4ISOA

Crystal structure of matriptase in complex with its inhibitor hai-1
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
241
structure length
241
Chain Sequence
VVGGTDADEGEWPWQVSLHALGQGHICGASLISPNWLVSAAHCYIDDRGFRYSDPTQWTAFLGLHDQSQRSAPGVQERRLKRIISHPFFNDFTFDYDIALLELEKPAEYSSMVRPICLPDASHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVIQQTTCENLLPQQITPRMMCVGFLSGGVDSCQGDSGGPLSSVEADGRIFQAGVVSWGDGCAQRNKPGVYTRLPLFRDWIKENTGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Suppressor of tumorigenicity 14 protein
publication title Crystal structures of matriptase in complex with its inhibitor hepatocyte growth factor activator inhibitor-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 57
structure length 241
sequence length 241
ec nomenclature ec 3.4.21.109: Matriptase.
pdb deposition date 2013-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4isoA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4isoA01
1SGRE 2B5TB 2GVFA 5A0AE 4X2VA 1GHAG 1DITH 4IBLH 2ZECA 3MU1A 1A7SA 1C5TA 2ZDVH 1C1VH 1KLJH 2FODA 1P09A 2H9HA 1KXBA 1C1SA 1CE5A 2O8UA 3SO3A 4FVBA 5C5OA 5E8EH 2ODYB 2W7UA 4FUCA 1CGJE 1EJNA 2AFQB 4ABDA 1Y5BT 1D3PB 1DWBH 3PLBA 1BTWA 2QXIA 3GCOA 5ETXA 2PTCE 1UJ1A 1T31A 1O0DH 1QIXB 1ANDA 3EA7A 1ESBA 1O2VA 3RMLH 4OS7A 2IPHA 3QDZB 1C2MA 4ZKNU 5E2PA 1C2FA 1WYKA 3RLWH 5JBCS 1EZSC 4JYTA 1HXFH 1PYTD 2TGPZ 3KQEA 2Z9KA 1UK4A 3BEIB 3L3TA 4AG1A 3ATKA 2P59A 1DSUA 2GGVB 3A8AA 4Q7ZA 1FIZA 1ZTJA 3UY9A 2WPJS 1FY8E 2A4QA 6ESTA 1EKBB 3MNCA 1CT0E 2ZDMA 5GPIB 5DJ7A 2CV3A 3F9HA 1IQNA 8ESTE 2C8XB 3RXAA 1HB0B 1ZMNA 3HGNA 2O8MA 2QF0A 2WUBA 4OGXA 2BY9X 1C9TA 1GI7B 4AFZA 4OS5A 4I32A 3CENA 1ZGIA 4YTAA 4ABFA 5GXPA 2GDDA 2QGRA 3Q76A 3RU4E 5LGOA 2WPLS 3GICB 3H7OA 4YM9A 3QZRA 4NA8A 1O3OA 2HWLB 3BTQE 5E2OA 1ELVA 1DXWA 3RU4T 5A0CA 5C67A 1C2EA 1ZYOA 1THRH 4ISLA 3ZVFA 1SLWB 1EB2A 1BTUA 2V3HH 1HJ8A 1P06A 3SJ9A 2G52A 1TNKA 1YYY1 1L1NA 1SHHB 4DY7B 1AU8A 2RDLA 3FZDA 1GJBB 1O5BB 2ZGXH 1SGEE 2Z3DA 3EA9A 1SGNE 2ILNA 4Y8ZA 1MTSA 3LC5A 1KSNA 5C3NA 3D62A 4NWKA 2FWWA 1O3KA 1GMDG 1WTHD 1FN6A 1ZGVA 1FDPA 3PYHA 2GD4B 3GYLB 4BTUB 1GJ5H 4NFFA 2BD4A 1GBFA 1T4UH 1Z7KA 3KCGH 2YOLA 3SNDA 4LK4A 3H7TA 1ZHRA 3GDVA 1QR3E 1BJVA 4OS4A 1NO9H 2V0BA 1C2KA 3PO1B 1TRNA 2WINI 4J2YB 3TPIZ 3A86A 3EAJA 5E0HA 3MU8A 4O3TA 3UOUA 2WPHS 4CBNA 2OQUA 1W12U 1FY4A 1A61H 1RD3B 2SFAA 1C1MA 2G4TA 3LGVA 3VB3A 1KXFA 1G30B 5DPAA 3U8TH 1GBHA 4ABEA 3EE0B 1GBKA 4IC6A 1MKXK 1GMHF 4FU7A 2ZU4A 2VIVA 4YT7H 1S5SA 1BUIA 3AAVA 2FP7B 3O8RA 1HLTH 3P8GA 2VU8E 1DSTA 3M7UA 3TNSA 4AFSA 3PLPA 4O3UA 2NU4E 1D9IA 2A32A 3PO1C 4SGAE 1W10U 1JIMA 2ODPA 2FOEA 1SG8B 2QAAA 1DANH 4WXIA 3RC4A 4DCDA 1PPCE 1Q3XA 1S0RA 3SU5A 4B76A 3A87A 3GCNA 1P04A 2NWNA 1ZJDA 3RUOA 1KLTA 1IQJA 1HAZB 1MU8B 1V3XA 1IQLA 1ETSH 1L4DA 1CVWH 3F9FA 1P0SH 1C2HA 1ELEE 1YP9A 2BD7A 4INLA 5DKMA 1C9PA 3S9CA 1NFXA 1X7AC 2QCYA 1C4V2 3PMJA 1S6HA 1FMGA 1EAXA 1W3CA 2OBQA 3M3SA 1DLEA 3Q3XA 2BVSH 2Z9GA 4MNYA 1TQ0B 1QQUA 4ZKOU 1VITH 2ZFRH 4JZDH 3D65E 5DP5A 4BNRA 5AHGH 3GY7A 4CR5A 1HXEH 3GDSA 2WPIS 4JK6A 4B2AA 4D9RA 4GCHF 1GBJA 4UFGH 3M36A 1VR1H 2XTTB 2YNBA 1PPFE 1TBQH 4X1SU 1CBWB 1BMLA 3SNCA 2BYAX 3U8OH 1TPPA 4CBOA 4X6MA 4E7RG 2QY0B 1FV9A 2V6NA 1F5KU 4Y7AA 3A8DA 4F49A 1FY1A 1AE5A 1DM4B 1S84A 3A85A 4AFUA 3W95A 4WH8A 1W8BH 3MO6A 1P03A 2BTCE 2A45B 1QRXA 2XWAA 2G81E 1GJAB 1QURH 4B71A 4ABJA 4AG2A 2Y7ZA 2VWNA 1UCYK 1MKXH 1CBWC 3GCTF 1KDQA 2EI8A 1O2ZA 1K1OA 4ABIA 4LXBH 4ZROA 2NU0E 1INCA 1DWDH 1LVBA 3M3VA 1ELDE 2A4GA 3Q77A 1BT7A 1KXCA 1GCDA 4TWWA 5EPYA 1QJ1B 1GJ8B 1BBRH 1UVTH 7GCHF 1W13U 4UE7H 9ESTA 1VGCB 2BD3A 1O2XA 1AVXA 5DP4A 1BHXB 3HK6B 1C2IA 1WBGB 3U8RH 1VZQH 4D76A 1P9UA 1EP5A 3UPEA 2C3SA 1QL8A 4WXVA 3ZZBA 2BDYA 3GY6A 1C5QA 3MO3A 2FLBH 1AUTC 1TONA 2J92A 1BRCE 5EQRA 1UHBB 1ZZZA 1P2OA 2OC7A 1KY9A 2ZHWH 3ELAH 2NU2E 3JZ1B 2A31A 1TBZH 2C4FH 3SU0A 1RTFB 2F9UA 1C5VA 2VWLA 2ZNKH 4Q2KA 1QBNA 1B0EA 3RC5A 1LVOA 5EXMA 3U9AH 1LTOA 1GI1A 2C8ZB 3SHAH 3PV4A 1HPGA 3PMAB 1THPB 2AEIH 2JH5D 5JDUB 3AW1A 4KP0A 3LGWA 2ZDNA 5A8YA 2ZGJA 3VGCB 1HAIH 1C1UH 1XUJA 2RA0A 1FN8A 1GMHG 4Y79A 4U2WA 2AERH 1V2OT 4UFEH 1AY6H 1YLCA 4U30A 1LHGH 1O36A 1CT2E 4FVDA 4INKA 1GBEA 2FOFA 1VITF 2ZIQH 2QXGA 1ZRBA 4B73A 5L2YH 1GI6A 4CRFA 1NRPH 2OQ5A 1H9IE 3S9AA 1FQ3A 1WQSA 2BY7X 1DWCH 1QJ7B 4DVAU 4A1XA 3O8DA 5AFZH 1YPMH 4H42U 4B74A 2BQWB 3N7OA 4UDWH 4UFDH 1OYTH 3SGBE 2CXVA 1H8DH 2SNWA 3TU7H 1GGDB 1GMCF 2VIPA 2O8WA 3RXIA 1S82A 3KNXA 5SGAE 2BZ6H 1O2HA 4YT6H 1O3PB 2PUQH 4DGJA 1PJPA 3MHWU 3RXPA 2TGDA 3BTGE 1LCYA 2VIDA 1TFXA 2ZDKA 3MNBA 3M35A 3U98H 4AGKA 3A7XA 1LMWB 4NIYA 3BTKE 1ORFA 1YPEH 2PKSB 5BPEA 2HOBA 1Y59T 1SB1H 1QBOA 6CHAB 1C5MD 1V2VT 3E8LA 1GBIA 1C5ZB 2BY8X 1F0TA 3MH7A 1HRTH 3T26A 3PMBB 1GGDC 5JBBS 1PPZA 1L1JA 1O2QA 1CA0B 1TGBA 3SQEE 2ZC9H 3RP2A 1GVLA 1MCVA 2XBYA 1EPTC 1QA7A 4K1TA 1T8OA 5FPSA 1JMOH 3EGKH 3SW2B 1FY3A 2AIQA 3P92A 2FYRA 5I25A 4HFPB 3SJ8A 1TPAE 2UWPA 3M37A 1TMTH 4DJZB 2PKSC 2VB0A 3GCTG 6CHAC 1KXAA 2ZTYA 3I29A 2R9PA 1SLUB 1DS2E 4FUEA 4WMDA 1GPZA 4GVUA 1QNJA 3QTVH 4Y0ZE 2FTLE 1SGPE 1ZR0A 3ZVCA 1GBAA 3VB6A 1CA0C 1MBMA 1H1BA 2EA3A 1HJAB 3BTDE 1PYTC 3RC6A 1P9SA 1DXPA 4HGCA 2F3CE 3MWIU 4WMFA 1ANCA 4E05H 2Y82A 4OS2A 3TK5A 4I33A 3LH3A 5E0GA 1HBTH 5C20A 1EZUC 3UWJH 2PTNA 3RXGA 3QZQA 4ABAA 1QBVH 2M5TA 1FUJA 2EI6A 4GUXA 1A4WH 2A4RA 4MTBA 4NA7A 4XBCA 1TX6A 1J9CH 2R0KA 1BB0B 2J2UA 2SGPE 1SGFG 2XBWA 3SUGA 1GCTB 2P3UB 1DFPA 1EAIA 1S83A 2Z9JA 3L6PA 3SN8A 5ESBA 1UVSH 4DG4A 1ELBA 3HGPA 4Y10E 2FI4E 1RGQA 1AVGH 1BMNH 2FM2A 3NPSA 1ZHMA 3GY2A 4IW4E 3SJIA 1O3BA 1OX1A 3MMGA 3V7TA 1O2NA 5A0BA 1YKTA 3HPTB 1HIAB 2AGGX 5AVDA 2A4OA 3O8CA 1O34A 1F2SE 2Y5GA 3E3TA 2ZPSA 2SGFE 3DT0H 3I78A 2C8WB 2HGTH 3S9BA 4TWYA 1P02A 1GCTC 1IHSH 3EYDA 5FPTA 2ZCKP 1UTLM 1V2JT 1RTLA 3DD2H 1DPOA 5J4QA 2GT7A 2W7SA 3PWBA 4B2CA 2NU1E 2HALA 1Z6JH 2OXSA 5EODA 2O8LA 4ISIH 2BM2A 1IQGA 1YPHC 3SZNA 2ZHEH 2AMPA 2F9OA 2ZTXA 1C4U2 5A09A 4KGAA 4I8KA 2VIWA 1Q31A 5GCHF 3SJOA 1YBWA 4RN6A 1C1NA 1NTPA 3KQCA 1FPHH 1TWXB 3TJVA 1GMCG 1MTVA 2OLGA 1C1OA 3K9XB 3S69A 1Z1JA 3RDZA 3MH6A 1G2MA 1YPLH 3STJA 2XNIA 2G8TA 4D9QA 2ZEBA 1O2MA 1LO6A 1PQ5A 1BTHH 2VVVA 1CT4E 2BOKA 1LDTT 2WV5A 5EQSA 5EOKA 2YNAA 3EQ0H 5C1YA 1OPHB 3SGQE 3SU6A 1CO7E 1Y3YA 2B8OH 4E7NA 2R2WU 2G5NA 1AFQB 1DUEA 3T62A 3QLPH 2AH4X 1LPGB 2ZU1A 4YLUA 3RU4D 1ZMJA 4KKDA 4WJG2 1SC8U 2HNTF 3B8JA 3FP6E 2AS9A 7KMEH 3KL6A 5CHAB 4K5ZA 4MNVA 4YLQH 4O9VA 2D26C 2H6MA 5EG4A 1NRRH 1CQQA 2H9EH 2KAIA 1BQYA 2A5AA 4MDSA 4DIIH 1C5RA 2IJOB 3NUMA 7LPRA 4JMYA 4CH8B 1P2QA 2FEQH 2ZQ1A 2WYJA 2XRCA 3SI3H 5LH8A 2FS9A 3ZZ8A 1NM6A 5DG6A 4FUHA 1Z8IB 1D6RA 2PV9B 3AASA 3BTME 3F68H 1AFQC 1E36B 1L0ZA 4OS1A 1O5AB 1H8IH 4ZUHA 1PQ8A 1GI9B 3ZZAA 3RXLA 1DWEH 2FO9A 4Y76A 2HPPH 1P05A 2ZO3H 4I8JA 4AB9A 5CHAC 4R0IA 3RXEA 5DP3A 1ID5H 5LPRA 1GWAA 1PPBH 4MNXA 1QRZA 1MZDA 4ZH8A 2XWBI 5C1XA 1YCPK 1EX3A 4K8YA 2GCTB 4X6PA 2AGIX 1JIRA 1RJXB 3MYWA 3H5CB 3GCHB 1C4Y2 5H4IB 2B0FA 4DW2U 1SGDE 1OWKA 2FLRH 1TA2A 1AFEH 3UUZA 2A5KA 1GJ6A 4GPGA 1TBRH 2Q6FA 3RMMH 2GZ7A 1MCTA 2VIQA 3S7HB 1SI5H 1HAGE 1TGNA 3EDXB 3A88A 1KDQB 1HV7A 3NWUA 2TRMA 1O2WA 2JH6D 3KF2A 4YOIA 2BVXH 4NZQA 4D7GA 3DHKH 4DOQA 2FI3E 1LHEH 1IOEA 2FOHA 1ELTA 2GCTC 3A8BA 3BN9A 4XE4A 2AYWA 2BD8A 3ZYDA 2BQ6B 1CHGA 3TVJB 2RCEA 2ZCLP 1HIAA 1A0HB 3ZZ7A 1E34B 2ZFTA 4D7FA 5J4SA 3GY3A 3IG6B 3W94A 1E38B 1L2EA 2D8WA 1G32B 3ZZCA 4HZHA 4AX9H 2J4IA 1C1PA 2G51A 2XW9A 3L33A 2EI7A 4NCYA 1C5OH 1KIGH 1P8VC 4ABBA 1P3CA 5C5NA 2PKAA 1O5GH 3JZ2B 3M3TA 4IC5A 3TGKE 2OUAA 1QB6A 3ZYEA 4KTCA 1J14A 2BLVA 5GCHG 2Z94A 4OS6A 4TYDA 1VCWA 3PWCA 3SUEA 3D23A 3MNXA 3TJOA 4LZ1H 1O32A 1G2LA 4MPXA 2ZTZA 1W14U 3BTTE 3V0XA 2W26A 1SVPA 3ENSB 4NZLA 1HJ9A 2XXLA 1DE7H 3A82A 4CR9A 4CRDA 1HAOH 2C90B 1SOZA 3UIRA 2P95A 3RXSA 4X0WU 1Y3VA 1C5YB 3T27A 1YCPH 1FJSA 2SNVA 1SQAA 1ACBE 2EC9H 1H4WA 1O35A 1TGCA 3ZVAA 1HAXB 1YPKH 2QXHA 3ZVDA 3UREA 1W7GH 2VNTA 3BTFE 1XM1A 5EW1H 4YESB 1OSSA 1ESAA 2AIPA 3SORA 3VB4A 3QUMP 1GI8B 3SNEA 1N1LA 1J8AA 4X6NA 1O2OA 2I6QA 3LKWA 4NA9H 1UO6A 1ZTLA 2PR3A 3A80A 1YC0A 2PLXA 3P8NA 1WTGH 4A1TA 1D6WA 4NSYA 4MPUA 3M5LA 1QL9A 3SNAA 1P57B 4CRBA 1UTOA 3PMHB 1TNGA 2ZFSA 1IQIA 3A7VA 3LONA 4GAWA 1ESTA 1IQMA 1XKBC 1AQ7A 1UTJA 2BX4A 1WUNH 4MPWA 1EJAA 3LT3A 1D3QB 1LQEA 1OWDA 2BLQA 3ZZ5A 5EQQA 1BDAA 1Y3WA 1QHRB 2PHBA 3E90B 3ATIA 2QA9E 2WYGA 3I77A 5EU8A 5A8ZA 1BRUP 1SQOA 1VJ9U 1MH0A 3KQDA 1C5UA 2A1DB 3ZVBA 2BD2A 2ZA5A 3E91A 3ZZDA 3S0NA 1RRKA 4O97A 1ETTH 4A7IB 3P70B 3S7KB 4JCNA 5T6GA 3OTJE 5JPMH 1FZZA 1C2JA 1TABE 3OYPA 5EW2H 5JB8S 1HAPH 1D3TB 1YPJH 1V2WT 1N6XA 1SBWA 3OX7U 2ZU5A 3VPKA 5K7RA 1UVPA 4ZHAA 4CREA 1DY9A 1QCPA 1O3LA 4NG9H 3RXHA 1BIOA 1DDJA 3A8CA 3V13A 4A6LA 3M7QA 5HM9A 1FAKH 1OOKB 5FCRA 3VFEA 4X8SH 3SOSA 2FZZA 1RTKA 3RXBA 1YPGH 1P10A 2P94A 2VH6A 1LHDH 2A2XH 2TBSA 2BDIA 1UVOA 1O3MA 1W0YH 2UUJB 3A7YA 3BEUA 4K3JA 1THSH 1YCPM 1A0LA 3K6ZA 2LPRA 1UK2A 1O2RA 1B7XB 2CJIA 3K65B 4CH2B 1Y5AT 2HVXA 1MTWA 2Y5FA 3OY5U 1ELFA 4IS5A 2OC0A 1C2GA 2STAE 1V2PT 2VGCB 1MUEB 1OWEA 3SU4A 3TJUA 4KTSA 2F83A 1VGCC 3LU9B 2VVCA 4I8HA 4Y11E 4GHQA 2GV7A 2GZ8A 1T7CA 3RM0H 2R3YA 2XYAA 1ZPBA 1ZTKA 3RMOH 3UFAA 4WVPE 4A5TS 1EZXC 1LHCH 1BCUH 2ZGCA 5A8XA 3QK1A 1SMFE 1QQ4A 2XC4A 1HAYB 2PUXB 1O3FA 6GCHF 1B0FA 3B9FH 1KXEA 4Y6DA 3RXKA 2VGCC 1VCPA 2D2DA 1O2YA 2TGAA 1BRBE 1MAXA 3TH4H 1E37B 3GYMA 1RIWB 1L4ZA 3BSQA 2JKHA 1K1MA 2SGQE 3VGCC 2SGEE 3NCLA 3RXUA 4CRGA 4ZKSU 1NY22 2W3KA 1O5EH 1UCYH 2VINA 1OP0A 1BJUA 3P6ZB 3T25A 2GMTB 2IOTA 3RXCA 5JYIA 4OGYA 3DFJA 2BD9A 1YF4A 3F6UH 1A0JA 1LPKB 1XUIA 3CS7A 4LOYH 1P01A 4IN2A 3HKIB 5BRRE 3T5FH 2ESTE 1NPMA 2FI5E 4K69A 4Q7YA 4H4FA 2BQ7B 1O3EA 1OYQA 4ZKRU 4NWLA 1K9OE 2UUYA 1FLEE 2XC5A 1ZSLA 3LGTA 1K28D 3SUDA 2G00A 1RIWC 2QV1A 1GBLA 2ALPA 5AFYH 1C5LH 1SGCA 1E35B 1ELCA 2OBOA 3SUFA 2P16A 1ELAA 5HXFA 2GMTC 4LZ4B 3PROA 1NU7B 3PB1E 5HM2A 2R3UA 3BEFB 3CP7A 1Y8TA 2FYQA 3VEQB 1IQEA 1PQAA 3Q3YA 3A7WA 3QGJA 2ZFPH 1HUTH 3LIWA 3ODDA 5HMAA 4FUGA 1CSOE 1N8OB 1Z8RA 4BAOB 1W11U 4K1SA 2BD5A 3BTEE 2KAIB 3LPRA 1O2UA 3M5OA 3P8OA 4Y7BA 3B23B 1K1NA 2ZGBH 3RXJA 1J15A 4AGJA 4R8TB 2FESH 4RKOB 1Y3UA 3E0PB 2FOBA 3URCA 1FXYA 3E0NB 2CF9H 1AZ8A 1TNJA 3SGAE 1C5XB 5T6FA 4AN7A 2BDCA 4WF8A 1PQ7A 1LPZB 1ARCA 3BF6H 4WH6A 2BXUH 2BDGA 2Y5HA 1DUAA 1S85A 1N8OC 1D4PB 2XCFA 1Z8JB 2Z9IA 1SHYA 1IQKA 1TGSZ 4X8VH 4TPYA 4BAQB 1V2TT 4IN1A 1UTKA 5GDSH 1NT1A 1XUHA 5DK1A 5GIBA 1EP6A 4QT8C 4B2BA 1GHZA 1O2JA 1O5FH 3BV9B 3LGIA 4K1EA 2VIOA 1BTXA 2ZU2A 1EATA 2P8OB 4Q7XA 4PROA 1OS8A 3A84A 1A1RA 4JZ1A 3E6PH 1C2LA 1GI4A 1O3DA 3A81A 4FUJA 3LOXA 3BTHE 4XOJA 1O5CB 1AWHB 4X2XA 3RXVA 3RMNH 1HAHH 2Q6GA 3Q00A 2BDAA 5FX6A 3VXEH 3SNBA 1HJAC 1GBDA 5EXNA 2QYIA 1C1TA 1O3NA 1A46H 4BAMB 3DA9B 3VB5A 5A2MH 1SGIB 1XX9A 3SV9A 3Q3KA 3AAUA 5F8XA 1JRSA 1SGTA 1T8NA 2UWOA 4MG3A 1S6FA 1BRAA 2P8OC 3QX5H 2CMYA 2A0QB 1SLXB 1KTSB 2BDBA 4X8UH 1P2NA 1YGCH 1G3EA 2H1UA 2H5CA 6GCHG 3OSYA 1LQDB 1O2PA 3A7ZA 1DT2A 1GJ4H 1XUKA 2A7CA 1Z8GA 1AKSB 3TK9A 2K1QA 2OTVA 1AZZA 1O2IA 1W7XH 2PKAB 3P95A 3BG8A 5T6DA 4BTIB 1EQ9A 5E0JA 2ULLA 1ETRH 4AOQA 1FNIA 1GHBF 1TNIA 2ZHQH 2B7DH 2Z9LA 1XVOA 2G55A 4BANB 4NIWA 4FXGH 1ZLRA 1EASA 1EB1H 3T28A 1V2QT 3GDUA 3O8BA 4M7GA 2GTBA 2ZPRA 2FOAA 1O30A 3FP8E 1IQHA 4JK5A 1NROH 1FPCH 1SGFA 3HK3B 4ZAEA 3TJNA 2BDHA 4ZHLU 5GWZA 1Y5UT 1SPJA 2QXJA 4AFQA 1NN6A 1HNEE 1MZAA 3BIVH 2DUCA 3M5NA 1QJ6B 3EA8A 3TH2H 1PPEE 2G4UA 4YO9A 4KTUA 4Q80A 4F4OC 5DGJA 1CGHA 5C2ZA 1XUGA 1L1GA 3K6YA 3LGUA 2BY6X 5F8TA 1GVKB 3PTBA 2ZFQH 1IAUA 1F92A 1EOLA 1T4VH 1TOCB 2CN0H 4FUDA 2OC8A 4X8TH 1K21H 2G5VA 2ZCHP 4ESTE 2H2ZA 1AIXH 1P2KA 3UNSA 4IMZA 1TPSA 1WSSH 4O03A 1ZSKA 2XBXA 1VCQA 4UD9H 1O3CA 2BXTH 4H6SB 1TRYA 1SR5C 4J1YA 3UTUH 3RXQA 4ISNA 3ZZ4A 1D3DB 3F9EA 4SGBE 1OKXA 1K2I1 1RFNA 3C27B 3GY5A 1BA8B 2ODQA 2W5EA 3MTYA 3A7TA 4BAKB 1H9HE 1HAVA 1GHXH 4X1PU 3SV7A 4ZHMU 1DOJA 1EZQA 2BX3A 2CHAB 5FXLA 4WMEA 2ZGHA 1TQ7B 4CRCA 4DIHH 1Z71A 2ZF0H 2NU3E 1TMBH 1MKWK 4Y0YE 4TY7A 3UOPA 1DX5M 3F1SB 1KTTB 1PPHE 1YM0A 1NESE 1OWHA 2GCHF 1HGTH 1KLIH 1GI0A 1XMNB 3KN2A 4X1RU 4DURA 2GT8A 2CHAC 2LNCA 4THNH 3AW0A 3MFJA 1K1IA 1UMAH 4B1TA 2XC0A 1DICA 1TRMA 3TITA 2EEKA 3MU5A 4DT7B 2P3TB 8GCHF 1N6YA 4JYUH 1FONA 1WCZA 2BY5X 1H9LB 4K8BA 2TIOA 1V2RT 1TMUH 2V3OH 4GHTA 5C1UA 4JZFH 3NZIA 2PSYA 3GOVB 2ZFFH 3F9GA 2DE8A 1UTNA 2BB4A 2ASUB 4MVNA 4CRAA 2AMDA 3GCHC 1BMAA 3R3GB 2P93A 4X2YA 3ZVEA 5FHTA 1F0RA 1TPOA 2BHGA 1BOQA 2RG3A 2HNTC 4E06H 2Y80A 4XDEA 1QGFA 3UWIA 2ZHDA 3NXPA 2Y81A 2RA3A 1C5WB 5T3HA 2F9NA 1A3BH 2VVUA 4B75A 1TA6A 8KME2 6LPRA 2PW8H 2JETB 4K2YA 1HCGA 1SGQE 1ANEA 1IQFA 3FFGA 1BTZA 2PSXA 1TGTA 1GI5A 4NFEA 1WQVH 1OWIA 1NU9A 1P2IA 1AKSA 1JOUB 1O2GH 4H6TA 1J17T 2HRVA 1GHBG 3LH1A 3UR6A 4HTCH 1M9UA 1V2LT 3BG4B 4GSOA 2VH0A 2XCNA 1QA0A 1BTYA 1LVYA 1XUFA 1O37A 2FPZA 1CU1A 1JRTA 5L30H 1SSXA 2ZDAH 4X2WA 2ANYA 3G01A 1V6DA 2GZ9A 2J95A 4ISOA 3V3MA 1O2KA 1G9IE 2JETC 1TNHA 1MKWH 1CGIE 1T8MA 1HFDA 2J38A 2P3FH 5PTPA 3UNQA 2R0LA 1A3EH 1FAXA 1ABIH 5FX5A 2C93B 3R0FA 2HPQH 3BG4C 1SOTA 3T29A 3KQBA 1MQ6A 1GJ7B 1CHOG 1TNLA 2DE9A 2A2QH 1LHFH 5EPNA 5DP7A 2WPKS 1BBRE 4MPVA 1A5IA 1XXDA 2TGTA 2J94A 4XSKU 1IHTH 5CMXH 1MMJN 4RKJB 2ZZUH 3MO9A 1G3CA 3QGNB 2BLWA 1QRWA 1UVUH 3RXFA 1J16A 3E1XB 4UFFH 4XFQA 2Z7FE 1GI2A 1O31A 2FS8A 3MU0A 3QN7A 2O9QA 5FBEA 1A5HA 1BBRK 1O5DH 8LPRA 5DP9A 4VGCB 2C8YB 1QY6A 1YPHE 1QTFA 2UUKB 1TE0A 2CF8H 3ZVGA 2CGAA 1WV7H 5TCAA 4AYYB 2GX4A 1ZRKA 2ZP0H 1SL3A 3UR9A 3SBKA 2QC2A 2FMJA 4ZXXH 5ABWA 3FVFB 3QTOH 1AVWA 1E0FD 1EAWA 1V2ST 1P12E 1OP2A 5HYOA 3OY6U 1MTNB 2WUCA 5TCCA 1NRNH 1F5RA 4ABHA 1GL1A 2VJ1A 4VGCC 2Z3EA 2GCHG 3TNTA 1NRSH 3PLKA 5FAHA 1AUJA 4RSPA 2UWLA 1G37A 4FU8A 2TPIZ 5I46H 1NFWA 8GCHG 1C2DA 2PFEA 3V12A 3MI4A 4INHA 1BHXF 3NK8A 2ALVA 4KELA 2I6SA 2Q6DA 4X1QU 1G36A 1SQTA 3P8FA 1O39A 1EJMA 1AI8H 2FOCA 3T2NA 1C5PA 1MD8A 2OC1A 1MTNC 1UCYE 2H5DA 4ZXYH 5L2ZH 1MBQA 2ZU3A 1K22H 1TB6H 2OP9A 1NZQH 2WPMS 1GI3A 5JB9S 2OD3B 1O33A 2QN5T 5JBTA 2ZI2H 2ANWA 1UTMA 4I8LA 1V2NT 3P17H 3MH5A 5HGGA 2ANMH 1EAUA 1FY5A 2FTMA 4BOHA 4UONA 3K2UA 1PFXC 2UUFB 1OWJA 1AB9B 1G3DA 1GHYH 3KIDU 2WV4A 1Y3XA 3SQHE 2A5IA 3HKJB 4GLYA 2GKVE 1GHVH 1GBMA 3D49H 4U32A 1S81A 2GV6A 3SU2A 2FOGA 3U69H 3ZZ9A 1P3EA 2THFB 3AVZA 1LVMA 3TK6A 1F5LA 3FP7E 4Y8YA 1BITA 5DP8A 1NFYA 3BTWE 2QF3A 1P2MA 4YOJA 1GVZA 1AB9C 3U1JB 2B9LA 2BLOA 1C5NH 4CHAB 2J9NA 2A7HA 2PWXA 3LJJA 9LPRA 1T8LA 3RLYH 4NGAH 3FAOA 2BZAA 4X1NU 3E16B 2PGQB 5F03A 1QB1A 3TIUA 3ATLA 4ABGA 2ZKSA 3TGJE 5IDKA 1SGYE 2ZG0H 2ZWLH 1GJCB 2IN2A 3QWCH 3RM2H 3NKKA 3CS0A 4U01A 3LGYA 2ZDLA 1UTPA 5LPFA 3LDXH 2J34A 4FU9A 4FUFA 2STBE 1UTQA 2ANKH 3SI4H 2HNTE 1Q2WA 2Y6TA 4ZMAH 3ATMA 1TLDA 4NIVA 1RXPA 4YOGA 3SJKA 2AGEX 3DUXH 4CHAC 1C1WH 1DLKB 1GHWH 1NRQH 5JBAS 4Z0KA 3A83A 1TOMH 5ESTE 3IWMA 2W3IA 4TY6A 2Y7XA 5EXLA 4XBDA 1GDQA 4UEHH 3KHVA 3LC3A 1TIOA 1MU6B 3M5MA 5L6NH 2BOHB 1G3BA 2F91A 3QO6A 3FZZA 4JYVH 4WWYA 3BIUH 4A1VA 4Y71A 2H9TH 4NSVA 3RXRA 1MD7A 1DY8A 1T32A 1AMHA 3C1KA 1DVAH 3HATH 1BZXE 1Z1IA 1TYNA 1W2KH 4K60A 1LKBA 1A5GH 2OINA 2Z6BD 1HDTH 1JBUH 1O38A 1AGJA 1KXDA 1ZOMA 2F9VA 1C5SA 1QFKH 2FIRH 3VXFH 1WU1A 1JXPA 3SHCH 4AZ2B 5FPYA 1EPTB 1S0QA 1WAYB 2FXRA 4GCHG 1AN1E 1AO5A 4BAHB 3MU4A 1K1PA 4MQAA 3PTNA 4MLFB 4I31A 5TJXA 4Z6AH 3SV8A 1O3AA 4AYVB 2BVRH 1GL0E 1C1RA 1GHAF 2R2MB 1TALA 1SFQB 3ITIA 1KYNA 1WOFA 1HAVB 4BXSA 1MQ5A 2SGDE 3RXDA 4BTTB 3KGPA 1V2UT 3A89A 2BMGB 4AB8A 2FOMB 1ZJKA 4BXWA 4ISHH 2Z3CA 1JWTA 5F6MA 2GP9B 3U1IB 3SU3A 1V2MT 1AD8H 1MTUA 3RXOA 2FDAA 2FX4A 4TPIZ 1BMMH 1GBCA 5AF9H 1F0UA 2Q1JA 1U6QA 1O3GA 1W0ZU 4HI3A 3VB7A 2OCVB 3TGIE 3MOCA 2ZHFH 3M61U 1V2KT 1XKAC 5IYTA 1K1LA 4XBBA 1QB9A 3ZZ3A 1O2TA 5EGMA 2O8TA 1MAYA 1RS0A 1ZHPA 2ZPQA 4A92A 4MNWA 7GCHG 2D1JA 2F9BH 3GY4A 4NIXA 1O3HA 3GY8A 1GG6B 5CE1A 4Y8XA 3TLOA 3ESTA 1ZPCA 5FBIA 1GJDB 1NFUA 3GISB 1O3JA 2PGBB 1EXFA 3ZZ6A 3RXTA 3UNRA 5LPEA 1AWFH 1P11E 4JZIA 1XXFA 3WY8A 2SGAA 3FANA 1XVMA 1AE8H 3ATWA 1UHBA 1EUFA 3DFLA 2V35A 2XBVA 1OP8A 3URDA 1K1JA 5B6OA 2VWMA 5F8ZA 5DP6A 1GDUA 1GDNA 1SFIA 1O3IA 1TX7A 5K0HA 1GG6C 2HLCA 1BTPA 1PPGE 2JH0D 1FIWA 4JZEH 5FCKA 1A2CH 1TX8A 1P2JA 3KEEA 1YLDA 1NS3A 4AORA 1AHTH 3MNSA 2F9PA 4I8GA 1TAWA 2A7JA 4I7YH 1O2LA 4WY3A 3UQVA 5G4BA 4YZUA 3UQOA 1VJAU 1VITG 1GMDF 3ODFA 4ASHA 4D8NA 1HYLA 3ZV8A 3RXMA 1O2SA 4X6OA 1GJ9B 4FUIA 3M7TA 1GBBA 1ZSJA 1ABJH 3SV6A 1FI8A 1NC6A 1F7ZA 3ZV9A 2FX6A 4IGDA 1EOJA 1B5GH 2AMQA 1OXGA 1C1QA 3SU1A 3OU0A 3PM3A 1F0SA 7ESTE 1CA8B 3MH4A 1SLVB 3IITA 3SV2H 4IMQA 5GJ4B 1ZPZA 1CHOF 2QIQA 1Z6EA 2VWOA 1QL7A 2GDEH 1ELGA 1ARBA 5DO4H 1LKAA 3TH3H 1UK3A 1ZMLA 1ANBA 2ZQ2A 3STIA 3LJOA 1EPTA 1GBTA 4FUBA
chains in the Genus database with same CATH superfamily
1SGRE 2B5TB 2GVFA 5A0AE 4X2VA 1GHAG 1DITH 4IBLH 2ZECA 3MU1A 1A7SA 1C5TA 2ZDVH 1C1VH 1KLJH 2FODA 1P09A 2H9HA 1KXBA 2QF5A 1C1SA 1CE5A 2O8UA 3SO3A 4FVBA 5C5OA 5E8EH 2ODYB 2W7UA 4FUCA 1CGJE 1EJNA 2AFQB 4ABDA 1Y5BT 1D3PB 3SZEA 1DWBH 3PLBA 1BTWA 2QXIA 3GCOA 5ETXA 2PTCE 2QF4A 1UJ1A 1T31A 1O0DH 1QIXB 1ANDA 3EA7A 1ESBA 1O2VA 3RMLH 4OS7A 2IPHA 3QDZB 1C2MA 4ZKNU 5E2PA 1C2FA 1WYKA 3RLWH 5JBCS 1EZSC 4JYTA 1HXFH 1PYTD 2TGPZ 3KQEA 2Z9KA 1UK4A 3BEIB 3L3TA 4AG1A 3ATKA 2P59A 1DSUA 2GGVB 3A8AA 4Q7ZA 1FIZA 1ZTJA 3UY9A 2WPJS 1FY8E 2A4QA 6ESTA 1EKBB 3MNCA 1CT0E 2ZDMA 5GPIB 5DJ7A 2CV3A 3F9HA 1IQNA 8ESTE 2C8XB 3RXAA 1HB0B 1ZMNA 2KCOA 3HGNA 2O8MA 2QF0A 2WUBA 4OGXA 2BY9X 1C9TA 1GI7B 4AFZA 4OS5A 4I32A 3CENA 1ZGIA 4YTAA 4ABFA 5GXPA 2GDDA 2QGRA 3Q76A 3RU4E 3UAIC 5B6LA 5LGOA 2WPLS 3GICB 3H7OA 4YM9A 3QZRA 4NA8A 1O3OA 2HWLB 3BTQE 5E2OA 1ELVA 1DXWA 3RU4T 5A0CA 5C67A 3H09A 1C2EA 1ZYOA 1THRH 4ISLA 3ZVFA 1SLWB 3PV5A 5EIYA 1EB2A 1BTUA 2V3HH 1HJ8A 1P06A 3SJ9A 4Q63A 2G52A 1TNKA 1YYY1 1L1NA 1SHHB 4DY7B 1AU8A 2RDLA 3FZDA 5KEDA 1GJBB 1O5BB 2ZGXH 1SGEE 2Z3DA 3EA9A 1SGNE 2ILNA 4Y8ZA 1MTSA 3LC5A 1KSNA 5C3NA 3D62A 4NWKA 2FWWA 1O3KA 1GMDG 1WTHD 1FN6A 1ZGVA 1FDPA 3PYHA 2GD4B 3FN8A 3GYLB 4BTUB 1GJ5H 4NFFA 2BD4A 1GBFA 1T4UH 1Z7KA 4XD7D 3KCGH 2YOLA 3SNDA 4LK4A 3H7TA 1ZHRA 4RT1A 3GDVA 1QR3E 1BJVA 4OS4A 1NO9H 4AC9A 2V0BA 1C2KA 3PO1B 1TRNA 2WINI 4J2YB 3TPIZ 3A86A 3EAJA 5E0HA 3MU8A 4O3TA 3UOUA 2WPHS 4CBNA 2OQUA 1W12U 1FY4A 1A61H 1RD3B 2K8IA 1C1MA 2G4TA 2SFAA 3LGVA 3VB3A 1KXFA 1G30B 5DPAA 3U8TH 1GBHA 1S6LA 4ABEA 3EE0B 1GBKA 4IC6A 1MKXK 1GMHF 4FU7A 2ZU4A 2VIVA 4YT7H 1S5SA 1BUIA 3AAVA 2FP7B 5DSFA 3O8RA 1HLTH 3P8GA 2VU8E 1DSTA 3M7UA 3TNSA 2F4LA 4AFSA 3PLPA 4O3UA 2NU4E 1D9IA 2A32A 3PO1C 4SGAE 1W10U 1JIMA 2ODPA 2FOEA 1SG8B 2QAAA 1DANH 4WXIA 3RC4A 4DCDA 1PPCE 1Q3XA 1S0RA 3SU5A 4B76A 3A87A 3GCNA 1P04A 2NWNA 1ZJDA 4RI0A 3RUOA 1KLTA 1IQJA 1HAZB 1MU8B 1V3XA 1IQLA 1ETSH 1L4DA 1CVWH 3F9FA 1P0SH 1C2HA 1ELEE 1YP9A 2BD7A 4INLA 5DKMA 1C9PA 3S9CA 1NFXA 1X7AC 2QCYA 1C4V2 3PMJA 1S6HA 1FMGA 4ASUD 1EAXA 1W3CA 2OBQA 3M3SA 1DLEA 3Q3XA 2BVSH 2Z9GA 4MNYA 3KYGA 1TQ0B 1QQUA 4ZKOU 1VITH 2ZFRH 4JZDH 3D65E 5DP5A 4BNRA 3F0OA 5AHGH 3GY7A 4CR5A 1HXEH 3GDSA 2WPIS 4JK6A 4B2AA 4D9RA 4GCHF 1GBJA 4UFGH 3M36A 1VR1H 2XTTB 2YNBA 1PPFE 1TBQH 4X1SU 1CBWB 1BMLA 3SNCA 2BYAX 3U8OH 1TPPA 4CBOA 4X6MA 4E7RG 2QY0B 1FV9A 2V6NA 1F5KU 4Y7AA 3A8DA 4F49A 5T1VA 1FY1A 1AE5A 1DM4B 1S84A 3A85A 4AFUA 3W95A 4WH8A 1W8BH 3MO6A 1P03A 2BTCE 2A45B 2XOKD 1QRXA 2XWAA 2G81E 1GJAB 1QURH 4B71A 4ABJA 4AG2A 2Y7ZA 2VWNA 1UCYK 1MKXH 1CBWC 4OM9A 3GCTF 1KDQA 2EI8A 1O2ZA 1K1OA 4ABIA 2WV9A 4LXBH 4ZROA 2NU0E 1INCA 1DWDH 1LVBA 3M3VA 1ELDE 2A4GA 3F2FA 3Q77A 1BT7A 4Z1MD 1KXCA 1E1RD 1GCDA 4TWWA 5EPYA 1QJ1B 1GJ8B 1BBRH 1UVTH 7GCHF 1W13U 4UE7H 9ESTA 1VGCB 2BD3A 1O2XA 1AVXA 5DP4A 1BHXB 3HK6B 1C2IA 1WBGB 3U8RH 3F3BA 1VZQH 4D76A 1P9UA 1EP5A 3UPEA 2C3SA 1QL8A 4WXVA 3ZZBA 2BDYA 3GY6A 1C5QA 3MO3A 2FLBH 4TT3D 1AUTC 1TONA 2J92A 1BRCE 2HLDD 5EQRA 1UHBB 1ZZZA 1P2OA 2OC7A 1KY9A 2ZHWH 3OAAD 3ELAH 2NU2E 3JZ1B 2A31A 1TBZH 2C4FH 2CK3D 1RTFB 3SU0A 2F9UA 5EJ1A 1C5VA 2VWLA 2ZNKH 4Q2KA 1QBNA 1B0EA 3RC5A 1LVOA 5EXMA 3U9AH 1LTOA 1GI1A 5F53A 2C8ZB 3SHAH 3PV4A 1HPGA 3PMAB 2J97A 1THPB 2AEIH 2JH5D 5JDUB 3AW1A 4KP0A 3LGWA 2ZDNA 5A8YA 2ZGJA 3VGCB 1HAIH 1C1UH 1XUJA 2RA0A 1FN8A 3N7DA 1GMHG 4Y79A 4U2WA 2AERH 1V2OT 4UFEH 1AY6H 1YLCA 4U30A 1LHGH 1O36A 2J98A 1CT2E 4FVDA 4INKA 1GBEA 2FOFA 1VITF 2ZIQH 2QXGA 1ZRBA 4B73A 5L2YH 1GI6A 4CRFA 1NRPH 2OQ5A 1W0JD 1H9IE 3DCLA 3S9AA 1FQ3A 1WQSA 2BY7X 1DWCH 1QJ7B 4DVAU 4A1XA 3O8DA 5AFZH 1YPMH 3FOAA 4H42U 3AK5A 4B74A 2BQWB 3N7OA 4UDWH 4UFDH 1OYTH 3SGBE 2CXVA 1H8DH 2SNWA 3TU7H 1GGDB 1GMCF 2VIPA 2O8WA 1UW7A 3RXIA 1S82A 3KNXA 5SGAE 2BZ6H 1O2HA 4YT6H 1O3PB 2PUQH 4DGJA 1PJPA 3MHWU 3RXPA 2TGDA 3BTGE 1LCYA 3VG8A 2VIDA 1TFXA 2ZDKA 3MNBA 3M35A 3U98H 4AGKA 3A7XA 1LMWB 4NIYA 3BTKE 1ORFA 1YPEH 2PKSB 5BPEA 2HOBA 1Y59T 1SB1H 1QBOA 3OE7D 6CHAB 1C5MD 1V2VT 3E8LA 1GBIA 1C5ZB 2BY8X 1F0TA 3MH7A 1HRTH 3T26A 3PMBB 1GGDC 5JBBS 1PPZA 1L1JA 1O2QA 1CA0B 1TGBA 3SQEE 2ZC9H 3RP2A 1GVLA 1MCVA 2XBYA 1EPTC 2WSSD 1QA7A 4K1TA 1T8OA 5FPSA 1JMOH 3EGKH 3SW2B 1FY3A 2AIQA 3P92A 2FYRA 5I25A 4HFPB 3SJ8A 1TPAE 2UWPA 3M37A 1TMTH 5HIYA 4DJZB 2PKSC 2VB0A 3GCTG 6CHAC 1KXAA 2ZTYA 3I29A 2R9PA 1SLUB 1DS2E 4FUEA 4WMDA 2YMSD 1GPZA 4GVUA 1QNJA 3QTVH 4Y0ZE 2FTLE 1SGPE 1ZR0A 3ZVCA 1GBAA 3VB6A 1CA0C 1MBMA 1H1BA 1MABB 1HJAB 2EA3A 1PYTC 3BTDE 3RC6A 1P9SA 1DXPA 4HGCA 2F3CE 3MWIU 4WMFA 1ANCA 4E05H 1K0HA 2Y82A 4OS2A 3U28C 3TK5A 4I33A 3LH3A 5E0GA 1HBTH 5C20A 2JJ1D 1EZUC 3UWJH 2PTNA 3RXGA 3QZQA 4ABAA 1QBVH 2M5TA 1FUJA 2EI6A 4GUXA 1A4WH 2A4RA 4MTBA 4NA7A 4XBCA 1TX6A 1J9CH 2R0KA 1BB0B 2J2UA 2SGPE 1SGFG 2XBWA 3SUGA 1GCTB 2P3UB 1DFPA 1EAIA 1S83A 2Z9JA 3L6PA 3SN8A 5ESBA 1UVSH 4DG4A 1ELBA 3HGPA 4Y10E 2FI4E 2JDID 1RGQA 1AVGH 1BMNH 2FM2A 3NPSA 1ZHMA 3GY2A 4IW4E 3SJIA 1O3BA 1OX1A 3MMGA 3V7TA 2IJD1 1O2NA 5A0BA 1YKTA 3HPTB 1HIAB 2AGGX 5AVDA 2A4OA 3O8CA 1O34A 1F2SE 2Y5GA 3E3TA 2ZPSA 2SGFE 3DT0H 3I78A 2C8WB 2HGTH 3S9BA 4TWYA 1P02A 1GCTC 1IHSH 3EYDA 5FPTA 2ZCKP 1UTLM 4ACAA 1V2JT 1RTLA 1E1QD 3DD2H 3DSOA 1DPOA 5J4QA 2GT7A 5CHBA 2W7SA 3PWBA 4B2CA 2NU1E 2HALA 1Z6JH 2OXSA 5EODA 2O8LA 4ISIH 2BM2A 1IQGA 1YPHC 3SZNA 2ZHEH 2AMPA 2F9OA 2ZTXA 1C4U2 5A09A 4KGAA 2KX4A 4I8KA 2VIWA 1Q31A 2OK5A 5GCHF 3SJOA 1YBWA 4RN6A 1C1NA 1NTPA 3KQCA 1FPHH 1TWXB 3TJVA 2JJ2D 1GMCG 1MTVA 2OLGA 1C1OA 3K9XB 3S69A 1Z1JA 4P02A 3RDZA 3MH6A 1G2MA 1YPLH 3STJA 2XNIA 2G8TA 4D9QA 2ZEBA 1O2MA 1LO6A 1PQ5A 1BTHH 2VVVA 1CT4E 2BOKA 1LDTT 2WV5A 5EQSA 5EOKA 2YNAA 3EQ0H 5C1YA 1OPHB 3SGQE 3SU6A 1CO7E 1Y3YA 2B8OH 4E7NA 2R2WU 2G5NA 1AFQB 1DUEA 3T62A 5C17A 3QLPH 2AH4X 1LPGB 2ZU1A 4YLUA 3RU4D 1ZMJA 4KKDA 4WJG2 1SC8U 2HNTF 3B8JA 3FP6E 2AS9A 7KMEH 3KL6A 5CHAB 4K5ZA 4MNVA 4YLQH 4O9VA 2D26C 2H6MA 5EG4A 1NRRH 1CQQA 2H9EH 5HKKD 2KAIA 1BQYA 2A5AA 4MDSA 4DIIH 1C5RA 2EY4C 2IJOB 3NUMA 7LPRA 4JMYA 4CH8B 1P2QA 2FEQH 2ZQ1A 2WYJA 2XRCA 5GNDA 3SI3H 5LH8A 2FS9A 3ZZ8A 1NM6A 5DG6A 4FUHA 1Z8IB 1D6RA 2PV9B 3AASA 3BTME 3F68H 1AFQC 1E36B 1L0ZA 4OS1A 1O5AB 1H8IH 4ZUHA 1PQ8A 1GI9B 3ZZAA 3RXLA 1YLNA 1DWEH 2FO9A 4Y76A 2HPPH 1P05A 2ZO3H 4I8JA 4AB9A 5CDFE 5CHAC 4R0IA 3RXEA 5DP3A 1ID5H 5LPRA 1GWAA 1PPBH 4MNXA 1QRZA 1MZDA 2KM0A 4ZH8A 2XWBI 5C1XA 1YCPK 1EX3A 4K8YA 2GCTB 4X6PA 2AGIX 1JIRA 1RJXB 3MYWA 3H5CB 3GCHB 1C4Y2 5H4IB 2B0FA 4DW2U 1SGDE 1OWKA 2FLRH 1TA2A 1AFEH 3UUZA 2A5KA 1GJ6A 4GPGA 1TBRH 2Q6FA 3RMMH 2GZ7A 1MCTA 2VIQA 3S7HB 1SI5H 1HAGE 1TGNA 3PV2A 3F0PA 2KFWA 3EDXB 3A88A 1KDQB 1HV7A 3NWUA 2TRMA 1O2WA 2JH6D 3KF2A 4YOIA 2BVXH 4NZQA 4D7GA 3DHKH 4DOQA 2FI3E 1LHEH 1IOEA 2QE7D 2FOHA 1ELTA 2GCTC 3A8BA 3BN9A 4XE4A 2AYWA 2BD8A 3ZYDA 2BQ6B 1CHGA 3TVJB 2RCEA 2ZCLP 1HIAA 1A0HB 3N7EA 1E79D 3ZZ7A 1E34B 2ZFTA 4D7FA 5J4SA 3GY3A 3IG6B 3W94A 1E38B 1L2EA 2D8WA 1G32B 3ZZCA 4HZHA 4AX9H 2J4IA 1C1PA 2G51A 2XW9A 3L33A 2EI7A 4NCYA 1C5OH 1KIGH 1P8VC 4ABBA 1P3CA 5C5NA 2PKAA 1O5GH 3JZ2B 3M3TA 4IC5A 3TGKE 2OUAA 1QB6A 3ZYEA 4KTCA 1J14A 2BLVA 5GCHG 2Z94A 4OS6A 4TYDA 1VCWA 3PWCA 3SUEA 3D23A 3MNXA 3TJOA 2LELA 4LZ1H 1O32A 1G2LA 4MPXA 2ZTZA 1W14U 3BTTE 3V0XA 2W26A 4P00A 1SVPA 3ENSB 4NZLA 1HJ9A 2XXLA 1DE7H 2J98B 3A82A 4CR9A 4CRDA 2C90B 1SOZA 3UIRA 1HAOH 2P95A 3RXSA 4X0WU 1Y3VA 1C5YB 3T27A 1YCPH 1FJSA 2SNVA 1SQAA 1ACBE 2EC9H 1H4WA 1O35A 1TGCA 3ZVAA 1HAXB 1YPKH 2QXHA 3ZVDA 3UREA 1W7GH 2VNTA 3BTFE 1XM1A 5EW1H 4YESB 1OSSA 3KYFA 1ESAA 2AIPA 3SORA 3VB4A 3QUMP 1GI8B 2F43B 3SNEA 1N1LA 1J8AA 4X6NA 1O2OA 4I86A 2I6QA 4TSFD 3FKSD 3LKWA 5C0TA 4NA9H 1UO6A 1ZTLA 2PR3A 3A80A 1YC0A 2PLXA 3P8NA 1WTGH 4A1TA 1D6WA 4NSYA 4MPUA 3M5LA 1QL9A 3SNAA 1P57B 4CRBA 1UTOA 3PMHB 1TNGA 2ZFSA 1IQIA 3A7VA 3LONA 4GAWA 1ESTA 1IQMA 1XKBC 1AQ7A 1UTJA 2BX4A 1WUNH 4MPWA 1EJAA 3LT3A 1D3QB 1LQEA 1OWDA 2BLQA 3ZZ5A 5EQQA 1BDAA 1Y3WA 1QHRB 2PHBA 3E90B 3ATIA 2QA9E 2WYGA 3I77A 5EU8A 5A8ZA 1BRUP 1SQOA 1VJ9U 1MH0A 3KQDA 1C5UA 1NBMD 2A1DB 3ZVBA 2BD2A 2ZA5A 3E91A 3ZZDA 3S0NA 1RRKA 4O97A 1ETTH 4A7IB 3P70B 3S7KB 4JCNA 5T6GA 3OTJE 5JPMH 1FZZA 1C2JA 1TABE 3OYPA 4FOUC 5EW2H 5JB8S 1HAPH 1D3TB 5FL7D 1YPJH 1V2WT 1N6XA 1SBWA 3OX7U 2ZU5A 3VPKA 5K7RA 1UVPA 4ZHAA 4CREA 1DY9A 1QCPA 1O3LA 4NG9H 3RXHA 1BIOA 1DDJA 3A8CA 3V13A 4A6LA 3M7QA 3DSGA 5HM9A 1FAKH 1OOKB 5FCRA 3VFEA 4X8SH 3SOSA 2FZZA 1RTKA 3RXBA 1YPGH 1P10A 2P94A 2VH6A 1LHDH 2A2XH 2TBSA 2BDIA 1UVOA 1O3MA 1W0YH 2UUJB 2J5UA 3A7YA 3BEUA 4K3JA 1THSH 1YCPM 1A0LA 2AHME 3K6ZA 2LPRA 1UK2A 1O2RA 1B7XB 2CJIA 3K65B 4CH2B 1Y5AT 2HVXA 1MTWA 2Y5FA 3OY5U 1ELFA 4IS5A 2OC0A 1C2GA 2STAE 1V2PT 2VGCB 1MUEB 1OWEA 3SU4A 3TJUA 4KTSA 2F83A 1VGCC 3LU9B 2VVCA 4I8HA 4Y11E 4GHQA 2GV7A 2GZ8A 1T7CA 3RM0H 2R3YA 2XYAA 1ZPBA 1ZTKA 3RMOH 3UFAA 4WVPE 4A5TS 1EZXC 1LHCH 1BCUH 2ZGCA 5A8XA 3QK1A 1SMFE 1QQ4A 2XC4A 1HAYB 2PUXB 1O3FA 6GCHF 1B0FA 3B9FH 1KXEA 4Y6DA 3RXKA 2VGCC 1VCPA 2D2DA 1O2YA 2TGAA 1BRBE 1MAXA 5DN6D 3TH4H 1E37B 3GYMA 1RIWB 1L4ZA 2KR7A 3BSQA 2JKHA 1K1MA 2SGQE 3VGCC 2SGEE 3NCLA 3RXUA 4CRGA 4ZKSU 1NY22 2W3KA 1O5EH 1UCYH 2VINA 1OP0A 1BJUA 3P6ZB 3T25A 2GMTB 2IOTA 3RXCA 5JYIA 3MQKC 4OGYA 3DFJA 2BD9A 1YF4A 3F6UH 2HVYB 1A0JA 1LPKB 1XUIA 3CS7A 4LOYH 1P01A 4IN2A 3HKIB 5BRRE 3T5FH 2ESTE 1NPMA 2FI5E 4K69A 4Q7YA 4H4FA 2BQ7B 1O3EA 1OYQA 4ZKRU 4NWLA 1K9OE 2UUYA 1FLEE 2XC5A 1ZSLA 3LGTA 3KQ5A 1K28D 3SUDA 2G00A 1RIWC 2QV1A 1GBLA 2ALPA 5AFYH 1C5LH 1SGCA 1E35B 1ELCA 2OBOA 3SUFA 2P16A 1ELAA 5HXFA 2GMTC 4LZ4B 3PROA 1NU7B 2LP6A 3PB1E 5HM2A 5HIZA 2R3UA 3BEFB 3CP7A 1Y8TA 2FYQA 3VEQB 1IQEA 1PQAA 3Q3YA 3A7WA 3QGJA 2ZFPH 1HUTH 3LIWA 3ODDA 5HMAA 4FUGA 1CSOE 1N8OB 1Z8RA 4BAOB 1W11U 4K1SA 2BD5A 3BTEE 2KAIB 3LPRA 3FO8D 1O2UA 3M5OA 3EE7A 3P8OA 4Y7BA 3B23B 1K1NA 2ZGBH 1KMHB 3RXJA 1J15A 4AGJA 4R8TB 2KCPA 2FESH 4RKOB 1Y3UA 3E0PB 2FOBA 3URCA 1FXYA 3E0NB 2CF9H 1AZ8A 1TNJA 2M2AA 3SGAE 3PRBA 1C5XB 5T6FA 4AN7A 2BDCA 2L6OA 4WF8A 1PQ7A 1LPZB 1ARCA 3BF6H 4WH6A 2BXUH 2BDGA 2Y5HA 1DUAA 1S85A 1N8OC 1D4PB 2XCFA 1Z8JB 2Z9IA 1SHYA 1IQKA 1TGSZ 4X8VH 4TPYA 4BAQB 1V2TT 4IN1A 1UTKA 5GDSH 1NT1A 1XUHA 5DK1A 5GIBA 1EP6A 4QT8C 4B2BA 1GHZA 1O2JA 1O5FH 3BV9B 3LGIA 3W1EA 4K1EA 2VIOA 1BTXA 2ZU2A 1EATA 2P8OB 4Q7XA 4PROA 1OS8A 3A84A 1A1RA 1FX0B 4JZ1A 3E6PH 2RFKC 1C2LA 1GI4A 1O3DA 3A81A 4FUJA 1H8ED 3LOXA 3BTHE 4XOJA 1O5CB 1AWHB 4X2XA 3RXVA 3RMNH 1HAHH 2Q6GA 3Q00A 2BDAA 5FX6A 3VXEH 3SNBA 1HJAC 1GBDA 5EXNA 2QYIA 2IPQX 1C1TA 1O3NA 1A46H 4BAMB 3DA9B 3VB5A 5A2MH 1SGIB 1XX9A 3SV9A 3Q3KA 3AAUA 5F8XA 1JRSA 1SGTA 1T8NA 2UWOA 4MG3A 1S6FA 1BRAA 4HG6A 2P8OC 3QX5H 2CMYA 2KCYA 2A0QB 1SLXB 3F2GA 1KTSB 2BDBA 4X8UH 1P2NA 1YGCH 1G3EA 2H1UA 2H5CA 6GCHG 3OSYA 1LQDB 3F2HA 1O2PA 3A7ZA 1DT2A 1GJ4H 1XUKA 2A7CA 1Z8GA 1OHHD 1AKSB 3OEED 3TK9A 2K1QA 2OTVA 1AZZA 1O2IA 1W7XH 2PKAB 3P95A 3BG8A 5T6DA 3NRLA 4BTIB 1EQ9A 5E0JA 2ULLA 1ETRH 4AOQA 1FNIA 1GHBF 1TNIA 2ZHQH 2B7DH 2Z9LA 1XVOA 2G55A 4BANB 4NIWA 4FXGH 1ZLRA 1EASA 1EB1H 3T28A 1V2QT 3GDUA 3O8BA 4M7GA 2GTBA 2ZPRA 2FOAA 1O30A 3FP8E 1IQHA 4JK5A 1NROH 1FPCH 1SGFA 3HK3B 4ZAEA 3TJNA 2BDHA 4ZHLU 3PRDA 5GWZA 1Y5UT 1SPJA 2QXJA 4AFQA 1NN6A 1HNEE 1MZAA 3OFND 3BIVH 2DUCA 3M5NA 1QJ6B 3EA8A 3TH2H 1PPEE 2G4UA 4YO9A 4KTUA 4Q80A 4F4OC 5DGJA 1CGHA 5C2ZA 1XUGA 1L1GA 3K6YA 3LGUA 2BY6X 5F8TA 1GVKB 3PTBA 2ZFQH 1IAUA 1F92A 1EOLA 1T4VH 1TOCB 2CN0H 4FUDA 2OC8A 4X8TH 1K21H 2G5VA 2ZCHP 4ESTE 2H2ZA 1AIXH 1P2KA 4Q4LA 3UNSA 4IMZA 1TPSA 1WSSH 4O03A 1ZSKA 2XBXA 1VCQA 4UD9H 1O3CA 2BXTH 4H6SB 1TRYA 1SR5C 4J1YA 3UTUH 3RXQA 5EJZA 4ISNA 3ZZ4A 1D3DB 3F9EA 4SGBE 1OKXA 1K2I1 1RFNA 3C27B 3GY5A 1BA8B 2ODQA 3WWFA 2W5EA 3MTYA 3A7TA 4BAKB 1H9HE 1HAVA 1GHXH 4X1PU 3SV7A 4ZHMU 1DOJA 1EZQA 3WW7A 2BX3A 2CHAB 2W6JD 5FXLA 4WMEA 2ZGHA 1TQ7B 4CRCA 4DIHH 1Z71A 2ZF0H 1YY3A 2NU3E 1TMBH 1MKWK 4Y0YE 4TY7A 3UOPA 1DX5M 4DT4A 3F1SB 1KTTB 1COWD 1PPHE 1YM0A 1NESE 1OWHA 2GCHF 1HGTH 1KLIH 1GI0A 1XMNB 3KN2A 4X1RU 4DURA 2GT8A 2CHAC 2LNCA 4THNH 3AW0A 3MFJA 1K1IA 1UMAH 4B1TA 2XC0A 1DICA 1TRMA 3TITA 2EEKA 3MU5A 4DT7B 2P3TB 8GCHF 1N6YA 4JYUH 1FONA 1WCZA 2BY5X 1H9LB 4K8BA 2TIOA 1V2RT 1TMUH 2V3OH 4GHTA 5C1UA 4JZFH 3NZIA 2PSYA 3GOVB 2ZFFH 3F9GA 1H8HD 2DE8A 1UTNA 2BB4A 2ASUB 4MVNA 4CRAA 2AMDA 3GCHC 1BMAA 3R3GB 2P93A 5KGOA 4X2YA 3ZVEA 5FHTA 1F0RA 1TPOA 2BHGA 1BOQA 2RG3A 2HNTC 4E06H 2Y80A 4XDEA 1QGFA 3UWIA 2ZHDA 3NXPA 2Y81A 2RA3A 1C5WB 5T3HA 2F9NA 1A3BH 4B6EA 2L74A 2VVUA 4B75A 1TA6A 8KME2 6LPRA 2PW8H 2JETB 4K2YA 1HCGA 1SGQE 1ANEA 1IQFA 3FFGA 1BTZA 2PSXA 1TGTA 1GI5A 4NFEA 1WQVH 1OWIA 1NU9A 1P2IA 1AKSA 1JOUB 1O2GH 4H6TA 1J17T 2HRVA 1GHBG 3LH1A 3UR6A 4HTCH 1M9UA 1V2LT 3BG4B 3CNRA 2VH0A 2XCNA 4GSOA 1QA0A 1BTYA 1LVYA 1XUFA 1O37A 2FPZA 1CU1A 1JRTA 5L30H 1SSXA 2ZDAH 4X2WA 2ANYA 3G01A 1V6DA 2GZ9A 2V7QD 2J95A 4ISOA 4XRNA 3V3MA 1O2KA 1G9IE 2JETC 1TNHA 1MKWH 1CGIE 1T8MA 1HFDA 2J38A 2P3FH 5PTPA 3UNQA 2R0LA 1A3EH 1FAXA 1ABIH 5FX5A 2C93B 3R0FA 2HPQH 3BG4C 1SOTA 3T29A 3KQBA 1MQ6A 1GJ7B 1CHOG 1TNLA 2DE9A 2A2QH 1LHFH 5EPNA 5DP7A 2WPKS 1BBRE 4MPVA 1A5IA 1XXDA 3DSPA 2TGTA 2J94A 4XSKU 1IHTH 5CMXH 1MMJN 4RKJB 2ZZUH 3MO9A 1G3CA 3QGNB 2BLWA 1QRWA 2KCAA 1UVUH 3RXFA 1J16A 3E1XB 4UFFH 4XFQA 2Z7FE 1GI2A 1O31A 2FS8A 3MU0A 3QN7A 2O9QA 5FBEA 1A5HA 1BBRK 1O5DH 8LPRA 5DP9A 4VGCB 2C8YB 1QY6A 2WZQA 1YPHE 1QTFA 2UUKB 1TE0A 2CF8H 3ZVGA 2CGAA 1WV7H 5TCAA 4AYYB 2GX4A 1ZRKA 2ZP0H 1SL3A 3UR9A 4F48B 3SBKA 2QC2A 2FMJA 4ZXXH 5ABWA 3FVFB 3QTOH 1AVWA 1E0FD 1EAWA 1V2ST 4M9FA 1P12E 1OP2A 5HYOA 3OY6U 1MTNB 2WUCA 5TCCA 1NRNH 1F5RA 3UB0A 4ABHA 1GL1A 2VJ1A 4VGCC 2Z3EA 2GCHG 4B6FA 3TNTA 5KECA 1NRSH 3PLKA 2PP6A 5FAHA 1AUJA 4RSPA 2UWLA 4RT0A 1G37A 4FU8A 2TPIZ 5I46H 1NFWA 8GCHG 1C2DA 2PFEA 3V12A 3MI4A 4INHA 1BHXF 3NK8A 2ALVA 4KELA 2YMSB 2I6SA 2Q6DA 4X1QU 1G36A 1SQTA 3P8FA 3SYJA 1O39A 1EJMA 1AI8H 2FOCA 3T2NA 1C5PA 1MD8A 2OC1A 1MTNC 1UCYE 2H5DA 1WXRA 4ZXYH 5L2ZH 1MBQA 2ZU3A 1K22H 1TB6H 2EQNA 2OP9A 1NZQH 2WPMS 1GI3A 5JB9S 2OD3B 1O33A 2QN5T 5JBTA 2ZI2H 2ANWA 1UTMA 4I8LA 1V2NT 3P17H 3MH5A 5HGGA 2ANMH 1EAUA 1FY5A 2FTMA 4BOHA 4UONA 3K2UA 1PFXC 2UUFB 2YMSC 1OWJA 1AB9B 1G3DA 1GHYH 3KIDU 2WV4A 3OEHD 1Y3XA 3SQHE 2A5IA 3HKJB 5C0UA 4GLYA 2GKVE 1EFRD 1GHVH 4FETA 1GBMA 3D49H 4U32A 1S81A 2GV6A 3SU2A 2FOGA 3U69H 3N99A 3ZZ9A 1P3EA 2THFB 3AVZA 1LVMA 3TK6A 2K0QA 1F5LA 3FP7E 1WDIA 4Y8YA 1BITA 5DP8A 1NFYA 1NBME 2QF3A 1P2MA 3BTWE 4YOJA 1GVZA 1AB9C 3U1JB 2B9LA 2BLOA 1C5NH 1VKYA 4CHAB 2J9NA 2A7HA 2PWXA 3LJJA 9LPRA 1T8LA 3RLYH 4NGAH 3FAOA 2BZAA 4X1NU 3E16B 2PGQB 5F03A 1QB1A 3TIUA 3ATLA 4ABGA 2ZKSA 3TGJE 5IDKA 1SGYE 2ZG0H 2WHXA 1BMFD 2V3MA 2ZWLH 1GJCB 2IN2A 3QWCH 3RM2H 3NKKA 3CS0A 4U01A 3LGYA 2ZDLA 1UTPA 5LPFA 3LDXH 2J34A 4FU9A 4FUFA 2STBE 1UTQA 2ANKH 3SI4H 2HNTE 1Q2WA 2Y6TA 4ZMAH 3ATMA 1TLDA 3WWBA 4NIVA 1RXPA 4YOGA 3SJKA 2AGEX 3DUXH 4CHAC 1C1WH 1DLKB 1GHWH 1NRQH 5JBAS 4Z0KA 3A83A 1TOMH 5ESTE 3IWMA 2W3IA 4TY6A 2Y7XA 5EXLA 3OTPA 4XBDA 1GDQA 4UEHH 2KZ4A 3KHVA 3LC3A 1TIOA 1MU6B 3M5MA 5L6NH 2BOHB 1G3BA 2F91A 3QO6A 3FZZA 4JYVH 4WWYA 3BIUH 4A1VA 4Y71A 2H9TH 4NSVA 3RXRA 1MD7A 1DY8A 1T32A 4ACBA 1AMHA 3C1KA 1DVAH 3HATH 1BZXE 1Z1IA 1TYNA 1W2KH 4K60A 1LKBA 1A5GH 2OINA 2Z6BD 1HDTH 1JBUH 1O38A 1AGJA 1KXDA 1ZOMA 2F9VA 1C5SA 1QFKH 2FIRH 3VXFH 1WU1A 1JXPA 3SHCH 4AZ2B 2GJGA 5FPYA 1EPTB 1S0QA 1WAYB 2FXRA 4GCHG 3ZIAD 1AN1E 5C94A 1AO5A 4BAHB 3MU4A 1K1PA 4MQAA 3PTNA 4MLFB 4I31A 5TJXA 4Z6AH 3SV8A 1O3AA 4AYVB 2BVRH 1GL0E 1C1RA 1GHAF 2R2MB 1TALA 1SFQB 3ITIA 1KYNA 1WOFA 1HAVB 4BXSA 1MQ5A 2SGDE 3RXDA 4BTTB 3KGPA 1V2UT 3A89A 2BMGB 4AB8A 2FOMB 1ZJKA 4BXWA 4ISHH 2Z3CA 1JWTA 5F6MA 2GP9B 3U1IB 3SU3A 1V2MT 1AD8H 1MTUA 3RXOA 2FDAA 2FX4A 4TPIZ 1BMMH 1GBCA 5AF9H 1F0UA 2Q1JA 1U6QA 1O3GA 1W0ZU 4HI3A 3VB7A 2OCVB 3TGIE 2JIZD 3MOCA 2ZHFH 3M61U 1V2KT 1XKAC 2WPDD 5IYTA 1K1LA 4XBBA 1QB9A 3ZZ3A 1O2TA 5EGMA 2O8TA 1MAYA 1RS0A 1ZHPA 2ZPQA 4A92A 4MNWA 7GCHG 2D1JA 2F9BH 4YXWD 3GY4A 4NIXA 1O3HA 2VBCA 3GY8A 1GG6B 5CE1A 4Y8XA 3TLOA 3ESTA 1ZPCA 5FBIA 1GJDB 1NFUA 3GISB 1O3JA 2PGBB 2XNDD 1EXFA 3ZZ6A 3RXTA 3UNRA 5LPEA 3GS9A 1AWFH 1P11E 4JZIA 1XXFA 3WY8A 2SGAA 3FANA 1XVMA 1AE8H 3ATWA 1UHBA 1EUFA 3DFLA 2V35A 2XBVA 1OP8A 3URDA 1K1JA 5B6OA 2VWMA 5F8ZA 5DP6A 1GDUA 1GDNA 1SFIA 1O3IA 1TX7A 5K0HA 1GG6C 2HLCA 4F55A 1BTPA 1PPGE 2JH0D 1FIWA 4JZEH 5FCKA 1A2CH 1TX8A 2W6ID 1P2JA 3KEEA 1YLDA 1NS3A 4AORA 1AHTH 3MNSA 2F9PA 4I8GA 1TAWA 2A7JA 4I7YH 1O2LA 4WY3A 3UQVA 5G4BA 4YZUA 3UQOA 1VJAU 1VITG 1GMDF 3ODFA 4ASHA 4D8NA 1HYLA 3ZV8A 3RXMA 1O2SA 1QZ8A 5EJLA 4X6OA 1GJ9B 4FUIA 3M7TA 1GBBA 1ZSJA 1ABJH 3SV6A 1FI8A 1NC6A 1F7ZA 3ZV9A 2FX6A 4IGDA 1W0KD 1EOJA 1B5GH 2AMQA 1OXGA 1SKYE 1C1QA 2RDEA 3SU1A 3OU0A 4ZCNA 3PM3A 1F0SA 1YWUA 7ESTE 1CA8B 3MH4A 1SLVB 3IITA 3SV2H 4IMQA 1SQRA 5GJ4B 1ZPZA 1CHOF 2QIQA 1Z6EA 2VWOA 5IK2D 1QL7A 2GDEH 1ELGA 1ARBA 5DO4H 1LKAA 3TH3H 1UK3A 1ZMLA 1ANBA 2ZQ2A 3STIA 3LJOA 1EPTA 1GBTA 4FUBA
chains in the Genus database with same CATH topology
1SGRE 2B5TB 2GVFA 5A0AE 4X2VA 1GHAG 1DITH 4IBLH 2ZECA 3MU1A 1A7SA 1C5TA 2ZDVH 1C1VH 1KLJH 2FODA 1P09A 2H9HA 1KXBA 1C1SA 1CE5A 2O8UA 3SO3A 4FVBA 5C5OA 5E8EH 2ODYB 2W7UA 4FUCA 1CGJE 1EJNA 2AFQB 4ABDA 1Y5BT 1D3PB 1DWBH 3PLBA 1BTWA 2QXIA 3GCOA 5ETXA 2PTCE 1UJ1A 1T31A 1O0DH 1QIXB 1ANDA 3EA7A 1ESBA 1O2VA 3RMLH 4OS7A 2IPHA 3QDZB 1C2MA 4ZKNU 5E2PA 1C2FA 1WYKA 3RLWH 5JBCS 1EZSC 4JYTA 1HXFH 1PYTD 2TGPZ 3KQEA 2Z9KA 1UK4A 3BEIB 3L3TA 4AG1A 3ATKA 2P59A 1DSUA 2GGVB 3A8AA 4Q7ZA 1FIZA 1ZTJA 3UY9A 2WPJS 1FY8E 2A4QA 6ESTA 1EKBB 3MNCA 1CT0E 2ZDMA 5GPIB 5DJ7A 2CV3A 3F9HA 1IQNA 8ESTE 2C8XB 3RXAA 1HB0B 1ZMNA 3HGNA 2O8MA 2QF0A 2WUBA 4OGXA 2BY9X 1C9TA 1GI7B 4AFZA 4OS5A 4I32A 3CENA 1ZGIA 4YTAA 4ABFA 5GXPA 2GDDA 2QGRA 3Q76A 3RU4E 5LGOA 2WPLS 3GICB 3H7OA 4YM9A 3QZRA 4NA8A 1O3OA 2HWLB 3BTQE 5E2OA 1ELVA 1DXWA 3RU4T 5A0CA 5C67A 1C2EA 1ZYOA 1THRH 4ISLA 3ZVFA 1SLWB 1EB2A 1BTUA 2V3HH 1HJ8A 1P06A 3SJ9A 2G52A 1TNKA 1YYY1 1L1NA 1SHHB 4DY7B 1AU8A 2RDLA 3FZDA 1GJBB 1O5BB 2ZGXH 1SGEE 2Z3DA 3EA9A 1SGNE 2ILNA 4Y8ZA 1MTSA 3LC5A 1KSNA 5C3NA 3D62A 4NWKA 2FWWA 1O3KA 1GMDG 1WTHD 1FN6A 1ZGVA 1FDPA 3PYHA 2GD4B 3GYLB 4BTUB 1GJ5H 4NFFA 2BD4A 1GBFA 1T4UH 1Z7KA 3KCGH 2YOLA 3SNDA 4LK4A 3H7TA 1ZHRA 3GDVA 1QR3E 1BJVA 4OS4A 1NO9H 2V0BA 1C2KA 3PO1B 1TRNA 2WINI 4J2YB 3TPIZ 3A86A 3EAJA 5E0HA 3MU8A 4O3TA 3UOUA 2WPHS 4CBNA 2OQUA 1W12U 1FY4A 1A61H 1RD3B 2SFAA 1C1MA 2G4TA 3LGVA 3VB3A 1KXFA 1G30B 5DPAA 3U8TH 1GBHA 4ABEA 3EE0B 1GBKA 4IC6A 1MKXK 1GMHF 4FU7A 2ZU4A 2VIVA 4YT7H 1S5SA 1BUIA 3AAVA 2FP7B 3O8RA 1HLTH 3P8GA 2VU8E 1DSTA 3M7UA 3TNSA 4AFSA 3PLPA 4O3UA 2NU4E 1D9IA 2A32A 3PO1C 4SGAE 1W10U 1JIMA 2ODPA 2FOEA 1SG8B 2QAAA 1DANH 4WXIA 3RC4A 4DCDA 1PPCE 1Q3XA 1S0RA 3SU5A 4B76A 3A87A 3GCNA 1P04A 2NWNA 1ZJDA 3RUOA 1KLTA 1IQJA 1HAZB 1MU8B 1V3XA 1IQLA 1ETSH 1L4DA 1CVWH 3F9FA 1P0SH 1C2HA 1ELEE 1YP9A 2BD7A 4INLA 5DKMA 1C9PA 3S9CA 1NFXA 1X7AC 2QCYA 1C4V2 3PMJA 1S6HA 1FMGA 1EAXA 1W3CA 2OBQA 3M3SA 1DLEA 3Q3XA 2BVSH 2Z9GA 4MNYA 1TQ0B 1QQUA 4ZKOU 1VITH 2ZFRH 4JZDH 3D65E 5DP5A 4BNRA 5AHGH 3GY7A 4CR5A 1HXEH 3GDSA 2WPIS 4JK6A 4B2AA 4D9RA 4GCHF 1GBJA 4UFGH 3M36A 1VR1H 2XTTB 2YNBA 1PPFE 1TBQH 4X1SU 1CBWB 1BMLA 3SNCA 2BYAX 3U8OH 1TPPA 4CBOA 4X6MA 4E7RG 2QY0B 1FV9A 2V6NA 1F5KU 4Y7AA 3A8DA 4F49A 1FY1A 1AE5A 1DM4B 1S84A 3A85A 4AFUA 3W95A 4WH8A 1W8BH 3MO6A 1P03A 2BTCE 2A45B 1QRXA 2XWAA 2G81E 1GJAB 1QURH 4B71A 4ABJA 4AG2A 2Y7ZA 2VWNA 1UCYK 1MKXH 1CBWC 3GCTF 1KDQA 2EI8A 1O2ZA 1K1OA 4ABIA 4LXBH 4ZROA 2NU0E 1INCA 1DWDH 1LVBA 3M3VA 1ELDE 2A4GA 3Q77A 1BT7A 1KXCA 1GCDA 4TWWA 5EPYA 1QJ1B 1GJ8B 1BBRH 1UVTH 7GCHF 1W13U 4UE7H 9ESTA 1VGCB 2BD3A 1O2XA 1AVXA 5DP4A 1BHXB 3HK6B 1C2IA 1WBGB 3U8RH 1VZQH 4D76A 1P9UA 1EP5A 3UPEA 2C3SA 1QL8A 4WXVA 3ZZBA 2BDYA 3GY6A 1C5QA 3MO3A 2FLBH 1AUTC 1TONA 2J92A 1BRCE 5EQRA 1UHBB 1ZZZA 1P2OA 2OC7A 1KY9A 2ZHWH 3ELAH 2NU2E 3JZ1B 2A31A 1TBZH 2C4FH 3SU0A 1RTFB 2F9UA 1C5VA 2VWLA 2ZNKH 4Q2KA 1QBNA 1B0EA 3RC5A 1LVOA 5EXMA 3U9AH 1LTOA 1GI1A 2C8ZB 3SHAH 3PV4A 1HPGA 3PMAB 1THPB 2AEIH 2JH5D 5JDUB 3AW1A 4KP0A 3LGWA 2ZDNA 5A8YA 2ZGJA 3VGCB 1HAIH 1C1UH 1XUJA 2RA0A 1FN8A 1GMHG 4Y79A 4U2WA 2AERH 1V2OT 4UFEH 1AY6H 1YLCA 4U30A 1LHGH 1O36A 1CT2E 4FVDA 4INKA 1GBEA 2FOFA 1VITF 2ZIQH 2QXGA 1ZRBA 4B73A 5L2YH 1GI6A 4CRFA 1NRPH 2OQ5A 1H9IE 3S9AA 1FQ3A 1WQSA 2BY7X 1DWCH 1QJ7B 4DVAU 4A1XA 3O8DA 5AFZH 1YPMH 4H42U 4B74A 2BQWB 3N7OA 4UDWH 4UFDH 1OYTH 3SGBE 2CXVA 1H8DH 2SNWA 3TU7H 1GGDB 1GMCF 2VIPA 2O8WA 3RXIA 1S82A 3KNXA 5SGAE 2BZ6H 1O2HA 4YT6H 1O3PB 2PUQH 4DGJA 1PJPA 3MHWU 3RXPA 2TGDA 3BTGE 1LCYA 2VIDA 1TFXA 2ZDKA 3MNBA 3M35A 3U98H 4AGKA 3A7XA 1LMWB 4NIYA 3BTKE 1ORFA 1YPEH 2PKSB 5BPEA 2HOBA 1Y59T 1SB1H 1QBOA 6CHAB 1C5MD 1V2VT 3E8LA 1GBIA 1C5ZB 2BY8X 1F0TA 3MH7A 1HRTH 3T26A 3PMBB 1GGDC 5JBBS 1PPZA 1L1JA 1O2QA 1CA0B 1TGBA 3SQEE 2ZC9H 3RP2A 1GVLA 1MCVA 2XBYA 1EPTC 1QA7A 4K1TA 1T8OA 5FPSA 1JMOH 3EGKH 3SW2B 1FY3A 2AIQA 3P92A 2FYRA 5I25A 4HFPB 3SJ8A 1TPAE 2UWPA 3M37A 1TMTH 4DJZB 2PKSC 2VB0A 3GCTG 6CHAC 1KXAA 2ZTYA 3I29A 2R9PA 1SLUB 1DS2E 4FUEA 4WMDA 1GPZA 4GVUA 1QNJA 3QTVH 4Y0ZE 2FTLE 1SGPE 1ZR0A 3ZVCA 1GBAA 3VB6A 1CA0C 1MBMA 1H1BA 2EA3A 1HJAB 3BTDE 1PYTC 3RC6A 1P9SA 1DXPA 4HGCA 2F3CE 3MWIU 4WMFA 1ANCA 4E05H 2Y82A 4OS2A 3TK5A 4I33A 3LH3A 5E0GA 1HBTH 5C20A 1EZUC 3UWJH 2PTNA 3RXGA 3QZQA 4ABAA 1QBVH 2M5TA 1FUJA 2EI6A 4GUXA 1A4WH 2A4RA 4MTBA 4NA7A 4XBCA 1TX6A 1J9CH 2R0KA 1BB0B 2J2UA 2SGPE 1SGFG 2XBWA 3SUGA 1GCTB 2P3UB 1DFPA 1EAIA 1S83A 2Z9JA 3L6PA 3SN8A 5ESBA 1UVSH 4DG4A 1ELBA 3HGPA 4Y10E 2FI4E 1RGQA 1AVGH 1BMNH 2FM2A 3NPSA 1ZHMA 3GY2A 4IW4E 3SJIA 1O3BA 1OX1A 3MMGA 3V7TA 1O2NA 5A0BA 1YKTA 3HPTB 1HIAB 2AGGX 5AVDA 2A4OA 3O8CA 1O34A 1F2SE 2Y5GA 3E3TA 2ZPSA 2SGFE 3DT0H 3I78A 2C8WB 2HGTH 3S9BA 4TWYA 1P02A 1GCTC 1IHSH 3EYDA 5FPTA 2ZCKP 1UTLM 1V2JT 1RTLA 3DD2H 1DPOA 5J4QA 2GT7A 2W7SA 3PWBA 4B2CA 2NU1E 2HALA 1Z6JH 2OXSA 5EODA 2O8LA 4ISIH 2BM2A 1IQGA 1YPHC 3SZNA 2ZHEH 2AMPA 2F9OA 2ZTXA 1C4U2 5A09A 4KGAA 4I8KA 2VIWA 1Q31A 5GCHF 3SJOA 1YBWA 4RN6A 1C1NA 1NTPA 3KQCA 1FPHH 1TWXB 3TJVA 1GMCG 1MTVA 2OLGA 1C1OA 3K9XB 3S69A 1Z1JA 3RDZA 3MH6A 1G2MA 1YPLH 3STJA 2XNIA 2G8TA 4D9QA 2ZEBA 1O2MA 1LO6A 1PQ5A 1BTHH 2VVVA 1CT4E 2BOKA 1LDTT 2WV5A 5EQSA 5EOKA 2YNAA 3EQ0H 5C1YA 1OPHB 3SGQE 3SU6A 1CO7E 1Y3YA 2B8OH 4E7NA 2R2WU 2G5NA 1AFQB 1DUEA 3T62A 3QLPH 2AH4X 1LPGB 2ZU1A 4YLUA 3RU4D 1ZMJA 4KKDA 4WJG2 1SC8U 2HNTF 3B8JA 3FP6E 2AS9A 7KMEH 3KL6A 5CHAB 4K5ZA 4MNVA 4YLQH 4O9VA 2D26C 2H6MA 5EG4A 1NRRH 1CQQA 2H9EH 2KAIA 1BQYA 2A5AA 4MDSA 4DIIH 1C5RA 2IJOB 3NUMA 7LPRA 4JMYA 4CH8B 1P2QA 2FEQH 2ZQ1A 2WYJA 2XRCA 3SI3H 5LH8A 2FS9A 3ZZ8A 1NM6A 5DG6A 4FUHA 1Z8IB 1D6RA 2PV9B 3AASA 3BTME 3F68H 1AFQC 1E36B 1L0ZA 4OS1A 1O5AB 1H8IH 4ZUHA 1PQ8A 1GI9B 3ZZAA 3RXLA 1DWEH 2FO9A 4Y76A 2HPPH 1P05A 2ZO3H 4I8JA 4AB9A 5CHAC 4R0IA 3RXEA 5DP3A 1ID5H 5LPRA 1GWAA 1PPBH 4MNXA 1QRZA 1MZDA 4ZH8A 2XWBI 5C1XA 1YCPK 1EX3A 4K8YA 2GCTB 4X6PA 2AGIX 1JIRA 1RJXB 3MYWA 3H5CB 3GCHB 1C4Y2 5H4IB 2B0FA 4DW2U 1SGDE 1OWKA 2FLRH 1TA2A 1AFEH 3UUZA 2A5KA 1GJ6A 4GPGA 1TBRH 2Q6FA 3RMMH 2GZ7A 1MCTA 2VIQA 3S7HB 1SI5H 1HAGE 1TGNA 3EDXB 3A88A 1KDQB 1HV7A 3NWUA 2TRMA 1O2WA 2JH6D 3KF2A 4YOIA 2BVXH 4NZQA 4D7GA 3DHKH 4DOQA 2FI3E 1LHEH 1IOEA 2FOHA 1ELTA 2GCTC 3A8BA 3BN9A 4XE4A 2AYWA 2BD8A 3ZYDA 2BQ6B 1CHGA 3TVJB 2RCEA 2ZCLP 1HIAA 1A0HB 3ZZ7A 1E34B 2ZFTA 4D7FA 5J4SA 3GY3A 3IG6B 3W94A 1E38B 1L2EA 2D8WA 1G32B 3ZZCA 4HZHA 4AX9H 2J4IA 1C1PA 2G51A 2XW9A 3L33A 2EI7A 4NCYA 1C5OH 1KIGH 1P8VC 4ABBA 1P3CA 5C5NA 2PKAA 1O5GH 3JZ2B 3M3TA 4IC5A 3TGKE 2OUAA 1QB6A 3ZYEA 4KTCA 1J14A 2BLVA 5GCHG 2Z94A 4OS6A 4TYDA 1VCWA 3PWCA 3SUEA 3D23A 3MNXA 3TJOA 4LZ1H 1O32A 1G2LA 4MPXA 2ZTZA 1W14U 3BTTE 3V0XA 2W26A 1SVPA 3ENSB 4NZLA 1HJ9A 2XXLA 1DE7H 3A82A 4CR9A 4CRDA 1HAOH 2C90B 1SOZA 3UIRA 2P95A 3RXSA 4X0WU 1Y3VA 1C5YB 3T27A 1YCPH 1FJSA 2SNVA 1SQAA 1ACBE 2EC9H 1H4WA 1O35A 1TGCA 3ZVAA 1HAXB 1YPKH 2QXHA 3ZVDA 3UREA 1W7GH 2VNTA 3BTFE 1XM1A 5EW1H 4YESB 1OSSA 1ESAA 2AIPA 3SORA 3VB4A 3QUMP 1GI8B 3SNEA 1N1LA 1J8AA 4X6NA 1O2OA 2I6QA 3LKWA 4NA9H 1UO6A 1ZTLA 2PR3A 3A80A 1YC0A 2PLXA 3P8NA 1WTGH 4A1TA 1D6WA 4NSYA 4MPUA 3M5LA 1QL9A 3SNAA 1P57B 4CRBA 1UTOA 3PMHB 1TNGA 2ZFSA 1IQIA 3A7VA 3LONA 4GAWA 1ESTA 1IQMA 1XKBC 1AQ7A 1UTJA 2BX4A 1WUNH 4MPWA 1EJAA 3LT3A 1D3QB 1LQEA 1OWDA 2BLQA 3ZZ5A 5EQQA 1BDAA 1Y3WA 1QHRB 2PHBA 3E90B 3ATIA 2QA9E 2WYGA 3I77A 5EU8A 5A8ZA 1BRUP 1SQOA 1VJ9U 1MH0A 3KQDA 1C5UA 2A1DB 3ZVBA 2BD2A 2ZA5A 3E91A 3ZZDA 3S0NA 1RRKA 4O97A 1ETTH 4A7IB 3P70B 3S7KB 4JCNA 5T6GA 3OTJE 5JPMH 1FZZA 1C2JA 1TABE 3OYPA 5EW2H 5JB8S 1HAPH 1D3TB 1YPJH 1V2WT 1N6XA 1SBWA 3OX7U 2ZU5A 3VPKA 5K7RA 1UVPA 4ZHAA 4CREA 1DY9A 1QCPA 1O3LA 4NG9H 3RXHA 1BIOA 1DDJA 3A8CA 3V13A 4A6LA 3M7QA 5HM9A 1FAKH 1OOKB 5FCRA 3VFEA 4X8SH 3SOSA 2FZZA 1RTKA 3RXBA 1YPGH 1P10A 2P94A 2VH6A 1LHDH 2A2XH 2TBSA 2BDIA 1UVOA 1O3MA 1W0YH 2UUJB 3A7YA 3BEUA 4K3JA 1THSH 1YCPM 1A0LA 3K6ZA 2LPRA 1UK2A 1O2RA 1B7XB 2CJIA 3K65B 4CH2B 1Y5AT 2HVXA