4ISOA

Crystal structure of matriptase in complex with its inhibitor hai-1
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
241
structure length
241
Chain Sequence
VVGGTDADEGEWPWQVSLHALGQGHICGASLISPNWLVSAAHCYIDDRGFRYSDPTQWTAFLGLHDQSQRSAPGVQERRLKRIISHPFFNDFTFDYDIALLELEKPAEYSSMVRPICLPDASHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVIQQTTCENLLPQQITPRMMCVGFLSGGVDSCQGDSGGPLSSVEADGRIFQAGVVSWGDGCAQRNKPGVYTRLPLFRDWIKENTGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Suppressor of tumorigenicity 14 protein
publication title Crystal structures of matriptase in complex with its inhibitor hepatocyte growth factor activator inhibitor-1.
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 241
sequence length 241
ec nomenclature ec 3.4.21.109: Matriptase.
pdb deposition date 2013-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4isoA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4isoA01
3MNXA 3PYHA 4Y8XA 3RXSA 1W11U 4FVBA 1C5ZB 5JBTA 1L1NA 2GDDA 1PPZA 3MH6A 1O38A 3B9FH 4CRBA 1GCTB 4AYYB 1C5OH 1ZPZA 2FODA 1MH0A 1GJDB 1HGTH 5DGJA 2A1DB 4R8TB 8GCHF 3SHCH 1TYNA 4WVPE 3HGNA 3TGIE 4B1TA 3RXKA 1VJAU 4D9QA 2QXIA 1C5XB 2PGQB 1H9HE 3LGVA 2WV5A 3PO1C 2HPPH 1HJ9A 3MH5A 3QZRA 3SI3H 5BRRE 3UTUH 3KEEA 2ZGJA 3KF2A 4FUHA 1C4V2 3FP8E 4WWYA 1QL9A 1YLDA 5G4BA 2NU3E 3FZZA 4XBCA 5CE1A 2G4UA 2J4IA 3RXCA 1PPHE 3UREA 1C4Y2 2HRVA 1HAIH 3HPTB 1W10U 1GI8B 2V35A 1ELDE 1YCPM 4Y6DA 1IQIA 1GBAA 4Z0KA 1C2LA 3M5LA 3BTKE 3SU5A 1O2HA 3M61U 3OX7U 3QGJA 4F49A 4FUCA 1T4VH 4JYTA 1TIOA 1O3KA 1G3CA 3QO6A 1A1RA 1BTPA 1QNJA 2WUBA 1P09A 2H5DA 3B23B 1FY8E 1WUNH 1XUFA 2UUKB 3LU9B 5FPTA 1ELBA 4ABBA 2SGDE 4LZ4B 1EAUA 4FUJA 2P93A 2Y7ZA 2NU4E 3MU0A 1TE0A 2GMTC 5T6DA 1TX8A 2BMGB 3STIA 1QFKH 3I78A 2BY5X 2Y5HA 1C5NH 1VCPA 2QN5T 4X8TH 1MCTA 1TX6A 5EOKA 3UR9A 3CS7A 5I25A 2BD7A 1AZZA 2ANMH 2FMJA 3F68H 2GCHG 4CRDA 1MZDA 1QBNA 3M5OA 1GMHG 3U8OH 5EQQA 4NIWA 2Z6BD 2NU1E 1V2NT 1GCTC 1W7XH 3MO6A 3GDVA 2BXUH 2SGEE 1IQKA 3LGWA 4MDSA 4FU7A 2GT7A 3WY8A 5DP4A 1A5HA 1PJPA 1J9CH 4Q2KA 4GPGA 1A0LA 1GPZA 2TGPZ 2AERH 1ANCA 2TPIZ 2VGCB 1EZSC 5GIBA 3MNSA 2ANKH 4NSYA 3DFJA 1DY8A 4UFDH 3E90B 1AO5A 3RMMH 1S83A 1BUIA 2H6MA 5FHTA 3TPIZ 2XBYA 1CSOE 1LHFH 5F03A 1O5EH 1O2JA 3LONA 1TGTA 1V2UT 2FOBA 4U2WA 1FXYA 3I77A 1QGFA 2ZFQH 4A1VA 5F8TA 2DE9A 3P8NA 3U8TH 1O5CB 2C4FH 2VIPA 1C5LH 4PROA 5L6NH 4IN2A 1ZJKA 1MTSA 4ZHMU 1GBFA 4NZQA 1DUAA 1LHCH 2ASUB 4A1TA 1TBRH 1H8DH 1C1SA 4FXGH 4THNH 5F6MA 1ZRKA 1N6YA 1G30B 1V2TT 3P92A 2J92A 3RXGA 4NG9H 3OU0A 2XBVA 2Z9GA 1P03A 2AIPA 2FTLE 1QJ1B 4YLQH 2BDBA 4QT8C 1O34A 3MI4A 2EI8A 1Y5AT 1QR3E 1K1PA 1S6FA 1BMAA 1BTUA 1BJVA 1WCZA 4NA7A 2VINA 1WBGB 1L2EA 3Q77A 1QCPA 2TBSA 3R0FA 1EP5A 3HKJB 3RDZA 1TNKA 1TNHA 3IWMA 4ISIH 2EEKA 2BD9A 1UVTH 3K9XB 1LQDB 2PTCE 2P3FH 3GICB 5AFYH 3EDXB 2BOHB 1C4U2 1EP6A 1O2WA 4BANB 1OWDA 3OY5U 1XVOA 3LT3A 1THSH 1SI5H 2VGCC 4ISHH 4X6PA 2Y6TA 5C2ZA 4B74A 1ZMLA 1BZXE 1UCYK 3NKKA 2NU2E 1TGCA 2G52A 1KTTB 4GSOA 1KXDA 1ZGVA 4GCHF 1Y59T 4AZ2B 1TB6H 2AGGX 1FN6A 3BTQE 5T6FA 1MZAA 1SGNE 1GBBA 1C5UA 4INHA 1DM4B 3ESTA 1A46H 2TRMA 4FU9A 3ZVEA 4WXIA 5SGAE 1UVPA 2O8WA 1WYKA 4MNYA 3HKIB 1O3DA 1A7SA 3RUOA 3T29A 2A5IA 1Z8GA 2LPRA 1DT2A 3BEFB 3VB5A 3ZZ6A 1ELTA 4YT7H 4ZHAA 4YLUA 2B0FA 3GY5A 1TRMA 3STJA 3RMLH 1E37B 2AIQA 2QGRA 4O97A 3SORA 4JCNA 2KAIA 2Y7XA 2GTBA 1O5GH 3AAVA 4JZFH 2ZDAH 3M3TA 1UTPA 1EOLA 3RXPA 1PPBH 5HM2A 4I31A 4RSPA 1O2VA 3MNCA 3SHAH 1G3DA 5EW1H 1C2HA 1TGBA 1VITH 3ZV8A 1OXGA 3ZZ5A 5C1XA 4MPXA 2OCVB 1GI5A 1QB6A 1JWTA 1SL3A 1AB9C 3A84A 4IN1A 3UPEA 2BHGA 4MNXA 4ZKNU 3TLOA 1SHHB 3M3SA 3O8RA 1GBKA 2OLGA 3PTNA 1P06A 1H9IE 3PLKA 1P01A 1O3OA 3UFAA 3SU1A 1C5QA 2ZU3A 1Z8RA 9ESTA 4B2CA 2CV3A 1C5VA 3A8AA 1QL8A 5JBBS 2ZGXH 2FESH 1O2GH 2CF9H 1O2ZA 4NA8A 4KTUA 2TGAA 1SLWB 5FBEA 1KSNA 3BG8A 1HAOH 2QIQA 1TLDA 1ARBA 1UCYH 2B7DH 4O3UA 3ZVAA 1F5LA 1V2WT 2Y5GA 4DW2U 1DICA 1OX1A 3LH1A 3URDA 4MQAA 1GI6A 3H7OA 3MTYA 3U1IB 1P05A 3TH2H 2C3SA 1ANEA 4Y8ZA 1TPOA 1SGTA 2R9PA 1UTMA 3ZZ4A 3RXLA 1NRPH 4JZIA 3BTEE 1AWHB 3SU4A 1EAWA 1O3LA 4AB9A 1AFQB 1Y3WA 2ZFSA 2P16A 4Y10E 1HV7A 5C1YA 1V2PT 1NFUA 1AHTH 2WYGA 1MTNB 2JH6D 2ZWLH 2F3CE 5A0AE 5GDSH 4AB8A 1V2QT 2G81E 4H42U 2CHAC 1GJ4H 5J4SA 1Z8IB 4X2XA 1D6WA 3DFLA 2FP7B 3MU4A 1QQ4A 1C1OA 4O03A 5FCRA 6GCHG 1C5WB 1HAPH 3TK5A 1ZJDA 1WOFA 2BD8A 1O2TA 3NWUA 1BTZA 1DITH 4ISOA 2VH0A 4OGXA 1LHGH 3GOVB 5EQRA 3TH4H 1T31A 1GHBF 1P3EA 3C1KA 1YCPK 1NRQH 3RXOA 5FCKA 3SU0A 1TMBH 2ANWA 4AYVB 1MAYA 1KTSB 1N8OB 2BDHA 2H9EH 4ABEA 5L2YH 3S7HB 1IQJA 2D1JA 4BXWA 1TQ7B 4ISLA 2FS8A 1SGIB 3PM3A 5DP6A 3FZDA 5ESBA 3SJKA 1OPHB 7ESTE 2RG3A 4X8SH 1THPB 5ETXA 2G51A 2SGQE 4HTCH 4TY6A 2ZGCA 1JRTA 3K2UA 4ISNA 3ATLA 5C20A 3L33A 4F4OC 2NWNA 4AFSA 2ZDLA 3M7QA 1NESE 2CJIA 5H4IB 1HAYB 1PQ5A 1E35B 2VU8E 2GZ9A 1SB1H 1UK2A 3ZYEA 1E36B 4BAKB 3D62A 3BN9A 4OS7A 3GY6A 1MQ5A 1FJSA 2GD4B 1DY9A 3LGUA 3TNTA 4OS2A 2Q6GA 4MNVA 3VGCB 3OSYA 1AFQC 1ZMJA 2BXTH 4X8UH 1WU1A 1LHEH 3UOUA 1ZR0A 1HAGE 3F9HA 2STAE 2BLWA 1MTNC 5F8ZA 1RFNA 1YPEH 2G5VA 1P8VC 3L6PA 2HOBA 4AORA 2BDYA 5EG4A 1BBRE 3M7UA 3SV2H 1W8BH 3KIDU 1GHAF 4MLFB 2TGTA 4Z6AH 2THFB 2Y80A 1KXAA 2AYWA 2PSXA 4I7YH 1S84A 2CN0H 1VCWA 1ZGIA 3VB7A 1GDNA 1YCPH 3S9BA 4YOJA 2PGBB 5JPMH 1EX3A 2J95A 1RGQA 2PUXB 1AU8A 2FDAA 1YPMH 3SJIA 4UE7H 3N7OA 2ODYB 3FVFB 4A92A 5HM9A 1XKBC 1TPPA 3HATH 2A7JA 1N8OC 7GCHF 1TALA 1UK3A 3D65E 1O37A 4Q7XA 1HAZB 1AZ8A 2VB0A 2QA9E 2ZU1A 4A6LA 4ABAA 3BTFE 1D3TB 2EA3A 1GMCF 2G55A 3S7KB 2ZPRA 1TA2A 3VFEA 1QJ6B 1C1VH 4ZROA 1GVKB 1S6HA 1QB1A 2FX6A 3UY9A 3PMAB 2ZNKH 3RXQA 8ESTE 2H9HA 2C93B 3JZ2B 2R3UA 1O2RA 1KY9A 1RD3B 3SJOA 3LJOA 3VGCC 3BIUH 1LHDH 4YOGA 1XUJA 5C67A 2BD2A 2Z9JA 3ZVGA 5DG6A 4R0IA 3ATWA 1H9LB 3U69H 1CHOF 4ABDA 1SHYA 1Y5UT 2UWPA 2WPJS 1CA0B 1Z6EA 1GJ6A 1YF4A 1IHTH 1O3AA 1VITF 1L4ZA 1C1UH 2WYJA 4B71A 1C1WH 2HNTF 2W7UA 2ZTZA 5AFZH 1AE8H 3TITA 5B6OA 3SUDA 1JBUH 3ZZ3A 2D26C 5EPYA 5C3NA 1C5SA 1HAVB 2FPZA 4NIYA 5HGGA 4X2WA 1YLCA 4VGCB 1A2CH 2W26A 4IC6A 2JKHA 1SMFE 4X1NU 3MMGA 1GI1A 1WTGH 1D9IA 1TBZH 2ZQ1A 5JB8S 2ZDKA 1UJ1A 2D2DA 1DSUA 3PLBA 2ZCLP 4OS6A 5AVDA 2PW8H 4DCDA 5CHAC 4ABFA 1BT7A 4IC5A 2QYIA 2A7CA 1T8MA 3MH7A 3V12A 4D7FA 3MOCA 2XW9A 3PTBA 3BEIB 1QJ7B 2RCEA 2XC4A 2RA0A 1GBLA 1ZTKA 1PPEE 3TIUA 3D23A 1AE5A 1GBCA 2AMQA 2QCYA 3M5MA 4SGBE 1CGHA 1X7AC 4ASHA 1NU7B 2VWMA 3QTOH 4NIXA 1DLEA 2FI3E 2A4RA 1QY6A 1GMDG 1HJAB 4UFGH 5E2PA 4UFEH 3BTTE 1EPTB 3EYDA 2ZG0H 5LPFA 1RTLA 1QRZA 1WQSA 4X1QU 2OBQA 1Q2WA 2FX4A 4K3JA 4A1XA 2VJ1A 3GCTF 4IS5A 3VB3A 1WQVH 3I29A 2ZZUH 3H5CB 3ZZ8A 3O8DA 3RXBA 3SI4H 3TJVA 2PUQH 1SC8U 2BD3A 3LC5A 5AF9H 5A8YA 1B0EA 4NA9H 4YZUA 5FX5A 1GGDB 1SSXA 3U9AH 5E0JA 1QA7A 1G3EA 2C8YB 1P2KA 3RXIA 1JIMA 1GI9B 1CA0C 1DUEA 1QRXA 1TPSA 1P2MA 1F2SE 1GVZA 3SQHE 5JDUB 1A5IA 1GBIA 1FY3A 4YO9A 1PPCE 4ZKOU 3A88A 2RA3A 1BBRH 2Q6FA 2ZA5A 3F6UH 1BCUH 2ESTE 2ZHWH 4ESTE 1HUTH 5GCHG 2HNTE 4NZLA 3SZNA 1YPHE 4VGCC 1O35A 1IQNA 4XE4A 2VVUA 1Q3XA 3V7TA 1EJNA 4DIIH 2J94A 2FIRH 1KDQA 5T6GA 1C2KA 1K1OA 5LPRA 2GZ8A 2BVXH 1NN6A 1C1TA 2UUYA 3T25A 3A7YA 4HZHA 3GY4A 1FONA 3GYLB 2OXSA 1OS8A 1UCYE 1PPFE 1LVOA 1P3CA 3A80A 1MKXK 3P17H 1EB2A 1OWJA 1VJ9U 2ZU5A 1LTOA 1TNIA 3LIWA 3M35A 2Z3CA 2FXRA 2TGDA 4UEHH 1GHWH 4WF8A 4J2YB 3BTHE 1O33A 3BTGE 1CT0E 1P57B 1SQAA 1HJAC 2BDCA 2VVCA 3SQEE 1EPTC 1QBVH 7KMEH 4JZEH 2A31A 1UTQA 2SGPE 2H2ZA 3NZIA 1O3PB 3CS0A 2PR3A 1D4PB 1BJUA 1AD8H 3QN7A 3SJ8A 3A86A 1AQ7A 2O8MA 1DWEH 1GGDC 2F9OA 5DP9A 5LH8A 3A87A 4LZ1H 3U98H 1KDQB 2GZ7A 5LGOA 1TGSZ 3ODDA 1O0DH 1NU9A 1O5DH 1TRYA 6ESTA 1L1GA 1TOMH 2A4QA 1HFDA 1A4WH 2CXVA 3KQDA 2ZHQH 2PSYA 1THRH 3ITIA 3Q3YA 1ZMNA 4NFFA 4X2YA 1S0RA 4MNWA 2P59A 2O8UA 4OS1A 3EA7A 1BA8B 4I8KA 7GCHG 1ZPCA 4OGYA 2OQ5A 2SFAA 1HYLA 3KQEA 3K65B 2ULLA 2M5TA 2B5TB 3TGKE 2A4GA 4K1EA 2DE8A 3U1JB 4DGJA 3AW0A 3TJUA 1DXWA 1C2IA 2W5EA 1O5FH 4UD9H 2WUCA 3Q3XA 3RP2A 1MTVA 4D9RA 1SQTA 4HGCA 4CR9A 1RIWB 2Y81A 5A0CA 1XX9A 5C5OA 3P95A 3UNSA 1BTXA 2XWBI 1MU8B 1HB0B 5ESTE 1LQEA 4DVAU 1AMHA 1DXPA 1NO9H 3EE0B 2ILNA 2ZDNA 2BB4A 4B2BA 4ZH8A 3RMOH 1MQ6A 1UHBA 3LOXA 1AGJA 1T8LA 2NU0E 1XXFA 1YPGH 2SGAA 3SU3A 1UTJA 2Z9LA 4XBBA 1F0RA 1ID5H 2BD5A 4WJG2 1AVXA 1D3DB 4H4FA 4YESB 1K22H 3T26A 1RTFB 3GDUA 1ABIH 4WH6A 2J9NA 1YKTA 2ZFRH 1O2MA 1C2JA 3GCOA 1HXFH 3S69A 1QB9A 1C1NA 1TNLA 4B73A 1XMNB 3A89A 4DT7B 3UQVA 1IAUA 3RC6A 1GI2A 2F9BH 3SUFA 3FFGA 3EA8A 1MUEB 4GHTA 1VCQA 1O3MA 2YNBA 3RLYH 1PQAA 4JYVH 1JXPA 1AUTC 4UONA 1UVOA 2BTCE 4BOHA 4CRAA 3M36A 1MTUA 5PTPA 5TCAA 1EB1H 2BY8X 2AGEX 3SGAE 1BRBE 1QBOA 2FYQA 4X1SU 1AI8H 1EZUC 1P9SA 1JIRA 1FN8A 5FXLA 2B8OH 1K9OE 1Y8TA 1GL1A 4A7IB 2H1UA 1ZTLA 1LPZB 3TJNA 3BSQA 1Y5BT 2ZGBH 5EU8A 5K0HA 4DURA 1SGRE 2G4TA 1QQUA 3JZ1B 3ZVDA 3H7TA 3T2NA 4BTUB 1G9IE 5FPSA 1T7CA 1L4DA 1O2IA 1V2VT 8GCHG 1E34B 3LKWA 1RIWC 5EPNA 2AGIX 3KQCA 1RTKA 2BM2A 3VXEH 1QTFA 3M5NA 4AGKA 1ZSLA 4X6OA 5K7RA 1TAWA 5GJ4B 4CBOA 1ESBA 1OKXA 2J38A 1JRSA 2ZFFH 2AH4X 1UVUH 5ABWA 3TH3H 4KKDA 5EXNA 1ETTH 3GCTG 1P2IA 1NT1A 1A61H 2FTMA 1PPGE 5TJXA 5GWZA 3QZQA 3RU4D 1D3QB 2KAIB 1LVBA 1CHGA 2Z7FE 2GV6A 4KP0A 4CREA 2OP9A 3ZVCA 5DK1A 1ELVA 3LPRA 1ZHMA 4AG2A 2V3OH 1DPOA 1CT2E 4SGAE 4XFQA 1ACBE 1ELGA 1GCDA 1UK4A 1O5AB 2BDAA 3VEQB 1WSSH 3NK8A 1GJCB 5DP3A 1AWFH 4Y7AA 2ZECA 2UUJB 1JMOH 3ELAH 1EZXC 1ZSKA 1T4UH 2Y5FA 1PYTD 1KXFA 5DP8A 3GDSA 3VB4A 1K28D 1S82A 1YPKH 1P10A 4CRCA 1W14U 1HCGA 1V2RT 2G5NA 1F0SA 2A5KA 2PFEA 3BTWE 4D8NA 4HI3A 1XUKA 1TMUH 2EC9H 2PHBA 4TY7A 1D3PB 3A7TA 1C5TA 1GJ8B 1NROH 4D76A 3E91A 4AFQA 2OC0A 2ZU2A 1BITA 1CA8B 2XBXA 1G3BA 1INCA 1HIAA 1T32A 1UVSH 2Z9IA 2Q1JA 1S0QA 3K6YA 1O2SA 3FANA 3SV6A 2XCNA 1O39A 1GHXH 1YC0A 1XUHA 5A8XA 3MU1A 5JB9S 3OTJE 5GXPA 2BZAA 1WTHD 4YTAA 3PWBA 3MYWA 1XUIA 1C5MD 4K69A 1P9UA 2IJOB 1GBHA 4Y71A 1O31A 5E2OA 3UWJH 1C5PA 1UTKA 1O3IA 2ZDMA 2IPHA 1ABJH 3T62A 3AASA 4IGDA 1WAYB 1K21H 1Q31A 1MTWA 2EI7A 1P2NA 1ZHRA 2PLXA 3RXFA 2FO9A 1ORFA 3AVZA 5L2ZH 2QXHA 4OS4A 3KCGH 3KHVA 1EQ9A 1SBWA 2GV7A 4DY7B 2F9UA 2HGTH 1SGEE 4O9VA 4AG1A 2BLOA 1OWEA 2SGFE 3HGPA 4FUBA 2JH5D 2EI6A 1O2PA 5EGMA 3MU8A 2ALVA 2J34A 2ZDVH 1H1BA 1Y3YA 2GCHF 3W95A 4CBNA 1NC6A 3UNRA 4NGAH 4NFEA 3B8JA 1GI3A 3PMHB 1AFEH 1FMGA 1GI4A 2FLRH 5FX6A 3O8CA 1AN1E 2A2XH 1V3XA 3HK6B 1JOUB 1FI8A 3P70B 4K1TA 5HYOA 1BRCE 2I6QA 4I33A 2C90B 2OC1A 3GCNA 1DWDH 1AKSA 4BTIB 1GG6B 1NTPA 3UNQA 1A3BH 2UWLA 4ABIA 1PYTC 1EZQA 1O3HA 4JK5A 1O3JA 4YT6H 3PMJA 4ABGA 5DPAA 4UDWH 5FPYA 3V0XA 4FUFA 1SOTA 4K5ZA 3AAUA 1C2MA 2XBWA 1FAXA 2P3TB 1TX7A 1O36A 1NRSH 1SLXB 4MTBA 1DOJA 3A83A 3GY3A 4BAHB 1SGCA 1MCVA 1YYY1 3VB6A 3EGKH 3RXMA 5TCCA 4J1YA 1IQFA 1BTWA 2BY6X 5A8ZA 1NFWA 4WMFA 1P11E 1C2EA 4AOQA 4GCHG 2PKSB 1TQ0B 3UWIA 3Q76A 1ELFA 2OINA 3ZZCA 2ZC9H 3UQOA 1SQOA 3LDXH 3PWCA 3IG6B 2XC5A 3MWIU 2QV1A 4Y11E 3ZVFA 3SN8A 2FOGA 2ZIQH 6LPRA 3M37A 1ESAA 3T5FH 3QDZB 1KXCA 1YGCH 3RU4T 1P02A 2AFQB 1C2GA 1V2MT 4JMYA 2LNCA 2VIWA 2ZKSA 5HMAA 4E7NA 1HNEE 1FY4A 3LH3A 3BEUA 1GBEA 2AMDA 1UTOA 2HWLB 2PKAA 1XKAC 1DVAH 1EKBB 5IYTA 1KIGH 2CF8H 1DANH 2OQUA 1TABE 1OOKB 2V3HH 4NWKA 2Z3EA 1K2I1 4FVDA 3URCA 7LPRA 1DWCH 1A0JA 1CE5A 3TJOA 1AUJA 1C1PA 2BVRH 1L1JA 2GKVE 4B75A 3SOSA 4AGJA 3SBKA 1O3CA 2JH0D 2C8WB 2ZTXA 3TK9A 1ZSJA 2R0KA 3NCLA 1F0TA 1L0ZA 2OUAA 3SW2B 1LO6A 2FI5E 4TWWA 2VIQA 5T3HA 2QXJA 3KQBA 4X8VH 2IN2A 2FOEA 1ARCA 4ZHLU 2XYAA 3GCHB 1TBQH 5E8EH 3RC5A 1B5GH 3UUZA 1TWXB 1GJ7B 1MBMA 2ZI2H 1F5RA 3LGYA 4FU8A 4X1PU 1V2LT 4BNRA 3OY6U 5DKMA 3E16B 3SUEA 2BQ7B 1HAXB 1UTNA 1ZLRA 1SPJA 3A7VA 3ENSB 3A7ZA 1A3EH 3BG4B 2GMTB 3MFJA 4Y8YA 2GGVB 1BTYA 3RXAA 3E1XB 2WINI 2FS9A 2OC7A 1YPJH 1LKBA 2G8TA 3PV4A 4ZUHA 1BOQA 4K1SA 1Y3UA 3L3TA 2ANYA 2PKSC 2ZHDA 4ZKRU 3S9CA 2GVFA 4IMZA 4FUEA 1EAXA 4ABJA 1FDPA 1GJ5H 1ESTA 1XVMA 1QL7A 1ZRBA 2VNTA 4CHAB 1QHRB 3Q00A 3PB1E 3QUMP 1YBWA 4H6SB 1G2MA 1OWIA 2AEIH 3EQ0H 1F92A 2BY7X 1ANBA 2J2UA 4Y0YE 2ZPQA 1IQMA 1P04A 1G37A 1C5RA 1QA0A 3F9EA 4WXVA 3SV8A 2DUCA 2GDEH 3T27A 3ZYDA 4I8HA 1F5KU 2R2WU 1TA6A 1UO6A 3NXPA 1P2QA 4KGAA 4E05H 1GVLA 2F91A 3HK3B 4RKOB 2HLCA 2Q6DA 3RU4E 1C1QA 5GPIB 3SU6A 2BDGA 3TK6A 1C2FA 5BPEA 1B7XB 4RKJB 1VR1H 5FAHA 1FY1A 4XDEA 2A2QH 4Y79A 1IOEA 1FLEE 3DA9B 2FEQH 5I46H 1GHBG 1GBTA 1FAKH 2XNIA 1MMJN 1SLUB 4WMDA 3GCHC 1EJMA 3CENA 4U32A 3P8GA 3UIRA 4I8GA 3T28A 5A0BA 1OP8A 4Q80A 1C2DA 4M7GA 2W3KA 1QIXB 2BQ6B 4AN7A 3QWCH 5EQSA 4K60A 3D49H 1GHZA 1W3CA 3GY7A 1F7ZA 1FNIA 1LKAA 3E3TA 4INKA 2BZ6H 3BG4C 4I8LA 3ZZBA 3AW1A 4MPWA 4TWYA 1ETSH 3V3MA 2ZGHA 1O2LA 1CGIE 3M3VA 6GCHF 2H9TH 2STBE 1DS2E 2WPMS 3A8DA 1O2NA 3FP6E 1NS3A 4Y76A 3QLPH 1H8IH 1A0HB 3Q3KA 1BTHH 3GISB 1IQGA 1DE7H 4GVUA 5JBAS 4INLA 4BXSA 1FUJA 4CHAC 4X0WU 2IOTA 1O3FA 2F9NA 3RC4A 2PWXA 3E0NB 1SGPE 3NPSA 3GYMA 3FAOA 4A5TS 1HLTH 1RXPA 4K8YA 3A82A 3A8CA 1W0ZU 2W3IA 1O30A 2QY0B 4D7GA 1K1NA 1C9TA 1CT4E 4NWLA 3U8RH 1NZQH 1W0YH 3SNCA 4U30A 1EASA 1GHAG 1P2OA 4I32A 3SNEA 9LPRA 1Y3VA 3S0NA 2ZU4A 1EUFA 3P6ZB 1XUGA 4ZXXH 1NFYA 4BAMB 3GY2A 3SNBA 1BB0B 1RRKA 1NFXA 5EODA 1O2XA 3IITA 3SNAA 1RJXB 1TNJA 3DHKH 1K1LA 2A5AA 2PTNA 1BMMH 3A81A 2YOLA 4E7RG 4Q7YA 2P3UB 1G36A 4B2AA 2Z9KA 1Z1JA 4NSVA 1GHVH 1ZPBA 2OBOA 1Z6JH 1M9UA 1HPGA 3O8BA 1OP2A 2GT8A 3BTDE 2GCTB 3P8OA 1F0UA 4LOYH 1GI7B 3RMNH 2FZZA 1GBJA 3TNSA 3ZVBA 5A09A 1GMCG 1VGCB 3EAJA 4IW4E 4K2YA 2FOCA 4FUDA 1MKXH 1ELEE 1J14A 2VIVA 5EW2H 1FPCH 1AIXH 1O2YA 4FUGA 1AB9B 4ZMAH 2QF3A 2ZFPH 5JYIA 2QAAA 4NCYA 4KTSA 2VWNA 2A7HA 2TIOA 2AS9A 2BVSH 4TPYA 1XXDA 1FZZA 1DLKB 2A45B 3RM0H 1NRNH 1HJ8A 4ZXYH 2O8TA 3CP7A 1UMAH 1EXFA 3MH4A 3TU7H 2OTVA 5DJ7A 4CRFA 1CHOG 3E8LA 1T8OA 1OP0A 2XC0A 1VITG 1SVPA 3OYPA 3KL6A 1P2JA 1KLTA 4JYUH 3A85A 1Z8JB 1EATA 1NRRH 4K8BA 4CR5A 2BX4A 1HBTH 3MO3A 2WPKS 1W12U 3ATKA 1CVWH 3W94A 1OYTH 2GX4A 2ZCKP 1SGQE 1A5GH 3ODFA 4AFUA 4JK6A 4E06H 5CMXH 1S81A 3ATMA 3LGIA 1W13U 3SJ9A 4IMQA 1V6DA 2YNAA 3SNDA 2V0BA 2OC8A 1O2QA 3ATIA 2FOHA 2F9PA 1DDJA 1ETRH 1MAXA 1UHBB 1IQHA 1IQEA 2CHAB 2JETB 2BD4A 1J17T 2WPHS 2FOMB 3PMBB 3LGTA 3UR6A 1BMNH 2GP9B 2ZO3H 4JZ1A 1FY5A 2GCTC 1OYQA 3DD2H 2BDIA 2ZHFH 4X6NA 1FIZA 1VGCC 3RXUA 3S9AA 1O32A 1VZQH 3RXVA 1GDUA 1WV7H 2ZCHP 1KXBA 1BQYA 1P0SH 1TRNA 1CQQA 2WPIS 5E0GA 1O2OA 1GBDA 1O3GA 1Z71A 2UWOA 1MD8A 3BF6H 3F1SB 4H6TA 1HDTH 4KELA 8KME2 4BTTB 3F9FA 1OWKA 4XOJA 1EJAA 2BQWB 2P94A 1NY22 1SR5C 4RN6A 4LK4A 2FM2A 5FBIA 1BRUP 4TYDA 2XCFA 1DX5M 3TVJB 3VPKA 1KXEA 2F83A 4UFFH 1SOZA 1KYNA 1FIWA 3RM2H 2C8ZB 4GHQA 3BIVH 3FP7E 1GBMA 1SGFG 1TONA 1CGJE 1Z7KA 2ODQA 1BRAA 3QK1A 1DWBH 4MPUA 1GJBB 1G32B 1TOCB 2CGAA 4MG3A 2BX3A 2ZHEH 4OS5A 2XWAA 1GMDF 1N6XA 2FWWA 1KLIH 2FI4E 2K1QA 4GLYA 1LCYA 5F8XA 4FUIA 2VIDA 1MBQA 1D6RA 1LMWB 2SNVA 1AY6H 2C8XB 3LJJA 1NPMA 3ZZAA 3ZV9A 2G00A 2FOAA 4U01A 3ZZ9A 3MHWU 2JETC 3RXJA 1LVMA 1P12E 1XM1A 4X2VA 4AX9H 4B76A 3DT0H 1O2UA 3DUXH 3RXTA 2HVXA 1CU1A 1S85A 3SO3A 1GHYH 1O5BB 1BHXB 2H5CA 4WMEA 3K6ZA 3MO9A 1O2KA 5EXLA 1QRWA 1TPAE 1DFPA 1S5SA 1BIOA 1QURH 2P8OB 3KN2A 1GDQA 4I8JA 1UTLM 1W2KH 1B0FA 1K1JA 4XBDA 2VVVA 5GCHF 1C9PA 5J4QA 2SNWA 5AHGH 3RXDA 2VIOA 3A7XA 4ABHA 1SGFA 2QC2A 4GUXA 1T8NA 4NIVA 5DP7A 1J8AA 4KTCA 8LPRA 4TPIZ 1GJAB 1GWAA 3MU5A 5C1UA 3BTME 4Y0ZE 1OWHA 1GL0E 4LXBH 4YM9A 3VXFH 1O3NA 1MKWK 2R3YA 3TGJE 2QXGA 4O3TA 1GMHF 4Q7ZA 1Y3XA 3F9GA 5DP5A 1PQ7A 2RDLA 3SGQE 1HIAB 1V2OT 1MD7A 4X1RU 1DSTA 1GI0A 2FLBH 4JZDH 1PQ8A 1J15A 1AVWA 3P8FA 3ZZ7A 1LVYA 2F9VA 4MPVA 4BAQB 1FQ3A 5HXFA 5L30H 1V2ST 1ELAA 5JBCS 1E0FD 1KLJH 1OSSA 2A32A 1V2JT 4AFZA 2D8WA 2XXLA 1C5YB 3A8BA 4HFPB 3BV9B 1E38B 5E0HA 1HAHH 3E0PB 1J16A 2HNTC 1TGNA 4DOQA 2ZTYA 1YPHC 3RLWH 3MNBA 3RXRA 1ZHPA 2BY9X 3SU2A 1ZTJA 6CHAB 3QGNB 1CBWB 1FV9A 1ZZZA 4CH8B 1TMTH 4X6MA 4ZKSU 3E6PH 1Z1IA 2PV9B 2VWLA 2FYRA 1U6QA 1RS0A 4ZAEA 2P8OC 1HXEH 1H4WA 2XRCA 3GY8A 2B9LA 2W7SA 1N1LA 3RXHA 4DG4A 4WY3A 3LC3A 1AVGH 4CH2B 5C5NA 2Z3DA 1K1MA 2WV4A 5CHAB 1LDTT 1MU6B 1BDAA 3KNXA 2ALPA 3EA9A 1SFIA 2AMPA 1MKWH 1AKSB 4IBLH 4WH8A 2Z94A 4Y7BA 1YM0A 2ODPA 2A0QB 2P95A 3UOPA 1HAVA 1TNGA 3PLPA 4MVNA 5DO4H 1SG8B 1SGYE 3SV9A 3PROA 1IQLA 1YP9A 1NM6A 1HRTH 1EOJA 3SV7A 3G01A 1EAIA 3PO1B 4CRGA 2QF0A 2ZQ2A 3RXEA 1GJ9B 1SLVB 3R3GB 2VWOA 2BLVA 2ZFTA 1V2KT 1ANDA 1C1RA 3C27B 2VH6A 2XTTB 1ZYOA 1O3EA 1GG6C 1ZOMA 3NUMA 4BAOB 2BYAX 3QX5H 2BOKA 4DJZB 4DIHH 4GAWA 1YPLH 1PFXC 2A4OA 3V13A 2CMYA 1G2LA 1CO7E 2WPLS 2I6SA 2BLQA 4YOIA 2FOFA 3SGBE 2UUFB 2ZEBA 1EPTA 1SGDE 3SUGA 1K1IA 1LPKB 1O3BA 2O8LA 3A7WA 5LPEA 1LPGB 6CHAC 2HPQH 1SFQB 1CBWC 3ZZDA 1TFXA 1IHSH 1BHXF 2R0LA 5A2MH 5EXMA 2O9QA 1BBRK 5IDKA 1ELCA 2ZP0H 1W7GH 3KGPA 2V6NA 2R2MB 2ZPSA 1BMLA 2ZF0H 3M7TA 2HALA 1FPHH 2PKAB 2Y82A 1C1MA 3QTVH 4XSKU 2OD3B
chains in the Genus database with same CATH superfamily
3MNXA 3PYHA 4Y8XA 3RXSA 1W11U 4FVBA 1C5ZB 5JBTA 1L1NA 2GDDA 1PPZA 3MH6A 1O38A 3B9FH 4CRBA 1GCTB 4AYYB 1C5OH 1ZPZA 2FODA 1COWD 1MH0A 1GJDB 1HGTH 5DGJA 2A1DB 4R8TB 8GCHF 3WWFA 3SHCH 1TYNA 4WVPE 3HGNA 3TGIE 4B1TA 3RXKA 1VJAU 4D9QA 2QXIA 1C5XB 2PGQB 1H9HE 1MABB 3LGVA 2WV5A 3PO1C 2HPPH 1HJ9A 3MH5A 3QZRA 3SI3H 5BRRE 3UTUH 3KEEA 2ZGJA 3KF2A 4FUHA 1C4V2 3FP8E 4WWYA 1QL9A 1SKYE 1YLDA 5G4BA 2NU3E 3FZZA 4XBCA 5CE1A 2G4UA 2J4IA 4AC9A 3RXCA 1PPHE 4TSFD 5DSFA 3UREA 1C4Y2 2HRVA 1HAIH 3HPTB 1W10U 1GI8B 2V35A 1ELDE 1YCPM 4Y6DA 1IQIA 1GBAA 4Z0KA 1C2LA 3M5LA 3BTKE 3SU5A 1O2HA 3M61U 3OX7U 3QGJA 4F49A 3DSGA 4FUCA 1T4VH 4JYTA 1TIOA 1O3KA 1G3CA 3QO6A 1A1RA 1BTPA 1QNJA 2WUBA 1P09A 2H5DA 3B23B 1FY8E 1WUNH 1XUFA 2UUKB 3LU9B 5FPTA 1ELBA 4ABBA 1SQRA 2SGDE 4LZ4B 1EAUA 4FUJA 2P93A 2Y7ZA 2NU4E 3MU0A 1TE0A 2GMTC 5T6DA 1TX8A 2BMGB 3STIA 1QFKH 3I78A 3F3BA 2BY5X 2Y5HA 1C5NH 1VCPA 2QN5T 4X8TH 1MCTA 1TX6A 5EOKA 3UR9A 3CS7A 5I25A 2BD7A 1AZZA 2ANMH 2FMJA 3F68H 4RI0A 2GCHG 4CRDA 1MZDA 3F2FA 1QBNA 3M5OA 1GMHG 3U8OH 5EQQA 4NIWA 2Z6BD 2NU1E 1V2NT 4XD7D 1GCTC 1W7XH 4Q63A 3MO6A 3GDVA 2BXUH 2SGEE 1IQKA 3LGWA 4MDSA 4FU7A 2GT7A 3WY8A 5DP4A 1A5HA 1PJPA 1J9CH 4Q2KA 4GPGA 1A0LA 1GPZA 2TGPZ 2AERH 1ANCA 2TPIZ 2VGCB 1EZSC 5GIBA 3MNSA 2ANKH 4NSYA 3DFJA 1DY8A 4UFDH 3E90B 1AO5A 3RMMH 1S83A 1BUIA 2H6MA 5FHTA 3TPIZ 2XBYA 1CSOE 1LHFH 5F03A 1O5EH 1O2JA 3LONA 1TGTA 1V2UT 2FOBA 4U2WA 1FXYA 3I77A 1QGFA 2ZFQH 4A1VA 5F8TA 2DE9A 3P8NA 3U8TH 1O5CB 2C4FH 5KGOA 2VIPA 1C5LH 4PROA 5L6NH 4IN2A 1ZJKA 1MTSA 2YMSD 4ZHMU 1GBFA 4NZQA 1DUAA 1LHCH 2ASUB 4A1TA 1E1RD 1TBRH 1H8DH 1C1SA 4FXGH 4THNH 5F6MA 1ZRKA 1N6YA 1G30B 1V2TT 3P92A 2J92A 3RXGA 4NG9H 3OU0A 2XBVA 2Z9GA 1P03A 2AIPA 2FTLE 1QJ1B 4YLQH 2BDBA 4QT8C 1O34A 3MI4A 2EI8A 1Y5AT 1QR3E 1K1PA 1S6FA 1BMAA 1BTUA 1BJVA 1WCZA 4NA7A 2VINA 1WBGB 2QE7D 1L2EA 3Q77A 1QCPA 2TBSA 3R0FA 1EP5A 3HKJB 3RDZA 1TNKA 1TNHA 3IWMA 4ISIH 2EEKA 2BD9A 1UVTH 3K9XB 1LQDB 2PTCE 2P3FH 3GICB 5AFYH 3EDXB 2BOHB 1C4U2 1EP6A 1O2WA 2QF4A 1OWDA 4BANB 2EY4C 3OY5U 4ACBA 1XVOA 3LT3A 1THSH 1SI5H 2VGCC 4ISHH 4X6PA 2Y6TA 5C2ZA 4B74A 1ZMLA 1BZXE 1UCYK 3NKKA 2NU2E 1TGCA 2G52A 1KTTB 4GSOA 1KXDA 1ZGVA 4GCHF 5KEDA 1Y59T 4AZ2B 1TB6H 2AGGX 1FN6A 3BTQE 5T6FA 1MZAA 1SGNE 1GBBA 1C5UA 4INHA 1DM4B 3ESTA 1A46H 2TRMA 3UAIC 4FU9A 3ZVEA 4WXIA 5SGAE 1UVPA 1WYKA 2O8WA 4MNYA 3HKIB 1O3DA 1A7SA 3RUOA 3T29A 2A5IA 1Z8GA 2LPRA 1DT2A 3BEFB 3VB5A 3ZZ6A 1ELTA 4YT7H 4ZHAA 3PV5A 4YLUA 2B0FA 3GY5A 1TRMA 3STJA 3RMLH 1E37B 2AIQA 2QGRA 3N7DA 4O97A 3SORA 4JCNA 2KAIA 2Y7XA 2GTBA 1O5GH 3AAVA 4JZFH 2LELA 2ZDAH 3M3TA 1UTPA 1EOLA 3RXPA 1PPBH 5HM2A 4I31A 4RSPA 1O2VA 3MNCA 3SHAH 2YMSC 3FKSD 1G3DA 5EW1H 1C2HA 1TGBA 1VITH 3ZV8A 1OXGA 3ZZ5A 5C1XA 4MPXA 2OCVB 1GI5A 1QB6A 1JWTA 1SL3A 1AB9C 3A84A 4IN1A 3UPEA 2BHGA 4MNXA 4ZKNU 3TLOA 1SHHB 3M3SA 3O8RA 1GBKA 2OLGA 3PTNA 1P06A 1H9IE 3PLKA 1P01A 1O3OA 2WZQA 3UFAA 3SU1A 1C5QA 2ZU3A 1Z8RA 9ESTA 4B2CA 2CV3A 1C5VA 3A8AA 1QL8A 5JBBS 2ZGXH 2FESH 1O2GH 2CF9H 1O2ZA 2EQNA 4NA8A 4FOUC 4KTUA 2TGAA 1SLWB 5FBEA 1KSNA 3BG8A 1HAOH 2QIQA 1TLDA 1ARBA 1UCYH 3OAAD 2B7DH 4O3UA 3ZVAA 1F5LA 1V2WT 2Y5GA 4DW2U 1DICA 1OX1A 3LH1A 3URDA 4MQAA 1GI6A 3H7OA 3MTYA 3U1IB 1P05A 3TH2H 2C3SA 1ANEA 4Y8ZA 1QZ8A 1TPOA 1SGTA 2R9PA 1UTMA 3ZZ4A 3RXLA 2XNDD 1NRPH 4JZIA 3BTEE 1AWHB 3SU4A 1EAWA 1O3LA 2HLDD 4AB9A 1AFQB 1Y3WA 2ZFSA 2P16A 4Y10E 1HV7A 5C1YA 1V2PT 5DN6D 1NFUA 2V3MA 1AHTH 2WYGA 1MTNB 2JH6D 2ZWLH 2F3CE 5A0AE 5GDSH 4AB8A 1V2QT 2G81E 4H42U 2CHAC 1GJ4H 5J4SA 1Z8IB 4X2XA 1D6WA 3SYJA 3DFLA 2FP7B 3MU4A 1QQ4A 1C1OA 4O03A 5FCRA 6GCHG 1C5WB 1HAPH 3TK5A 1ZJDA 1WOFA 2BD8A 1O2TA 3NWUA 1BTZA 1DITH 4ISOA 2VH0A 4OGXA 1LHGH 2WHXA 3GOVB 5EQRA 5GNDA 3TH4H 1YWUA 1T31A 1GHBF 1P3EA 3C1KA 1YCPK 1NRQH 3RXOA 5FCKA 3KQ5A 3SU0A 1TMBH 2ANWA 4AYVB 1MAYA 1KTSB 1N8OB 2BDHA 2H9EH 4P02A 4ABEA 5L2YH 3S7HB 3H09A 1IQJA 2D1JA 4BXWA 1TQ7B 4ISLA 1H8ED 2FS8A 1SGIB 3PM3A 5DP6A 3FZDA 5ESBA 3SJKA 1OPHB 7ESTE 2RG3A 4X8SH 1THPB 5ETXA 3N99A 2G51A 2SGQE 4HTCH 4TY6A 2ZGCA 1JRTA 3K2UA 4ISNA 3ATLA 5C20A 3L33A 4F4OC 2NWNA 4AFSA 2ZDLA 3M7QA 1NESE 2CJIA 5H4IB 1HAYB 1PQ5A 1E35B 2VU8E 2GZ9A 1SB1H 1UK2A 3FOAA 3ZYEA 1E36B 4BAKB 3D62A 3BN9A 4OS7A 3GY6A 1MQ5A 1FJSA 2JIZD 2GD4B 1DY9A 3LGUA 3TNTA 4OS2A 2Q6GA 4MNVA 3VGCB 3OSYA 1AFQC 1ZMJA 2BXTH 4X8UH 1WU1A 1LHEH 3UOUA 1ZR0A 1HAGE 3F9HA 2STAE 2BLWA 1MTNC 5F8ZA 1RFNA 1YPEH 1VKYA 2G5VA 1P8VC 3L6PA 5B6LA 2HOBA 4AORA 2BDYA 5EG4A 1BBRE 3M7UA 3SV2H 1W8BH 3KIDU 1GHAF 4MLFB 2TGTA 4Z6AH 2THFB 2Y80A 1KXAA 2AYWA 1E79D 2PSXA 4I7YH 1S84A 2CN0H 1VCWA 1ZGIA 3VB7A 1GDNA 1YCPH 3S9BA 4YOJA 2PGBB 5JPMH 1EX3A 2J95A 1RGQA 2PUXB 1AU8A 2FDAA 1YPMH 3SJIA 4UE7H 3N7OA 2ODYB 3FVFB 4XRNA 4A92A 5HM9A 1XKBC 1TPPA 3HATH 2A7JA 1N8OC 2KX4A 7GCHF 1TALA 1UK3A 3D65E 1O37A 3GS9A 4Q7XA 1HAZB 1AZ8A 5EIYA 2VB0A 2QA9E 2ZU1A 4A6LA 4ABAA 3BTFE 1D3TB 2EA3A 1GMCF 2G55A 3S7KB 2ZPRA 1TA2A 5HKKD 3VFEA 1QJ6B 3OEHD 1C1VH 4ZROA 1GVKB 1S6HA 1QB1A 2FX6A 3UY9A 3PMAB 2ZNKH 3RXQA 8ESTE 2H9HA 2C93B 3JZ2B 2R3UA 1O2RA 1KY9A 1RD3B 3SJOA 3LJOA 3VGCC 3BIUH 1LHDH 4YOGA 1XUJA 5C67A 2BD2A 2Z9JA 3ZVGA 5DG6A 4R0IA 3ATWA 1H9LB 3U69H 1CHOF 4ABDA 1SHYA 1Y5UT 2UWPA 2WPJS 1CA0B 1Z6EA 1GJ6A 1YF4A 1IHTH 1O3AA 1VITF 1L4ZA 4F48B 1C1UH 2WYJA 4B71A 1C1WH 2HNTF 2W7UA 2ZTZA 5AFZH 1AE8H 3TITA 5B6OA 3SUDA 1JBUH 3ZZ3A 2D26C 5EPYA 5C3NA 1C5SA 1HAVB 2FPZA 4NIYA 5HGGA 4X2WA 1YLCA 4VGCB 1A2CH 2W26A 4IC6A 2JKHA 1SMFE 4X1NU 3MMGA 1GI1A 1WTGH 1D9IA 1TBZH 2ZQ1A 5JB8S 2ZDKA 1UJ1A 2D2DA 1DSUA 3PLBA 2ZCLP 4OS6A 5AVDA 2PW8H 4DCDA 2WPDD 5CHAC 4ABFA 1BT7A 4IC5A 2QYIA 2A7CA 1T8MA 3MH7A 3V12A 4D7FA 3MOCA 2XW9A 3PTBA 3BEIB 1QJ7B 2RCEA 5EJ1A 3MQKC 2XC4A 2RA0A 1GBLA 1ZTKA 1PPEE 3TIUA 2LP6A 5CHBA 3D23A 1AE5A 1GBCA 2AMQA 2QCYA 3M5MA 4SGBE 1CGHA 1X7AC 4ASHA 1NU7B 2VWMA 3QTOH 4NIXA 1DLEA 2FI3E 2A4RA 1QY6A 1GMDG 1HJAB 4UFGH 5E2PA 4UFEH 3BTTE 1EPTB 3EYDA 2ZG0H 3ZIAD 3W1EA 5LPFA 1RTLA 1QRZA 1WQSA 4X1QU 2OBQA 1Q2WA 2FX4A 4K3JA 4A1XA 2VJ1A 3GCTF 4IS5A 3VB3A 1WQVH 3I29A 2ZZUH 3H5CB 3ZZ8A 3O8DA 3RXBA 4RT0A 3SI4H 3TJVA 2PUQH 1SC8U 2BD3A 3LC5A 5AF9H 5A8YA 1B0EA 4NA9H 4YZUA 5FX5A 1GGDB 1SSXA 3U9AH 5E0JA 1QA7A 1K0HA 1G3EA 2C8YB 1P2KA 3RXIA 1JIMA 1GI9B 1CA0C 1DUEA 1QRXA 1TPSA 1P2MA 1F2SE 1GVZA 5C0UA 3SQHE 5JDUB 1A5IA 1GBIA 1FY3A 4YO9A 1PPCE 4ZKOU 3A88A 2RA3A 1BBRH 2L74A 2Q6FA 2ZA5A 3F6UH 1BCUH 2ESTE 2ZHWH 4ESTE 1HUTH 5GCHG 2HNTE 4NZLA 3SZNA 1YPHE 4VGCC 1O35A 1IQNA 4XE4A 2VVUA 1Q3XA 3V7TA 1EJNA 4DIIH 2J94A 2FIRH 1KDQA 5T6GA 1C2KA 1K1OA 5LPRA 2GZ8A 2BVXH 1NN6A 1C1TA 2UUYA 3OFND 3T25A 3A7YA 4HZHA 3GY4A 2RFKC 1FONA 3GYLB 2OXSA 1OS8A 1UCYE 1PPFE 1LVOA 2XOKD 1P3CA 3A80A 1MKXK 3P17H 1EB2A 1OWJA 1VJ9U 2ZU5A 1LTOA 1TNIA 3LIWA 3M35A 2Z3CA 2FXRA 2TGDA 4M9FA 4UEHH 1GHWH 4WF8A 4J2YB 3BTHE 3UB0A 1O33A 3BTGE 1CT0E 1P57B 1SQAA 1HJAC 2BDCA 2VVCA 2J98A 2KCPA 3SQEE 1EPTC 1QBVH 7KMEH 4JZEH 2A31A 1UTQA 2SGPE 2H2ZA 3NZIA 1O3PB 3CS0A 2PR3A 1D4PB 1BJUA 1AD8H 3QN7A 3SJ8A 3A86A 1AQ7A 2O8MA 1DWEH 1GGDC 2F9OA 5DP9A 5LH8A 3A87A 4LZ1H 3U98H 1KDQB 2GZ7A 5LGOA 1TGSZ 3ODDA 1O0DH 1NU9A 1O5DH 1TRYA 6ESTA 1L1GA 1TOMH 2A4QA 3FN8A 1HFDA 1A4WH 2CXVA 3KQDA 2ZHQH 2PSYA 1THRH 3ITIA 3Q3YA 1ZMNA 4NFFA 4X2YA 1S0RA 4MNWA 2P59A 2O8UA 4OS1A 3EA7A 1BA8B 4I8KA 7GCHG 1ZPCA 4OGYA 2OQ5A 2SFAA 4B6EA 1HYLA 3KQEA 3K65B 2ULLA 2M5TA 2B5TB 3TGKE 2A4GA 2J98B 4K1EA 2DE8A 3U1JB 4DGJA 3AW0A 3TJUA 1DXWA 1C2IA 2W5EA 1O5FH 4UD9H 2WUCA 1W0KD 3Q3XA 3RP2A 1MTVA 4D9RA 1SQTA 4HGCA 4CR9A 1RIWB 2Y81A 5A0CA 1XX9A 5C5OA 3P95A 3UNSA 1BTXA 2XWBI 1MU8B 1EFRD 1HB0B 5ESTE 1LQEA 4DVAU 1AMHA 1DXPA 1NO9H 3EE0B 2ILNA 2ZDNA 2BB4A 4B2BA 4ZH8A 3RMOH 1MQ6A 1UHBA 5KECA 3LOXA 1AGJA 1T8LA 2NU0E 1XXFA 1YPGH 2SGAA 3SU3A 1UTJA 2Z9LA 4XBBA 1F0RA 1ID5H 2BD5A 4WJG2 1AVXA 1D3DB 4H4FA 4YESB 1K22H 3T26A 1RTFB 3GDUA 1ABIH 4WH6A 2J9NA 2W6JD 1YKTA 3PRDA 2ZFRH 1O2MA 1C2JA 3GCOA 1HXFH 3S69A 2HVYB 1QB9A 1C1NA 1TNLA 4B73A 1XMNB 3A89A 4DT7B 3UQVA 1IAUA 3RC6A 1GI2A 2F9BH 3SUFA 2KCYA 3FFGA 3EA8A 1MUEB 4GHTA 1VCQA 1O3MA 2KZ4A 2YNBA 3RLYH 1PQAA 4JYVH 1JXPA 1AUTC 4UONA 1UVOA 2BTCE 4BOHA 4CRAA 3M36A 1MTUA 5PTPA 5TCAA 1EB1H 2BY8X 2AGEX 3SGAE 1BRBE 1QBOA 2FYQA 4X1SU 1AI8H 1EZUC 1P9SA 1JIRA 1FN8A 5FXLA 2B8OH 1K9OE 1Y8TA 1GL1A 4A7IB 2H1UA 1ZTLA 1LPZB 3TJNA 3BSQA 1Y5BT 2ZGBH 5EU8A 3WWBA 5K0HA 4DURA 1SGRE 2G4TA 1QQUA 2QF5A 3JZ1B 3ZVDA 3H7TA 3NRLA 2F43B 2PP6A 3T2NA 4BTUB 1G9IE 5FPSA 1T7CA 2WV9A 4FETA 1L4DA 1O2IA 1YLNA 1V2VT 8GCHG 1E34B 3LKWA 1RIWC 5EPNA 2AGIX 3KQCA 1RTKA 2BM2A 3VXEH 1QTFA 3M5NA 4AGKA 1ZSLA 4X6OA 5K7RA 1TAWA 5GJ4B 4CBOA 1ESBA 1OKXA 5HIZA 2J38A 1JRSA 2ZFFH 4TT3D 2AH4X 1UVUH 5ABWA 3TH3H 1WDIA 4KKDA 5EXNA 1ETTH 3GCTG 1P2IA 1NT1A 1A61H 2FTMA 1PPGE 5TJXA 5GWZA 3QZQA 3RU4D 1D3QB 2KAIB 1LVBA 1CHGA 2Z7FE 2GV6A 4KP0A 4CREA 2OP9A 3ZVCA 5DK1A 1ELVA 3LPRA 1ZHMA 4AG2A 2V3OH 1DPOA 1CT2E 4SGAE 4XFQA 1ACBE 1ELGA 1GCDA 1UK4A 1O5AB 2BDAA 3VEQB 1WSSH 3NK8A 1GJCB 5DP3A 1AWFH 4Y7AA 2ZECA 2UUJB 1JMOH 3ELAH 1EZXC 1ZSKA 1T4UH 2Y5FA 1PYTD 1KXFA 5DP8A 3GDSA 3VB4A 1K28D 1S82A 1YPKH 1P10A 4CRCA 1W14U 1HCGA 1V2RT 2G5NA 1F0SA 2J97A 2A5KA 2PFEA 3BTWE 4D8NA 4HI3A 1XUKA 1TMUH 2EC9H 2PHBA 4TY7A 1D3PB 3A7TA 1C5TA 1GJ8B 1NROH 4D76A 2L6OA 3E91A 4AFQA 2OC0A 2ZU2A 1BITA 1CA8B 2XBXA 1G3BA 1INCA 1HIAA 1T32A 1UVSH 2Z9IA 2Q1JA 1S0QA 3K6YA 1O2SA 3FANA 3SV6A 2XCNA 1O39A 1GHXH 1YC0A 1XUHA 5A8XA 3MU1A 4RT1A 5JB9S 3OTJE 5GXPA 2BZAA 1WTHD 4YTAA 3PWBA 3MYWA 1XUIA 1C5MD 4K69A 1P9UA 2IJOB 4I86A 1GBHA 4Y71A 1O31A 5E2OA 4P00A 3UWJH 1C5PA 1UTKA 1O3IA 2ZDMA 2IPHA 1ABJH 3T62A 3AASA 4IGDA 1WAYB 1K21H 1Q31A 1MTWA 2EI7A 1P2NA 1ZHRA 2PLXA 3RXFA 2FO9A 1ORFA 3F2HA 4ZCNA 3AVZA 5L2ZH 2QXHA 4OS4A 3KCGH 3KHVA 1EQ9A 1SBWA 2GV7A 4DY7B 2F9UA 1NBMD 2HGTH 1SGEE 4O9VA 4AG1A 2BLOA 1OWEA 2SGFE 3HGPA 4FUBA 2JH5D 2EI6A 1O2PA 5EGMA 3MU8A 2ALVA 2J34A 2ZDVH 1H1BA 1Y3YA 2GCHF 3W95A 4CBNA 1NC6A 3UNRA 4NGAH 4NFEA 3B8JA 4OM9A 1GI3A 3PMHB 1AFEH 3FO8D 1FMGA 1GI4A 2FLRH 5FX6A 3O8CA 2GJGA 1AN1E 2A2XH 1V3XA 3HK6B 1JOUB 1FI8A 3P70B 4K1TA 5HYOA 1BRCE 2I6QA 4I33A 2C90B 2OC1A 3GCNA 1DWDH 1AKSA 4BTIB 1GG6B 1NTPA 3UNQA 1A3BH 2UWLA 4ABIA 1PYTC 1EZQA 1O3HA 4JK5A 1O3JA 4YT6H 3PMJA 4ABGA 5DPAA 4UDWH 5FPYA 3V0XA 4FUFA 1SOTA 2K0QA 4K5ZA 3AAUA 1C2MA 2XBWA 1FAXA 3PRBA 2P3TB 1TX7A 1O36A 1NRSH 1SLXB 4MTBA 1DOJA 3A83A 5F53A 3GY3A 4BAHB 1SGCA 1MCVA 1W0JD 1YYY1 3VB6A 3EGKH 5CDFE 3RXMA 5TCCA 4J1YA 1IQFA 1BTWA 2BY6X 5A8ZA 1NFWA 4WMFA 1P11E 1C2EA 4AOQA 4GCHG 2PKSB 1TQ0B 3UWIA 3Q76A 1ELFA 2OINA 3ZZCA 2ZC9H 3UQOA 1SQOA 3LDXH 3PWCA 3IG6B 2XC5A 3MWIU 2QV1A 4Y11E 3ZVFA 3SN8A 2FOGA 2ZIQH 3CNRA 3U28C 6LPRA 3M37A 1ESAA 3T5FH 3QDZB 1KXCA 1YGCH 3RU4T 1P02A 2AFQB 1C2GA 1V2MT 4JMYA 2LNCA 2VIWA 3AK5A 4HG6A 2ZKSA 5HMAA 4E7NA 1HNEE 1FY4A 3LH3A 3BEUA 1GBEA 2AMDA 1UTOA 2HWLB 2PKAA 5T1VA 1XKAC 1DVAH 1EKBB 5IYTA 1KIGH 2CF8H 2J5UA 1DANH 2OQUA 1TABE 1OOKB 3OTPA 2V3HH 4NWKA 2Z3EA 1K2I1 4FVDA 3URCA 7LPRA 1DWCH 1A0JA 1CE5A 3TJOA 1AUJA 1C1PA 2BVRH 1L1JA 2GKVE 4B75A 3SOSA 4AGJA 3SBKA 1O3CA 2JH0D 2C8WB 2ZTXA 3TK9A 1ZSJA 2R0KA 3NCLA 1F0TA 1L0ZA 2OUAA 3SW2B 1LO6A 2FI5E 4TWWA 2VIQA 5T3HA 2QXJA 3KQBA 2V7QD 4X8VH 2IN2A 2FOEA 3DSPA 1ARCA 4ZHLU 2XYAA 4Q4LA 3GCHB 1TBQH 5E8EH 3RC5A 1B5GH 1S6LA 3UUZA 1TWXB 1GJ7B 1MBMA 2ZI2H 2KM0A 1F5RA 3LGYA 4FU8A 4X1PU 1V2LT 4BNRA 3OY6U 5EJZA 5DKMA 3E16B 3SUEA 2BQ7B 1HAXB 1UTNA 2AHME 1ZLRA 1SPJA 3A7VA 3ENSB 3A7ZA 1A3EH 3BG4B 2GMTB 3MFJA 4Y8YA 2GGVB 1BTYA 3RXAA 2JJ2D 1OHHD 2WINI 3E1XB 2FS9A 2OC7A 1YPJH 1LKBA 2G8TA 3PV4A 4ZUHA 4YXWD 1BOQA 4K1SA 1Y3UA 3L3TA 2ANYA 2PKSC 2ZHDA 4ZKRU 3S9CA 2GVFA 4IMZA 4FUEA 1EAXA 4ABJA 1FDPA 1GJ5H 2KCAA 1ESTA 1XVMA 1QL7A 1ZRBA 2VNTA 4CHAB 5IK2D 1QHRB 3Q00A 2KFWA 3PB1E 3QUMP 1YBWA 4H6SB 1G2MA 1OWIA 2AEIH 3EQ0H 1F92A 2BY7X 5C0TA 1ANBA 2J2UA 4Y0YE 2ZPQA 1IQMA 1P04A 1G37A 2IJD1 1C5RA 1QA0A 3F9EA 4WXVA 3SV8A 2DUCA 2GDEH 3T27A 3ZYDA 4I8HA 1F5KU 2R2WU 1TA6A 1UO6A 3NXPA 1P2QA 4KGAA 4E05H 1GVLA 2F4LA 2F91A 3HK3B 4RKOB 2HLCA 2Q6DA 3RU4E 1C1QA 5GPIB 3SU6A 2BDGA 2W6ID 3TK6A 1C2FA 5BPEA 1B7XB 4RKJB 1VR1H 5FAHA 1FY1A 4XDEA 2A2QH 4Y79A 1IOEA 1FLEE 3DA9B 2FEQH 5I46H 1GHBG 1GBTA 1FAKH 2XNIA 1MMJN 1SLUB 4WMDA 4Z1MD 3GCHC 1EJMA 3CENA 4U32A 3P8GA 3UIRA 4I8GA 3T28A 5A0BA 1OP8A 4Q80A 1C2DA 4M7GA 2W3KA 1QIXB 2BQ6B 4AN7A 2JJ1D 3QWCH 5EQSA 4K60A 3D49H 1GHZA 1W3CA 3GY7A 1F7ZA 1FNIA 1LKAA 3E3TA 4INKA 2BZ6H 3BG4C 4I8LA 3ZZBA 3AW1A 4MPWA 4TWYA 1ETSH 3V3MA 1E1QD 2ZGHA 1O2LA 1CGIE 3KYGA 3M3VA 2H9TH 2STBE 6GCHF 1DS2E 2WPMS 3A8DA 1O2NA 3FP6E 1NS3A 4Y76A 3QLPH 1H8IH 1A0HB 3Q3KA 1BTHH 3GISB 1IQGA 1DE7H 4GVUA 5JBAS 2JDID 4INLA 4BXSA 1FUJA 4CHAC 4X0WU 2IOTA 1O3FA 2F9NA 3RC4A 2PWXA 3E0NB 1SGPE 3NPSA 3GYMA 3FAOA 4A5TS 1HLTH 1RXPA 4K8YA 3A82A 3A8CA 1W0ZU 2W3IA 1O30A 2QY0B 4D7GA 1K1NA 1C9TA 1CT4E 4NWLA 3U8RH 1NZQH 1W0YH 3SNCA 4U30A 1EASA 1GHAG 1NBME 1P2OA 4I32A 3SNEA 9LPRA 1Y3VA 3S0NA 2ZU4A 1EUFA 3P6ZB 1XUGA 4ZXXH 1NFYA 4BAMB 3GY2A 3SNBA 1BB0B 1RRKA 1NFXA 5EODA 1O2XA 3IITA 3SNAA 1RJXB 1TNJA 3DHKH 1K1LA 2A5AA 2PTNA 1BMMH 3A81A 2YOLA 4E7RG 4Q7YA 1BMFD 2P3UB 1G36A 4B2AA 2Z9KA 1Z1JA 4NSVA 1GHVH 1ZPBA 2OBOA 1Z6JH 1M9UA 1HPGA 3O8BA 1OP2A 2GT8A 3BTDE 2GCTB 3P8OA 1F0UA 4LOYH 1GI7B 3RMNH 2FZZA 1GBJA 3TNSA 3ZVBA 5A09A 1GMCG 1VGCB 3EAJA 4IW4E 4K2YA 2YMSB 2FOCA 4FUDA 1MKXH 1ELEE 1J14A 2VIVA 5EW2H 3PV2A 1FPCH 1AIXH 1O2YA 4FUGA 2CK3D 1AB9B 4ZMAH 2QF3A 2ZFPH 5JYIA 2QAAA 4NCYA 4KTSA 2VWNA 2A7HA 2TIOA 2AS9A 2BVSH 4TPYA 1XXDA 1FZZA 1DLKB 2A45B 3RM0H 1NRNH 1HJ8A 4ZXYH 5FL7D 2O8TA 3CP7A 1UMAH 1EXFA 3MH4A 2KCOA 3TU7H 2OTVA 5DJ7A 4CRFA 1CHOG 3E8LA 1T8OA 1OP0A 2XC0A 1VITG 1SVPA 3OYPA 3KL6A 1P2JA 1KLTA 4JYUH 5C94A 3A85A 1Z8JB 1EATA 1NRRH 4K8BA 4CR5A 2BX4A 1HBTH 3MO3A 2WPKS 1W12U 3ATKA 1CVWH 3W94A 1OYTH 2GX4A 2ZCKP 1SGQE 1A5GH 3N7EA 2WSSD 3ODFA 4AFUA 4JK6A 4E06H 5CMXH 1S81A 3ATMA 3LGIA 1W13U 3SJ9A 4IMQA 1V6DA 2YNAA 3SNDA 2V0BA 2OC8A 1O2QA 3ATIA 2FOHA 2F9PA 1DDJA 1ETRH 1MAXA 3DSOA 1UHBB 1IQHA 1IQEA 2CHAB 2JETB 2BD4A 1J17T 2WPHS 2FOMB 3PMBB 3LGTA 3UR6A 1BMNH 2GP9B 2ZO3H 4JZ1A 1FY5A 2GCTC 1OYQA 3DD2H 2BDIA 2ZHFH 4X6NA 1FIZA 4ASUD 1VGCC 3RXUA 3S9AA 3F2GA 1O32A 1KMHB 1VZQH 3RXVA 1GDUA 1WV7H 2ZCHP 4DT4A 1KXBA 3F0PA 1BQYA 1P0SH 1TRNA 1CQQA 2WPIS 3OE7D 5E0GA 1O2OA 2VBCA 1GBDA 3WW7A 1O3GA 1Z71A 2UWOA 1MD8A 3BF6H 3F1SB 1UW7A 3KYFA 4H6TA 1HDTH 4KELA 8KME2 4BTTB 3F9FA 1OWKA 4XOJA 1EJAA 2BQWB 2P94A 1NY22 1SR5C 4RN6A 4LK4A 2FM2A 5FBIA 3SZEA 1BRUP 4TYDA 2XCFA 1DX5M 3TVJB 1FX0B 3VPKA 1KXEA 2F83A 4UFFH 1SOZA 1KYNA 1FIWA 3RM2H 2C8ZB 4GHQA 3BIVH 3FP7E 1GBMA 1SGFG 1TONA 1CGJE 1Z7KA 2ODQA 1BRAA 3QK1A 1DWBH 4MPUA 1GJBB 1G32B 1TOCB 2CGAA 4MG3A 2BX3A 2ZHEH 4OS5A 2XWAA 1GMDF 1N6XA 2FWWA 1KLIH 2FI4E 2K1QA 4GLYA 1LCYA 5F8XA 4FUIA 2VIDA 1MBQA 1D6RA 1LMWB 2SNVA 1AY6H 2C8XB 3LJJA 1NPMA 3ZZAA 3ZV9A 2G00A 2FOAA 4U01A 3ZZ9A 3MHWU 3F0OA 2JETC 3RXJA 1LVMA 1P12E 1XM1A 4X2VA 4AX9H 4B76A 3DT0H 1O2UA 3DUXH 3RXTA 2HVXA 1CU1A 1S85A 3SO3A 1GHYH 1O5BB 1BHXB 2H5CA 4WMEA 3K6ZA 3MO9A 1O2KA 5EXLA 1QRWA 1TPAE 1DFPA 1S5SA 1BIOA 1QURH 2P8OB 3KN2A 1GDQA 4I8JA 1UTLM 1W2KH 1B0FA 1K1JA 4XBDA 2VVVA 5GCHF 4ACAA 1C9PA 5J4QA 2SNWA 5AHGH 3RXDA 2VIOA 3A7XA 4ABHA 1SGFA 2QC2A 4GUXA 1T8NA 4NIVA 5DP7A 1J8AA 3OEED 4KTCA 8LPRA 4TPIZ 1GJAB 1GWAA 3MU5A 5C1UA 3BTME 4Y0ZE 1OWHA 1GL0E 4LXBH 4YM9A 3VXFH 1O3NA 1MKWK 2R3YA 3TGJE 2QXGA 4B6FA 4O3TA 1GMHF 4Q7ZA 1Y3XA 3F9GA 5DP5A 1PQ7A 2RDLA 3SGQE 1HIAB 1V2OT 1MD7A 4X1RU 1DSTA 1GI0A 2FLBH 4JZDH 1PQ8A 1J15A 1AVWA 5EJLA 3P8FA 3ZZ7A 1LVYA 2F9VA 4MPVA 4BAQB 1FQ3A 5HXFA 5L30H 2KR7A 1V2ST 1ELAA 5JBCS 1E0FD 1KLJH 1OSSA 2A32A 1V2JT 4AFZA 2D8WA 2XXLA 1C5YB 3A8BA 4HFPB 3BV9B 1E38B 5E0HA 1HAHH 5HIYA 3E0PB 1J16A 2HNTC 1TGNA 4DOQA 1YY3A 2ZTYA 1YPHC 3RLWH 3MNBA 3RXRA 1ZHPA 2BY9X 3SU2A 1ZTJA 6CHAB 3QGNB 1CBWB 1FV9A 1ZZZA 4CH8B 1TMTH 4X6MA 4ZKSU 3E6PH 1Z1IA 2RDEA 2PV9B 2VWLA 2FYRA 1U6QA 1RS0A 4ZAEA 2P8OC 1HXEH 1H4WA 2XRCA 3GY8A 2B9LA 2W7SA 1N1LA 3RXHA 4DG4A 4WY3A 3LC3A 1AVGH 4CH2B 5C5NA 2Z3DA 1K1MA 2WV4A 3EE7A 1LDTT 5CHAB 1MU6B 1BDAA 3KNXA 2ALPA 2OK5A 3EA9A 1SFIA 2AMPA 1MKWH 1AKSB 4IBLH 4WH8A 2Z94A 4Y7BA 1YM0A 5C17A 2ODPA 2A0QB 2P95A 3UOPA 1HAVA 1TNGA 3PLPA 4MVNA 5DO4H 1SG8B 1SGYE 3SV9A 3PROA 1IQLA 1YP9A 1NM6A 1HRTH 1EOJA 3SV7A 3G01A 1EAIA 3PO1B 4CRGA 2QF0A 2ZQ2A 3RXEA 1GJ9B 1SLVB 3R3GB 2VWOA 2BLVA 2ZFTA 1V2KT 1ANDA 1C1RA 3C27B 1H8HD 2VH6A 2XTTB 1ZYOA 1O3EA 1GG6C 1ZOMA 3NUMA 4BAOB 2BYAX 3QX5H 2BOKA 4DJZB 4DIHH 4GAWA 1YPLH 1PFXC 2A4OA 2M2AA 3V13A 2CMYA 1G2LA 1CO7E 2WPLS 4F55A 2I6SA 2IPQX 2BLQA 4YOIA 2FOFA 3SGBE 2UUFB 2K8IA 2ZEBA 1EPTA 1SGDE 3SUGA 1K1IA 1LPKB 1O3BA 2O8LA 3A7WA 1WXRA 5LPEA 1LPGB 6CHAC 2HPQH 1SFQB 1CBWC 3ZZDA 1TFXA 1IHSH 1BHXF 2R0LA 5A2MH 5EXMA 2O9QA 3VG8A 1BBRK 5IDKA 1ELCA 2ZP0H 3DCLA 1W7GH 3KGPA 2V6NA 2R2MB 2ZPSA 1BMLA 2ZF0H 3M7TA 2HALA 1FPHH 2PKAB 2Y82A 1C1MA 3QTVH 4XSKU 2OD3B
chains in the Genus database with same CATH topology
3MNXA 3PYHA 4Y8XA 3RXSA 1W11U 4FVBA 1C5ZB 5JBTA 1L1NA 2GDDA 1PPZA 3MH6A 1O38A 3B9FH 4CRBA 1GCTB 4AYYB 1C5OH 1ZPZA 2FODA 1MH0A 1GJDB 1HGTH 5DGJA 2A1DB 4R8TB 8GCHF 3SHCH 1TYNA 4WVPE 3HGNA 3TGIE 4B1TA 3RXKA 1VJAU 4D9QA 2QXIA 1C5XB 2PGQB 1H9HE 3LGVA 2WV5A 3PO1C 2HPPH 1HJ9A 3MH5A 3QZRA 3SI3H 5BRRE 3UTUH 3KEEA 2ZGJA 3KF2A 4FUHA 1C4V2 3FP8E 4WWYA 1QL9A 1YLDA 5G4BA 2NU3E 3FZZA 4XBCA 5CE1A 2G4UA 2J4IA 3RXCA 1PPHE 3UREA 1C4Y2 2HRVA 1HAIH 3HPTB 1W10U 1GI8B 2V35A 1ELDE 1YCPM 4Y6DA 1IQIA 1GBAA 4Z0KA 1C2LA 3M5LA 3BTKE 3SU5A 1O2HA 3M61U 3OX7U 3QGJA 4F49A 4FUCA 1T4VH 4JYTA 1TIOA 1O3KA 1G3CA 3QO6A 1A1RA 1BTPA 1QNJA 2WUBA 1P09A 2H5DA 3B23B 1FY8E 1WUNH 1XUFA 2UUKB 3LU9B 5FPTA 1ELBA 4ABBA 2SGDE 4LZ4B 1EAUA 4FUJA 2P93A 2Y7ZA 2NU4E 3MU0A 1TE0A 2GMTC 5T6DA 1TX8A 2BMGB 3STIA 1QFKH 3I78A 2BY5X 2Y5HA 1C5NH 1VCPA 2QN5T 4X8TH 1MCTA 1TX6A 5EOKA 3UR9A 3CS7A 5I25A 2BD7A 1AZZA 2ANMH 2FMJA 3F68H 2GCHG 4CRDA 1MZDA 1QBNA 3M5OA 1GMHG 3U8OH 5EQQA 4NIWA 2Z6BD 2NU1E 1V2NT 1GCTC 1W7XH 3MO6A 3GDVA 2BXUH 2SGEE 1IQKA 3LGWA 4MDSA 4FU7A 2GT7A 3WY8A 5DP4A 1A5HA 1PJPA 1J9CH 4Q2KA 4GPGA 1A0LA 1GPZA 2TGPZ 2AERH 1ANCA 2TPIZ 2VGCB 1EZSC 5GIBA 3MNSA 2ANKH 4NSYA 3DFJA 1DY8A 4UFDH 3E90B 1AO5A 3RMMH 1S83A 1BUIA 2H6MA 5FHTA 3TPIZ 2XBYA 1CSOE 1LHFH 5F03A 1O5EH 1O2JA 3LONA 1TGTA 1V2UT 2FOBA 4U2WA 1FXYA 3I77A 1QGFA 2ZFQH 4A1VA 5F8TA 2DE9A 3P8NA 3U8TH 1O5CB 2C4FH 2VIPA 1C5LH 4PROA 5L6NH 4IN2A 1ZJKA 1MTSA 4ZHMU 1GBFA 4NZQA 1DUAA 1LHCH 2ASUB 4A1TA 1TBRH 1H8DH 1C1SA 4FXGH 4THNH 5F6MA 1ZRKA 1N6YA 1G30B 1V2TT 3P92A 2J92A 3RXGA 4NG9H 3OU0A 2XBVA 2Z9GA 1P03A 2AIPA 2FTLE 1QJ1B 4YLQH 2BDBA 4QT8C 1O34A 3MI4A 2EI8A 1Y5AT 1QR3E 1K1PA 1S6FA 1BMAA 1BTUA 1BJVA 1WCZA 4NA7A 2VINA 1WBGB 1L2EA 3Q77A 1QCPA 2TBSA 3R0FA 1EP5A 3HKJB 3RDZA 1TNKA 1TNHA 3IWMA 4ISIH 2EEKA 2BD9A 1UVTH 3K9XB 1LQDB 2PTCE 2P3FH 3GICB 5AFYH 3EDXB 2BOHB 1C4U2 1EP6A 1O2WA 4BANB 1OWDA 3OY5U 1XVOA 3LT3A 1THSH 1SI5H 2VGCC 4ISHH 4X6PA 2Y6TA 5C2ZA 4B74A 1ZMLA 1BZXE 1UCYK 3NKKA 2NU2E 1TGCA 2G52A 1KTTB 4GSOA 1KXDA 1ZGVA 4GCHF 1Y59T 4AZ2B 1TB6H 2AGGX 1FN6A 3BTQE 5T6FA 1MZAA 1SGNE 1GBBA 1C5UA 4INHA 1DM4B 3ESTA 1A46H 2TRMA 4FU9A 3ZVEA 4WXIA 5SGAE 1UVPA 2O8WA 1WYKA 4MNYA 3HKIB 1O3DA 1A7SA 3RUOA 3T29A 2A5IA 1Z8GA 2LPRA 1DT2A 3BEFB 3VB5A 3ZZ6A 1ELTA 4YT7H 4ZHAA 4YLUA 2B0FA 3GY5A 1TRMA 3STJA 3RMLH 1E37B 2AIQA 2QGRA 4O97A 3SORA 4JCNA 2KAIA 2Y7XA 2GTBA 1O5GH 3AAVA 4JZFH 2ZDAH 3M3TA 1UTPA 1EOLA 3RXPA 1PPBH 5HM2A 4I31A 4RSPA 1O2VA 3MNCA 3SHAH 1G3DA 5EW1H 1C2HA 1TGBA 1VITH 3ZV8A 1OXGA 3ZZ5A 5C1XA 4MPXA 2OCVB 1GI5A 1QB6A 1JWTA 1SL3A 1AB9C 3A84A 4IN1A 3UPEA 2BHGA 4MNXA 4ZKNU 3TLOA 1SHHB 3M3SA 3O8RA 1GBKA 2OLGA 3PTNA 1P06A 1H9IE 3PLKA 1P01A 1O3OA 3UFAA 3SU1A 1C5QA 2ZU3A 1Z8RA 9ESTA 4B2CA 2CV3A 1C5VA 3A8AA 1QL8A 5JBBS 2ZGXH 2FESH 1O2GH 2CF9H 1O2ZA 4NA8A 4KTUA 2TGAA 1SLWB 5FBEA 1KSNA 3BG8A 1HAOH 2QIQA 1TLDA 1ARBA 1UCYH 2B7DH 4O3UA 3ZVAA 1F5LA 1V2WT 2Y5GA 4DW2U 1DICA 1OX1A 3LH1A 3URDA 4MQAA 1GI6A 3H7OA 3MTYA 3U1IB 1P05A 3TH2H 2C3SA 1ANEA 4Y8ZA 1TPOA 1SGTA 2R9PA 1UTMA 3ZZ4A 3RXLA 1NRPH 4JZIA 3BTEE 1AWHB 3SU4A 1EAWA 1O3LA 4AB9A 1AFQB 1Y3WA 2ZFSA 2P16A 4Y10E 1HV7A 5C1YA 1V2PT 1NFUA 1AHTH 2WYGA 1MTNB 2JH6D 2ZWLH 2F3CE 5A0AE 5GDSH 4AB8A 1V2QT 2G81E 4H42U 2CHAC 1GJ4H 5J4SA 1Z8IB 4X2XA 1D6WA 3DFLA 2FP7B 3MU4A 1QQ4A 1C1OA 4O03A 5FCRA 6GCHG 1C5WB 1HAPH 3TK5A 1ZJDA 1WOFA 2BD8A 1O2TA 3NWUA 1BTZA 1DITH 4ISOA 2VH0A 4OGXA 1LHGH 3GOVB 5EQRA 3TH4H 1T31A 1GHBF 1P3EA 3C1KA 1YCPK 1NRQH 3RXOA 5FCKA 3SU0A 1TMBH 2ANWA 4AYVB 1MAYA 1KTSB 1N8OB 2BDHA 2H9EH 4ABEA 5L2YH 3S7HB 1IQJA 2D1JA 4BXWA 1TQ7B 4ISLA 2FS8A 1SGIB 3PM3A 5DP6A 3FZDA 5ESBA 3SJKA 1OPHB 7ESTE 2RG3A 4X8SH 1THPB 5ETXA 2G51A 2SGQE 4HTCH 4TY6A 2ZGCA 1JRTA 3K2UA 4ISNA 3ATLA 5C20A 3L33A 4F4OC 2NWNA 4AFSA 2ZDLA 3M7QA 1NESE 2CJIA 5H4IB 1HAYB 1PQ5A 1E35B 2VU8E 2GZ9A 1SB1H 1UK2A 3ZYEA 1E36B 4BAKB 3D62A 3BN9A 4OS7A 3GY6A 1MQ5A 1FJSA 2GD4B 1DY9A 3LGUA 3TNTA 4OS2A 2Q6GA 4MNVA 3VGCB 3OSYA 1AFQC 1ZMJA 2BXTH 4X8UH 1WU1A 1LHEH 3UOUA 1ZR0A 1HAGE 3F9HA 2STAE 2BLWA 1MTNC 5F8ZA 1RFNA 1YPEH 2G5VA 1P8VC 3L6PA 2HOBA 4AORA 2BDYA 5EG4A 1BBRE 3M7UA 3SV2H 1W8BH 3KIDU 1GHAF 4MLFB 2TGTA 4Z6AH 2THFB 2Y80A 1KXAA 2AYWA 2PSXA 4I7YH 1S84A 2CN0H 1VCWA 1ZGIA 3VB7A 1GDNA 1YCPH 3S9BA 4YOJA 2PGBB 5JPMH 1EX3A 2J95A 1RGQA 2PUXB 1AU8A 2FDAA 1YPMH 3SJIA 4UE7H 3N7OA 2ODYB 3FVFB 4A92A 5HM9A 1XKBC 1TPPA 3HATH 2A7JA 1N8OC 7GCHF 1TALA 1UK3A 3D65E 1O37A 4Q7XA 1HAZB 1AZ8A 2VB0A 2QA9E 2ZU1A 4A6LA 4ABAA 3BTFE 1D3TB 2EA3A 1GMCF 2G55A 3S7KB 2ZPRA 1TA2A 3VFEA 1QJ6B 1C1VH 4ZROA 1GVKB 1S6HA 1QB1A 2FX6A 3UY9A 3PMAB 2ZNKH 3RXQA 8ESTE 2H9HA 2C93B 3JZ2B 2R3UA 1O2RA 1KY9A 1RD3B 3SJOA 3LJOA 3VGCC 3BIUH 1LHDH 4YOGA 1XUJA 5C67A 2BD2A 2Z9JA 3ZVGA 5DG6A 4R0IA 3ATWA 1H9LB 3U69H 1CHOF 4ABDA 1SHYA 1Y5UT 2UWPA 2WPJS 1CA0B 1Z6EA 1GJ6A 1YF4A 1IHTH 1O3AA 1VITF 1L4ZA 1C1UH 2WYJA 4B71A 1C1WH 2HNTF 2W7UA 2ZTZA 5AFZH 1AE8H 3TITA 5B6OA 3SUDA 1JBUH 3ZZ3A 2D26C 5EPYA 5C3NA 1C5SA 1HAVB 2FPZA 4NIYA 5HGGA 4X2WA 1YLCA 4VGCB 1A2CH 2W26A 4IC6A 2JKHA 1SMFE 4X1NU 3MMGA 1GI1A 1WTGH 1D9IA 1TBZH 2ZQ1A 5JB8S 2ZDKA 1UJ1A 2D2DA 1DSUA 3PLBA 2ZCLP 4OS6A 5AVDA 2PW8H 4DCDA 5CHAC 4ABFA 1BT7A 4IC5A 2QYIA 2A7CA 1T8MA 3MH7A 3V12A 4D7FA 3MOCA 2XW9A 3PTBA 3BEIB 1QJ7B 2RCEA 2XC4A 2RA0A 1GBLA 1ZTKA 1PPEE 3TIUA 3D23A 1AE5A 1GBCA 2AMQA 2QCYA 3M5MA 4SGBE 1CGHA 1X7AC 4ASHA 1NU7B 2VWMA 3QTOH 4NIXA 1DLEA 2FI3E 2A4RA 1QY6A 1GMDG 1HJAB 4UFGH 5E2PA 4UFEH 3BTTE 1EPTB 3EYDA 2ZG0H 5LPFA 1RTLA 1QRZA 1WQSA 4X1QU 2OBQA 1Q2WA 2FX4A 4K3JA 4A1XA 2VJ1A 3GCTF 4IS5A 3VB3A 1WQVH 3I29A 2ZZUH 3H5CB 3ZZ8A 3O8DA 3RXBA 3SI4H 3TJVA 2PUQH 1SC8U 2BD3A 3LC5A 5AF9H 5A8YA 1B0EA 4NA9H 4YZUA 5FX5A 1GGDB 1SSXA 3U9AH 5E0JA 1QA7A 1G3EA 2C8YB 1P2KA 3RXIA 1JIMA 1GI9B 1CA0C 1DUEA 1QRXA 1TPSA 1P2MA 1F2SE 1GVZA 3SQHE 5JDUB 1A5IA 1GBIA 1FY3A 4YO9A 1PPCE 4ZKOU 3A88A 2RA3A 1BBRH 2Q6FA 2ZA5A 3F6UH 1BCUH 2ESTE 2ZHWH 4ESTE 1HUTH 5GCHG 2HNTE 4NZLA 3SZNA 1YPHE 4VGCC 1O35A 1IQNA 4XE4A 2VVUA 1Q3XA 3V7TA 1EJNA 4DIIH 2J94A 2FIRH 1KDQA 5T6GA 1C2KA 1K1OA 5LPRA 2GZ8A 2BVXH 1NN6A 1C1TA 2UUYA 3T25A 3A7YA 4HZHA 3GY4A 1FONA 3GYLB 2OXSA 1OS8A 1UCYE 1PPFE 1LVOA 1P3CA 3A80A 1MKXK 3P17H 1EB2A 1OWJA 1VJ9U 2ZU5A 1LTOA 1TNIA 3LIWA 3M35A 2Z3CA 2FXRA 2TGDA 4UEHH 1GHWH 4WF8A 4J2YB 3BTHE 1O33A 3BTGE 1CT0E 1P57B 1SQAA 1HJAC 2BDCA 2VVCA 3SQEE 1EPTC 1QBVH 7KMEH 4JZEH 2A31A 1UTQA 2SGPE 2H2ZA 3NZIA 1O3PB 3CS0A 2PR3A 1D4PB 1BJUA 1AD8H 3QN7A 3SJ8A 3A86A 1AQ7A 2O8MA 1DWEH 1GGDC 2F9OA 5DP9A 5LH8A 3A87A 4LZ1H 3U98H 1KDQB 2GZ7A 5LGOA 1TGSZ 3ODDA 1O0DH 1NU9A 1O5DH 1TRYA 6ESTA 1L1GA 1TOMH 2A4QA 1HFDA 1A4WH 2CXVA 3KQDA 2ZHQH 2PSYA 1THRH 3ITIA 3Q3YA 1ZMNA 4NFFA 4X2YA 1S0RA 4MNWA 2P59A 2O8UA 4OS1A 3EA7A 1BA8B 4I8KA 7GCHG 1ZPCA 4OGYA 2OQ5A 2SFAA 1HYLA 3KQEA 3K65B 2ULLA 2M5TA 2B5TB 3TGKE 2A4GA 4K1EA 2DE8A 3U1JB 4DGJA 3AW0A 3TJUA 1DXWA 1C2IA 2W5EA 1O5FH 4UD9H 2WUCA 3Q3XA 3RP2A 1MTVA 4D9RA 1SQTA 4HGCA 4CR9A 1RIWB 2Y81A 5A0CA 1XX9A 5C5OA 3P95A 3UNSA 1BTXA 2XWBI 1MU8B 1HB0B 5ESTE 1LQEA 4DVAU 1AMHA 1DXPA 1NO9H 3EE0B 2ILNA 2ZDNA 2BB4A 4B2BA 4ZH8A 3RMOH 1MQ6A 1UHBA 3LOXA 1AGJA 1T8LA 2NU0E 1XXFA 1YPGH 2SGAA 3SU3A 1UTJA 2Z9LA 4XBBA 1F0RA 1ID5H 2BD5A 4WJG2 1AVXA 1D3DB 4H4FA 4YESB 1K22H 3T26A 1RTFB 3GDUA 1ABIH 4WH6A 2J9NA 1YKTA 2ZFRH 1O2MA 1C2JA 3GCOA 1HXFH 3S69A 1QB9A 1C1NA 1TNLA 4B73A 1XMNB 3A89A 4DT7B 3UQVA 1IAUA 3RC6A 1GI2A 2F9BH 3SUFA 3FFGA 3EA8A 1MUEB 4GHTA 1VCQA 1O3MA 2YNBA 3RLYH 1PQAA 4JYVH 1JXPA 1AUTC 4UONA 1UVOA 2BTCE 4BOHA 4CRAA 3M36A 1MTUA 5PTPA 5TCAA 1EB1H 2BY8X 2AGEX 3SGAE 1BRBE 1QBOA 2FYQA 4X1SU 1AI8H 1EZUC 1P9SA 1JIRA 1FN8A 5FXLA 2B8OH 1K9OE 1Y8TA 1GL1A 4A7IB 2H1UA 1ZTLA 1LPZB 3TJNA 3BSQA 1Y5BT 2ZGBH 5EU8A 5K0HA 4DURA 1SGRE 2G4TA 1QQUA 3JZ1B 3ZVDA 3H7TA 3T2NA 4BTUB 1G9IE 5FPSA 1T7CA 1L4DA 1O2IA 1V2VT 8GCHG 1E34B 3LKWA 1RIWC 5EPNA 2AGIX 3KQCA 1RTKA 2BM2A 3VXEH 1QTFA 3M5NA 4AGKA 1ZSLA 4X6OA 5K7RA 1TAWA 5GJ4B 4CBOA 1ESBA 1OKXA 2J38A