4ISOA

Crystal structure of matriptase in complex with its inhibitor hai-1
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
241
structure length
241
Chain Sequence
b'VVGGTDADEGEWPWQVSLHALGQGHICGASLISPNWLVSAAHCYIDDRGFRYSDPTQWTAFLGLHDQSQRSAPGVQERRLKRIISHPFFNDFTFDYDIALLELEKPAEYSSMVRPICLPDASHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVIQQTTCENLLPQQITPRMMCVGFLSGGVDSCQGDSGGPLSSVEADGRIFQAGVVSWGDGCAQRNKPGVYTRLPLFRDWIKENTGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Suppressor of tumorigenicity 14 protein
publication title Crystal structures of matriptase in complex with its inhibitor hepatocyte growth factor activator inhibitor-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 57
structure length 241
sequence length 241
ec nomenclature ec 3.4.21.109: Matriptase.
pdb deposition date 2013-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4isoA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4isoA01
4CRDA 1EPTB 4NZLA 3A81A 1SGFG 1KDQB 4LZ4B 2CHAC 3M37A 4MNYA 2RA0A 3MNXA 1QR3E 3RXAA 5EQSA 1UVTH 3PROA 2JH6D 1O3MA 3T5FH 1IAUA 2UUYA 2RCEA 5EOKA 4ASHA 3LGIA 2FESH 1GBLA 2ZKSA 3K9XB 4ABHA 3OTJE 3RXFA 4I31A 1GVZA 3LGUA 4INKA 1ELTA 1SHHB 5LH8A 1BMLA 2BXTH 1WCZA 1O35A 1P09A 1SVPA 4MNVA 1S83A 1C2EA 1G3EA 1GG6B 5DJ7A 3A82A 6CHAB 4Y0ZE 2A4OA 4E7RG 1LVYA 3F9EA 1O39A 4MTBA 2HPQH 4YESB 2OQUA 1E35B 4LK4A 1G2MA 1Z8RA 1LHCH 3VB7A 1ARBA 1BMMH 2FLRH 1SGFA 2QY0B 2A7JA 1F7ZA 1NC6A 1TX6A 2BD4A 1C1OA 3KL6A 1RS0A 4PROA 3UREA 3UTUH 6LPRA 1KXFA 1GHAF 1P01A 1P9UA 2K1QA 4K1TA 1VJAU 5JB8S 2IOTA 2W26A 2ZDKA 3UR6A 2ALPA 3M7TA 3VXEH 5IDKA 3LJJA 5EGMA 1AD8H 1O5CB 2A4GA 2TBSA 1ELEE 1MZAA 4JYUH 3CP7A 1O36A 3SUFA 2UUKB 1NU9A 1P3CA 1V6DA 3L3TA 3MH6A 1P9SA 2VWLA 3RC6A 1AY6H 4JYTA 3G01A 2GDDA 2ZTZA 2A4QA 1C4V2 4SGAE 1O3CA 3FP7E 3ZVGA 1QJ7B 2PSYA 1MH0A 1FLEE 1GHWH 3M3TA 4BTTB 4I8LA 2PFEA 3SJKA 4ABFA 1BMNH 1C1PA 1C2LA 1YPGH 1H8IH 5FPYA 2FODA 1UJ1A 2F9OA 2G5VA 1QA7A 4GHQA 5AHGH 2PW8H 1CO7E 1UTJA 1TA2A 4OS1A 3TK9A 1QHRB 5EPNA 1Z6EA 2NU1E 1TLDA 3BTGE 1EAUA 4JYVH 1BTYA 4WXVA 2AGEX 3SNDA 3A7TA 1O5FH 1YF4A 1DXWA 2PGBB 2Z9KA 3SNEA 1ESTA 2OCVB 2BDBA 7KMEH 1EP6A 2V6NA 4CHAC 2ZDLA 5K0HA 3MTYA 3A84A 1YCPM 4B2BA 1HAYB 1F2SE 1TALA 1O38A 1EKBB 4DJZB 1NS3A 1W7XH 1ABJH 1S81A 1YGCH 3FP6E 4U30A 3TIUA 1UHBB 1SGCA 5EQQA 1XVMA 3ODDA 1G3CA 3WY8A 4I32A 2KAIB 3VB6A 1FV9A 2EA3A 5DPAA 1W3CA 3HKJB 4AZ2B 1ELAA 1GJCB 3SV2H 1TRNA 1OXGA 1LHFH 2F9VA 1GWAA 2GT8A 1P2KA 2Y81A 3A86A 1O5EH 1XUKA 2TGPZ 4CREA 2PTNA 2WPHS 1GJAB 1J9CH 2CMYA 1W8BH 2Y6TA 5C2ZA 2V3OH 3GY2A 2WPIS 3RP2A 3MU8A 1QB9A 3Q00A 5GWZA 1K1JA 2BD8A 1LMWB 1L2EA 2JH5D 2WUCA 1BTZA 3ZYEA 3U9AH 1MBQA 1PPBH 1EX3A 2CJIA 4GVUA 4J1YA 1ELCA 7LPRA 1F0RA 4MLFB 1AHTH 2UWPA 1GGDB 2FI3E 1EB2A 5FCRA 1AFEH 2VVCA 1C5MD 3JZ1B 4F49A 3S7KB 3ZZAA 1O2MA 3M7QA 4WH6A 3TGJE 3PMHB 1SLVB 4JZ1A 3KQEA 1FIZA 2FOAA 4ISNA 2ZPSA 8ESTE 4GCHF 5K7RA 2IPHA 3Q3XA 1BTHH 2IN2A 1UTMA 2ZCKP 3SI4H 1HJ8A 2A5KA 8LPRA 3RXBA 4CBNA 4X6MA 1O3JA 2GGVB 1HLTH 1TNJA 5FX5A 1M9UA 4NCYA 1ZJDA 1VGCC 4SGBE 1O5GH 2G4UA 1RTLA 2FEQH 3BF6H 3ZZ4A 1NRPH 1XUJA 3MH4A 3Q3KA 4ZKSU 5EW2H 2GDEH 3SQHE 3QZQA 1DY9A 5A8XA 1CT4E 3NCLA 5I46H 2FTLE 2BY8X 1FY8E 1O3GA 3BV9B 2BD3A 4Y7BA 5L6NH 2CV3A 1DANH 1FN6A 4B75A 1CU1A 1GL0E 1O34A 5AVDA 2BZ6H 3PLBA 2BTCE 2XBYA 3RXPA 2ZCLP 2ZHQH 3VB5A 4I8KA 4X2XA 2ZU1A 1CHOG 1MTNC 1XKAC 3SJOA 1S6HA 1LCYA 1C5LH 2ZHWH 3RUOA 3BTWE 4R8TB 1VZQH 1E36B 1QBNA 2ZHEH 1Q31A 1UCYK 1HRTH 2A1DB 5GCHF 1V2QT 5EXNA 2QIQA 1DE7H 1C5YB 1ZSKA 1AVGH 5BPEA 2HVXA 1K21H 3OSYA 3TH2H 2C4FH 2ZDAH 2XBVA 3H5CB 1K1LA 1P11E 5FCKA 2Y82A 1SLXB 3MI4A 1QA0A 1BBRE 1OWHA 3LC3A 2OBQA 5C5OA 1O30A 3UWJH 1OSSA 4HZHA 3RXEA 3DFJA 4WY3A 2EI6A 3PO1B 1C5XB 1C1QA 1ELGA 1YKTA 4WH8A 1A5GH 1J14A 2P95A 4WWYA 2GTBA 2HGTH 1GMCF 1VJ9U 1O2OA 4B2AA 3K6YA 1GJ4H 2VIVA 3SZNA 1P02A 1UVPA 1ZTKA 3GCHB 2VIQA 1NRQH 7GCHG 1P2QA 1GMHF 1FI8A 1UCYE 1HAVB 1N6XA 2B8OH 4X8SH 2VNTA 1A3EH 5T3HA 5EXMA 3KIDU 1ZJKA 1UO6A 1CSOE 1FPHH 1A4WH 1P2NA 3PM3A 2BD9A 2CN0H 3SV6A 4Q7ZA 4U32A 1C2DA 1YPHC 1SOZA 1HB0B 1A0HB 1BUIA 3LU9B 3EE0B 3TJUA 3PB1E 4CRFA 1H4WA 4ZKNU 5ETXA 1KSNA 2QAAA 2PKAA 1LDTT 3BTDE 1OWDA 1VCWA 1CQQA 3P8OA 2QCYA 1S85A 2G55A 5CE1A 4CR5A 4TWWA 1DWBH 1NTPA 1TAWA 2H5CA 1OS8A 2QV1A 1TPAE 4BANB 1WBGB 4ISLA 1GHXH 3SHAH 2GCTC 1BRBE 3GY7A 1G37A 3K2UA 1AGJA 2EI7A 5DGJA 4CRBA 1O3LA 2GZ8A 1YBWA 1O2XA 2VIOA 3D62A 3BN9A 2LNCA 2H6MA 2FI5E 2GZ9A 3MO3A 1TX7A 3UNRA 5GIBA 2FWWA 3U1IB 1THSH 4O9VA 4ZMAH 2AS9A 5HYOA 2P93A 2C3SA 2PTCE 2FOEA 3BTEE 2VH0A 1RIWB 1N6YA 1GI8B 2V35A 1SLWB 1KTSB 4A7IB 1V2TT 1G3BA 1MTUA 4HI3A 4ESTE 2AGGX 4HTCH 2NU2E 1QB6A 2O8UA 1C1SA 2FS9A 3GY5A 3RU4E 3F6UH 1GJDB 1CBWB 2ZEBA 1MKWH 4FUHA 4JK6A 3CENA 3RU4T 3HK6B 4BXSA 1JMOH 1EZSC 2WYJA 3PTNA 2BVXH 2A32A 4DIIH 1C5WB 5HMAA 1SQTA 1SGYE 4DG4A 1FJSA 1KDQA 1AFQB 2AMDA 5FHTA 2G5NA 3NUMA 3SN8A 1PQ8A 2ANYA 4K8BA 3DHKH 1K28D 2P3UB 3GY4A 5F8TA 1SGDE 1C1UH 1WTHD 1IQEA 4FUBA 3TJNA 3URCA 1TWXB 3S69A 3TLOA 5JBTA 2OQ5A 2UUFB 1BOQA 3SNAA 1GI6A 5FPTA 5C1UA 4X1QU 4BAKB 4ABBA 1GJ5H 3U69H 2QXGA 8GCHF 5DP6A 2BQ6B 1QNJA 2ZCHP 3URDA 1GHYH 9ESTA 1O3HA 3BG8A 1F5LA 3DA9B 5DK1A 4H6TA 2PKSB 1C5ZB 4Z6AH 3OY5U 2BLWA 3TJVA 4I8GA 4Y8ZA 1WSSH 5H4IB 3GY8A 2AH4X 1C2GA 2XTTB 1NO9H 1O32A 3A8CA 3GCNA 1FXYA 4IS5A 1K1IA 2GP9B 1O3NA 1MU8B 2BOKA 1NY22 2ANWA 2VIWA 1HNEE 3RDZA 3Q76A 2Y7ZA 1HJAB 1CA0C 1Y8TA 2ZZUH 3ATWA 2CHAB 2SFAA 1PPZA 4JCNA 3V3MA 3M36A 4ZROA 5HGGA 3VFEA 3VPKA 4RKOB 1C1NA 3B9FH 3EDXB 1B5GH 4VGCB 2TRMA 5F03A 1EJMA 1GI0A 4DIHH 1RTFB 3M5NA 1TNHA 4QT8C 4YT7H 1DT2A 1XUGA 5C5NA 1DVAH 2ZFQH 3P95A 5C67A 1BA8B 1HDTH 1X7AC 2V3HH 1AUTC 1JOUB 3UOUA 3KGPA 1AO5A 4O97A 4OS6A 2AERH 1DX5M 1QRXA 1DITH 2H9HA 2VJ1A 1AN1E 3P17H 2OP9A 4ZAEA 3UNSA 4IW4E 3ZZBA 2ZTXA 2BYAX 1SL3A 1O2UA 1FN8A 3BEUA 1L4ZA 2R0KA 1GBBA 1WYKA 2AEIH 4AOQA 4E06H 2AYWA 2FYQA 1CT2E 1GHAG 3MH5A 4ABDA 4YOGA 3TVJB 2Z7FE 3UFAA 3ATIA 4X1NU 3GDSA 1G32B 2BZAA 3A7XA 4U01A 2PSXA 2EC9H 1S0QA 3ZVFA 1QY6A 3NK8A 4ISHH 2ZPRA 1F0TA 2WV5A 1KTTB 1V2NT 2G4TA 1OWJA 1BDAA 4XBCA 3ZZCA 1UHBA 4TWYA 2ZP0H 2BDAA 2W7UA 2KAIA 1DSUA 2O9QA 2AMPA 1F0SA 2BD7A 1O3AA 2CXVA 3RXLA 2ZFSA 1V2LT 2QYIA 1BB0B 1MQ6A 2R2WU 3RU4D 1MCVA 4DURA 2J38A 3N7OA 3BIVH 4UDWH 2OXSA 5FBIA 4DCDA 1BQYA 3OX7U 4M7GA 4O3TA 3ZVCA 3AASA 3ELAH 1A46H 2FO9A 5FBEA 1VITF 2ZECA 3GICB 1JIRA 4NZQA 1J17T 1O2JA 4FUDA 1PPGE 3CS0A 1Y3WA 4ISIH 1HAOH 4K69A 1SB1H 1RXPA 2ZPQA 1O2WA 2TGAA 3SUEA 1TPPA 2J4IA 1GHBG 3SORA 4CHAB 5J4QA 2VGCC 3GY6A 5EODA 4AG1A 2QC2A 2Z6BD 3W95A 1FMGA 5FPSA 2H9EH 3RC5A 2G81E 2ZF0H 5JBBS 3LGWA 1TE0A 3KCGH 2FMJA 3STJA 1AVXA 3E16B 4NSYA 5CHAB 1ZTJA 2ASUB 2ZIQH 1ZSLA 3SUGA 4XE4A 4AB8A 1QRWA 1W13U 3UQVA 2I6SA 1RGQA 1HAGE 2PUXB 2P3FH 1FY1A 4A92A 4UFDH 1O5DH 1TIOA 2BD5A 2BLQA 1OKXA 4FVBA 5E2PA 4CRCA 4UFEH 1Y3XA 2TIOA 3GCOA 1MKXK 4MPWA 5A09A 1AUJA 1EZQA 1L0ZA 1HGTH 2TGTA 4ZKOU 1AI8H 2XCNA 3NZIA 2ILNA 3LC5A 2G00A 5ESTE 2AIPA 1GDUA 1P04A 1THRH 2FLBH 2WPJS 1SC8U 2EI8A 3BG4C 1FUJA 1SGTA 3V13A 3SGQE 1LTOA 4AFSA 2ULLA 1PFXC 1ESBA 4X2VA 3RXMA 2YNAA 3SBKA 1Y3YA 2ZHDA 1O3EA 2RA3A 4OGYA 4GCHG 2C8XB 1W10U 5DP4A 3QGJA 2PGQB 4KELA 1HUTH 2W5EA 1JIMA 3UPEA 1O2GH 2FI4E 1GMDF 5TCCA 3TH4H 2BLVA 1DXPA 4YTAA 3Q77A 3GISB 1L4DA 3TGKE 1MD8A 1WAYB 1YPHE 4WMFA 3SGAE 2OTVA 1QIXB 1TGTA 1YPKH 1BRAA 3LKWA 1A0JA 4X0WU 4Y0YE 1HXEH 1SOTA 4F4OC 1ELVA 3OU0A 5IYTA 6ESTA 3ITIA 1W2KH 1K22H 1NFXA 2G8TA 2ZNKH 2GKVE 3QGNB 4BAOB 2J9NA 2RG3A 1YLDA 7ESTE 1HAVA 1ZPBA 2J34A 2ZHFH 3QO6A 5A0CA 4Q7YA 1TMUH 1ABIH 1VR1H 3UIRA 1O2NA 4MDSA 4YZUA 1MCTA 2VWOA 2ZWLH 1BRCE 1MZDA 2Z9IA 1PPCE 1AMHA 1K9OE 4J2YB 1XXDA 3RXVA 2GV6A 3PMJA 5GCHG 5J4SA 2DUCA 4AORA 1GG6C 2YNBA 1P2IA 3MMGA 6CHAC 3TJOA 2J95A 4INHA 1OP8A 2Q6DA 5L2ZH 1KLIH 3DFLA 2G52A 3GY3A 2OC1A 1CGJE 1SHYA 1VCPA 3MU1A 1MU6B 4DW2U 1S84A 1C2HA 1K1NA 4Y79A 5DP3A 1XM1A 3QLPH 2FX4A 5A2MH 1THPB 2ODYB 4DY7B 1WV7H 1ZZZA 1SR5C 2BY6X 1HAXB 1GHVH 1Z8IB 4CH2B 3ATKA 2XNIA 4K5ZA 1GMCG 3UWIA 1CA8B 1O33A 1NU7B 1LQEA 1D4PB 2FIRH 3T27A 2BY7X 1GMHG 1GI3A 2R3UA 1EB1H 5JB9S 2C8ZB 1K1MA 1W0YH 1CGHA 2ZGJA 4ZXYH 2FX6A 3LOXA 1LQDB 1TMBH 4WMEA 4Y8XA 3MOCA 4IGDA 1ACBE 2O8TA 3T26A 1T8NA 2A5IA 4NA8A 4Q7XA 3KQCA 1O5BB 3UUZA 2ANKH 1EJAA 4GAWA 2P8OB 1IQGA 3NPSA 4ZXXH 3SJ8A 4D7GA 2GVFA 2I6QA 3TU7H 3A7YA 4KTCA 1Z71A 4WF8A 1TA6A 4O03A 1KY9A 1JWTA 3FFGA 4RSPA 1DWDH 2VVUA 3KHVA 4Y7AA 1BBRK 3A85A 1C1WH 1SQOA 3ZZ5A 1QL7A 1PPEE 2Y5FA 2A2QH 2IJOB 1OX1A 2GCTB 1QGFA 1YLCA 3IG6B 1E37B 1ZTLA 2A7CA 4BAMB 2QXHA 1OYQA 1SG8B 1B7XB 1V2OT 1HCGA 2THFB 1KXCA 1GCTB 1TQ0B 3M3VA 3SU0A 1C1MA 2NWNA 1AWFH 1EOJA 2SGPE 3KQBA 4FU8A 4UFGH 2Z94A 2F9UA 1PPFE 3E8LA 5SGAE 1KXBA 1IQHA 1O0DH 3R0FA 1INCA 1Y5AT 3RXGA 2UWOA 1EASA 5ESBA 4ZHAA 3SNCA 1MTSA 3RMOH 1A5HA 3OYPA 1PQAA 3NKKA 5JBAS 2XBWA 4Y11E 1FONA 3SI3H 5DG6A 3SU3A 4X2YA 1YCPK 4ZHLU 3FAOA 4DOQA 1AZ8A 3R3GB 2GZ7A 3A7ZA 2ZO3H 1TYNA 3RXIA 1WOFA 1C5SA 2BHGA 1XXFA 2F3CE 1S5SA 1Y3UA 3SU6A 5GPIB 4AGJA 1BZXE 3M35A 4BTIB 3QN7A 4MNXA 6GCHG 1UTNA 2WPKS 4UFFH 3F68H 1O2PA 1D3TB 3AW1A 2P3TB 1A3BH 4XFQA 4A6LA 2OD3B 2R0LA 4THNH 4Y6DA 5GXPA 1IQFA 3FP8E 1NPMA 1GGDC 3MYWA 4YLUA 4MPVA 1C2KA 4AYVB 3AAVA 1WQSA 5L30H 9LPRA 4NIXA 1TRYA 1BMAA 4GPGA 4DVAU 3OY6U 1GI7B 4TYDA 3L33A 3QDZB 3ODFA 5GJ4B 2Q1JA 1DDJA 5JBCS 1NFYA 3V0XA 3VB4A 1JBUH 4TY7A 1O2SA 3H7TA 2JETC 1JXPA 3PWBA 4B73A 1TNKA 1ANBA 1GL1A 1AB9B 4B1TA 4ABGA 1EZXC 1L1JA 3GCTF 1AE5A 1J15A 1ZR0A 3EAJA 3DD2H 4X6NA 3S9BA 1DS2E 4NSVA 2ZDVH 1CGIE 1N8OB 2H9TH 1S82A 4R0IA 2H5DA 4ABIA 3C27B 2F9PA 1HXFH 2WV4A 4MG3A 1SFIA 1ZRKA 1GVLA 1ZRBA 2FTMA 3HPTB 3FZZA 3MU4A 1MBMA 2D1JA 1RFNA 3SQEE 3ZYDA 2DE8A 2R3YA 1YPEH 1V2ST 3LDXH 4IN2A 2SNVA 1P0SH 4FU9A 1QQ4A 3KEEA 4E05H 1QFKH 3M61U 1GBTA 1H9IE 4ZKRU 4WMDA 1OP0A 1P03A 1N1LA 2GMTB 3D49H 4KP0A 1GBMA 3SO3A 2ZTYA 5F6MA 1TRMA 4ZUHA 5A8YA 1SMFE 3M7UA 1KLJH 3AVZA 3A89A 3VGCB 3LH3A 1KXEA 1DUEA 3RM2H 1EPTA 1TOCB 3V12A 1SBWA 1QURH 1C1RA 1KXDA 3MU5A 3PO1C 1P3EA 3MH7A 1G9IE 2PWXA 3A83A 1AQ7A 1LPKB 4IMQA 3H7OA 2OUAA 1UVSH 1BRUP 1P2JA 2CF9H 3MO6A 1SGEE 5FXLA 3GCHC 1C5NH 1O37A 2VINA 1BJVA 1YPJH 3RMNH 1QBVH 3I78A 4AFZA 1ZMJA 1ANEA 3HKIB 2EEKA 3KF2A 4AN7A 2J94A 1PYTC 4AB9A 4NWLA 3A7WA 3P8GA 3ENSB 1XUHA 2B7DH 1VITH 4ZH8A 3HK3B 3P8FA 2F9NA 3S0NA 1HAPH 2BLOA 5C1YA 1UTPA 3ZZDA 1LVBA 1HJ9A 4CR9A 1K1OA 4RN6A 2Z3CA 2BDGA 1GBEA 1O31A 1CVWH 4X1SU 5C3NA 1DICA 2FP7B 4GSOA 2BX3A 1G36A 1VITG 1NZQH 1ZPCA 1BT7A 1ELDE 2ZFFH 1TGNA 2Z9JA 3ATMA 2NU0E 4TPIZ 2GD4B 3STIA 1TOMH 3F9FA 1NFWA 2SGQE 2XW9A 2Z3EA 1V2RT 2VGCB 1Z6JH 1NRNH 2QXIA 1TABE 1W11U 1AU8A 4HFPB 3TK6A 1FY5A 2FDAA 1FY3A 4D9RA 1T32A 1H9HE 1AKSB 1P05A 1WQVH 1QQUA 1P12E 1HIAB 4ISOA 1DUAA 3L6PA 2R9PA 3BSQA 1UVOA 3MNBA 5I25A 4E7NA 1GI9B 4FUJA 2BB4A 2A5AA 1AZZA 1Z8JB 1QBOA 2ZU3A 3PWCA 1T31A 3BTFE 3HGPA 4B2CA 1CBWC 1E38B 3SV9A 1YC0A 3QZRA 1NN6A 3I29A 2WUBA 2JH0D 2QN5T 3LPRA 3TNTA 3EA8A 1AIXH 1L1NA 1NM6A 3PLPA 1WUNH 2FOHA 1HAZB 1DLEA 1TBQH 3O8BA 1AFQC 5AFYH 4IBLH 4ZHMU 3BG4B 2P16A 1GVKB 1GI1A 1MKXH 3RXHA 1E0FD 4B71A 1C5OH 1T8MA 4O3UA 2ZQ1A 2ZDMA 1UK2A 4NWKA 1LVOA 1QL8A 1BTUA 1VCQA 1O2QA 1ZHPA 2QF0A 5L2YH 1DPOA 3UOPA 2SGAA 2BDIA 4K8YA 3MNCA 4Y71A 4ABAA 1OP2A 3M3SA 2O8LA 3QTOH 1V2PT 1UTOA 3RC4A 3A8AA 1Z1IA 1SGIB 3S9AA 2ZGXH 1GMDG 2XC4A 4GHTA 3A7VA 2Z3DA 4NFEA 1Z1JA 1S0RA 2PHBA 1QJ1B 1TGCA 3SOSA 3RXJA 1GJBB 4JZIA 3BTME 3LH1A 4WXIA 5FAHA 2Z9GA 1IHTH 4Q2KA 1D3PB 1O2LA 3DUXH 3RXQA 4X2WA 2O8WA 4LZ1H 4A5TS 2AMQA 1HJAC 4I8JA 2M5TA 2C90B 1Y3VA 2VU8E 3ZV8A 2GT7A 3ZZ8A 1Q3XA 1A0LA 2HOBA 4TPYA 1O2KA 4VGCC 1U6QA 2O8MA 1EATA 2ZQ2A 3QX5H 1GBHA 1C2FA 2BY5X 2B5TB 2HPPH 1PQ7A 5DO4H 2WINI 1WTGH 4XOJA 1PPHE 4FUGA 2CGAA 3SU2A 2B0FA 3IWMA 1O2RA 1P57B 1BITA 1XMNB 1V3XA 3P8NA 3SJIA 1QL9A 4MQAA 4OS4A 5F8ZA 5EW1H 1TPSA 1SFQB 1C5TA 2FOFA 3MWIU 1LO6A 4KGAA 2A4RA 3O8CA 2D26C 3B8JA 4JK5A 1Z8GA 4YLQH 1RRKA 1KYNA 4D76A 4IN1A 1Y5UT 4UE7H 1LHEH 5JYIA 1P8VC 4I7YH 5C20A 4OGXA 1SQAA 1B0FA 4IC6A 5C1XA 1UK4A 3EA9A 4YOIA 1O2IA 3ZV9A 3SU4A 4D7FA 1RD3B 1C9TA 3P92A 2Y5HA 1GJ7B 1XKBC 3A8BA 1NROH 4DT7B 1G2LA 1ETSH 2ALVA 1C4U2 2ODQA 1VGCB 2VVVA 1QRZA 2VWNA 1ZPZA 3LGTA 2BDCA 5B6OA 2W7SA 4GUXA 3TNSA 1D3QB 1DM4B 3EQ0H 1ZGVA 2BMGB 1ETTH 2HNTC 1GHZA 3W94A 4NA9H 1WU1A 1ZGIA 2GCHF 1KXAA 5EU8A 3BEFB 3CS7A 3RMMH 5A0AE 1LVMA 1V2WT 3K6ZA 5LPFA 3GDUA 2FOGA 5T6FA 2ZA5A 1EPTC 2XYAA 5F8XA 4H6SB 1H9LB 1O3FA 1EQ9A 4XDEA 3E6PH 1TQ7B 3UQOA 3RMLH 1EJNA 3PTBA 4X8VH 2ZGCA 2G51A 4K2YA 3ZVDA 1MTNB 2ZGBH 1GHBF 1OYTH 2BVSH 2VH6A 5LPRA 1O2HA 1H1BA 4BAQB 1TMTH 3BTTE 4IC5A 1BBRH 3M5MA 3SU1A 2Z9LA 3BIUH 2TGDA 4IMZA 5T6DA 3NWUA 4FXGH 1LPGB 3RM0H 1ZLRA 3E1XB 1T8OA 4Z0KA 4AGKA 2FOBA 1L1GA 1A1RA 1FY4A 2XBXA 3M5OA 1TNLA 3ZVEA 1V2JT 3HATH 1QB1A 5GDSH 1Z7KA 2DE9A 5CHAC 1FIWA 1FPCH 3NXPA 4OS7A 4DGJA 4X8UH 3A88A 1UCYH 2OINA 3SUDA 4MPUA 1W14U 3BTHE 1EZUC 1DWEH 5EG4A 1FZZA 1GBCA 1A5IA 2WYGA 2ZU5A 3U8OH 3E3TA 4HGCA 1B0EA 2Y5GA 4CRAA 1C5QA 1LKAA 5TCAA 4NFFA 1J16A 3SHCH 3T62A 1SPJA 1GJ8B 4RKJB 5E8EH 2GX4A 2FOMB 1GJ9B 1S6FA 2BQ7B 1YCPH 3RXDA 2BDHA 4XBDA 2SGEE 2H2ZA 2ZDNA 5E2OA 1HPGA 1QJ6B 1UVUH 1QTFA 1OWKA 1OOKB 3DT0H 1HAHH 3KNXA 1C4Y2 1ZMNA 1BTXA 3T25A 5HXFA 3VB3A 2CF8H 3VEQB 4MPXA 4AFUA 4A1VA 3MO9A 4X8TH 1G3DA 3QTVH 5JPMH 1F5KU 1O3KA 1P2OA 2AGIX 4X6OA 4YO9A 4MNWA 2VIDA 2XWAA 2FOCA 1GBAA 4I8HA 1V2UT 5A0BA 1HFDA 1MTVA 3BTQE 1BHXF 1UTLM 2HALA 1Y5BT 2B9LA 2QA9E 1ESAA 2JETB 8KME2 4K3JA 2TPIZ 3K65B 2ANMH 2XC0A 3ZZ3A 2ZFRH 3GCTG 4FU7A 4UEHH 4B76A 4NG9H 3U98H 3U8TH 2FPZA 4D9QA 2OLGA 1O3BA 1DY8A 4B74A 3SU5A 2RDLA 1CT0E 1KLTA 3HGNA 1AVWA 4Y76A 1P2MA 1T8LA 1TGSZ 1AE8H 3E90B 3O8DA 1GBIA 3MFJA 4H4FA 4MVNA 4Y8YA 1TNGA 1FAKH 1O2ZA 1P06A 5EXLA 1NFUA 2V0BA 3M5LA 2F83A 2FXRA 3QK1A 2PV9B 5DP9A 3E0PB 2GV7A 3UR9A 5PTPA 3GYMA 1OPHB 1GPZA 3ZVBA 1CHGA 1UTQA 4KTSA 1C5VA 1GBFA 1TNIA 3T28A 2F9BH 3UY9A 1IOEA 4UONA 1DFPA 3TGIE 1GBKA 1C1VH 3A87A 1BTPA 2ZG0H 3E0NB 5HM2A 4D8NA 3AAUA 4BNRA 3D23A 3SNBA 3RLWH 5DP7A 1MAXA 1LHDH 1MUEB 1TPOA 1FDPA 1T4VH 3B23B 1IQMA 4Q80A 2ZFTA 1SGQE 2J2UA 2BX4A 5HM9A 3MHWU 1GCDA 1AWHB 2QXJA 1W0ZU 4BXWA 3RXRA 1JRTA 1UK3A 2R2MB 2ZC9H 1SGNE 1OWIA 4OS5A 5E0GA 3KQDA 2PUQH 3PV4A 3RXUA 3ZVAA 3F9GA 4FVDA 3SV8A 1AKSA 1O2TA 4X1PU 5TJXA 3SW2B 3RXKA 1HIAA 4K1EA 8GCHG 1BHXB 4KTUA 1K2I1 4JZDH 1ORFA 2OBOA 1TX8A 3EA7A 2FYRA 1TBZH 2C8WB 1MTWA 2P8OC 3A8DA 2STBE 2HRVA 3MU0A 1NRRH 2XRCA 4FUEA 1J8AA 1BTWA 3LGYA 4FUIA 2ODPA 4K60A 2H1UA 1XVOA 1TB6H 2BOHB 3UNQA 1ZYOA 2FS8A 1FQ3A 1CA0B 2P59A 3P6ZB 3PMBB 2BXUH 4CH8B 1G30B 3S9CA 4FUFA 2SNWA 4CRGA 1C2JA 2VIPA 1GJ6A 3GYLB 4X1RU 2JKHA 3PMAB 3GDVA 1TGBA 2LPRA 4LXBH 4JZEH 5CMXH 1SGPE 2ZU4A 1IHSH 2A7HA 1CHOF 3KN2A 3RXTA 1F92A 2AIQA 1GCTC 2ZI2H 3E91A 4KKDA 3LJOA 3LONA 1PQ5A 2YOLA 1F0UA 1O3DA 5LGOA 2Y7XA 3MNSA 1JRSA 2ZGHA 2P94A 2BVRH 3ESTA 2QF3A 5E0JA 1ID5H 4NIWA 2BY9X 2HWLB 1ARCA 1ELFA 1PYTD 1C2IA 1YM0A 2VB0A 5T6GA 1SLUB 5JDUB 3GOVB 2A0QB 2QGRA 1MAYA 3TK5A 4A1XA 1T7CA 3V7TA 1C5UA 1ZHMA 1TONA 4NIVA 1DLKB 2BD2A 1EOLA 5EPYA 2D8WA 1MMJN 3FVFB 3JZ2B 3Q3YA 2BM2A 2FZZA 2A45B 4AG2A 3RXSA 2SGDE 1GDQA 6GCHF 1D6RA 4YM9A 7GCHF 1A7SA 1NESE 3P70B 1OWEA 1D9IA 4AX9H 1EAWA 1GDNA 1YYY1 4YT6H 1NT1A 3AW0A 5A8ZA 1PJPA 1SGRE 1HBTH 4NA7A 1ETRH 1TBRH 5AF9H 1KIGH 4UD9H 3RXOA 1EUFA 1F5RA 2A31A 3FANA 1V2MT 1XUIA 4ABJA 2Q6FA 3ATLA 1ZSJA 5DP5A 4WVPE 2XCFA 1P10A 1GI4A 2Q6GA 3S7HB 2NU4E 1ELBA 4ABEA 1CE5A 5DP8A 1ANCA 2C93B 1RJXB 2STAE 3RXCA 4JZFH 3TH3H 5BRRE 1C5PA 1UTKA 1BCUH 2WPMS 1C2MA 1MQ5A 3ZZ9A 1C1TA 1YP9A 3EYDA 1O3PB 3T2NA 1O5AB 2NU3E 4FUCA 1AB9C 2HNTF 2ZFPH 1IQJA 1IQIA 1LKBA 2UWLA 3IITA 1IQKA 1LHGH 1O3OA 5DKMA 1D6WA 2HNTE 5FX6A 1N8OC 4K1SA 1E34B 2A2XH 5E0HA 5ABWA 1O2YA 1ZOMA 4AFQA 1IQNA 3RLYH 1ANDA 4NGAH 4Y10E 3U8RH 1A2CH 2XC5A 3SGBE 4BTUB 4GLYA 2HLCA 4AYYB 1EAXA 3EGKH 3U1JB 1RIWC 5EQRA 4XSKU 1DWCH 1MKWK 1ZHRA 4WJG2 5AFZH 4CBOA 4X6PA 1C5RA 1Q2WA 1TFXA 4A1TA 1O2VA 1NRSH 5G4BA 2PKAB 1MD7A 3TPIZ 1UMAH 2GMTC 2XWBI 2C8YB 1GBDA 1H8DH 1SSXA 2Y80A 1HAIH 1V2VT 2J92A 1YPLH 4H42U 2SGFE 4I33A 4OS2A 2OC7A 3VGCC 2VWMA 3FZDA 3VXFH 1BIOA 3QWCH 1D3DB 1GBJA 4BAHB 3SJ9A 3F1SB 5LPEA 2W3KA 3ZZ7A 1DSTA 3BTKE 1A61H 3ZZ6A 3T29A 3LT3A 4INLA 2ZU2A 2BDYA 1O3IA 4JMYA 1QCPA 1FAXA 3D65E 4BOHA 4NIYA 3PYHA 1Y59T 1XUFA 1W12U 1GI5A 2OC8A 2W3IA 3BEIB 4TY6A 1IQLA 2WPLS 1YPMH 1SI5H 1W7GH 3A80A 1EAIA 2BQWB 1BJUA 3I77A 1C9PA 3LIWA 4LOYH 2XXLA 1K1PA 3QUMP 3LGVA 2D2DA 2OC0A 1DOJA 1ZMLA 1HV7A 3PLKA 2PR3A 3TITA 2PKSC 3C1KA 1HYLA 1T4UH 2FM2A 1FNIA 1GI2A 2F91A 2ESTE 1RTKA 3O8RA 1EP5A 4XBBA 1LPZB 1XX9A 4YOJA 3SV7A 1V2KT 1EXFA 3F9HA 2UUJB 2AFQB 2GCHG 4U2WA 2PLXA
chains in the Genus database with same CATH superfamily
4CRDA 1EPTB 4NZLA 3A81A 1SGFG 1KDQB 4LZ4B 2CHAC 3M37A 4MNYA 2RA0A 3MNXA 1QR3E 3RXAA 5EQSA 1UVTH 3PROA 2JH6D 1O3MA 3T5FH 1IAUA 4M9FA 2UUYA 2RCEA 5EOKA 4ASHA 3LGIA 2FESH 1GBLA 2ZKSA 3K9XB 4ABHA 3OTJE 3RXFA 4I31A 1GVZA 3LGUA 4INKA 1ELTA 1SHHB 5LH8A 1BMLA 2BXTH 1WCZA 1O35A 1P09A 1SVPA 4MNVA 1S83A 1C2EA 1G3EA 1GG6B 5DJ7A 3A82A 6CHAB 4Y0ZE 2A4OA 4E7RG 1LVYA 3F9EA 1O39A 4MTBA 2HPQH 4YESB 2OQUA 1COWD 1E35B 4LK4A 1G2MA 1Z8RA 1LHCH 3VB7A 1ARBA 1BMMH 2FLRH 1SGFA 2QY0B 2A7JA 1F7ZA 1NC6A 1TX6A 2BD4A 1C1OA 3KL6A 1RS0A 4PROA 3UREA 3UTUH 6LPRA 1KXFA 1GHAF 1P01A 1P9UA 2K1QA 4K1TA 1VJAU 5JB8S 2IOTA 2W26A 2ZDKA 3UR6A 2ALPA 3M7TA 3VXEH 5IDKA 3LJJA 5T1VA 5EGMA 1AD8H 1O5CB 2A4GA 2TBSA 1ELEE 1MZAA 4JYUH 3CP7A 3F2HA 1O36A 3SUFA 2UUKB 1NU9A 1P3CA 1V6DA 1YLNA 3L3TA 3MH6A 1P9SA 2VWLA 3RC6A 1AY6H 4JYTA 3G01A 2GDDA 2ZTZA 2A4QA 1C4V2 4SGAE 1O3CA 3FP7E 3ZVGA 1QJ7B 2PSYA 2WV9A 1MH0A 1FLEE 1GHWH 3M3TA 4BTTB 4I8LA 2PFEA 3SJKA 4ABFA 1BMNH 1C1PA 1C2LA 1YPGH 1H8IH 5FPYA 2FODA 1UJ1A 2F9OA 2G5VA 1QA7A 4GHQA 5AHGH 2PW8H 3OEED 1CO7E 1UTJA 1TA2A 4OS1A 3TK9A 1QHRB 5EPNA 1Z6EA 2NU1E 1TLDA 3BTGE 1EAUA 4JYVH 1BTYA 4WXVA 2AGEX 3SNDA 3A7TA 1O5FH 1YF4A 1DXWA 2PGBB 2Z9KA 3SNEA 1ESTA 2OCVB 2BDBA 7KMEH 1EP6A 2V6NA 4CHAC 2ZDLA 5K0HA 3MTYA 3A84A 1YCPM 4B2BA 1HAYB 1F2SE 1TALA 1WDIA 3AK5A 1O38A 1EKBB 4DJZB 1NS3A 1W7XH 1ABJH 1S81A 1YGCH 3FP6E 4U30A 3TIUA 1UHBB 1SGCA 5EQQA 1XVMA 4P02A 3ODDA 1G3CA 3WY8A 4I32A 2KAIB 3VB6A 1FV9A 2EA3A 5DPAA 1W3CA 3HKJB 3OTPA 4AZ2B 1ELAA 1GJCB 3SV2H 1TRNA 1OXGA 1LHFH 2F9VA 1GWAA 2GT8A 1P2KA 2Y81A 3A86A 1O5EH 1XUKA 2TGPZ 4CREA 2PTNA 2WPHS 1GJAB 1J9CH 2CMYA 1W8BH 2Y6TA 5C2ZA 2V3OH 3GY2A 2WPIS 3RP2A 3MU8A 1QB9A 3Q00A 5GWZA 1K1JA 2BD8A 1LMWB 1L2EA 2JH5D 2WUCA 1BTZA 3ZYEA 3U9AH 1MBQA 1PPBH 1EX3A 2CJIA 4GVUA 4J1YA 1ELCA 7LPRA 1F0RA 4MLFB 1AHTH 2UWPA 1GGDB 2FI3E 1EB2A 5FCRA 1AFEH 2VVCA 1C5MD 3JZ1B 4F49A 3S7KB 3ZZAA 1O2MA 3M7QA 4WH6A 3TGJE 3PMHB 1SLVB 4JZ1A 3KQEA 1FIZA 2FOAA 4ISNA 2ZPSA 8ESTE 4GCHF 5K7RA 2IPHA 3Q3XA 1BTHH 2IN2A 1UTMA 2ZCKP 3SI4H 1HJ8A 2A5KA 8LPRA 3RXBA 4CBNA 4X6MA 1O3JA 2GGVB 1HLTH 1TNJA 5FX5A 1M9UA 4NCYA 1ZJDA 1VGCC 4SGBE 1O5GH 2G4UA 1RTLA 2FEQH 3BF6H 3ZZ4A 1NRPH 1XUJA 3MH4A 3Q3KA 4ZKSU 5EW2H 2GDEH 3SQHE 3QZQA 1DY9A 5A8XA 1CT4E 3NCLA 5I46H 1MABB 2FTLE 2BY8X 3WW7A 1FY8E 1O3GA 3BV9B 2BD3A 4Y7BA 5L6NH 2CV3A 1DANH 1FN6A 4B75A 1CU1A 1GL0E 1O34A 5AVDA 1YWUA 2BZ6H 3PLBA 2BTCE 2LELA 2XBYA 3RXPA 2ZCLP 2ZHQH 3VB5A 4I8KA 4RT1A 4X2XA 2ZU1A 1CHOG 1MTNC 1XKAC 3SJOA 1EFRD 1S6HA 1LCYA 1C5LH 2ZHWH 3RUOA 3BTWE 4R8TB 1VZQH 1E36B 1QBNA 2ZHEH 1Q31A 1UCYK 1HRTH 2A1DB 5GCHF 1V2QT 5EXNA 2QIQA 1DE7H 1C5YB 1ZSKA 1AVGH 5BPEA 2HVXA 1K21H 3OSYA 3TH2H 2C4FH 4F55A 2ZDAH 2XBVA 3H5CB 1K1LA 1P11E 5FCKA 2Y82A 1SLXB 3MI4A 1QA0A 1BBRE 1OWHA 3LC3A 2OBQA 5C5OA 1O30A 3UWJH 1OSSA 4HZHA 3RXEA 3DFJA 4WY3A 2EI6A 1VKYA 1C5XB 3PO1B 1C1QA 1ELGA 1YKTA 4WH8A 1A5GH 1J14A 2P95A 4WWYA 2GTBA 2HGTH 1GMCF 1VJ9U 1O2OA 4B2AA 3K6YA 1GJ4H 2VIVA 3SZNA 1P02A 1UVPA 1ZTKA 3GCHB 2VIQA 1NRQH 7GCHG 2JDID 1P2QA 1GMHF 1FI8A 1UCYE 1HAVB 1N6XA 2B8OH 4X8SH 2VNTA 1A3EH 5T3HA 3DSOA 5C17A 5EXMA 3KIDU 1ZJKA 1UO6A 1CSOE 1FPHH 1A4WH 1P2NA 2KR7A 3PM3A 2BD9A 2CN0H 3SV6A 4Q7ZA 4U32A 1C2DA 1YPHC 1SOZA 1HB0B 1A0HB 1BUIA 3LU9B 3EE0B 3TJUA 3PB1E 4CRFA 1H4WA 4ZKNU 5ETXA 1KSNA 4XRNA 2QAAA 2CK3D 1LDTT 2PKAA 3BTDE 1OWDA 1VCWA 1CQQA 3P8OA 2QCYA 1S85A 2G55A 5CE1A 4CR5A 4TWWA 1DWBH 1NTPA 1TAWA 2H5CA 4TSFD 1OS8A 2QV1A 1TPAE 4BANB 1WBGB 4ISLA 1GHXH 3SHAH 2GCTC 1BRBE 3GY7A 1G37A 3K2UA 1AGJA 2EI7A 5DGJA 4CRBA 1O3LA 2GZ8A 1YBWA 1O2XA 2VIOA 3D62A 3BN9A 2LNCA 2H6MA 2FI5E 2GZ9A 3MO3A 1TX7A 3UNRA 5GIBA 2FWWA 3U1IB 1THSH 4O9VA 4ZMAH 2AS9A 5HYOA 1OHHD 2C3SA 2P93A 2PTCE 2FOEA 3BTEE 2VH0A 1RIWB 1N6YA 1GI8B 2V35A 1SLWB 1KTSB 4A7IB 1V2TT 1G3BA 1MTUA 4HI3A 4ESTE 2AGGX 4HTCH 2NU2E 1QB6A 2O8UA 1C1SA 2FS9A 3GY5A 3RU4E 3F6UH 1GJDB 1CBWB 2ZEBA 1MKWH 4FUHA 4JK6A 3CENA 3RU4T 3HK6B 4BXSA 1JMOH 1EZSC 2WYJA 3PTNA 2BVXH 2A32A 4DIIH 1C5WB 5HMAA 1SQTA 3SZEA 1SGYE 4DG4A 1FJSA 1KDQA 1AFQB 5C0TA 2AMDA 5FHTA 2G5NA 3NUMA 3SN8A 1PQ8A 2ANYA 4K8BA 3DHKH 1K28D 2P3UB 3GY4A 5F8TA 1SGDE 1C1UH 1WTHD 1IQEA 4FUBA 3TJNA 3URCA 1TWXB 3S69A 3TLOA 5JBTA 2OQ5A 2UUFB 1BOQA 3SNAA 1GI6A 5FPTA 5C1UA 4X1QU 4BAKB 4ABBA 1GJ5H 3U69H 2QXGA 8GCHF 5DP6A 2BQ6B 1QNJA 2ZCHP 3URDA 1GHYH 2WHXA 9ESTA 1O3HA 3BG8A 1F5LA 3DA9B 5DK1A 4H6TA 2KCAA 2PKSB 1C5ZB 4Z6AH 3OY5U 2BLWA 2KX4A 3TJVA 4I8GA 4Y8ZA 1WSSH 5H4IB 3GY8A 2AH4X 1C2GA 2XTTB 1NO9H 1O32A 3A8CA 3GCNA 1FXYA 4IS5A 1K1IA 2GP9B 1O3NA 1MU8B 2BOKA 1NY22 2ANWA 2VIWA 1HNEE 3RDZA 3Q76A 2Y7ZA 1HJAB 1CA0C 1Y8TA 2ZZUH 3ATWA 2CHAB 2SFAA 1PPZA 4JCNA 3V3MA 3M36A 4ZROA 5HGGA 2JIZD 3VFEA 3VPKA 4RKOB 1C1NA 3B9FH 3EDXB 2HVYB 1B5GH 4VGCB 2TRMA 5F03A 1EJMA 1GI0A 4DIHH 5C94A 1RTFB 3M5NA 1TNHA 4QT8C 4YT7H 1DT2A 1XUGA 5C5NA 1DVAH 2ZFQH 1NBME 3P95A 5C67A 1BA8B 1HDTH 1X7AC 2V3HH 1AUTC 1JOUB 3F2FA 3UOUA 3KGPA 1AO5A 4O97A 4OS6A 2AERH 1DX5M 1QRXA 1DITH 2H9HA 2VJ1A 1AN1E 3P17H 2OP9A 4ZAEA 3UNSA 4IW4E 3ZZBA 2ZTXA 2BYAX 1SL3A 1O2UA 1FN8A 3BEUA 1L4ZA 2R0KA 5EJLA 1GBBA 1WYKA 2AEIH 4AOQA 4E06H 2AYWA 2FYQA 1CT2E 1GHAG 3MH5A 4ABDA 4YOGA 3TVJB 2Z7FE 2IPQX 3UFAA 3ATIA 4X1NU 3GDSA 1G32B 2BZAA 3A7XA 4U01A 2PSXA 2EC9H 1S0QA 3ZVFA 1QY6A 3NK8A 4ISHH 2ZPRA 1F0TA 2WV5A 1KTTB 1V2NT 2M2AA 2G4TA 1OWJA 1BDAA 4XBCA 3ZZCA 1UHBA 2W6JD 4TWYA 2ZP0H 2BDAA 2W7UA 2KAIA 1DSUA 2O9QA 2AMPA 1F0SA 2BD7A 1O3AA 2CXVA 3RXLA 2ZFSA 1V2LT 2QYIA 1BB0B 1MQ6A 2R2WU 3RU4D 1MCVA 4DURA 2J38A 3N7OA 3BIVH 4UDWH 2OXSA 5FBIA 4DCDA 1BQYA 3OX7U 4M7GA 4O3TA 3ZVCA 3AASA 3ELAH 1A46H 5C0UA 2FO9A 5FBEA 1VITF 2ZECA 3GICB 1JIRA 4NZQA 1J17T 1O2JA 4FUDA 3FN8A 1PPGE 3CS0A 1Y3WA 4ISIH 1HAOH 4K69A 1SB1H 1RXPA 2ZPQA 1O2WA 2TGAA 3SUEA 1TPPA 2J4IA 1GHBG 3SORA 4CHAB 5J4QA 2VGCC 3GY6A 5EODA 4AG1A 2QC2A 2Z6BD 3W95A 1FMGA 5FPSA 2H9EH 3RC5A 2G81E 2ZF0H 5JBBS 3LGWA 1TE0A 3KCGH 2FMJA 3STJA 1AVXA 3E16B 4NSYA 5CHAB 1ZTJA 2ASUB 2ZIQH 3GS9A 1ZSLA 3SUGA 4XE4A 4AB8A 1QRWA 1W13U 3UQVA 2I6SA 1RGQA 1HAGE 2PUXB 2P3FH 1FY1A 4A92A 4UFDH 1O5DH 1TIOA 2BD5A 2BLQA 1OKXA 4FVBA 5E2PA 4CRCA 4UFEH 1Y3XA 2TIOA 3GCOA 1MKXK 4MPWA 5KGOA 5A09A 1AUJA 1EZQA 1L0ZA 1HGTH 2TGTA 4ZKOU 1AI8H 2XCNA 3NZIA 2ILNA 3LC5A 2G00A 5ESTE 2AIPA 1GDUA 1P04A 1THRH 2FLBH 2WPJS 1SC8U 2EI8A 3BG4C 1FUJA 1SGTA 3V13A 3SGQE 1LTOA 4AFSA 2ULLA 1PFXC 1E1QD 1NBMD 1ESBA 4X2VA 3RXMA 4TT3D 2YNAA 3SBKA 1Y3YA 2ZHDA 1O3EA 2RA3A 4OGYA 4GCHG 2C8XB 1W10U 5DP4A 3QGJA 2PGQB 4KELA 1HUTH 2W5EA 1JIMA 3UPEA 1O2GH 2FI4E 1GMDF 5TCCA 3TH4H 2BLVA 1DXPA 4YTAA 3Q77A 3GISB 1L4DA 3TGKE 1S6LA 1MD8A 2KCPA 1WAYB 1YPHE 4WMFA 3SGAE 5EIYA 2OTVA 1QIXB 1TGTA 1YPKH 1BRAA 3LKWA 5CDFE 1A0JA 4X0WU 4Y0YE 1HXEH 1SOTA 4F4OC 1ELVA 3OU0A 5IYTA 6ESTA 3ITIA 1W2KH 1K22H 1NFXA 2G8TA 2ZNKH 2GKVE 3QGNB 4BAOB 2J9NA 2RG3A 4RT0A 1YLDA 7ESTE 1HAVA 1ZPBA 2J34A 2ZHFH 3QO6A 5A0CA 4Q7YA 1TMUH 1ABIH 1VR1H 3UIRA 1O2NA 4ACBA 4MDSA 4YZUA 1MCTA 2VWOA 2ZWLH 1BRCE 1MZDA 2Z9IA 2JJ2D 3OE7D 1PPCE 1AMHA 1K9OE 4J2YB 1XXDA 3RXVA 2GV6A 3PMJA 5GCHG 5J4SA 2DUCA 4AORA 1GG6C 2YNBA 3U28C 1P2IA 3MMGA 6CHAC 3TJOA 2J95A 4INHA 1OP8A 2Q6DA 5L2ZH 2K8IA 1KLIH 3DFLA 2G52A 3GY3A 2OC1A 3OEHD 1CGJE 2KM0A 1SHYA 1VCPA 3MU1A 1MU6B 4DW2U 1S84A 1C2HA 1K1NA 4Y79A 5DP3A 1XM1A 3QLPH 2FX4A 5A2MH 1THPB 2ODYB 4DY7B 1WV7H 1ZZZA 1SR5C 2BY6X 1HAXB 1GHVH 1Z8IB 4CH2B 5DN6D 3ATKA 2XNIA 4K5ZA 1GMCG 3UWIA 1CA8B 1O33A 1NU7B 1LQEA 1D4PB 2FIRH 3T27A 2BY7X 1GMHG 1GI3A 2R3UA 1EB1H 5JB9S 2C8ZB 1K1MA 1W0YH 1CGHA 2ZGJA 4ZXYH 2FX6A 3LOXA 1LQDB 1TMBH 4WMEA 2YMSC 4Y8XA 3MOCA 4IGDA 1ACBE 2O8TA 3F0PA 3T26A 1T8NA 2A5IA 4NA8A 4Q7XA 3UAIC 3KQCA 1O5BB 3UUZA 2ANKH 5HKKD 1EJAA 4GAWA 2P8OB 1IQGA 3NPSA 4ZXXH 3SJ8A 4D7GA 2GVFA 2I6QA 3TU7H 3A7YA 4KTCA 1Z71A 3PV5A 4WF8A 1TA6A 4O03A 1KY9A 4P00A 3VG8A 1JWTA 3FFGA 4RSPA 1DWDH 2VVUA 3KHVA 4Y7AA 1BBRK 3A85A 1C1WH 1SQOA 3ZZ5A 2LP6A 1QL7A 1PPEE 2Y5FA 2A2QH 2IJOB 1OX1A 2GCTB 2AHME 1QGFA 1YLCA 3IG6B 1E37B 1ZTLA 2A7CA 4BAMB 2QXHA 1OYQA 1SG8B 1B7XB 1V2OT 1HCGA 2THFB 1KXCA 1GCTB 1TQ0B 3M3VA 3SU0A 1C1MA 2NWNA 1AWFH 1EOJA 2SGPE 3KQBA 4FU8A 4UFGH 2Z94A 2F9UA 1PPFE 3E8LA 5SGAE 1KXBA 1IQHA 1O0DH 3R0FA 1INCA 1Y5AT 4HG6A 3RXGA 2UWOA 1EASA 5ESBA 4ZHAA 3SNCA 1MTSA 3RMOH 1A5HA 3OYPA 1PQAA 3NKKA 5JBAS 2XBWA 4Y11E 1FONA 3SI3H 5DG6A 3SU3A 4X2YA 1YCPK 4ZHLU 3FAOA 4DOQA 1AZ8A 3R3GB 2GZ7A 3A7ZA 2ZO3H 1TYNA 3RXIA 1WOFA 1C5SA 4F48B 2BHGA 1XXFA 2F3CE 1S5SA 1Y3UA 3SU6A 1E1RD 5GPIB 4AGJA 1BZXE 3M35A 4BTIB 3QN7A 2KFWA 4MNXA 1UTNA 2WPKS 6GCHG 5FL7D 4UFFH 3F68H 1O2PA 1D3TB 3AW1A 2P3TB 1A3BH 4XFQA 3W1EA 4A6LA 2OD3B 2R0LA 4THNH 1W0JD 4Y6DA 5GXPA 4FETA 1IQFA 3FP8E 3F0OA 1NPMA 1GGDC 3MYWA 4YLUA 4MPVA 1C2KA 1E79D 4AYVB 3AAVA 1WQSA 5L30H 9LPRA 4NIXA 1TRYA 1BMAA 4GPGA 4DVAU 3OY6U 1GI7B 4TYDA 3L33A 3QDZB 3ODFA 5GJ4B 2Q1JA 1DDJA 3SYJA 5JBCS 1NFYA 3V0XA 3VB4A 1JBUH 4TY7A 1O2SA 3H7TA 2JETC 1JXPA 3PWBA 4B73A 1TNKA 1ANBA 2XNDD 1GL1A 1AB9B 4B1TA 4ABGA 1EZXC 1L1JA 3GCTF 1AE5A 1J15A 1ZR0A 3EAJA 3DD2H 4X6NA 3S9BA 1DS2E 4NSVA 2ZDVH 1CGIE 1N8OB 2H9TH 1S82A 4R0IA 2H5DA 4ABIA 3C27B 2F9PA 1HXFH 2WV4A 4MG3A 1SFIA 1ZRKA 1GVLA 1ZRBA 2FTMA 3HPTB 3FZZA 3MU4A 4ASUD 1MBMA 2D1JA 1RFNA 3SQEE 3ZYDA 2DE8A 2R3YA 1YPEH 1V2ST 3LDXH 4IN2A 2SNVA 1P0SH 4FU9A 1QQ4A 3KEEA 4E05H 1QFKH 3M61U 2RFKC 1GBTA 1H9IE 2VBCA 4ZKRU 4WMDA 1OP0A 2KZ4A 1P03A 1N1LA 2GMTB 3D49H 4KP0A 1GBMA 3SO3A 2ZTYA 5F6MA 1TRMA 4ZUHA 5A8YA 2EQNA 3F2GA 1SMFE 3M7UA 1KLJH 3AVZA 3A89A 3VGCB 3LH3A 1KXEA 1DUEA 3OAAD 3RM2H 1EPTA 1TOCB 3V12A 1SBWA 1QURH 1C1RA 1KXDA 3MU5A 3PO1C 1P3EA 3MH7A 1G9IE 2PWXA 3A83A 1AQ7A 1LPKB 4IMQA 3H7OA 2OUAA 3F3BA 1UVSH 1BRUP 1P2JA 2CF9H 3MO6A 1SGEE 5FXLA 3GCHC 1C5NH 1O37A 2VINA 1BJVA 1YPJH 3RMNH 1QBVH 3I78A 4AFZA 1ZMJA 1ANEA 3HKIB 2EEKA 2QF5A 3KF2A 4AN7A 2J94A 1PYTC 4AB9A 4NWLA 3A7WA 3P8GA 3ENSB 1XUHA 2B7DH 1VITH 4ZH8A 3HK3B 3P8FA 2F9NA 3S0NA 1HAPH 2BLOA 5C1YA 1UTPA 3ZZDA 5B6LA 1LVBA 1HJ9A 4CR9A 1K1OA 4RN6A 2Z3CA 2BDGA 1GBEA 3PV2A 1O31A 1CVWH 4X1SU 5C3NA 1DICA 2FP7B 4GSOA 2BX3A 1G36A 1VITG 1NZQH 1ZPCA 1BT7A 1ELDE 2ZFFH 1TGNA 2Z9JA 3ATMA 4ZCNA 2NU0E 4TPIZ 2GD4B 3STIA 1TOMH 3F9FA 1NFWA 2SGQE 2XW9A 1H8HD 2Z3EA 1V2RT 2VGCB 1Z6JH 1NRNH 2QXIA 2L74A 1TABE 3KYGA 1W11U 1AU8A 4HFPB 3TK6A 1FY5A 2FDAA 1FY3A 4D9RA 1T32A 1H9HE 1AKSB 1P05A 1WQVH 3KYFA 1QQUA 1P12E 1HIAB 4ISOA 1DUAA 3L6PA 2R9PA 3BSQA 1UVOA 3MNBA 2KCOA 5I25A 4E7NA 1GI9B 4FUJA 2BB4A 2A5AA 1AZZA 1Z8JB 3H09A 1QBOA 2ZU3A 3PWCA 1T31A 3BTFE 3HGPA 4B2CA 1CBWC 1E38B 3SV9A 1YC0A 3QZRA 1NN6A 3I29A 2WUBA 2JH0D 2QN5T 3LPRA 3TNTA 3EA8A 1AIXH 1L1NA 1NM6A 3PLPA 1WUNH 2FOHA 1HAZB 1DLEA 1TBQH 3O8BA 1AFQC 5AFYH 4IBLH 4ZHMU 3BG4B 2P16A 1GVKB 1GI1A 1MKXH 3RXHA 1E0FD 4B71A 1C5OH 1T8MA 4O3UA 2ZQ1A 2ZDMA 1UK2A 4NWKA 1LVOA 1QL8A 1BTUA 1VCQA 1O2QA 1ZHPA 2QF0A 2WPDD 5L2YH 1DPOA 3UOPA 2SGAA 2BDIA 4K8YA 3MNCA 4Y71A 4ABAA 1OP2A 3M3SA 2O8LA 3QTOH 1V2PT 1UTOA 3RC4A 3A8AA 1Z1IA 1SGIB 3S9AA 2ZGXH 1GMDG 2XC4A 1UW7A 4GHTA 3A7VA 2HLDD 2Z3DA 4NFEA 2OK5A 4FOUC 1Z1JA 1S0RA 2PHBA 1QJ1B 2EY4C 1TGCA 3SOSA 4B6FA 3RXJA 1GJBB 2W6ID 4JZIA 3BTME 3LH1A 4WXIA 5FAHA 2Z9GA 1IHTH 4Q4LA 4Q2KA 5CHBA 1D3PB 1O2LA 3DUXH 3RXQA 4X2WA 2O8WA 4LZ1H 4A5TS 4OM9A 2AMQA 3N7EA 1HJAC 4I8JA 2M5TA 2C90B 1Y3VA 2VU8E 3ZV8A 2GT7A 3ZZ8A 1Q3XA 1A0LA 2HOBA 4TPYA 1O2KA 4VGCC 1U6QA 2O8MA 1EATA 2ZQ2A 3QX5H 1GBHA 1C2FA 2BY5X 2B5TB 2HPPH 1PQ7A 5DO4H 2WINI 1WTGH 4DT4A 4XOJA 1PPHE 5EJZA 4FUGA 2CGAA 3SU2A 2B0FA 3IWMA 1O2RA 1P57B 1BITA 1XMNB 1V3XA 3P8NA 2J5UA 3SJIA 1QL9A 3ZIAD 4MQAA 4OS4A 5F8ZA 5EW1H 1TPSA 1SFQB 1C5TA 2FOFA 3MWIU 1LO6A 4KGAA 2A4RA 3O8CA 2D26C 3B8JA 4JK5A 1Z8GA 4YLQH 1RRKA 1SQRA 5GNDA 1KYNA 4D76A 4IN1A 1Y5UT 4UE7H 1LHEH 5JYIA 3FKSD 2J98B 1P8VC 4I7YH 5C20A 4OGXA 1SQAA 1B0FA 4IC6A 5C1XA 1UK4A 3EA9A 4YOIA 1O2IA 3ZV9A 3SU4A 4D7FA 1RD3B 1C9TA 3P92A 2Y5HA 1GJ7B 1XKBC 3WWFA 3A8BA 1NROH 4DT7B 2YMSB 1G2LA 2PP6A 2QF4A 1ETSH 2J97A 2ALVA 1C4U2 2ODQA 1VGCB 2VVVA 1QRZA 2VWNA 3PRBA 1ZPZA 3LGTA 2BDCA 5B6OA 2W7SA 4GUXA 3TNSA 1FX0B 1D3QB 1DM4B 3EQ0H 1ZGVA 2BMGB 1ETTH 4AC9A 1KMHB 1GHZA 2HNTC 4NA9H 1WU1A 3W94A 2GJGA 1ZGIA 2GCHF 1KXAA 5EU8A 3BEFB 3CS7A 3RMMH 5A0AE 1LVMA 1V2WT 3K6ZA 5LPFA 3GDUA 2FOGA 5T6FA 2ZA5A 1EPTC 2XYAA 5F8XA 4H6SB 1H9LB 1O3FA 1EQ9A 4XDEA 3E6PH 1TQ7B 3UQOA 3RMLH 1EJNA 3PTBA 4X8VH 5KEDA 2ZGCA 2G51A 4K2YA 3ZVDA 1MTNB 2ZGBH 1GHBF 1OYTH 2BVSH 2VH6A 5LPRA 1O2HA 1H1BA 3PRDA 4BAQB 1TMTH 3BTTE 4IC5A 1BBRH 3M5MA 3SU1A 2Z9LA 3BIUH 2TGDA 4IMZA 5T6DA 3NWUA 4FXGH 1LPGB 3RM0H 1ZLRA 3E1XB 1T8OA 4Z0KA 2IJD1 3DSGA 2FOBA 4AGKA 1L1GA 1A1RA 1FY4A 2XBXA 3M5OA 1TNLA 3ZVEA 1V2JT 3HATH 1QB1A 5GDSH 1Z7KA 2DE9A 5CHAC 1FIWA 1FPCH 3NXPA 4OS7A 4DGJA 3N99A 4X8UH 2YMSD 3A88A 1UCYH 5HIYA 2OINA 3SUDA 4MPUA 1W14U 3BTHE 1EZUC 1DWEH 5EG4A 1FZZA 1GBCA 1A5IA 2WYGA 2ZU5A 3U8OH 3E3TA 4HGCA 1B0EA 2Y5GA 4CRAA 1C5QA 1LKAA 5TCAA 4NFFA 1J16A 3SHCH 3T62A 1SPJA 1GJ8B 4RKJB 5E8EH 2GX4A 2FOMB 1GJ9B 1S6FA 5IK2D 3KQ5A 2BQ7B 1YCPH 3RXDA 2BDHA 4XBDA 2SGEE 2H2ZA 2ZDNA 5E2OA 5EJ1A 1HPGA 1QJ6B 1UVUH 1QTFA 1OWKA 1OOKB 3DT0H 1HAHH 3KNXA 1C4Y2 1ZMNA 1BTXA 3T25A 5HXFA 3VB3A 2CF8H 3VEQB 4MPXA 4AFUA 4A1VA 3MO9A 4X8TH 1G3DA 3QTVH 5JPMH 1F5KU 1O3KA 1P2OA 2AGIX 4X6OA 4YO9A 4MNWA 2VIDA 2XWAA 2FOCA 1GBAA 4I8HA 1V2UT 5A0BA 1HFDA 1MTVA 3DCLA 3BTQE 1BHXF 1UTLM 2HALA 1Y5BT 2B9LA 2QA9E 1ESAA 2JETB 8KME2 4K3JA 2TPIZ 3K65B 2ANMH 2XC0A 3ZZ3A 2ZFRH 3GCTG 4FU7A 4UEHH 4B76A 4NG9H 3U98H 3U8TH 2FPZA 4D9QA 2OLGA 4Z1MD 1O3BA 1DY8A 4B74A 3SU5A 2RDLA 1CT0E 1KLTA 3HGNA 1AVWA 4Y76A 1P2MA 1T8LA 1TGSZ 1AE8H 3E90B 3O8DA 1GBIA 3MFJA 4H4FA 4MVNA 4Y8YA 1TNGA 1FAKH 1O2ZA 1P06A 5EXLA 1NFUA 2V0BA 3M5LA 2F83A 2FXRA 3QK1A 2PV9B 5DP9A 3E0PB 2GV7A 3UR9A 5PTPA 3GYMA 1OPHB 1GPZA 3ZVBA 1CHGA 1UTQA 4KTSA 1C5VA 1GBFA 1TNIA 3T28A 4I86A 2F9BH 2KCYA 2WZQA 3UY9A 1IOEA 4UONA 1DFPA 3TGIE 1GBKA 1C1VH 4B6EA 4RI0A 3A87A 1BTPA 2ZG0H 3E0NB 5HM2A 4D8NA 3AAUA 3WWBA 4BNRA 3D23A 3SNBA 3RLWH 5DP7A 1MAXA 1LHDH 1MUEB 1TPOA 1FDPA 1T4VH 3B23B 1IQMA 4Q80A 2ZFTA 1SGQE 2J2UA 2BX4A 5DSFA 3NRLA 5HM9A 3MHWU 1GCDA 1AWHB 2K0QA 2QXJA 1W0ZU 4BXWA 3RXRA 1JRTA 4Q63A 1UK3A 2R2MB 2ZC9H 1SGNE 1OWIA 4OS5A 5E0GA 3KQDA 2PUQH 3PV4A 3RXUA 3ZVAA 3F9GA 4FVDA 3SV8A 1AKSA 1O2TA 4X1PU 5TJXA 3SW2B 3RXKA 1HIAA 1W0KD 4K1EA 8GCHG 1BHXB 4KTUA 1K2I1 1WXRA 4JZDH 1ORFA 2OBOA 1BMFD 1TX8A 3EA7A 2FYRA 1TBZH 2C8WB 1MTWA 2P8OC 3A8DA 2STBE 4XD7D 2HRVA 3MU0A 1NRRH 2XRCA 4FUEA 1J8AA 1BTWA 3LGYA 4FUIA 2ODPA 4K60A 2H1UA 1XVOA 1TB6H 2BOHB 3OFND 3UNQA 1ZYOA 2FS8A 1FQ3A 1CA0B 2P59A 3P6ZB 3PMBB 2BXUH 4CH8B 1G30B 3S9CA 4FUFA 2SNWA 4CRGA 1C2JA 2VIPA 1GJ6A 3GYLB 4X1RU 2JKHA 3PMAB 3GDVA 1TGBA 2LPRA 4LXBH 4JZEH 5CMXH 1SGPE 2ZU4A 1IHSH 2A7HA 1CHOF 3KN2A 3RXTA 1F92A 2AIQA 1GCTC 2ZI2H 3E91A 4KKDA 5KECA 3CNRA 3LJOA 3LONA 1PQ5A 2YOLA 1F0UA 1O3DA 5LGOA 2Y7XA 3MNSA 1JRSA 2ZGHA 2P94A 2BVRH 3ESTA 3DSPA 2QF3A 3FO8D 2F43B 5E0JA 2V3MA 1ID5H 4NIWA 2BY9X 2HWLB 1ARCA 1ELFA 1PYTD 1C2IA 1YM0A 2VB0A 5F53A 5T6GA 1SLUB 5JDUB 3GOVB 2A0QB 2QGRA 1MAYA 3TK5A 4A1XA 1T7CA 3V7TA 1C5UA 1ZHMA 1TONA 4NIVA 1DLKB 2BD2A 2RDEA 1EOLA 5EPYA 2D8WA 1MMJN 3FVFB 3JZ2B 3FOAA 2BM2A 2FZZA 3Q3YA 2A45B 4AG2A 3RXSA 2SGDE 1GDQA 6GCHF 1D6RA 4YM9A 7GCHF 1A7SA 1NESE 3P70B 1OWEA 1D9IA 2XOKD 1EAWA 4AX9H 1GDNA 1YYY1 4YT6H 1NT1A 3AW0A 5A8ZA 1PJPA 1SGRE 1HBTH 1YY3A 4NA7A 1ETRH 1TBRH 5AF9H 1KIGH 4UD9H 3RXOA 1EUFA 1F5RA 2A31A 3FANA 1V2MT 1XUIA 4ABJA 2Q6FA 2QE7D 3ATLA 1ZSJA 5DP5A 4WVPE 2XCFA 1P10A 3EE7A 1GI4A 2Q6GA 3S7HB 1ELBA 2NU4E 4ABEA 3MQKC 1CE5A 5DP8A 1ANCA 2C93B 1RJXB 2STAE 3RXCA 4JZFH 3TH3H 5BRRE 1K0HA 1C5PA 1UTKA 1BCUH 2WPMS 1C2MA 1MQ5A 3ZZ9A 1C1TA 1YP9A 3EYDA 1O3PB 3T2NA 1O5AB 1H8ED 2NU3E 4FUCA 1AB9C 2HNTF 2ZFPH 1IQJA 1IQIA 1LKBA 2UWLA 3IITA 1QZ8A 1IQKA 3UB0A 1LHGH 1O3OA 5DKMA 1D6WA 2HNTE 5FX6A 1N8OC 4K1SA 1E34B 2J98A 2A2XH 5E0HA 5ABWA 1O2YA 1ZOMA 4AFQA 1IQNA 3RLYH 1ANDA 3N7DA 4NGAH 4Y10E 3U8RH 1A2CH 2XC5A 3SGBE 4BTUB 2JJ1D 4GLYA 2HLCA 4AYYB 1EAXA 3EGKH 3U1JB 5HIZA 1RIWC 5EQRA 4XSKU 1DWCH 1MKWK 1ZHRA 4WJG2 5AFZH 4CBOA 4X6PA 1C5RA 1Q2WA 1TFXA 4A1TA 1O2VA 1NRSH 5G4BA 2PKAB 1MD7A 3TPIZ 1UMAH 2GMTC 2XWBI 2C8YB 1GBDA 1H8DH 1SSXA 2Y80A 1HAIH 2F4LA 1V2VT 2J92A 1YPLH 4H42U 2SGFE 4I33A 4OS2A 2OC7A 3VGCC 2VWMA 3FZDA 3VXFH 1BIOA 3QWCH 1D3DB 1GBJA 4BAHB 3SJ9A 3F1SB 5LPEA 2W3KA 3ZZ7A 1DSTA 3BTKE 1A61H 3ZZ6A 3T29A 3LT3A 4INLA 1SKYE 2ZU2A 2BDYA 1O3IA 4JMYA 1QCPA 1FAXA 3D65E 4BOHA 4NIYA 3PYHA 4ACAA 1Y59T 1XUFA 1W12U 1GI5A 2OC8A 2W3IA 3BEIB 4TY6A 1IQLA 2WPLS 1YPMH 1SI5H 1W7GH 3A80A 1EAIA 2BQWB 1BJUA 3I77A 1C9PA 3LIWA 4LOYH 2XXLA 1K1PA 2L6OA 4YXWD 3QUMP 3LGVA 2D2DA 2OC0A 1DOJA 1ZMLA 1HV7A 3PLKA 2PR3A 3TITA 2PKSC 3C1KA 1HYLA 1T4UH 2FM2A 1FNIA 1GI2A 2F91A 2ESTE 2WSSD 1RTKA 3O8RA 1EP5A 4XBBA 1LPZB 1XX9A 4YOJA 3SV7A 1V2KT 1EXFA 3F9HA 2UUJB 2AFQB 2GCHG 4U2WA 2V7QD 2PLXA
chains in the Genus database with same CATH topology
4CRDA 1EPTB 4NZLA 3A81A 1SGFG 1KDQB 4LZ4B 2CHAC 3M37A 4MNYA 2RA0A 3MNXA 1QR3E 3RXAA 5EQSA 1UVTH 3PROA 2JH6D 1O3MA 3T5FH 1IAUA 2UUYA 2RCEA 5EOKA 4ASHA 3LGIA 2FESH 1GBLA 2ZKSA 3K9XB 4ABHA 3OTJE 3RXFA 4I31A 1GVZA 3LGUA 4INKA 1ELTA 1SHHB 5LH8A 1BMLA 2BXTH 1WCZA 1O35A 1P09A 1SVPA 4MNVA 1S83A 1C2EA 1G3EA 1GG6B 5DJ7A 3A82A 6CHAB 4Y0ZE 2A4OA 4E7RG 1LVYA 3F9EA 1O39A 4MTBA 2HPQH 4YESB 2OQUA 1E35B 4LK4A 1G2MA 1Z8RA 1LHCH 3VB7A 1ARBA 1BMMH 2FLRH 1SGFA 2QY0B 2A7JA 1F7ZA 1NC6A 1TX6A 2BD4A 1C1OA 3KL6A 1RS0A 4PROA 3UREA 3UTUH 6LPRA 1KXFA 1GHAF 1P01A 1P9UA 2K1QA 4K1TA 1VJAU 5JB8S 2IOTA 2W26A 2ZDKA 3UR6A 2ALPA 3M7TA 3VXEH 5IDKA 3LJJA 5EGMA 1AD8H 1O5CB 2A4GA 2TBSA 1ELEE 1MZAA 4JYUH 3CP7A 1O36A 3SUFA 2UUKB 1NU9A 1P3CA 1V6DA 3L3TA 3MH6A 1P9SA 2VWLA 3RC6A 1AY6H 4JYTA 3G01A 2GDDA 2ZTZA 2A4QA 1C4V2 4SGAE 1O3CA 3FP7E 3ZVGA 1QJ7B 2PSYA 1MH0A 1FLEE 1GHWH 3M3TA 4BTTB 4I8LA 2PFEA 3SJKA 4ABFA 1BMNH 1C1PA 1C2LA 1YPGH 1H8IH 5FPYA 2FODA 1UJ1A 2F9OA 2G5VA 1QA7A 4GHQA 5AHGH 2PW8H 1CO7E 1UTJA 1TA2A 4OS1A 3TK9A 1QHRB 5EPNA 1Z6EA 2NU1E 1TLDA 3BTGE 1EAUA 4JYVH 1BTYA 4WXVA 2AGEX 3SNDA 3A7TA 1O5FH 1YF4A 1DXWA 2PGBB 2Z9KA 3SNEA 1ESTA 2OCVB 2BDBA 7KMEH 1EP6A 2V6NA 4CHAC 2ZDLA 5K0HA 3MTYA 3A84A 1YCPM 4B2BA 1HAYB 1F2SE 1TALA 1O38A 1EKBB 4DJZB 1NS3A 1W7XH 1ABJH 1S81A 1YGCH 3FP6E 4U30A 3TIUA 1UHBB 1SGCA 5EQQA 1XVMA 3ODDA 1G3CA 3WY8A 4I32A 2KAIB 3VB6A 1FV9A 2EA3A 5DPAA 1W3CA 3HKJB 4AZ2B 1ELAA 1GJCB 3SV2H 1TRNA 1OXGA 1LHFH 2F9VA 1GWAA 2GT8A 1P2KA 2Y81A 3A86A 1O5EH 1XUKA 2TGPZ 4CREA 2PTNA 2WPHS 1GJAB 1J9CH 2CMYA 1W8BH 2Y6TA 5C2ZA 2V3OH 3GY2A 2WPIS 3RP2A 3MU8A 1QB9A 3Q00A 5GWZA 1K1JA 2BD8A 1LMWB 1L2EA 2JH5D 2WUCA 1BTZA 3ZYEA 3U9AH 1MBQA 1PPBH 1EX3A 2CJIA 4GVUA 4J1YA 1ELCA 7LPRA 1F0RA 4MLFB 1AHTH 2UWPA 1GGDB 2FI3E 1EB2A 5FCRA 1AFEH 2VVCA 1C5MD 3JZ1B 4F49A 3S7KB 3ZZAA 1O2MA 3M7QA 4WH6A 3TGJE 3PMHB 1SLVB 4JZ1A 3KQEA 1FIZA 2FOAA 4ISNA 2ZPSA 8ESTE 4GCHF 5K7RA 2IPHA 3Q3XA 1BTHH 2IN2A 1UTMA 2ZCKP 3SI4H 1HJ8A 2A5KA 8LPRA 3RXBA 4CBNA 4X6MA 1O3JA 2GGVB 1HLTH 1TNJA 5FX5A 1M9UA 4NCYA 1ZJDA 1VGCC 4SGBE 1O5GH 2G4UA 1RTLA 2FEQH 3BF6H 3ZZ4A 1NRPH 1XUJA 3MH4A 3Q3KA 4ZKSU 5EW2H 2GDEH 3SQHE 3QZQA 1DY9A 5A8XA 1CT4E 3NCLA 5I46H 2FTLE 2BY8X 1FY8E 1O3GA 3BV9B 2BD3A 4Y7BA 5L6NH 2CV3A 1DANH 1FN6A 4B75A 1CU1A 1GL0E 1O34A 5AVDA 2BZ6H 3PLBA 2BTCE 2XBYA 3RXPA 2ZCLP 2ZHQH 3VB5A 4I8KA 4X2XA 2ZU1A 1CHOG 1MTNC 1XKAC 3SJOA 1S6HA 1LCYA 1C5LH 2ZHWH 3RUOA 3BTWE 4R8TB 1VZQH 1E36B 1QBNA 2ZHEH 1Q31A 1UCYK 1HRTH 2A1DB 5GCHF 1V2QT 5EXNA 2QIQA 1DE7H 1C5YB 1ZSKA 1AVGH 5BPEA 2HVXA 1K21H 3OSYA 3TH2H 2C4FH 2ZDAH 2XBVA 3H5CB 1K1LA 1P11E 5FCKA 2Y82A 1SLXB 3MI4A 1QA0A 1BBRE 1OWHA 3LC3A 2OBQA 5C5OA 1O30A 3UWJH 1OSSA 4HZHA 3RXEA 3DFJA 4WY3A 2EI6A 3PO1B 1C5XB 1C1QA 1ELGA 1YKTA 4WH8A 1A5GH 1J14A 2P95A 4WWYA 2GTBA 2HGTH 1GMCF 1VJ9U 1O2OA 4B2AA 3K6YA 1GJ4H 2VIVA 3SZNA 1P02A 1UVPA 1ZTKA 3GCHB 2VIQA 1NRQH 7GCHG 1P2QA 1GMHF 1FI8A 1UCYE 1HAVB 1N6XA 2B8OH 4X8SH 2VNTA 1A3EH 5T3HA 5EXMA 3KIDU 1ZJKA 1UO6A 1CSOE 1FPHH 1A4WH 1P2NA 3PM3A 2BD9A 2CN0H 3SV6A 4Q7ZA 4U32A 1C2DA 1YPHC 1SOZA 1HB0B 1A0HB 1BUIA 3LU9B 3EE0B 3TJUA 3PB1E 4CRFA 1H4WA 4ZKNU 5ETXA 1KSNA 2QAAA 2PKAA 1LDTT 3BTDE 1OWDA 1VCWA 1CQQA 3P8OA 2QCYA 1S85A 2G55A 5CE1A 4CR5A 4TWWA 1DWBH 1NTPA 1TAWA 2H5CA 1OS8A 2QV1A 1TPAE 4BANB 1WBGB 4ISLA 1GHXH 3SHAH 2GCTC 1BRBE 3GY7A 1G37A 3K2UA 1AGJA 2EI7A 5DGJA 4CRBA 1O3LA 2GZ8A 1YBWA 1O2XA 2VIOA 3D62A 3BN9A 2LNCA 2H6MA 2FI5E 2GZ9A 3MO3A 1TX7A 3UNRA 5GIBA 2FWWA 3U1IB 1THSH 4O9VA 4ZMAH 2AS9A 5HYOA 2P93A 2C3SA 2PTCE 2FOEA 3BTEE 2VH0A 1RIWB 1N6YA 1GI8B 2V35A 1SLWB 1KTSB 4A7IB 1V2TT 1G3BA 1MTUA 4HI3A 4ESTE 2AGGX 4HTCH 2NU2E 1QB6A 2O8UA 1C1SA 2FS9A 3GY5A 3RU4E 3F6UH 1GJDB 1CBWB 2ZEBA 1MKWH 4FUHA 4JK6A 3CENA 3RU4T 3HK6B 4BXSA 1JMOH 1EZSC 2WYJA 3PTNA 2BVXH 2A32A 4DIIH 1C5WB 5HMAA 1SQTA 1SGYE 4DG4A 1FJSA 1KDQA 1AFQB 2AMDA 5FHTA 2G5NA 3NUMA 3SN8A 1PQ8A 2ANYA 4K8BA 3DHKH 1K28D 2P3UB 3GY4A 5F8TA 1SGDE 1C1UH 1WTHD 1IQEA 4FUBA 3TJNA 3URCA 1TWXB 3S69A 3TLOA 5JBTA 2OQ5A 2UUFB 1BOQA 3SNAA 1GI6A 5FPTA 5C1UA 4X1QU 4BAKB 4ABBA 1GJ5H 3U69H 2QXGA 8GCHF 5DP6A 2BQ6B 1QNJA 2ZCHP 3URDA 1GHYH 9ESTA 1O3HA 3BG8A 1F5LA 3DA9B 5DK1A 4H6TA 2PKSB 1C5ZB 4Z6AH 3OY5U 2BLWA 3TJVA 4I8GA 4Y8ZA 1WSSH 5H4IB 3GY8A 2AH4X 1C2GA 2XTTB 1NO9H 1O32A 3A8CA 3GCNA 1FXYA 4IS5A 1K1IA 2GP9B 1O3NA 1MU8B 2BOKA 1NY22 2ANWA 2VIWA 1HNEE 3RDZA 3Q76A 2Y7ZA 1HJAB 1CA0C 1Y8TA 2ZZUH 3ATWA 2CHAB 2SFAA 1PPZA 4JCNA 3V3MA 3M36A 4ZROA 5HGGA 3VFEA 3VPKA 4RKOB 1C1NA 3B9FH 3EDXB 1B5GH 4VGCB 2TRMA 5F03A 1EJMA 1GI0A 4DIHH 1RTFB 3M5NA 1TNHA 4QT8C 4YT7H 1DT2A 1XUGA 5C5NA 1DVAH 2ZFQH 3P95A 5C67A 1BA8B 1HDTH 1X7AC 2V3HH 1AUTC 1JOUB 3UOUA 3KGPA 1AO5A 4O97A 4OS6A 2AERH 1DX5M 1QRXA 1DITH 2H9HA 2VJ1A 1AN1E 3P17H 2OP9A 4ZAEA 3UNSA 4IW4E 3ZZBA 2ZTXA 2BYAX 1SL3A 1O2UA 1FN8A 3BEUA 1L4ZA 2R0KA 1GBBA 1WYKA 2AEIH 4AOQA 4E06H 2AYWA 2FYQA 1CT2E 1GHAG 3MH5A 4ABDA 4YOGA 3TVJB 2Z7FE 3UFAA 3ATIA 4X1NU 3GDSA 1G32B 2BZAA 3A7XA 4U01A 2PSXA 2EC9H 1S0QA 3ZVFA 1QY6A 3NK8A 4ISHH 2ZPRA 1F0TA 2WV5A 1KTTB 1V2NT 2G4TA 1OWJA 1BDAA 4XBCA 3ZZCA 1UHBA 4TWYA 2ZP0H 2BDAA 2W7UA 2KAIA 1DSUA 2O9QA 2AMPA 1F0SA 2BD7A 1O3AA 2CXVA 3RXLA 2ZFSA 1V2LT 2QYIA 1BB0B 1MQ6A 2R2WU 3RU4D 1MCVA 4DURA 2J38A 3N7OA 3BIVH 4UDWH 2OXSA 5FBIA 4DCDA 1BQYA 3OX7U 4M7GA 4O3TA 3ZVCA 3AASA 3ELAH 1A46H 2FO9A 5FBEA 1VITF 2ZECA 3GICB 1JIRA 4NZQA 1J17T 1O2JA 4FUDA 1PPGE 3CS0A 1Y3WA 4ISIH 1HAOH 4K69A 1SB1H 1RXPA 2ZPQA 1O2WA 2TGAA 3SUEA 1TPPA 2J4IA 1GHBG 3SORA 4CHAB 5J4QA 2VGCC 3GY6A 5EODA 4AG1A 2QC2A 2Z6BD 3W95A 1FMGA 5FPSA 2H9EH 3RC5A 2G81E 2ZF0H 5JBBS 3LGWA 1TE0A 3KCGH 2FMJA 3STJA 1AVXA 3E16B 4NSYA 5CHAB 1ZTJA 2ASUB 2ZIQH 1ZSLA 3SUGA 4XE4A 4AB8A 1QRWA 1W13U 3UQVA 2I6SA 1RGQA 1HAGE 2PUXB 2P3FH 1FY1A 4A92A 4UFDH 1O5DH 1TIOA 2BD5A 2BLQA 1OKXA 4FVBA 5E2PA 4CRCA 4UFEH 1Y3XA 2TIOA 3GCOA 1MKXK 4MPWA 5A09A 1AUJA 1EZQA 1L0ZA 1HGTH 2TGTA 4ZKOU 1AI8H 2XCNA 3NZIA 2ILNA 3LC5A 2G00A 5ESTE 2AIPA 1GDUA 1P04A 1THRH 2FLBH 2WPJS 1SC8U 2EI8A 3BG4C 1FUJA 1SGTA 3V13A 3SGQE 1LTOA 4AFSA 2ULLA 1PFXC 1ESBA 4X2VA 3RXMA 2YNAA 3SBKA 1Y3YA 2ZHDA 1O3EA 2RA3A 4OGYA 4GCHG 2C8XB 1W10U 5DP4A 3QGJA 2PGQB 4KELA 1HUTH 2W5EA 1JIMA 3UPEA 1O2GH 2FI4E 1GMDF 5TCCA 3TH4H 2BLVA 1DXPA 4YTAA 3Q77A 3GISB 1L4DA 3TGKE 1MD8A 1WAYB 1YPHE 4WMFA 3SGAE 2OTVA 1QIXB 1TGTA 1YPKH 1BRAA 3LKWA 1A0JA 4X0WU 4Y0YE 1HXEH 1SOTA 4F4OC 1ELVA 3OU0A 5IYTA 6ESTA 3ITIA 1W2KH 1K22H 1NFXA 2G8TA 2ZNKH 2GKVE 3QGNB 4BAOB 2J9NA 2RG3A 1YLDA 7ESTE 1HAVA 1ZPBA 2J34A 2ZHFH 3QO6A 5A0CA 4Q7YA 1TMUH 1ABIH 1VR1H 3UIRA 1O2NA 4MDSA 4YZUA 1MCTA 2VWOA 2ZWLH 1BRCE 1MZDA 2Z9IA 1PPCE 1AMHA 1K9OE 4J2YB 1XXDA 3RXVA 2GV6A 3PMJA 5GCHG 5J4SA 2DUCA 4AORA 1GG6C 2YNBA 1P2IA 3MMGA 6CHAC 3TJOA 2J95A 4INHA 1OP8A 2Q6DA 5L2ZH 1KLIH 3DFLA 2G52A 3GY3A 2OC1A 1CGJE 1SHYA 1VCPA 3MU1A 1MU6B 4DW2U 1S84A 1C2HA 1K1NA 4Y79A 5DP3A 1XM1A 3QLPH 2FX4A 5A2MH 1THPB 2ODYB 4DY7B 1WV7H 1ZZZA 1SR5C 2BY6X 1HAXB 1GHVH 1Z8IB 4CH2B 3ATKA 2XNIA 4K5ZA 1GMCG 3UWIA 1CA8B 1O33A 1NU7B 1LQEA 1D4PB 2FIRH 3T27A 2BY7X 1GMHG 1GI3A 2R3UA 1EB1H 5JB9S 2C8ZB 1K1MA 1W0YH 1CGHA 2ZGJA 4ZXYH 2FX6A 3LOXA 1LQDB 1TMBH 4WMEA 4Y8XA 3MOCA 4IGDA 1ACBE 2O8TA 3T26A 1T8NA 2A5IA 4NA8A 4Q7XA 3KQCA 1O5BB 3UUZA 2ANKH 1EJAA 4GAWA 2P8OB 1IQGA 3NPSA 4ZXXH 3SJ8A 4D7GA 2GVFA 2I6QA 3TU7H 3A7YA 4KTCA 1Z71A 4WF8A 1TA6A 4O03A 1KY9A 1JWTA 3FFGA 4RSPA 1DWDH 2VVUA 3KHVA 4Y7AA 1BBRK 3A85A 1C1WH 1SQOA 3ZZ5A 1QL7A 1PPEE 2Y5FA 2A2QH 2IJOB 1OX1A 2GCTB 1QGFA 1YLCA 3IG6B 1E37B 1ZTLA 2A7CA 4BAMB 2QXHA 1OYQA 1SG8B 1B7XB 1V2OT 1HCGA 2THFB 1KXCA 1GCTB 1TQ0B 3M3VA 3SU0A 1C1MA 2NWNA 1AWFH 1EOJA 2SGPE 3KQBA 4FU8A 4UFGH 2Z94A 2F9UA 1PPFE 3E8LA 5SGAE 1KXBA 1IQHA 1O0DH 3R0FA 1INCA 1Y5AT 3RXGA 2UWOA 1EASA 5ESBA 4ZHAA 3SNCA 1MTSA 3RMOH 1A5HA 3OYPA 1PQAA 3NKKA 5JBAS 2XBWA 4Y11E 1FONA 3SI3H 5DG6A 3SU3A 4X2YA 1YCPK 4ZHLU 3FAOA 4DOQA 1AZ8A 3R3GB 2GZ7A 3A7ZA 2ZO3H 1TYNA 3RXIA 1WOFA 1C5SA 2BHGA 1XXFA 2F3CE