2FODA

Structure of porcine pancreatic elastase in 80% ethanol
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords elastase-1
publication title Multiple solvent crystal structures: Probing binding sites, plasticity and hydration
pubmed doi rcsb
molecule tags Hydrolase
total genus 59
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2006-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fodA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fodA01
3FVFB 4X1QU 5IYTA 5DP7A 1AKSA 4WXIA 4B74A 3A8AA 2UWOA 1ELFA 2FOFA 1YPHC 1KSNA 2OC0A 1UTMA 2VIPA 3GCHC 3O8BA 4Y7BA 3RXTA 1ZMLA 2KAIA 2Z6BD 3ZVFA 1QIXB 4CRCA 1ZSLA 3SU4A 1T4UH 3GCOA 3ZZ3A 2R0KA 4ESTE 1DLKB 4AORA 3OY5U 1P02A 4BAOB 2UWPA 4Q7ZA 4TPYA 3SGQE 4LXBH 5EU8A 1XUJA 1W0YH 1HAVB 2G51A 4I32A 1TE0A 1C5WB 1E0FD 3E91A 1IQIA 7KMEH 4RN6A 1RIWB 1ZTLA 1DOJA 3RUOA 2VGCB 4INHA 2OCVB 3U8TH 2ULLA 1OX1A 1YPMH 3A82A 3K65B 2JH6D 1GMCF 2WPJS 2BMGB 2Y81A 1GBKA 3ZZCA 1UVPA 4Y0ZE 1HAOH 2C8XB 2DE9A 5DP6A 2OD3B 3A7ZA 3KCGH 1ZRKA 1NFUA 1K2I1 3ELAH 1RXPA 4INLA 1XVMA 1UVOA 4ABAA 2BY6X 4JZDH 1C5ZB 4PROA 5EQQA 5EW2H 1SGYE 1GJ8B 1SGQE 1BTZA 2ZPRA 1FXYA 1YBWA 1XX9A 4BXSA 1W2KH 1BDAA 3QWCH 1AVXA 2PTNA 3PYHA 1WQVH 4ZUHA 4YO9A 3U8OH 5FXLA 3P95A 2VVVA 1EPTB 4JMYA 1KXEA 2XBVA 1W7GH 2QCYA 3RXJA 1IQLA 1CSOE 2RG3A 2EI7A 2CHAC 1C5LH 1P8VC 6CHAB 1YPHE 3SNDA 4XBDA 2OXSA 1SSXA 1SMFE 2GVFA 1O3PB 1VITG 4DIIH 2A4QA 1H8IH 1PPEE 5DG6A 1DANH 1EJNA 4I8GA 3A7TA 1NRNH 4CRAA 3W94A 1V2ST 1HAVA 2EI8A 3FAOA 1FN6A 1C2HA 4FU8A 4WMEA 3LGTA 3TGKE 1YM0A 2TPIZ 2VU8E 3LGYA 4R8TB 1O2UA 1XUKA 3NK8A 4BANB 2ZU5A 4D7GA 2BDYA 4FUEA 4GHTA 1O3NA 3NUMA 1JRTA 1P2IA 4WMFA 1NRSH 1W3CA 3GY6A 2WPLS 6LPRA 3I78A 2P3FH 4B2BA 1GJCB 4YOJA 2A5KA 1RTKA 5CHAB 3QGJA 1D3TB 2RDLA 4IBLH 3A7VA 4ZROA 1Y3VA 4WVPE 4TY7A 1GHYH 3K2UA 2ZPQA 3M5OA 1Z71A 4B73A 4X1SU 3E0NB 2ODQA 2FTLE 2YOLA 3SV7A 3TK5A 1LKAA 2ZI2H 1ZZZA 1SHHB 1P2JA 1UVTH 1EATA 1SOZA 4FU7A 4AN7A 1TX7A 3MNSA 1FI8A 5GCHG 1NU9A 1D3DB 1L1GA 3S0NA 1EPTA 2WPHS 1TX6A 5F8XA 4BTUB 1DDJA 2Q1JA 4LK4A 1CHGA 1NM6A 1O2PA 3IWMA 3GICB 1CHOG 2PSXA 4YM9A 3V3MA 2QA9E 1LMWB 3STIA 1AWHB 2BQWB 4SGAE 1ZPCA 4ABEA 1Q2WA 4ZXXH 3V0XA 1SGTA 1QR3E 4ISHH 2ZEBA 5LPFA 4B76A 2TIOA 2ZU4A 1TMBH 1YPKH 1GMHG 3GY4A 4R0IA 1C2EA 2QXIA 1GDNA 2RA0A 3Q3KA 1AFEH 4VGCC 1TGTA 2YNAA 4O9VA 1LHDH 1QJ7B 3RP2A 4INKA 1T31A 5C20A 2OBOA 1HFDA 3ZZ9A 3ZZAA 1YGCH 3BIVH 1THSH 1O32A 4FVBA 3LC5A 4Z6AH 3P17H 3V7TA 1MD7A 2ZFPH 4ZKSU 4FUCA 2ZC9H 2FOCA 1P09A 1O35A 3A87A 2J95A 5EPYA 4NWKA 3SJOA 3T62A 2AIQA 3U9AH 2VIOA 1CGJE 4U32A 4ZH8A 4U30A 1C5RA 3PROA 3QUMP 4X2YA 1H9IE 1ETRH 1YLDA 1V2VT 3M5LA 1CA0C 2BB4A 1BHXB 4H6SB 1P05A 5C3NA 1TRMA 5A8YA 3Q3XA 2QF0A 2XCFA 1JIRA 5EQSA 2BOKA 4BAMB 2AEIH 2H9EH 4NG9H 3N7OA 5K0HA 2R2WU 5C1XA 5EXNA 3VXEH 3AVZA 4K8YA 1GBFA 3LGUA 3O8RA 1ARBA 2W7SA 3PWCA 4AZ2B 1FJSA 2BZAA 5DP4A 5A0AE 2W3IA 5C5NA 2O8UA 2QXJA 2J34A 1VCQA 1CVWH 2GDDA 1GJDB 1Y5BT 1NRRH 1AFQC 2C8YB 5HM2A 2ZU2A 3BG4B 3KIDU 5L2YH 5EW1H 3LJJA 1EXFA 1QY6A 5DP5A 1E36B 1GMDF 1XUGA 3MU0A 2HPPH 2QYIA 2FO9A 5F03A 3UR9A 1ZSKA 5E0JA 5BPEA 3M35A 1BBRE 2ANWA 1GJ9B 1T8MA 1SLUB 3O8DA 2UUKB 2FYQA 3UQOA 2ZPSA 3A7YA 1C5OH 3SW2B 1NU7B 1PPBH 4Y71A 1V2NT 4NSYA 1QURH 3T2NA 3PMHB 3PWBA 4JYTA 1BRAA 5LH8A 2W3KA 1K1OA 3SU0A 3V13A 2FOMB 1OPHB 2F9NA 3D62A 2OLGA 1TNGA 1Z8GA 4FUBA 4MLFB 4Q80A 1O2HA 4XOJA 1CBWB 4MG3A 1ELGA 1TPPA 1B5GH 1GL0E 5F6MA 8LPRA 1AN1E 3MI4A 2P94A 2FI3E 3GCHB 3RXAA 4ZHMU 1FZZA 1UCYH 2BY9X 2WPIS 2ZCLP 1EAWA 4ZKRU 1BTWA 1PQ7A 1ANDA 4UFGH 2FPZA 3BTME 4HTCH 1YP9A 2FOEA 4J2YB 1BRUP 4D9RA 1GWAA 3LT3A 1JOUB 2QV1A 2LPRA 2ZIQH 3M3SA 4A1VA 2HVXA 1YPEH 3F6UH 4Y10E 1O2GH 2GCHG 1O3KA 1UK4A 3QGNB 1QBVH 4JYVH 3RLYH 1V2PT 3U69H 3TH2H 3A85A 5J4SA 2GCTC 2Z94A 2ALPA 1QNJA 1ABIH 1E37B 1HLTH 4WJG2 1LPGB 3FP7E 2W26A 4CHAB 1EAIA 3LGWA 3SJ8A 5LPEA 1FDPA 4UONA 1YPLH 3GY2A 8KME2 2F3CE 1NS3A 3RDZA 3D49H 2OC1A 1E34B 3C27B 1FY5A 1GHAG 3PTBA 1D3PB 2B5TB 3HK6B 4BTTB 3FP6E 4AFQA 4E06H 1E38B 1C1PA 2SFAA 3SU3A 2PR3A 1WTGH 1GDQA 2WPKS 3QTOH 1SGEE 1OWDA 1XUHA 3A8BA 5J4QA 1K9OE 1TA2A 3K9XB 2ZGJA 2ZQ1A 5BRRE 3SORA 1UJ1A 1TFXA 1VCWA 3FANA 2BD4A 1C1NA 4NZQA 1S81A 1HAHH 1QBOA 3Q77A 2CHAB 1F7ZA 2J9NA 3KGPA 1V2JT 1JIMA 2LNCA 1BZXE 2ZTYA 1QB1A 1V2RT 2H9HA 2VINA 3DFLA 2G52A 2Y5HA 1ID5H 5B6OA 4AFZA 1K28D 1KXBA 1C2IA 1O2LA 3RC5A 4SGBE 2V3HH 1FY3A 3GY8A 3EGKH 3A7WA 3SOSA 4ZKOU 4OS5A 1EX3A 1YF4A 1ORFA 1HJAB 1EP5A 1Q3XA 2PGBB 3HATH 3SU2A 1V2QT 2CV3A 1HV7A 1C2GA 4DURA 1EP6A 1WAYB 1CA8B 1PQ5A 1UMAH 2HNTF 1KXFA 2A31A 4MDSA 2H9TH 1IQMA 1ANCA 1F5RA 2XTTB 3U1JB 2H5CA 4Y79A 3BEIB 4IN2A 5AFZH 5EQRA 1LHEH 5ESTE 5FAHA 1MTSA 1UTPA 1GCTB 1GBLA 2HNTC 1P2QA 4OS7A 2VH0A 1ZGVA 1WQSA 2K1QA 2BD9A 1QHRB 3SNEA 1ACBE 2VIQA 1A0LA 1O39A 2DE8A 1A5GH 3DT0H 2WYJA 4FUDA 4JZFH 4CH8B 1W10U 1JWTA 5AVDA 2IOTA 1NPMA 3MU8A 2SGQE 2FEQH 1GHWH 4Y76A 3HGNA 4Y6DA 2AYWA 1DXPA 1IQGA 1EB1H 2WINI 4CREA 2F9PA 1O2OA 2H2ZA 1C5SA 3RU4T 1DSUA 1THRH 1EZSC 2D2DA 3UTUH 1FPHH 2PV9B 2ILNA 1F0TA 2A4OA 4IN1A 5JBTA 2G4UA 1MTUA 1KTTB 1YYY1 3RXUA 3ZYEA 1MKWK 1F0RA 2AGIX 1YCPH 2QGRA 1O2YA 1AU8A 1WU1A 2BQ6B 2O8WA 3MMGA 1H9LB 4X6NA 4OGXA 2F9UA 1UTKA 4E05H 1GBHA 1MUEB 4U2WA 3SZNA 3GY5A 1HJ9A 2P93A 2D26C 1SGFG 2TGAA 3TGIE 3HKIB 2XC5A 4E7NA 1HYLA 4H42U 1C1MA 3TJNA 2AIPA 3EA9A 3A7XA 1BJVA 4CR5A 4AG2A 1L2EA 2W7UA 4KTUA 1GBAA 1RS0A 1C2LA 3HKJB 3RXKA 3RXLA 2VVCA 1P0SH 4NGAH 2HNTE 3TH3H 2STAE 3ZVEA 5A0CA 1AI8H 2R2MB 2Y6TA 3U1IB 4AB8A 4IC5A 3IG6B 5FBEA 4MTBA 4DY7B 3TK9A 6GCHG 1IQFA 1G3EA 1JXPA 3MWIU 1J16A 2EEKA 1DT2A 1NFXA 2ZHQH 1G3DA 2P3TB 2A45B 3RMOH 3A88A 3UQVA 2SGFE 1HAGE 1FONA 1Y3XA 1ZGIA 2ZDAH 4I8JA 2FMJA 1OYQA 3TVJB 4DOQA 2FTMA 2V35A 3U98H 1QA0A 4NZLA 1QBNA 4K69A 3QZQA 3SJIA 1P2MA 3KNXA 2W5EA 1IHSH 1W7XH 5HGGA 1G30B 2A4GA 3PO1B 2CXVA 2BDCA 1GI7B 3HPTB 1QA7A 1C5PA 4O03A 5HYOA 4BAKB 2GZ7A 1TQ7B 1RTFB 4ABDA 4O97A 4F4OC 2HGTH 3KQCA 3RXEA 2NU2E 4I7YH 4ASHA 1J8AA 2UWLA 1XMNB 1GJBB 1P10A 5FPSA 4GCHF 5H4IB 1DS2E 3I77A 1O2IA 2BY7X 1Z6JH 1GHBF 2F83A 2AMDA 2GMTC 2STBE 1EKBB 2OC7A 4GPGA 4TYDA 1F0UA 1O5DH 3EA7A 3PLKA 2TGTA 1C2KA 1MQ5A 4RKJB 3M3TA 3NZIA 5ABWA 1GHZA 5E2OA 2F9OA 1Z8IB 2Z3DA 1CQQA 1HIAB 5GJ4B 1ZLRA 1XUIA 5EXMA 3T25A 2XXLA 3PMJA 4ABFA 1PPGE 4NIXA 5JBCS 1YCPK 3MO3A 5GWZA 3DA9B 3BTDE 2H6MA 3QK1A 3RXSA 2ZHEH 1P01A 1K1NA 1O2NA 1OYTH 1Z7KA 1G32B 1KLIH 1ELBA 3SQEE 4A92A 1GMDG 1K1PA 3PMBB 1RRKA 3S9BA 5EGMA 1TABE 1SGRE 1SG8B 1GGDC 4XDEA 5DO4H 2GDEH 1DITH 1HB0B 1KDQB 3P8NA 5DK1A 3T27A 1TPAE 2BLWA 2C93B 1DFPA 3MTYA 1C9TA 1HPGA 4I33A 4X1NU 3WY8A 2FDAA 3MH5A 1YCPM 2VIWA 1XVOA 4DT7B 3SUFA 3UNQA 1GI1A 1SHYA 2D1JA 2BD7A 3AAUA 1ESAA 4HFPB 1S0QA 4AYYB 1RJXB 1ZHPA 4K2YA 5T6FA 1S6FA 5AF9H 2BDGA 2ZFRH 5HXFA 2PKSC 2NWNA 1NTPA 3SNAA 3MH6A 1XXFA 3Q76A 1ELVA 1O3LA 4X8TH 1BOQA 3B8JA 3W95A 1P04A 5C1UA 4UEHH 3RLWH 3V12A 1O3FA 1SL3A 1RTLA 1HAYB 1GVLA 1A4WH 2TBSA 1GI2A 1BTPA 1O37A 1C5QA 2NU0E 5T6GA 3E1XB 1TAWA 1ZHRA 2C8ZB 1MZDA 4WF8A 2JETC 1QL8A 4B75A 2BDHA 4Y0YE 1O2QA 2FLBH 1SQOA 2ZNKH 1HIAA 3NXPA 4DG4A 1SLWB 2PUXB 2PLXA 3RC6A 1AVGH 2FX6A 1W12U 2Z9GA 3GY7A 3BEFB 4D76A 1IQNA 2ZA5A 2FOGA 1XKAC 1GBJA 1THPB 1CGHA 1YLCA 3E6PH 2BVXH 5EXLA 2J2UA 4NSVA 2A5AA 2Z7FE 1UHBB 4AFSA 3VXFH 2FLRH 4BAHB 2WV4A 1ANBA 4X2VA 3P8FA 1WUNH 3TNTA 1CO7E 2P95A 1QFKH 1V2KT 4JK5A 1O5CB 1EZQA 1O3IA 1KYNA 4YOIA 1C1SA 2JH0D 3RXIA 3SV6A 3SJKA 1O5GH 1YKTA 1OXGA 1LO6A 1KDQA 1Q31A 2ZFTA 2BLOA 3PB1E 4UFDH 3SQHE 3IITA 1MTWA 3LIWA 1HAZB 2I6SA 3VB5A 1NN6A 2AH4X 1AUJA 2RA3A 1Z8JB 1O0DH 1SGPE 3ATWA 2ANMH 1C1TA 2C90B 1C2JA 3NKKA 1TA6A 1UVSH 2PUQH 3RXFA 1HNEE 3KHVA 3GYLB 4A1XA 1VCPA 1D9IA 3EDXB 3ATIA 3TITA 4AFUA 1BQYA 4XE4A 3EAJA 4MNWA 1C5TA 4FUFA 5C2ZA 2CN0H 3SNBA 2FIRH 3UOUA 1GCDA 1WTHD 2O9QA 1H8DH 5HMAA 4BTIB 2GD4B 2CF8H 5JB9S 6ESTA 1AZZA 1TPOA 3FFGA 8GCHF 1FAXA 3ZZ7A 1LDTT 1QJ6B 3AW0A 4LZ4B 1MKXK 1C1VH 4E7RG 2ZDKA 2CMYA 3S7KB 4Q7YA 4MNXA 1OS8A 1MU6B 1EOLA 4UFEH 3ZVCA 1O34A 1N8OC 1KLTA 1V2UT 1G36A 1A3EH 1SFIA 1SGNE 4A5TS 2UUFB 1G3BA 1IQKA 3TU7H 1UHBA 1QL9A 1W14U 1VJAU 3KQBA 1RGQA 1AUTC 1TX8A 3LDXH 4KKDA 1DPOA 2G5VA 1LPZB 2VH6A 3S69A 1YPJH 1TBZH 1N6XA 1GHVH 4ISNA 2FOBA 2O8MA 3SU1A 3VFEA 1SGDE 1MD8A 1BTHH 1BTYA 3BTKE 1HJ8A 1O30A 1DUEA 2OTVA 1LQDB 3QO6A 3BEUA 1FPCH 2C8WB 2ZCKP 1O3MA 1O38A 4ISOA 2GT7A 4K5ZA 4YTAA 1L4DA 1DSTA 4WXVA 2VWNA 3BTHE 1HAPH 1UK3A 3VEQB 1NC6A 5E0HA 3SI3H 3ZZ5A 2I6QA 1FIWA 1P11E 1GBMA 1O2JA 3BTTE 2XBYA 1NO9H 4TPIZ 3ZV9A 1B0FA 1ZPZA 4FUJA 2J92A 1A1RA 3M7UA 2BHGA 3SJ9A 1ZMJA 2CF9H 1GI9B 4AYVB 2PKAB 3EQ0H 2G55A 3VB6A 1BCUH 1JRSA 2BX4A 3TJVA 1PQAA 4HGCA 1AWFH 4IC6A 2XNIA 1BBRK 1ELDE 2ZFSA 3BSQA 2BX3A 2ZTZA 1UVUH 3LU9B 4Q7XA 2SNVA 3T26A 1C2FA 3E16B 1EZUC 2J94A 5FPTA 2PW8H 4MPXA 1DY8A 1SGCA 1UTOA 2BZ6H 2P59A 2TGPZ 4U01A 1HAIH 5A2MH 4CBNA 3SGBE 3SUDA 2PSYA 2R3UA 5A09A 1TIOA 4NIWA 3SI4H 4B2CA 3SGAE 3EA8A 1D4PB 4ZHLU 2F9BH 1GBDA 2PHBA 3QZRA 4GHQA 3NCLA 1TGSZ 2HALA 2FWWA 1QTFA 4ZMAH 1FIZA 2BD5A 1BIOA 1QQ4A 1GI5A 4NIYA 1ZRBA 2ZU3A 4XFQA 3LH3A 5FX6A 3SNCA 7ESTE 4WMDA 2ZO3H 5DP3A 1GG6C 2QIQA 5L30H 4MNVA 2HRVA 3OY6U 1NFYA 1ZTJA 4TWWA 1ELEE 1K1JA 2UUYA 1MKWH 1W13U 1F2SE 3MNCA 4CR9A 4I8LA 5GCHF 3EYDA 4CRGA 2ALVA 1TNHA 1ABJH 1S5SA 1ELCA 2SGPE 3BF6H 3H7OA 3BV9B 2NU1E 1CHOF 5E0GA 2BXTH 1GJ6A 1T7CA 2AS9A 2ASUB 1BRBE 4FUGA 4YT7H 1CT4E 2SGAA 2Z9KA 1JMOH 4JZIA 3DHKH 1MTNC 1T8OA 2IJOB 1P57B 1TOMH 1OWJA 1NFWA 2BVRH 4Y8ZA 1BA8B 2A2XH 1GPZA 2ZG0H 2JKHA 5F8ZA 3SO3A 8ESTE 2ZWLH 2ZFFH 1O5AB 3DUXH 3MO9A 5ETXA 1DY9A 2ZGHA 4UE7H 1KY9A 1GMHF 1WYKA 3HGPA 3ZV8A 3E90B 1GVZA 3D65E 2QXHA 5A8XA 1QGFA 3S9AA 4OS2A 4JK6A 1GGDB 5PTPA 1ZYOA 1GVKB 1EAUA 1TRYA 3LOXA 4NA7A 4NA9H 1GMCG 4GLYA 4GCHG 1DWBH 2A1DB 2BVSH 1C5NH 4X2WA 1LPKB 1EJAA 4MPUA 3ITIA 1GHBG 1DLEA 1MH0A 1U6QA 1Y3YA 1LVOA 5I46H 2VIVA 1GJAB 3T5FH 3MFJA 2F9VA 2PKSB 3ZYDA 2ZKSA 5E8EH 1NROH 4FUIA 1MAXA 1TNJA 1C1QA 2ZGXH 5A8ZA 1FV9A 4I8HA 4AGJA 3ZVDA 2FOHA 4MPWA 1P2NA 3MO6A 1QRWA 2ZDVH 2ZP0H 3F1SB 4FUHA 3ODFA 1VGCC 7LPRA 3M5NA 1OWIA 1O3GA 2ANYA 1CU1A 4H6TA 2QAAA 1TMUH 1UCYE 3SHAH 3R3GB 3SBKA 3T29A 2JETB 4THNH 4CRBA 3CS0A 2GZ9A 2Q6GA 1EAXA 1C5MD 4Y7AA 5FCRA 1TALA 2FOAA 4AOQA 3G01A 4LOYH 3MU1A 1GI6A 1JBUH 3K6ZA 3RM2H 5AHGH 1HGTH 1OKXA 1SB1H 2H5DA 2EC9H 1C5VA 1GJ5H 1ELAA 4MNYA 2O8TA 3ZVBA 3PLBA 5A0BA 5HM9A 1Y8TA 3VB7A 1LHCH 1LTOA 1SI5H 5T3HA 3CS7A 2P3UB 2XYAA 2BXUH 2AERH 3VGCC 1ZR0A 3SU5A 2C3SA 4NWLA 1RFNA 2P8OC 1V2TT 1Y5AT 3GOVB 1LVBA 1BHXF 1O3AA 3L3TA 5G4BA 3UIRA 2ZZUH 1O5BB 1X7AC 2VB0A 2ZHWH 1FUJA 2V0BA 1G3CA 2Z3CA 2GV6A 3DFJA 3K6YA 1IAUA 4VGCB 3UPEA 2SNWA 3ZZBA 3KL6A 3LGIA 1UTJA 4JZEH 2BD3A 1ZSJA 2A2QH 1ZJKA 1LKBA 3RC4A 3TJUA 3T28A 1F92A 1AB9C 5K7RA 1O3OA 1OP8A 5JBBS 2A7HA 4FVDA 3R0FA 2M5TA 1GBCA 1L1JA 3CENA 1C4Y2 2ODYB 1OWEA 2FZZA 4DW2U 4XSKU 2NU3E 2A7JA 3KQDA 9ESTA 1F0SA 3P8GA 2ZHFH 1ETSH 1MQ6A 2B7DH 3E3TA 4ISIH 4K3JA 3TJOA 3RXHA 3VB4A 3D23A 3L6PA 1P3EA 4KELA 1BT7A 1CA0B 3UNRA 5EG4A 1GJ7B 1SGFA 1UTLM 1N8OB 3ZVAA 2GV7A 4KP0A 1QJ1B 3VPKA 1SPJA 4GAWA 1MBQA 2O8LA 2TRMA 2EA3A 3GCNA 2VVUA 1HXEH 1HCGA 4O3UA 3TLOA 3MHWU 5CE1A 2FXRA 1HBTH 1C1UH 4K1TA 1O5EH 4DJZB 2GX4A 1TNKA 1O33A 5EODA 1TBQH 1D6WA 1MCVA 2A4RA 3UWJH 3RXQA 2OP9A 1AY6H 3TH4H 2QN5T 1SC8U 3RU4D 3GDVA 3LPRA 3M7QA 3MNBA 1QRXA 1GHAF 1QB6A 1BTXA 5E2PA 3MH4A 1RD3B 4X6MA 1H9HE 3GISB 1CBWC 1AFQB 4H4FA 1KTSB 2VWMA 1O3DA 5LGOA 1HUTH 2A7CA 4JZ1A 1S6HA 2QC2A 4IW4E 2BY5X 1YPGH 2FYRA 1P2KA 3P70B 2B9LA 2BTCE 5JYIA 1WSSH 2VJ1A 2FI5E 1GI4A 1QCPA 1O3CA 8GCHG 5JDUB 3P92A 1C5YB 4JYUH 3F9HA 2H1UA 3ODDA 5CMXH 2BD8A 2BDBA 3B23B 1IQJA 1TYNA 1O2ZA 2OINA 4WH8A 1NZQH 1TNLA 1H1BA 5FBIA 3BG8A 1N6YA 4KTCA 1TOCB 1TONA 2IN2A 5EOKA 4X8VH 1ESTA 1ZTKA 1A0HB 1MAYA 2QF3A 1EUFA 2GTBA 3RU4E 3AAVA 1PPCE 3DD2H 1V2LT 1WV7H 4YLQH 4X1RU 1T8NA 1B7XB 4CHAC 3PLPA 1LVMA 4OS4A 1TNIA 1K1LA 1BMNH 3HK3B 1TPSA 1O2XA 1UK2A 2ZDNA 3GCTF 3RMNH 4B2AA 1ZPBA 1IQHA 1GHXH 4B71A 1V2MT 1T32A 4OS1A 1WBGB 1A0JA 1K22H 1CT2E 1C2DA 3TIUA 1DX5M 4X1PU 1O36A 1MKXH 1SOTA 3BTGE 4YESB 1INCA 1BMMH 3ATMA 2GCTB 4OGYA 2G5NA 1GG6B 2HOBA 1DXWA 1A5HA 4NIVA 4CRFA 2XC0A 5FPYA 1K1IA 3PV4A 1LCYA 1G9IE 1J15A 3A89A 2GKVE 3RXGA 3U8RH 3RXOA 1EB2A 3MU5A 4UFFH 1W11U 7GCHF 1P9UA 5TCCA 4D9QA 3B9FH 4UDWH 1QB9A 3F9GA 3MH7A 1FLEE 1D6RA 2UUJB 5JPMH 3ZZDA 1TBRH 1AGJA 2XBXA 3RXCA 3URCA 5GIBA 1KXAA 2ZFQH 1MTNB 1GDUA 1G2MA 4YZUA 1AQ7A 4CH2B 1HJAC 3GY3A 3UFAA 1O2KA 2BY8X 2ZF0H 1ZOMA 2HLCA 5LPRA 4X8UH 1BTUA 5AFYH 2D8WA 3M61U 2FESH 1W8BH 3E0PB 1Y5UT 4I8KA 4Y8YA 1AMHA 1HAXB 2XW9A 3LC3A 4MPVA 4MQAA 4D7FA 1L1NA 1GCTC 2VWOA 2CGAA 1T4VH 5T6DA 1YC0A 3BTQE 5GXPA 2YNBA 4FXGH 4GVUA 3O8CA 3P8OA 3SV8A 2PGQB 5DP8A 1D3QB 3A80A 2B0FA 1AE5A 2ZGBH 5DP9A 1BBRH 5FCKA 1BUIA 4Q2KA 4X6OA 4ZKNU 2Y7XA 4NCYA 1WOFA 3QN7A 5DJ7A 2OBQA 2AFQB 3TPIZ 2R3YA 2TGDA 3FZZA 1EZXC 3BTWE 1Z1JA 1FAKH 3QTVH 4IS5A 4OS6A 5IDKA 1FY4A 1S0RA 6GCHF 1P12E 4F49A 3M7TA 2ZQ2A 1VGCB 1M9UA 1BMAA 4Z0KA 1ANEA 4ABIA 4A6LA 1C5UA 3A8DA 1L4ZA 4IMQA 1G2LA 3ZZ4A 3LJOA 2ZU1A 5C5OA 2RCEA 4MVNA 2FS8A 3ZZ6A 1MZAA 1KIGH 2B8OH 2ZDMA 1ESBA 3LONA 2Q6DA 5FX5A 5L6NH 4BOHA 1C2MA 3SV2H 1A61H 4XBBA 4CBOA 4GUXA 5TJXA 3ATKA 5EPNA 3OSYA 1A7SA 1J9CH 3LH1A 2GP9B 1IQEA 3CP7A 3Q00A 2WYGA 3S7HB 5JBAS 3OU0A 3RXDA 4AB9A 1C4U2 3RMLH 3VB3A 3ATLA 3FZDA 1GI0A 2ESTE 3VGCB 2A0QB 3OTJE 3P6ZB 1K1MA 2ANKH 3UNSA 2GGVB 2ZECA 2PFEA 2P8OB 3A8CA 1O2VA 1GBTA 2Y82A 1E35B 3NPSA 1BMLA 1GBEA 1O31A 3KF2A 1IOEA 1TGCA 1LHGH 5L2ZH 1F5LA 3STJA 3TGJE 2ZGCA 1UTNA 1QQUA 3A84A 4K8BA 2XCNA 1P06A 4X0WU 3UWIA 4HI3A 4DIHH 1TQ0B 3URDA 2G4TA 3UUZA 2AMQA 1AB9B 1VITH 1O3JA 1DUAA 1BRCE 1TRNA 2G81E 2FI4E 2R9PA 2A32A 1O2SA 1OSSA 4IGDA 3PMAB 3OX7U 1A2CH 1ZJDA 2BYAX 4AGKA 1HRTH 2GT8A 3KQEA 3ENSB 1A46H 2Z9JA 1F5KU 1Z6EA 3QX5H 4Y8XA 2FS9A 3PO1C 1TLDA 1NRPH 5I25A 1LHFH 3M36A 3RXRA 3LGVA 1RIWC 1LQEA 2FP7B 1VITF 2VGCC 3LKWA 1OP2A 1C9PA 1GI3A 1S83A 1OWHA 3NWUA 4Y11E 2IPHA 4ABGA 5JB8S 2Q6FA 5DPAA 1SQAA 3S9CA 4A7IB 1O2WA 2OUAA 2PTCE 2VWLA 1KXCA 4NA8A 4IMZA 1FY8E 1L0ZA 4ZAEA 2WUCA 2HPQH 1FNIA 4K1EA 2FM2A 1AO5A 4NFFA 1AZ8A 2Z9LA 1OP0A 4X2XA 4WWYA 3SU6A 2OQ5A 1W0ZU 1XXDA 2Y5FA 4KGAA 1V2WT 1SLXB 3SUEA 2NU4E 1PPFE 2XRCA 1EQ9A 5FHTA 1FMGA 1P2OA 3H5CB 3JZ1B 1ZMNA 1SGIB 2AGGX 2G00A 2SGEE 4KTSA 1PJPA 1XKBC 1EPTC 1S85A 3JZ2B 3AW1A 3M3VA 2G8TA 4X6PA 1C1RA 3F9FA 4FU9A 3BN9A 1GL1A 2AMPA 3ESTA 4ZHAA 4A1TA 4AX9H 1ETTH 3Q3YA 2DUCA 2GMTB 3QLPH 3SN8A 6CHAC 4BXWA 1XUFA 2OC8A 4M7GA 1V3XA 2ZDLA 3TNSA 3BTEE 1SLVB 1O3HA 1CGIE 2CJIA 1A3BH 3GYMA 5C1YA 3OYPA 2VIDA 1OOKB 1TWXB 2FX4A 5DGJA 1MTVA 4ZXYH 1SQTA 2EI6A 1NRQH 3UREA 3ZZ8A 3TK6A 2BLVA 2PKAA 4UD9H 3RXPA 1WCZA 2HWLB 3PM3A 3RXBA 3KN2A 3MNXA 3RM0H 1N1LA 1GJ4H 3F68H 1Z8RA 1H4WA 4DCDA 5CHAC 1QL7A 1J14A 2C4FH 2P16A 2GZ8A 4J1YA 2PWXA 1VZQH 1MCTA 1SVPA 4XBCA 4ABBA 4YOGA 4BNRA 5GDSH 4TY6A 3PTNA 2VNTA 1VJ9U 1P03A 1VR1H 2QXGA 1DICA 1NESE 3FP8E 3MOCA 2ZCHP 3QDZB 4I31A 2OQUA 2Y80A 1O2MA 3UOPA 1TB6H 1EOJA 4LZ1H 1Y59T 4TWYA 1Y3UA 3BTFE 5F8TA 1SFQB 1NT1A 1HDTH 3A86A 1PFXC 4X8SH 1GBIA 3RMMH 2BD2A 1AD8H 1OWKA 1O2RA 1MU8B 5ESBA 1S84A 2BDAA 4BAQB 1PYTC 1PPHE 1QRZA 1V2OT 3A81A 3RXVA 3BIUH 4RSPA 4DVAU 1ELTA 4YT6H 3GCTG 1UTQA 2J4IA 2R0LA 1KLJH 3L33A 9LPRA 1A5IA 2BQ7B 1PQ8A 1TGBA 3MYWA 2QY0B 3UY9A 3GDSA 2SGDE 2Y5GA 1DM4B 1C1WH 5TCAA 1AE8H 1FN8A 1AHTH 1DWEH 3F9EA 2XBWA 3E8LA 4K1SA 2WPMS 4WH6A 4NFEA 2ZTXA 1GBBA 1AIXH 1MMJN 2A5IA 1PYTD 1UCYK 1CT0E 4HZHA 2THFB 1BITA 1Z1IA 1O3EA 7GCHG 2JH5D 1MBMA 1O5FH 1SR5C 1HXFH 1SBWA 1DVAH 4K60A 2V3OH 2Y7ZA 1CE5A 5SGAE 3MU4A 3I29A 3H7TA 3GDUA 1AKSB 2Z9IA 5GPIB 1B0EA 1Y3WA 1C5XB 2AGEX 3SHCH 1J17T 2ZHDA 4DGJA 2WUBA 2BLQA 1DE7H 3SV9A 1ZHMA 2BDIA 2KAIB 1IHTH 3M37A 1G37A 2XC4A 3A83A 1UO6A 3AASA 3C1KA 1PPZA 4CRDA 1TGNA 1FY1A 4O3TA 1GI8B 1C4V2 2BM2A 1LVYA 2XWAA 1O3BA 1T8LA 4WY3A 3EE0B 1O2TA 1NY22 1S82A 4ISLA 2WV5A 3ZVGA 4ABHA 2Z3EA 3UR6A 1AVWA 1DWDH 4YLUA 2V6NA 1ARCA 4QT8C 2J38A 2ODPA 4JCNA 2FODA 1KXDA 3BG4C 2GCHF 5DKMA 3KEEA 3RXMA 1K21H 1BB0B 1FQ3A 1C1OA 1DWCH 1TMTH 1V6DA 2BOHB 3M5MA 1XM1A 5C67A 4AG1A 4GSOA 1P9SA 2F91A 1EJMA 2XWBI 4RKOB 1BJUA 3SUGA 4ABJA 1P3CA 1EASA 4D8NA 4B1TA
chains in the Genus database with same CATH superfamily
3FVFB 4X1QU 5IYTA 5DP7A 2WSSD 1AKSA 4WXIA 4B74A 3A8AA 2UWOA 1ELFA 2FOFA 1YPHC 1KSNA 2OC0A 1UTMA 2VIPA 3GCHC 3UAIC 3O8BA 4Y7BA 3RXTA 1ZMLA 2KAIA 2Z6BD 3ZVFA 1QIXB 4CRCA 1ZSLA 3SU4A 1T4UH 3GCOA 3ZZ3A 3N7DA 2R0KA 3F2FA 4ESTE 1DLKB 4AORA 3OY5U 1P02A 4BAOB 2UWPA 4Q7ZA 4TPYA 3SGQE 4LXBH 5EU8A 1XUJA 1W0YH 1HAVB 2G51A 4I32A 1TE0A 1C5WB 1E0FD 3E91A 1IQIA 7KMEH 4RN6A 1RIWB 1ZTLA 1DOJA 3RUOA 2VGCB 4INHA 2OCVB 3U8TH 2ULLA 1OX1A 1YPMH 3A82A 3K65B 2JH6D 1GMCF 2WPJS 2BMGB 2Y81A 1GBKA 3ZZCA 1UVPA 4Y0ZE 1HAOH 2C8XB 2DE9A 5DP6A 2J97A 2OD3B 3A7ZA 3KCGH 1ZRKA 1NFUA 1K2I1 3ELAH 1RXPA 4INLA 1XVMA 1UVOA 4ABAA 2BY6X 4JZDH 1C5ZB 4PROA 5EQQA 5EW2H 1SGYE 1GJ8B 1SGQE 3EE7A 1BTZA 2ZPRA 1FXYA 2KCPA 3ZIAD 1YBWA 2KCAA 1XX9A 4BXSA 1W2KH 1BDAA 3OEED 3QWCH 1AVXA 2PTNA 2KR7A 3PYHA 1WQVH 4ZUHA 4YO9A 5HIZA 3U8OH 5FXLA 3P95A 2VVVA 1EPTB 4JMYA 1KXEA 2XBVA 1W7GH 2QCYA 3RXJA 1IQLA 1CSOE 2RG3A 2EI7A 2CHAC 4F48B 1C5LH 1P8VC 6CHAB 1YPHE 3SNDA 4XBDA 2OXSA 1SSXA 1SMFE 2GVFA 1O3PB 1VITG 4DIIH 2A4QA 1H8IH 4M9FA 1PPEE 5DG6A 1NBME 1DANH 1EJNA 4I8GA 3A7TA 4FETA 1NRNH 4CRAA 3W94A 1V2ST 1HAVA 2EI8A 3FAOA 5B6LA 1FN6A 1C2HA 4FU8A 4WMEA 3LGTA 3TGKE 1YM0A 2TPIZ 2VU8E 3LGYA 4R8TB 1O2UA 1XUKA 3NK8A 4BANB 2ZU5A 4D7GA 2BDYA 4FUEA 4GHTA 1O3NA 3NUMA 2EY4C 1JRTA 1P2IA 4WMFA 1NRSH 1W3CA 3GY6A 2WPLS 6LPRA 3I78A 2P3FH 4B2BA 1GJCB 4YOJA 2A5KA 1RTKA 5CHAB 3QGJA 1D3TB 2RDLA 4IBLH 3A7VA 4ZROA 1Y3VA 4WVPE 4TY7A 1GHYH 3K2UA 2ZPQA 3M5OA 1Z71A 4B73A 4X1SU 3E0NB 2ODQA 2FTLE 2YOLA 3SV7A 3TK5A 1LKAA 2ZI2H 1ZZZA 3OAAD 1SHHB 5IK2D 3F0OA 4RT1A 3GS9A 1P2JA 1UVTH 1EATA 1SOZA 4FU7A 4AN7A 1TX7A 2HVYB 3MNSA 1FI8A 5GCHG 1NU9A 1D3DB 1L1GA 2AHME 3S0NA 1EPTA 2WPHS 1TX6A 5F8XA 4BTUB 5KECA 1DDJA 2Q1JA 4LK4A 1CHGA 1NM6A 1O2PA 3IWMA 3GICB 1CHOG 2PSXA 4YM9A 3V3MA 2QA9E 1LMWB 3STIA 1AWHB 2BQWB 4SGAE 1ZPCA 4ABEA 1Q2WA 4ZXXH 3V0XA 3FO8D 1SGTA 1QR3E 4ISHH 2ZEBA 5LPFA 4B76A 2TIOA 2ZU4A 1WDIA 1TMBH 1YPKH 1GMHG 3GY4A 4R0IA 1C2EA 2QXIA 1GDNA 2RA0A 3Q3KA 1AFEH 2KCYA 4VGCC 1TGTA 2YNAA 4O9VA 1LHDH 1QJ7B 3RP2A 4INKA 1T31A 5C20A 2OBOA 1HFDA 3ZZ9A 3ZZAA 1YGCH 3BIVH 1THSH 1O32A 4FVBA 3LC5A 4Z6AH 3P17H 3V7TA 1MD7A 2ZFPH 4ZKSU 4FUCA 2ZC9H 2FOCA 1P09A 1O35A 3A87A 2J95A 5EPYA 4NWKA 3SJOA 3T62A 2AIQA 3U9AH 2VIOA 1CGJE 4U32A 4ZH8A 4U30A 1C5RA 3PROA 3QUMP 4X2YA 1H9IE 1ETRH 1YLDA 1V2VT 3M5LA 1CA0C 2BB4A 1BHXB 4H6SB 1P05A 5C3NA 1TRMA 5A8YA 3Q3XA 2QF0A 2XCFA 1JIRA 5EQSA 2BOKA 4BAMB 2AEIH 2H9EH 4NG9H 3N7OA 4ACBA 5K0HA 2L6OA 2R2WU 5C1XA 5C0TA 4TT3D 5EXNA 3VXEH 3AVZA 4K8YA 1GBFA 3LGUA 5HKKD 3O8RA 1ARBA 2W7SA 3PWCA 4AZ2B 1FJSA 2BZAA 5DP4A 5A0AE 2W3IA 5C5NA 2O8UA 2QXJA 2J34A 1FX0B 1VCQA 1CVWH 2GDDA 1GJDB 1Y5BT 1NRRH 1AFQC 2C8YB 5HM2A 2ZU2A 3BG4B 3KIDU 5L2YH 5EW1H 3LJJA 1EXFA 1QY6A 5DP5A 1E36B 1GMDF 1XUGA 3MU0A 2HPPH 3U28C 2QYIA 2FO9A 5F03A 3UR9A 1ZSKA 5E0JA 5BPEA 3M35A 1BBRE 2ANWA 1GJ9B 1T8MA 1SLUB 3O8DA 2UUKB 2FYQA 3UQOA 2ZPSA 3A7YA 1C5OH 3SW2B 1NU7B 1PPBH 4Y71A 1V2NT 4NSYA 1QURH 3T2NA 3PMHB 3PWBA 4JYTA 1BRAA 5LH8A 2W3KA 1K1OA 3SU0A 3V13A 2FOMB 5DN6D 1OPHB 2F9NA 3D62A 2OLGA 1TNGA 1Z8GA 4FUBA 4MLFB 4Q80A 1O2HA 4XOJA 1CBWB 4MG3A 1ELGA 1TPPA 1B5GH 1GL0E 5F6MA 8LPRA 1AN1E 3MI4A 2P94A 2FI3E 3GCHB 1YY3A 3RXAA 4ZHMU 1FZZA 1UCYH 2BY9X 2WPIS 2KZ4A 2ZCLP 1EAWA 4ZKRU 1BTWA 1PQ7A 1ANDA 4UFGH 2FPZA 3BTME 4HTCH 1YP9A 2FOEA 4J2YB 1BRUP 4D9RA 1GWAA 3LT3A 1JOUB 2QV1A 2LPRA 2ZIQH 3M3SA 4A1VA 2HVXA 1YPEH 3F6UH 4Y10E 1UK4A 2GCHG 1O2GH 1O3KA 3QGNB 1QBVH 4JYVH 3RLYH 1V2PT 3U69H 3TH2H 3A85A 5J4SA 2GCTC 2Z94A 5HIYA 2ALPA 1QNJA 1ABIH 1E37B 1HLTH 4WJG2 1LPGB 2QF4A 3FP7E 2W26A 4CHAB 1EAIA 3LGWA 3SJ8A 5LPEA 1FDPA 4UONA 1YPLH 3GY2A 8KME2 2F3CE 1NS3A 3RDZA 3D49H 2OC1A 1E34B 3C27B 1FY5A 1GHAG 3PTBA 1D3PB 2B5TB 3HK6B 5EJZA 4BTTB 3FP6E 4AFQA 4E06H 1E38B 1C1PA 2SFAA 3F2GA 3SU3A 2PR3A 2OK5A 1WTGH 1GDQA 2WPKS 3QTOH 1SGEE 1OWDA 1XUHA 3A8BA 5J4QA 1K9OE 1TA2A 3K9XB 2ZGJA 2ZQ1A 5BRRE 3SORA 1UJ1A 1TFXA 1VCWA 3FANA 2BD4A 1C1NA 4NZQA 1S81A 1HAHH 1QBOA 3Q77A 2CHAB 1F7ZA 2J9NA 2YMSD 3KGPA 4XD7D 5T1VA 1V2JT 1JIMA 2LNCA 1BZXE 2ZTYA 1QB1A 1V2RT 2H9HA 2VINA 3DFLA 2M2AA 2G52A 2Y5HA 1ID5H 5B6OA 4AFZA 1K28D 4DT4A 1KXBA 1C2IA 1O2LA 3RC5A 4SGBE 2V3HH 1FY3A 2F4LA 3GY8A 3EGKH 3A7WA 3SOSA 4ZKOU 4OS5A 2CK3D 3F2HA 1EX3A 1YF4A 1ORFA 1HJAB 1EP5A 1Q3XA 2PGBB 3HATH 3SU2A 1V2QT 2CV3A 1HV7A 1C2GA 4DURA 1EP6A 1WAYB 1CA8B 1PQ5A 1UMAH 1SKYE 2HNTF 1KXFA 2A31A 4MDSA 2H9TH 1IQMA 1ANCA 1F5RA 2XTTB 3U1JB 2H5CA 4Y79A 3BEIB 2V3MA 4IN2A 5AFZH 5EQRA 1LHEH 5ESTE 5FAHA 1MTSA 1UTPA 1GCTB 1GBLA 2HNTC 1P2QA 4OS7A 2VH0A 1ZGVA 1WQSA 2K1QA 2BD9A 1QHRB 3SNEA 1ACBE 2VIQA 1A0LA 1O39A 2DE8A 1A5GH 3DT0H 2WYJA 4FUDA 4JZFH 4CH8B 1S6LA 1W10U 1JWTA 5AVDA 2IOTA 2RFKC 1NPMA 3MU8A 3W1EA 2SGQE 2FEQH 5F53A 1GHWH 4Y76A 3HGNA 4Y6DA 2AYWA 1DXPA 1IQGA 1EB1H 2WINI 4CREA 2F9PA 1O2OA 2H2ZA 1C5SA 3N7EA 3RU4T 1DSUA 1THRH 1EZSC 2D2DA 3UTUH 5GNDA 1FPHH 2PV9B 2ILNA 1F0TA 2A4OA 4IN1A 5JBTA 2G4UA 1MTUA 1KTTB 1YYY1 3RXUA 3ZYEA 1MKWK 1F0RA 2AGIX 1YCPH 2QGRA 1O2YA 1AU8A 1WU1A 2BQ6B 2O8WA 3MMGA 1H9LB 4X6NA 4OGXA 2F9UA 1UTKA 3F0PA 4E05H 1GBHA 1MUEB 4U2WA 3SZNA 3GY5A 1HJ9A 2P93A 2D26C 1SGFG 2TGAA 3TGIE 3HKIB 4I86A 2XC5A 4E7NA 1HYLA 4H42U 1C1MA 3TJNA 2AIPA 3EA9A 4TSFD 3A7XA 1BJVA 4CR5A 4AG2A 1L2EA 2W7UA 4KTUA 1GBAA 1RS0A 1C2LA 3HKJB 3RXKA 3RXLA 2VVCA 1P0SH 4NGAH 2HNTE 3TH3H 2STAE 3ZVEA 5A0CA 1AI8H 2R2MB 2Y6TA 3U1IB 4AB8A 4IC5A 3IG6B 5FBEA 4MTBA 1K0HA 4DY7B 3TK9A 6GCHG 1IQFA 1G3EA 1JXPA 3MWIU 1J16A 2EEKA 1DT2A 1NFXA 2ZHQH 1G3DA 2P3TB 2A45B 3RMOH 3A88A 3UQVA 2SGFE 2EQNA 1HAGE 1FONA 1Y3XA 1ZGIA 2ZDAH 4I8JA 4RI0A 2FMJA 1OYQA 3TVJB 4DOQA 2FTMA 2V35A 3U98H 2WHXA 1QA0A 4NZLA 1QBNA 4K69A 3QZQA 3SJIA 1P2MA 3KNXA 2W5EA 1IHSH 1W7XH 2JJ1D 5HGGA 1G30B 2A4GA 3PO1B 2CXVA 2BDCA 1GI7B 3HPTB 1QA7A 1C5PA 4O03A 5HYOA 4BAKB 2GZ7A 1TQ7B 1RTFB 4ABDA 4O97A 4F4OC 2HGTH 3KQCA 3RXEA 4OM9A 2NU2E 4I7YH 4ASHA 1J8AA 2UWLA 1XMNB 1GJBB 1P10A 5FPSA 4GCHF 5H4IB 1DS2E 3I77A 1O2IA 2BY7X 1Z6JH 1GHBF 2F83A 2AMDA 2GMTC 2STBE 1EKBB 2OC7A 4GPGA 4TYDA 1F0UA 1O5DH 3EA7A 3PLKA 2TGTA 1C2KA 1MQ5A 4RKJB 3M3TA 3NZIA 5ABWA 1GHZA 5E2OA 2F9OA 1Z8IB 2Z3DA 1CQQA 1HIAB 5GJ4B 1ZLRA 1XUIA 5EXMA 3T25A 2XXLA 3PMJA 4ABFA 1PPGE 4NIXA 5JBCS 1YCPK 3MO3A 5GWZA 3DA9B 5DSFA 3BTDE 2H6MA 3QK1A 3RXSA 2ZHEH 1P01A 1K1NA 1O2NA 3WWFA 1OYTH 1Z7KA 1G32B 1KLIH 1ELBA 3SQEE 4A92A 1GMDG 1K1PA 3PMBB 1RRKA 3S9BA 5EGMA 1TABE 1SGRE 1SG8B 1GGDC 4XDEA 5DO4H 2GDEH 1DITH 1HB0B 1KDQB 3P8NA 2QF5A 5DK1A 3T27A 1TPAE 2BLWA 2C93B 1DFPA 3MTYA 1C9TA 1HPGA 4I33A 4X1NU 3WY8A 2FDAA 3MH5A 1YCPM 2VIWA 1XVOA 4DT7B 3SUFA 3UNQA 1GI1A 1SHYA 2D1JA 2BD7A 3AAUA 1ESAA 4HFPB 1S0QA 4AYYB 1RJXB 1ZHPA 4K2YA 5T6FA 1S6FA 5AF9H 2BDGA 2ZFRH 5HXFA 2NWNA 2PKSC 1NTPA 3OE7D 3SNAA 1KMHB 3MH6A 1XXFA 3Q76A 1ELVA 1O3LA 4X8TH 1BOQA 3B8JA 3W95A 1P04A 3DSGA 5C1UA 4UEHH 3RLWH 3V12A 1O3FA 1SL3A 1RTLA 1HAYB 1GVLA 1A4WH 5KGOA 2TBSA 1GI2A 1BTPA 1O37A 1C5QA 2NU0E 5T6GA 3E1XB 1TAWA 1ZHRA 2C8ZB 1MZDA 4WF8A 2JETC 1QL8A 4B75A 2BDHA 4Y0YE 1O2QA 2FLBH 1SQOA 2ZNKH 1HIAA 3NXPA 4DG4A 1SLWB 2PUXB 2PLXA 3RC6A 1AVGH 2FX6A 1W12U 2Z9GA 3GY7A 3BEFB 4D76A 1IQNA 2ZA5A 2FOGA 1XKAC 1GBJA 1THPB 1CGHA 1YLCA 3E6PH 2BVXH 5EXLA 2J2UA 4NSVA 2A5AA 2Z7FE 1UHBB 4AFSA 3VXFH 2FLRH 4BAHB 2QE7D 2WV4A 1ANBA 4X2VA 3P8FA 1WUNH 3TNTA 1CO7E 2P95A 5C94A 1QFKH 1V2KT 4JK5A 1O5CB 1EZQA 1O3IA 1KYNA 4YOIA 1C1SA 2JH0D 3RXIA 3SV6A 3SJKA 1O5GH 1YKTA 1OXGA 1LO6A 1KDQA 1Q31A 2ZFTA 2BLOA 3PB1E 4UFDH 3SQHE 3IITA 1MTWA 3LIWA 1HAZB 2I6SA 3VB5A 1NN6A 2AH4X 1AUJA 2RA3A 1Z8JB 1O0DH 1SGPE 3ATWA 2ANMH 1C1TA 2C90B 1C2JA 3NKKA 1TA6A 1UVSH 2PUQH 3PRBA 2KX4A 3RXFA 1HNEE 3KHVA 3GYLB 4A1XA 1VCPA 1D9IA 3EDXB 3ATIA 3TITA 4AFUA 1BQYA 1YLNA 4XE4A 3EAJA 4MNWA 1C5TA 4FUFA 5C2ZA 2CN0H 3SNBA 2FIRH 4B6FA 3UOUA 1GCDA 1WTHD 2O9QA 1H8DH 5HMAA 4BTIB 2GD4B 2CF8H 5JB9S 6ESTA 1AZZA 1TPOA 3FFGA 8GCHF 1FAXA 3ZZ7A 1LDTT 1QJ6B 3AW0A 4LZ4B 1MKXK 5C0UA 1C1VH 4E7RG 2ZDKA 2CMYA 3S7KB 2JDID 4Q7YA 4MNXA 1OS8A 1MU6B 1EOLA 4UFEH 3ZVCA 1O34A 1N8OC 1KLTA 1V2UT 1G36A 1A3EH 1SFIA 1SGNE 4A5TS 2UUFB 1G3BA 1IQKA 3TU7H 1UHBA 1QL9A 1W14U 1VJAU 3KQBA 1RGQA 1AUTC 1TX8A 3LDXH 4KKDA 1DPOA 2G5VA 1LPZB 2VH6A 3S69A 2JIZD 1YPJH 1TBZH 1N6XA 1GHVH 3WW7A 4ISNA 2FOBA 2O8MA 3SU1A 3VFEA 1SGDE 1MD8A 1BTHH 1BTYA 3BTKE 1E79D 1HJ8A 1O30A 1DUEA 2OTVA 1LQDB 3QO6A 3BEUA 1FPCH 2C8WB 2ZCKP 1O3MA 1O38A 5CDFE 4ISOA 2GT7A 4K5ZA 4YTAA 1L4DA 1DSTA 4WXVA 2VWNA 3BTHE 3DSPA 1HAPH 1UK3A 3VEQB 1NC6A 5E0HA 3SI3H 3ZZ5A 2I6QA 1FIWA 1P11E 1GBMA 1O2JA 3BTTE 2KFWA 2XBYA 1NO9H 4TPIZ 3ZV9A 1B0FA 1ZPZA 4FUJA 2J92A 1A1RA 3M7UA 2BHGA 3SJ9A 1ZMJA 2CF9H 1GI9B 3F3BA 4AYVB 2PKAB 3EQ0H 2G55A 3VB6A 1BCUH 1JRSA 2BX4A 3TJVA 1PQAA 4HGCA 1AWFH 4IC6A 2XNIA 3UB0A 1BBRK 1ELDE 2ZFSA 3BSQA 2BX3A 2ZTZA 1UVUH 3LU9B 4Q7XA 2SNVA 3T26A 1C2FA 3E16B 1EZUC 2J94A 5FPTA 2PW8H 4MPXA 1DY8A 1SGCA 1UTOA 2BZ6H 2P59A 2TGPZ 4U01A 1HAIH 5A2MH 4CBNA 3SGBE 3SUDA 2PSYA 2R3UA 5A09A 1TIOA 4NIWA 3SI4H 4B2CA 3SGAE 3EA8A 1D4PB 4ZHLU 2F9BH 1GBDA 2PHBA 3QZRA 4GHQA 3NCLA 4RT0A 1TGSZ 2HALA 2FWWA 1QTFA 4ZMAH 1FIZA 2BD5A 3MQKC 1BIOA 1QQ4A 5C17A 1GI5A 4NIYA 5EJLA 1ZRBA 2ZU3A 4XFQA 3LH3A 5FX6A 3SNCA 4F55A 7ESTE 4WMDA 2ZO3H 5DP3A 1GG6C 2QIQA 5L30H 4MNVA 2HRVA 3OY6U 1NFYA 1ZTJA 4TWWA 1ELEE 1K1JA 2UUYA 1MKWH 2YMSC 1W13U 1F2SE 3FOAA 3MNCA 4CR9A 4I8LA 5GCHF 3EYDA 4CRGA 2ALVA 1TNHA 1ABJH 1S5SA 1ELCA 2SGPE 3BF6H 3H7OA 3BV9B 2NU1E 3AK5A 1CHOF 5E0GA 2BXTH 1GJ6A 1T7CA 2AS9A 2ASUB 1BRBE 4FUGA 4YT7H 1CT4E 1W0KD 2SGAA 2Z9KA 1JMOH 4JZIA 3DHKH 1MTNC 1T8OA 2IJOB 1P57B 1TOMH 1W0JD 1OWJA 1NFWA 2BVRH 4Y8ZA 1BA8B 2A2XH 1GPZA 2ZG0H 2JKHA 5F8ZA 3SO3A 8ESTE 2ZWLH 2ZFFH 1O5AB 4B6EA 3DUXH 3MO9A 5ETXA 1DY9A 2ZGHA 4UE7H 1KY9A 1GMHF 1WYKA 3HGPA 3ZV8A 3E90B 1GVZA 3D65E 2QXHA 5A8XA 1QGFA 3S9AA 4OS2A 4JK6A 1GGDB 5PTPA 1ZYOA 1GVKB 1EAUA 1TRYA 3LOXA 4NA7A 4NA9H 1GMCG 4GLYA 4GCHG 1DWBH 2A1DB 2BVSH 1C5NH 4X2WA 1LPKB 1EJAA 4MPUA 3ITIA 1GHBG 1DLEA 1MH0A 1U6QA 1Y3YA 1LVOA 5I46H 2VIVA 1GJAB 3T5FH 3MFJA 2F9VA 2PKSB 3ZYDA 2ZKSA 3N99A 5E8EH 1COWD 1NROH 4FUIA 1MAXA 1TNJA 1C1QA 2ZGXH 4YXWD 5A8ZA 1FV9A 4I8HA 4AGJA 3ZVDA 2FOHA 4MPWA 5FL7D 1P2NA 3MO6A 1QRWA 2ZDVH 2ZP0H 3F1SB 4FUHA 3ODFA 1VGCC 7LPRA 3M5NA 1OWIA 1O3GA 2ANYA 1CU1A 4H6TA 2QAAA 1TMUH 1UCYE 3SHAH 3R3GB 3SBKA 3T29A 2JETB 3FKSD 4THNH 4CRBA 3CS0A 2GZ9A 2Q6GA 1EAXA 1C5MD 4Y7AA 5FCRA 1TALA 2FOAA 4AOQA 3G01A 2W6JD 4LOYH 3MU1A 1GI6A 1JBUH 3K6ZA 3RM2H 5AHGH 1HGTH 4ASUD 3DSOA 1OKXA 1SB1H 2H5DA 2EC9H 1C5VA 1GJ5H 1ELAA 4MNYA 2O8TA 3ZVBA 3PLBA 5A0BA 5HM9A 1Y8TA 3VB7A 1LHCH 1LTOA 1SI5H 5T3HA 3CS7A 3KQ5A 2P3UB 2XYAA 2BXUH 2AERH 3VGCC 1ZR0A 3SU5A 2C3SA 4NWLA 1RFNA 2P8OC 1V2TT 1Y5AT 3GOVB 1LVBA 1BHXF 1O3AA 3L3TA 5G4BA 3UIRA 2ZZUH 1O5BB 1X7AC 2VB0A 2ZHWH 1FUJA 2V0BA 1G3CA 2Z3CA 2GV6A 3DFJA 3K6YA 5EIYA 1IAUA 4VGCB 3UPEA 2SNWA 3ZZBA 3KL6A 3LGIA 1UTJA 4JZEH 2BD3A 1ZSJA 2A2QH 4ZCNA 1ZJKA 1LKBA 3RC4A 3TJUA 3T28A 1F92A 1AB9C 5K7RA 1O3OA 1OP8A 5JBBS 2A7HA 3H09A 4FVDA 3R0FA 2M5TA 1GBCA 1L1JA 3CENA 1C4Y2 2ODYB 1OWEA 3CNRA 2FZZA 4DW2U 4XSKU 2NU3E 2A7JA 3KQDA 9ESTA 1YWUA 1F0SA 3P8GA 2ZHFH 1ETSH 1MQ6A 2B7DH 3E3TA 4ISIH 4K3JA 3TJOA 3RXHA 3VB4A 3D23A 3L6PA 1P3EA 4KELA 1BT7A 1CA0B 3UNRA 5EG4A 1GJ7B 1SGFA 1UTLM 1N8OB 3ZVAA 2GV7A 4KP0A 1QJ1B 3VPKA 1SPJA 4GAWA 1MBQA 2O8LA 2TRMA 2EA3A 3GCNA 2VVUA 1HXEH 1HCGA 4O3UA 3TLOA 3MHWU 5CE1A 2FXRA 1HBTH 1C1UH 4K1TA 1O5EH 4DJZB 2GX4A 1TNKA 5EJ1A 1O33A 5EODA 1TBQH 1D6WA 1MCVA 2A4RA 3UWJH 3RXQA 2OP9A 1AY6H 3TH4H 2QN5T 1SC8U 3RU4D 3GDVA 3LPRA 3M7QA 3MNBA 1QRXA 4P00A 1GHAF 1QB6A 1BTXA 5E2PA 3MH4A 3FN8A 1RD3B 4X6MA 1H9HE 3GISB 1CBWC 1AFQB 4H4FA 1KTSB 2VWMA 1O3DA 5LGOA 1HUTH 2A7CA 4JZ1A 1S6HA 2QC2A 4IW4E 2BY5X 1YPGH 2FYRA 1P2KA 3P70B 2B9LA 2BTCE 5JYIA 1WSSH 2VJ1A 2FI5E 1GI4A 1QCPA 3PV2A 1O3CA 8GCHG 5JDUB 3P92A 1C5YB 4JYUH 1VKYA 3F9HA 2H1UA 3ODDA 2GJGA 5CMXH 2BD8A 2BDBA 3B23B 1IQJA 1TYNA 1O2ZA 2OINA 4WH8A 1NZQH 1TNLA 4P02A 1H1BA 4HG6A 5FBIA 3BG8A 1N6YA 2K0QA 1TOCB 1TONA 2IN2A 4KTCA 5EOKA 1WXRA 4X8VH 1ESTA 1ZTKA 3SYJA 1A0HB 1MAYA 1SQRA 2HLDD 2QF3A 1EUFA 2GTBA 3RU4E 3AAVA 1PPCE 3DD2H 1V2LT 1WV7H 4YLQH 4X1RU 2W6ID 1T8NA 1B7XB 4XRNA 3PLPA 1NBMD 4CHAC 1LVMA 4OS4A 1E1RD 1TNIA 1K1LA 1BMNH 3HK3B 1TPSA 1O2XA 1UK2A 2ZDNA 3GCTF 3RMNH 4B2AA 1ZPBA 1IQHA 1GHXH 4B71A 1V2MT 1T32A 4OS1A 1WBGB 1A0JA 1K22H 1CT2E 1C2DA 3TIUA 1DX5M 4X1PU 1O36A 1MKXH 1SOTA 3BTGE 4YESB 1INCA 1BMMH 3ATMA 2VBCA 2GCTB 3PRDA 4OGYA 2G5NA 1GG6B 2HOBA 2WZQA 1DXWA 1A5HA 4NIVA 4CRFA 2XC0A 5FPYA 1K1IA 3PV4A 1LCYA 1G9IE 1J15A 3A89A 2GKVE 3RXGA 3U8RH 3RXOA 1EB2A 3MU5A 3DCLA 4UFFH 1W11U 2YMSB 7GCHF 1P9UA 5TCCA 4D9QA 3B9FH 4UDWH 1QB9A 3F9GA 3MH7A 1FLEE 1D6RA 2UUJB 1UW7A 5JPMH 3ZZDA 1TBRH 1AGJA 2XBXA 3RXCA 3URCA 5GIBA 1KXAA 2ZFQH 1MTNB 1GDUA 1G2MA 4YZUA 1AQ7A 4CH2B 1HJAC 4Q63A 3GY3A 3UFAA 5CHBA 1O2KA 2BY8X 2ZF0H 1ZOMA 2HLCA 5LPRA 4X8UH 1BTUA 5AFYH 2D8WA 2V7QD 3M61U 2FESH 1W8BH 3E0PB 1Y5UT 3OTPA 4I8KA 4Y8YA 1AMHA 1HAXB 2XW9A 3LC3A 4MPVA 4MQAA 4D7FA 1L1NA 1GCTC 2VWOA 2CGAA 1T4VH 5T6DA 1YC0A 3BTQE 5GXPA 2YNBA 4FXGH 4GVUA 3O8CA 3P8OA 3SV8A 2KCOA 2PGQB 5DP8A 3VG8A 1D3QB 3A80A 2B0FA 1AE5A 2ZGBH 5DP9A 1BBRH 5FCKA 1BUIA 4Q2KA 4X6OA 4ZKNU 2Y7XA 4NCYA 1WOFA 3QN7A 5DJ7A 2OBQA 4ACAA 2AFQB 4AC9A 3TPIZ 2R3YA 2TGDA 3FZZA 1EZXC 3BTWE 1Z1JA 1FAKH 3QTVH 4IS5A 4OS6A 5IDKA 1FY4A 1S0RA 6GCHF 1P12E 4F49A 3M7TA 2ZQ2A 1VGCB 1M9UA 1BMAA 4Z0KA 1ANEA 4ABIA 4A6LA 4Z1MD 1C5UA 4Q4LA 3A8DA 1L4ZA 4IMQA 1G2LA 2L74A 3ZZ4A 3LJOA 2ZU1A 3OEHD 5C5OA 2RCEA 4MVNA 2FS8A 3ZZ6A 1MZAA 1KIGH 2B8OH 2ZDMA 1ESBA 3LONA 2Q6DA 5FX5A 5L6NH 4BOHA 1C2MA 3SV2H 1A61H 4XBBA 4CBOA 4GUXA 5TJXA 3ATKA 5EPNA 3OSYA 1A7SA 1J9CH 3LH1A 2GP9B 1IQEA 3CP7A 3Q00A 1EFRD 2WYGA 3S7HB 5JBAS 3OU0A 3RXDA 4AB9A 1C4U2 3RMLH 3VB3A 3ATLA 3FZDA 1GI0A 2ESTE 3VGCB 2A0QB 3OTJE 3P6ZB 1K1MA 2ANKH 3UNSA 2GGVB 2ZECA 2PFEA 2P8OB 3A8CA 1O2VA 1GBTA 2Y82A 1E35B 3NPSA 1BMLA 1GBEA 1O31A 3KF2A 1IOEA 1TGCA 1LHGH 5L2ZH 1F5LA 3STJA 3TGJE 2ZGCA 1UTNA 1QQUA 3A84A 4K8BA 2XCNA 1P06A 4X0WU 3UWIA 4HI3A 4DIHH 3NRLA 1TQ0B 3URDA 2G4TA 3UUZA 2AMQA 1AB9B 1VITH 1O3JA 1DUAA 1BRCE 3OFND 1TRNA 2G81E 2FI4E 2R9PA 2A32A 1O2SA 1OSSA 4IGDA 3PMAB 3OX7U 1A2CH 1ZJDA 2BYAX 4AGKA 1HRTH 2GT8A 3KQEA 3ENSB 3PV5A 3SZEA 1A46H 2Z9JA 2JJ2D 2PP6A 1F5KU 1Z6EA 3QX5H 2J98B 4Y8XA 2FS9A 3PO1C 1TLDA 1NRPH 5I25A 1LHFH 3M36A 3RXRA 3LGVA 1RIWC 1LQEA 2FP7B 1VITF 2VGCC 3LKWA 1OP2A 1C9PA 1GI3A 1S83A 2XOKD 1OWHA 3NWUA 4Y11E 2IPHA 4ABGA 5JB8S 2Q6FA 5DPAA 1SQAA 3S9CA 4A7IB 1O2WA 2WV9A 2OUAA 2PTCE 2VWLA 1KXCA 4NA8A 4IMZA 1FY8E 1L0ZA 4ZAEA 2WUCA 2HPQH 1FNIA 4K1EA 2FM2A 1AO5A 4NFFA 1AZ8A 2Z9LA 1OP0A 4X2XA 1OHHD 4WWYA 3SU6A 2OQ5A 1W0ZU 1XXDA 2Y5FA 4KGAA 1V2WT 1SLXB 3SUEA 2LP6A 2NU4E 1PPFE 5KEDA 2XRCA 1EQ9A 5FHTA 1FMGA 1P2OA 3H5CB 3JZ1B 1ZMNA 1SGIB 2AGGX 2G00A 2SGEE 4KTSA 1PJPA 1XKBC 1EPTC 1S85A 3JZ2B 3AW1A 3M3VA 2G8TA 4X6PA 1C1RA 1H8HD 3F9FA 4FU9A 3BN9A 1GL1A 2AMPA 2IJD1 3ESTA 4ZHAA 4A1TA 4AX9H 1ETTH 3Q3YA 2DUCA 2GMTB 3QLPH 3SN8A 6CHAC 2KM0A 4BXWA 1XUFA 2OC8A 4M7GA 2F43B 1V3XA 2ZDLA 3TNSA 3BTEE 1SLVB 2J98A 1O3HA 1CGIE 2CJIA 1A3BH 3GYMA 5C1YA 3OYPA 2VIDA 1OOKB 1TWXB 2FX4A 5DGJA 1MTVA 4ZXYH 1SQTA 2EI6A 1NRQH 3UREA 3ZZ8A 3TK6A 2BLVA 2PKAA 4UD9H 3RXPA 1WCZA 2HWLB 3PM3A 3RXBA 3KN2A 3MNXA 3RM0H 1N1LA 1GJ4H 2LELA 3F68H 1Z8RA 1H4WA 4DCDA 5CHAC 1QL7A 1J14A 2C4FH 2P16A 2GZ8A 1QZ8A 4J1YA 2PWXA 1VZQH 1MCTA 1SVPA 4XBCA 4ABBA 4YOGA 4BNRA 5GDSH 4TY6A 3PTNA 2VNTA 1VJ9U 1P03A 2RDEA 1VR1H 2QXGA 1DICA 1NESE 2K8IA 3FP8E 2ZCHP 3MOCA 3QDZB 2OQUA 2Y80A 1O2MA 4I31A 3UOPA 1TB6H 1EOJA 4LZ1H 1Y59T 4TWYA 1Y3UA 3BTFE 5F8TA 1SFQB 1NT1A 1HDTH 3A86A 1PFXC 4X8SH 1GBIA 3RMMH 2BD2A 1AD8H 1OWKA 1O2RA 1MU8B 5ESBA 1S84A 2BDAA 4BAQB 1PYTC 3WWBA 1PPHE 1QRZA 1V2OT 3A81A 3RXVA 3BIUH 4RSPA 4DVAU 1ELTA 4YT6H 3GCTG 1UTQA 2J4IA 2R0LA 1KLJH 3L33A 9LPRA 1A5IA 2BQ7B 1PQ8A 1TGBA 3MYWA 2QY0B 3UY9A 3GDSA 2SGDE 2Y5GA 1DM4B 1C1WH 5TCAA 1AE8H 1FN8A 1H8ED 1AHTH 2IPQX 1DWEH 3F9EA 2XNDD 2XBWA 3E8LA 4K1SA 2WPMS 4WH6A 4NFEA 2ZTXA 1GBBA 1AIXH 1MMJN 2A5IA 1PYTD 1UCYK 1CT0E 4HZHA 2THFB 1BITA 1Z1IA 1O3EA 7GCHG 2JH5D 1MBMA 1O5FH 2J5UA 1SR5C 1HXFH 1SBWA 1DVAH 4K60A 2V3OH 2Y7ZA 1CE5A 5SGAE 3MU4A 3I29A 3H7TA 3GDUA 1AKSB 2Z9IA 5GPIB 1B0EA 1Y3WA 1C5XB 2AGEX 3KYFA 3SHCH 1J17T 2ZHDA 4DGJA 2WUBA 2BLQA 1DE7H 3SV9A 1ZHMA 2BDIA 2KAIB 1IHTH 3M37A 1G37A 2XC4A 3A83A 1UO6A 3AASA 3C1KA 1PPZA 4CRDA 1TGNA 1FY1A 4O3TA 1GI8B 1C4V2 2BM2A 1LVYA 2XWAA 1O3BA 1BMFD 1T8LA 3EE0B 4WY3A 1O2TA 1NY22 1S82A 4ISLA 2WV5A 3ZVGA 4ABHA 1MABB 2Z3EA 3UR6A 1AVWA 1DWDH 4YLUA 2V6NA 1ARCA 4QT8C 3KYGA 2J38A 2ODPA 4JCNA 2FODA 1KXDA 3BG4C 2GCHF 5DKMA 3KEEA 3RXMA 1K21H 1BB0B 1FQ3A 1C1OA 1E1QD 1DWCH 1TMTH 1V6DA 2BOHB 3M5MA 1XM1A 2WPDD 5C67A 4AG1A 4GSOA 1P9SA 2F91A 1EJMA 2XWBI 4RKOB 1BJUA 3SUGA 4ABJA 1P3CA 1EASA 4D8NA 4FOUC 4B1TA
chains in the Genus database with same CATH topology
3FVFB 4X1QU 5IYTA 5DP7A 1AKSA 4WXIA 4B74A 3A8AA 2UWOA 1ELFA 2FOFA 1YPHC 1KSNA 2OC0A 1UTMA 2VIPA 3GCHC 3O8BA 4Y7BA 3RXTA 1ZMLA 2KAIA 2Z6BD 3ZVFA 1QIXB 4CRCA 1ZSLA 3SU4A 1T4UH 3GCOA 3ZZ3A 2R0KA 4ESTE 1DLKB 4AORA 3OY5U 1P02A 4BAOB 2UWPA 4Q7ZA 4TPYA 3SGQE 4LXBH 5EU8A 1XUJA 1W0YH 1HAVB 2G51A 4I32A 1TE0A 1C5WB 1E0FD 3E91A 1IQIA 7KMEH 4RN6A 1RIWB 1ZTLA 1DOJA 3RUOA 2VGCB 4INHA 2OCVB 3U8TH 2ULLA 1OX1A 1YPMH 3A82A 3K65B 2JH6D 1GMCF 2WPJS 2BMGB 2Y81A 1GBKA 3ZZCA 1UVPA 4Y0ZE 1HAOH 2C8XB 2DE9A 5DP6A 2OD3B 3A7ZA 3KCGH 1ZRKA 1NFUA 1K2I1 3ELAH 1RXPA 4INLA 1XVMA 1UVOA 4ABAA 2BY6X 4JZDH 1C5ZB 4PROA 5EQQA 5EW2H 1SGYE 1GJ8B 1SGQE 1BTZA 2ZPRA 1FXYA 1YBWA 1XX9A 4BXSA 1W2KH 1BDAA 3QWCH 1AVXA 2PTNA 3PYHA 1WQVH 4ZUHA 4YO9A 3U8OH 5FXLA 3P95A 2VVVA 1EPTB 4JMYA 1KXEA 2XBVA 1W7GH 2QCYA 3RXJA 1IQLA 1CSOE 2RG3A 2EI7A 2CHAC 1C5LH 1P8VC 6CHAB 1YPHE 3SNDA 4XBDA 2OXSA 1SSXA 1SMFE 2GVFA 1O3PB 1VITG 4DIIH 2A4QA 1H8IH 1PPEE 5DG6A 1DANH 1EJNA 4I8GA 3A7TA 1NRNH 4CRAA 3W94A 1V2ST 1HAVA 2EI8A 3FAOA 1FN6A 1C2HA 4FU8A 4WMEA 3LGTA 3TGKE 1YM0A 2TPIZ 2VU8E 3LGYA 4R8TB 1O2UA 1XUKA 3NK8A 4BANB 2ZU5A 4D7GA 2BDYA 4FUEA 4GHTA 1O3NA 3NUMA 1JRTA 1P2IA 4WMFA 1NRSH 1W3CA 3GY6A 2WPLS 6LPRA 3I78A 2P3FH 4B2BA 1GJCB 4YOJA 2A5KA 1RTKA 5CHAB 3QGJA 1D3TB 2RDLA 4IBLH 3A7VA 4ZROA 1Y3VA 4WVPE 4TY7A 1GHYH 3K2UA 2ZPQA 3M5OA 1Z71A 4B73A 4X1SU 3E0NB 2ODQA 2FTLE 2YOLA 3SV7A 3TK5A 1LKAA 2ZI2H 1ZZZA 1SHHB 1P2JA 1UVTH 1EATA 1SOZA 4FU7A 4AN7A 1TX7A 3MNSA 1FI8A 5GCHG 1NU9A 1D3DB 1L1GA 3S0NA 1EPTA 2WPHS 1TX6A 5F8XA 4BTUB 1DDJA 2Q1JA 4LK4A 1CHGA 1NM6A 1O2PA 3IWMA 3GICB 1CHOG 2PSXA 4YM9A 3V3MA 2QA9E 1LMWB 3STIA 1AWHB 2BQWB 4SGAE 1ZPCA 4ABEA 1Q2WA 4ZXXH 3V0XA 1SGTA 1QR3E 4ISHH 2ZEBA 5LPFA 4B76A 2TIOA 2ZU4A 1TMBH 1YPKH 1GMHG 3GY4A 4R0IA 1C2EA 2QXIA 1GDNA 2RA0A 3Q3KA 1AFEH 4VGCC 1TGTA 2YNAA 4O9VA 1LHDH 1QJ7B 3RP2A 4INKA 1T31A 5C20A 2OBOA 1HFDA 3ZZ9A 3ZZAA 1YGCH 3BIVH 1THSH 1O32A 4FVBA 3LC5A 4Z6AH 3P17H 3V7TA 1MD7A 2ZFPH 4ZKSU 4FUCA 2ZC9H 2FOCA 1P09A 1O35A 3A87A 2J95A 5EPYA 4NWKA 3SJOA 3T62A 2AIQA 3U9AH 2VIOA 1CGJE 4U32A 4ZH8A 4U30A 1C5RA 3PROA 3QUMP 4X2YA 1H9IE 1ETRH 1YLDA 1V2VT 3M5LA 1CA0C 2BB4A 1BHXB 4H6SB 1P05A 5C3NA 1TRMA 5A8YA 3Q3XA 2QF0A 2XCFA 1JIRA 5EQSA 2BOKA 4BAMB 2AEIH 2H9EH 4NG9H 3N7OA 5K0HA 2R2WU 5C1XA 5EXNA 3VXEH 3AVZA 4K8YA 1GBFA 3LGUA 3O8RA 1ARBA 2W7SA 3PWCA 4AZ2B 1FJSA 2BZAA 5DP4A 5A0AE 2W3IA 5C5NA 2O8UA 2QXJA 2J34A 1VCQA 1CVWH 2GDDA 1GJDB 1Y5BT 1NRRH 1AFQC 2C8YB 5HM2A 2ZU2A 3BG4B 3KIDU 5L2YH 5EW1H 3LJJA 1EXFA 1QY6A 5DP5A 1E36B 1GMDF 1XUGA 3MU0A 2HPPH 2QYIA 2FO9A 5F03A 3UR9A 1ZSKA 5E0JA 5BPEA 3M35A 1BBRE 2ANWA 1GJ9B 1T8MA 1SLUB 3O8DA 2UUKB 2FYQA 3UQOA 2ZPSA 3A7YA 1C5OH 3SW2B 1NU7B 1PPBH 4Y71A 1V2NT 4NSYA 1QURH 3T2NA 3PMHB 3PWBA 4JYTA 1BRAA 5LH8A 2W3KA 1K1OA 3SU0A 3V13A 2FOMB 1OPHB 2F9NA 3D62A 2OLGA 1TNGA 1Z8GA 4FUBA 4MLFB 4Q80A 1O2HA 4XOJA 1CBWB 4MG3A 1ELGA 1TPPA 1B5GH 1GL0E 5F6MA 8LPRA 1AN1E 3MI4A 2P94A 2FI3E 3GCHB 3RXAA 4ZHMU 1FZZA 1UCYH 2BY9X 2WPIS 2ZCLP 1EAWA 4ZKRU 1BTWA 1PQ7A 1ANDA 4UFGH 2FPZA 3BTME 4HTCH 1YP9A 2FOEA 4J2YB 1BRUP 4D9RA 1GWAA 3LT3A 1JOUB 2QV1A 2LPRA 2ZIQH 3M3SA 4A1VA 2HVXA 1YPEH 3F6UH 4Y10E 1O2GH 2GCHG 1O3KA 1UK4A 3QGNB 1QBVH 4JYVH 3RLYH 1V2PT 3U69H 3TH2H 3A85A 5J4SA 2GCTC 2Z94A 2ALPA 1QNJA 1ABIH 1E37B 1HLTH 4WJG2 1LPGB 3FP7E 2W26A 4CHAB 1EAIA 3LGWA 3SJ8A 5LPEA 1FDPA 4UONA 1YPLH 3GY2A 8KME2 2F3CE 1NS3A 3RDZA 3D49H 2OC1A 1E34B 3C27B 1FY5A 1GHAG 3PTBA 1D3PB 2B5TB 3HK6B 4BTTB 3FP6E 4AFQA 4E06H 1E38B 1C1PA 2SFAA 3SU3A 2PR3A 1WTGH 1GDQA 2WPKS 3QTOH 1SGEE 1OWDA 1XUHA 3A8BA 5J4QA 1K9OE 1TA2A 3K9XB 2ZGJA 2ZQ1A 5BRRE 3SORA 1UJ1A 1TFXA 1VCWA 3FANA 2BD4A 1C1NA 4NZQA 1S81A 1HAHH 1QBOA 3Q77A 2CHAB 1F7ZA 2J9NA 3KGPA 1V2JT 1JIMA 2LNCA 1BZXE 2ZTYA 1QB1A 1V2RT 2H9HA 2VINA 3DFLA 2G52A 2Y5HA 1ID5H 5B6OA 4AFZA 1K28D 1KXBA 1C2IA 1O2LA 3RC5A 4SGBE 2V3HH 1FY3A 3GY8A 3EGKH 3A7WA 3SOSA 4ZKOU 4OS5A 1EX3A 1YF4A 1ORFA 1HJAB 1EP5A 1Q3XA 2PGBB 3HATH 3SU2A 1V2QT 2CV3A 1HV7A 1C2GA 4DURA 1EP6A 1WAYB 1CA8B 1PQ5A 1UMAH 2HNTF 1KXFA 2A31A 4MDSA 2H9TH 1IQMA 1ANCA 1F5RA 2XTTB 3U1JB 2H5CA 4Y79A 3BEIB 4IN2A 5AFZH 5EQRA 1LHEH 5ESTE 5FAHA 1MTSA 1UTPA 1GCTB 1GBLA 2HNTC 1P2QA 4OS7A 2VH0A 1ZGVA 1WQSA 2K1QA 2BD9A 1QHRB 3SNEA 1ACBE 2VIQA 1A0LA 1O39A 2DE8A 1A5GH 3DT0H 2WYJA 4FUDA 4JZFH 4CH8B 1W10U 1JWTA 5AVDA 2IOTA 1NPMA 3MU8A 2SGQE 2FEQH 1GHWH 4Y76A 3HGNA 4Y6DA 2AYWA 1DXPA 1IQGA 1EB1H 2WINI 4CREA 2F9PA 1O2OA 2H2ZA 1C5SA 3RU4T 1DSUA 1THRH 1EZSC 2D2DA 3UTUH 1FPHH 2PV9B 2ILNA 1F0TA 2A4OA 4IN1A 5JBTA 2G4UA 1MTUA 1KTTB 1YYY1 3RXUA 3ZYEA 1MKWK 1F0RA 2AGIX 1YCPH 2QGRA 1O2YA 1AU8A 1WU1A 2BQ6B 2O8WA 3MMGA 1H9LB 4X6NA 4OGXA 2F9UA 1UTKA 4E05H 1GBHA 1MUEB 4U2WA 3SZNA 3GY5A 1HJ9A 2P93A 2D26C 1SGFG 2TGAA 3TGIE 3HKIB 2XC5A 4E7NA 1HYLA 4H42U 1C1MA 3TJNA 2AIPA 3EA9A 3A7XA 1BJVA 4CR5A 4AG2A 1L2EA 2W7UA 4KTUA 1GBAA 1RS0A 1C2LA 3HKJB 3RXKA 3RXLA 2VVCA 1P0SH 4NGAH 2HNTE 3TH3H 2STAE 3ZVEA 5A0CA 1AI8H 2R2MB 2Y6TA 3U1IB 4AB8A 4IC5A 3IG6B 5FBEA 4MTBA 4DY7B 3TK9A 6GCHG 1IQFA 1G3EA 1JXPA 3MWIU 1J16A 2EEKA 1DT2A 1NFXA 2ZHQH 1G3DA 2P3TB 2A45B 3RMOH 3A88A 3UQVA 2SGFE 1HAGE 1FONA 1Y3XA 1ZGIA 2ZDAH 4I8JA 2FMJA 1OYQA 3TVJB 4DOQA 2FTMA 2V35A 3U98H 1QA0A 4NZLA 1QBNA 4K69A 3QZQA 3SJIA 1P2MA 3KNXA 2W5EA 1IHSH 1W7XH 5HGGA 1G30B 2A4GA 3PO1B 2CXVA 2BDCA 1GI7B 3HPTB 1QA7A 1C5PA 4O03A 5HYOA 4BAKB 2GZ7A 1TQ7B 1RTFB 4ABDA 4O97A 4F4OC 2HGTH 3KQCA 3RXEA 2NU2E 4I7YH 4ASHA 1J8AA 2UWLA 1XMNB 1GJBB 1P10A 5FPSA 4GCHF 5H4IB 1DS2E 3I77A 1O2IA 2BY7X 1Z6JH 1GHBF 2F83A 2AMDA 2GMTC 2STBE 1EKBB 2OC7A 4GPGA 4TYDA 1F0UA 1O5DH 3EA7A 3PLKA 2TGTA 1C2KA 1MQ5A 4RKJB 3M3TA 3NZIA 5ABWA 1GHZA 5E2OA 2F9OA 1Z8IB 2Z3DA 1CQQA 1HIAB 5GJ4B 1ZLRA 1XUIA 5EXMA 3T25A 2XXLA 3PMJA 4ABFA 1PPGE 4NIXA 5JBCS 1YCPK 3MO3A 5GWZA 3DA9B 3BTDE 2H6MA 3QK1A 3RXSA 2ZHEH 1P01A 1K1NA 1O2NA 1OYTH 1Z7KA 1G32B 1KLIH 1ELBA 3SQEE 4A92A 1GMDG 1K1PA 3PMBB 1RRKA 3S9BA 5EGMA 1TABE 1SGRE 1SG8B 1GGDC 4XDEA 5DO4H 2GDEH 1DITH 1HB0B 1KDQB 3P8NA 5DK1A 3T27A 1TPAE 2BLWA 2C93B 1DFPA 3MTYA 1C9TA 1HPGA 4I33A 4X1NU 3WY8A 2FDAA 3MH5A 1YCPM 2VIWA 1XVOA 4DT7B 3SUFA 3UNQA 1GI1A 1SHYA 2D1JA 2BD7A 3AAUA 1ESAA 4HFPB 1S0QA 4AYYB 1RJXB 1ZHPA 4K2YA 5T6FA 1S6FA 5AF9H 2BDGA 2ZFRH 5HXFA 2PKSC 2NWNA 1NTPA 3SNAA 3MH6A 1XXFA 3Q76A 1ELVA 1O3LA 4X8TH 1BOQA 3B8JA 3W95A 1P04A 5C1UA 4UEHH 3RLWH 3V12A 1O3FA 1SL3A 1RTLA 1HAYB 1GVLA 1A4WH 2TBSA 1GI2A 1BTPA 1O37A 1C5QA 2NU0E 5T6GA 3E1XB 1TAWA 1ZHRA 2C8ZB 1MZDA 4WF8A 2JETC 1QL8A 4B75A 2BDHA 4Y0YE 1O2QA 2FLBH 1SQOA 2ZNKH 1HIAA 3NXPA 4DG4A 1SLWB 2PUXB 2PLXA 3RC6A 1AVGH 2FX6A 1W12U 2Z9GA 3GY7A 3BEFB 4D76A 1IQNA 2ZA5A 2FOGA 1XKAC 1GBJA 1THPB 1CGHA 1YLCA 3E6PH 2BVXH 5EXLA 2J2UA 4NSVA 2A5AA 2Z7FE 1UHBB 4AFSA 3VXFH 2FLRH 4BAHB 2WV4A 1ANBA 4X2VA 3P8FA 1WUNH 3TNTA 1CO7E 2P95A 1QFKH 1V2KT 4JK5A 1O5CB 1EZQA 1O3IA 1KYNA 4YOIA 1C1SA 2JH0D 3RXIA 3SV6A 3SJKA 1O5GH 1YKTA 1OXGA 1LO6A 1KDQA 1Q31A 2ZFTA 2BLOA 3PB1E 4UFDH 3SQHE 3IITA 1MTWA 3LIWA 1HAZB 2I6SA 3VB5A 1NN6A 2AH4X 1AUJA 2RA3A 1Z8JB 1O0DH 1SGPE 3ATWA 2ANMH 1C1TA 2C90B 1C2JA 3NKKA 1TA6A 1UVSH 2PUQH 3RXFA 1HNEE 3KHVA 3GYLB 4A1XA 1VCPA 1D9IA 3EDXB 3ATIA 3TITA 4AFUA 1BQYA 4XE4A 3EAJA 4MNWA 1C5TA 4FUFA 5C2ZA 2CN0H 3SNBA 2FIRH 3UOUA 1GCDA 1WTHD 2O9QA 1H8DH 5HMAA 4BTIB 2GD4B 2CF8H 5JB9S 6ESTA 1AZZA 1TPOA 3FFGA 8GCHF 1FAXA 3ZZ7A 1LDTT 1QJ6B 3AW0A 4LZ4B 1MKXK 1C1VH 4E7RG 2ZDKA 2CMYA 3S7KB 4Q7YA 4MNXA 1OS8A 1MU6B 1EOLA 4UFEH 3ZVCA 1O34A 1N8OC 1KLTA 1V2UT 1G36A 1A3EH 1SFIA 1SGNE 4A5TS 2UUFB 1G3BA 1IQKA 3TU7H 1UHBA 1QL9A 1W14U 1VJAU 3KQBA 1RGQA 1AUTC 1TX8A 3LDXH 4KKDA 1DPOA 2G5VA 1LPZB 2VH6A 3S69A 1YPJH 1TBZH 1N6XA 1GHVH 4ISNA 2FOBA 2O8MA 3SU1A 3VFEA 1SGDE 1MD8A 1BTHH 1BTYA 3BTKE 1HJ8A 1O30A 1DUEA 2OTVA 1LQDB 3QO6A 3BEUA 1FPCH 2C8WB 2ZCKP 1O3MA 1O38A 4ISOA 2GT7A 4K5ZA 4YTAA 1L4DA 1DSTA 4WXVA 2VWNA 3BTHE 1HAPH 1UK3A 3VEQB 1NC6A 5E0HA 3SI3H 3ZZ5A 2I6QA 1FIWA 1P11E 1GBMA 1O2JA 3BTTE 2XBYA 1NO9H 4TPIZ 3ZV9A 1B0FA 1ZPZA