE 3MO6A 3P70B 2P8OC 2J98B 1D6RA 1TRYA 4MNVA 1N6XA 2NWNA 3VG8A 2BQ7B 1ZHPA 2FESH 1F0SA 1O35A 2KCAA 1MTSA 3GDUA 2G81E 4X1QU 1GBBA 4E7RG 3ZVFA 3P8GA 4JMYA 3UTUH 3RLYH 4B2AA 5DKMA 1ZSLA 1EAUA 1SBWA 1FZZA 1MKWH 3HPTB 2BOHB 1V2JT 1W13U 5EW1H 2KAIA 1BTUA 5F8ZA 1DSTA 3EGKH 1HAIH 6CHAC 3K9XB 1OHHD 3E3TA 4XBBA 1GCDA 1O5GH 3MQKC 1SC8U 1YCPH 5HMAA 4NA8A 1KLTA 2J34A 2V3HH 3RXGA 1P57B 3NWUA 4WVPE 1PQ7A 3SV6A 2Y81A 1UK3A 1AWFH 3BTDE 8GCHG 4ZHMU 1ELTA 3O8RA 4QT8C 1TBRH 1Y5UT 1C1VH 4B6FA 2UUJB 1K28D 2HNTC 1SGRE 1NFYA 3GY3A 3MNSA 3P8FA 2SGEE 1O32A 2AHME 1EJNA 1ZLRA 2P93A 1MKWK 1UVUH 4D9RA 5JBAS 2FOAA 3UPEA 5DP9A 1GI0A 3LGYA 1F92A 3P8NA 5HGGA 3STIA 4AG2A 2ZDNA 5GCHF 1GHXH 4NIVA 4I8LA 1ARCA 3RXBA 1YCPK 1EJAA 2QCYA 2VWOA 1ZMJA 1LDTT 1V2VT 2D8WA 2BY6X 5IDKA 4MQAA 1GJ4H 1JRSA 3GY7A 4BTUB 1ABIH 2TIOA 3FAOA 2CK3D 1WBGB 4Y0YE 1WXRA 1SLVB 1ELGA 4A6LA 4DCDA 2M5TA 3SU6A 3MH7A 5GWZA 1QY6A 3Q77A 4R8TB 2H2ZA 1W0KD 5C2ZA 3ITIA 1SGCA 2ZQ1A 1FDPA 2WPLS 5EQSA 1V3XA 1NBME 4RT0A 1AE8H 1E1RD 3VPKA 3V12A 4YESB 2ZNKH 4F55A 4HGCA 3E0PB 4NA9H 2GCHG 3ELAH 2NU4E 1SR5C 4Y8XA 1V2NT 1ZGVA 1GPZA 4MDSA 1LCYA 1UW7A 1E37B 1DVAH 4AZ2B 3KQCA 3A86A 3P17H 2XBVA 5C1YA 1A2CH 4P02A 4ZH8A 2OC0A 4AOQA 1J15A 2G55A 3U1JB 1G2LA 3UR9A 4AFUA 3RDZA 3UIRA 1AU8A 4FU7A 3W94A 2F4LA 2BDHA 3EE0B 2PKSC 1O33A 1NT1A 1WQSA 4X2XA 1KXBA 4RKOB 1O34A 1Q2WA 3RC4A 2ZI2H 1O2ZA 3RMNH 1VITG 3VGCC 3QTVH 2A7JA 3QZRA 1G3DA 2FI4E 1CE5A 3LGVA 3OEED 3RXVA 2A32A 1CQQA 2Y6TA 1SQOA 2W7SA 1O3DA 2BX3A 1BTHH 1TFXA 1TWXB 2BB4A 1P8VC 1COWD 2KX4A 2OC7A 1C4V2 3BIVH 1ELDE 2GMTC 3TGJE 2OINA 1OWKA 1CSOE 4X2WA 3OSYA 2W26A 5ETXA 1EXFA 1BMFD 1MAXA 1C9PA 1T32A 3LU9B 4YLQH 5BPEA 3ZVEA 1K1OA 1GI1A 3N7EA 4FUGA 2ALPA 3RMOH 1QB9A 1SKYE 1EP5A 1O2GH 3MU8A 1T31A 1SGTA 3OU0A 1EQ9A 1EATA 3SV7A 4CBNA 2GD4B 1F5LA 4GAWA 3EA8A 3GDVA 3UOUA 1A3EH 3DHKH 3SU0A 2XRCA 4THNH 4ABEA 1KXCA 2FODA 1TQ0B 5A0AE 3SORA 5HM2A 1W10U 2Z9JA 1DX5M 3F9GA 1OX1A 1VCPA 1ZRBA 2O8WA 1VJAU 3SO3A 1TBZH 2IPQX 4ZHAA 1SQAA 2GZ8A 1HAVB 2SFAA 3KQEA 2ZDVH 3VB6A 1RS0A 3Q00A 3DUXH 1DITH 3KYFA 1FIWA 2Z3EA 2XOKD 4AX9H 1QNJA 1ZR0A 2R3UA 2PKAA 4WWYA 1HAHH 1TNKA 1W0JD 2PFEA 3ESTA 3VXFH 3VB7A 2Z3CA 1SQTA 4VGCC 3UQVA 3UY9A 1YLDA 2BZAA 4ABDA 2VBCA 2VVUA 4BNRA 7KMEH 1UJ1A 1A0HB 1GMHF 4K60A 3DT0H 5GJ4B 4BAMB 5HYOA 2KR7A 5EJLA 1TONA 4TY6A 2A4OA 5FPYA 4Q63A 3PROA 1B0FA 1G3BA 2ZHFH 1DDJA 1EAIA 3RXSA 1TNLA 3ZZ8A 1K1LA 1AFQB 3QGNB 5C5OA 2PSXA 2QF4A 3ZVDA 2CJIA 3FN8A 3A87A 2H9EH 5FX6A 4ISNA 2G51A 8GCHF 3M3TA 1XVMA 2CV3A 5T6GA 3T5FH 3ODDA 5DG6A 1HJ8A 2F91A 1IQIA 3MFJA 2BMGB 5GPIB 1TPOA 1FIZA 3SU4A 2D26C 5A0BA 3T25A 4KKDA 1AVXA 2XC4A 1H9HE 3A7YA 3LJOA 1P06A 4ZKSU 1D3QB 3FO8D 4CRGA 5E2OA 1GHYH 1DS2E 5JBCS 2ILNA 1KLJH 1NU7B 3TNTA 4JYVH 5T6FA 1HAOH 1RFNA 1PYTD 2FI3E 3GYLB 2UWLA 3KIDU 2ODPA 1DT2A 1CBWC 2WZQA 4TT3D 1PJPA 1HXEH 1S82A 2QY0B 3ZYEA 5DP4A 1MZDA 1ESAA 2QAAA 1JIRA 2J5UA 2J9NA 5A09A 2B9LA 3SYJA 5C0TA 3ZZCA 4P00A 4HFPB 2EEKA 1LHEH 1LMWB 1GI8B 2SNWA 1OWJA 4OM9A 5L2ZH 4K5ZA 1IQMA 2KFWA 1A5HA 1K1NA 1MD8A 1XXFA 2EA3A 3LH3A 2VGCB 4FUJA 1AKSA 1SQRA 2BD4A 2Y82A 1HUTH 1TMUH 3QO6A 2P3TB 3EQ0H 1CA8B 2GCHF 3PB1E 1ANBA 1CU1A 1NU9A 1MBQA 4A92A 2YMSD 5GXPA 4B1TA 2ZKSA 4Y76A 4YOGA 4I33A 1FI8A 1O2RA 1THRH 2LP6A 1CO7E 1RD3B 3BTWE 1BOQA 2Y7XA 2ZU5A 2ZFTA 5DN6D 3UR6A 1FV9A 1P3CA 2OTVA 5DK1A 1DANH 2QE7D 4CREA 1PPCE 2QN5T 1F0RA 1K1JA 1WTHD 2FOFA 2SGFE 4NWKA 1O2QA 3ZV8A 1DPOA 2GDDA 2GV6A 3GCTG 4FUHA 1NM6A 2HOBA 4OGYA 1NTPA 3LONA 2TGAA 1QR3E 1DUEA 2BVXH 1QFKH 1YPHE 1O2YA 4ABBA 1MTUA 1IOEA 3UQOA 1HAPH 1W2KH 3D23A 6GCHG 1PPHE 3GY4A 3ZVCA 1BRUP 1HBTH 1J16A 4Y0ZE 3PMBB 1XKBC 2XBWA 3D62A 3GYMA 5GIBA 5ESTE 3RU4E 1OYTH 1ETRH 1GG6B 2AIQA 2ZPSA 3N7OA 3EAJA 2ZA5A 5GCHG 4CRBA 3MH6A 1EZXC 2XCFA 2BZ6H 3SV2H 4H6TA 1UO6A 2BLQA 1N8OC 4XFQA 1Q31A 1CGHA 1PQ5A 4XOJA 5AF9H 1O3NA 4Y7AA 1QQ4A 1SHYA 1EAXA 4ABAA 2BX4A 1CA0B 2BD9A 3LJJA 1Z1IA 4FUIA 1XUHA 2DUCA 3TH2H 3HK3B 4ABHA 5CHAC 4DG4A 4ZCNA 1FLEE 3KEEA 5G4BA 5C1UA 1OP0A 1J17T 3RXQA 1CGIE 1GDQA 2I6SA 1HFDA 3RXPA 1WV7H 3F68H 1CBWB 1OYQA 1UTPA 2FS8A 1JMOH 1GL1A 1SI5H 1HJAC 3PTNA 3S7HB 2WPIS 4ZMAH 5KGOA 1ZJDA 4RKJB 3T62A 4GHTA 3SU2A 5L6NH 1DM4B 5EU8A 3PV4A 1EFRD 1OP8A 3OE7D 3LKWA 2B0FA 1HLTH 1BJUA 5JBTA 4HI3A 1BCUH 5DJ7A 1HCGA 2DE8A 2H9HA 1S6FA 1TGSZ 2PTNA 3SZEA 4MTBA 2KZ4A 3SHAH 3OYPA 1YP9A 1NFWA 3RXEA 2BYAX 1TYNA 2EQNA 4A1XA 9LPRA 4F48B 4ISOA 5B6OA 1TAWA 2KCYA 2ZIQH 2ANMH 4WJG2 3BN9A 1SMFE 4Q4LA 3F9FA 2BLVA 5CDFE 3A82A 2BY9X 2QYIA 2AH4X 4UD9H 4UFFH 2WUBA 2BXUH 3TLOA 1KDQB 3H7OA 1UHBB 1DUAA 2FLBH 1TNGA 2FS9A 2EI6A 4BAOB 3ZZ4A 4CHAC 3BTEE 2STBE 2ZDLA 2CHAB 5FBIA 3A8BA 3AASA 3KNXA 3AVZA 1ETSH 1P2KA 3UOPA 5JPMH 3KL6A 2RA0A 2K8IA 2FP7B 4O3TA 1SB1H 3TVJB 1C2JA 1XUIA 3ATKA 1OWEA 2BQ6B 4CBOA 2C93B 4B2BA 3H09A 5DP7A 1QURH 3NK8A 3RXLA 4FU9A 4NIYA 2ANKH 2VIVA 2V3MA 4UFGH 5DP5A 1PQ8A 1XUJA 3SN8A 1P0SH 2ZTYA 3SUGA 1DE7H 2H6MA 1AB9C 1DWCH 1XXDA 3GCHB 4JZIA 4X1NU 1GBHA 1RXPA 2FTMA 4IC5A 1QIXB 1ELFA 1N8OB 1V2RT 2PUXB 1UMAH 2F3CE 4UDWH 1C2EA 1GGDC 1EP6A 2TRMA 4LOYH 4ACBA 2AEIH 4DT7B 3HGPA 3PWCA 3F0PA 3MU5A 4LXBH 1T4UH 1DLEA 1FAXA 1YWUA 5KECA 4Z6AH 1F7ZA 3MYWA 1TPSA 3ODFA 3WW7A 4Z1MD 3OEHD 4JYTA 4K1SA 2KM0A 4DIIH 1FY4A 3A83A 4TYDA 1W7XH 3MTYA 4XE4A 1O5FH 3VB5A 3A7TA 3KYGA 2ZU1A 5HIYA 1CT2E 4WMFA 2OK5A 4XD7D 4O3UA 5A0CA 1VITH 2LELA 1HIAA 3M36A 1YPJH 2FLRH 4CRDA 3DSOA 4D8NA 1P9UA 1QRXA 2GX4A 1GDUA 3BIUH 1Y8TA 1TALA 3AAVA 2P59A 3PRBA 1O5DH 1ID5H 1GMHG 1WAYB 1ANDA 1AO5A 1TRNA 2O8TA 1O2IA 2OC1A 1GCTC 3GCOA 3M7QA 3O8BA 5HXFA 1O31A 1O5AB 1SFQB 4FOUC 4Y7BA 4NA7A 1GJCB 3PLBA 2WPHS 3NRLA 1DLKB 1ESBA 4ZKRU 3PO1B 4O9VA 1BBRE 2QIQA 3GY8A 1TABE 1AMHA 1O30A 2VNTA 2ZDKA 3GCTF 2L74A 3L33A 5EG4A 3SNBA 1A46H 2W3IA 3ZVAA 4KP0A 1DFPA 1D3DB 1V2TT 4SGBE 1FN8A 3TJVA 2VWMA 1JWTA 1BTZA 1HJ9A 1XMNB 1Z6JH 5C20A 1IQHA 3A7VA 2OP9A 3TIUA 3BG4B 2AMPA 4FUFA 1ZPZA 1IHSH 1BMAA 1NRPH 1C1QA 6GCHF 4ZROA 3FP6E 1EPTA 4ZHLU 3A80A 1WTGH 1DY8A 2ZG0H 1DWEH 3U8TH 5FPSA 4D7FA 5EXNA 3DD2H 4NZLA 2WPJS 1KXAA 3AAUA 1W0ZU 3STJA 1A3BH 2BHGA 2IJOB 3T29A 3FKSD 4M7GA 1P2MA 1LHDH 1YLNA 2M2AA 2RDEA 3TK5A 2ZDMA 4AORA 5EPNA 5C1XA 3UREA 2J97A 2XW9A 4WH8A 1O2WA 1TMBH 2A5KA 1MQ5A 2J98A 5TCAA 1AB9B 2ZHWH 1ZSKA 1HB0B 2EC9H 4J2YB 1GBJA 1O38A 1O2KA 2UUKB 3BTGE 1L0ZA 1WYKA 4NSVA 3ZZBA 4FUCA 4B76A 5FCKA 1O39A 1EJMA 1WOFA 5H4IB 3U8RH 3UWIA 2A2XH 4SGAE 1GHBG 4FUEA 1A1RA 2TGPZ 4GHQA 1C2GA 1C5LH 2TPIZ 4E06H 1JBUH 3T2NA 4JZDH 3QWCH 1BMLA 2ODQA 1O2JA 4FETA 4R0IA 3RC6A 1C9TA 1GBCA 4AB8A 1YGCH 1U6QA 4ZAEA 2PSYA 4YLUA 2P8OB 3SV9A 1XKAC 4BOHA 1W0YH 4Y8ZA 1GBMA 1GJAB 2RG3A 1O2PA 1GMCG 1TNHA 4TY7A 4IW4E 1YPHC 2EI8A 4X6MA 1C5ZB 4E7NA 3R3GB 2SNVA 1IQGA 1YPMH 3P92A 3MOCA 3TK9A 5F8XA 1L2EA 3PMAB 4DW2U 5T6DA 2JH5D 2V3OH 2Y5HA 1ZTKA 3T28A 1C1MA 2QXGA 3IWMA 6CHAB 1YC0A 3BTME 1ANCA 1SGYE 4H4FA 1O3LA 1T8MA 5F03A 1VCQA 5ABWA 2XWAA 3OX7U 2ESTE 4FVDA 1YM0A 2FPZA 1TOMH 4GCHF 1O2LA 3V3MA 2R3YA 2SGDE 3RXAA 4X8VH 4U2WA 1WQVH 1F2SE 1CT0E 4YO9A 4ISIH 4KTSA 4K1TA 1AQ7A 3GDSA 1FNIA 1TNIA 2HVXA 1MBMA 3TH3H 3SNEA 3I77A 1V2OT 1IQKA 2ALVA 2ODYB 5EXMA 1OOKB 2AERH 2CMYA 1MD7A 4TPIZ 2ZTXA 5I25A 4MG3A 2GVFA 2SGPE 2XTTB 4X1SU 5LGOA 1LPZB 2KCPA 1C5RA 3ATIA 3PTBA 1SSXA 3GCNA 3ZZDA 1ELCA 2BD5A 2QXJA 3RLWH 6ESTA 1ABJH 3FZZA 4DOQA 2D1JA 3ZIAD 1BQYA 2PV9B 3B8JA 1GHVH 1GI3A 1J14A 1B0EA 4AG1A 1ZPCA 1DXWA 4DGJA 3E90B 2G5VA 5CHBA 1H8DH 2FO9A 4AYVB 4K69A 1FONA 3OTPA 2Y80A 3BEIB 1ZTLA 2V6NA 1FPCH 4K2YA 1KXEA 1SGIB 1D3TB 1A0LA 1YBWA 1YPLH 2AGEX 1QL9A 4M9FA 4DT4A 1KTTB 1MTNC 1QGFA 5K7RA 4B73A 2J94A 1WDIA 1PFXC 1S0QA 1PYTC 1V2ST 3JZ1B 2ZU3A 1FY3A 3GISB 2GV7A 4WH6A 3A88A 4NSYA 2P3FH 1DWDH 3SNDA 1EOJA 1JXPA 1QB1A 4H6SB 3A8AA 1GI6A 4X2YA 2PGBB 3QDZB 5FAHA 4ZKOU 4Q7YA 3UB0A 3N99A 2A31A 5CE1A 5DGJA 1A5GH 1NPMA 1WCZA 2P94A 4NZQA 1T8OA 3ZZ6A 1NN6A 3C1KA 2GGVB 3Q76A 2TBSA 2ZQ2A 1A7SA 4LK4A 4YM9A 3NUMA 4X8SH 1ZMLA 1F5KU 5TJXA 5KEDA 3A84A 1GJ9B 2Y7ZA 2FIRH 1AZZA 1J9CH 2J2UA 5J4QA 4DURA 5I46H 4XDEA 1FUJA 1AIXH 1SGFG 2PUQH 2ZFRH 3E91A 1AZ8A 1JRTA 4IS5A 2PKSB 2YMSC 3F0OA 3SQEE 1O2VA 2F9OA 3LGUA 1TBQH 3M3SA 1AHTH 3QK1A 3VGCB 1GHWH 1HNEE 4X1RU 1UCYE 1E36B 1OP2A 1D3PB 1BRBE 2DE9A 1HV7A 2UWPA 3U98H 1QJ7B 4BAKB 3M7UA 5FXLA 1C1SA 1GI9B 4AGJA 1H8IH 2VINA 1GBLA 4BAHB 1NFXA 3RXFA 1AFEH 2VJ1A 1BT7A 3D49H 2PHBA 1T8NA 2GMTB 2VIPA 2BXTH 1THPB 4YT6H 1SGPE 3MNXA 1C1OA 3OAAD 1VR1H 2W7UA 3LDXH 4Y8YA 1LHGH 4BTIB 5A8XA 2FOBA 2FOMB 2TGTA 4I7YH 2THFB 1HAVA 2WYGA 2ZEBA 1FQ3A 4MLFB 4HZHA 1C4U2 1NRRH 1MQ6A 1KLIH 3SQHE 1BRAA 1TGBA 4TPYA 3SUDA 2GCTC 1BBRH 1RIWC 7ESTE 1YF4A 2FOEA 2L6OA 2R0KA 2FXRA 1LKBA 4U01A 5EXLA 1H1BA 5AVDA 7GCHG 1MTVA 4X8UH 1GJBB 1QTFA 2O8MA 2YNAA 2AGIX 3ATWA 2CXVA 3TJOA 2K1QA 1P02A 1SGFA 3TITA 1G3EA 1GHBF 1Y3YA 4IGDA 4KGAA 1C5OH 1W3CA 2JETC 4K1EA 5LH8A 4JZFH 3A7WA 2BOKA 1ZJKA 3KQBA 2ZFQH 3N7DA 1DXPA 3B9FH 1C5QA 1JIMA 2Z9LA 1TX8A 1GJ6A 1MMJN 2HRVA 4IBLH 1ORFA 3SNAA 3S0NA 1C5TA 1ELEE 3I29A 2P16A 2G4UA 3MNCA 3M35A 5EJZA 3IITA 1GMCF 2ZWLH 1AY6H 1IHTH 5E2PA 1BBRK 1FX0B 1MAYA 2ZCKP 2PTCE 3G01A 4VGCB 1S83A 1A4WH 4RSPA 2C8ZB 2O8LA 1V2MT 2C90B 3NXPA 4AN7A 1UVTH 1CT4E 2G4TA 1RRKA 3BF6H 3WWBA 5FBEA 4D9QA 3BEUA 1OXGA 1TRMA 3RXOA 1ZMNA 8ESTE 1LVMA 1C1NA 2BVRH 2WHXA 1GI5A 3BG8A 1C1UH 2F9UA 3RXJA 1VGCC 1TA6A 4I86A 4OS1A 3F6UH 1JOUB 5IYTA 1LPGB 1O3HA 2D2DA 3U8OH 1S5SA 1DY9A 1CVWH 2R0LA 2Z9KA 3MNBA 3LT3A 1Z6EA 1VZQH 5CMXH 2GP9B 4Y79A 1Y3XA 2OUAA 1BZXE 5C3NA 2HLCA 4ZKNU 2FOHA 1VKYA 3MU1A 2ZGHA 1QQUA 1AVGH 3QLPH 1O3KA 2VIDA 2JH0D 3V7TA 1V2KT 5DSFA 4I8GA 1K22H 2F43B 3MO3A 4RT1A 5AFZH 1AUJA 2XCNA 2XC0A 1S6HA 1NZQH 1GL0E 3PMJA 1T8LA 2G52A 1AVWA 2ZGXH 3MH5A 4X6PA 1O2NA 1HAXB 3M3VA 1LHCH 2HNTF 5FHTA 1QL7A 1Z8RA 2Q6GA 3RM2H 4CH2B 1MU6B 3GICB 1QA0A 1QJ6B 1EPTC 4XSKU 4KTUA 2LNCA 1W7GH 1S6LA 1L4ZA 1H4WA 4X6NA 3M5MA 3V0XA 3F9HA 1SPJA 1J8AA 4Y11E 5A8YA 1W14U 2F9PA 2A45B 1IQEA 2AIPA 1BDAA 1ESTA 1W8BH 2YOLA 3QZQA 3SHCH 1Y5BT 1Z8JB 5T1VA 3RXMA 2A4RA 5FL7D 1LQDB 3CP7A 1YY3A 3U9AH 3EA9A 1C2LA 4GUXA 3ENSB 1Q3XA 5JBBS 2FZZA 2ZECA 2ANYA 2TGDA 1PPEE 5C0UA 3LGIA 4YOIA 1V2PT 2V7QD 3SNCA 2BD3A 4WF8A 2BDAA 1AWHB 1EUFA 4LZ1H 2ZU4A 2Q6FA 1P2IA 5L2YH 2QGRA 2XBYA 2BTCE 4MPUA 2VH6A 4NGAH 5F53A 1ZPBA 1B5GH 5AFYH 4BXWA 4NFEA 1P03A 3PLKA 2RA3A 3BSQA 4CRAA 3A7ZA 1CGJE 5C67A 1V2QT 4MNYA 2V0BA 1Y5AT 1AN1E 2STAE 5C5NA 3Q3KA 1QCPA 5GDSH 2B8OH 2ZF0H 1UTKA 1AD8H 1TPAE 1O36A 4GCHG 1O3PB 1EKBB 4MNWA 1RTLA 2VB0A 3M37A 3RXRA 1O0DH 3QTOH 1MCTA 5JB8S 2A7HA 4GVUA 4B2CA 1C5YB 2Y5GA 1HRTH 4JZ1A 5C17A 2VU8E 3RM0H 1VGCB 3M7TA 3MHWU 1BA8B 3E8LA 1NBMD 1PPBH 3KQ5A 4OS2A 1KYNA 1W11U 1NRSH 2KAIB 1SLWB 1Z8GA 2HALA 4AFZA 1P2OA 3SOSA 3TJUA 4OS6A 2WV5A 3QX5H 1GJ8B 1KTSB 1O3JA 1SOZA 2ZDAH 3KCGH 2JJ2D 4OS7A 3MO9A 3LGTA 1GHZA 3SGBE 4XBDA 4AGKA 3HK6B 1GMDF 3JZ2B 2XBXA 1TNJA 2GKVE 3LC5A 2PW8H 4JYUH 3KQDA 5F8TA 1TQ7B 3PV5A 1A61H 3TH4H 1FXYA 4ACAA 5CHAB 4Q2KA 1E1QD 1P09A 2W6JD 4K8YA 1UK4A 1GBAA 2Z9IA 3RXUA 1G37A 1AE5A 3EDXB 3OFND 2EY4C 1GJDB 1H9LB 2GT8A 2ZCLP 1UTLM 4MPVA 4ZUHA 4Y10E 1GI7B 1HJAB 1KXDA 4CRFA 2J4IA 3QUMP 2XNDD 3RP2A 7GCHF 1SG8B 5AHGH 2UWOA 1BMNH 1EAWA 3PV2A 1UCYH 4K3JA 3SW2B 2IJD1 2BD2A 4FUDA 1GHAF 1C2HA 4O03A 9ESTA 2XNIA 3UWJH 4ISLA 3ZZ3A 1GWAA 4UFDH 2OQUA 3K65B 1KDQA 1GBTA 1UHBA 5FPTA 2FX6A 1OWDA 1G32B 4J1YA 4OGXA 4ASUD 3GY5A 2ZP0H 5DO4H 1IQLA 1K21H 3OTJE 1AI8H 2WSSD 1SHHB 3SUEA 3RXHA 1BTPA 2B5TB 1FPHH 1LVYA 1WSSH 1ACBE 1YCPM 5DP6A 4YOJA 1Y3UA 4BAQB 3VFEA 3FOAA 3PRDA 2W3KA 2ZU2A 2OXSA 2FEQH 1GBDA 1IQNA 3BTQE 3M5LA 3VEQB 2QF5A 1O2XA 1UCYK 3MMGA 4FUBA 2BY7X 1N1LA 1P10A 2JH6D 1SLUB 3ZVGA 3AW1A 1TX7A 1L4DA 3PWBA 4Q7XA 4NFFA 2XC5A 2NU2E 1SVPA 1YPKH 2ZZUH 1V2UT 1V2WT 1TX6A 4CHAB 3RC5A 4NG9H 1F5RA 2Q6DA 1P2NA 2A7CA 1TE0A 2J38A 3TU7H 1P05A 3SGAE 2F83A 3O8CA 1C5WB 2RCEA 1T4VH 3LGWA 4X6OA 1V6DA 3E6PH 1MABB 2ZHQH 1K1PA 1OS8A 5HM9A 2GDEH 5DPAA 1LVOA 1BJVA 1QA7A 2XYAA 1QRWA 1Y3WA 2CF8H 4XBCA 3UFAA 2VIQA 1EB1H 4UEHH 2IPHA 3MI4A 3RMLH 1C5SA 1G30B 1P2QA 3SJ9A 2G5NA 4ABJA 3GOVB 1OKXA 5E0JA 8KME2 2A4GA 3LOXA 2A2QH 1ZTJA 3E16B 3O8DA 2GZ7A 1GGDB 1BTWA 3VB4A 3U1IB 1UTJA 1RTKA 1G9IE 1BMMH 2VWNA 3P6ZB 2ULLA 4A1TA 3MWIU 1C5VA 2P3UB 1SFIA 2FDAA 3SI3H 3MU0A 1MH0A 2P95A 4INLA 4ABGA 1C5XB 1SGNE 2OBQA 2VH0A 1D6WA 2C8YB 3TNSA 4BTTB 2W5EA 3ZZ9A 1GJ7B 2QF3A 3E1XB 2OLGA 1THSH 1XM1A 2WV4A 5A2MH 5BRRE 1F0TA 2HWLB 4BXSA 1ZHMA 1ELVA 2PLXA 2AMQA 1ZZZA 3RXDA 4FVBA 3U69H 2C8WB 2WINI 3DA9B 1RTFB 1EX3A 2ZC9H 4PROA 1OPHB 1TLDA 2CN0H 3S9AA 2Q1JA 3C27B 4WXIA 5EGMA 3RUOA 1O2MA 2FMJA 1LO6A 2BM2A 3FZDA 4UONA 1GBEA 3ZV9A 2YNBA 3QN7A 1GCTB 3LH1A 2WPMS 1HAYB 1O3GA 2ZPRA 1YPEH 2A1DB 3A81A 1MU8B 3KF2A 4OS5A 4IMQA 1PPFE 1L1GA 3ATLA 3IG6B 1TGCA 4Y71A 5L30H 2R2MB 1YPGH 1QJ1B 2ANWA 4O97A 4A1VA 4H42U 8LPRA 1AFQC 3HATH 3ZYDA 1B7XB 1GVZA 2PKAB 1O3OA 3PM3A 1E35B 1LTOA 4HG6A 3GS9A 3WWFA 1O5BB 1C2DA 5PTPA 1C4Y2 4AC9A 2BDBA 2QXHA 2V35A 1WU1A 1KMHB 1X7AC 2HPQH 4MPXA 4F4OC 2C8XB 3M61U 4ZXXH 3ZZ7A 1MTWA 3L6PA 3TK6A 3Q3XA 2ZO3H 5IK2D 4AB9A 3PMHB 5SGAE 4Z0KA 2ZFPH 5DP3A 4YT7H 3FFGA 2WPDD 2I6QA 2H5CA 1LVBA 2F9BH 3A7XA 2QA9E 3BEFB 1DOJA 5EJ1A 4ABFA 4X0WU 2ZGCA 3CENA 4KTCA 1GDNA 1P01A 1BITA 1UVOA 4CH8B 4WMEA 1ZSJA 4WY3A 3AW0A 5EODA 3T27A 3LPRA 3FANA 4YTAA 3TPIZ 3FP8E 2JJ1D 2QF0A 3NZIA 2FX4A 2OQ5A 5J4SA 1FY1A 4OS4A 2IOTA 1CHOG 1C1WH 5JDUB 3H5CB 1FJSA 3ZZ5A 5LPFA 1NS3A 1O3AA 1INCA 1TMTH 2UUYA 1BHXB 2H1UA 2BD7A 2XXLA 2HLDD 5LPEA 2JDID 2ZTZA 1GBFA 2VGCC 1GI2A 3SU3A 1ZHRA 4RN6A 1M9UA 1O3EA 1S0RA 1LKAA 2AMDA 1GI4A 2UUFB 1G2MA 2W6ID 4CR5A 1YKTA 3D65E 1IAUA 1L1JA 5JB9S 2A4QA 4D76A 3RU4D 2K0QA 2HPPH 2WYJA 1C5NH 4INKA 3SV8A 2AYWA 3PLPA 3I78A 2J95A 1T7CA 3E0NB 3KN2A 1O3CA 3K6YA 1O5EH 2Z3DA 3URDA 1GVLA 1OSSA 1PQAA 2ZHDA 3H7TA 4JCNA 1EZUC 1GBKA 1Z1JA 1UTQA 2AS9A 4B74A 4A7IB 2WV9A 2GTBA 2BY5X 3TGIE 1AKSB 3DFJA 1MCVA 1QBNA 1C2FA 3K2UA 1BTYA 1UTOA 3F3BA 2ZPQA 2G8TA 4U30A 3T26A 1MUEB 4FXGH 3DSPA 2ASUB 3F9EA 1F0UA 1Z7KA 1BTXA 1RJXB 2LPRA 2OC8A 1O37A 5F6MA 2BY8X
chains in the Genus database with same CATH topology
4Q7ZA 3SJOA 1C1TA 2VIOA 1ZRKA 1E34B 2PGQB 4GLYA 2WUCA 2B7DH 3FVFB 3RMMH 2A5AA 1HYLA 2EI7A 4DVAU 1O5CB 3SU5A 4UE7H 4AFQA 2CGAA 1GG6C 1ZYOA 2Z6BD 4JK6A 1XVOA 2BDYA 2Y5FA 4WXVA 4IN2A 1K2I1 3CS7A 4A5TS 1HAGE 1P04A 1SL3A 1C1PA 1GMDG 2BLWA 1Y59T 1WUNH 1Y3VA 4MNXA 1HPGA 1QHRB 2CF9H 3BTTE 1CA0C 1TB6H 1TPPA 4Q80A 2FYQA 1UTMA 1LHFH 1SLXB 3WY8A 1V2LT 3SU1A 4LZ4B 4B75A 1FY8E 2HNTE 1RGQA 2C3SA 1NO9H 4HTCH 5JYIA 1GBIA 1H9IE 1UVPA 3NCLA 1P9SA 5FCRA 3UUZA 3GY2A 1HAZB 2ZCHP 1C1RA 5EPYA 1C2KA 1GHAG 3K6ZA 1YLCA 1O3MA 1W12U 2F9NA 3P8OA 3W95A 1QBOA 1O2OA 3ZZAA 1MTNB 2H9TH 2OCVB 1D4PB 3M5OA 3NKKA 1N6YA 3RXCA 4BANB 2VVCA 2QXIA 1NC6A 1D9IA 4IMZA 1TGNA 2FM2A 3F1SB 2Z9GA 1KXFA 1SOTA 2BQWB 3MH4A 2ZGBH 1BRCE 3OY5U 5E0HA 2C4FH 1O3FA 1G36A 2FYRA 4ZXYH 3KHVA 1NRQH 1OWIA 3LC3A 1PPZA 4I8HA 3S7KB 1XUFA 3MU4A 1Z8IB 1XX9A 1E0FD 1HXFH 1LQEA 2VVVA 1EOLA 2JKHA 3L3TA 2VWLA 2WPKS 3SJIA 4X1PU 4ABIA 5K0HA 1IQJA 3TGKE 1SGQE 4NWLA 3ATMA 1GVKB 2CHAC 3ZVBA 3S9CA 1G3CA 1ZGIA 3DFLA 1NROH 4UFEH 2AGGX 4AYYB 2F9VA 4D7GA 1O2SA 3SUFA 3SI4H 4K8BA 2O8UA 2R2WU 5EW2H 1VITF 7LPRA 4ISHH 3UNRA 4GSOA 1ARBA 1MKXH 1K9OE 3BTKE 4Y6DA 4DJZB 3FP7E 3SGQE 2A0QB 1O2TA 2IN2A 1DWBH 2GZ9A 1BUIA 4MPWA 3EA7A 1P11E 3B23B 4WMDA 5LPRA 2J92A 2BDGA 1O2UA 2NU1E 1L1NA 3EYDA 3GCHC 1PPGE 5EQRA 1NRNH 2ZHEH 4TWYA 4CR9A 1TGTA 1P2JA 2FTLE 4FU8A 5E8EH 1BB0B 5EQQA 3CS0A 1LPKB 3A89A 2ZFFH 2GCTB 3A8DA 4NIXA 3P95A 1RIWB 5T3HA 1ETTH 1QBVH 3PYHA 1MKXK 3S69A 6LPRA 1CHOF 2G00A 1NESE 1IQFA 2Z7FE 1TA2A 2NU3E 1Z71A 4CRCA 4X2VA 3A85A 4NIWA 2BDIA 3RXIA 4AFSA 3TJNA 2JETB 3KGPA 1P3EA 3S9BA 1SGEE 2Z94A 1C5MD 3RU4T 1HGTH 1KY9A 2GT7A 2QV1A 4E05H 1ELAA 5EOKA 1BHXF 1EB2A 2BDCA 4KELA 1VJ9U 1XUKA 1A5IA 4I31A 2BVSH 2SGAA 3UNQA 3HKJB 2OD3B 3A8CA 1O3IA 5TCCA 3HKIB 4F49A 3PO1C 1GJ5H 3V13A 1DICA 1QRZA 2PWXA 1VCWA 2FWWA 3QGJA 4JZEH 2RDLA 1DSUA 3RXKA 1ANEA 2H5DA 5FX5A 4X8TH 1HDTH 1KIGH 1HIAB 3SBKA 3M5NA 2NU0E 2VIWA 1A0JA 1FMGA 3NPSA 1CHGA 3SJ8A 5ESBA 2OBOA 1AUTC 1QB6A 2BLOA 4INHA 1C5UA 3BG4C 4YZUA 3RXTA 4ESTE 1C2IA 2BD8A 1UVSH 3SZNA 5DP8A 4NCYA 1S84A 3Q3YA 3BV9B 3BTFE 4I32A 1SGDE 4MVNA 2O9QA 2AFQB 2ZFSA 4IC6A 4DIHH 3VB3A 1O3BA 1NY22 1K1IA 1YYY1 5A8ZA 3UNSA 4ASHA 1E38B 1MZAA 1XUGA 4IN1A 3VXEH 2FOCA 1TIOA 4DY7B 1EASA 2XWBI 1UTNA 2A5IA 1AGJA 1C5PA 3R0FA 3URCA 1EPTB 2ZGJA 4I8JA 1BIOA 1K1MA 5E0GA 1FAKH 2HGTH 1NFUA 4U32A 2FOGA 2FI5E 1UK2A 3GY6A 1KSNA 3BTHE 1ELBA 3LIWA 4I8KA 1EZQA 4TWWA 2PR3A 1EZSC 3SJKA 1ZOMA 1OWHA 1QL8A 1TOCB 1FY5A 3HGNA 3OY6U 2R9PA 1S81A 2QC2A 4B71A 1P12E 1FN6A 1C2MA 4JK5A 1O2HA 1S85A 4GPGA 2SGQE 3MO6A 3P70B 2P8OC 1D6RA 1TRYA 4MNVA 1N6XA 2NWNA 2BQ7B 1ZHPA 2FESH 1F0SA 1O35A 1MTSA 3GDUA 2G81E 4X1QU 1GBBA 4E7RG 3ZVFA 3P8GA 4JMYA 3UTUH 3RLYH 4B2AA 5DKMA 1ZSLA 1EAUA 1SBWA 1FZZA 1MKWH 3HPTB 2BOHB 1V2JT 1W13U 5EW1H 2KAIA 1BTUA 5F8ZA 1DSTA 3EGKH 1HAIH 6CHAC 3K9XB 3E3TA 4XBBA 1GCDA 1O5GH 1SC8U 1YCPH 5HMAA 4NA8A 1KLTA 2J34A 2V3HH 3RXGA 1P57B 3NWUA 4WVPE 1PQ7A 3SV6A 2Y81A 1UK3A 1AWFH 3BTDE 8GCHG 4ZHMU 1ELTA 3O8RA 4QT8C 1TBRH 1Y5UT 1C1VH 2UUJB 1K28D 2HNTC 1SGRE 1NFYA 3GY3A 3MNSA 3P8FA 2SGEE 1O32A 1EJNA 1ZLRA 2P93A 1MKWK 1UVUH 4D9RA 5JBAS 2FOAA 3UPEA 5DP9A 1GI0A 3LGYA 1F92A 3P8NA 5HGGA 3STIA 4AG2A 2ZDNA 5GCHF 1GHXH 4NIVA 4I8LA 1ARCA 3RXBA 1YCPK 1EJAA 2QCYA 2VWOA 1ZMJA 1LDTT 1V2VT 2D8WA 2BY6X 5IDKA 4MQAA 1GJ4H 1JRSA 3GY7A 4BTUB 1ABIH 2TIOA 3FAOA 1WBGB 4Y0YE 1SLVB 1ELGA 4A6LA 4DCDA 2M5TA 3SU6A 3MH7A 5GWZA 1QY6A 3Q77A 4R8TB 2H2ZA 5C2ZA 3ITIA 1SGCA 2ZQ1A 1FDPA 2WPLS 5EQSA 1V3XA 1AE8H 3VPKA 3V12A 4YESB 2ZNKH 4HGCA 3E0PB 4NA9H 2GCHG 3ELAH 2NU4E 1SR5C 4Y8XA 1V2NT 1ZGVA 1GPZA 4MDSA 1LCYA 1E37B 1DVAH 4AZ2B 3KQCA 3A86A 3P17H 2XBVA 5C1YA 1A2CH 4ZH8A 2OC0A 4AOQA 1J15A 2G55A 3U1JB 1G2LA 3UR9A 4AFUA 3RDZA 3UIRA 1AU8A 4FU7A 3W94A 2BDHA 3EE0B 2PKSC 1O33A 1NT1A 1WQSA 4X2XA 1KXBA 4RKOB 1O34A 1Q2WA 3RC4A 2ZI2H 1O2ZA 3RMNH 1VITG 3VGCC 3QTVH 2A7JA 3QZRA 1G3DA 2FI4E 1CE5A 3LGVA 3RXVA 2A32A 1CQQA 2Y6TA 1SQOA 2W7SA 1O3DA 2BX3A 1BTHH 1TFXA 1TWXB 2BB4A 1P8VC 2OC7A 1C4V2 3BIVH 1ELDE 2GMTC 3TGJE 2OINA 1OWKA 1CSOE 4X2WA 3OSYA 2W26A 5ETXA 1EXFA 1MAXA 1C9PA 1T32A 3LU9B 4YLQH 5BPEA 3ZVEA 1K1OA 1GI1A 4FUGA 2ALPA 3RMOH 1QB9A 1EP5A 1O2GH 3MU8A 1T31A 1SGTA 3OU0A 1EQ9A 1EATA 3SV7A 4CBNA 2GD4B 1F5LA 4GAWA 3EA8A 3GDVA 3UOUA 1A3EH 3DHKH 3SU0A 2XRCA 4THNH 4ABEA 1KXCA 2FODA 1TQ0B 5A0AE 3SORA 5HM2A 1W10U 2Z9JA 1DX5M 3F9GA 1OX1A 1VCPA 1ZRBA 2O8WA 1VJAU 3SO3A 1TBZH 4ZHAA 1SQAA 2GZ8A 1HAVB 2SFAA 3KQEA 2ZDVH 3VB6A 1RS0A 3Q00A 3DUXH 1DITH 1FIWA 2Z3EA 4AX9H 1QNJA 1ZR0A 2R3UA 2PKAA 4WWYA 1HAHH 1TNKA 2PFEA 3ESTA 3VXFH 3VB7A 2Z3CA 1SQTA 4VGCC 3UQVA 3UY9A 1YLDA 2BZAA 4ABDA 7KMEH 2VVUA 4BNRA 1UJ1A 1A0HB 1GMHF 4K60A 3DT0H 5GJ4B 4BAMB 5HYOA 1TONA 4TY6A 2A4OA 5FPYA 3PROA 1B0FA 1G3BA 2ZHFH 1DDJA 1EAIA 3RXSA 1TNLA 3ZZ8A 1K1LA 1AFQB 3QGNB 5C5OA 2PSXA 3ZVDA 2CJIA 3A87A 2H9EH 5FX6A 4ISNA 2G51A 8GCHF 3M3TA 1XVMA 2CV3A 5T6GA 3T5FH 3ODDA 5DG6A 1HJ8A 2F91A 1IQIA 3MFJA 2BMGB 5GPIB 1TPOA 1FIZA 3SU4A 2D26C 5A0BA 3T25A 4KKDA 1AVXA 2XC4A 1H9HE 3A7YA 3LJOA 1P06A 4ZKSU 1D3QB 4CRGA 5JBCS 5E2OA 1GHYH 1DS2E 2ILNA 1KLJH 1NU7B 3TNTA 4JYVH 5T6FA 1HAOH 1RFNA 1PYTD 2FI3E 3GYLB 2UWLA 3KIDU 2ODPA 1DT2A 1CBWC 1PJPA 1HXEH 1S82A 2QY0B 3ZYEA 5DP4A 1MZDA 1ESAA 2QAAA 1JIRA 2J9NA 5A09A 2B9LA 3ZZCA 4HFPB 2EEKA 1LHEH 1LMWB 1GI8B 2SNWA 1OWJA 5L2ZH 4K5ZA 1IQMA 1A5HA 1K1NA 1MD8A 1XXFA 2EA3A 3LH3A 2VGCB 4FUJA 1AKSA 2BD4A 2Y82A 1HUTH 1TMUH 3QO6A 2P3TB 3EQ0H 1CA8B 2GCHF 3PB1E 1ANBA 1CU1A 1NU9A 1MBQA 4A92A 5GXPA 4B1TA 2ZKSA 4Y76A 4YOGA 4I33A 1FI8A 1O2RA 1THRH 1CO7E 1RD3B 3BTWE 1BOQA 2Y7XA 2ZU5A 2ZFTA 3UR6A 1FV9A 1P3CA 2OTVA 5DK1A 1DANH 4CREA 1PPCE 2QN5T 1F0RA 1K1JA 1WTHD 2FOFA 2SGFE 4NWKA 1O2QA 3ZV8A 1DPOA 2GDDA 2GV6A 3GCTG 4FUHA 1NM6A 2HOBA 4OGYA 1NTPA 3LONA 2TGAA 1QR3E 1DUEA 2BVXH 1QFKH 1YPHE 1O2YA 4ABBA 1MTUA 1IOEA 3UQOA 1HAPH 1W2KH 3D23A 6GCHG 1PPHE 3GY4A 3ZVCA 1BRUP 1HBTH 1J16A 4Y0ZE 3PMBB 1XKBC 2XBWA 3D62A 3GYMA 5GIBA 5ESTE 3RU4E 1OYTH 1ETRH 1GG6B 2AIQA 2ZPSA 3N7OA 3EAJA 2ZA5A 5GCHG 4CRBA 3MH6A 1EZXC 2XCFA 2BZ6H 3SV2H 4H6TA 1UO6A 2BLQA 1N8OC 4XFQA 1Q31A 1CGHA 1PQ5A 4XOJA 5AF9H 1O3NA 4Y7AA 1QQ4A 1SHYA 1EAXA 4ABAA 2BX4A 1CA0B 2BD9A 3LJJA 1Z1IA 4FUIA 1XUHA 2DUCA 3TH2H 3HK3B 4ABHA 5CHAC 4DG4A 1FLEE 3KEEA 5G4BA 5C1UA 1OP0A 1J17T 3RXQA 1CGIE 1GDQA 2I6SA 1HFDA 3RXPA 1WV7H 3F68H 1CBWB 1OYQA 1UTPA 2FS8A 1JMOH 1GL1A 1SI5H 1HJAC 3PTNA 3S7HB 2WPIS 4ZMAH 1ZJDA 4RKJB 3T62A 4GHTA 3SU2A 5L6NH 1DM4B 5EU8A 3PV4A 1OP8A 3LKWA 2B0FA 1HLTH 1BJUA 5JBTA 4HI3A 1BCUH 5DJ7A 1HCGA 2DE8A 2H9HA 1S6FA 1TGSZ 2PTNA 4MTBA 3SHAH 3OYPA 1YP9A 1NFWA 3RXEA 2BYAX 1TYNA 4A1XA 9LPRA 4ISOA 5B6OA 1TAWA 2ZIQH 2ANMH 4WJG2 3BN9A 1SMFE 3F9FA 2BLVA 3A82A 2BY9X 2QYIA 2AH4X 4UD9H 4UFFH 2WUBA 2BXUH 3TLOA 1KDQB 3H7OA 1UHBB 1DUAA 2FLBH 1TNGA 2FS9A 2EI6A 4BAOB 3ZZ4A 4CHAC 3BTEE 2STBE 2ZDLA 2CHAB 5FBIA 3A8BA 3AASA 3KNXA 3AVZA 1ETSH 1P2KA 3UOPA 5JPMH 3KL6A 2RA0A 2FP7B 4O3TA 1SB1H 3TVJB 1C2JA 1XUIA 3ATKA 1OWEA 2BQ6B 4CBOA 2C93B 4B2BA 5DP7A 1QURH 3NK8A 3RXLA 4FU9A 4NIYA 2ANKH 2VIVA 4UFGH 5DP5A 1PQ8A 1XUJA 3SN8A 1P0SH 2ZTYA 3SUGA 1DE7H 2H6MA 1AB9C 1DWCH 1XXDA 3GCHB 4JZIA 4X1NU 1GBHA 1RXPA 2FTMA 4IC5A 1QIXB 1ELFA 1N8OB 1V2RT 2PUXB 1UMAH 2F3CE 4UDWH 1C2EA 1GGDC 1EP6A 2TRMA 4LOYH 2AEIH 4DT7B 3HGPA 3PWCA 3MU5A 4LXBH 1T4UH 1DLEA 1FAXA 4Z6AH 1F7ZA 3MYWA 1TPSA 3ODFA 4JYTA 4K1SA 4DIIH 1FY4A 3A83A 4TYDA 1W7XH 3MTYA 4XE4A 1O5FH 3VB5A 3A7TA 2ZU1A 1CT2E 4WMFA 4O3UA 5A0CA 1VITH 1HIAA 3M36A 1YPJH 2FLRH 4CRDA 4D8NA 1P9UA 1QRXA 2GX4A 1GDUA 3BIUH 1Y8TA 1TALA 3AAVA 2P59A 1O5DH 1ID5H 1GMHG 1WAYB 1ANDA 2OC1A 1AO5A 1TRNA 1O2IA 2O8TA 1GCTC 3GCOA 3M7QA 3O8BA 5HXFA 1O31A 1O5AB 1SFQB 4Y7BA 4NA7A 1GJCB 3PLBA 2WPHS 1DLKB 1ESBA 4ZKRU 3PO1B 4O9VA 1BBRE 2QIQA 3GY8A 1TABE 1AMHA 1O30A 2VNTA 2ZDKA 3GCTF 3L33A 5EG4A 3SNBA 1A46H 2W3IA 3ZVAA 4KP0A 1DFPA 1D3DB 1V2TT 4SGBE 1FN8A 3TJVA 2VWMA 1JWTA 1BTZA 1HJ9A 1XMNB 1Z6JH 5C20A 1IQHA 3A7VA 2OP9A 3TIUA