4X2YA

Crystal structure of a chimeric murine norovirus ns6 protease (inactive c139a mutant) in which the p4-p4 prime residues of the cleavage junction in the extended c-terminus have been replaced by the corresponding residues from the ns2-3 junction.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
179
structure length
172
Chain Sequence
SIWSRVVQFGTGWGFWVSGHVFITAKHVAPPKGTEIFGRKPGDFTVTSSGDFLKYYFTSAVRPDIPAMVLENGCQEGVVASVLVKRASGEMLALAVRMGSQAAIKIGSAVVHGQTGMLLTGSNLGTIPGDAGCPYVYKKGNTWVVIGVHVAATRNTVIAATHGEPTLEAWQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords NS6 Protease,NS6 Protease
publication title Structure determination of Murine Norovirus NS6 proteases with C-terminal extensions designed to probe protease-substrate interactions.
pubmed doi rcsb
source organism Murine norovirus 1
total genus 29
structure length 172
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4x2yA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4x2yA01
2G8TA 1INCA 2PKAA 3F9EA 4OS7A 2LNCA 1NESE 1MAXA 4ZXXH 2BDIA 5BPEA 2YNBA 1GMHF 4TPIZ 3IWMA 4X1NU 3A88A 1IQFA 3D65E 1SGRE 4CHAC 3T29A 1HLTH 1PPCE 4Y0ZE 1UK3A 3LH3A 3URDA 4HZHA 4NA9H 4NWLA 1QHRB 3SBKA 1UVTH 4YT7H 3PTNA 3SNCA 7KMEH 4GPGA 1N1LA 3AW1A 5CMXH 2QIQA 1GI4A 3ATKA 1HPGA 1O3FA 2Z3DA 1EPTB 1TNLA 1ABJH 4FUCA 2YNAA 3KEEA 4ABBA 1J16A 1H4WA 1HGTH 4OGXA 3VPKA 4X6NA 1FONA 2CXVA 1OWDA 2BZAA 1O38A 4ISNA 1A2CH 4U30A 2BB4A 2ZHQH 1O2IA 4NIVA 5IDKA 1DITH 1EB1H 2HNTF 5E2PA 3U98H 3SZNA 1FUJA 2Q1JA 1MKWK 1O2LA 3FP8E 1TNGA 3I78A 3S9BA 4BANB 2EI6A 2QY0B 2RDLA 1GBHA 1O2WA 1J8AA 3KQBA 1DSTA 3RXMA 3T2NA 1O2NA 2WPMS 3UNRA 1CE5A 2WYGA 3RXGA 3TH3H 1GHAF 1EJAA 1EAIA 2FI5E 1TMUH 2ZGJA 2V0BA 2W7SA 4KTCA 4O03A 3A85A 5E0GA 3EQ0H 1L4DA 1LO6A 2RCEA 2PTCE 1V2LT 1V2TT 1SGNE 2O8MA 1ACBE 1JRSA 1SI5H 4ZKRU 3RXLA 2GCTC 1RIWC 2FWWA 1IQEA 6CHAB 4NG9H 1T4UH 4JK6A 1FI8A 3OTJE 1SLWB 5DP4A 2UWPA 1XXFA 1CHGA 4YTAA 4WMDA 4J2YB 3F68H 1EQ9A 1AO5A 3NPSA 3TIUA 1W10U 3E8LA 2AYWA 1KLIH 2Z94A 3UTUH 2OC8A 1OP2A 1F2SE 2ALVA 1Y5UT 1KYNA 2BQ6B 4X1QU 2FXRA 2AMDA 2G81E 3PMHB 1BDAA 1HIAA 3L33A 1UTNA 2BX3A 3AAUA 1L2EA 3K2UA 1GJ9B 3ZZCA 1AFEH 1OYTH 3RC5A 3P8NA 3T27A 4X6MA 3ATMA 1ELBA 3BTME 1EOJA 3MWIU 3KL6A 1QTFA 1TNHA 4NIXA 3VGCC 2Y81A 3GY4A 1HAXB 3D49H 1HYLA 1TOMH 1B0FA 1SB1H 4MPVA 2OCVB 1A1RA 4X1RU 3HGNA 1LPGB 6GCHF 5FX5A 3ZZ5A 2ZDNA 4ABEA 1YPGH 1KTSB 3MNBA 1OS8A 2G4TA 2WUBA 4A6LA 1LTOA 3AAVA 2XTTB 1C2MA 4JZEH 4X8VH 1IQIA 1UTPA 2XBYA 2ZIQH 1MD7A 1BMLA 2GMTC 1G3BA 2QYIA 2VIVA 1F5KU 1C5LH 1CHOF 1S82A 1FV9A 2G55A 3RU4E 1QNJA 4AG2A 1GDUA 1ANBA 1HAZB 1K1LA 2A5KA 1MTVA 2J38A 1SGYE 2P8OB 3RXVA 3C1KA 3MH4A 4E7NA 3P8FA 2FESH 4JYUH 2OINA 1P09A 3NK8A 1HAPH 4NCYA 2ZF0H 4JYVH 2O8TA 3NCLA 1PYTC 1TONA 3VEQB 3ZVEA 1CBWC 1FLEE 4Y76A 1TNKA 4VGCB 1ANDA 4FUEA 1BJUA 1TB6H 3RXKA 1O35A 4B74A 2GZ9A 1WTGH 2W26A 1BBRE 1OXGA 5AFZH 3M5MA 3SQEE 2BLOA 4F49A 5DP7A 1QJ7B 3VXFH 2ULLA 1F0SA 4DW2U 3SV8A 2G4UA 4X8UH 3A7ZA 2BHGA 8GCHF 2G51A 1S0RA 3SU2A 2FS9A 1P01A 1DLKB 2BTCE 4WXIA 1C2DA 3ZVDA 3GYLB 2SGQE 2B5TB 2GDDA 3D23A 1NFXA 2ZGHA 2XRCA 1V2JT 1O2XA 3A7XA 5EPYA 2FYQA 1GBAA 4AX9H 4AZ2B 1V2WT 1L1NA 1CA0C 2FTMA 3BTTE 1VCPA 1HV7A 1YLDA 1NC6A 2GT8A 3TK5A 3FANA 8LPRA 1S5SA 2IJOB 1GVLA 1GI7B 1F92A 1XVMA 2I6SA 4GCHG 1EKBB 1EUFA 1P05A 3QDZB 5JDUB 1LPZB 1FJSA 1IOEA 5EODA 2BY9X 1DWDH 4Y8YA 2V6NA 1O2KA 4D9RA 3TJVA 1HXFH 2NU2E 1SSXA 2ZEBA 3ZZ7A 4MQAA 2ZCKP 1A61H 4ABFA 3EGKH 1N8OC 1D6WA 3TGIE 2HNTC 2HOBA 3RM0H 1YC0A 2J94A 3BG4B 1YLCA 1C5PA 3KQEA 1HXEH 2GCTB 1RIWB 3FP6E 2K1QA 1K21H 2VVUA 1C9PA 3DD2H 1K9OE 1QBNA 1QRXA 3VB3A 2ZG0H 8KME2 3JZ1B 3UUZA 3BTHE 1ESBA 1MBMA 2R3UA 2R2WU 1AN1E 4UONA 1XUHA 1QQ4A 2ZDAH 1SGIB 4BTUB 5A09A 1TOCB 4JZDH 1C1VH 1TIOA 1HUTH 4K5ZA 2R0LA 2Z6BD 3PROA 2AFQB 3AVZA 3EDXB 1SQTA 1AKSA 2PGBB 1TA6A 4BOHA 2ZHWH 1F0RA 1JIMA 5L2YH 3A87A 2GVFA 2BD9A 1K2I1 3P8OA 1O3JA 2ALPA 3BTEE 1SGDE 3LC3A 3FP7E 2ZHFH 1KXCA 2JH6D 2ZU4A 2VWLA 2BDAA 1FZZA 2OC1A 5FBEA 1TPAE 2OQUA 3ZZ3A 4FUJA 3ELAH 3L3TA 4I8HA 1NRRH 2C8XB 1TGCA 4Y10E 1DE7H 1B0EA 2NU3E 1T31A 2RA0A 3VGCB 3AW0A 1S83A 4KELA 4ABDA 3RXEA 3U8OH 3MO3A 1UTOA 2Y7ZA 2PV9B 1F0TA 1GBIA 2ZP0H 1GJ6A 1ID5H 2BLVA 3A89A 1AVWA 2GV6A 2ZECA 2V35A 2FYRA 1DVAH 1QY6A 4NSVA 4JZ1A 3ZV8A 1NRQH 1GHXH 1G3CA 1P3CA 5T3HA 3MNCA 1QB1A 3MU5A 2GMTB 1W0ZU 4AYVB 1S81A 1O2TA 2GP9B 1BHXF 2SGDE 4K1EA 5C5OA 2QA9E 2BD2A 4AOQA 4CRDA 1VITG 2GGVB 2WPLS 3M3TA 1XVOA 4KP0A 1KLTA 1C1SA 1CQQA 3EA9A 1P2JA 4X6OA 2HALA 4CREA 1GJ7B 4INLA 3BSQA 1P3EA 3PMBB 1OX1A 1LHFH 2FLRH 1NY22 1C2EA 4HTCH 3CENA 1UCYH 3QZRA 1BCUH 3A7VA 6ESTA 2A2XH 1T8OA 1QB9A 1WQSA 1ZOMA 4B73A 3SV9A 3CP7A 4ZUHA 1A3EH 2QV1A 2V3OH 3K9XB 2R3YA 3LIWA 5GWZA 3LT3A 3QGJA 1O5GH 3STJA 1G37A 1ETTH 1O37A 1O3NA 1EXFA 2A32A 2O8LA 3A82A 3SU3A 2QC2A 5B6OA 4BXWA 1ELDE 1DM4B 1SGTA 4BTIB 2GTBA 3ZZ6A 3F9GA 2VNTA 2XCFA 4AYYB 4UFGH 4Q7ZA 2CF9H 3V13A 3MU4A 1WUNH 2GV7A 1ZJDA 4Y8XA 1Z6EA 4ISIH 2V3HH 5C67A 1J15A 2R9PA 4X2WA 5A0BA 4B2BA 2W7UA 1Z6JH 1V2UT 2FOHA 1C5YB 5IYTA 4YOIA 1JMOH 2HPPH 1C2FA 1XKAC 1P2MA 4MNXA 2Y6TA 5DKMA 1SGFG 1K22H 1A5GH 1P9SA 2BVRH 4BXSA 1CA0B 2FOMB 3SGBE 1DOJA 4UD9H 3TNSA 1NRPH 2BDYA 1C2LA 2W5EA 3SORA 3GY3A 3BIVH 1IQNA 1BMNH 1TA2A 1SGPE 1DANH 1EZQA 3LJJA 3PLKA 3PO1C 1T32A 4CRCA 1C2GA 1GI0A 1TPSA 3GCOA 1ZR0A 1YP9A 1MTWA 2VIWA 1SHHB 1O33A 3S9CA 3QWCH 4NFFA 1GCDA 1MKWH 3M35A 3PB1E 3FZZA 2FI3E 1FPHH 1TX8A 1AD8H 3LC5A 1K1OA 3UOUA 2VINA 1P06A 5EGMA 3M61U 4YOJA 1ZYOA 4AORA 2P3FH 3RXQA 1N8OB 4ZMAH 1P12E 1BBRK 3GY6A 1OWKA 5GIBA 1BTPA 2QXGA 2YOLA 3PV4A 1AQ7A 1TMBH 3P92A 1C5VA 1TX7A 1C1PA 4TY6A 2Y80A 4O97A 4CRFA 1WCZA 2SNVA 4I8GA 3E91A 3LKWA 5F8XA 2FM2A 1A0JA 3SNEA 1IQHA 1UK4A 2H2ZA 1EP5A 5GPIB 3MNXA 3QTOH 1ZPZA 4A7IB 2ZWLH 2F91A 6LPRA 3M36A 2STBE 1O3EA 3ODFA 1QJ1B 1HJAC 1C4U2 1GBJA 1LKBA 1QB6A 2PUXB 1QJ6B 2BLWA 3LDXH 1GBLA 5A0CA 4UFDH 5EW2H 3HK6B 2WYJA 2Z9KA 5E0HA 4X1PU 2AGIX 5H4IB 2QAAA 2AS9A 1WYKA 2ZFPH 4ZHMU 3M5NA 1EZXC 1GMHG 2WINI 3LGUA 3V12A 2Z9JA 4THNH 3RXDA 1Z8RA 1W12U 1ZLRA 1GBKA 2XBVA 4ASHA 1S85A 1DWEH 5HMAA 3UFAA 1S6HA 3STIA 1ZHPA 1TLDA 4GVUA 4IN2A 1EP6A 3MO9A 4B76A 2BMGB 1ZSJA 3PM3A 5DGJA 1EATA 4TPYA 1GHVH 2J34A 5F8TA 3EYDA 4DJZB 1BZXE 4ZH8A 4AGKA 3BF6H 4ZROA 1NU9A 4E06H 3VB6A 1AVXA 1EOLA 3GISB 1ZHRA 1UHBB 1EX3A 1GJCB 2NU4E 4FU8A 2THFB 2AGGX 2WV4A 1AUJA 2G5VA 2XYAA 1ZGVA 1HJ8A 5FPTA 5DP9A 1CT0E 3GY2A 1AGJA 2EEKA 1GHBF 2OTVA 4RKOB 3U9AH 2H5DA 1HAGE 2A7HA 2JKHA 3ZZ8A 2J2UA 2O8WA 1TX6A 4FUBA 4YESB 5C1XA 2Y7XA 1MU6B 2RG3A 4X2YA 2SNWA 4FVBA 3A7WA 3GCTF 1HAHH 1Z71A 1H9LB 1GHAG 2ZDKA 1J17T 2ZPQA 3SHAH 4D8NA 2PWXA 3GYMA 4Y11E 2XCNA 4OS6A 2A5AA 4Q80A 3TK9A 5G4BA 1BIOA 4A92A 1ZMJA 3H7TA 1GVKB 1ZMLA 2FOAA 1GI5A 3SJ9A 1QURH 4XDEA 5EQRA 5EOKA 3VB5A 4R0IA 3S69A 4XBBA 1ZRKA 4PROA 4X8SH 1A7SA 1HFDA 1W13U 3M37A 3BTGE 2F9VA 3BG4C 4X1SU 3ZZ4A 4ABGA 1TRMA 2Y5GA 1MTNC 1TMTH 4H6TA 4Y7AA 1XUJA 2Z7FE 4YLQH 2ZU2A 1C5WB 3TH2H 2BDGA 1HB0B 1Y3YA 1GBEA 3SNBA 1QCPA 1LMWB 1AUTC 2ZO3H 2BM2A 3KQCA 3TU7H 1AB9C 1DXPA 3A80A 4ZKOU 3KF2A 4DY7B 2UUKB 2ZTZA 3QTVH 4ZHAA 4BTTB 2A2QH 1DY8A 2Z3EA 1SVPA 1BITA 1KXFA 1W2KH 2HWLB 5ESTE 1N6XA 4ISHH 2Z9LA 1O0DH 5T6GA 3RXUA 1D3DB 1GHZA 1P8VC 2GKVE 1NO9H 3UWJH 1JWTA 3NWUA 4TY7A 4GHTA 1VR1H 3UY9A 2G52A 2Z3CA 3PO1B 1G2MA 1TBRH 4J1YA 3SHCH 1F7ZA 1A4WH 2BD5A 2VVVA 1BRCE 2EC9H 2Z9GA 3Q3YA 5DJ7A 1AWFH 2FOBA 3DT0H 2QGRA 1GBMA 4UEHH 1MCTA 2ZNKH 3RU4T 2UUYA 3OY5U 2AGEX 1G3EA 1TNJA 4TWWA 1ZTJA 3MTYA 6GCHG 5LPFA 1NROH 1C1MA 3TVJB 4MTBA 1NM6A 2EI8A 2OBOA 4MPUA 5GDSH 1SBWA 5FCRA 1G36A 1FXYA 3CS7A 1TBQH 3MH7A 3O8BA 2C8WB 3RU4D 4WXVA 2BDBA 5C1UA 3EA7A 1Q2WA 4I7YH 2VJ1A 1P10A 4Z6AH 1EZSC 1KXDA 2BOHB 2Q6DA 1CHOG 2ZHDA 3M5LA 7GCHF 4WVPE 2XC5A 1M9UA 1O3HA 1O2MA 1AHTH 3PMJA 1NFYA 3RUOA 2BD3A 2AMPA 1SLXB 4CRGA 1FY3A 1ZJKA 3RXOA 1P2KA 2Y5FA 2VIQA 1VCWA 3MU0A 1A0LA 3RXTA 3KCGH 1NFUA 3TLOA 1AZZA 2PHBA 3E90B 3GDSA 3T62A 2JETC 3LONA 2VWNA 2WPHS 1Y8TA 3A81A 3SU0A 2IOTA 1TGTA 2FI4E 2ASUB 1A3BH 1HJAB 5EPNA 1O34A 1THRH 1LDTT 2VB0A 2UUJB 3LGVA 1PFXC 1ESAA 2F9BH 2ZTXA 2J95A 5GJ4B 4BAOB 2TGTA 4ISLA 3QO6A 3RXHA 2HVXA 1TRYA 3UNQA 4LK4A 1O3CA 2A4QA 2ZDLA 3UREA 1THSH 2P95A 1Z8GA 1ABIH 1CGJE 2P3TB 1GHYH 3MHWU 2RA3A 3N7OA 1KY9A 4KTUA 1C2KA 1AVGH 1Z1JA 1OP8A 1Z7KA 3SI3H 4IN1A 1DS2E 2BZ6H 2ZDVH 5LH8A 1YPKH 1K1NA 1G9IE 1MZDA 5EW1H 1GMDF 1OWEA 1DX5M 1DFPA 8GCHG 1O3GA 3PWBA 3ZVBA 4DIIH 4FXGH 2TGAA 2P59A 1SOTA 2FPZA 2ZC9H 1ZMNA 1Y3UA 2Q6GA 3KN2A 3ENSB 3DFLA 3ITIA 5C20A 2C90B 2DE9A 4SGAE 4NA7A 2XC0A 3RMMH 5AF9H 5FAHA 1GMCG 1D4PB 2DUCA 3A8AA 2D8WA 2A4GA 1LHEH 1VJAU 3B9FH 3SV6A 2PKAB 1CT4E 1TE0A 3A7YA 1GMCF 5EXLA 2GX4A 5SGAE 4K8BA 4B2AA 2IPHA 4ESTE 3SUFA 3OU0A 1V2RT 1BTYA 1MTUA 1O3PB 2GZ8A 2ZGCA 3RXJA 2P94A 4AFQA 3RXCA 3UPEA 3SW2B 3BEFB 3FAOA 2J9NA 1HAVA 5CHAC 1ZPCA 3BTFE 1YGCH 1G32B 1TNIA 1BHXB 4X2VA 5E0JA 2ANKH 1GHWH 1V2KT 1QBOA 3SOSA 1QR3E 1KLJH 2A5IA 5EU8A 1OWJA 1BTZA 1C5XB 3ATLA 1K1JA 1O3MA 2VH0A 3RMOH 5L30H 1SHYA 3NZIA 2AERH 4KTSA 3PLPA 3BEUA 1TFXA 5TCCA 1FY4A 5JB9S 2TRMA 1MMJN 2ZU5A 3M3SA 1C1NA 1TRNA 1GL0E 3PMAB 1XX9A 2BYAX 2BD4A 3CS0A 1MTNB 1MAYA 1TGSZ 1FIZA 5A8ZA 3SV7A 2QN5T 2HNTE 1P2QA 4D7FA 2SGPE 3KNXA 2OC0A 1AB9B 4FUGA 4BAHB 2W3IA 3FFGA 3T26A 1T8MA 1NZQH 4WMFA 1HBTH 3KIDU 4U01A 3S9AA 1QL9A 2VWMA 1IHTH 1NS3A 1OKXA 3D62A 2PW8H 5AHGH 1LHDH 1SLVB 2A1DB 4NZLA 1GDQA 3A7TA 1A5IA 4XOJA 1TAWA 1UO6A 2P93A 1S84A 5EQSA 3GY7A 1BMMH 4FU9A 2A4RA 1WU1A 5ABWA 3OYPA 2ANWA 4H6SB 3WY8A 1GWAA 4CBOA 1HRTH 2SFAA 2GZ7A 1RTFB 1Y59T 3RP2A 1XM1A 1UTMA 3PYHA 3SNAA 1GGDC 3U1JB 2BY8X 1YKTA 3BN9A 1EJNA 4MPWA 1VZQH 5EXNA 4K60A 3RLYH 1C5MD 1ZZZA 1O2QA 1EPTA 1Y3VA 5C2ZA 3A84A 3SU4A 2ANMH 4MVNA 2OD3B 2Y5HA 1S6FA 3SNDA 3HGPA 1BBRH 1C1QA 2BQ7B 3AASA 4OS1A 4Q2KA 1HIAB 1LKAA 4Y79A 2CF8H 1TQ0B 2FP7B 1K1MA 1KXEA 3BG8A 5AVDA 2SGEE 1FPCH 2ZU1A 1O2SA 1GJ4H 1O2JA 3Q00A 3ZVAA 2WV5A 3ATIA 1O5AB 1P02A 5L2ZH 1ZSLA 1PPEE 2JETB 4K69A 3ZVFA 4RN6A 3UQVA 1YF4A 2BVXH 3FZDA 3K65B 3T25A 1TWXB 1ZHMA 2ZKSA 3MNSA 1EJMA 3BTDE 1SPJA 1AWHB 3VFEA 1C1OA 3LPRA 3O8DA 4DVAU 1BRAA 1FMGA 1MH0A 1KSNA 1FNIA 3GCNA 1RGQA 5HM9A 1H1BA 2BD8A 2XXLA 1H8IH 2F3CE 2UWLA 2R2MB 3KHVA 4LOYH 1NN6A 4D9QA 2KAIB 4RKJB 4O3TA 4AB8A 1GI8B 4ZHLU 3SQHE 1O32A 2PKSC 2VGCB 5DP8A 1HAYB 2ZTYA 1ZTKA 1GCTC 2R0KA 1FIWA 1P2OA 3MYWA 1MU8B 1XUGA 4DG4A 1ORFA 4K2YA 2PGQB 5TJXA 1O2HA 1LVBA 2FOFA 1RRKA 4YT6H 2VWOA 1WOFA 2F9UA 2F9PA 1AFQC 3HK3B 1TBZH 3NKKA 2OP9A 2PUQH 4XE4A 1G3DA 2BDCA 4BAQB 4ISOA 2AIPA 1J14A 4Q7XA 3RXAA 4UDWH 4BAKB 3Q3XA 1D6RA 4M7GA 1IQJA 3F9FA 3I77A 1OWIA 5C5NA 4GLYA 1GG6B 1OOKB 2B8OH 1ELTA 1MUEB 3E6PH 4K8YA 4A1XA 3PLBA 2WPJS 1WAYB 1C5QA 2BD7A 2FEQH 3RMNH 5CHAB 1N6YA 1AZ8A 1ELEE 3SJKA 1FN8A 2BLQA 3V3MA 2FZZA 1IQKA 1BA8B 4XSKU 3DFJA 1FDPA 2P16A 3P70B 5GCHF 1IQLA 2FOCA 2WUCA 1Z8JB 1GI6A 1X7AC 1GBBA 2H5CA 2PLXA 1ZPBA 1KDQB 3VB4A 1ELVA 3UR6A 2VIOA 2SGAA 4AB9A 2DE8A 1Q3XA 3SUEA 2WPKS 4D76A 2IN2A 1D3PB 1P9UA 1P2IA 1XUFA 3BV9B 4B2CA 1DUAA 1O2YA 3Q76A 3RC4A 1YPHE 4IW4E 5ETXA 4JYTA 3MFJA 4IS5A 2CJIA 1XUKA 3NXPA 4Y7BA 3GDUA 3ZYDA 1BRUP 1NT1A 4I8KA 1O2PA 3TH4H 1V2VT 2TPIZ 1HNEE 1P04A 1AMHA 1DY9A 5DK1A 1BOQA 3A8CA 3UNSA 1C5RA 5DPAA 1PJPA 1E35B 4ABHA 1KIGH 4H4FA 5EXMA 2J4IA 1MQ5A 2NU1E 1UVSH 3G01A 1XKBC 2VIDA 4JK5A 1F5LA 2ZQ1A 3U8TH 3RXRA 2G5NA 4X6PA 4H42U 3SJIA 2HGTH 3NUMA 5JBCS 1UTKA 3BTWE 1C1TA 3E16B 1CGHA 2C3SA 1MD8A 3S0NA 1GGDB 2QXIA 4JCNA 1IQGA 4MNWA 3TJUA 4I8LA 4A1TA 2Z9IA 3BTKE 1AKSB 1YBWA 3ODDA 1SFQB 1ETRH 1O31A 2PR3A 3OSYA 1YPJH 2J92A 1AE5A 7ESTE 4K3JA 2A7CA 2O9QA 1LHCH 4NIWA 2ZDMA 2D1JA 1O30A 2QF0A 3EAJA 3P17H 1K1PA 4WY3A 1DXWA 4GAWA 3QN7A 2ZFRH 1LVYA 1SFIA 1Y3WA 4AGJA 1GHBG 1ZRBA 1NFWA 1JOUB 2PSYA 3EE0B 1WTHD 2OQ5A 4CRBA 1NTPA 4A1VA 1QQUA 4IMZA 5JYIA 2FO9A 1PQAA 5LGOA 1GI3A 4TWYA 3GCTG 1V2OT 1O2VA 2AEIH 3SJOA 3ESTA 4BAMB 2ESTE 4TYDA 2ZFTA 1SQOA 9LPRA 4MDSA 4FU7A 2H9HA 2XBWA 1NRNH 1O2GH 3SI4H 1E37B 1F5RA 3OX7U 1O3OA 5AFYH 1C5ZB 1HCGA 1C2JA 1QL7A 4DURA 2ANYA 1FY8E 1C2HA 1O3AA 2FMJA 5ESBA 3RLWH 1QL8A 2ZPRA 1YPEH 2PKSB 3VXEH 1TGBA 1MKXK 3BEIB 1T8LA 1FAXA 1ANEA 1PQ8A 2ZZUH 1GCTB 1AIXH 1C2IA 3O8RA 5CE1A 4Y71A 3KGPA 1GJ8B 1TQ7B 5T6DA 5A0AE 3T5FH 3ZVGA 1K1IA 1AFQB 3UQOA 2B0FA 3BIUH 1GDNA 2VVCA 1SOZA 1TPOA 1O39A 1SGQE 3P8GA 3LOXA 1LPKB 2A0QB 1A5HA 1DPOA 2TGDA 4O3UA 4NA8A 1YPLH 1GI9B 4AFUA 4IBLH 5A8XA 2CMYA 1LHGH 2FTLE 1D3QB 4NFEA 1Y3XA 4GHQA 1SGFA 3SO3A 2NU0E 3DHKH 3V0XA 4KKDA 1W3CA 1YM0A 2STAE 3SU1A 5EQQA 1CO7E 4HGCA 1E0FD 1YCPK 1EASA 4IMQA 1WSSH 3LU9B 1MCVA 1LVMA 2BX4A 1E36B 3LGTA 3R0FA 4IC6A 1SMFE 3Q77A 4WWYA 5TCAA 1BTXA 1P11E 4HI3A 3TPIZ 3S7KB 3MH6A 2A4OA 2ZFFH 2ZQ2A 2FOGA 1C4V2 1GBTA 2QF3A 1C5TA 2H1UA 3SUGA 4AN7A 4XFQA 4YOGA 5C3NA 1TPPA 3TITA 4XBCA 1J9CH 1RD3B 2FX4A 1P57B 1PPHE 1QRZA 7GCHG 1XUIA 3M5OA 1LQDB 1VCQA 4YO9A 1F0UA 4NWKA 2M5TA 2JH0D 1RTKA 1PPBH 1WV7H 3UR9A 1W8BH 4JMYA 1FAKH 1BB0B 1O2OA 3RMLH 2H9EH 2XBXA 3O8CA 2OUAA 2CV3A 1TYNA 1PPFE 3ZZ9A 1EB2A 4CR9A 3RC6A 1LVOA 2D26C 4OS2A 3M3VA 5I25A 3QGNB 1BTHH 3HATH 1ELFA 3MI4A 1KXAA 2ZFSA 5FCKA 3Q3KA 1PYTD 5K0HA 3HPTB 1AY6H 4MG3A 3URCA 2KAIA 4K1TA 3QK1A 5BRRE 4ZKSU 2QXJA 3GY5A 1L1GA 4MPXA 3A86A 1O3DA 2TBSA 2BY6X 3QLPH 2ZGXH 3TGKE 3LGWA 1C5UA 4I33A 4LZ4B 1GMDG 3SJ8A 4HFPB 1L0ZA 1V2QT 1QIXB 2EA3A 1CU1A 4BNRA 5DP5A 5J4SA 1H8DH 1ETSH 3RDZA 2VGCC 1V3XA 5JBAS 1LQEA 2ZCHP 3RXSA 1DICA 3B8JA 1OYQA 4AG1A 2GCHG 4Z0KA 1FN6A 1ZTLA 4UE7H 2ODYB 1W14U 1SC8U 1MTSA 3A83A 3GDVA 4U32A 3MOCA 2GCHF 3K6YA 1O36A 1BRBE 2XNIA 4CHAB 1MQ6A 2FLBH 1WQVH 1VITH 1PQ5A 1ESTA 5J4QA 3MMGA 2FDAA 2BXUH 4QT8C 5F8ZA 1P2NA 2C8ZB 3UWIA 2AH4X 3U1IB 2GT7A 1DLEA 4JZIA 1DT2A 3GICB 2ILNA 3QX5H 4MNYA 4A5TS 2XWAA 1O3LA 3L6PA 1JXPA 1GG6C 3PTBA 3GOVB 1AE8H 3UIRA 1KDQA 5T6FA 2XC4A 1UCYE 3E0NB 2QXHA 9ESTA 4DT7B 3M7UA 5DP3A 2GD4B 1DUEA 3IITA 5DO4H 1A0HB 1SR5C 1ELAA 1TABE 3MO6A 3ATWA 2ZPSA 1Q31A 2XW9A 1L1JA 1O5FH 2QCYA 4WMEA 1D9IA 2HPQH 1QBVH 4FVDA 1SLUB 1UJ1A 2VIPA 5L6NH 1EAXA 5HXFA 4GCHF 2TGPZ 1YYY1 4R8TB 3F6UH 3DUXH 4X2XA 1O2ZA 1VGCC 3BTQE 4CRAA 1CVWH 1LCYA 4RSPA 1TALA 2A7JA 5FXLA 5LPRA 1RTLA 1RJXB 3GCHC 4CH2B 2C93B 4CR5A 4F4OC 5A2MH 4ABAA 2Q6FA 3IG6B 1C5SA 1GJDB 4X0WU 2LPRA 1KXBA 2FOEA 3TJOA 3T28A 3FVFB 1P03A 4FUDA 5JBTA 5JB8S 1V2MT 5LPEA 1H9HE 4NZQA 4I8JA 1GL1A 1EAUA 3GY8A 4B1TA 1GVZA 1JIRA 1Y5BT 1DSUA 4OGYA 4NGAH 1O2UA 1CSOE 1CGIE 1GBCA 1NPMA 2ZI2H 1OSSA 1AU8A 1QFKH 2P3UB 3SU5A 3U69H 1PPGE 1V2PT 4MLFB 2HRVA 1ELGA 2BOKA 1ZGIA 4Y6DA 2NWNA 3SN8A 2CGAA 1C4Y2 3A8DA 4FUFA 1E34B 1UVUH 1TGNA 2CHAC 3MU8A 1SGCA 5I46H 1BTUA 2EI7A 1Y5AT 1PPZA 1SG8B 1UVPA 1QA7A 1G2LA 1UHBA 3RXFA 1JRTA 2ZGBH 1DWBH 1PQ7A 1QA0A 4E05H 4WJG2 3LH1A 4CH8B 3U8RH 2GDEH 8ESTE 3HKIB 1FQ3A 3P6ZB 3ZYEA 2G00A 3JZ2B 2Y82A 1W7GH 3S7HB 2FODA 4IC5A 4AFZA 4GUXA 1CA8B 1GJ5H 2OBQA 3SGQE 3TGJE 1C9TA 3M7QA 3ZZDA 2ZA5A 1D3TB 2H6MA 1IQMA 3ZV9A 1ELCA 1U6QA 4LXBH 2O8UA 1ZSKA 2OC7A 4I32A 2C4FH 3M7TA 1O5BB 4B75A 2ODPA 1V6DA 1A46H 4JZFH 3HKJB 1C1WH 4DIHH 1QRWA 1EPTC 1IAUA 2F83A 1OP0A 3I29A 1O3BA 1UTLM 1T7CA 2HLCA 3ZVCA 1V2ST 1O5EH 1VITF 3VB7A 2BDHA 3B23B 4B71A 3W95A 4YLUA 3RM2H 4INKA 2WPIS 3OY6U 2VU8E 4FUIA 1C5OH 3E1XB 3SU6A 2FIRH 4ABIA 2JH5D 1UMAH 2C8YB 5FPYA 1B5GH 2D2DA 1HAOH 3SUDA 3UOPA 5DG6A 1HJ9A 3H5CB 1BJVA 1Z8IB 1CBWB 1EZUC 7LPRA 4ABJA 1IHSH 5FPSA 2B9LA 5JPMH 5DP6A 3A8BA 4O9VA 4YZUA 3TJNA 1HDTH 3QUMP 1MBQA 4GSOA 5FX6A 1C1RA 2OLGA 3SV2H 3C27B 1MZAA 3ZZAA 1HAIH 1GJAB 2FX6A 5FHTA 3DA9B 4OS4A 4AFSA 2BVSH 4UFEH 6CHAC 5FBIA 1B7XB 4ZXYH 2A45B 5E2OA 5C1YA 3E0PB 1UTQA 4E7RG 2ZCLP 5HM2A 3P95A 1W0YH 1OWHA 1GI1A 3TNTA 4UFFH 1O3IA 1RXPA 3RXIA 1JBUH 4Y0YE 5A8YA 1FY5A 1DWCH 2PTNA 4MNVA 4NSYA 1K28D 4IGDA 3LGIA 3TK6A 5GCHG 4NIYA 4Y8ZA 1UVOA 1O5DH 2ZFQH 3MU1A 4XBDA 2I6QA 3F1SB 2OXSA 1BT7A 1OPHB 2BXTH 2VH6A 4SGBE 1T8NA 1E38B 1XXDA 1BUIA 3EA8A 5PTPA 2F9OA 4D7GA 4Q7YA 2AIQA 3QZQA 1G30B 2H9TH 1RFNA 1UK2A 4CBNA 1O5CB 2ODQA 2SGFE 3H7OA 1ANCA 1VGCB 4INHA 1GI2A 1MKXH 2CN0H 1YPMH 1SQAA 1QGFA 2BQWB 3MH5A 3GCHB 4WF8A 1FY1A 2F9NA 2AMQA 1THPB 1RS0A 1HAVB 4KGAA 2ZHEH 4YM9A 1BQYA 4I31A 3K6ZA 1YPHC 1NU7B 1XMNB 4DCDA 5F6MA 1GBFA 5GXPA 1W11U 4ZKNU 3V7TA 2BY7X 1ARCA 2A31A 1BMAA 4K1SA 1SL3A 1CT2E 1AI8H 1GPZA 2W3KA 1YCPM 1WBGB 3W94A 5E8EH 2PFEA 1P0SH 1NRSH 5HGGA 1H9IE 5JBBS 1O2RA 5K7RA 1EAWA 1SGEE 2PSXA 5HYOA 1S0QA 3LGYA 1GJBB 3RXBA 1C1UH 4LZ1H 3F9HA 1T4VH 1GBDA 2UWOA 4U2WA 1V2NT 1W7XH 4DGJA 4OS5A 4ZAEA 3SGAE 2FS8A 1Z1IA 2B7DH 1UCYK 5EG4A 1BTWA 2P8OC 1L4ZA 1YCPH 4WH8A 2ZU3A 3PWCA 3R3GB 1ARBA 1C5NH 3LJOA 2XWBI 3E3TA 2UUFB 4X8TH 1UTJA 2CHAB 2BY5X 3KQDA 4DOQA 4FUHA 1O3KA 1DDJA 4WH6A 3ZZBA 1VJ9U 4VGCC 2TIOA 3RXPA 5F03A 1KTTB
chains in the Genus database with same CATH superfamily
2G8TA 1INCA 2PKAA 3F9EA 4OS7A 2LNCA 1NESE 1MAXA 4ZXXH 2BDIA 5BPEA 2YNBA 1GMHF 4TPIZ 3IWMA 4X1NU 3A88A 1IQFA 3D65E 1SGRE 4CHAC 3T29A 1HLTH 1PPCE 4Y0ZE 1UK3A 3F2HA 3LH3A 3URDA 4HZHA 4NA9H 4NWLA 1QHRB 3SBKA 1UVTH 4YT7H 3PTNA 3SNCA 7KMEH 4GPGA 2RFKC 1N1LA 3AW1A 5CMXH 2QIQA 1GI4A 3ATKA 1HPGA 5DN6D 1O3FA 2Z3DA 1EPTB 1TNLA 1ABJH 4FUCA 2YNAA 3KEEA 4ABBA 1J16A 1H4WA 1HGTH 4OGXA 2KFWA 3VPKA 4X6NA 1FONA 2CXVA 1OWDA 2BZAA 1O38A 4ISNA 1A2CH 4U30A 2BB4A 2ZHQH 1O2IA 4NIVA 5IDKA 1DITH 1EB1H 2HNTF 5E2PA 3FKSD 3U98H 3SZNA 1FUJA 2Q1JA 1MKWK 1O2LA 3FP8E 1TNGA 3I78A 3S9BA 4BANB 2EI6A 2QY0B 2RDLA 1GBHA 1O2WA 1J8AA 1YWUA 3KQBA 1DSTA 3RXMA 3T2NA 1O2NA 2WPMS 3UNRA 4XD7D 1CE5A 2WYGA 3RXGA 3TH3H 1GHAF 1EJAA 1EAIA 2FI5E 1TMUH 2ZGJA 2V0BA 2W7SA 4KTCA 4O03A 3A85A 5E0GA 3EQ0H 1L4DA 1LO6A 3UAIC 2RCEA 2PTCE 1V2LT 1V2TT 1SGNE 2O8MA 1ACBE 1JRSA 1SI5H 4ZKRU 3RXLA 2GCTC 1RIWC 2FWWA 1IQEA 6CHAB 4NG9H 1T4UH 4JK6A 1FI8A 3OTJE 1SLWB 2L74A 5DP4A 2UWPA 1XXFA 1CHGA 4YTAA 4WMDA 4J2YB 4Z1MD 3F68H 1EQ9A 1AO5A 3NPSA 2RDEA 1W10U 3E8LA 3TIUA 2AYWA 1KLIH 2Z94A 3UTUH 2OC8A 1OP2A 1F2SE 2ALVA 1Y5UT 1KYNA 2BQ6B 4X1QU 2FXRA 5C0TA 2AMDA 2G81E 3PMHB 1BDAA 1HIAA 3L33A 1UTNA 2BX3A 3AAUA 1L2EA 3K2UA 4YXWD 1GJ9B 3ZZCA 1AFEH 1OYTH 3RC5A 3P8NA 3T27A 4X6MA 3ATMA 1ELBA 3BTME 1EOJA 3MWIU 3KL6A 1QTFA 1TNHA 4NIXA 3VGCC 2Y81A 3GY4A 1H8HD 1HAXB 3D49H 1HYLA 1TOMH 1B0FA 1SB1H 4MPVA 2OCVB 1EFRD 2J5UA 1A1RA 4X1RU 3HGNA 1LPGB 6GCHF 5FX5A 3ZZ5A 2ZDNA 4ABEA 1YPGH 1KTSB 3MNBA 1OS8A 2G4TA 2WUBA 4A6LA 1LTOA 3AAVA 2XTTB 1C2MA 4JZEH 4X8VH 1IQIA 1UTPA 2XBYA 2ZIQH 1MD7A 1BMLA 2GMTC 1G3BA 2QYIA 2VIVA 1F5KU 1C5LH 1CHOF 1S82A 1FV9A 2G55A 3RU4E 1QNJA 4AG2A 1GDUA 1ANBA 1HAZB 1K1LA 2A5KA 1MTVA 2J38A 1SGYE 2P8OB 3RXVA 3C1KA 3MH4A 4E7NA 2QF4A 3P8FA 2FESH 4JYUH 2OINA 1P09A 3NK8A 1K0HA 1HAPH 3WW7A 4NCYA 2ZF0H 4JYVH 5EIYA 2O8TA 3NCLA 1PYTC 1TONA 3N7DA 3VEQB 3ZVEA 1CBWC 2V3MA 1FLEE 4Y76A 1TNKA 4VGCB 1ANDA 4FUEA 1BJUA 1TB6H 3RXKA 1O35A 4B74A 2GZ9A 1WTGH 2W26A 3OE7D 1BBRE 1OXGA 5AFZH 3M5MA 3SQEE 2BLOA 4F49A 5DP7A 1QJ7B 2L6OA 3VXFH 2ULLA 1F0SA 4DW2U 3SV8A 2G4UA 4X8UH 3A7ZA 2BHGA 8GCHF 2G51A 1S0RA 3SU2A 2FS9A 1P01A 1DLKB 2BTCE 4WXIA 1C2DA 3ZVDA 3GYLB 2SGQE 2B5TB 2GDDA 3D23A 1NFXA 2ZGHA 2XRCA 1FX0B 1V2JT 1O2XA 3A7XA 5EPYA 2FYQA 1GBAA 4AX9H 1MABB 1SKYE 4AZ2B 1V2WT 1L1NA 1CA0C 2FTMA 4M9FA 3BTTE 1VCPA 1HV7A 1YLDA 1NC6A 2GT8A 3TK5A 3FANA 8LPRA 1S5SA 2IJOB 1GVLA 1GI7B 1F92A 1XVMA 2I6SA 4GCHG 1EKBB 1EUFA 1P05A 3QDZB 5JDUB 1LPZB 1FJSA 3KYFA 1IOEA 2W6JD 5EODA 2BY9X 1DWDH 4Y8YA 2V6NA 1O2KA 4D9RA 3TJVA 1HXFH 2NU2E 1SSXA 2ZEBA 3ZZ7A 4MQAA 2ZCKP 1A61H 4ABFA 3EGKH 1N8OC 1D6WA 3TGIE 2HNTC 2HOBA 3RM0H 1YC0A 2J94A 3BG4B 1YLCA 1C5PA 3KQEA 1HXEH 2GCTB 1RIWB 3FP6E 2K1QA 1K21H 2VVUA 1C9PA 3DD2H 1K9OE 1QBNA 1QRXA 3VB3A 2ZG0H 8KME2 3JZ1B 3UUZA 3BTHE 1ESBA 1MBMA 2R3UA 2R2WU 1AN1E 4UONA 1XUHA 1QQ4A 2ZDAH 1UW7A 1S6LA 4P00A 1SGIB 4BTUB 5A09A 1TOCB 4JZDH 1C1VH 1TIOA 1HUTH 4K5ZA 2R0LA 2Z6BD 3PROA 2AFQB 3AVZA 3EDXB 2EY4C 1SQTA 1AKSA 2PGBB 1TA6A 2CK3D 4BOHA 2ZHWH 1F0RA 1JIMA 5L2YH 3A87A 2GVFA 2BD9A 1K2I1 3P8OA 1O3JA 2ALPA 3BTEE 1SGDE 3LC3A 3FP7E 2ZHFH 1KXCA 2JH6D 2ZU4A 2VWLA 2BDAA 1FZZA 2OC1A 2LELA 5FBEA 1TPAE 2OQUA 3ZZ3A 4FUJA 3ELAH 3L3TA 4I8HA 1NRRH 2C8XB 1TGCA 4Y10E 1DE7H 1B0EA 2NU3E 1T31A 2RA0A 3VGCB 3AW0A 1S83A 3KYGA 4KELA 4ABDA 3RXEA 3U8OH 3MO3A 1UTOA 2Y7ZA 2PV9B 1F0TA 1GBIA 2ZP0H 1GJ6A 1ID5H 2BLVA 3A89A 1AVWA 2GV6A 2HVYB 2ZECA 2V35A 2FYRA 3AK5A 1DVAH 1QY6A 4NSVA 4JZ1A 3ZV8A 1NRQH 1GHXH 1G3CA 1P3CA 5T3HA 2LP6A 3MNCA 1QB1A 3MU5A 2GMTB 1W0ZU 4AYVB 1S81A 1O2TA 2GP9B 1BHXF 2SGDE 4K1EA 5C5OA 2QA9E 2BD2A 4F48B 4AOQA 4CRDA 1VITG 2GGVB 2WPLS 3M3TA 3ZIAD 1XVOA 4KP0A 1KLTA 1C1SA 1CQQA 3EA9A 1P2JA 4X6OA 2HALA 4CREA 1GJ7B 4INLA 3BSQA 1P3EA 3PMBB 1OX1A 1LHFH 2JJ1D 2FLRH 1NY22 1C2EA 4HTCH 3CENA 1UCYH 3QZRA 1BCUH 3A7VA 6ESTA 2A2XH 1T8OA 1QB9A 1QZ8A 1WQSA 1ZOMA 4B73A 3SV9A 3CP7A 4ZUHA 2W6ID 1A3EH 2QV1A 2V3OH 1E1RD 3K9XB 2R3YA 3LIWA 5GWZA 3LT3A 4RT0A 3QGJA 1O5GH 3STJA 1G37A 1ETTH 1O37A 1O3NA 1EXFA 2A32A 2O8LA 3A82A 3SU3A 2QC2A 5B6OA 4BXWA 1ELDE 1DM4B 1SGTA 4BTIB 2GTBA 3ZZ6A 5KEDA 3F9GA 2VNTA 2XCFA 4AYYB 4UFGH 4Q7ZA 2CF9H 3V13A 3MU4A 1WUNH 2GV7A 1ZJDA 4Y8XA 1Z6EA 4ISIH 2V3HH 5C67A 1J15A 2R9PA 4X2WA 5A0BA 4B2BA 1BMFD 2W7UA 1Z6JH 1V2UT 2FOHA 1C5YB 5IYTA 4YOIA 1JMOH 2HPPH 1C2FA 4Q4LA 1XKAC 1P2MA 4MNXA 2Y6TA 5DKMA 1SGFG 1K22H 1A5GH 1P9SA 2BVRH 4BXSA 2KX4A 1CA0B 2FOMB 3SGBE 1DOJA 4UD9H 3TNSA 1NRPH 2BDYA 1C2LA 2W5EA 3SORA 3GY3A 3BIVH 1IQNA 1BMNH 1TA2A 1SGPE 1DANH 1EZQA 3LJJA 1E1QD 3PLKA 3PO1C 1T32A 4CRCA 1C2GA 1GI0A 2M2AA 1TPSA 3GCOA 1ZR0A 1YP9A 1MTWA 2VIWA 1SHHB 1O33A 3S9CA 3QWCH 2V7QD 4NFFA 1GCDA 1MKWH 3M35A 3PB1E 3FZZA 2FI3E 1FPHH 1TX8A 1AD8H 3LC5A 1K1OA 3UOUA 2VINA 1P06A 5EGMA 3M61U 4YOJA 1ZYOA 4AORA 2P3FH 3RXQA 1N8OB 4ZMAH 1P12E 1BBRK 3GY6A 1OWKA 5GIBA 1BTPA 2QXGA 2YOLA 3PV4A 1AQ7A 1TMBH 3P92A 2F4LA 1C5VA 2KCOA 1TX7A 1C1PA 4TY6A 2Y80A 4O97A 4CRFA 1WCZA 2SNVA 4I8GA 3E91A 3LKWA 5F8XA 2FM2A 1A0JA 3SNEA 1IQHA 1UK4A 2H2ZA 1EP5A 5GPIB 3MNXA 3QTOH 1ZPZA 4A7IB 2ZWLH 2F91A 6LPRA 3M36A 2STBE 1O3EA 3ODFA 1QJ1B 1HJAC 1C4U2 1GBJA 1LKBA 1QB6A 2PUXB 1QJ6B 2BLWA 3LDXH 1GBLA 3F2GA 4UFDH 5A0CA 5EW2H 3HK6B 2WYJA 2Z9KA 5E0HA 4X1PU 2AGIX 5H4IB 2QAAA 2AS9A 1WYKA 2ZFPH 4ZHMU 3M5NA 1EZXC 1GMHG 2WINI 3LGUA 3V12A 4I86A 2Z9JA 4THNH 3RXDA 1Z8RA 1W12U 1ZLRA 1GBKA 2XBVA 4ASHA 1S85A 1DWEH 5HMAA 3UFAA 1S6HA 3STIA 1ZHPA 1TLDA 4GVUA 4IN2A 1EP6A 3MO9A 4B76A 1NBME 2BMGB 1ZSJA 3PM3A 5DGJA 1EATA 4TPYA 1GHVH 2J34A 5F8TA 3EYDA 4DJZB 1BZXE 4ZH8A 4AGKA 3DSOA 3BF6H 4ZROA 1NU9A 4E06H 3VB6A 1AVXA 1EOLA 3GISB 1ZHRA 1UHBB 1EX3A 1GJCB 2NU4E 4FU8A 2THFB 2AGGX 2WV4A 1AUJA 2G5VA 2XYAA 1ZGVA 1HJ8A 5FPTA 5DP9A 1CT0E 3GY2A 1AGJA 2EEKA 1GHBF 2OTVA 4RKOB 3U9AH 2H5DA 1HAGE 2A7HA 2JKHA 3ZZ8A 2J2UA 2O8WA 1TX6A 4FUBA 4YESB 5C1XA 2Y7XA 1MU6B 2RG3A 4X2YA 2SNWA 4FVBA 3A7WA 3GCTF 1HAHH 1Z71A 1H9LB 1GHAG 2ZDKA 1J17T 2ZPQA 3SHAH 4D8NA 2PWXA 3GYMA 4Y11E 2XCNA 4OS6A 2A5AA 4Q80A 3TK9A 5G4BA 1BIOA 4A92A 1ZMJA 3H7TA 1GVKB 1ZMLA 2FOAA 1GI5A 3SJ9A 1QURH 4XDEA 5EQRA 5EOKA 5EJZA 3VB5A 4R0IA 3S69A 4XBBA 1ZRKA 4PROA 4X8SH 1A7SA 1HFDA 1W13U 3M37A 3BTGE 2F9VA 3BG4C 4X1SU 3ZZ4A 4ABGA 1TRMA 2Y5GA 1MTNC 1TMTH 4H6TA 4Y7AA 1KMHB 1XUJA 1OHHD 2Z7FE 4YLQH 2ZU2A 1C5WB 3TH2H 2BDGA 1HB0B 1Y3YA 1GBEA 3SNBA 1QCPA 1LMWB 2IPQX 1AUTC 2ZO3H 2BM2A 3KQCA 3TU7H 1AB9C 1DXPA 3A80A 1COWD 4ZKOU 3KF2A 4DY7B 2UUKB 2ZTZA 3QTVH 4ZHAA 4BTTB 2A2QH 1DY8A 2Z3EA 1SVPA 1BITA 1KXFA 1W2KH 3F3BA 2HWLB 5ESTE 1N6XA 4ISHH 2Z9LA 3DCLA 1O0DH 5T6GA 3RXUA 1D3DB 1GHZA 1P8VC 2GKVE 1NO9H 3UWJH 1JWTA 3NWUA 4TY7A 4GHTA 1VR1H 3UY9A 2VBCA 2G52A 2Z3CA 3PO1B 1G2MA 1TBRH 4J1YA 3SHCH 1F7ZA 1A4WH 2BD5A 4OM9A 2VVVA 1BRCE 2EC9H 2Z9GA 3Q3YA 5DJ7A 1AWFH 2FOBA 3DT0H 5GNDA 2QGRA 1GBMA 4UEHH 3PV2A 1MCTA 2ZNKH 3RU4T 2UUYA 3OY5U 3OEHD 2AGEX 1G3EA 1TNJA 4TWWA 1ZTJA 3MTYA 6GCHG 5LPFA 3OTPA 1NROH 1C1MA 3TVJB 4MTBA 1NM6A 2EI8A 2OBOA 4MPUA 5GDSH 1SBWA 5FCRA 1G36A 1FXYA 2K0QA 3CS7A 1TBQH 3MH7A 3O8BA 2C8WB 3RU4D 4WXVA 2BDBA 5C1UA 3EA7A 1Q2WA 2J98B 4I7YH 2VJ1A 1P10A 4Z6AH 1EZSC 1KXDA 2BOHB 2Q6DA 1CHOG 2ZHDA 3M5LA 7GCHF 4WVPE 2XC5A 1M9UA 1O3HA 1O2MA 1AHTH 3PMJA 1NFYA 3RUOA 2BD3A 2JDID 2AMPA 1SLXB 4CRGA 1FY3A 1ZJKA 3RXOA 1P2KA 2Y5FA 2VIQA 1VCWA 3MU0A 1A0LA 3RXTA 3KCGH 1NFUA 3TLOA 1AZZA 2PHBA 3E90B 3GDSA 3T62A 2JETC 3LONA 2VWNA 2WPHS 1Y8TA 3A81A 3SU0A 2IOTA 1TGTA 2FI4E 2ASUB 1A3BH 1HJAB 5EPNA 1O34A 1THRH 1LDTT 2VB0A 2UUJB 3LGVA 1PFXC 1ESAA 2F9BH 2ZTXA 2J95A 5GJ4B 4BAOB 2TGTA 4ISLA 3QO6A 2YMSD 3RXHA 2HVXA 1TRYA 3UNQA 4LK4A 1O3CA 2A4QA 2ZDLA 3UREA 1THSH 2P95A 1Z8GA 1ABIH 1CGJE 2P3TB 1GHYH 2K8IA 3MHWU 2RA3A 5FL7D 3N7OA 1KY9A 4KTUA 1C2KA 1AVGH 1Z1JA 1OP8A 1Z7KA 3SI3H 4IN1A 1DS2E 2BZ6H 2ZDVH 5LH8A 1YPKH 1K1NA 1G9IE 1MZDA 5EW1H 1GMDF 1OWEA 1DX5M 1DFPA 4Q63A 3U28C 8GCHG 1O3GA 3PWBA 3ZVBA 4DIIH 4FXGH 2TGAA 2P59A 1SOTA 2FPZA 2YMSC 2ZC9H 1ZMNA 1Y3UA 2Q6GA 3KN2A 3ENSB 3DFLA 3ITIA 5C20A 2C90B 2DE9A 4SGAE 4NA7A 2XC0A 3RMMH 5AF9H 5FAHA 1GMCG 1D4PB 2DUCA 3A8AA 2D8WA 2A4GA 1LHEH 1VJAU 3B9FH 3SV6A 2PKAB 1CT4E 1TE0A 3A7YA 1GMCF 2F43B 5EXLA 2GX4A 5SGAE 4K8BA 4B2AA 2IPHA 2PP6A 4ESTE 2WSSD 3SUFA 3OU0A 1V2RT 1BTYA 1MTUA 1O3PB 2GZ8A 2ZGCA 3RXJA 5C0UA 2P94A 4AFQA 3RXCA 3UPEA 3SW2B 3BEFB 3FAOA 2J9NA 1HAVA 5CHAC 1ZPCA 3BTFE 1YGCH 1G32B 3UB0A 1TNIA 1BHXB 4X2VA 5E0JA 2QE7D 2ANKH 1GHWH 1V2KT 1QBOA 3SOSA 1QR3E 1KLJH 2A5IA 5EU8A 1OWJA 1BTZA 3F0OA 1C5XB 3ATLA 1K1JA 1O3MA 2VH0A 3RMOH 5L30H 1SHYA 3NZIA 2AERH 4KTSA 3PLPA 3BEUA 1TFXA 5TCCA 1FY4A 5CHBA 5JB9S 5KECA 2TRMA 1MMJN 2ZU5A 3M3SA 1C1NA 1TRNA 1GL0E 4RI0A 3PMAB 1XX9A 2BYAX 2BD4A 3CS0A 1MTNB 1MAYA 1TGSZ 1FIZA 5A8ZA 3SV7A 2QN5T 2HNTE 1P2QA 4D7FA 2SGPE 3KNXA 2OC0A 1AB9B 4FUGA 4BAHB 2W3IA 3FFGA 3T26A 1T8MA 1NZQH 4WMFA 1HBTH 3KIDU 4U01A 3S9AA 1QL9A 2VWMA 1IHTH 1NS3A 1OKXA 3D62A 2PW8H 5AHGH 1LHDH 1SLVB 2WZQA 2A1DB 4NZLA 2WV9A 1GDQA 3A7TA 5DSFA 1A5IA 4XOJA 1TAWA 1UO6A 2P93A 1S84A 5EQSA 3GY7A 1BMMH 4B6EA 4FU9A 2A4RA 1WU1A 5ABWA 3OAAD 3OYPA 2ANWA 4H6SB 3WY8A 1GWAA 3N99A 4CBOA 1HRTH 2SFAA 2GZ7A 1RTFB 1Y59T 3RP2A 1XM1A 3KQ5A 1UTMA 3PYHA 3SNAA 1GGDC 3U1JB 2BY8X 1YKTA 3BN9A 1EJNA 4MPWA 1VZQH 5EXNA 4K60A 3RLYH 1YLNA 1C5MD 1ZZZA 1O2QA 1EPTA 1Y3VA 5C2ZA 3A84A 3SU4A 2ANMH 4MVNA 2OD3B 2Y5HA 1S6FA 3SNDA 3HGPA 1BBRH 1C1QA 2BQ7B 3AASA 4OS1A 2WPDD 4Q2KA 1HIAB 1LKAA 4Y79A 2CF8H 1TQ0B 2FP7B 1K1MA 1KXEA 3BG8A 5AVDA 2SGEE 1FPCH 2ZU1A 1O2SA 1GJ4H 1O2JA 3Q00A 3ZVAA 2WV5A 3H09A 3ATIA 4TSFD 1O5AB 1P02A 5L2ZH 1ZSLA 1PPEE 2JETB 4K69A 3ZVFA 4RN6A 3UQVA 1YF4A 1W0JD 2BVXH 1W0KD 3FZDA 3K65B 4RT1A 3T25A 1TWXB 1ZHMA 2ZKSA 5HIYA 3MNSA 1EJMA 3BTDE 1SPJA 1AWHB 3VFEA 1C1OA 3LPRA 3O8DA 4DVAU 1BRAA 2WHXA 1FMGA 1MH0A 4P02A 1KSNA 1FNIA 3DSGA 3GCNA 1RGQA 5HM9A 1H1BA 2BD8A 2XXLA 1H8IH 2F3CE 2UWLA 2R2MB 3KHVA 4LOYH 1NN6A 4D9QA 2KAIB 4RKJB 4O3TA 4AB8A 1GI8B 4ZHLU 3SQHE 1O32A 2PKSC 2VGCB 5DP8A 4ZCNA 1HAYB 2ZTYA 1ZTKA 1GCTC 2R0KA 1FIWA 1P2OA 3MYWA 1MU8B 1XUGA 2YMSB 4DG4A 1ORFA 4K2YA 2PGQB 5TJXA 1O2HA 1LVBA 2FOFA 1RRKA 4YT6H 2VWOA 1WOFA 2F9UA 2F9PA 1AFQC 3HK3B 1TBZH 3NKKA 2OP9A 2PUQH 4XE4A 1G3DA 2BDCA 4BAQB 4ISOA 2AIPA 1J14A 4Q7XA 3RXAA 4UDWH 4BAKB 3Q3XA 1D6RA 4M7GA 1IQJA 3F9FA 3I77A 1OWIA 5C5NA 4GLYA 1GG6B 1OOKB 2B8OH 1ELTA 1MUEB 3E6PH 4K8YA 4A1XA 3PLBA 2WPJS 1WAYB 1C5QA 2BD7A 2FEQH 3RMNH 5CHAB 1N6YA 1AZ8A 1ELEE 3SJKA 1FN8A 2BLQA 3V3MA 2FZZA 1IQKA 1BA8B 4XSKU 3DFJA 1FDPA 2P16A 3P70B 5GCHF 2J98A 1IQLA 2FOCA 2WUCA 1Z8JB 2KCPA 1GI6A 3WWBA 1X7AC 1GBBA 2H5CA 2PLXA 1ZPBA 1KDQB 3VB4A 4ACAA 1ELVA 2KR7A 3UR6A 2VIOA 2SGAA 4AB9A 2DE8A 1Q3XA 3SUEA 2WPKS 1YY3A 4D76A 2IN2A 1D3PB 1P9UA 1P2IA 1XUFA 3BV9B 4B2CA 1DUAA 1O2YA 3Q76A 3RC4A 1YPHE 4IW4E 5ETXA 4JYTA 3MFJA 4IS5A 2CJIA 1XUKA 3NXPA 4Y7BA 3GDUA 3ZYDA 2XOKD 1BRUP 1NT1A 5HIZA 4I8KA 1O2PA 3TH4H 1V2VT 2TPIZ 1HNEE 1P04A 1AMHA 3PRDA 1DY9A 5DK1A 1BOQA 3A8CA 3UNSA 1C5RA 2XNDD 5DPAA 1PJPA 1E35B 4ABHA 1KIGH 4H4FA 5EXMA 2J4IA 1MQ5A 2NU1E 1UVSH 3G01A 1WXRA 1XKBC 2VIDA 4JK5A 1F5LA 2ZQ1A 3U8TH 3RXRA 2G5NA 4X6PA 4H42U 3SJIA 2HGTH 3NUMA 5JBCS 1UTKA 3BTWE 1C1TA 1NBMD 3E16B 1CGHA 2C3SA 1MD8A 3S0NA 1GGDB 2QXIA 3FOAA 4JCNA 1IQGA 4MNWA 3TJUA 4I8LA 4A1TA 2Z9IA 3BTKE 1AKSB 1YBWA 3ODDA 1SFQB 1ETRH 1O31A 2PR3A 3OSYA 1YPJH 2J92A 1AE5A 7ESTE 4K3JA 2A7CA 2O9QA 1LHCH 4NIWA 2ZDMA 2D1JA 1O30A 2QF0A 3EAJA 3P17H 1K1PA 4WY3A 1DXWA 4GAWA 3OFND 3QN7A 2ZFRH 1LVYA 1SFIA 3N7EA 1Y3WA 4AGJA 1GHBG 1ZRBA 1NFWA 1JOUB 2PSYA 3EE0B 1WTHD 2OQ5A 4CRBA 2OK5A 1NTPA 4A1VA 1QQUA 4IMZA 5JYIA 2FO9A 1PQAA 5LGOA 1GI3A 4TWYA 5EJLA 3GCTG 1V2OT 1O2VA 2AEIH 2KZ4A 3NRLA 3SJOA 3ESTA 4BAMB 2ESTE 4TYDA 2ZFTA 1SQOA 3GS9A 9LPRA 4MDSA 4FU7A 2H9HA 2XBWA 1NRNH 1O2GH 3F2FA 3SI4H 1E37B 1F5RA 3OX7U 1O3OA 5AFYH 1C5ZB 1HCGA 1C2JA 1QL7A 4DURA 2ANYA 1FY8E 1C2HA 1O3AA 2FMJA 5ESBA 3RLWH 1QL8A 2ZPRA 1YPEH 2QF5A 3DSPA 2PKSB 3VXEH 1TGBA 1MKXK 3BEIB 1T8LA 1FAXA 1ANEA 1PQ8A 2ZZUH 1GCTB 1AIXH 1C2IA 3O8RA 5CE1A 4Y71A 3KGPA 1GJ8B 1TQ7B 5T6DA 5A0AE 3T5FH 3ZVGA 1K1IA 1AFQB 3UQOA 2B0FA 3BIUH 1GDNA 2VVCA 1SOZA 1TPOA 1O39A 1SGQE 3P8GA 3LOXA 1LPKB 2A0QB 1A5HA 1DPOA 2TGDA 4O3UA 4NA8A 1YPLH 1GI9B 4AFUA 4IBLH 5A8XA 4ACBA 2CMYA 1LHGH 2FTLE 1D3QB 4NFEA 1Y3XA 4GHQA 1SGFA 3SO3A 2NU0E 3DHKH 3V0XA 4KKDA 1W3CA 1YM0A 2STAE 3WWFA 3SU1A 5EQQA 1CO7E 4HGCA 1E0FD 1YCPK 1EASA 4IMQA 1WSSH 3LU9B 1MCVA 1LVMA 2BX4A 1E36B 3LGTA 3R0FA 4IC6A 1SMFE 3Q77A 4WWYA 5TCAA 1BTXA 1P11E 4HI3A 5B6LA 3TPIZ 3S7KB 3EE7A 3MH6A 2A4OA 4B6FA 2ZFFH 2ZQ2A 2FOGA 1C4V2 1GBTA 2QF3A 3FN8A 1C5TA 3FO8D 2H1UA 3SUGA 3SYJA 4AN7A 4XFQA 4YOGA 5C3NA 1TPPA 3TITA 5C17A 4XBCA 1J9CH 1RD3B 2FX4A 1P57B 1PPHE 1QRZA 7GCHG 1XUIA 3M5OA 1LQDB 1VCQA 4YO9A 1F0UA 4NWKA 2M5TA 2JH0D 1RTKA 1PPBH 3PRBA 1WV7H 3UR9A 1W8BH 4JMYA 1FAKH 1BB0B 1O2OA 3RMLH 2H9EH 2XBXA 3O8CA 2OUAA 3VG8A 2CV3A 1TYNA 1PPFE 2JJ2D 3ZZ9A 1EB2A 4CR9A 3RC6A 1LVOA 2D26C 4OS2A 3M3VA 5I25A 3QGNB 1BTHH 3HATH 1ELFA 3MI4A 1KXAA 2ZFSA 5FCKA 3Q3KA 1PYTD 5K0HA 3HPTB 1AY6H 4HG6A 4MG3A 3URCA 2KAIA 4K1TA 4F55A 3QK1A 5BRRE 4ZKSU 2QXJA 3GY5A 1L1GA 4MPXA 3A86A 1O3DA 2TBSA 2BY6X 3QLPH 2ZGXH 3TGKE 3LGWA 1C5UA 4I33A 4LZ4B 1GMDG 3SJ8A 4HFPB 1L0ZA 1V2QT 1QIXB 2EA3A 1CU1A 4BNRA 5DP5A 5J4SA 1H8DH 1ETSH 3RDZA 2VGCC 1V3XA 5JBAS 1LQEA 2ZCHP 3RXSA 1DICA 3B8JA 1OYQA 4AG1A 2GCHG 4Z0KA 1FN6A 1ZTLA 4UE7H 2ODYB 1W14U 1SC8U 1MTSA 3A83A 3GDVA 4U32A 3MOCA 2GCHF 3K6YA 1O36A 1BRBE 2XNIA 4CHAB 1MQ6A 2FLBH 1WQVH 1VITH 1PQ5A 1ESTA 5J4QA 3MMGA 2FDAA 2BXUH 4QT8C 5F8ZA 1P2NA 2C8ZB 3UWIA 2AH4X 3U1IB 2GT7A 1DLEA 4JZIA 1DT2A 3GICB 1SQRA 2ILNA 3QX5H 4MNYA 4A5TS 2XWAA 1O3LA 3L6PA 1JXPA 1GG6C 3PTBA 3GOVB 1AE8H 3UIRA 1KDQA 5T6FA 2XC4A 1UCYE 1WDIA 3E0NB 2QXHA 9ESTA 4DT7B 3M7UA 5DP3A 2GD4B 1DUEA 3IITA 5DO4H 1A0HB 1SR5C 1ELAA 1TABE 3MO6A 3ATWA 2ZPSA 1Q31A 2XW9A 1L1JA 1O5FH 2QCYA 4WMEA 1D9IA 2HPQH 1QBVH 4FVDA 1SLUB 1UJ1A 2VIPA 5L6NH 1EAXA 5HXFA 4GCHF 2TGPZ 1YYY1 4R8TB 3F6UH 1VKYA 2IJD1 3DUXH 4X2XA 1O2ZA 1VGCC 3BTQE 4CRAA 1CVWH 1LCYA 4RSPA 1TALA 2A7JA 5FXLA 5LPRA 1RTLA 1RJXB 3GCHC 4CH2B 2C93B 4CR5A 4F4OC 5A2MH 4ABAA 2KCYA 2Q6FA 3IG6B 1C5SA 1GJDB 4X0WU 2LPRA 1KXBA 2FOEA 3TJOA 3T28A 3FVFB 1P03A 4FUDA 5JBTA 5JB8S 1V2MT 5LPEA 1H9HE 4NZQA 4I8JA 1GL1A 1EAUA 3GY8A 4B1TA 1GVZA 1JIRA 1Y5BT 1DSUA 4OGYA 4NGAH 1O2UA 1CSOE 1CGIE 1GBCA 1NPMA 2ZI2H 1OSSA 1AU8A 1QFKH 2P3UB 3SU5A 3U69H 1PPGE 1V2PT 4MLFB 2HRVA 1ELGA 2BOKA 1ZGIA 4Y6DA 2NWNA 3SN8A 2CGAA 1C4Y2 3A8DA 4FUFA 1E34B 1UVUH 1TGNA 2CHAC 4XRNA 3MU8A 1SGCA 4AC9A 5I46H 1BTUA 2EI7A 1Y5AT 1PPZA 1SG8B 1UVPA 1QA7A 1G2LA 1UHBA 3RXFA 1JRTA 2ZGBH 1DWBH 1PQ7A 1QA0A 4E05H 4WJG2 2KCAA 2EQNA 3LH1A 4CH8B 3U8RH 2GDEH 8ESTE 3HKIB 1FQ3A 3P6ZB 3ZYEA 2G00A 3JZ2B 2Y82A 1W7GH 3S7HB 2FODA 4IC5A 4AFZA 4GUXA 1CA8B 1GJ5H 2OBQA 5KGOA 3SGQE 3TGJE 2AHME 1C9TA 3M7QA 3ZZDA 2ZA5A 5T1VA 1D3TB 2H6MA 1IQMA 4FOUC 3ZV9A 1ELCA 1U6QA 4LXBH 2O8UA 1ZSKA 2OC7A 4I32A 2GJGA 2C4FH 3M7TA 1O5BB 2JIZD 2ODPA 4B75A 1V6DA 1A46H 4JZFH 3HKJB 5IK2D 1C1WH 4DIHH 1QRWA 1EPTC 1IAUA 4ASUD 2F83A 1OP0A 3I29A 1O3BA 1UTLM 1T7CA 2HLCA 3ZVCA 1V2ST 1O5EH 1VITF 3VB7A 2BDHA 3B23B 4B71A 3W95A 1H8ED 4DT4A 4YLUA 3RM2H 4INKA 2WPIS 3OY6U 2VU8E 3SZEA 4FUIA 1C5OH 3E1XB 3SU6A 2FIRH 4ABIA 2JH5D 1UMAH 2C8YB 5FPYA 1B5GH 2D2DA 1HAOH 3SUDA 3UOPA 5DG6A 1HJ9A 3H5CB 1BJVA 1Z8IB 1CBWB 1EZUC 7LPRA 4ABJA 1IHSH 5FPSA 2B9LA 5JPMH 5DP6A 3A8BA 4O9VA 4YZUA 3TJNA 1HDTH 5C94A 3QUMP 1MBQA 4GSOA 5FX6A 1C1RA 2OLGA 3SV2H 3C27B 1MZAA 3ZZAA 1HAIH 1GJAB 2FX6A 2KM0A 5FHTA 3DA9B 4OS4A 4AFSA 2BVSH 4UFEH 6CHAC 5FBIA 1B7XB 4ZXYH 2A45B 5E2OA 5C1YA 3E0PB 1UTQA 4E7RG 2ZCLP 5HM2A 3P95A 1W0YH 1OWHA 1GI1A 3TNTA 3CNRA 4UFFH 1O3IA 1RXPA 3RXIA 1JBUH 4Y0YE 5A8YA 1FY5A 1DWCH 3PV5A 2PTNA 4MNVA 4NSYA 1K28D 4IGDA 3LGIA 3TK6A 5GCHG 4NIYA 4Y8ZA 1UVOA 1O5DH 2ZFQH 3MU1A 4XBDA 2I6QA 3F1SB 2OXSA 1BT7A 1OPHB 2BXTH 5F53A 2VH6A 5HKKD 4SGBE 1T8NA 1E38B 1XXDA 1BUIA 3W1EA 3EA8A 5PTPA 2F9OA 4D7GA 4Q7YA 2AIQA 3QZQA 1G30B 2H9TH 1RFNA 1UK2A 4CBNA 1O5CB 2ODQA 2SGFE 3H7OA 1ANCA 1VGCB 3OEED 1GI2A 4INHA 1MKXH 2CN0H 1YPMH 1SQAA 1QGFA 2BQWB 3MH5A 3GCHB 2J97A 4WF8A 1FY1A 2F9NA 2AMQA 1THPB 1RS0A 1HAVB 4KGAA 2ZHEH 4YM9A 1BQYA 4I31A 3K6ZA 1YPHC 1NU7B 1XMNB 4DCDA 5F6MA 1GBFA 5GXPA 5CDFE 1W11U 4ZKNU 3V7TA 2BY7X 1ARCA 2A31A 1BMAA 4K1SA 1SL3A 1CT2E 1AI8H 1GPZA 2W3KA 1YCPM 1WBGB 3W94A 5E8EH 2PFEA 1P0SH 1NRSH 5HGGA 1H9IE 5JBBS 1O2RA 5K7RA 1EAWA 1SGEE 2PSXA 5HYOA 1S0QA 3LGYA 1GJBB 4TT3D 3RXBA 1C1UH 4LZ1H 3F9HA 1T4VH 1GBDA 2UWOA 4U2WA 1V2NT 1W7XH 4DGJA 4OS5A 4ZAEA 3SGAE 2FS8A 1Z1IA 2B7DH 1UCYK 5EG4A 1BTWA 1L4ZA 1YCPH 2P8OC 4WH8A 2ZU3A 3PWCA 1E79D 3R3GB 1ARBA 1C5NH 3LJOA 2HLDD 2XWBI 3E3TA 2UUFB 4X8TH 1UTJA 5EJ1A 2CHAB 2BY5X 3KQDA 3F0PA 4DOQA 4FUHA 4FETA 1O3KA 1DDJA 4WH6A 3ZZBA 1VJ9U 4VGCC 2TIOA 3RXPA 5F03A 1KTTB 3MQKC
chains in the Genus database with same CATH topology
2G8TA 1INCA 2PKAA 3F9EA 4OS7A 2LNCA 1NESE 1MAXA 4ZXXH 2BDIA 5BPEA 2YNBA 1GMHF 4TPIZ 3IWMA 4X1NU 3A88A 1IQFA 3D65E 1SGRE 4CHAC 3T29A 1HLTH 1PPCE 4Y0ZE 1UK3A 3LH3A 3URDA 4HZHA 4NA9H 4NWLA 1QHRB 3SBKA 1UVTH 4YT7H 3PTNA 3SNCA 7KMEH 4GPGA 1N1LA 3AW1A 5CMXH 2QIQA 1GI4A 3ATKA 1HPGA 1O3FA 2Z3DA 1EPTB 1TNLA 1ABJH 4FUCA 2YNAA 3KEEA 4ABBA 1J16A 1H4WA 1HGTH 4OGXA 3VPKA 4X6NA 1FONA 2CXVA 1OWDA 2BZAA 1O38A 4ISNA 1A2CH 4U30A 2BB4A 2ZHQH 1O2IA 4NIVA 5IDKA 1DITH 1EB1H 2HNTF 5E2PA 3U98H 3SZNA 1FUJA 2Q1JA 1MKWK 1O2LA 3FP8E 1TNGA 3I78A 3S9BA 4BANB 2EI6A 2QY0B 2RDLA 1GBHA 1O2WA 1J8AA 3KQBA 1DSTA 3RXMA 3T2NA 1O2NA 2WPMS 3UNRA 1CE5A 2WYGA 3RXGA 3TH3H 1GHAF 1EJAA 1EAIA 2FI5E 1TMUH 2ZGJA 2V0BA 2W7SA 4KTCA 4O03A 3A85A 5E0GA 3EQ0H 1L4DA 1LO6A 2RCEA 2PTCE 1V2LT 1V2TT 1SGNE 2O8MA 1ACBE 1JRSA 1SI5H 4ZKRU 3RXLA 2GCTC 1RIWC 2FWWA 1IQEA 6CHAB 4NG9H 1T4UH 4JK6A 1FI8A 3OTJE 1SLWB 5DP4A 2UWPA 1XXFA 1CHGA 4YTAA 4WMDA 4J2YB 3F68H 1EQ9A 1AO5A 3NPSA 3TIUA 1W10U 3E8LA 2AYWA 1KLIH 2Z94A 3UTUH 2OC8A 1OP2A 1F2SE 2ALVA 1Y5UT 1KYNA 2BQ6B 4X1QU 2FXRA 2AMDA 2G81E 3PMHB 1BDAA 1HIAA 3L33A 1UTNA 2BX3A 3AAUA 1L2EA 3K2UA 1GJ9B 3ZZCA 1AFEH 1OYTH 3RC5A 3P8NA 3T27A 4X6MA 3ATMA 1ELBA 3BTME 1EOJA 3MWIU 3KL6A 1QTFA 1TNHA 4NIXA 3VGCC 2Y81A 3GY4A 1HAXB 3D49H 1HYLA 1TOMH 1B0FA 1SB1H 4MPVA 2OCVB 1A1RA 4X1RU 3HGNA 1LPGB 6GCHF 5FX5A 3ZZ5A 2ZDNA 4ABEA 1YPGH 1KTSB 3MNBA 1OS8A 2G4TA 2WUBA 4A6LA 1LTOA 3AAVA 2XTTB 1C2MA 4JZEH 4X8VH 1IQIA 1UTPA 2XBYA 2ZIQH 1MD7A 1BMLA 2GMTC 1G3BA 2QYIA 2VIVA 1F5KU 1C5LH 1CHOF 1S82A 1FV9A 2G55A 3RU4E 1QNJA 4AG2A 1GDUA 1ANBA 1HAZB 1K1LA 2A5KA 1MTVA 2J38A 1SGYE 2P8OB 3RXVA 3C1KA 3MH4A 4E7NA 3P8FA 2FESH 4JYUH 2OINA 1P09A 3NK8A 1HAPH 4NCYA 2ZF0H 4JYVH 2O8TA 3NCLA 1PYTC 1TONA 3VEQB 3ZVEA 1CBWC 1FLEE 4Y76A 1TNKA 4VGCB 1ANDA 4FUEA 1BJUA 1TB6H 3RXKA 1O35A 4B74A 2GZ9A 1WTGH 2W26A 1BBRE 1OXGA 5AFZH 3M5MA 3SQEE 2BLOA 4F49A 5DP7A 1QJ7B 3VXFH 2ULLA 1F0SA 4DW2U 3SV8A 2G4UA 4X8UH 3A7ZA 2BHGA 8GCHF 2G51A 1S0RA 3SU2A 2FS9A 1P01A 1DLKB 2BTCE 4WXIA 1C2DA 3ZVDA 3GYLB 2SGQE 2B5TB 2GDDA 3D23A 1NFXA 2ZGHA 2XRCA 1V2JT 1O2XA 3A7XA 5EPYA 2FYQA 1GBAA 4AX9H 4AZ2B 1V2WT 1L1NA 1CA0C 2FTMA 3BTTE 1VCPA 1HV7A 1YLDA 1NC6A 2GT8A 3TK5A 3FANA 8LPRA 1S5SA 2IJOB 1GVLA 1GI7B 1F92A 1XVMA 2I6SA 4GCHG 1EKBB 1EUFA 1P05A 3QDZB 5JDUB 1LPZB 1FJSA 1IOEA 5EODA 2BY9X 1DWDH 4Y8YA 2V6NA 1O2KA 4D9RA 3TJVA 1HXFH 2NU2E 1SSXA 2ZEBA 3ZZ7A 4MQAA 2ZCKP 1A61H 4ABFA 3EGKH 1N8OC 1D6WA 3TGIE 2HNTC 2HOBA 3RM0H 1YC0A 2J94A 3BG4B 1YLCA 1C5PA 3KQEA 1HXEH 2GCTB 1RIWB 3FP6E 2K1QA 1K21H 2VVUA 1C9PA 3DD2H 1K9OE 1QBNA 1QRXA 3VB3A 2ZG0H 8KME2 3JZ1B 3UUZA 3BTHE 1ESBA 1MBMA 2R3UA 2R2WU 1AN1E 4UONA 1XUHA 1QQ4A 2ZDAH 1SGIB 4BTUB 5A09A 1TOCB 4JZDH 1C1VH 1TIOA 1HUTH 4K5ZA 2R0LA 2Z6BD 3PROA 2AFQB 3AVZA 3EDXB 1SQTA 1AKSA 2PGBB 1TA6A 4BOHA 2ZHWH 1F0RA 1JIMA 5L2YH 3A87A 2GVFA 2BD9A 1K2I1 3P8OA 1O3JA 2ALPA 3BTEE 1SGDE 3LC3A 3FP7E 2ZHFH 1KXCA 2JH6D 2ZU4A 2VWLA 2BDAA 1FZZA 2OC1A 5FBEA 1TPAE 2OQUA 3ZZ3A 4FUJA 3ELAH 3L3TA 4I8HA 1NRRH 2C8XB 1TGCA 4Y10E 1DE7H 1B0EA 2NU3E 1T31A 2RA0A 3VGCB 3AW0A 1S83A 4KELA 4ABDA 3RXEA 3U8OH 3MO3A 1UTOA 2Y7ZA 2PV9B 1F0TA 1GBIA 2ZP0H 1GJ6A 1ID5H 2BLVA 3A89A 1AVWA 2GV6A 2ZECA 2V35A 2FYRA 1DVAH 1QY6A 4NSVA 4JZ1A 3ZV8A 1NRQH 1GHXH 1G3CA 1P3CA 5T3HA 3MNCA 1QB1A 3MU5A 2GMTB 1W0ZU 4AYVB 1S81A 1O2TA 2GP9B 1BHXF 2SGDE 4K1EA 5C5OA 2QA9E 2BD2A 4AOQA 4CRDA 1VITG 2GGVB 2WPLS 3M3TA 1XVOA 4KP0A 1KLTA 1C1SA 1CQQA 3EA9A 1P2JA 4X6OA 2HALA 4CREA 1GJ7B 4INLA 3BSQA 1P3EA 3PMBB 1OX1A 1LHFH 2FLRH 1NY22 1C2EA 4HTCH 3CENA 1UCYH 3QZRA 1BCUH 3A7VA 6ESTA 2A2XH 1T8OA 1QB9A 1WQSA 1ZOMA 4B73A 3SV9A 3CP7A 4ZUHA 1A3EH 2QV1A 2V3OH 3K9XB 2R3YA 3LIWA 5GWZA 3LT3A 3QGJA 1O5GH 3STJA 1G37A 1ETTH 1O37A 1O3NA 1EXFA 2A32A 2O8LA 3A82A 3SU3A 2QC2A 5B6OA 4BXWA 1ELDE 1DM4B 1SGTA 4BTIB 2GTBA 3ZZ6A 3F9GA 2VNTA 2XCFA 4AYYB 4UFGH 4Q7ZA 2CF9H 3V13A 3MU4A 1WUNH 2GV7A 1ZJDA 4Y8XA 1Z6EA 4ISIH 2V3HH 5C67A 1J15A 2R9PA 4X2WA 5A0BA 4B2BA 2W7UA 1Z6JH 1V2UT 2FOHA 1C5YB 5IYTA 4YOIA 1JMOH 2HPPH 1C2FA 1XKAC 1P2MA 4MNXA 2Y6TA 5DKMA 1SGFG 1K22H 1A5GH 1P9SA 2BVRH 4BXSA 1CA0B 2FOMB 3SGBE 1DOJA 4UD9H 3TNSA 1NRPH 2BDYA 1C2LA 2W5EA 3SORA 3GY3A 3BIVH 1IQNA 1BMNH 1TA2A 1SGPE 1DANH 1EZQA 3LJJA 3PLKA 3PO1C 1T32A 4CRCA 1C2GA 1GI0A 1TPSA 3GCOA 1ZR0A 1YP9A 1MTWA 2VIWA 1SHHB 1O33A 3S9CA 3QWCH 4NFFA 1GCDA 1MKWH 3M35A 3PB1E 3FZZA 2FI3E 1FPHH 1TX8A 1AD8H 3LC5A 1K1OA 3UOUA 2VINA 1P06A 5EGMA 3M61U 4YOJA 1ZYOA 4AORA 2P3FH 3RXQA 1N8OB 4ZMAH 1P12E 1BBRK 3GY6A 1OWKA 5GIBA 1BTPA 2QXGA 2YOLA 3PV4A 1AQ7A 1TMBH 3P92A 1C5VA 1TX7A 1C1PA 4TY6A 2Y80A 4O97A 4CRFA 1WCZA 2SNVA 4I8GA 3E91A 3LKWA 5F8XA 2FM2A 1A0JA 3SNEA 1IQHA 1UK4A 2H2ZA 1EP5A 5GPIB 3MNXA 3QTOH 1ZPZA 4A7IB 2ZWLH 2F91A 6LPRA 3M36A 2STBE 1O3EA 3ODFA 1QJ1B 1HJAC 1C4U2 1GBJA 1LKBA 1QB6A 2PUXB 1QJ6B 2BLWA 3LDXH 1GBLA 5A0CA 4UFDH 5EW2H 3HK6B 2WYJA 2Z9KA 5E0HA 4X1PU 2AGIX 5H4IB 2QAAA 2AS9A 1WYKA 2ZFPH 4ZHMU 3M5NA 1EZXC 1GMHG 2WINI 3LGUA 3V12A 2Z9JA 4THNH 3RXDA 1Z8RA 1W12U 1ZLRA 1GBKA 2XBVA 4ASHA 1S85A 1DWEH 5HMAA 3UFAA 1S6HA 3STIA 1ZHPA 1TLDA 4GVUA 4IN2A 1EP6A 3MO9A 4B76A 2BMGB 1ZSJA 3PM3A 5DGJA 1EATA 4TPYA 1GHVH 2J34A 5F8TA 3EYDA 4DJZB 1BZXE 4ZH8A 4AGKA 3BF6H 4ZROA 1NU9A 4E06H 3VB6A 1AVXA 1EOLA 3GISB 1ZHRA 1UHBB 1EX3A 1GJCB 2NU4E 4FU8A 2THFB 2AGGX 2WV4A 1AUJA 2G5VA 2XYAA 1ZGVA 1HJ8A 5FPTA 5DP9A 1CT0E 3GY2A 1AGJA 2EEKA 1GHBF 2OTVA 4RKOB 3U9AH 2H5DA 1HAGE 2A7HA 2JKHA 3ZZ8A 2J2UA 2O8WA 1TX6A 4FUBA 4YESB 5C1XA 2Y7XA 1MU6B 2RG3A 4X2YA 2SNWA 4FVBA 3A7WA 3GCTF 1HAHH 1Z71A 1H9LB 1GHAG 2ZDKA 1J17T 2ZPQA 3SHAH 4D8NA 2PWXA 3GYMA 4Y11E 2XCNA 4OS6A 2A5AA 4Q80A 3TK9A 5G4BA 1BIOA 4A92A 1ZMJA 3H7TA 1GVKB 1ZMLA 2FOAA 1GI5A 3SJ9A 1QURH 4XDEA 5EQRA 5EOKA 3VB5A 4R0IA 3S69A 4XBBA 1ZRKA 4PROA 4X8SH 1A7SA 1HFDA 1W13U 3M37A 3BTGE 2F9VA 3BG4C 4X1SU 3ZZ4A 4ABGA 1TRMA 2Y5GA 1MTNC 1TMTH 4H6TA 4Y7AA 1XUJA 2Z7FE 4YLQH 2ZU2A 1C5WB 3TH2H 2BDGA 1HB0B 1Y3YA 1GBEA 3SNBA 1QCPA 1LMWB 1AUTC 2ZO3H 2BM2A 3KQCA 3TU7H 1AB9C 1DXPA 3A80A 4ZKOU 3KF2A 4DY7B 2UUKB 2ZTZA 3QTVH 4ZHAA 4BTTB 2A2QH 1DY8A 2Z3EA 1SVPA 1BITA 1KXFA 1W2KH 2HWLB 5ESTE 1N6XA 4ISHH 2Z9LA 1O0DH 5T6GA 3RXUA 1D3DB 1GHZA 1P8VC 2GKVE 1NO9H 3UWJH 1JWTA 3NWUA 4TY7A 4GHTA 1VR1H 3UY9A 2G52A 2Z3CA 3PO1B 1G2MA 1TBRH 4J1YA 3SHCH 1F7ZA 1A4WH 2BD5A 2VVVA 1BRCE 2EC9H 2Z9GA 3Q3YA 5DJ7A 1AWFH 2FOBA 3DT0H 2QGRA 1GBMA 4UEHH 1MCTA 2ZNKH 3RU4T 2UUYA 3OY5U 2AGEX 1G3EA 1TNJA 4TWWA 1ZTJA 3MTYA 6GCHG 5LPFA 1NROH 1C1MA 3TVJB 4MTBA 1NM6A 2EI8A 2OBOA 4MPUA 5GDSH 1SBWA 5FCRA 1G36A 1FXYA 3CS7A 1TBQH 3MH7A 3O8BA 2C8WB 3RU4D 4WXVA 2BDBA 5C1UA 3EA7A 1Q2WA 4I7YH 2VJ1A 1P10A 4Z6AH 1EZSC 1KXDA 2BOHB 2Q6DA 1CHOG 2ZHDA 3M5LA 7GCHF 4WVPE 2XC5A 1M9UA 1O3HA 1O2MA 1AHTH 3PMJA 1NFYA 3RUOA 2BD3A 2AMPA 1SLXB 4CRGA 1FY3A 1ZJKA 3RXOA 1P2KA 2Y5FA 2VIQA 1VCWA 3MU0A 1A0LA 3RXTA 3KCGH 1NFUA 3TLOA 1AZZA 2PHBA 3E90B 3GDSA 3T62A 2JETC 3LONA 2VWNA 2WPHS 1Y8TA 3A81A 3SU0A 2IOTA 1TGTA 2FI4E 2ASUB 1A3BH 1HJAB 5EPNA 1O34A 1THRH 1LDTT 2VB0A 2UUJB 3LGVA 1PFXC 1ESAA 2F9BH 2ZTXA 2J95A 5GJ4B 4BAOB 2TGTA 4ISLA 3QO6A 3RXHA 2HVXA 1TRYA 3UNQA 4LK4A 1O3CA 2A4QA 2ZDLA 3UREA 1THSH 2P95A 1Z8GA 1ABIH 1CGJE 2P3TB 1GHYH 3MHWU 2RA3A 3N7OA 1KY9A 4KTUA 1C2KA 1AVGH 1Z1JA 1OP8A 1Z7KA 3SI3H 4IN1A 1DS2E 2BZ6H 2ZDVH 5LH8A 1YPKH 1K1NA 1G9IE 1MZDA 5EW1H 1GMDF 1OWEA 1DX5M 1DFPA 8GCHG 1O3GA 3PWBA 3ZVBA 4DIIH 4FXGH 2TGAA 2P59A 1SOTA 2FPZA 2ZC9H 1ZMNA 1Y3UA 2Q6GA 3KN2A 3ENSB 3DFLA 3ITIA 5C20A 2C90B 2DE9A 4SGAE 4NA7A 2XC0A 3RMMH 5AF9H 5FAHA 1GMCG 1D4PB 2DUCA 3A8AA 2D8WA 2A4GA 1LHEH 1VJAU 3B9FH 3SV6A 2PKAB 1CT4E 1TE0A 3A7YA 1GMCF 5EXLA 2GX4A 5SGAE 4K8BA 4B2AA 2IPHA 4ESTE 3SUFA 3OU0A 1V2RT 1BTYA 1MTUA 1O3PB 2GZ8A 2ZGCA 3RXJA 2P94A 4AFQA 3RXCA 3UPEA 3SW2B 3BEFB 3FAOA 2J9NA 1HAVA 5CHAC 1ZPCA 3BTFE 1YGCH 1G32B 1TNIA 1BHXB 4X2VA 5E0JA 2ANKH 1GHWH 1V2KT 1QBOA 3SOSA 1QR3E 1KLJH 2A5IA 5EU8A 1OWJA 1BTZA 1C5XB 3ATLA 1K1JA 1O3MA 2VH0A 3RMOH 5L30H 1SHYA 3NZIA 2AERH 4KTSA