2FODA

Structure of porcine pancreatic elastase in 80% ethanol
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords elastase-1
publication title Multiple solvent crystal structures: Probing binding sites, plasticity and hydration
pubmed doi rcsb
molecule tags Hydrolase
total genus 59
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2006-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fodA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fodA01
2IPHA 1ZTKA 2BVXH 3MO6A 2STBE 3HPTB 4TY7A 1G2MA 4TY6A 5HM2A 2ZG0H 1O2XA 2WUCA 1OWEA 3RM0H 1BCUH 2ZU3A 1MU6B 1O2QA 2QYIA 3RXJA 2OXSA 4H42U 2FZZA 3B23B 2WPIS 5F03A 1QA7A 2BLWA 3BSQA 2B7DH 1O2IA 1T8LA 5CMXH 1FDPA 2VVCA 5HM9A 4AGJA 1MTSA 2R2WU 1C4Y2 3TGJE 4DIIH 1LVYA 1AO5A 1SSXA 1GI7B 4ESTE 2R0KA 3ZVBA 1L1GA 2I6SA 5LGOA 1DITH 1LPGB 2RDLA 1BMLA 3MH4A 4Y71A 4CHAC 1ARBA 1BTWA 1MTNC 1HAPH 3AW1A 1SI5H 1ZYOA 3SGQE 3T29A 4X6PA 4UFEH 1K1MA 2CJIA 1TLDA 1YLDA 3PTBA 4BTUB 4U30A 5GCHG 1BRUP 2ANKH 1CE5A 1E0FD 1YC0A 4YOGA 1A0JA 1ZTLA 1TQ7B 3TH2H 3LH3A 1UCYK 2VWOA 2WPLS 1O31A 1W11U 2FWWA 2JETC 2BYAX 1BTUA 1O3KA 3W94A 1NFUA 1XUJA 2Q6FA 3HK3B 1O3NA 2BOHB 2JH0D 1NT1A 2OTVA 4JYVH 1YCPM 2CXVA 4MLFB 1O3FA 3KQCA 3R3GB 1Y3WA 4WMDA 1SLWB 1UVTH 1SFIA 4K8YA 2ZFQH 1C2HA 3RC6A 3A8AA 2PV9B 1GHBF 2BD7A 3LPRA 3M3VA 6LPRA 3E91A 1IQFA 1HGTH 1L0ZA 2ZGHA 4OS6A 5ESTE 4ZHAA 1T4UH 3A89A 1A5HA 4CR9A 2R3UA 2AGEX 4THNH 1MAXA 1FZZA 3UTUH 5EU8A 1CHOG 1DFPA 3M5LA 1UK2A 1AUTC 2VIOA 3SUGA 1NU7B 3SV9A 1CT2E 3UPEA 5T6GA 4HGCA 3NUMA 3BTHE 4X6NA 4BNRA 4FUFA 3RP2A 1RIWB 1Z1IA 5FBIA 1LVOA 3ZV9A 1O5GH 1MKWH 3PLBA 4X2WA 5DP3A 3M35A 5H4IB 4ZXXH 3MMGA 2WPKS 4J2YB 3M3TA 3VGCC 1G9IE 2H9HA 2BX4A 1TMUH 3GDSA 1ELEE 3RC4A 5JB8S 3TGKE 1YPKH 1GJAB 1N6XA 1ESTA 2VWNA 1SBWA 1O5DH 5ABWA 2BD3A 3LH1A 4BXWA 1S0QA 2GGVB 2PSXA 8GCHF 3UR9A 1W7XH 1KXAA 1W13U 3EA9A 1EZQA 4DVAU 2XYAA 1EQ9A 2AMQA 3BEUA 3TNTA 2ALVA 3A83A 1SQAA 1AVGH 1Z8IB 4E7NA 2XC4A 1S83A 9ESTA 3KEEA 1C2LA 3HKJB 1QFKH 3BTWE 4AFUA 5FCKA 1THRH 2ZHWH 3FP6E 4WWYA 2QXJA 1PJPA 1H4WA 2WPHS 4HZHA 1Q3XA 1WBGB 2FODA 1P02A 1O34A 1CU1A 1V2NT 1AIXH 3JZ1B 1DX5M 4FXGH 4AFQA 1NY22 1GHYH 1OP8A 4NZLA 1CGHA 1A1RA 2ASUB 1P09A 2Y5FA 1C9PA 1Y3YA 1K1OA 1G36A 1P05A 1EPTA 4WXIA 1BMNH 3VFEA 3LGTA 1NRPH 4ISOA 1O3CA 3ZZ6A 1GGDC 4OS5A 2NU3E 4BANB 1YPEH 4FU7A 2CHAC 4I8HA 3O8RA 2ZZUH 5DO4H 1QBVH 1LPKB 5DP5A 4HFPB 4YM9A 3SGBE 3TH4H 5DPAA 1RTKA 2BVSH 2HRVA 1YBWA 3OSYA 2Q1JA 4Y7BA 1WAYB 2P3FH 2ZTYA 2QIQA 3HGPA 4YO9A 1SGDE 2RCEA 4FU8A 1C5PA 2ZU1A 4I8KA 1RD3B 2WPMS 4X2VA 3Q3XA 1PPCE 1MQ5A 2JKHA 1CT0E 2BY6X 1AQ7A 1C1PA 1O3JA 2F9VA 2GVFA 3ELAH 4AFSA 1BRBE 3VXEH 4Y6DA 5DK1A 1O2RA 1V6DA 2R0LA 3RXTA 3SI4H 5BRRE 1DXPA 5EG4A 2V0BA 2A4QA 1CA0B 1SHHB 4WH6A 2ZGXH 1ZZZA 2TPIZ 4A6LA 4CRCA 3PM3A 1DLEA 4YT6H 1ZRBA 1A7SA 1XMNB 3M36A 3T2NA 5TJXA 3RMNH 5IDKA 3BG4B 1TAWA 3DFJA 4A1VA 4RN6A 1S6HA 2W3IA 3I78A 3LT3A 3RXCA 1D9IA 4MNXA 1G32B 1W3CA 4MNVA 5FPYA 3MU8A 2XNIA 1N1LA 4B76A 1OYQA 3ZZ7A 2C8WB 3QX5H 4NZQA 1IQNA 1JOUB 1NU9A 2K1QA 4YT7H 1XM1A 3SORA 4Y8YA 1DWBH 2Y7ZA 5A8XA 4UD9H 2A5AA 4NWLA 1GDNA 4Q2KA 4R0IA 1ETSH 1YPLH 1HAOH 3UUZA 1ELBA 1TNGA 4A5TS 1SGYE 2GDDA 5L2ZH 1NTPA 4AN7A 3KCGH 2Z7FE 3R0FA 2ZEBA 1ZPCA 1GJ7B 2C3SA 1MQ6A 1BB0B 4J1YA 4DCDA 1T8OA 4LOYH 2ZGCA 7GCHG 4B2BA 1P3CA 3RXOA 9LPRA 2XWBI 5GIBA 1TABE 3UOPA 1QB9A 4SGBE 1O3IA 1O3PB 1O35A 2P95A 2GD4B 4I8GA 2FOMB 4MVNA 4NA9H 1FUJA 4AB8A 1O2YA 4ZKNU 3D49H 2OQUA 3SO3A 1E38B 3GY7A 1RIWC 1F0SA 2A0QB 4GAWA 1Z6JH 1D3PB 3QTVH 3BTME 6CHAB 2FESH 3M5OA 1BT7A 1FY3A 5AF9H 1JIRA 1O2LA 2FP7B 1IQLA 4JZFH 1W14U 4WMFA 2PGBB 1NPMA 4NIYA 1S84A 1AVWA 3D62A 1WYKA 1KXDA 2H5DA 4RKJB 3SBKA 1V2PT 1OWHA 1ESBA 3GICB 3RMOH 1NFXA 3WY8A 3SJ9A 2OCVB 6ESTA 2G51A 2GP9B 4ABJA 1O36A 1C1SA 1V2MT 4I8LA 3NWUA 2B9LA 1HAXB 3SQHE 1MD7A 1O2HA 2A7CA 1O33A 3ODFA 5JPMH 2SGQE 2FS9A 2ZKSA 3MYWA 1HAVB 2ODPA 1UTJA 4Y11E 5HMAA 2BQ7B 3KIDU 1J9CH 3PWBA 1T31A 3ESTA 1UVUH 3PV4A 1CA8B 1BTPA 2SGFE 3PYHA 1Y8TA 3UIRA 1TNLA 1PPEE 5A2MH 3RU4E 4NFEA 1QJ6B 4ZHMU 3GISB 3BV9B 1BHXF 2ZHFH 1QURH 1SGCA 3VB5A 3F9FA 1NN6A 2ZPRA 1TBZH 2PKAB 1AE8H 2TRMA 3GDVA 2J95A 4U2WA 1MKXH 3ZZDA 5C3NA 1BBRE 1O2KA 2BDAA 2FIRH 4IN1A 5ESBA 3H7OA 1XKBC 2AFQB 1IQGA 3V0XA 1O2OA 3RXDA 1AGJA 3P8OA 3RC5A 5JBBS 1Z71A 3D23A 3FVFB 1AN1E 4TWWA 3KQEA 3BEIB 4ABEA 1EAXA 4MNWA 3EAJA 1SLXB 1GVZA 3TLOA 5BPEA 3LOXA 1SLUB 3MH6A 5JBTA 4GCHF 1PPZA 2VJ1A 2F9UA 1ZTJA 4DY7B 1DSUA 1LHFH 3LGYA 2H2ZA 2VVVA 3VB7A 2F83A 1M9UA 4DW2U 1KY9A 3F9HA 2A1DB 4JZIA 8KME2 5J4SA 4MPWA 1CA0C 1IAUA 1O2VA 1PYTC 1MUEB 1SVPA 1F0TA 2ZCKP 4FUDA 3UNSA 4WH8A 3BG4C 4DIHH 3MO3A 1SR5C 2HALA 1FAKH 3RMLH 3E0NB 2STAE 4AGKA 1GL0E 1VZQH 4Y7AA 1J8AA 1PQ7A 2C8YB 3M3SA 2TGAA 1ZGVA 1VCQA 1HJAB 1SOTA 1A3EH 1AMHA 2FPZA 4JMYA 3ITIA 2BZ6H 3D65E 1UCYH 3NK8A 2TGTA 5AVDA 2A32A 1F2SE 2QXIA 1NC6A 3VB4A 4ABIA 3ATKA 2KAIA 1TYNA 1ZHMA 3BN9A 4A92A 2HPPH 1D3DB 2ANMH 3EQ0H 5IYTA 4X0WU 4Y79A 4XFQA 4YTAA 1GI6A 2J38A 4XBCA 1ZGIA 1NM6A 4DURA 1RTLA 4ABBA 1A4WH 1J17T 1C2IA 2OD3B 3LC5A 1P10A 2UWPA 2O9QA 4KGAA 4X2XA 1L1NA 1O0DH 2DE9A 1GI4A 1C2JA 2UUFB 3UR6A 4GSOA 4ZHLU 2VU8E 3QK1A 4CRGA 1E34B 3S9AA 1PPBH 3L33A 1VITH 1TMBH 2O8TA 3O8BA 1J16A 1SQOA 1ANEA 2F91A 6GCHG 5EQSA 1IQJA 1A3BH 1T8MA 3L3TA 1WQSA 2Z9IA 3OY5U 2NU2E 2F9BH 1EZSC 1LVBA 1K2I1 5C5OA 4XOJA 2OBQA 1TONA 4JCNA 3SUEA 3VXFH 5DKMA 2C90B 3PB1E 4K1TA 2P59A 2ZO3H 1CO7E 2QXHA 6CHAC 3I29A 2ALPA 4WMEA 3A86A 3BTGE 2WINI 1UJ1A 1TA6A 4A7IB 4Q7YA 1F5RA 3M5MA 5CHAB 3QZRA 3QDZB 1GBTA 1TGBA 4ZMAH 3E6PH 4X8TH 1RXPA 2WYGA 3U98H 1SGFG 1HFDA 4X8UH 5F8TA 4ABGA 1WU1A 5FX5A 1N6YA 2AERH 2PFEA 3MNCA 1SC8U 1WV7H 3ZZCA 4ZKSU 2OC8A 1TB6H 3QGNB 1FONA 1S5SA 1EOJA 4FVBA 3IG6B 1MCVA 2XC0A 1UHBB 4OS4A 3T28A 2QV1A 1FIZA 1DOJA 3RXLA 2NU0E 4UONA 1PFXC 1SGTA 3K6ZA 3MO9A 2ZDAH 4I8JA 4U32A 4B74A 5J4QA 3TIUA 1GI3A 3F1SB 3A8DA 1HAIH 4JK6A 1ID5H 1BMMH 3CS0A 5CE1A 1TIOA 1V2WT 1K1IA 1ZJKA 2XC5A 1ESAA 1B5GH 4MG3A 2PKSB 1AZ8A 1VCPA 1P3EA 3E0PB 3BEFB 1K21H 1O39A 4LK4A 4YLUA 2EI7A 4CRAA 2HNTC 1FJSA 2FO9A 3O8CA 2Y5GA 2AMDA 1EJAA 2W7UA 1SGNE 2YOLA 4AFZA 1G3BA 5F8XA 1C5TA 3A7WA 1E36B 2BLQA 2ZU4A 3LJJA 1SQTA 5FCRA 5C5NA 1SG8B 4QT8C 4TYDA 5TCAA 4D8NA 1TPOA 4AZ2B 1T32A 4YLQH 2BM2A 3EDXB 3MOCA 3PMAB 2YNBA 1ARCA 1P2KA 1TGNA 4KKDA 1V2QT 4ABHA 5EXLA 2Z9GA 8ESTE 1W10U 2P3TB 3KNXA 4E06H 3U1JB 1ELAA 1D6WA 2C4FH 1F0RA 1DPOA 2V6NA 3TJUA 2GCHG 6GCHF 1BQYA 1C2GA 2GMTB 2UWOA 1K1JA 1AU8A 3P8GA 2A4OA 3ZVDA 2AGIX 2VIPA 5FHTA 1LQDB 1GBEA 1TGCA 2UWLA 1UVOA 2XBVA 1H9IE 2PWXA 3PROA 2THFB 1C4U2 2IN2A 1F0UA 4KTUA 5DG6A 1AHTH 1GI2A 1A5GH 3NKKA 2ANYA 1Y3XA 1GMDG 1BTZA 1AFEH 1GVKB 1HBTH 4PROA 1HJAC 2GZ8A 1GBDA 3EGKH 3SHAH 2A4GA 3AAVA 1QRXA 3ZYEA 1GBBA 2ZF0H 3GYLB 1EZUC 1GBIA 4CH2B 2CGAA 1EXFA 1V2VT 2C8ZB 4H4FA 3ZZAA 3DUXH 4UDWH 2XBWA 2VH6A 3LGVA 3GCNA 3VB6A 3RUOA 2BVRH 2XTTB 1W12U 4GPGA 3TNSA 1VJAU 3TJNA 3A80A 1K9OE 3KHVA 3RXBA 4I31A 1TNKA 4AYVB 1DM4B 3MU0A 1TPPA 1DWCH 3ATWA 1KXEA 1GCDA 2ODYB 1V3XA 1O5AB 2FI3E 1U6QA 4DGJA 1O2SA 4O9VA 2CN0H 4ASHA 3H7TA 1P2MA 1EB2A 4INHA 3LU9B 1C1WH 1NESE 4K8BA 1F5LA 3QZQA 1V2UT 2OP9A 2SGDE 2O8MA 1Y5UT 2BB4A 1O2MA 4BAKB 1C1QA 2A7HA 2ZQ1A 1OKXA 1TNJA 1DUEA 5HGGA 4AG2A 4AB9A 2YNAA 2W7SA 4BTTB 3S9BA 3PMJA 4IC5A 4GLYA 5CHAC 4B75A 2O8WA 1EAIA 5E2PA 1EUFA 3Q76A 4A1TA 1CGJE 3SQEE 3KL6A 2LPRA 3UY9A 5GCHF 2AIQA 1O3LA 2ZDMA 2BDIA 3MNSA 1TBQH 4NCYA 4BTIB 5B6OA 2ZTXA 4XSKU 1CT4E 1DICA 4BAHB 3VPKA 1GDQA 4B73A 5JDUB 1SGFA 4HI3A 4FUEA 1MBQA 2GTBA 1V2RT 4FU9A 1C5XB 2D2DA 1NRSH 1AB9B 3E3TA 1ZOMA 1GI0A 2NU4E 1CVWH 2BY9X 2FLBH 2ZHQH 3SU4A 4CBNA 2HGTH 2F3CE 3SV8A 1GG6B 1EASA 1V2KT 4CREA 2UUKB 1LHEH 2WV4A 1GMDF 1L2EA 1ELGA 1YPGH 5DP8A 1GMCG 1QQ4A 1A0LA 1LMWB 4UFFH 2C93B 1SGQE 2W5EA 3BF6H 3OX7U 4ABDA 3ZVFA 1ZSLA 2PKSC 3ZZ9A 2ZDVH 1RRKA 1ZPZA 1P2QA 1CHOF 4YESB 5FXLA 1UVPA 3A87A 4I33A 1THPB 1XKAC 3Q77A 5GXPA 1W8BH 4BOHA 1BTYA 4RSPA 3I77A 3MH7A 1FN6A 5SGAE 3KN2A 3E1XB 2J4IA 2HVXA 4MPVA 2G4UA 1V2JT 2P3UB 2WPJS 3U9AH 7ESTE 4TPIZ 1DS2E 1P11E 1IQEA 2F9OA 2PTNA 3RLWH 3SJ8A 3AAUA 2VIDA 1AVXA 1DUAA 1VCWA 3NCLA 1OWJA 1EPTB 4E05H 3RU4D 3SZNA 1PQAA 3TK6A 1YCPK 3PWCA 2QY0B 1SPJA 2D8WA 2VIVA 1TALA 1QRWA 2GMTC 1YPMH 4XE4A 4R8TB 2XWAA 3GCHB 1NROH 1ZSKA 2J92A 4NA8A 3QGJA 1S6FA 4CRFA 1KYNA 5I46H 3GY3A 1LCYA 4B71A 1YPHE 4OS2A 4FUJA 1WOFA 1ORFA 1P57B 2GZ7A 1P0SH 1J15A 1GJ9B 3S7KB 1ETTH 3ZZ5A 2HPQH 4A1XA 1TWXB 2BTCE 1L1JA 3TVJB 1FQ3A 3LKWA 1NO9H 2PHBA 3LC3A 3RXKA 2UUJB 1AD8H 5DP6A 4AOQA 1J14A 1Y3VA 1DE7H 2OUAA 2BDGA 1HJ8A 3S69A 1LO6A 2ZIQH 4IW4E 1UTQA 1P2NA 3C1KA 3SNDA 2G52A 1DVAH 3OU0A 1TNIA 2FDAA 2O8LA 1E37B 1W0ZU 1HIAB 3O8DA 2ZC9H 3H5CB 2GCTB 3PO1B 1A61H 5DP7A 5JBCS 3T26A 2Z9LA 1CBWB 4JYUH 2H5CA 1OX1A 5EPNA 1PQ5A 2OQ5A 4X1PU 1GHAG 2Z6BD 2W26A 3ZZBA 2XRCA 2EI8A 5EOKA 4DOQA 1JXPA 1OWIA 1D4PB 1Y5AT 2B8OH 1VJ9U 4Z6AH 1O2JA 2PGQB 1ZLRA 1UMAH 4TWYA 2Z3EA 3FP7E 2XW9A 1S0RA 3UREA 2PUXB 3UQVA 2R2MB 1Z7KA 1C1UH 4K2YA 4NG9H 4AYYB 3FZDA 1O2PA 5E2OA 1EP5A 1OWDA 1GHXH 1BBRK 1LHCH 3LONA 4NSVA 1FNIA 4X1QU 4F49A 1Z1JA 2ZFPH 1O3EA 2ZA5A 3PLPA 3SUDA 4ABFA 3T5FH 2AGGX 4E7RG 1O3HA 1ELTA 1O5CB 4TPYA 2VIQA 3Q3KA 2ZCLP 3GY4A 2B0FA 3M7QA 1BMAA 4HTCH 4K69A 1C2FA 1ELFA 1XX9A 1OYTH 2ZGBH 1ELVA 1K1PA 3DA9B 3Q3YA 1K1LA 3S9CA 4X6MA 3S7HB 2CF8H 2PLXA 4SGAE 1TX7A 3RM2H 4X6OA 3MHWU 3SU0A 1OSSA 1BRCE 1AB9C 1EOLA 2Z3CA 1TX6A 3CP7A 5DP9A 2Y6TA 1L4DA 1YYY1 2QAAA 3SOSA 2PUQH 3MWIU 1P9UA 5A0BA 1TGTA 4INLA 4XDEA 2A2XH 2IOTA 1WTGH 1GG6C 2A7JA 2FEQH 3ZV8A 4D7FA 2OC1A 2D26C 3A7YA 1MAYA 7GCHF 1NRNH 1D3QB 5F6MA 2F9NA 5GJ4B 2XCNA 2ZP0H 4M7GA 3RXQA 1KIGH 2Z94A 1TRYA 1QRZA 1Z8GA 5L6NH 2Y82A 3GY8A 1BDAA 1H9LB 1SL3A 3P92A 4OGXA 4DT7B 2FX4A 3T62A 1YGCH 1XXFA 2FTMA 1EB1H 1DY8A 1GBAA 3ENSB 1TFXA 3GCTG 4OGYA 4DJZB 5C67A 1WQVH 3NZIA 1HRTH 2V3OH 1TOCB 1AKSA 2BY8X 5C20A 3BTDE 1AE5A 2TGPZ 2BXUH 3HK6B 3HKIB 3SV6A 1FN8A 1GHAF 1UTOA 2FX6A 2W3KA 1NRQH 4FUIA 3SNCA 1OS8A 4BAOB 1EPTC 3RLYH 2OLGA 1UVSH 1GJBB 3SU1A 2G4TA 4RKOB 1E35B 1BJVA 1NRRH 2GKVE 4LXBH 5EXNA 2ZFFH 1LKAA 1S81A 3GCHC 1GI9B 2BQ6B 1LPZB 2ZDLA 3SW2B 4Q7ZA 2P8OB 4JK5A 3NXPA 3LGUA 1HXEH 4ABAA 1RS0A 3GYMA 2VGCB 1C5SA 2H9TH 2HWLB 4XBBA 1MTVA 3IWMA 4CRBA 2ZU2A 2A5IA 1QTFA 3G01A 1O2NA 4GHTA 3DFLA 1C1OA 1O3AA 3PTNA 1KXFA 1C5MD 3ZZ8A 2CV3A 2EA3A 2OBOA 1GJCB 2Y80A 2R3YA 1GJDB 3MH5A 2SGPE 3B9FH 5ETXA 2VINA 1XXDA 1ZHPA 1MCTA 1C4V2 1MD8A 3UNQA 2QXGA 1FY5A 2BOKA 1GJ4H 1YM0A 3SNBA 1MZAA 1B0EA 5FPTA 3PO1C 4KTSA 2GCTC 2BLOA 1CBWC 2Y5HA 3ATIA 1PPGE 1GJ5H 4AORA 2BD4A 4K5ZA 1NFWA 1HAZB 1SGIB 3A8BA 4KP0A 3P8NA 1RFNA 2CMYA 3QO6A 2BXTH 1PPFE 4NWKA 1YPJH 1W2KH 8LPRA 1FAXA 1KTTB 1QHRB 2BD8A 3QUMP 3UQOA 1KXBA 1BHXB 1H8IH 5EW2H 1LHDH 2R9PA 1SLVB 1O2GH 4B2AA 2KAIB 1HLTH 1VR1H 3AVZA 1GHBG 2GT7A 1C5NH 5EPYA 1C1MA 2A2QH 1WSSH 2FM2A 2Z9JA 3EA8A 1D3TB 3GCTF 1DLKB 3K9XB 3BTTE 1TOMH 1Q2WA 4YOIA 1GBFA 4JZEH 3URCA 1FY4A 3MU4A 1KLIH 3BIUH 1SHYA 3QN7A 1C5OH 1JWTA 1QB6A 5PTPA 5LPEA 3SJOA 3TU7H 2H9EH 1WUNH 2BD9A 2P94A 1MMJN 4OS7A 1HAGE 2NU1E 1P9SA 1Y59T 1B7XB 2GDEH 3FANA 1GCTB 4JZDH 1S82A 2ESTE 1T8NA 2FXRA 2VVUA 3UWIA 2TGDA 1TPAE 3AW0A 3ZZ3A 1AI8H 8GCHG 3STJA 1V2TT 5FX6A 1GVLA 2G5NA 2SNVA 2VIWA 1DXWA 4ZKRU 3CS7A 5GPIB 1C2KA 2OC0A 2ILNA 3A85A 4ZXYH 3EE0B 3RXEA 2OINA 4NIXA 2HLCA 7LPRA 3ZYDA 3A7ZA 2PTCE 3TK9A 3W95A 2CF9H 4I7YH 4MPXA 3SNAA 3SU3A 4NFFA 4CH8B 1T7CA 1HAYB 1ZMJA 1GPZA 1KDQB 1ANDA 3K65B 1P2OA 2A31A 4NSYA 3C27B 2NWNA 1CGIE 2ZI2H 1HJ9A 5A8ZA 2VWMA 2FTLE 2AYWA 3T25A 1C1NA 1JRTA 2BQWB 2G5VA 2FOHA 3BTKE 1EP6A 1QBNA 3U8TH 2B5TB 1F5KU 1GI8B 3P17H 4YOJA 3QWCH 5HXFA 1YCPH 1DWDH 2ANWA 1QBOA 3ZZ4A 1THSH 3P6ZB 4ZUHA 1HPGA 1A5IA 1FY8E 2BX3A 3OTJE 2QF0A 4IGDA 5C1YA 2SNWA 1QL9A 4F4OC 7KMEH 1PYTD 4IMZA 1BTXA 1GMHG 1P12E 2FOBA 1HNEE 3EA7A 3QTOH 1O3MA 2JH6D 1OPHB 1TA2A 2GV7A 1EATA 3A7VA 3DHKH 1UCYE 5F8ZA 1V2LT 1ZMLA 1PPHE 3RXAA 1C2DA 1LQEA 3GDUA 1KLJH 2P8OC 5E0JA 1K28D 1O5BB 3F9EA 1KTSB 1G37A 4X1RU 4JZ1A 3SHCH 2VGCC 1Y5BT 1TQ0B 1UTLM 1ZSJA 1SGRE 1DSTA 1C5YB 1EX3A 4ISIH 1BTHH 3DD2H 5T6FA 1GBMA 3RXRA 3F68H 1RTFB 1NZQH 5EQQA 5G4BA 2Q6GA 3UOUA 1LHGH 5JBAS 2RA0A 2BD5A 1YLCA 1G3DA 3TGIE 1G3CA 2J2UA 2XXLA 1TRNA 1H9HE 4K1EA 3LGWA 4X1SU 3K2UA 3UNRA 5A0AE 1LDTT 4Q80A 2H1UA 1BITA 1AWFH 1VGCB 1CHGA 2GV6A 4X2YA 2BHGA 1WCZA 4CBOA 4FUCA 4FVDA 2FOGA 3SV2H 5FAHA 3E8LA 3SI3H 2RA3A 1GBLA 2TBSA 3A7XA 1O5FH 4VGCB 1XVMA 1ZR0A 1NS3A 1GHZA 3TH3H 4D9RA 5AFYH 1ZHRA 3UWJH 1O3GA 1QJ7B 2J9NA 3BTFE 1L4ZA 2GCHF 1JRSA 3SU5A 1IOEA 2G55A 5L30H 1C5RA 5L2YH 3RXHA 1QL8A 2OC7A 5FPSA 1BBRH 1H8DH 2GT8A 1SMFE 1P06A 2ZFRH 2ZFTA 5E0GA 4ISNA 1GHVH 1O2ZA 2JH5D 4H6SB 5A8YA 2BDHA 4D7GA 1C9TA 4YZUA 4X8VH 4Y0YE 1T4VH 1GL1A 4XBDA 1AY6H 3SUFA 1N8OB 4BXSA 2AEIH 3M5NA 1IHTH 4FUGA 4ZROA 2DE8A 3RDZA 1JMOH 1OP2A 2ZNKH 1QL7A 3GCOA 1QJ1B 2ZQ2A 3MI4A 3MNXA 4MDSA 3A7TA 1IHSH 4IN2A 4UEHH 4IS5A 5A09A 5LPRA 1DANH 1QIXB 5GDSH 3DT0H 3RXSA 1GCTC 3BIVH 1GMHF 2ZHDA 4D76A 2EI6A 2QCYA 2FS8A 3KF2A 3F6UH 4CR5A 1TNHA 2QC2A 2BDCA 1ABJH 1ANBA 3TPIZ 1QB1A 4O97A 3OYPA 5T3HA 2SGAA 3QLPH 2HNTF 4D9QA 2ULLA 1O2UA 1IQIA 4IBLH 1MZDA 4Y10E 1KLTA 2V3HH 4WJG2 5C1XA 4X1NU 3U69H 5DP4A 2VB0A 3UFAA 1GDUA 5EQRA 2FOFA 1XUGA 2PW8H 1HIAA 1UTMA 1P8VC 1SOZA 1EAUA 3AASA 1C2MA 1W7GH 3A84A 4B2CA 4K1SA 1HV7A 3LGIA 2ZPSA 2A4RA 2FMJA 2BDYA 1HB0B 1ACBE 2ZPQA 3RXVA 3V7TA 1XUIA 2ZCHP 4K60A 4KELA 2BZAA 3P95A 2IJOB 3VB3A 1NFYA 1OP0A 2PR3A 2UUYA 3RXIA 3M61U 1S85A 1FLEE 1MU8B 1C5WB 1LTOA 1EJNA 4O3TA 3FAOA 2J94A 1GI1A 1K22H 1G3EA 2G8TA 1HAVA 3ODDA 4BAQB 4ZAEA 1JBUH 2ZWLH 4IC6A 4UFGH 3SNEA 1AZZA 1MKWK 4I32A 1MH0A 3HGNA 2P93A 1RGQA 3LDXH 2FYQA 3TJVA 1QA0A 2P16A 5EXMA 3URDA 4NGAH 4GCHG 1HAHH 1GBHA 1EJMA 3NPSA 4ISLA 3V13A 4Y0ZE 1IQKA 2O8UA 1UK4A 1O30A 1F92A 2PKAA 1BJUA 4GHQA 3MU5A 1HCGA 2AIPA 2BLVA 1FV9A 4INKA 1DY9A 3KQDA 1O38A 3LIWA 4NIVA 1GMCF 3CENA 4K3JA 3V3MA 3E16B 1FMGA 1O2TA 2BY5X 1C1TA 3EYDA 1BRAA 1QQUA 3GOVB 5DGJA 4Y8ZA 1V2ST 4Y8XA 3L6PA 3ZVAA 4BAMB 3SJIA 2C8XB 3BTQE 3PLKA 4UE7H 3LJOA 1HUTH 2GX4A 1XUKA 1GI5A 1FI8A 1O37A 1O3DA 3V12A 5HYOA 1QY6A 3RU4T 3TK5A 1F7ZA 3ZVCA 4AX9H 4NA7A 1FIWA 2VWLA 1C5ZB 2A5KA 1VGCC 2VNTA 2FYRA 2A45B 5C2ZA 1QR3E 2BMGB 4VGCC 2F9PA 3U8RH 4ZH8A 1LVMA 3TJOA 1XVOA 4O3UA 1JIMA 1YP9A 2HOBA 1Z8JB 2BY7X 2V35A 1A2CH 1AFQB 1ABIH 2HNTE 3SU6A 4DG4A 1INCA 5GWZA 5LPFA 2AMPA 4WF8A 3A82A 1TMTH 3FP8E 3RXFA 1TGSZ 5EGMA 1XUHA 1B0FA 1V2OT 1P01A 3KQBA 3GY5A 5TCCA 5AHGH 2WYJA 3SGAE 2BD2A 3ATMA 2Y81A 2Y7XA 2Z3DA 1TBRH 1UTPA 1XUFA 1LKBA 5EW1H 2XCFA 4O03A 1Z8RA 1W0YH 2D1JA 2FI5E 1SGEE 3F9GA 1N8OC 5FBEA 1Z6EA 1AUJA 1O5EH 1TPSA 5JYIA 4FUBA 1HXFH 1G30B 1D6RA 1UK3A 3M37A 2GZ9A 3ZVGA 2XBXA 1OWKA 4Q7XA 1DT2A 1P2IA 5A0CA 1FPHH 1GWAA 2I6QA 1Q31A 2RG3A 4CHAB 2FI4E 1MTNB 1C5UA 1QGFA 2XBYA 3P70B 1A46H 2ZECA 4WXVA 3P8FA 1KSNA 3MFJA 4LZ4B 2SFAA 1G2LA 1MBMA 1P2JA 4CRDA 5I25A 4AG1A 1EAWA 1O2WA 2QF3A 4LZ1H 2LNCA 5C1UA 1ETRH 1GBJA 1QNJA 1UO6A 1ZRKA 2DUCA 3PMBB 2QGRA 3M7UA 2JETB 1C5LH 1DWEH 2ZDKA 1YF4A 3E90B 5K0HA 1BIOA 3PMHB 5AFZH 1FPCH 1GBCA 1VITG 3BG8A 1MTWA 1ANCA 3OY6U 3U1IB 3U8OH 2G00A 1OXGA 2ZFSA 3SJKA 1KXCA 1GJ6A 1TRMA 2ZTZA 3IITA 4NIWA 3HATH 2ODQA 4GVUA 1C2EA 2WUBA 3K6YA 1BUIA 4B1TA 3GY6A 2TIOA 3FZZA 1IQHA 3FFGA 1Y3UA 2AH4X 4UFDH 4KTCA 1MTUA 4WVPE 1H1BA 1RJXB 3KGPA 5E0HA 2BDBA 3STIA 1FY1A 3VEQB 3Q00A 1BZXE 4U01A 3A81A 4JYTA 1UTNA 4MNYA 2M5TA 2ZGJA 3MTYA 3A88A 2ZDNA 4IMQA 2ZHEH 3RXGA 1O32A 1OOKB 2QN5T 1IQMA 2AS9A 1ZJDA 3RXUA 3SV7A 1PQ8A 1A0HB 1BA8B 2ZU5A 1UHBA 1GBKA 3VGCB 3N7OA 1FXYA 5K7RA 4GUXA 1C1VH 1GHWH 5T6DA 3SU2A 1YPHC 2H6MA 1ELDE 4ISHH 1EZXC 1C1RA 3A8CA 3ZVEA 1TX8A 5JB9S 1AKSB 2FOEA 1K1NA 1QCPA 1GJ8B 3ATLA 3BTEE 5EODA 1O3BA 4MTBA 1HYLA 4Y76A 1P04A 3SN8A 4H6TA 2G81E 4MQAA 4OS1A 1WTHD 2WV5A 1SFQB 3T27A 1CSOE 4WY3A 3RXMA 1C5VA 4X8SH 4ZKOU 1ELCA 2Q6DA 4Z0KA 2SGEE 2EC9H 4MPUA 3RXPA 2FOAA 1ZPBA 2FLRH 1TE0A 2QA9E 3TITA 1SGPE 4FUHA 2J34A 1BOQA 3JZ2B 5LH8A 2Z9KA 3S0NA 1X7AC 3MU1A 2PSYA 1O3OA 3M7TA 2FOCA 3B8JA 1GGDB 2EEKA 1KDQA 1DDJA 2CHAB 1YKTA 1HDTH 2VH0A 1CQQA 3RMMH 1C5QA 3MNBA 1AWHB 5E8EH 5DJ7A 1P03A 1SB1H 1EKBB 1ZMNA 3GY2A 1MKXK 1UTKA 1AFQC 1VITF
chains in the Genus database with same CATH superfamily
2IPHA 3KYGA 1ZTKA 2BVXH 3MO6A 2STBE 3HPTB 4TY7A 1G2MA 4TY6A 5HM2A 4XD7D 2ZG0H 1E79D 1O2XA 3W1EA 2WUCA 1OWEA 3RM0H 2GJGA 1BCUH 2ZU3A 1MU6B 1O2QA 2QYIA 3RXJA 2OXSA 4H42U 2FZZA 3B23B 2WPIS 5F03A 1QA7A 2BLWA 3BSQA 2B7DH 1O2IA 1T8LA 5CMXH 5EJ1A 1FDPA 2VVCA 5HM9A 4AGJA 1MTSA 2R2WU 1C4Y2 3TGJE 4DIIH 1LVYA 1AO5A 1SSXA 1GI7B 2WSSD 4ESTE 2R0KA 3ZVBA 1L1GA 2I6SA 5LGOA 4M9FA 1DITH 2KCPA 1LPGB 2RDLA 1BMLA 3MH4A 4Y71A 4CHAC 1ARBA 1BTWA 1MTNC 1HAPH 3AW1A 1SI5H 1ZYOA 3SGQE 3T29A 4X6PA 4UFEH 4Z1MD 1K1MA 2CJIA 1TLDA 1YLDA 3PTBA 4BTUB 4U30A 5GCHG 1BRUP 4FETA 2ANKH 1CE5A 1E0FD 1YC0A 4YOGA 3OTPA 1A0JA 1ZTLA 1TQ7B 3TH2H 3LH3A 1UCYK 2VWOA 2WPLS 1O31A 1W11U 2FWWA 2JETC 2BYAX 1BTUA 1O3KA 3W94A 1NFUA 1XUJA 2Q6FA 3HK3B 1O3NA 2BOHB 2JH0D 1NT1A 2OTVA 4JYVH 1YCPM 2CXVA 4MLFB 1O3FA 3KQCA 3R3GB 5HKKD 1Y3WA 4WMDA 3FO8D 1SLWB 1UVTH 1SFIA 4K8YA 2ZFQH 1C2HA 3RC6A 3A8AA 2PV9B 1GHBF 2BD7A 3LPRA 3M3VA 6LPRA 3E91A 1IQFA 1HGTH 1L0ZA 2ZGHA 4OS6A 5ESTE 4ZHAA 1T4UH 3A89A 1A5HA 1YY3A 4CR9A 2R3UA 2AGEX 4THNH 1MAXA 1FZZA 3UTUH 5EU8A 1CHOG 1DFPA 3M5LA 1UK2A 1AUTC 2VIOA 3SUGA 1NU7B 3SV9A 1CT2E 3UPEA 5T6GA 4HGCA 3NUMA 3FKSD 3BTHE 4X6NA 4BNRA 4FUFA 3RP2A 1RIWB 1Z1IA 5FBIA 1LVOA 3ZV9A 1O5GH 1MKWH 3PLBA 4X2WA 5DP3A 3M35A 5H4IB 4ZXXH 3MMGA 2WPKS 4J2YB 3M3TA 3VGCC 1G9IE 2H9HA 2BX4A 1TMUH 3GDSA 2KCOA 1ELEE 3RC4A 5JB8S 3TGKE 1YPKH 1GJAB 1N6XA 5EJZA 1ESTA 2VWNA 1SBWA 1O5DH 5ABWA 2QE7D 2BD3A 3LH1A 4BXWA 1S0QA 2GGVB 2PSXA 8GCHF 3UR9A 1W7XH 1KXAA 1W13U 3EA9A 1EZQA 4DVAU 2XYAA 1EQ9A 2AMQA 3BEUA 3TNTA 2ALVA 3A83A 1SQAA 1AVGH 1Z8IB 4E7NA 2XC4A 1S83A 3KQ5A 9ESTA 3KEEA 1C2LA 3HKJB 1QFKH 3BTWE 4AFUA 5FCKA 1THRH 2ZHWH 3FP6E 4WWYA 2QXJA 1PJPA 1H4WA 2WPHS 4HZHA 1Q3XA 1WBGB 2FODA 1P02A 1O34A 1CU1A 1V2NT 1AIXH 3JZ1B 1DX5M 4FXGH 4AFQA 1NY22 1GHYH 1OP8A 4NZLA 1CGHA 1A1RA 2ASUB 3FN8A 1P09A 5DN6D 2Y5FA 1C9PA 1Y3YA 1K1OA 1G36A 1P05A 1EPTA 4WXIA 1BMNH 3VFEA 4B6FA 3LGTA 1NRPH 4ISOA 1O3CA 3OE7D 3ZZ6A 1GGDC 4OS5A 2NU3E 4BANB 1YPEH 4FU7A 2CHAC 1UW7A 4I8HA 3O8RA 2ZZUH 5DO4H 1QBVH 1LPKB 5DP5A 4HFPB 4YM9A 3SGBE 3TH4H 5DPAA 1RTKA 2BVSH 2HRVA 1YBWA 3OSYA 2Q1JA 4Y7BA 1WAYB 2P3FH 2ZTYA 2QIQA 3HGPA 4YO9A 1SGDE 2RCEA 4FU8A 1C5PA 2ZU1A 4I8KA 3CNRA 1RD3B 2WPMS 4X2VA 3Q3XA 1PPCE 1MQ5A 2JKHA 1CT0E 2BY6X 1AQ7A 1C1PA 1O3JA 2F9VA 2GVFA 3ELAH 4AFSA 1BRBE 5FL7D 3VXEH 4Y6DA 5DK1A 1O2RA 1V6DA 4F55A 2R0LA 2J5UA 3RXTA 3SI4H 5BRRE 1DXPA 5EG4A 2V0BA 2A4QA 1CA0B 3F2FA 1SHHB 4WH6A 2ZGXH 1ZZZA 2TPIZ 4A6LA 4CRCA 3PM3A 4OM9A 1DLEA 4YT6H 1ZRBA 1A7SA 1XMNB 3M36A 3T2NA 5TJXA 3RMNH 5IDKA 3BG4B 1TAWA 3DFJA 4A1VA 2K0QA 4RN6A 1S6HA 2W3IA 3I78A 3LT3A 3RXCA 1D9IA 4MNXA 1G32B 1W3CA 4MNVA 5FPYA 3MU8A 5B6LA 2XNIA 1N1LA 4B76A 1OYQA 3ZZ7A 2C8WB 3QX5H 4NZQA 1IQNA 1JOUB 1NU9A 2K1QA 4YT7H 1XM1A 3SORA 4Y8YA 1DWBH 2Y7ZA 5A8XA 4UD9H 2A5AA 4NWLA 2HLDD 1GDNA 4Q2KA 4R0IA 1E1QD 1ETSH 1YPLH 1HAOH 3UUZA 1ELBA 5HIYA 1TNGA 4A5TS 1SGYE 2GDDA 5L2ZH 1NTPA 4AN7A 3KCGH 2Z7FE 3R0FA 4Q4LA 2ZEBA 1ZPCA 1GJ7B 2C3SA 1MQ6A 2HVYB 1BB0B 4J1YA 4DCDA 1T8OA 4LOYH 2ZGCA 7GCHG 4B2BA 2JJ2D 1P3CA 3RXOA 9LPRA 2XWBI 5GIBA 1TABE 3UOPA 1QB9A 4SGBE 1O3IA 1O3PB 1O35A 2P95A 2GD4B 4I8GA 2FOMB 4MVNA 4NA9H 1FUJA 4AB8A 1O2YA 4ZKNU 1K0HA 3D49H 2OQUA 1NBME 3SO3A 1E38B 3GY7A 1RIWC 1F0SA 5EIYA 2A0QB 4GAWA 1Z6JH 1D3PB 3QTVH 3BTME 6CHAB 2FESH 3M5OA 1BT7A 1FY3A 5AF9H 1JIRA 1O2LA 2FP7B 1MABB 1IQLA 4JZFH 1W14U 4WMFA 2PGBB 1NPMA 4NIYA 1S84A 1AVWA 3D62A 1WYKA 1KXDA 2H5DA 4RKJB 3SBKA 1V2PT 1OWHA 1ESBA 3GICB 3RMOH 1NFXA 3WY8A 3SJ9A 2OCVB 6ESTA 2G51A 2GP9B 4ABJA 1O36A 2JJ1D 1C1SA 1V2MT 4I8LA 4ZCNA 3NWUA 2B9LA 1HAXB 3SQHE 1MD7A 1O2HA 2A7CA 1O33A 3ODFA 5JPMH 2SGQE 2FS9A 2ZKSA 3MYWA 3AK5A 1HAVB 2ODPA 1UTJA 4Y11E 5HMAA 2BQ7B 3KIDU 1J9CH 3PWBA 1T31A 3ESTA 1UVUH 3PV4A 1CA8B 1BTPA 2SGFE 3PYHA 1Y8TA 3UIRA 1TNLA 1PPEE 5A2MH 3RU4E 4NFEA 1QJ6B 4ZHMU 3GISB 3BV9B 3GS9A 1BHXF 2ZHFH 3F3BA 1QURH 1SGCA 2EY4C 3VB5A 3F9FA 1NN6A 2ZPRA 1TBZH 2PKAB 1AE8H 2TRMA 3GDVA 2J95A 4U2WA 1MKXH 3ZZDA 5C3NA 1BBRE 1O2KA 2BDAA 2FIRH 4IN1A 5ESBA 3H7OA 1XKBC 2AFQB 1IQGA 3V0XA 1O2OA 3RXDA 1AGJA 3P8OA 3RC5A 5JBBS 1Z71A 3D23A 3FVFB 1AN1E 4TWWA 3KQEA 3BEIB 4ABEA 1EAXA 4MNWA 2WZQA 3EAJA 1SLXB 1GVZA 3TLOA 5BPEA 3LOXA 1SLUB 3MH6A 5JBTA 4GCHF 1PPZA 2VJ1A 2F9UA 1ZTJA 4DY7B 1DSUA 1LHFH 3LGYA 2H2ZA 2VVVA 3VB7A 2F83A 1M9UA 2KZ4A 4DW2U 1KY9A 3F9HA 2A1DB 4JZIA 8KME2 5J4SA 4MPWA 1CA0C 1IAUA 1O2VA 1PYTC 1MUEB 1SVPA 1F0TA 2ZCKP 4FUDA 4Q63A 3UNSA 4WH8A 3BG4C 4DIHH 3MO3A 1SR5C 2HALA 1FAKH 3RMLH 2M2AA 3E0NB 2STAE 4AGKA 1GL0E 1VZQH 4Y7AA 1J8AA 1PQ7A 2C8YB 3M3SA 2TGAA 1ZGVA 1VCQA 1HJAB 1SOTA 1A3EH 1AMHA 2FPZA 4HG6A 4JMYA 3ITIA 2BZ6H 3D65E 1UCYH 3NK8A 2TGTA 5AVDA 2A32A 1F2SE 2QXIA 1NC6A 3VB4A 4ABIA 3ATKA 2KAIA 1TYNA 1ZHMA 3BN9A 4A92A 2HPPH 1D3DB 2ANMH 2VBCA 3EQ0H 4X0WU 5IYTA 4Y79A 4XFQA 4YTAA 1GI6A 2J38A 4XBCA 1ZGIA 1NM6A 4DURA 1RTLA 4ABBA 1A4WH 1J17T 1C2IA 2OD3B 3LC5A 1P10A 2UWPA 2O9QA 4KGAA 4X2XA 1L1NA 1O0DH 5T1VA 2DE9A 1GI4A 1C2JA 2UUFB 3UR6A 4GSOA 4ZHLU 2VU8E 3QK1A 4CRGA 1E34B 1YWUA 3S9AA 1PPBH 3L33A 1VITH 1TMBH 2O8TA 3O8BA 1J16A 1SQOA 1ANEA 2F91A 6GCHG 5EQSA 1IQJA 1A3BH 5HIZA 1T8MA 3L3TA 2WHXA 1WQSA 2Z9IA 3OY5U 2NU2E 2F9BH 1EZSC 1LVBA 1K2I1 5C5OA 4XOJA 2OBQA 1TONA 4JCNA 3SUEA 3VXFH 5DKMA 2C90B 3PB1E 4K1TA 2P59A 1FX0B 2ZO3H 1CO7E 2QXHA 6CHAC 3I29A 2ALPA 4WMEA 3A86A 3BTGE 2WINI 1UJ1A 1TA6A 4A7IB 4Q7YA 1F5RA 3M5MA 3UB0A 5CHAB 3QZRA 3QDZB 1GBTA 1TGBA 4ZMAH 3E6PH 4X8TH 1RXPA 2WYGA 3U98H 1H8ED 1SGFG 1HFDA 4X8UH 5F8TA 4ABGA 1WU1A 5FX5A 1N6YA 2AERH 2PFEA 2YMSB 3MNCA 1SC8U 1WV7H 3ZZCA 4ZKSU 3DSGA 2OC8A 1TB6H 3QGNB 1FONA 1S5SA 1EOJA 4FVBA 3IG6B 1MCVA 2XC0A 1UHBB 4OS4A 3T28A 2QV1A 1FIZA 1DOJA 3RXLA 2NU0E 4UONA 1PFXC 1SGTA 3K6ZA 3MO9A 2ZDAH 4I8JA 4U32A 4B74A 3U28C 5J4QA 3TIUA 1GI3A 2IPQX 3F1SB 3A8DA 1HAIH 4JK6A 1ID5H 1BMMH 3CS0A 5CE1A 1TIOA 1V2WT 1K1IA 1ZJKA 2XC5A 1ESAA 1B5GH 4MG3A 2PKSB 1AZ8A 1VCPA 1P3EA 3E0PB 3BEFB 1K21H 1O39A 4LK4A 2J98A 4YLUA 2EI7A 4CRAA 2W6JD 2HNTC 3OAAD 1FJSA 2FO9A 3O8CA 2Y5GA 2AMDA 1EJAA 2W7UA 1SGNE 2YOLA 3OEHD 4AFZA 1G3BA 5F8XA 1C5TA 3A7WA 1E36B 2BLQA 2ZU4A 3LJJA 1SQTA 5FCRA 3F0OA 1SG8B 4QT8C 4TYDA 5C5NA 5TCAA 4D8NA 1TPOA 4AZ2B 1T32A 4YLQH 2BM2A 3EDXB 3MOCA 1KMHB 3PMAB 2YNBA 1ARCA 1P2KA 1TGNA 4KKDA 1V2QT 4ABHA 5CHBA 5EXLA 2Z9GA 8ESTE 1W10U 2P3TB 3KNXA 4E06H 3U1JB 1ELAA 1D6WA 2C4FH 1F0RA 1DPOA 2V6NA 3TJUA 2GCHG 2L6OA 6GCHF 1BQYA 1C2GA 2GMTB 2UWOA 4RT1A 1K1JA 1AU8A 3P8GA 2QF5A 2A4OA 3ZVDA 2AGIX 2VIPA 5FHTA 1LQDB 1GBEA 1TGCA 2UWLA 1UVOA 2XBVA 1H9IE 2PWXA 3PROA 2THFB 1C4U2 2IN2A 1F0UA 4KTUA 5DG6A 1AHTH 1GI2A 1A5GH 3NKKA 2ANYA 5KECA 1Y3XA 1GMDG 1BTZA 1AFEH 1GVKB 1HBTH 4PROA 1HJAC 2GZ8A 1GBDA 3EGKH 3SHAH 2A4GA 3AAVA 1QRXA 3ZYEA 1GBBA 2ZF0H 3GYLB 1EZUC 1GBIA 4CH2B 2RFKC 2CGAA 2KFWA 1EXFA 1V2VT 2C8ZB 4H4FA 3ZZAA 3DUXH 1COWD 4UDWH 2XBWA 2VH6A 3LGVA 3GCNA 3VB6A 3RUOA 4FOUC 2BVRH 2XTTB 1W12U 4GPGA 3TNSA 1VJAU 3TJNA 3A80A 1K9OE 3KHVA 3RXBA 4I31A 1TNKA 4AYVB 1DM4B 3MU0A 1TPPA 1DWCH 3ATWA 1KXEA 1GCDA 2ODYB 1V3XA 1O5AB 2FI3E 1U6QA 4DGJA 1O2SA 4O9VA 2CN0H 4ASHA 3H7TA 1P2MA 1EB2A 2EQNA 4INHA 3LU9B 1C1WH 1NESE 4K8BA 1F5LA 3QZQA 1V2UT 2OP9A 2SGDE 2O8MA 1Y5UT 2BB4A 1O2MA 4BAKB 1C1QA 2A7HA 2ZQ1A 1OKXA 1TNJA 1DUEA 5HGGA 4AG2A 4AB9A 2YNAA 2W7SA 4BTTB 3S9BA 3PMJA 4IC5A 4GLYA 5CHAC 4B75A 2O8WA 1EAIA 5E2PA 1EUFA 3Q76A 4A1TA 1CGJE 3SQEE 3KL6A 2LPRA 3UY9A 5GCHF 2AIQA 1O3LA 2ZDMA 2BDIA 3MNSA 1TBQH 4NCYA 4BTIB 5B6OA 2ZTXA 4XSKU 1WXRA 1CT4E 1DICA 2AHME 2YMSC 3VPKA 4BAHB 1GDQA 4B73A 5JDUB 1SGFA 4HI3A 4FUEA 1MBQA 2GTBA 1V2RT 4FU9A 1C5XB 1E1RD 2D2DA 1NRSH 1AB9B 3E3TA 1NBMD 2KM0A 1ZOMA 1GI0A 2NU4E 1CVWH 2BY9X 2FLBH 2ZHQH 3F0PA 3SU4A 4CBNA 1QZ8A 2HGTH 2F3CE 3SV8A 1GG6B 1EASA 1V2KT 2V3MA 5EJLA 4CREA 2UUKB 1LHEH 2WV4A 1GMDF 1L2EA 1YLNA 1ELGA 1YPGH 5DP8A 1GMCG 1QQ4A 1A0LA 1LMWB 4UFFH 2C93B 1SGQE 2W5EA 3BF6H 3OX7U 4ABDA 3ZVFA 1ZSLA 2PKSC 3ZZ9A 2ZDVH 1RRKA 1ZPZA 1P2QA 1CHOF 4YESB 5FXLA 1UVPA 3A87A 4I33A 4ACAA 1THPB 1XKAC 3Q77A 5GXPA 1W8BH 4BOHA 1BTYA 4RSPA 4RI0A 3I77A 3MH7A 1FN6A 5SGAE 3KN2A 3ZIAD 3E1XB 2J4IA 2HVXA 4MPVA 2G4UA 1V2JT 2P3UB 2WPJS 3U9AH 2QF4A 7ESTE 4TPIZ 1DS2E 1P11E 1IQEA 2F9OA 3SYJA 2PTNA 3RLWH 3SJ8A 3AAUA 2VIDA 1AVXA 1DUAA 1VCWA 3NCLA 1OWJA 1EPTB 4E05H 3RU4D 3SZNA 1PQAA 3TK6A 1YCPK 3PWCA 2QY0B 1SPJA 2D8WA 2VIVA 1TALA 1QRWA 2GMTC 1YPMH 4XE4A 4R8TB 2XWAA 3GCHB 1NROH 1ZSKA 2J92A 4NA8A 3QGJA 1S6FA 4CRFA 1KYNA 5I46H 3GY3A 1LCYA 4B71A 1YPHE 4OS2A 4FUJA 1WOFA 1ORFA 1P57B 2GZ7A 2WPDD 1P0SH 1J15A 2KX4A 1GJ9B 3S7KB 1ETTH 3ZZ5A 2HPQH 3VG8A 4A1XA 1TWXB 2BTCE 2L74A 1L1JA 3TVJB 1FQ3A 3LKWA 1NO9H 2PHBA 3LC3A 3RXKA 2UUJB 1AD8H 5DP6A 4AOQA 1J14A 1Y3VA 1DE7H 2OUAA 2BDGA 1WDIA 1HJ8A 3S69A 1LO6A 2ZIQH 4IW4E 1UTQA 1P2NA 3C1KA 3SNDA 2G52A 1DVAH 3OU0A 1TNIA 2FDAA 2O8LA 1E37B 1W0ZU 1HIAB 3O8DA 2ZC9H 3H5CB 2GCTB 3PO1B 1A61H 5DP7A 5JBCS 3T26A 2Z9LA 1CBWB 4JYUH 2H5CA 1OX1A 5EPNA 1PQ5A 2OQ5A 4X1PU 1GHAG 2Z6BD 3MQKC 2W26A 3ZZBA 2XRCA 2EI8A 5EOKA 4DOQA 1JXPA 1OWIA 1D4PB 1Y5AT 2B8OH 1VJ9U 4Z6AH 1O2JA 2PGQB 1ZLRA 1UMAH 4TWYA 2Z3EA 3FP7E 2XW9A 1S0RA 3UREA 2PUXB 3UQVA 2R2MB 1Z7KA 1C1UH 4K2YA 4NG9H 4AYYB 3FZDA 1O2PA 5E2OA 1EP5A 1OWDA 1GHXH 1BBRK 1LHCH 3LONA 4NSVA 1FNIA 4X1QU 4F49A 1Z1JA 2ZFPH 1O3EA 2ZA5A 3PLPA 3SUDA 4ABFA 3T5FH 2AGGX 4E7RG 1O3HA 1ELTA 1O5CB 4TPYA 2VIQA 3Q3KA 2ZCLP 3GY4A 2B0FA 3M7QA 1BMAA 4HTCH 4K69A 1C2FA 1ELFA 1XX9A 1OYTH 2ZGBH 1ELVA 3WWFA 1K1PA 3DA9B 3Q3YA 1K1LA 3S9CA 4X6MA 3S7HB 2CF8H 2PLXA 4SGAE 1TX7A 3RM2H 4X6OA 3MHWU 3SU0A 1OSSA 1BRCE 1AB9C 1EOLA 2F4LA 2Z3CA 1TX6A 2XOKD 3CP7A 5DP9A 2Y6TA 1L4DA 1YYY1 2QAAA 3SOSA 2PUQH 3MWIU 1P9UA 4ACBA 5A0BA 1TGTA 4INLA 4XDEA 2A2XH 2IOTA 1WTGH 1GG6C 2A7JA 2FEQH 1W0KD 3ZV8A 4D7FA 2OC1A 2D26C 3A7YA 1MAYA 7GCHF 1NRNH 1D3QB 5F6MA 2F9NA 5GJ4B 4XRNA 2XCNA 2ZP0H 4M7GA 3RXQA 1KIGH 2Z94A 1TRYA 1QRZA 1Z8GA 5L6NH 2Y82A 3GY8A 1BDAA 1H9LB 1SL3A 3P92A 2PP6A 4OGXA 4DT7B 2FX4A 3T62A 1YGCH 1VKYA 1XXFA 2FTMA 1EB1H 1DY8A 1GBAA 3ENSB 1TFXA 3GCTG 4OGYA 4DJZB 5C67A 1WQVH 3NZIA 1HRTH 2V3OH 1TOCB 1AKSA 2BY8X 5C20A 3BTDE 1AE5A 3PV5A 2TGPZ 2BXUH 3HK6B 4P02A 3HKIB 4TT3D 3SV6A 1FN8A 1GHAF 3EE7A 1UTOA 2FX6A 2W3KA 1NRQH 4FUIA 3SNCA 1OS8A 4BAOB 1EPTC 3RLYH 2OLGA 1UVSH 1GJBB 3SU1A 2G4TA 2KCYA 4RKOB 1E35B 1BJVA 1NRRH 2GKVE 4LXBH 5EXNA 2ZFFH 1LKAA 1S81A 3GCHC 2LELA 1GI9B 2BQ6B 1LPZB 2ZDLA 3SW2B 4Q7ZA 2P8OB 4JK5A 3NXPA 3LGUA 1HXEH 2OK5A 1RS0A 4ABAA 3GYMA 5CDFE 2VGCB 1C5SA 2H9TH 2HWLB 3FOAA 4XBBA 1MTVA 3IWMA 4CRBA 2ZU2A 2A5IA 1QTFA 3G01A 1O2NA 4GHTA 3DFLA 2KCAA 1C1OA 1O3AA 3PTNA 1KXFA 3F2GA 1C5MD 3ZZ8A 2CV3A 2EA3A 2OBOA 1GJCB 2Y80A 2R3YA 1GJDB 3MH5A 2SGPE 3B9FH 5ETXA 2VINA 1XXDA 1ZHPA 1MCTA 1C4V2 1MD8A 3UNQA 2QXGA 1FY5A 2BOKA 2RDEA 1GJ4H 1YM0A 3SNBA 1MZAA 1B0EA 2V7QD 3PV2A 5FPTA 3OEED 3PO1C 4KTSA 2GCTC 2BLOA 1CBWC 2Y5HA 3ATIA 1PPGE 1GJ5H 4AORA 2BD4A 4K5ZA 1NFWA 1HAZB 1SGIB 3A8BA 4KP0A 3P8NA 1RFNA 2CMYA 3QO6A 2BXTH 1PPFE 4NWKA 1YPJH 1W2KH 8LPRA 1FAXA 1KTTB 1QHRB 2BD8A 3QUMP 3UQOA 1KXBA 1BHXB 1H8IH 5EW2H 1LHDH 2R9PA 1SLVB 1O2GH 4B2AA 2JDID 2KAIB 1HLTH 1VR1H 3AVZA 1GHBG 2GT7A 1C5NH 1SKYE 5EPYA 1C1MA 2A2QH 1WSSH 2FM2A 2Z9JA 3EA8A 1D3TB 3GCTF 1DLKB 3K9XB 3BTTE 1TOMH 1Q2WA 4YOIA 1GBFA 4JZEH 3URCA 1FY4A 3MU4A 2LP6A 1KLIH 3BIUH 1SHYA 3QN7A 1C5OH 2JIZD 1JWTA 1QB6A 5PTPA 3N7DA 5LPEA 3SJOA 3TU7H 2H9EH 1WUNH 2BD9A 2P94A 1MMJN 4OS7A 1HAGE 2NU1E 1P9SA 1Y59T 1B7XB 2GDEH 3FANA 1GCTB 4JZDH 1S82A 2ESTE 1T8NA 2FXRA 2VVUA 3UWIA 2TGDA 1EFRD 1TPAE 3AW0A 3ZZ3A 1AI8H 8GCHG 3STJA 1V2TT 5FX6A 1GVLA 2G5NA 2SNVA 2VIWA 1DXWA 4ZKRU 3CS7A 5GPIB 1C2KA 2OC0A 2ILNA 3A85A 4ZXYH 3EE0B 3RXEA 2OINA 4NIXA 2HLCA 7LPRA 3ZYDA 3A7ZA 2PTCE 3TK9A 3W95A 2CF9H 4I7YH 4MPXA 3SNAA 3SU3A 4NFFA 4CH8B 1T7CA 1HAYB 1ZMJA 1GPZA 1KDQB 1ANDA 3K65B 1P2OA 2A31A 4NSYA 3C27B 2NWNA 1CGIE 2ZI2H 3PRDA 1HJ9A 5A8ZA 2VWMA 2FTLE 2AYWA 3T25A 1C1NA 1JRTA 2BQWB 2G5VA 2FOHA 3BTKE 1EP6A 1QBNA 3U8TH 2B5TB 4DT4A 1F5KU 1GI8B 3N7EA 3P17H 4YOJA 3QWCH 5HXFA 1YCPH 1DWDH 2ANWA 2K8IA 1QBOA 3ZZ4A 1THSH 3P6ZB 4ZUHA 1HPGA 1A5IA 1FY8E 2BX3A 3OTJE 2QF0A 4IGDA 2J98B 2SNWA 1QL9A 5C1YA 4F4OC 1PYTD 7KMEH 4IMZA 1BTXA 1GMHG 1P12E 2FOBA 1HNEE 3EA7A 5KGOA 3QTOH 1O3MA 3F2HA 2JH6D 1OPHB 1TA2A 2GV7A 4AC9A 1EATA 3A7VA 3DHKH 1UCYE 1BMFD 5F8ZA 1V2LT 1ZMLA 1PPHE 2J97A 3RXAA 1C2DA 1LQEA 3GDUA 1KLJH 2P8OC 5E0JA 1K28D 1O5BB 3F9EA 1KTSB 1G37A 4X1RU 4JZ1A 3SHCH 2VGCC 1Y5BT 1TQ0B 1UTLM 1ZSJA 1SGRE 1DSTA 1C5YB 1EX3A 4ISIH 1BTHH 3DD2H 5T6FA 1GBMA 3RXRA 3F68H 1RTFB 1NZQH 5EQQA 5G4BA 2Q6GA 3UOUA 1LHGH 5JBAS 5GNDA 2RA0A 2BD5A 1YLCA 1G3DA 3TGIE 1G3CA 2J2UA 2XXLA 1TRNA 1H9HE 4K1EA 5C0TA 3LGWA 4X1SU 3K2UA 3UNRA 5A0AE 3DCLA 1LDTT 4Q80A 2H1UA 1BITA 1AWFH 1VGCB 1CHGA 2GV6A 4X2YA 2BHGA 1WCZA 4CBOA 4FUCA 4FVDA 2FOGA 3SV2H 5FAHA 3E8LA 3SI3H 2RA3A 1GBLA 2TBSA 3A7XA 1O5FH 4VGCB 1XVMA 1ZR0A 1NS3A 1GHZA 3TH3H 4D9RA 5AFYH 1ZHRA 3UWJH 1O3GA 1QJ7B 2J9NA 3BTFE 1L4ZA 2GCHF 1JRSA 3SU5A 1IOEA 2G55A 5L30H 5C94A 1C5RA 5L2YH 3RXHA 1QL8A 2OC7A 3N99A 5FPSA 1BBRH 1H8DH 2GT8A 1SMFE 1P06A 2ZFRH 2ZFTA 4YXWD 5E0GA 4ISNA 1GHVH 1O2ZA 2JH5D 4H6SB 5A8YA 2BDHA 4D7GA 1C9TA 4YZUA 4X8VH 4Y0YE 1T4VH 1GL1A 4XBDA 1AY6H 3SUFA 1N8OB 4BXSA 2AEIH 3M5NA 1IHTH 4FUGA 4ZROA 2DE8A 3RDZA 1JMOH 1OP2A 2ZNKH 1QL7A 3GCOA 1QJ1B 2ZQ2A 3MI4A 3MNXA 4MDSA 3A7TA 1IHSH 4IN2A 4RT0A 4UEHH 4IS5A 5A09A 5LPRA 1DANH 1QIXB 5GDSH 3DT0H 3RXSA 1GCTC 3BIVH 1GMHF 2ZHDA 4D76A 2EI6A 2QCYA 2FS8A 3KF2A 3F6UH 4CR5A 1TNHA 2QC2A 2BDCA 1ABJH 1ANBA 3TPIZ 1QB1A 4O97A 3OYPA 5T3HA 2SGAA 1W0JD 3QLPH 2HNTF 4D9QA 2ULLA 1O2UA 1IQIA 4IBLH 1MZDA 4TSFD 4Y10E 1KLTA 2V3HH 4WJG2 5C1XA 4X1NU 3U69H 5DP4A 2VB0A 3UFAA 1GDUA 5EQRA 2FOFA 1XUGA 2PW8H 1HIAA 1UTMA 1P8VC 1SOZA 4B6EA 1EAUA 3AASA 1C2MA 1W7GH 3A84A 4B2CA 4K1SA 1HV7A 3LGIA 2ZPSA 2A4RA 2FMJA 1OHHD 2BDYA 1HB0B 5IK2D 1ACBE 2XNDD 2ZPQA 3RXVA 3V7TA 1XUIA 2ZCHP 5C17A 4K60A 4KELA 2BZAA 3P95A 2IJOB 3VB3A 1NFYA 1OP0A 2PR3A 2UUYA 3RXIA 1H8HD 3H09A 3M61U 1S85A 1FLEE 1MU8B 1C5WB 1LTOA 1EJNA 4O3TA 3FAOA 2J94A 1GI1A 1K22H 1G3EA 2G8TA 1HAVA 3ODDA 4BAQB 4ZAEA 1JBUH 2ZWLH 4IC6A 4UFGH 3SNEA 1AZZA 1MKWK 4I32A 1MH0A 3HGNA 2P93A 1RGQA 3LDXH 2FYQA 3TJVA 1QA0A 2P16A 5EXMA 3URDA 4NGAH 4GCHG 1HAHH 1GBHA 1EJMA 3NPSA 4ISLA 3V13A 5F53A 4Y0ZE 1IQKA 2O8UA 1UK4A 1O30A 1F92A 2PKAA 1BJUA 3NRLA 4GHQA 3MU5A 1HCGA 2AIPA 2BLVA 1FV9A 4INKA 1DY9A 2KR7A 3WWBA 3KQDA 1O38A 3LIWA 4NIVA 3PRBA 1GMCF 3CENA 4K3JA 3V3MA 3E16B 1FMGA 1O2TA 2BY5X 1C1TA 3EYDA 1BRAA 1QQUA 3GOVB 5DGJA 4Y8ZA 1V2ST 4Y8XA 3L6PA 3ZVAA 3WW7A 4BAMB 3SJIA 2C8XB 3BTQE 3SZEA 3PLKA 4UE7H 3LJOA 1HUTH 2GX4A 1XUKA 1GI5A 1FI8A 1O37A 1O3DA 3V12A 5HYOA 1QY6A 3RU4T 3TK5A 1F7ZA 3ZVCA 4AX9H 4NA7A 1FIWA 2VWLA 1C5ZB 2A5KA 1VGCC 2VNTA 2FYRA 2A45B 5C2ZA 1QR3E 2BMGB 4VGCC 2F9PA 2WV9A 4ZH8A 3U8RH 1LVMA 3TJOA 1XVOA 4O3UA 1JIMA 1YP9A 2HOBA 1Z8JB 2BY7X 2V35A 1A2CH 1AFQB 1ABIH 2HNTE 3SU6A 4DG4A 1INCA 5GWZA 3OFND 2AMPA 5LPFA 4WF8A 3A82A 1TMTH 3FP8E 3RXFA 1TGSZ 5EGMA 1XUHA 1B0FA 1V2OT 1P01A 3KQBA 3GY5A 5TCCA 5AHGH 2WYJA 3SGAE 2BD2A 3ATMA 2Y81A 2Y7XA 3DSOA 2Z3DA 2F43B 1TBRH 1UTPA 1XUFA 1LKBA 5EW1H 2XCFA 2W6ID 4O03A 1Z8RA 1W0YH 2D1JA 2FI5E 1SGEE 3F9GA 1N8OC 5FBEA 1Z6EA 1AUJA 1O5EH 1TPSA 5JYIA 4FUBA 1HXFH 1G30B 4P00A 1D6RA 1UK3A 3M37A 2GZ9A 3ZVGA 2XBXA 2YMSD 1OWKA 4Q7XA 1DT2A 1P2IA 5A0CA 1FPHH 1GWAA 2I6QA 1Q31A 2RG3A 4CHAB 2FI4E 1MTNB 1C5UA 1QGFA 2XBYA 3P70B 1A46H 2ZECA 4WXVA 1SQRA 3P8FA 1KSNA 2CK3D 3MFJA 3UAIC 4LZ4B 2SFAA 1G2LA 1MBMA 1P2JA 4CRDA 5I25A 4AG1A 1EAWA 1O2WA 2QF3A 4LZ1H 2LNCA 5C1UA 1ETRH 1GBJA 1QNJA 1UO6A 1ZRKA 2DUCA 3PMBB 2QGRA 3M7UA 2JETB 1C5LH 1DWEH 2ZDKA 1YF4A 3E90B 5K0HA 1BIOA 3PMHB 5AFZH 1FPCH 1GBCA 1VITG 3BG8A 1MTWA 1ANCA 3OY6U 3U1IB 3U8OH 2G00A 1OXGA 2ZFSA 3SJKA 5KEDA 1KXCA 1GJ6A 1TRMA 2ZTZA 3IITA 4NIWA 3HATH 2ODQA 4GVUA 1C2EA 2WUBA 3K6YA 1BUIA 4B1TA 3GY6A 2TIOA 3FZZA 1IQHA 3FFGA 1Y3UA 2AH4X 4UFDH 4KTCA 1MTUA 4WVPE 1H1BA 1RJXB 3KGPA 5E0HA 2BDBA 3STIA 1FY1A 3VEQB 3Q00A 1BZXE 4U01A 3A81A 4JYTA 1UTNA 4MNYA 2M5TA 2ZGJA 3MTYA 3A88A 2ZDNA 4IMQA 2ZHEH 3RXGA 1O32A 1OOKB 2QN5T 1IQMA 2AS9A 1ZJDA 3RXUA 3SV7A 1PQ8A 1A0HB 1BA8B 2ZU5A 1UHBA 1GBKA 2IJD1 3VGCB 3N7OA 3KYFA 1FXYA 5K7RA 4GUXA 1C1VH 1GHWH 5T6DA 3SU2A 1YPHC 2H6MA 1ELDE 4F48B 4ISHH 1EZXC 1C1RA 1S6LA 3A8CA 3ZVEA 1TX8A 5JB9S 1AKSB 2FOEA 1K1NA 1QCPA 1GJ8B 3ATLA 3BTEE 5EODA 1O3BA 4MTBA 1HYLA 4Y76A 1P04A 3SN8A 4H6TA 2G81E 4MQAA 4OS1A 1WTHD 2WV5A 1SFQB 3T27A 1CSOE 4WY3A 3RXMA 1C5VA 4X8SH 4ZKOU 1ELCA 2Q6DA 4Z0KA 2SGEE 2EC9H 4MPUA 3RXPA 2FOAA 1ZPBA 2FLRH 1TE0A 2QA9E 3TITA 5C0UA 1SGPE 4FUHA 5DSFA 2J34A 1BOQA 3JZ2B 5LH8A 2Z9KA 3S0NA 1X7AC 3MU1A 2PSYA 1O3OA 3M7TA 2FOCA 3B8JA 1GGDB 2EEKA 1KDQA 4I86A 1DDJA 2CHAB 1YKTA 4ASUD 1HDTH 2VH0A 1CQQA 3DSPA 3RMMH 1C5QA 3MNBA 1AWHB 5E8EH 5DJ7A 1P03A 1SB1H 1EKBB 1ZMNA 3GY2A 1MKXK 1UTKA 1AFQC 1VITF
chains in the Genus database with same CATH topology
2IPHA 1ZTKA 2BVXH 3MO6A 2STBE 3HPTB 4TY7A 1G2MA 4TY6A 5HM2A 2ZG0H 1O2XA 2WUCA 1OWEA 3RM0H 1BCUH 2ZU3A 1MU6B 1O2QA 2QYIA 3RXJA 2OXSA 4H42U 2FZZA 3B23B 2WPIS 5F03A 1QA7A 2BLWA 3BSQA 2B7DH 1O2IA 1T8LA 5CMXH 1FDPA 2VVCA 5HM9A 4AGJA 1MTSA 2R2WU 1C4Y2 3TGJE 4DIIH 1LVYA 1AO5A 1SSXA 1GI7B 4ESTE 2R0KA 3ZVBA 1L1GA 2I6SA 5LGOA 1DITH 1LPGB 2RDLA 1BMLA 3MH4A 4Y71A 4CHAC 1ARBA 1BTWA 1MTNC 1HAPH 3AW1A 1SI5H 1ZYOA 3SGQE 3T29A 4X6PA 4UFEH 1K1MA 2CJIA 1TLDA 1YLDA 3PTBA 4BTUB 4U30A 5GCHG 1BRUP 2ANKH 1CE5A 1E0FD 1YC0A 4YOGA 1A0JA 1ZTLA 1TQ7B 3TH2H 3LH3A 1UCYK 2VWOA 2WPLS 1O31A 1W11U 2FWWA 2JETC 2BYAX 1BTUA 1O3KA 3W94A 1NFUA 1XUJA 2Q6FA 3HK3B 1O3NA 2BOHB 2JH0D 1NT1A 2OTVA 4JYVH 1YCPM 2CXVA 4MLFB 1O3FA 3KQCA 3R3GB 1Y3WA 4WMDA 1SLWB 1UVTH 1SFIA 4K8YA 2ZFQH 1C2HA 3RC6A 3A8AA 2PV9B 1GHBF 2BD7A 3LPRA 3M3VA 6LPRA 3E91A 1IQFA 1HGTH 1L0ZA 2ZGHA 4OS6A 5ESTE 4ZHAA 1T4UH 3A89A 1A5HA 4CR9A 2R3UA 2AGEX 4THNH 1MAXA 1FZZA 3UTUH 5EU8A 1CHOG 1DFPA 3M5LA 1UK2A 1AUTC 2VIOA 3SUGA 1NU7B 3SV9A 1CT2E 3UPEA 5T6GA 4HGCA 3NUMA 3BTHE 4X6NA 4BNRA 4FUFA 3RP2A 1RIWB 1Z1IA 5FBIA 1LVOA 3ZV9A 1O5GH 1MKWH 3PLBA 4X2WA 5DP3A 3M35A 5H4IB 4ZXXH 3MMGA 2WPKS 4J2YB 3M3TA 3VGCC 1G9IE 2H9HA 2BX4A 1TMUH 3GDSA 1ELEE 3RC4A 5JB8S 3TGKE 1YPKH 1GJAB 1N6XA 1ESTA 2VWNA 1SBWA 1O5DH 5ABWA 2BD3A 3LH1A 4BXWA 1S0QA 2GGVB 2PSXA 8GCHF 3UR9A 1W7XH 1KXAA 1W13U 3EA9A 1EZQA 4DVAU 2XYAA 1EQ9A 2AMQA 3BEUA 3TNTA 2ALVA 3A83A 1SQAA 1AVGH 1Z8IB 4E7NA 2XC4A 1S83A 9ESTA 3KEEA 1C2LA 3HKJB 1QFKH 3BTWE 4AFUA 5FCKA 1THRH 2ZHWH 3FP6E 4WWYA 2QXJA 1PJPA 1H4WA 2WPHS 4HZHA 1Q3XA 1WBGB 2FODA 1P02A 1O34A 1CU1A 1V2NT 1AIXH 3JZ1B 1DX5M 4FXGH 4AFQA 1NY22 1GHYH 1OP8A 4NZLA 1CGHA 1A1RA 2ASUB 1P09A 2Y5FA 1C9PA 1Y3YA 1K1OA 1G36A 1P05A 1EPTA 4WXIA 1BMNH 3VFEA 3LGTA 1NRPH 4ISOA 1O3CA 3ZZ6A 1GGDC 4OS5A 2NU3E 4BANB 1YPEH 4FU7A 2CHAC 4I8HA 3O8RA 2ZZUH 5DO4H 1QBVH 1LPKB 5DP5A 4HFPB 4YM9A 3SGBE 3TH4H 5DPAA 1RTKA 2BVSH 2HRVA 1YBWA 3OSYA 2Q1JA 4Y7BA 1WAYB 2P3FH 2ZTYA 2QIQA 3HGPA 4YO9A 1SGDE 2RCEA 4FU8A 1C5PA 2ZU1A 4I8KA 1RD3B 2WPMS 4X2VA 3Q3XA 1PPCE 1MQ5A 2JKHA 1CT0E 2BY6X 1AQ7A 1C1PA 1O3JA 2F9VA 2GVFA 3ELAH 4AFSA 1BRBE 3VXEH 4Y6DA 5DK1A 1O2RA 1V6DA 2R0LA 3RXTA 3SI4H 5BRRE 1DXPA 5EG4A 2V0BA 2A4QA 1CA0B 1SHHB 4WH6A 2ZGXH 1ZZZA 2TPIZ 4A6LA 4CRCA 3PM3A 1DLEA 4YT6H 1ZRBA 1A7SA 1XMNB 3M36A 3T2NA 5TJXA 3RMNH 5IDKA 3BG4B 1TAWA 3DFJA 4A1VA 4RN6A 1S6HA 2W3IA 3I78A 3LT3A 3RXCA 1D9IA 4MNXA 1G32B 1W3CA 4MNVA 5FPYA 3MU8A 2XNIA 1N1LA 4B76A 1OYQA 3ZZ7A 2C8WB 3QX5H 4NZQA 1IQNA 1JOUB 1NU9A 2K1QA 4YT7H 1XM1A 3SORA 4Y8YA 1DWBH 2Y7ZA 5A8XA 4UD9H 2A5AA 4NWLA 1GDNA 4Q2KA 4R0IA 1ETSH 1YPLH 1HAOH 3UUZA 1ELBA 1TNGA 4A5TS 1SGYE 2GDDA 5L2ZH 1NTPA 4AN7A 3KCGH 2Z7FE 3R0FA 2ZEBA 1ZPCA 1GJ7B 2C3SA 1MQ6A 1BB0B 4J1YA 4DCDA 1T8OA 4LOYH 2ZGCA 7GCHG 4B2BA 1P3CA 3RXOA 9LPRA 2XWBI 5GIBA 1TABE 3UOPA 1QB9A 4SGBE 1O3IA 1O3PB 1O35A 2P95A 2GD4B 4I8GA 2FOMB 4MVNA 4NA9H 1FUJA 4AB8A 1O2YA 4ZKNU 3D49H 2OQUA 3SO3A 1E38B 3GY7A 1RIWC 1F0SA 2A0QB 4GAWA 1Z6JH 1D3PB 3QTVH 3BTME 6CHAB 2FESH 3M5OA 1BT7A 1FY3A 5AF9H 1JIRA 1O2LA 2FP7B 1IQLA 4JZFH 1W14U 4WMFA 2PGBB 1NPMA 4NIYA 1S84A 1AVWA 3D62A 1WYKA 1KXDA 2H5DA 4RKJB 3SBKA 1V2PT 1OWHA 1ESBA 3GICB 3RMOH 1NFXA 3WY8A 3SJ9A 2OCVB 6ESTA 2G51A 2GP9B 4ABJA 1O36A 1C1SA 1V2MT 4I8LA 3NWUA 2B9LA 1HAXB 3SQHE 1MD7A 1O2HA 2A7CA 1O33A 3ODFA 5JPMH 2SGQE 2FS9A 2ZKSA 3MYWA 1HAVB 2ODPA 1UTJA 4Y11E 5HMAA 2BQ7B 3KIDU 1J9CH 3PWBA 1T31A 3ESTA 1UVUH 3PV4A 1CA8B 1BTPA 2SGFE 3PYHA 1Y8TA 3UIRA 1TNLA 1PPEE 5A2MH 3RU4E 4NFEA 1QJ6B 4ZHMU 3GISB 3BV9B 1BHXF 2ZHFH 1QURH 1SGCA 3VB5A 3F9FA 1NN6A 2ZPRA 1TBZH 2PKAB 1AE8H 2TRMA 3GDVA 2J95A 4U2WA 1MKXH 3ZZDA 5C3NA 1BBRE 1O2KA 2BDAA 2FIRH 4IN1A 5ESBA 3H7OA 1XKBC 2AFQB 1IQGA 3V0XA 1O2OA 3RXDA 1AGJA 3P8OA 3RC5A 5JBBS 1Z71A 3D23A 3FVFB 1AN1E 4TWWA 3KQEA 3BEIB 4ABEA 1EAXA 4MNWA 3EAJA 1SLXB 1GVZA 3TLOA 5BPEA 3LOXA 1SLUB 3MH6A 5JBTA 4GCHF 1PPZA 2VJ1A 2F9UA 1ZTJA 4DY7B 1DSUA 1LHFH 3LGYA 2H2ZA 2VVVA 3VB7A 2F83A 1M9UA 4DW2U 1KY9A 3F9HA 2A1DB 4JZIA 8KME2 5J4SA 4MPWA 1CA0C 1IAUA 1O2VA 1PYTC 1MUEB 1SVPA 1F0TA 2ZCKP 4FUDA 3UNSA 4WH8A 3BG4C 4DIHH 3MO3A 1SR5C 2HALA 1FAKH 3RMLH 3E0NB 2STAE 4AGKA 1GL0E 1VZQH 4Y7AA 1J8AA 1PQ7A 2C8YB 3M3SA 2TGAA 1ZGVA 1VCQA 1HJAB 1SOTA 1A3EH 1AMHA 2FPZA 4JMYA 3ITIA 2BZ6H 3D65E 1UCYH 3NK8A 2TGTA 5AVDA 2A32A 1F2SE 2QXIA 1NC6A 3VB4A 4ABIA 3ATKA 2KAIA 1TYNA 1ZHMA 3BN9A 4A92A 2HPPH 1D3DB 2ANMH 3EQ0H 5IYTA 4X0WU 4Y79A 4XFQA 4YTAA 1GI6A 2J38A 4XBCA 1ZGIA 1NM6A 4DURA 1RTLA 4ABBA 1A4WH 1J17T 1C2IA 2OD3B 3LC5A 1P10A 2UWPA 2O9QA 4KGAA 4X2XA 1L1NA 1O0DH 2DE9A 1GI4A 1C2JA 2UUFB 3UR6A 4GSOA 4ZHLU 2VU8E 3QK1A 4CRGA 1E34B 3S9AA 1PPBH 3L33A 1VITH 1TMBH 2O8TA 3O8BA 1J16A 1SQOA 1ANEA 2F91A 6GCHG 5EQSA 1IQJA 1A3BH 1T8MA 3L3TA 1WQSA 2Z9IA 3OY5U 2NU2E 2F9BH 1EZSC 1LVBA 1K2I1 5C5OA 4XOJA 2OBQA 1TONA 4JCNA 3SUEA 3VXFH 5DKMA 2C90B 3PB1E 4K1TA 2P59A 2ZO3H 1CO7E 2QXHA 6CHAC 3I29A 2ALPA 4WMEA 3A86A 3BTGE 2WINI 1UJ1A 1TA6A 4A7IB 4Q7YA 1F5RA 3M5MA 5CHAB 3QZRA 3QDZB 1GBTA 1TGBA 4ZMAH 3E6PH 4X8TH 1RXPA 2WYGA 3U98H 1SGFG 1HFDA 4X8UH 5F8TA 4ABGA 1WU1A 5FX5A 1N6YA 2AERH 2PFEA 3MNCA 1SC8U 1WV7H 3ZZCA 4ZKSU 2OC8A 1TB6H 3QGNB 1FONA 1S5SA 1EOJA 4FVBA 3IG6B 1MCVA 2XC0A 1UHBB 4OS4A 3T28A 2QV1A 1FIZA 1DOJA 3RXLA 2NU0E 4UONA 1PFXC 1SGTA 3K6ZA 3MO9A 2ZDAH 4I8JA 4U32A 4B74A 5J4QA 3TIUA 1GI3A 3F1SB 3A8DA 1HAIH 4JK6A 1ID5H 1BMMH 3CS0A 5CE1A 1TIOA 1V2WT 1K1IA 1ZJKA 2XC5A 1ESAA 1B5GH 4MG3A 2PKSB 1AZ8A 1VCPA 1P3EA 3E0PB 3BEFB 1K21H 1O39A 4LK4A 4YLUA 2EI7A 4CRAA 2HNTC 1FJSA 2FO9A 3O8CA 2Y5GA 2AMDA 1EJAA 2W7UA 1SGNE 2YOLA 4AFZA 1G3BA 5F8XA 1C5TA 3A7WA 1E36B 2BLQA 2ZU4A 3LJJA 1SQTA 5FCRA 5C5NA 1SG8B 4QT8C 4TYDA 5TCAA 4D8NA 1TPOA 4AZ2B 1T32A 4YLQH 2BM2A 3EDXB 3MOCA 3PMAB 2YNBA 1ARCA 1P2KA 1TGNA 4KKDA 1V2QT 4ABHA 5EXLA 2Z9GA 8ESTE 1W10U 2P3TB 3KNXA 4E06H 3U1JB 1ELAA 1D6WA 2C4FH 1F0RA 1DPOA 2V6NA 3TJUA 2GCHG 6GCHF 1BQYA 1C2GA 2GMTB 2UWOA 1K1JA 1AU8A 3P8GA 2A4OA 3ZVDA 2AGIX 2VIPA 5FHTA 1LQDB 1GBEA 1TGCA 2UWLA 1UVOA 2XBVA 1H9IE 2PWXA 3PROA 2THFB 1C4U2 2IN2A 1F0UA 4KTUA 5DG6A 1AHTH 1GI2A 1A5GH 3NKKA 2ANYA 1Y3XA 1GMDG 1BTZA 1AFEH 1GVKB 1HBTH 4PROA 1HJAC 2GZ8A 1GBDA 3EGKH 3SHAH 2A4GA 3AAVA 1QRXA 3ZYEA 1GBBA 2ZF0H 3GYLB 1EZUC 1GBIA 4CH2B 2CGAA 1EXFA 1V2VT 2C8ZB 4H4FA 3ZZAA 3DUXH 4UDWH 2XBWA 2VH6A 3LGVA 3GCNA 3VB6A 3RUOA 2BVRH 2XTTB 1W12U 4GPGA 3TNSA 1VJAU 3TJNA 3A80A 1K9OE 3KHVA 3RXBA 4I31A 1TNKA 4AYVB 1DM4B 3MU0A 1TPPA 1DWCH 3ATWA 1KXEA 1GCDA 2ODYB 1V3XA 1O5AB 2FI3E 1U6QA 4DGJA 1O2SA 4O9VA 2CN0H 4ASHA 3H7TA 1P2MA 1EB2A 4INHA 3LU9B 1C1WH 1NESE 4K8BA 1F5LA 3QZQA 1V2UT 2OP9A 2SGDE 2O8MA 1Y5UT 2BB4A 1O2MA 4BAKB 1C1QA 2A7HA 2ZQ1A 1OKXA 1TNJA 1DUEA 5HGGA 4AG2A 4AB9A 2YNAA 2W7SA 4BTTB 3S9BA 3PMJA 4IC5A 4GLYA 5CHAC 4B75A 2O8WA 1EAIA 5E2PA 1EUFA 3Q76A 4A1TA 1CGJE 3SQEE 3KL6A 2LPRA 3UY9A 5GCHF 2AIQA 1O3LA 2ZDMA 2BDIA 3MNSA 1TBQH 4NCYA 4BTIB 5B6OA 2ZTXA 4XSKU 1CT4E 1DICA 4BAHB 3VPKA 1GDQA 4B73A 5JDUB 1SGFA 4HI3A 4FUEA 1MBQA 2GTBA 1V2RT 4FU9A 1C5XB 2D2DA 1NRSH 1AB9B 3E3TA 1ZOMA 1GI0A 2NU4E 1CVWH 2BY9X 2FLBH 2ZHQH 3SU4A 4CBNA 2HGTH 2F3CE 3SV8A 1GG6B 1EASA 1V2KT 4CREA 2UUKB 1LHEH 2WV4A 1GMDF 1L2EA 1ELGA 1YPGH 5DP8A 1GMCG 1QQ4A 1A0LA 1LMWB 4UFFH 2C93B 1SGQE 2W5EA 3BF6H 3OX7U 4ABDA 3ZVFA 1ZSLA 2PKSC 3ZZ9A 2ZDVH 1RRKA 1ZPZA 1P2QA 1CHOF 4YESB 5FXLA 1UVPA 3A87A 4I33A 1THPB 1XKAC 3Q77A 5GXPA 1W8BH 4BOHA 1BTYA 4RSPA 3I77A 3MH7A 1FN6A 5SGAE 3KN2A 3E1XB 2J4IA 2HVXA 4MPVA 2G4UA 1V2JT 2P3UB 2WPJS 3U9AH 7ESTE 4TPIZ 1DS2E 1P11E 1IQEA 2F9OA 2PTNA 3RLWH 3SJ8A 3AAUA 2VIDA 1AVXA 1DUAA 1VCWA 3NCLA 1OWJA 1EPTB 4E05H 3RU4D 3SZNA 1PQAA 3TK6A 1YCPK 3PWCA 2QY0B 1SPJA 2D8WA 2VIVA 1TALA 1QRWA 2GMTC 1YPMH 4XE4A 4R8TB 2XWAA 3GCHB 1NROH 1ZSKA 2J92A 4NA8A 3QGJA 1S6FA 4CRFA 1KYNA 5I46H 3GY3A 1LCYA 4B71A 1YPHE 4OS2A 4FUJA 1WOFA 1ORFA 1P57B 2GZ7A 1P0SH 1J15A 1GJ9B 3S7KB 1ETTH 3ZZ5A 2HPQH 4A1XA 1TWXB 2BTCE 1L1JA 3TVJB 1FQ3A 3LKWA 1NO9H 2PHBA 3LC3A 3RXKA 2UUJB 1AD8H