2FODA

Structure of porcine pancreatic elastase in 80% ethanol
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords elastase-1
publication title Multiple solvent crystal structures: Probing binding sites, plasticity and hydration
pubmed doi rcsb
total genus 59
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2006-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fodA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fodA01
2G55A 1T7CA 2SNVA 3VEQB 1C5NH 3RXAA 2R3UA 1CHGA 4FUHA 4VGCB 1ETTH 1E37B 3ZZAA 1LVOA 2TGAA 1O3AA 2KAIB 4THNH 5FHTA 1Z1JA 1KXDA 4DT7B 2WV4A 1LKAA 4NSYA 1C1QA 1EAUA 1RTKA 2FWWA 3BTDE 1ELEE 2SFAA 3S7KB 1MCVA 1V6DA 4JZEH 3P70B 3GDUA 2BD5A 1BOQA 4ZKOU 1ORFA 4K60A 4UFFH 2W5EA 3ZYDA 2AERH 2J9NA 3NK8A 2THFB 3MU5A 2ZGCA 4MPWA 1FAXA 1EAIA 2P8OB 3P8GA 1AUTC 1RXPA 4CR5A 1E34B 1FY5A 2O9QA 4O3UA 2VIWA 2K1QA 1KY9A 1JOUB 1ZMJA 1V2MT 2QIQA 3MH7A 1K1LA 2SNWA 3ATKA 1O2IA 3TK6A 1BZXE 3VFEA 1P03A 4A6LA 2A0QB 1TQ7B 1JIMA 1QGFA 1XUGA 4FUGA 3RXHA 2GT8A 1KXFA 1LPZB 1P05A 1TFXA 1Y3WA 5DP6A 2B0FA 2C8ZB 4I8LA 1SL3A 1ETRH 2GT7A 2WPIS 1D3DB 7LPRA 1NPMA 1ANDA 4BXSA 1GPZA 1O5EH 3GY3A 4WMFA 1ZTLA 4GLYA 4FU8A 4WH6A 4OS5A 4ZROA 1GI6A 1O3NA 1C2DA 2PSXA 1G2MA 1Y5BT 1ANEA 2F83A 3PMAB 4DIHH 3W94A 2J94A 2SGDE 1MQ5A 4Y8ZA 1BTPA 4KTUA 1UTPA 1PPCE 4NFEA 4R0IA 1HAHH 1TONA 2VIOA 4GHTA 4ZHAA 1DVAH 1NU7B 2CJIA 1HIAB 3NKKA 4UONA 1AZZA 1OS8A 2DE8A 2C8YB 5DKMA 2ZHDA 3KEEA 1TX8A 2W3KA 3EYDA 4YT7H 3D23A 2OBOA 5EOKA 5F8ZA 1O37A 1GL1A 3GY5A 1BJVA 3RXLA 1GHYH 1RGQA 3MMGA 2FOEA 5DGJA 3VGCC 4AZ2B 2VB0A 1TLDA 1C5RA 9LPRA 1QBVH 4ISIH 4DG4A 1ZPCA 4OS4A 3SORA 3RU4D 2XWBI 1NS3A 1P2QA 1C2KA 1CA0B 5HM2A 1P57B 1WYKA 2O8TA 3EA7A 4CRFA 2ZKSA 1F92A 4OS1A 3P95A 2I6SA 1O31A 1O3KA 4X6OA 3D49H 4NGAH 4I8GA 2A2QH 3EGKH 3PB1E 3NUMA 1FQ3A 8ESTE 4AG1A 1NT1A 4IMZA 1HXEH 1GI2A 2Z9GA 4Q80A 2A7CA 3IITA 1P2OA 1XUJA 2GZ7A 4AYYB 1FV9A 1GVZA 5GJ4B 3RMNH 2W7SA 1IQHA 1C1NA 1C9TA 4UDWH 1BMLA 2NWNA 1O2YA 3L6PA 1AB9B 3OX7U 2ZC9H 2UWOA 3MNSA 2FOHA 1YM0A 1LDTT 1O30A 1BT7A 2QXJA 1ABJH 2ZTZA 4YLQH 5EG4A 1CT2E 4H6TA 2QN5T 3VB3A 1NC6A 1L1JA 2RG3A 3O8RA 2VGCB 1AZ8A 1V2TT 1Y3VA 1ETSH 3LGWA 1YCPM 3D65E 1GHBG 1LHDH 3UNRA 2W3IA 2XBWA 4NWLA 5B6OA 4WVPE 1BRAA 1Y3UA 1GCTB 5EQSA 3TJOA 1Y5AT 3GICB 2QV1A 1JXPA 4KTSA 4U01A 2C8WB 3F1SB 4DOQA 2Y80A 1TRYA 2VVCA 2VVUA 4I32A 4ABIA 2GDDA 2Z9KA 2ZTYA 1T4VH 1C2FA 2ALVA 2STAE 1BTXA 1PYTD 1P2NA 1A5GH 5SGAE 5J4SA 2CV3A 4GCHF 4Y11E 1ZPBA 3RC5A 3M5NA 3MWIU 3GCTF 1RRKA 3ZZ4A 3A7XA 3GCOA 4NA8A 1AIXH 2F9NA 3GCHB 2AIPA 1MTUA 5PTPA 3AASA 3TGJE 4BANB 1AGJA 1DY8A 1HAIH 3ATWA 3ZZ6A 3BG4C 1GMCG 3SU3A 3SV8A 1YPJH 2VU8E 3A7ZA 1WQVH 4WJG2 4Z0KA 1UVOA 4DJZB 1S0RA 4XDEA 1ANCA 4RKJB 1O34A 1KXAA 1V3XA 1TX7A 1F5KU 2C90B 5E0JA 3N7OA 3LGUA 3MYWA 3A8AA 1O3JA 3BEUA 1SOTA 2I6QA 3LT3A 3RXIA 2PW8H 2ZFSA 3ZVAA 2BQWB 1VR1H 4WWYA 1GJCB 2PKSC 1QJ6B 4F4OC 1QRWA 1TGSZ 2BM2A 3IG6B 2BVSH 4AGKA 5DP4A 1D4PB 1YC0A 4XBBA 1G30B 1SGQE 2VH6A 1C4V2 2BHGA 2Y7XA 4SGAE 4FUCA 1W7XH 1BA8B 3P8NA 1U6QA 4B1TA 1EATA 1M9UA 4XOJA 1J9CH 1SLUB 2ZDVH 1GDNA 1EASA 1PFXC 1FY1A 3MOCA 1GJ8B 4BTUB 3S9BA 1Y5UT 1C1PA 1V2QT 3QWCH 2F9OA 2FYQA 2QF3A 2AGIX 1G32B 2G5VA 1GBHA 2P8OC 2ZPSA 3T25A 3U8RH 1QTFA 2ZU5A 1DXPA 2NU2E 1BB0B 1LPGB 3I29A 1GJ5H 3ZVCA 5T6GA 1EB1H 2TIOA 1MZDA 1WTGH 4CRDA 3SNBA 1G3CA 3MH4A 1G3EA 2V35A 4B73A 1K9OE 3GISB 1WV7H 2G51A 4OS2A 2GKVE 5HXFA 1MAXA 2PFEA 4H4FA 2ZNKH 3HKJB 1BHXF 3ZVFA 5JBAS 3SJ8A 1TPAE 1TGCA 1FPCH 3RXQA 1CGIE 3TJUA 1YKTA 4Y71A 4BTIB 4B2CA 1AVGH 2FTLE 1SOZA 1NO9H 3M61U 4IN2A 1W14U 2P95A 4NG9H 3ZV8A 1E36B 2P3UB 1O3OA 3LH1A 3TK9A 3NCLA 2YNBA 1EOLA 1DSTA 6CHAC 1HAVB 2HNTE 1HXFH 1YPGH 1J8AA 4AFUA 1GHAG 4NZLA 2WUBA 1O2ZA 1C5VA 1XUHA 5F8XA 2VIDA 1C5QA 3UTUH 1SFIA 1F2SE 1T31A 2BY8X 1TNGA 5LPEA 2WV5A 3LH3A 1DE7H 1LVMA 1TABE 4JK6A 1MAYA 2FOAA 1WQSA 5HYOA 3DHKH 2Y81A 5E8EH 1MBQA 1P3CA 1WTHD 2Z9IA 3ESTA 3SUDA 4I31A 1P12E 9ESTA 1DXWA 1ZYOA 1RS0A 3NWUA 2BD9A 3ZZ8A 3P17H 2VVVA 4F49A 5FX5A 3H7TA 2GZ9A 1TA6A 4D9RA 3E8LA 2R0LA 1P01A 3ZVBA 1GJ9B 1CVWH 1O3CA 3RXKA 1CA0C 2ZGBH 2ZIQH 3TLOA 3O8CA 1O5CB 8KME2 3KQCA 3ODDA 4MQAA 5GDSH 1TBZH 1O35A 3FFGA 3PTBA 1FN8A 3DFJA 1UTKA 5TJXA 6ESTA 1T8MA 5GIBA 3U8TH 1G9IE 1TNJA 1O3DA 4IS5A 2QC2A 3ZZCA 1O2HA 2XBVA 1UVPA 2O8UA 3FP6E 1ELFA 1F5RA 1FZZA 1DWEH 3RLWH 4NZQA 3RMMH 3PLKA 2VJ1A 4E06H 1ELVA 4NA9H 2A2XH 1H4WA 1EZQA 4A92A 1KYNA 1DLEA 3EDXB 1IQNA 5GCHF 5A0CA 3VGCB 1TIOA 3LPRA 4SGBE 2J4IA 1P02A 1TAWA 1S83A 2BTCE 4UEHH 3RXOA 4HFPB 3LGTA 4U2WA 1C1OA 1LMWB 2Z94A 3RXJA 1GJ7B 3RC6A 2QXGA 4YLUA 1CBWC 2ZFTA 1H1BA 3RLYH 2PKAB 1L4ZA 3RXCA 1C5WB 1DPOA 2XBYA 5C67A 1MD7A 2ALPA 2GCHF 5AF9H 1AY6H 4Y0ZE 2ZGHA 3GYLB 1W3CA 2TGPZ 2VGCC 3Q76A 4AFSA 1FNIA 1O5GH 2ZFRH 2H2ZA 5LH8A 1OP2A 3UR9A 6GCHF 3V12A 4KP0A 1AFQB 1O2VA 1GCTC 1V2UT 1BHXB 1GI8B 1S85A 4B71A 1EJAA 1AKSB 4CRCA 3DFLA 4MVNA 1ZJKA 2ANYA 4NIXA 5C3NA 1CE5A 5ESTE 2ZEBA 1GCDA 3M37A 4YO9A 1W11U 1D3PB 1YBWA 1ZLRA 1EQ9A 1O3LA 7GCHG 3A8CA 1SHYA 1DICA 1O3IA 1FDPA 1LHGH 3STIA 3A85A 2QXIA 1ELTA 4QT8C 4Y8YA 2YOLA 3A80A 3BTEE 4AG2A 2GTBA 5FBEA 3SGBE 2B7DH 3ELAH 5EU8A 4MPXA 1NFUA 5L6NH 1AWHB 2J92A 1O2OA 1UK2A 4ABGA 1DSUA 5EGMA 3FAOA 5DP7A 2PKAA 3RXVA 4ZHMU 5EXMA 1IQIA 3NZIA 2P3TB 3A8BA 2EI8A 2AMQA 2BDBA 2ZHEH 4NFFA 4ASHA 5L2ZH 4BTTB 1MU8B 1RIWC 1O33A 1LVYA 2OTVA 4K2YA 3BSQA 2HWLB 5DO4H 2ZPRA 2Y5FA 4BAHB 5FPTA 3P8FA 1EKBB 2ESTE 1GI3A 2FP7B 4ZKNU 1CT4E 1QL7A 4INLA 1SGEE 5JBBS 1BRUP 2R2WU 4ZUHA 1QRXA 3F6UH 4MLFB 1FONA 3M35A 3MI4A 1HV7A 5A8YA 3BG4B 1T8OA 1UTJA 2LPRA 2ZG0H 3F9EA 1GMHF 1AKSA 1W0ZU 1HAPH 2ASUB 5I25A 2WPJS 2QXHA 2F3CE 1Q2WA 5FPYA 2Y5HA 3E3TA 3UNSA 1S0QA 7KMEH 2A45B 4BAKB 2JKHA 3MU0A 1G2LA 2W7UA 1K1NA 1EP5A 2FZZA 1IQJA 2PKSB 2WUCA 4ABHA 2BVRH 3Q00A 4ISHH 5IDKA 1TOCB 5C1YA 4DVAU 4HI3A 3SO3A 2J2UA 3LU9B 1SGFG 1ZJDA 4X1QU 3BTQE 4GUXA 3RXPA 4Q2KA 1MQ6A 3EA9A 1DUEA 1GI0A 2A32A 1AFEH 3LIWA 2CN0H 1MU6B 5DPAA 1SQAA 1O2JA 4BOHA 4Y6DA 3T2NA 4DGJA 4K8BA 3SU6A 2ZFQH 1TMUH 3UQVA 1AUJA 1EUFA 1P9SA 4NWKA 2GV6A 1AVWA 2BDCA 1UTMA 4MPVA 3MU1A 1BTZA 4Y7BA 1O2RA 1OYQA 5EXNA 1GHXH 5BPEA 1TGTA 3S69A 1ESTA 1TNLA 2FO9A 4X0WU 1PJPA 1SMFE 1HGTH 4XBDA 3SUEA 4GCHG 2HGTH 3D62A 1TBQH 2XNIA 2SGFE 3K6YA 3UNQA 1V2OT 1QA0A 3ATIA 1J17T 1ZPZA 2ZQ2A 1Z8GA 3PYHA 2Q6GA 3SJKA 1ID5H 1TOMH 3KF2A 4IBLH 1XM1A 3F68H 1PPEE 2ZDAH 1P09A 2FXRA 2G81E 2PGQB 1ZR0A 4IMQA 2UUYA 1TMTH 1MBMA 3Q3KA 4MDSA 4YZUA 4B2AA 1QJ7B 6CHAB 1KDQA 2ZCHP 1O3FA 2G4UA 1QQUA 4ZAEA 4JZDH 1UCYH 1QB1A 3BTGE 1SGNE 1RJXB 2TRMA 1UHBA 2ZCLP 4E7NA 4X1RU 1GHWH 4FVBA 2WINI 2VWNA 1O5AB 2FM2A 1PQ5A 2SGPE 3F9HA 1YCPK 1TGBA 4BXWA 1G36A 2FOCA 1YLDA 1L1NA 2FOBA 2QYIA 3RMOH 1SPJA 1HAOH 2AGGX 2CMYA 4MNVA 2PGBB 2HVXA 4X1PU 5JYIA 5A2MH 1QIXB 4ABFA 3JZ2B 2HALA 1S6FA 2AEIH 1TPPA 1A4WH 3SV6A 1BTUA 1EPTA 5EODA 3PWBA 3CENA 1MKXK 1KIGH 1SGIB 3OU0A 3TH3H 1PPZA 5F03A 3SUFA 2SGQE 2XXLA 4ISOA 1GBLA 2ODPA 3TK5A 3ZVDA 1MUEB 1V2JT 3MNCA 3R0FA 4YTAA 1P2KA 1FAKH 1C4Y2 1V2ST 2CHAB 3TGIE 2OC1A 1UK4A 4ABBA 1WSSH 1VITH 3VXEH 1AFQC 1DUAA 2RA3A 1B0FA 2BVXH 3U9AH 3VB6A 1TBRH 3A7YA 1GHVH 1OP8A 2B9LA 1A3BH 2WPHS 1SVPA 2BDAA 3HGNA 2VIVA 3SU2A 2AS9A 5EQRA 3TGKE 1F5LA 1O2XA 4A1VA 3SUGA 4AYVB 3QUMP 2A5IA 1EJNA 1UTNA 1CBWB 1GI7B 1FJSA 5CMXH 4B74A 1EX3A 2NU4E 3LGYA 1DOJA 1C9PA 1BJUA 1QQ4A 1W13U 2JH6D 1J14A 4GSOA 3JZ1B 3MHWU 1T32A 1SFQB 3K9XB 3GY2A 1CSOE 1HJ8A 3STJA 1C1UH 3SJ9A 3BTWE 1ZHPA 5EPYA 3SV7A 4I7YH 3MO9A 5K7RA 1W2KH 1W8BH 1Z6JH 1ZRKA 3EE0B 3SGAE 3RUOA 1C5YB 1QBOA 1BIOA 3QZQA 5JPMH 5C5OA 4X2WA 1ZHRA 3HPTB 3BTHE 4KGAA 3CS7A 1IQFA 1EZSC 3PO1B 5GPIB 3M3SA 1V2KT 1WCZA 1T8NA 1FN6A 3A87A 2CF8H 1XXFA 1C2LA 1PPFE 3QGNB 1ELAA 4AB8A 3MO6A 1TPSA 4X2XA 2NU1E 2XYAA 1PQ8A 3RU4E 3AAUA 3BF6H 4DIIH 1JBUH 1IQLA 2OUAA 3PMJA 5C5NA 2OC7A 3SGQE 1CGHA 1C2IA 1ELBA 2GX4A 4FUDA 3U98H 3BV9B 1OWEA 3H7OA 4XE4A 1QURH 2Z9LA 4FUFA 1G3DA 2BLOA 2AH4X 1RFNA 1QBNA 3URDA 2LNCA 1YYY1 2CGAA 1BQYA 4U30A 1YPHC 1AVXA 2AMPA 4CHAB 1TYNA 2HRVA 3LGIA 1N8OC 1QR3E 3L33A 3M7TA 2AMDA 1TWXB 1BMNH 4A5TS 4OGYA 1QJ1B 1RIWB 1VITF 2OXSA 1EZUC 2FLRH 1K1OA 1CQQA 1DDJA 2ZU1A 2H9HA 4K1TA 1KLTA 1WAYB 3E6PH 1ZSLA 2CF9H 2ZDLA 1TRNA 3ODFA 2G52A 1AQ7A 4B2BA 1GJAB 1AE5A 3RXGA 1F0SA 2F9UA 1ZMNA 4O03A 4UFDH 1TX6A 3F9FA 4DW2U 2GMTC 1DFPA 1SI5H 5CHAB 2OBQA 1XUIA 3RXFA 3FZDA 1X7AC 1HNEE 1UVSH 2D1JA 2STBE 1RTFB 3LC3A 2FS9A 2UUFB 3S9CA 3LC5A 1MH0A 3CS0A 4X1SU 6GCHG 2PTCE 4X8UH 2FI5E 4CR9A 4RKOB 2ILNA 3SQEE 1XXDA 2ANKH 2XCNA 3QTVH 1YPEH 1MTNB 1NRRH 3OSYA 1HAGE 4B76A 4JYUH 3B8JA 3MNBA 3T29A 5F6MA 1CU1A 5TCCA 4NSVA 3PV4A 2GD4B 3ZVEA 2RDLA 1EPTC 3GDSA 3LJOA 1EB2A 1BTHH 1NTPA 3UIRA 1QB9A 1LTOA 3O8DA 4X8VH 2C93B 5T6DA 4ISNA 2V0BA 3U8OH 4TWWA 1GJ6A 4JZIA 1SG8B 4ZXXH 1PYTC 3S7HB 5JB8S 2BQ6B 1UJ1A 1D3QB 3SU0A 5I46H 2FS8A 3A7VA 1IAUA 4MTBA 3V0XA 4XBCA 2XCFA 3M7QA 4IC5A 1IQGA 2DE9A 1N1LA 1A46H 1LPKB 1QB6A 2ZPQA 4X6MA 2FI3E 5C1XA 1SQOA 1GBJA 4JYTA 1H9HE 1UK3A 3KL6A 1MTWA 1C2EA 1GMDF 1E35B 3T28A 1XVOA 4CBOA 1Z7KA 3SNAA 2SGAA 1GG6C 2C4FH 4INHA 4ABAA 1VJ9U 3DT0H 1A2CH 2ODQA 4A7IB 3SU1A 4CRBA 1O2MA 3DD2H 1O3EA 1C1SA 1G3BA 2B8OH 2EC9H 2R2MB 1LQDB 3T5FH 2ZZUH 1P3EA 3A81A 3ATMA 4NIWA 5BRRE 2XRCA 4TYDA 2HOBA 5GWZA 1P04A 1GMHG 1Y3XA 3QGJA 4ABJA 2OCVB 3K65B 1HRTH 2H1UA 4JYVH 4WXVA 1C1TA 3BN9A 1IQMA 1BBRE 1GHBF 4FUIA 1NY22 1RTLA 4KELA 2ZCKP 1S82A 1DY9A 5CE1A 3PM3A 1C5SA 4OGXA 1BTYA 3A7TA 5L2YH 2V3HH 1JIRA 3V3MA 3UOUA 2V6NA 3GY7A 3OTJE 1TB6H 1FMGA 2CHAC 3O8BA 1O5FH 5FCRA 3B23B 2A4QA 1L0ZA 1ZSJA 1SGRE 4Q7ZA 1GGDC 5HMAA 5A0AE 1AI8H 3S0NA 2UUKB 2UUJB 1O2WA 1TA2A 3KQEA 1O2TA 1Z8RA 1DM4B 1PPHE 1SGFA 1WBGB 1GMCF 2WYGA 4O9VA 3K2UA 3ITIA 3OY6U 2RCEA 1BBRH 1NESE 1O5BB 1GBAA 1W12U 1S81A 4BNRA 1OYTH 3F9GA 2BZ6H 1HJAC 2FESH 2C8XB 2P16A 1HAZB 2A5AA 3E0PB 1BMAA 4LXBH 3TH4H 2OC8A 2FODA 2QAAA 1T8LA 3BG8A 1SQTA 4IW4E 5F8TA 3TIUA 1J16A 1AD8H 5LPFA 3ZZ5A 3OY5U 2BOKA 1TQ0B 3DA9B 3SNDA 5C20A 1GJDB 1MMJN 2BD7A 1CHOF 4Q7XA 1O2GH 1QY6A 3PO1C 1V2WT 4UE7H 1CGJE 1L1GA 2BY7X 1KXEA 2ZHWH 1PPBH 1EJMA 1GI9B 3GYMA 4X8TH 4ABDA 8GCHF 5JBTA 2W26A 4IN1A 3VB7A 1HDTH 1IHTH 1N6XA 2GGVB 5ESBA 2BDGA 1V2NT 2Z3CA 2BYAX 3FANA 2ZFPH 4LOYH 2RA0A 4RN6A 1DLKB 1GBCA 2GCTC 3SZNA 3I78A 3MU8A 1TNHA 2R3YA 4K5ZA 1Y59T 1ZZZA 2OP9A 1O3HA 1XKBC 1DANH 2VNTA 2XWAA 1O2SA 4WY3A 1WOFA 4JMYA 1OP0A 2G8TA 3P6ZB 1P2IA 4AX9H 1Z6EA 2PSYA 1OWIA 1VCPA 4CHAC 3RXDA 2GDEH 3WY8A 1N6YA 1OKXA 3UPEA 4ZHLU 1OPHB 2BLVA 2OINA 4LK4A 4GAWA 2IN2A 5AFZH 3S9AA 4U32A 1GJBB 2O8WA 4X8SH 2F9BH 5DG6A 1SB1H 1QL8A 2QF0A 2ZU3A 2ZP0H 3LKWA 1ZTJA 1UO6A 3A82A 1OXGA 4XFQA 5CHAC 3RC4A 1QNJA 2AGEX 3RXBA 2O8MA 4WXIA 3VXFH 3V13A 2ZU4A 2A4RA 4MPUA 1J15A 2ODYB 3A84A 3E1XB 1DWDH 4WF8A 5G4BA 1OOKB 1GBEA 3SOSA 3M3VA 2NU3E 1AHTH 4KKDA 2NU0E 1MTNC 2FEQH 5EW1H 3A83A 4TPIZ 1N8OB 1Z8IB 4X2YA 4D7GA 3H5CB 2J38A 3TU7H 3NXPA 1UTQA 1A5IA 2A4GA 1EP6A 1GWAA 2GV7A 3PTNA 4Y79A 1Z1IA 3RXTA 2OQ5A 4I33A 2Q1JA 2BD3A 2TGDA 1JMOH 1KDQB 3RU4T 1WU1A 1GVLA 2FYRA 3MNXA 4R8TB 4K1SA 3B9FH 4K3JA 2D8WA 1HJ9A 1ZOMA 1KTSB 1MKWH 1AWFH 4FUBA 2GMTB 1GBTA 1KSNA 3U1JB 1SBWA 1UHBB 4INKA 4FVDA 2FI4E 1FY4A 4YM9A 1QFKH 1C2HA 3SI4H 3KHVA 1NU9A 1EZXC 3SJIA 1JRSA 1SGPE 1NFXA 3FP8E 1KXCA 1PPGE 3ZZDA 2G4TA 3V7TA 1OWJA 2Q6FA 1NFYA 3T26A 1UCYE 1CT0E 4MNYA 2Y5GA 4MNXA 1SHHB 4K1EA 5E0HA 2QGRA 2QY0B 3SV9A 5DP9A 1Z8JB 2PWXA 2OC0A 3NPSA 4HTCH 1SGCA 2VIPA 4ISLA 1EPTB 1GI5A 3SV2H 3LDXH 1MTVA 2XTTB 1V2LT 3GCTG 4X1NU 4FXGH 3QK1A 2D2DA 3UUZA 5K0HA 4D76A 1C2GA 3ENSB 1AO5A 1K2I1 1A0JA 2ZECA 3LONA 5A0BA 3TJNA 3VB5A 2H5DA 3A88A 1P0SH 1C1MA 2P3FH 5AVDA 3P8OA 1GI1A 3URCA 1XUKA 4AFZA 1F0UA 2BD2A 2V3OH 3T62A 3E90B 2C3SA 3TNTA 1QA7A 1RD3B 3TPIZ 4K69A 1JRTA 2Y6TA 3HK6B 3M5MA 3QDZB 3I77A 1C1VH 2CXVA 1H9LB 1GG6B 2ZA5A 3SW2B 1VITG 3A89A 1H8IH 2ZFFH 1DT2A 3AVZA 1LHEH 4TWYA 1O2PA 1YPLH 5E2PA 3U1IB 3TNSA 3BTME 2KAIA 3HK3B 1QL9A 2EEKA 1THRH 4ABEA 1A7SA 2ZO3H 1ABIH 3MH5A 2JH0D 3K6ZA 7GCHF 4JK5A 4A1TA 1HFDA 1ESBA 2Z3EA 4PROA 1BITA 2B5TB 2R9PA 1B5GH 1FPHH 4E7RG 1TRMA 3UOPA 5H4IB 1C1RA 4YOJA 3A8DA 3MFJA 4IC6A 3KN2A 1VZQH 5A09A 1HB0B 1B0EA 3SU5A 4WMEA 2QCYA 3UWJH 1BCUH 1P06A 1S6HA 2A5KA 3M5LA 2BXTH 4HZHA 3PMHB 1W7GH 1LO6A 1XUFA 3FVFB 1OWDA 5IYTA 3TH2H 1O36A 1LVBA 3MH6A 2M5TA 1LCYA 2FX6A 1K1MA 2BXUH 4DY7B 1G37A 2XC5A 1GGDB 3GOVB 3HATH 1DS2E 3QN7A 3SJOA 1NRPH 3GY6A 5AHGH 3RM2H 5LPRA 4LZ1H 5DP5A 6LPRA 1LHFH 1VCQA 1TGNA 2ANWA 2PHBA 2Y7ZA 1C5MD 1SSXA 1HAYB 5DP8A 1GBIA 4H42U 1XKAC 2BZAA 1GMDG 1EXFA 4BAMB 2D26C 3MTYA 1MCTA 1HJAB 4TPYA 1O3PB 4BAOB 1F0RA 1IOEA 3SN8A 2ZTXA 3A7WA 5T3HA 1ZTKA 1VJAU 1A3EH 1FIWA 3GCNA 2ZDKA 1C2JA 1IHSH 1JWTA 3M3TA 1HIAA 4UFEH 4ZKRU 5DP3A 2ZDMA 4J1YA 5TCAA 3EA8A 2BX4A 3SQHE 1K21H 4Y10E 2AYWA 1AN1E 1UVTH 5EPNA 3RXMA 3BTFE 1B7XB 1VGCB 1P2MA 1GHZA 2A31A 3KIDU 1LQEA 1LHCH 1SC8U 3RXSA 1C5TA 1MZAA 3BEIB 4Z6AH 1P9UA 4FU9A 4I8JA 1DWBH 1OWKA 4CRGA 1QHRB 2ANMH 3KNXA 1ELDE 2G00A 2TGTA 2GCTB 2PV9B 4D9QA 2ZHFH 2PTNA 3E0NB 3EQ0H 2ZGXH 1ZGVA 3IWMA 1NM6A 2BDHA 2VWOA 1V2PT 2ZQ1A 4MG3A 1L4DA 3TITA 3TJVA 1E0FD 2BQ7B 3SI3H 3ZZ3A 1YPMH 3M7UA 1YPHE 2A4OA 1YGCH 5GCHG 2P94A 1TE0A 1KXBA 4O97A 3QX5H 5J4QA 2GZ8A 1BBRK 1K1JA 3PROA 2JETB 2VWMA 5GXPA 1UTLM 1TNIA 3ZZ9A 4D8NA 4K8YA 2QA9E 1HUTH 4YESB 3ZVGA 1SGTA 2AIQA 2P93A 4AOQA 2BY6X 2GCHG 2ZU2A 1QCPA 5HM9A 2FOGA 1HLTH 3HKIB 4WMDA 2HPPH 2H6MA 2J95A 5E0GA 5FPSA 2A1DB 3PLPA 5C2ZA 1GBDA 3M36A 4VGCC 1ANBA 4OS6A 5JBCS 1NN6A 3RXUA 2Y82A 1AMHA 1TPOA 1LKBA 1O3MA 4Q7YA 3UREA 1C5XB 2BD4A 1C2MA 2ZWLH 2XW9A 2F9PA 1GJ4H 3QTOH 4NA7A 1BRCE 1CHOG 1F7ZA 1V2VT 2XBXA 1O38A 4YT6H 2FTMA 1L2EA 3A86A 1T4UH 1H8DH 2TPIZ 1YCPH 1A5HA 1GL0E 8GCHG 3HGPA 2A7JA 4BAQB 3DUXH 2ZDNA 3C27B 2BOHB 2AFQB 1PQAA 1DWCH 1TNKA 5FBIA 1O2QA 1O3GA 1WUNH 1GBBA 1AU8A 4XSKU 2OLGA 2BX3A 2FOMB 3Q3XA 3RP2A 2PUQH 4GPGA 1XMNB 1YF4A 3KQBA 4Y7AA 1MKXH 5E2OA 2J34A 3UY9A 4TY7A 1P10A 4H6SB 4UFGH 1ELCA 1O2UA 4J2YB 2VH0A 4ZMAH 2FLBH 4A1XA 2P59A 4YOGA 2FDAA 2F91A 2FPZA 2BLQA 1BUIA 1BDAA 1A1RA 4Y8XA 2UWPA 1FY3A 4B75A 2ULLA 4WH8A 5A8XA 4LZ4B 3ZZ7A 1GI4A 2PLXA 3QLPH 1O5DH 1C4U2 1NRQH 4Y76A 3QZRA 1K1PA 2HNTC 5EQQA 1GBKA 1P11E 3QO6A 5ABWA 1C5LH 2GVFA 2VWLA 1FXYA 1NRSH 7ESTE 4OS7A 3BEFB 3SHAH 3EAJA 1AE8H 4JZFH 3GY8A 3Q3YA 5FAHA 2H5CA 2EA3A 4AFQA 1EAWA 2ZGJA 1O2NA 1ZSKA 1EAXA 2SGEE 1V2RT 2WPMS 1C5PA 2OD3B 1BMMH 1OX1A 2BB4A 1DITH 4JCNA 1ACBE 1K28D 5DK1A 1OSSA 1SGDE 1CO7E 1C1WH 1VCWA 5AFYH 2EI7A 5JDUB 3SNCA 4I8KA 2G5NA 1INCA 3RMLH 8LPRA 1Z71A 1MKWK 3PWCA 1HBTH 1YP9A 4NCYA 1S84A 1P2JA 1SLVB 3ZZBA 3LOXA 3MU4A 5DJ7A 2VIQA 4UD9H 4Y0YE 2BY5X 1TALA 2DUCA 1C5OH 3AW0A 4ZKSU 3RXEA 1D3TB 3VB4A 5JB9S 4CH2B 1A0LA 3OYPA 3CP7A 3KCGH 3UWIA 2Q6DA 2VINA 2Z9JA 2XC0A 1C5UA 4O3TA 1SLWB 5EXLA 3P92A 4CBNA 5FX6A 1HAVA 4YOIA 1IQEA 3SU4A 3TVJB 2BDYA 5FCKA 2IPHA 4CRAA 1YLCA 1UVUH 1GBFA 2TBSA 1FIZA 1NZQH 3M5OA 5ETXA 1XVMA 3FP7E 1DX5M 1C5ZB 1XX9A 2WYJA 1GDUA 3BIUH 4FUEA 1Q31A 1ZGIA 1OWHA 2Z3DA 2OQUA 1S5SA 1AB9C 1O0DH 1FUJA 2Z6BD 2PUXB 1SR5C 2PR3A 1Y8TA 1NROH 2ZHQH 1QRZA 1HPGA 2ZF0H 3PMBB 1UTOA 3ATLA 2BD8A 2WPLS 1FY8E 4TY6A 1GBMA 3LJJA 4GHQA 3RDZA 1GVKB 1HCGA 1D6RA 2ZI2H 4AN7A 1O32A 4GVUA 4AORA 5C1UA 3AW1A 1ARBA 1VGCC 3G01A 1NRNH 2JH5D 1O2KA 1O3BA 5LGOA 1HAXB 1HYLA 3KGPA 3RXRA 1H9IE 1A61H 1UCYK 4CH8B 2H9EH 4ZXYH 4NIVA 2BY9X 3SNEA 4FU7A 1Q3XA 2FOFA 4I8HA 3SHCH 3UFAA 1ZMLA 3UR6A 1TMBH 3U69H 1F0TA 4ESTE 1ESAA 3AAVA 1THPB 3FZZA 5EW2H 1O2LA 1A0HB 3BIVH 4RSPA 2FX4A 3E91A 3E16B 2IJOB 1KLJH 3C1KA 4FUJA 4X6NA 1THSH 2A7HA 2BMGB 4MNWA 1IQKA 3GCHC 2XC4A 1E38B 4X6PA 4D7FA 1KTTB 3BTTE 1SGYE 1P8VC 2UWLA 2HNTF 1D6WA 4CREA 3T27A 1FI8A 3GY4A 1EOJA 4IGDA 2JETC 2WPKS 1ZHMA 3ZV9A 2FMJA 3RM0H 1MTSA 1BTWA 1ELGA 2H9TH 4DCDA 3SBKA 3W95A 1GHAF 1W0YH 3VPKA 5A8ZA 4KTCA 3MO3A 1YPKH 1FLEE 2GP9B 1K1IA 4NIYA 1K22H 4X2VA 5T6FA 1Y3YA 3L3TA 4HGCA 3GDVA 2FIRH 2IOTA 1KLIH 1W10U 3BTKE 1SLXB 2BDIA 1BRBE 2F9VA 2O8LA 1GDQA 5L30H 1ARCA 4DURA 3KQDA 1D9IA 3Q77A 3LGVA 4E05H 3PLBA 2Z7FE 3UQOA 4AB9A 3R3GB 5FXLA 4M7GA 1CA8B 4ZH8A 5HGGA 1ZRBA 1UMAH 1O39A 2EI6A 2BLWA 3ZYEA 4AGJA 1PQ7A 4JZ1A 1MD8A 1NFWA 2R0KA 2HLCA 2YNAA 2HPQH
chains in the Genus database with same CATH superfamily
2G55A 5KGOA 1T7CA 2SNVA 3VEQB 1C5NH 3RXAA 5HKKD 2R3UA 1CHGA 4FUHA 4VGCB 1ETTH 1E37B 3ZZAA 1LVOA 2TGAA 1O3AA 1SQRA 2KAIB 4THNH 5FHTA 1Z1JA 1KXDA 4DT7B 2WV4A 5B6LA 1LKAA 4NSYA 1C1QA 1EAUA 1RTKA 2FWWA 3BTDE 1ELEE 2SFAA 3S7KB 1MCVA 1V6DA 4JZEH 3P70B 3GDUA 2BD5A 1BOQA 4ZKOU 3N7DA 1ORFA 4K60A 4UFFH 2W5EA 3ZYDA 2AERH 2J9NA 3NK8A 2THFB 3MU5A 2ZGCA 4MPWA 1FAXA 1EAIA 4XRNA 2P8OB 3P8GA 1AUTC 1RXPA 4CR5A 1E34B 1FY5A 2O9QA 4O3UA 2VIWA 2K1QA 1KY9A 1JOUB 1ZMJA 1V2MT 2QIQA 3MH7A 1K1LA 2SNWA 3ATKA 1O2IA 3TK6A 1BZXE 3VFEA 1P03A 4A6LA 2A0QB 1TQ7B 1JIMA 1QGFA 1XUGA 4FUGA 3RXHA 2GT8A 2OK5A 1KXFA 4YXWD 1LPZB 1P05A 1TFXA 1Y3WA 5DP6A 2B0FA 2C8ZB 4I8LA 1SL3A 1ETRH 2GT7A 2WPIS 1D3DB 7LPRA 1NPMA 1ANDA 4BXSA 1GPZA 1O5EH 3GY3A 4WMFA 4ASUD 1ZTLA 4GLYA 4FU8A 4WH6A 4OS5A 4ZROA 1GI6A 1O3NA 1C2DA 2PSXA 1G2MA 1Y5BT 1ANEA 2F83A 3PMAB 4DIHH 3W94A 2J94A 2SGDE 1MQ5A 4Y8ZA 1BTPA 4KTUA 1UTPA 1PPCE 4FETA 1H8ED 4NFEA 2XNDD 4R0IA 1HAHH 1TONA 2VIOA 4GHTA 4ZHAA 1DVAH 1NU7B 2CJIA 1HIAB 3NKKA 4UONA 1AZZA 1OS8A 3WWBA 2DE8A 2C8YB 5DKMA 2ZHDA 3KEEA 1TX8A 2W3KA 3EYDA 4YT7H 3D23A 2OBOA 5EOKA 5F8ZA 1O37A 1GL1A 3GY5A 1BJVA 3RXLA 1GHYH 1RGQA 3MMGA 4HG6A 2FOEA 5DGJA 3VGCC 4AZ2B 2KM0A 2VB0A 1TLDA 1C5RA 9LPRA 1QBVH 4ISIH 4DG4A 1ZPCA 4OS4A 3SORA 3RU4D 2XWBI 1NS3A 1P2QA 1C2KA 1CA0B 5HM2A 1P57B 1WYKA 2O8TA 3EA7A 4CRFA 2F43B 2ZKSA 1F92A 4OS1A 3P95A 2I6SA 1O31A 4ZCNA 1O3KA 4X6OA 3D49H 4NGAH 4I8GA 2A2QH 3EGKH 3PB1E 3NUMA 4Z1MD 1FQ3A 4AC9A 8ESTE 4AG1A 1NT1A 4IMZA 1HXEH 1GI2A 2Z9GA 4Q80A 2A7CA 3IITA 1P2OA 1XUJA 2GZ7A 4AYYB 1FV9A 1GVZA 5GJ4B 3RMNH 2W7SA 1IQHA 1C1NA 1C9TA 4UDWH 1BMLA 2NWNA 1O2YA 3L6PA 1AB9B 3OX7U 2ZC9H 2UWOA 3MNSA 2FOHA 2KFWA 1YM0A 1LDTT 1O30A 3ZIAD 1BT7A 2QXJA 1ABJH 2ZTZA 4YLQH 5EG4A 1CT2E 3F2HA 4H6TA 2QN5T 3VB3A 1NC6A 1L1JA 2RG3A 3O8RA 2VGCB 1AZ8A 1V2TT 1Y3VA 1ETSH 2LP6A 3LGWA 1YCPM 3D65E 1GHBG 1LHDH 3UNRA 2W3IA 2XBWA 4NWLA 5B6OA 4WVPE 1BRAA 1Y3UA 1GCTB 5EQSA 3TJOA 1Y5AT 3GICB 2QV1A 1JXPA 4KTSA 4U01A 2C8WB 3F1SB 4DOQA 2Y80A 1TRYA 2VVCA 2VVUA 4I32A 4ABIA 2GDDA 3GS9A 2Z9KA 2ZTYA 1T4VH 1C2FA 2ALVA 2STAE 1BTXA 1PYTD 1P2NA 1A5GH 5SGAE 5J4SA 2CV3A 4GCHF 4Y11E 1ZPBA 3RC5A 3M5NA 3MWIU 3GCTF 5EJLA 1RRKA 3ZZ4A 3A7XA 3FOAA 3GCOA 4NA8A 1AIXH 2F9NA 3GCHB 3KYGA 2AIPA 2AHME 1MTUA 5PTPA 3AASA 3TGJE 4BANB 1AGJA 1DY8A 1HAIH 3ATWA 3ZZ6A 3BG4C 1GMCG 3SU3A 3SV8A 1YPJH 2VU8E 3A7ZA 1WQVH 4WJG2 4Z0KA 1UVOA 4DJZB 1S0RA 4XDEA 3U28C 1ANCA 4RKJB 1O34A 1KXAA 1V3XA 1TX7A 1F5KU 2C90B 5E0JA 3N7OA 3LGUA 3MYWA 3A8AA 1O3JA 3BEUA 1SOTA 2I6QA 3LT3A 3RXIA 2PW8H 2ZFSA 3ZVAA 2BQWB 4Q63A 1VR1H 4WWYA 1GJCB 2PKSC 1QJ6B 4F4OC 1QRWA 1TGSZ 2BM2A 3IG6B 2BVSH 4AGKA 5DP4A 1D4PB 1YC0A 4XBBA 1G30B 1SGQE 2VH6A 1C4V2 2BHGA 2Y7XA 4SGAE 4FUCA 1W7XH 1BA8B 3P8NA 1U6QA 4B1TA 1EATA 1M9UA 4XOJA 1J9CH 1SLUB 2ZDVH 1GDNA 3FKSD 5DN6D 1EASA 1PFXC 1FY1A 3MOCA 1GJ8B 4BTUB 3S9BA 1Y5UT 1C1PA 1V2QT 3QWCH 2F9OA 2FYQA 2QF3A 2AGIX 1G32B 2G5VA 1GBHA 2P8OC 2ZPSA 3T25A 3U8RH 1QTFA 2ZU5A 1DXPA 2NU2E 1BB0B 1LPGB 3I29A 1GJ5H 3ZVCA 5T6GA 1EB1H 2TIOA 1W0KD 1MZDA 1WTGH 4CRDA 3SNBA 1G3CA 3MH4A 1G3EA 2V35A 4B73A 1K9OE 3GISB 1WV7H 2G51A 4OS2A 2GKVE 5HXFA 1MAXA 2PFEA 4H4FA 2ZNKH 3HKJB 1BHXF 3ZVFA 5JBAS 3FN8A 3SJ8A 1TPAE 1TGCA 1FPCH 3RXQA 1CGIE 3TJUA 1YKTA 4Y71A 4BTIB 4B2CA 1AVGH 2FTLE 2JJ2D 1YY3A 1SOZA 1NO9H 3M61U 4IN2A 1W14U 2P95A 4NG9H 1UW7A 3ZV8A 1E36B 2P3UB 2WSSD 1O3OA 3LH1A 3TK9A 3NCLA 2YNBA 3UAIC 1EOLA 1DSTA 6CHAC 1HAVB 2HNTE 1HXFH 1YWUA 1YPGH 1J8AA 4AFUA 1GHAG 4NZLA 1FX0B 2WUBA 1O2ZA 1C5VA 1XUHA 5F8XA 4F48B 2VIDA 1C5QA 3UTUH 1SFIA 1F2SE 1T31A 2BY8X 1TNGA 5LPEA 2WV5A 3OTPA 3LH3A 1DE7H 1LVMA 1TABE 4JK6A 1MAYA 2FOAA 1WQSA 5HYOA 3DHKH 3OEHD 2Y81A 5E8EH 1MBQA 1P3CA 1WTHD 2Z9IA 3ESTA 3SUDA 4I31A 1P12E 9ESTA 1DXWA 1ZYOA 1RS0A 3NWUA 2BD9A 3ZZ8A 3P17H 2VVVA 4F49A 2JJ1D 5FX5A 3H7TA 2GZ9A 1TA6A 4D9RA 3E8LA 2R0LA 1P01A 3ZVBA 1GJ9B 1CVWH 1O3CA 3RXKA 1CA0C 2ZGBH 2ZIQH 3TLOA 3O8CA 1O5CB 8KME2 3KQCA 3ODDA 4MQAA 5GDSH 1TBZH 1O35A 3FFGA 3PTBA 1FN8A 3DFJA 1UTKA 5TJXA 6ESTA 1T8MA 5GIBA 5EIYA 3U8TH 4TT3D 1G9IE 1TNJA 1O3DA 4IS5A 5KEDA 2QC2A 3ZZCA 1O2HA 2XBVA 1UVPA 2O8UA 3FP6E 1ELFA 1F5RA 1FZZA 1DWEH 3RLWH 4NZQA 3RMMH 3PLKA 2VJ1A 4E06H 1ELVA 4NA9H 2A2XH 1H4WA 1EZQA 4A92A 1KYNA 2J98A 1DLEA 3EDXB 1IQNA 5GCHF 5A0CA 3VGCB 1TIOA 3LPRA 4SGBE 2J4IA 1P02A 1TAWA 1S83A 2BTCE 4UEHH 3RXOA 4HFPB 3LGTA 4U2WA 1C1OA 1LMWB 2Z94A 3RXJA 1GJ7B 3RC6A 2QXGA 4YLUA 1CBWC 2ZFTA 1H1BA 3RLYH 2PKAB 1L4ZA 3RXCA 1C5WB 1DPOA 2XBYA 5C67A 1MD7A 2ALPA 2GCHF 5AF9H 1AY6H 4Y0ZE 2ZGHA 3GYLB 1W3CA 2TGPZ 2VGCC 3Q76A 4AFSA 1FNIA 1O5GH 2ZFRH 2H2ZA 5LH8A 1OP2A 3UR9A 6GCHF 3V12A 4KP0A 1AFQB 1O2VA 1GCTC 1V2UT 1BHXB 1GI8B 1S85A 4B71A 1EJAA 1AKSB 2KCAA 4CRCA 1SKYE 3DFLA 4MVNA 1ZJKA 2ANYA 4NIXA 5C3NA 1CE5A 5ESTE 1MABB 2ZEBA 1GCDA 3M37A 4YO9A 1W11U 1D3PB 1YBWA 1ZLRA 1EQ9A 1O3LA 7GCHG 2KCYA 3A8CA 1SHYA 1NBME 2V3MA 1DICA 1O3IA 1FDPA 1LHGH 3STIA 3A85A 2JDID 2QXIA 1ELTA 4QT8C 4Y8YA 2YOLA 3A80A 3BTEE 4AG2A 2GTBA 5FBEA 3SGBE 2B7DH 3ELAH 5EU8A 4MPXA 1NFUA 1OHHD 5L6NH 1AWHB 2J92A 1O2OA 1UK2A 4ABGA 1DSUA 5EGMA 3FAOA 5DP7A 2PKAA 3RXVA 4ZHMU 5EXMA 1IQIA 3NZIA 2P3TB 3A8BA 2EI8A 2AMQA 2BDBA 2ZHEH 4NFFA 4ASHA 5L2ZH 4BTTB 1MU8B 1RIWC 2RDEA 1O33A 1LVYA 2OTVA 4K2YA 3BSQA 2HWLB 5DO4H 2ZPRA 2Y5FA 4BAHB 5FPTA 3P8FA 1EKBB 2ESTE 1GI3A 2FP7B 5CHBA 4ZKNU 1CT4E 1QL7A 2KX4A 4INLA 1SGEE 5JBBS 1BRUP 2R2WU 3OFND 4ZUHA 1QRXA 3F6UH 4MLFB 1FONA 3M35A 3MI4A 1HV7A 5A8YA 3BG4B 1T8OA 1UTJA 2LPRA 2ZG0H 3F9EA 1GMHF 1AKSA 1W0ZU 2WPDD 1HAPH 2ASUB 5I25A 2WPJS 2QXHA 2F3CE 1Q2WA 5FPYA 2Y5HA 3E3TA 1E1RD 1S0QA 3UNSA 7KMEH 2A45B 4BAKB 2JKHA 4RT0A 3MU0A 1G2LA 2W7UA 1K1NA 1EP5A 2QF4A 2FZZA 2YMSC 1IQJA 2PKSB 2WUCA 4ABHA 2BVRH 3Q00A 4ISHH 5IDKA 1TOCB 5C1YA 2L6OA 4DVAU 4HI3A 3SO3A 2J2UA 3LU9B 1SGFG 1ZJDA 4X1QU 3BTQE 4GUXA 3NRLA 3RXPA 4Q2KA 1MQ6A 3EA9A 1DUEA 3PV5A 1GI0A 2A32A 2KCOA 1AFEH 3LIWA 2M2AA 2CN0H 1MU6B 5DPAA 1SQAA 1O2JA 4BOHA 4Y6DA 3T2NA 4DGJA 4K8BA 3SU6A 2ZFQH 1TMUH 3UQVA 1AUJA 1EUFA 1P9SA 2IJD1 4NWKA 2GV6A 1AVWA 2BDCA 1UTMA 4MPVA 3MU1A 1BTZA 4Y7BA 1O2RA 1OYQA 5EXNA 1GHXH 5BPEA 1TGTA 3S69A 1ESTA 1TNLA 2FO9A 4X0WU 1PJPA 1SMFE 1HGTH 4XBDA 3SUEA 4GCHG 2HGTH 1E1QD 3D62A 1TBQH 2XNIA 2SGFE 3K6YA 3UNQA 1V2OT 1QA0A 3ATIA 1J17T 1ZPZA 2ZQ2A 1Z8GA 3PYHA 2Q6GA 3SJKA 1ID5H 1TOMH 3KF2A 4IBLH 1XM1A 3F68H 1PPEE 2ZDAH 1P09A 2FXRA 1KMHB 2G81E 2PGQB 1ZR0A 4IMQA 2UUYA 1TMTH 1MBMA 3Q3KA 4MDSA 4YZUA 4B2AA 1QJ7B 6CHAB 1KDQA 2ZCHP 1O3FA 2G4UA 1QQUA 4ZAEA 4JZDH 1UCYH 1QB1A 3F0PA 3BTGE 1SGNE 1RJXB 2TRMA 1UHBA 2ZCLP 4E7NA 4X1RU 1GHWH 4FVBA 2WINI 2VWNA 1O5AB 2FM2A 1PQ5A 2SGPE 3F9HA 1YCPK 1TGBA 2QE7D 4BXWA 1G36A 2FOCA 1YLDA 1L1NA 2FOBA 5DSFA 2QYIA 3RMOH 1SPJA 1HAOH 2AGGX 2CMYA 4MNVA 2PGBB 2HVXA 4X1PU 5JYIA 5A2MH 1QIXB 4ABFA 3JZ2B 2HALA 1S6FA 2AEIH 1TPPA 1A4WH 3SV6A 1BTUA 1EPTA 5EODA 3PWBA 3F2GA 3CENA 3DSPA 1MKXK 1KIGH 1SGIB 3OU0A 3TH3H 1PPZA 5F03A 3SUFA 2SGQE 2XXLA 4ISOA 1GBLA 2ODPA 3TK5A 3ZVDA 1MUEB 1V2JT 3MNCA 3R0FA 3AK5A 4YTAA 1P2KA 1FAKH 1C4Y2 1V2ST 2CHAB 3TGIE 2OC1A 1UK4A 4ABBA 1WSSH 1VITH 3VXEH 1AFQC 1DUAA 2RA3A 1B0FA 2BVXH 3U9AH 3VB6A 1TBRH 3A7YA 1GHVH 1OP8A 2B9LA 1A3BH 2WPHS 1SVPA 2BDAA 3HGNA 2VIVA 3SU2A 2AS9A 5EQRA 3TGKE 1F5LA 1O2XA 4A1VA 3SUGA 4AYVB 3QUMP 2A5IA 1EJNA 1UTNA 5C0TA 1CBWB 1GI7B 1FJSA 5CMXH 4B74A 1EX3A 2NU4E 3LGYA 1DOJA 1C9PA 1BJUA 1QQ4A 1W13U 2JH6D 1J14A 4GSOA 3JZ1B 2CK3D 3MHWU 1T32A 1SFQB 3K9XB 3GY2A 1CSOE 1HJ8A 3STJA 1C1UH 3SJ9A 3BTWE 1ZHPA 5EPYA 3SV7A 4I7YH 3MO9A 5K7RA 1W2KH 1W8BH 1Z6JH 1ZRKA 3EE0B 3SGAE 3RUOA 1C5YB 1QBOA 1BIOA 3QZQA 5JPMH 5C5OA 4X2WA 1ZHRA 3HPTB 3BTHE 4KGAA 3CS7A 1IQFA 1EZSC 3PO1B 5GPIB 3M3SA 1V2KT 1WCZA 1T8NA 1FN6A 3A87A 2CF8H 1XXFA 1C2LA 1PPFE 3QGNB 3F3BA 1ELAA 4AB8A 3MO6A 1TPSA 2KZ4A 4X2XA 2NU1E 2XYAA 1PQ8A 3RU4E 3AAUA 3BF6H 4DIIH 1JBUH 1IQLA 1YLNA 2OUAA 3PMJA 5C5NA 2OC7A 3SGQE 1CGHA 1C2IA 1ELBA 2GX4A 4FUDA 3U98H 3BV9B 1OWEA 3H7OA 4XE4A 1QURH 2Z9LA 4FUFA 1G3DA 2BLOA 2AH4X 1RFNA 1QBNA 3URDA 2LNCA 1YYY1 2CGAA 1BQYA 4U30A 1YPHC 1AVXA 2AMPA 4CHAB 1TYNA 2HRVA 3LGIA 3N99A 1N8OC 1QR3E 3L33A 3M7TA 2AMDA 1TWXB 1BMNH 4A5TS 4OGYA 1QJ1B 1RIWB 1VITF 2OXSA 1EZUC 2FLRH 1K1OA 1CQQA 1DDJA 2ZU1A 2H9HA 4K1TA 1KLTA 1WAYB 3E6PH 1ZSLA 2CF9H 2ZDLA 3H09A 1WXRA 1TRNA 3ODFA 2G52A 1AQ7A 4B2BA 1GJAB 1AE5A 3RXGA 1F0SA 2F9UA 1ZMNA 4O03A 4UFDH 1TX6A 3F9FA 4DW2U 2GMTC 1DFPA 1SI5H 5CHAB 2OBQA 1XUIA 3RXFA 3FZDA 1X7AC 1HNEE 1UVSH 2D1JA 2STBE 1RTFB 3LC3A 2FS9A 2UUFB 3S9CA 3LC5A 1MH0A 3CS0A 4X1SU 6GCHG 2PTCE 4X8UH 2FI5E 2EY4C 4CR9A 4RKOB 2ILNA 3SQEE 1XXDA 2ANKH 2XCNA 3QTVH 1YPEH 1MTNB 1NRRH 3OSYA 1HAGE 4B76A 4JYUH 3B8JA 3MNBA 3T29A 5F6MA 2YMSB 1CU1A 5TCCA 4NSVA 3PV4A 2GD4B 3ZVEA 2RDLA 1EPTC 3GDSA 3LJOA 1EB2A 1BTHH 1NTPA 3UIRA 1QB9A 1LTOA 3O8DA 4X8VH 2C93B 5T6DA 4ISNA 2W6JD 2V0BA 1W0JD 3U8OH 4TWWA 1GJ6A 4JZIA 1SG8B 4ZXXH 1PYTC 3S7HB 5JB8S 2BQ6B 1UJ1A 1D3QB 3SU0A 5I46H 2FS8A 3A7VA 1IAUA 4MTBA 3V0XA 4XBCA 2XCFA 3M7QA 4IC5A 1IQGA 2DE9A 1N1LA 1A46H 1LPKB 1QB6A 2ZPQA 4X6MA 2FI3E 5C1XA 1SQOA 1GBJA 4JYTA 1H9HE 1UK3A 2J98B 3KL6A 1MTWA 1C2EA 1GMDF 1E35B 3T28A 1XVOA 4CBOA 1Z7KA 3SNAA 2SGAA 1GG6C 2C4FH 4INHA 2J5UA 4ABAA 1VJ9U 3DT0H 1A2CH 2ODQA 4A7IB 3SU1A 4CRBA 1O2MA 3W1EA 1O3EA 1C1SA 1G3BA 1H8HD 2B8OH 2EC9H 2R2MB 3DD2H 5C0UA 1LQDB 3T5FH 2ZZUH 5HIYA 1P3EA 3A81A 3ATMA 4NIWA 5BRRE 2XRCA 4TYDA 2HOBA 5GWZA 1P04A 1GMHG 1Y3XA 3QGJA 3SYJA 4ABJA 2OCVB 3K65B 1HRTH 2H1UA 4JYVH 4WXVA 1C1TA 3BN9A 2RFKC 1IQMA 1BBRE 1GHBF 3DSGA 4FUIA 1NY22 2WZQA 1COWD 1RTLA 4KELA 2ZCKP 1S82A 1DY9A 5CE1A 3PM3A 1C5SA 4OGXA 1BTYA 3A7TA 5L2YH 2V3HH 1JIRA 3V3MA 3UOUA 2V6NA 3GY7A 3OTJE 1NBMD 1FMGA 1TB6H 2CHAC 3O8BA 4B6EA 1O5FH 5FCRA 3B23B 2A4QA 1L0ZA 1ZSJA 1EFRD 1SGRE 4Q7ZA 1GGDC 5HMAA 5A0AE 1AI8H 3UB0A 5EJ1A 3S0NA 2UUKB 4RT1A 2UUJB 4XD7D 1O2WA 1TA2A 3KQEA 1O2TA 1Z8RA 1DM4B 1PPHE 1SGFA 1WBGB 1GMCF 2WYGA 4O9VA 3K2UA 3ITIA 3OY6U 2RCEA 1BBRH 1NESE 1O5BB 1GBAA 1W12U 1S81A 4BNRA 1OYTH 3F9GA 2BZ6H 1HJAC 2FESH 2C8XB 3FO8D 4ACBA 2P16A 1HAZB 2A5AA 3E0PB 1BMAA 4LXBH 3TH4H 2OC8A 2QF5A 2FODA 2QAAA 1T8LA 3BG8A 1SQTA 4IW4E 2KR7A 5F8TA 3TIUA 1J16A 1AD8H 3KQ5A 4OM9A 5LPFA 3ZZ5A 3OY5U 2BOKA 1TQ0B 4P02A 3DA9B 3SNDA 5C20A 1GJDB 1MMJN 2BD7A 1CHOF 4Q7XA 1O2GH 1QY6A 3PO1C 1V2WT 4UE7H 1CGJE 1L1GA 2BY7X 4P00A 1KXEA 2ZHWH 1PPBH 1EJMA 1GI9B 3GYMA 4X8TH 4ABDA 8GCHF 5JBTA 2W26A 4IN1A 3VB7A 1HDTH 1IHTH 1N6XA 2GGVB 5ESBA 2BDGA 1V2NT 2Z3CA 2BYAX 3FANA 2ZFPH 4FOUC 4LOYH 2RA0A 4RN6A 1DLKB 1GBCA 2GCTC 3SZNA 3I78A 3MU8A 1TNHA 2R3YA 4K5ZA 1Y59T 1ZZZA 2OP9A 1O3HA 3KYFA 1XKBC 1DANH 2VNTA 2XWAA 1O2SA 4WY3A 1WOFA 4JMYA 1OP0A 2G8TA 3P6ZB 1P2IA 4AX9H 1BMFD 1Z6EA 2KCPA 2PSYA 1OWIA 1VCPA 4CHAC 3RXDA 2GDEH 3WY8A 1N6YA 1OKXA 3UPEA 2VBCA 1OPHB 4ZHLU 2BLVA 2OINA 5CDFE 4LK4A 4GAWA 2IN2A 5AFZH 3S9AA 4U32A 1GJBB 2O8WA 4X8SH 2F9BH 5DG6A 1SB1H 1QL8A 2QF0A 2ZU3A 2ZP0H 3LKWA 1ZTJA 1UO6A 3A82A 1OXGA 4XFQA 5CHAC 3RC4A 1QNJA 2AGEX 3RXBA 2O8MA 4WXIA 3VXFH 3V13A 2ZU4A 2A4RA 4MPUA 1J15A 2ODYB 3A84A 3E1XB 1DWDH 4WF8A 5G4BA 1OOKB 1GBEA 3SOSA 3M3VA 2NU3E 1AHTH 4KKDA 2NU0E 1MTNC 2FEQH 5EW1H 3A83A 4TPIZ 1N8OB 1Z8IB 4X2YA 4D7GA 3H5CB 2J38A 3TU7H 3NXPA 4F55A 1UTQA 1A5IA 2A4GA 1EP6A 1GWAA 2GV7A 3PTNA 4Y79A 1Z1IA 3RXTA 2OQ5A 4I33A 2Q1JA 2BD3A 2TGDA 1JMOH 1KDQB 3RU4T 2WV9A 1WU1A 1GVLA 2FYRA 3MNXA 4R8TB 4K1SA 3B9FH 4K3JA 2D8WA 1HJ9A 1ZOMA 1KTSB 2GJGA 1MKWH 5HIZA 1AWFH 4FUBA 3F2FA 2WHXA 2GMTB 1GBTA 1KSNA 3U1JB 1SBWA 1UHBB 3DSOA 4INKA 4FVDA 2FI4E 1FY4A 4YM9A 1QFKH 1C2HA 3SI4H 3KHVA 1NU9A 1EZXC 3SJIA 1JRSA 1SGPE 1NFXA 3FP8E 1KXCA 1PPGE 3ZZDA 2G4TA 5EJZA 3V7TA 1OWJA 2Q6FA 1NFYA 3T26A 1UCYE 1CT0E 4MNYA 2Y5GA 4MNXA 1SHHB 4K1EA 5E0HA 2QGRA 2QY0B 3SV9A 5DP9A 1Z8JB 2PWXA 2OC0A 3NPSA 4HTCH 1SGCA 2VIPA 4ISLA 1EPTB 1GI5A 3SV2H 3LDXH 1MTVA 2XTTB 1V2LT 3GCTG 4X1NU 4FXGH 3QK1A 2D2DA 3UUZA 5K0HA 4D76A 1C2GA 3ENSB 1WDIA 1AO5A 1K2I1 1A0JA 2ZECA 3LONA 5A0BA 3TJNA 3VB5A 2H5DA 3A88A 1P0SH 1C1MA 2P3FH 5AVDA 3P8OA 1GI1A 3URCA 1XUKA 4AFZA 1F0UA 2BD2A 2V3OH 3T62A 3E90B 2C3SA 3TNTA 1QA7A 1RD3B 4I86A 4K69A 1JRTA 2Y6TA 3HK6B 3TPIZ 3M5MA 3QDZB 3I77A 1C1VH 2CXVA 1H9LB 2K0QA 1GG6B 2ZA5A 3SW2B 1VITG 3A89A 1H8IH 2ZFFH 1DT2A 3AVZA 1LHEH 4TWYA 1O2PA 4B6FA 1YPLH 5E2PA 3U1IB 3TNSA 3BTME 2KAIA 3HK3B 1QL9A 2EEKA 1THRH 2JIZD 4ABEA 1A7SA 2ZO3H 1ABIH 3MH5A 2JH0D 3K6ZA 7GCHF 4JK5A 4A1TA 1HFDA 1ESBA 2Z3EA 4PROA 1BITA 2B5TB 2J97A 2R9PA 1B5GH 1FPHH 4E7RG 1TRMA 3UOPA 5H4IB 1C1RA 4YOJA 3A8DA 3MFJA 4IC6A 3KN2A 1VZQH 5A09A 1HB0B 4RI0A 1B0EA 3SU5A 4WMEA 1QZ8A 2EQNA 2QCYA 3UWJH 1BCUH 1P06A 1S6HA 2A5KA 3M5LA 2BXTH 4HZHA 3PMHB 2V7QD 1W7GH 1LO6A 1XUFA 3FVFB 1OWDA 5IYTA 3TH2H 1O36A 1LVBA 3MH6A 2M5TA 1LCYA 2FX6A 1K1MA 2BXUH 4DY7B 1G37A 2XC5A 1GGDB 3GOVB 3HATH 1DS2E 3QN7A 3SJOA 1NRPH 3GY6A 5AHGH 3RM2H 5LPRA 4LZ1H 3MQKC 5DP5A 6LPRA 1LHFH 1VCQA 1TGNA 2ANWA 2PHBA 2Y7ZA 1C5MD 1SSXA 1HAYB 5DP8A 1GBIA 4H42U 1XKAC 2BZAA 1GMDG 1EXFA 4BAMB 2D26C 3MTYA 1MCTA 1HJAB 4TPYA 1O3PB 4BAOB 1F0RA 1IOEA 3SN8A 2ZTXA 3A7WA 5T3HA 4TSFD 1ZTKA 1VJAU 1A3EH 1FIWA 3GCNA 2ZDKA 1C2JA 1IHSH 1JWTA 3M3TA 1HIAA 4UFEH 4ZKRU 5DP3A 2ZDMA 4J1YA 5TCAA 3EA8A 2BX4A 3SQHE 1K21H 4Y10E 2AYWA 1AN1E 1UVTH 5EPNA 3RXMA 3BTFE 1B7XB 1VGCB 1P2MA 1GHZA 2A31A 3KIDU 1LQEA 1LHCH 1SC8U 3RXSA 1C5TA 1MZAA 2L74A 3BEIB 4Z6AH 1P9UA 4FU9A 4I8JA 1DWBH 3VG8A 1OWKA 4CRGA 1QHRB 2ANMH 3KNXA 1ELDE 2G00A 2TGTA 2GCTB 2PV9B 4D9QA 2ZHFH 2PTNA 3E0NB 3EQ0H 2ZGXH 1ZGVA 3IWMA 1NM6A 2HVYB 2BDHA 2VWOA 1V2PT 2ZQ1A 4MG3A 1L4DA 3TITA 3TJVA 1E0FD 2BQ7B 3SI3H 3ZZ3A 1YPMH 3M7UA 1YPHE 2A4OA 1YGCH 5GCHG 2P94A 1TE0A 1KXBA 4O97A 3QX5H 5J4QA 2GZ8A 2K8IA 1BBRK 1K1JA 3PROA 2JETB 2VWMA 5GXPA 1UTLM 1TNIA 2LELA 3ZZ9A 4D8NA 4K8YA 2QA9E 1HUTH 4YESB 5T1VA 3ZVGA 1SGTA 2AIQA 2P93A 4AOQA 2BY6X 2GCHG 2ZU2A 1QCPA 5HM9A 2FOGA 1HLTH 3HKIB 4WMDA 2HPPH 2H6MA 2J95A 5IK2D 5E0GA 5FPSA 2A1DB 3PLPA 5C2ZA 1GBDA 3M36A 5C17A 4VGCC 1ANBA 4OS6A 5JBCS 1NN6A 3RXUA 2Y82A 1AMHA 1TPOA 1LKBA 1O3MA 4Q7YA 3UREA 1C5XB 2BD4A 1C2MA 2ZWLH 2XW9A 2F9PA 1GJ4H 3QTOH 4M9FA 4NA7A 1BRCE 1CHOG 1F7ZA 1V2VT 2XBXA 1O38A 4YT6H 2FTMA 1L2EA 3A86A 5GNDA 1T4UH 1H8DH 2TPIZ 1YCPH 1A5HA 1GL0E 8GCHG 3HGPA 2A7JA 3F0OA 4BAQB 3DUXH 2ZDNA 3C27B 3DCLA 2BOHB 2AFQB 1PQAA 1DWCH 1TNKA 5FBIA 1O2QA 1O3GA 1WUNH 1GBBA 1AU8A 4XSKU 2OLGA 2BX3A 2FOMB 3Q3XA 3RP2A 2PUQH 4GPGA 1XMNB 1YF4A 3KQBA 4Y7AA 1MKXH 5E2OA 2J34A 3UY9A 4TY7A 1P10A 4H6SB 4UFGH 1ELCA 1O2UA 4J2YB 2VH0A 4ZMAH 2FLBH 4A1XA 2P59A 4YOGA 2FDAA 2F91A 2FPZA 2BLQA 1BUIA 1BDAA 1A1RA 4Y8XA 2UWPA 1FY3A 4B75A 1VKYA 2ULLA 4WH8A 5A8XA 4LZ4B 3ZZ7A 1GI4A 2PLXA 3QLPH 1O5DH 1C4U2 1NRQH 4Y76A 2IPQX 3PV2A 3QZRA 2W6ID 1K1PA 2HNTC 5EQQA 1GBKA 1P11E 3QO6A 5ABWA 1C5LH 2GVFA 2VWLA 1FXYA 1NRSH 7ESTE 4OS7A 3BEFB 3SHAH 3EAJA 1AE8H 4JZFH 3GY8A 3Q3YA 5FAHA 2H5CA 2EA3A 4AFQA 1EAWA 3SZEA 2ZGJA 3N7EA 1O2NA 1ZSKA 1EAXA 2SGEE 1V2RT 2WPMS 1C5PA 2OD3B 1BMMH 1OX1A 2BB4A 1DITH 4JCNA 4Q4LA 1ACBE 1K28D 5DK1A 1OSSA 1SGDE 1CO7E 1C1WH 1VCWA 5AFYH 2EI7A 5JDUB 3SNCA 4I8KA 2G5NA 1INCA 3RMLH 8LPRA 1Z71A 1MKWK 3PWCA 1HBTH 1YP9A 4NCYA 1S84A 1P2JA 1SLVB 3ZZBA 3LOXA 3MU4A 5DJ7A 2VIQA 4UD9H 4Y0YE 2BY5X 1TALA 2DUCA 1C5OH 3AW0A 4ZKSU 3RXEA 1D3TB 3VB4A 4DT4A 5JB9S 4CH2B 1A0LA 3OYPA 3CP7A 3KCGH 3UWIA 1E79D 2Q6DA 2VINA 2Z9JA 3OEED 2XC0A 1C5UA 4O3TA 1SLWB 5EXLA 3P92A 4CBNA 5FX6A 1HAVA 4YOIA 1IQEA 3SU4A 3TVJB 2BDYA 5FCKA 2IPHA 4CRAA 1YLCA 1UVUH 1GBFA 2TBSA 1FIZA 1NZQH 3M5OA 5ETXA 1XVMA 3FP7E 1DX5M 1C5ZB 1XX9A 2WYJA 1GDUA 2HLDD 3BIUH 4FUEA 1Q31A 1ZGIA 1OWHA 2Z3DA 2OQUA 1S5SA 1AB9C 1O0DH 1FUJA 3WW7A 2Z6BD 2PUXB 1SR5C 2PR3A 2XOKD 1Y8TA 1NROH 2ZHQH 1QRZA 1HPGA 2ZF0H 3PMBB 1UTOA 3ATLA 2BD8A 2WPLS 1FY8E 4TY6A 1GBMA 3LJJA 4GHQA 3RDZA 1GVKB 1HCGA 1D6RA 2ZI2H 4AN7A 1O32A 4GVUA 4AORA 5C1UA 3AW1A 1ARBA 5F53A 1VGCC 3G01A 1NRNH 3PRDA 2JH5D 1O2KA 4ACAA 1O3BA 5LGOA 1HAXB 1HYLA 3KGPA 5C94A 3RXRA 1H9IE 1A61H 1UCYK 4CH8B 2H9EH 3WWFA 4ZXYH 4NIVA 2YMSD 2BY9X 3SNEA 4FU7A 1Q3XA 2FOFA 4I8HA 3SHCH 3UFAA 1ZMLA 3UR6A 1TMBH 3U69H 1F0TA 4ESTE 1ESAA 3EE7A 3AAVA 1THPB 3FZZA 5EW2H 1O2LA 1A0HB 3BIVH 4RSPA 2FX4A 3E91A 3E16B 2IJOB 1KLJH 3C1KA 4FUJA 4X6NA 1THSH 2A7HA 2BMGB 4MNWA 1IQKA 3GCHC 2XC4A 1E38B 4X6PA 4D7FA 1KTTB 3BTTE 1SGYE 1P8VC 2UWLA 2HNTF 1D6WA 4CREA 3T27A 1FI8A 3GY4A 1EOJA 4IGDA 2JETC 2WPKS 1ZHMA 3ZV9A 2FMJA 3RM0H 3OE7D 1MTSA 1BTWA 3OAAD 2PP6A 1ELGA 2H9TH 4DCDA 3PRBA 3SBKA 5FL7D 3W95A 1GHAF 1W0YH 3VPKA 5A8ZA 4KTCA 3MO3A 1YPKH 2F4LA 1FLEE 2GP9B 1K1IA 4NIYA 1K22H 4X2VA 5T6FA 1Y3YA 3L3TA 4HGCA 3GDVA 2FIRH 2IOTA 1KLIH 1W10U 3BTKE 1S6LA 1SLXB 2BDIA 1BRBE 2F9VA 2O8LA 1GDQA 5L30H 1ARCA 5KECA 4DURA 1K0HA 3KQDA 1D9IA 3Q77A 3LGVA 4E05H 3PLBA 2Z7FE 3UQOA 4AB9A 3R3GB 5FXLA 4M7GA 1CA8B 4ZH8A 5HGGA 3CNRA 1ZRBA 1UMAH 1O39A 2EI6A 2BLWA 3ZYEA 4AGJA 1PQ7A 4JZ1A 1MD8A 1NFWA 2R0KA 2HLCA 2YNAA 2HPQH
chains in the Genus database with same CATH topology
2G55A 1T7CA 2SNVA 3VEQB 1C5NH 3RXAA 2R3UA 1CHGA 4FUHA 4VGCB 1ETTH 1E37B 3ZZAA 1LVOA 2TGAA 1O3AA 2KAIB 4THNH 5FHTA 1Z1JA 1KXDA 4DT7B 2WV4A 1LKAA 4NSYA 1C1QA 1EAUA 1RTKA 2FWWA 3BTDE 1ELEE 2SFAA 3S7KB 1MCVA 1V6DA 4JZEH 3P70B 3GDUA 2BD5A 1BOQA 4ZKOU 1ORFA 4K60A 4UFFH 2W5EA 3ZYDA 2AERH 2J9NA 3NK8A 2THFB 3MU5A 2ZGCA 4MPWA 1FAXA 1EAIA 2P8OB 3P8GA 1AUTC 1RXPA 4CR5A 1E34B 1FY5A 2O9QA 4O3UA 2VIWA 2K1QA 1KY9A 1JOUB 1ZMJA 1V2MT 2QIQA 3MH7A 1K1LA 2SNWA 3ATKA 1O2IA 3TK6A 1BZXE 3VFEA 1P03A 4A6LA 2A0QB 1TQ7B 1JIMA 1QGFA 1XUGA 4FUGA 3RXHA 2GT8A 1KXFA 1LPZB 1P05A 1TFXA 1Y3WA 5DP6A 2B0FA 2C8ZB 4I8LA 1SL3A 1ETRH 2GT7A 2WPIS 1D3DB 7LPRA 1NPMA 1ANDA 4BXSA 1GPZA 1O5EH 3GY3A 4WMFA 1ZTLA 4GLYA 4FU8A 4WH6A 4OS5A 4ZROA 1GI6A 1O3NA 1C2DA 2PSXA 1G2MA 1Y5BT 1ANEA 2F83A 3PMAB 4DIHH 3W94A 2J94A 2SGDE 1MQ5A 4Y8ZA 1BTPA 4KTUA 1UTPA 1PPCE 4NFEA 4R0IA 1HAHH 1TONA 2VIOA 4GHTA 4ZHAA 1DVAH 1NU7B 2CJIA 1HIAB 3NKKA 4UONA 1AZZA 1OS8A 2DE8A 2C8YB 5DKMA 2ZHDA 3KEEA 1TX8A 2W3KA 3EYDA 4YT7H 3D23A 2OBOA 5EOKA 5F8ZA 1O37A 1GL1A 3GY5A 1BJVA 3RXLA 1GHYH 1RGQA 3MMGA 2FOEA 5DGJA 3VGCC 4AZ2B 2VB0A 1TLDA 1C5RA 9LPRA 1QBVH 4ISIH 4DG4A 1ZPCA 4OS4A 3SORA 3RU4D 2XWBI 1NS3A 1P2QA 1C2KA 1CA0B 5HM2A 1P57B 1WYKA 2O8TA 3EA7A 4CRFA 2ZKSA 1F92A 4OS1A 3P95A 2I6SA 1O31A 1O3KA 4X6OA 3D49H 4NGAH 4I8GA 2A2QH 3EGKH 3PB1E 3NUMA 1FQ3A 8ESTE 4AG1A 1NT1A 4IMZA 1HXEH 1GI2A 2Z9GA 4Q80A 2A7CA 3IITA 1P2OA 1XUJA 2GZ7A 4AYYB 1FV9A 1GVZA 5GJ4B 3RMNH 2W7SA 1IQHA 1C1NA 1C9TA 4UDWH 1BMLA 2NWNA 1O2YA 3L6PA 1AB9B 3OX7U 2ZC9H 2UWOA 3MNSA 2FOHA 1YM0A 1LDTT 1O30A 1BT7A 2QXJA 1ABJH 2ZTZA 4YLQH 5EG4A 1CT2E 4H6TA 2QN5T 3VB3A 1NC6A 1L1JA 2RG3A 3O8RA 2VGCB 1AZ8A 1V2TT 1Y3VA 1ETSH 3LGWA 1YCPM 3D65E 1GHBG 1LHDH 3UNRA 2W3IA 2XBWA 4NWLA 5B6OA 4WVPE 1BRAA 1Y3UA 1GCTB 5EQSA 3TJOA 1Y5AT 3GICB 2QV1A 1JXPA 4KTSA 4U01A 2C8WB 3F1SB 4DOQA 2Y80A 1TRYA 2VVCA 2VVUA 4I32A 4ABIA 2GDDA 2Z9KA 2ZTYA 1T4VH 1C2FA 2ALVA 2STAE 1BTXA 1PYTD 1P2NA 1A5GH 5SGAE 5J4SA 2CV3A 4GCHF 4Y11E 1ZPBA 3RC5A 3M5NA 3MWIU 3GCTF 1RRKA 3ZZ4A 3A7XA 3GCOA 4NA8A 1AIXH 2F9NA 3GCHB 2AIPA 1MTUA 5PTPA 3AASA 3TGJE 4BANB 1AGJA 1DY8A 1HAIH 3ATWA 3ZZ6A 3BG4C 1GMCG 3SU3A 3SV8A 1YPJH 2VU8E 3A7ZA 1WQVH 4WJG2 4Z0KA 1UVOA 4DJZB 1S0RA 4XDEA 1ANCA 4RKJB 1O34A 1KXAA 1V3XA 1TX7A 1F5KU 2C90B 5E0JA 3N7OA 3LGUA 3MYWA 3A8AA 1O3JA 3BEUA 1SOTA 2I6QA 3LT3A 3RXIA 2PW8H 2ZFSA 3ZVAA 2BQWB 1VR1H 4WWYA 1GJCB 2PKSC 1QJ6B 4F4OC 1QRWA 1TGSZ 2BM2A 3IG6B 2BVSH 4AGKA 5DP4A 1D4PB 1YC0A 4XBBA 1G30B 1SGQE 2VH6A 1C4V2 2BHGA 2Y7XA 4SGAE 4FUCA 1W7XH 1BA8B 3P8NA 1U6QA 4B1TA 1EATA 1M9UA 4XOJA 1J9CH 1SLUB 2ZDVH 1GDNA 1EASA 1PFXC 1FY1A 3MOCA 1GJ8B 4BTUB 3S9BA 1Y5UT 1C1PA 1V2QT 3QWCH 2F9OA 2FYQA 2QF3A 2AGIX 1G32B 2G5VA 1GBHA 2P8OC 2ZPSA 3T25A 3U8RH 1QTFA 2ZU5A 1DXPA 2NU2E 1BB0B 1LPGB 3I29A 1GJ5H 3ZVCA 5T6GA 1EB1H 2TIOA 1MZDA 1WTGH 4CRDA 3SNBA 1G3CA 3MH4A 1G3EA 2V35A 4B73A 1K9OE 3GISB 1WV7H 2G51A 4OS2A 2GKVE 5HXFA 1MAXA 2PFEA 4H4FA 2ZNKH 3HKJB 1BHXF 3ZVFA 5JBAS 3SJ8A 1TPAE 1TGCA 1FPCH 3RXQA 1CGIE 3TJUA 1YKTA 4Y71A 4BTIB 4B2CA 1AVGH 2FTLE 1SOZA 1NO9H 3M61U 4IN2A 1W14U 2P95A 4NG9H 3ZV8A 1E36B 2P3UB 1O3OA 3LH1A 3TK9A 3NCLA 2YNBA 1EOLA 1DSTA 6CHAC 1HAVB 2HNTE 1HXFH 1YPGH 1J8AA 4AFUA 1GHAG 4NZLA 2WUBA 1O2ZA 1C5VA 1XUHA 5F8XA 2VIDA 1C5QA 3UTUH 1SFIA 1F2SE 1T31A 2BY8X 1TNGA 5LPEA 2WV5A 3LH3A 1DE7H 1LVMA 1TABE 4JK6A 1MAYA 2FOAA 1WQSA 5HYOA 3DHKH 2Y81A 5E8EH 1MBQA 1P3CA 1WTHD 2Z9IA 3ESTA 3SUDA 4I31A 1P12E 9ESTA 1DXWA 1ZYOA 1RS0A 3NWUA 2BD9A 3ZZ8A 3P17H 2VVVA 4F49A 5FX5A 3H7TA 2GZ9A 1TA6A 4D9RA 3E8LA 2R0LA 1P01A 3ZVBA 1GJ9B 1CVWH 1O3CA 3RXKA 1CA0C 2ZGBH 2ZIQH 3TLOA 3O8CA 1O5CB 8KME2 3KQCA 3ODDA 4MQAA 5GDSH 1TBZH 1O35A 3FFGA 3PTBA 1FN8A 3DFJA 1UTKA 5TJXA 6ESTA 1T8MA 5GIBA 3U8TH 1G9IE 1TNJA 1O3DA 4IS5A 2QC2A 3ZZCA 1O2HA 2XBVA 1UVPA 2O8UA 3FP6E 1ELFA 1F5RA 1FZZA 1DWEH 3RLWH 4NZQA 3RMMH 3PLKA 2VJ1A 4E06H 1ELVA 4NA9H 2A2XH 1H4WA 1EZQA 4A92A 1KYNA 1DLEA 3EDXB 1IQNA 5GCHF 5A0CA 3VGCB 1TIOA 3LPRA 4SGBE 2J4IA 1P02A 1TAWA 1S83A 2BTCE 4UEHH 3RXOA 4HFPB 3LGTA 4U2WA 1C1OA 1LMWB 2Z94A 3RXJA 1GJ7B 3RC6A 2QXGA 4YLUA 1CBWC 2ZFTA 1H1BA 3RLYH 2PKAB 1L4ZA 3RXCA 1C5WB 1DPOA 2XBYA 5C67A 1MD7A 2ALPA 2GCHF 5AF9H 1AY6H 4Y0ZE 2ZGHA 3GYLB 1W3CA 2TGPZ 2VGCC 3Q76A 4AFSA 1FNIA 1O5GH 2ZFRH 2H2ZA 5LH8A 1OP2A 3UR9A 6GCHF 3V12A 4KP0A 1AFQB 1O2VA 1GCTC 1V2UT 1BHXB 1GI8B 1S85A 4B71A 1EJAA 1AKSB 4CRCA 3DFLA 4MVNA 1ZJKA 2ANYA 4NIXA 5C3NA 1CE5A 5ESTE 2ZEBA 1GCDA 3M37A 4YO9A 1W11U 1D3PB 1YBWA 1ZLRA 1EQ9A 1O3LA 7GCHG 3A8CA 1SHYA 1DICA 1O3IA 1FDPA 1LHGH 3STIA 3A85A 2QXIA 1ELTA 4QT8C 4Y8YA 2YOLA 3A80A 3BTEE 4AG2A 2GTBA 5FBEA 3SGBE 2B7DH 3ELAH 5EU8A 4MPXA 1NFUA 5L6NH 1AWHB 2J92A 1O2OA 1UK2A 4ABGA 1DSUA 5EGMA 3FAOA 5DP7A 2PKAA 3RXVA 4ZHMU 5EXMA 1IQIA 3NZIA 2P3TB 3A8BA 2EI8A 2AMQA 2BDBA 2ZHEH 4NFFA 4ASHA 5L2ZH 4BTTB 1MU8B 1RIWC 1O33A 1LVYA 2OTVA 4K2YA 3BSQA 2HWLB 5DO4H 2ZPRA 2Y5FA 4BAHB 5FPTA 3P8FA 1EKBB 2ESTE 1GI3A 2FP7B 4ZKNU 1CT4E 1QL7A 4INLA 1SGEE 5JBBS 1BRUP 2R2WU 4ZUHA 1QRXA 3F6UH 4MLFB 1FONA 3M35A 3MI4A 1HV7A 5A8YA 3BG4B 1T8OA 1UTJA 2LPRA 2ZG0H 3F9EA 1GMHF 1AKSA 1W0ZU 1HAPH 2ASUB 5I25A 2WPJS 2QXHA 2F3CE 1Q2WA 5FPYA 2Y5HA 3E3TA 3UNSA 1S0QA 7KMEH 2A45B 4BAKB 2JKHA 3MU0A 1G2LA 2W7UA 1K1NA 1EP5A 2FZZA 1IQJA 2PKSB 2WUCA 4ABHA 2BVRH 3Q00A 4ISHH 5IDKA 1TOCB 5C1YA 4DVAU 4HI3A 3SO3A 2J2UA 3LU9B 1SGFG 1ZJDA 4X1QU 3BTQE 4GUXA 3RXPA 4Q2KA 1MQ6A 3EA9A 1DUEA 1GI0A 2A32A 1AFEH 3LIWA 2CN0H 1MU6B 5DPAA 1SQAA 1O2JA 4BOHA 4Y6DA 3T2NA 4DGJA 4K8BA 3SU6A 2ZFQH 1TMUH 3UQVA 1AUJA 1EUFA 1P9SA 4NWKA 2GV6A 1AVWA 2BDCA 1UTMA 4MPVA 3MU1A 1BTZA 4Y7BA 1O2RA 1OYQA 5EXNA 1GHXH 5BPEA 1TGTA 3S69A 1ESTA 1TNLA 2FO9A 4X0WU 1PJPA 1SMFE 1HGTH 4XBDA 3SUEA 4GCHG 2HGTH 3D62A 1TBQH 2XNIA 2SGFE 3K6YA 3UNQA 1V2OT 1QA0A 3ATIA 1J17T 1ZPZA 2ZQ2A 1Z8GA 3PYHA 2Q6GA 3SJKA 1ID5H 1TOMH 3KF2A 4IBLH 1XM1A 3F68H 1PPEE 2ZDAH 1P09A 2FXRA 2G81E 2PGQB 1ZR0A 4IMQA 2UUYA 1TMTH 1MBMA 3Q3KA 4MDSA 4YZUA 4B2AA 1QJ7B 6CHAB 1KDQA 2ZCHP 1O3FA 2G4UA 1QQUA 4ZAEA 4JZDH 1UCYH 1QB1A 3BTGE 1SGNE 1RJXB 2TRMA 1UHBA 2ZCLP 4E7NA 4X1RU 1GHWH 4FVBA 2WINI 2VWNA 1O5AB 2FM2A 1PQ5A 2SGPE 3F9HA 1YCPK 1TGBA 4BXWA 1G36A 2FOCA 1YLDA 1L1NA 2FOBA 2QYIA 3RMOH 1SPJA 1HAOH 2AGGX 2CMYA 4MNVA 2PGBB 2HVXA 4X1PU 5JYIA 5A2MH 1QIXB 4ABFA 3JZ2B 2HALA 1S6FA 2AEIH 1TPPA 1A4WH 3SV6A 1BTUA 1EPTA 5EODA 3PWBA 3CENA 1MKXK 1KIGH 1SGIB 3OU0A 3TH3H 1PPZA 5F03A 3SUFA 2SGQE 2XXLA 4ISOA 1GBLA 2ODPA 3TK5A 3ZVDA 1MUEB 1V2JT 3MNCA 3R0FA 4YTAA 1P2KA 1FAKH 1C4Y2 1V2ST 2CHAB 3TGIE 2OC1A 1UK4A 4ABBA 1WSSH 1VITH 3VXEH 1AFQC 1DUAA 2RA3A 1B0FA 2BVXH 3U9AH 3VB6A 1TBRH 3A7YA 1GHVH 1OP8A 2B9LA 1A3BH 2WPHS 1SVPA 2BDAA 3HGNA 2VIVA 3SU2A 2AS9A 5EQRA 3TGKE 1F5LA 1O2XA 4A1VA 3SUGA 4AYVB 3QUMP 2A5IA 1EJNA 1UTNA 1CBWB 1GI7B 1FJSA 5CMXH 4B74A 1EX3A 2NU4E 3LGYA 1DOJA 1C9PA 1BJUA 1QQ4A 1W13U 2JH6D 1J14A 4GSOA 3JZ1B 3MHWU 1T32A 1SFQB 3K9XB 3GY2A 1CSOE 1HJ8A 3STJA 1C1UH 3SJ9A 3BTWE 1ZHPA 5EPYA 3SV7A 4I7YH 3MO9A 5K7RA 1W2KH 1W8BH 1Z6JH 1ZRKA 3EE0B 3SGAE 3RUOA 1C5YB 1QBOA 1BIOA 3QZQA 5JPMH 5C5OA 4X2WA 1ZHRA 3HPTB 3BTHE 4KGAA 3CS7A 1IQFA 1EZSC 3PO1B 5GPIB 3M3SA 1V2KT 1WCZA 1T8NA 1FN6A 3A87A 2CF8H 1XXFA 1C2LA 1PPFE 3QGNB 1ELAA 4AB8A 3MO6A 1TPSA 4X2XA 2NU1E 2XYAA 1PQ8A 3RU4E 3AAUA 3BF6H 4DIIH 1JBUH 1IQLA 2OUAA 3PMJA 5C5NA 2OC7A 3SGQE 1CGHA 1C2IA 1ELBA 2GX4A 4FUDA 3U98H 3BV9B 1OWEA 3H7OA 4XE4A 1QURH 2Z9LA 4FUFA 1G3DA 2BLOA 2AH4X 1RFNA 1QBNA 3URDA 2LNCA 1YYY1 2CGAA 1BQYA 4U30A 1YPHC 1AVXA 2AMPA 4CHAB 1TYNA 2HRVA 3LGIA 1N8OC 1QR3E 3L33A 3M7TA 2AMDA 1TWXB 1BMNH 4A5TS 4OGYA 1QJ1B 1RIWB 1VITF 2OXSA 1EZUC 2FLRH 1K1OA 1CQQA 1DDJA 2ZU1A 2H9HA 4K1TA 1KLTA 1WAYB 3E6PH 1ZSLA 2CF9H 2ZDLA 1TRNA 3ODFA 2G52A 1AQ7A 4B2BA 1GJAB 1AE5A 3RXGA 1F0SA 2F9UA 1ZMNA 4O03A 4UFDH 1TX6A 3F9FA 4DW2U 2GMTC 1DFPA 1SI5H 5CHAB 2OBQA 1XUIA 3RXFA 3FZDA 1X7AC 1HNEE 1UVSH 2D1JA 2STBE 1RTFB 3LC3A 2FS9A 2UUFB 3S9CA 3LC5A 1MH0A 3CS0A 4X1SU 6GCHG 2PTCE 4X8UH 2FI5E 4CR9A 4RKOB 2ILNA