4X2YA

Crystal structure of a chimeric murine norovirus ns6 protease (inactive c139a mutant) in which the p4-p4 prime residues of the cleavage junction in the extended c-terminus have been replaced by the corresponding residues from the ns2-3 junction.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
179
structure length
172
Chain Sequence
SIWSRVVQFGTGWGFWVSGHVFITAKHVAPPKGTEIFGRKPGDFTVTSSGDFLKYYFTSAVRPDIPAMVLENGCQEGVVASVLVKRASGEMLALAVRMGSQAAIKIGSAVVHGQTGMLLTGSNLGTIPGDAGCPYVYKKGNTWVVIGVHVAATRNTVIAATHGEPTLEAWQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NS6 Protease,NS6 Protease
publication title Structure determination of Murine Norovirus NS6 proteases with C-terminal extensions designed to probe protease-substrate interactions.
pubmed doi rcsb
source organism Murine norovirus 1
molecule tags Viral protein
total genus 29
structure length 172
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4x2yA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4x2yA01
1K1OA 2ZTYA 1BBRK 1GI1A 3URDA 1A7SA 4Y8ZA 1MBQA 2FLBH 4GHTA 2A2XH 1W7GH 1GG6C 1TRNA 2WUBA 3BG4B 2WV5A 1SC8U 5A0AE 4CHAB 1LVYA 3TVJB 2IN2A 1W13U 1MTNC 2VIPA 1AI8H 1LPZB 1FMGA 4NG9H 2BOKA 2FIRH 3Q3YA 3U8TH 1OX1A 1G37A 1RIWB 3RMMH 2CN0H 5EU8A 2F91A 4WXVA 1ESTA 3A85A 1U6QA 3V13A 2SFAA 1ZLRA 3JZ2B 3P8GA 1DS2E 1E34B 3RXGA 3LT3A 4BAMB 3KN2A 1QB6A 1NFYA 3F68H 3V7TA 1DX5M 2TBSA 1SI5H 1SG8B 1AGJA 1C2KA 2PLXA 5T3HA 1NO9H 1TNGA 2ZA5A 4D9QA 2H1UA 4FUJA 1Y3UA 3MO9A 4K2YA 4YOGA 1ETRH 3LJJA 4ISNA 2QYIA 4X1SU 3UWIA 3UREA 4TPIZ 3BN9A 1AFQB 1THPB 2C8YB 2Y7XA 1K2I1 1DICA 1F0RA 2AH4X 1NRNH 1AKSA 4ZXYH 2PGQB 4ZHAA 4X0WU 1H8IH 1UO6A 3GDSA 2C93B 2VIOA 1TABE 4GCHF 3RXSA 4BXSA 5HYOA 4H6TA 4AG2A 2O8WA 3QGJA 2G8TA 2NU1E 1ESAA 4WH8A 1TPAE 4ZROA 1OWHA 4R8TB 1LMWB 1LPKB 2BMGB 1SVPA 4JZ1A 1Z6EA 1HAPH 4SGAE 2WYGA 1MKXK 4MNXA 4UONA 1O2YA 3UQOA 4U01A 3SBKA 1CA8B 1RGQA 2BDCA 1W8BH 3M5MA 2JKHA 2ZPRA 5J4SA 2XXLA 1SOZA 4HTCH 1NFUA 4X1QU 1RJXB 1F92A 1C1TA 1GJ5H 1O3NA 1Y3VA 1UTPA 1FN6A 2BX4A 1IQGA 2J4IA 4AFUA 3KGPA 3DFLA 1C5VA 1J16A 4OGYA 5EOKA 2ZO3H 3RM2H 1O5BB 2QGRA 5H4IB 3PWBA 3LJOA 1FJSA 1GMHF 3QWCH 5LGOA 3AW0A 1Y59T 2B0FA 3UWJH 3GISB 1PQ8A 1EAXA 2XCNA 2ODPA 1GBEA 2ZECA 1JXPA 9LPRA 1DSUA 4DW2U 1GDUA 1BDAA 1TNIA 2CJIA 2NU0E 3S7HB 1YPHC 1LQEA 5I46H 3UIRA 6LPRA 1NROH 3MOCA 5C5OA 1O2HA 4THNH 4AFSA 4RKOB 1OWKA 3W94A 3NCLA 1O37A 1BQYA 4K1TA 1O3GA 5FX5A 3T62A 1A4WH 1NRPH 2QXJA 4IC6A 1TFXA 1KDQB 4HFPB 2H2ZA 3P6ZB 4A1TA 1XXDA 3TH2H 1IQEA 1EZXC 2FOAA 1YLCA 1H4WA 1QJ7B 2PTCE 4Y7AA 4AN7A 3ESTA 3LDXH 4IMZA 2ANWA 3LGYA 3M3TA 1VZQH 1SGQE 1K1PA 3GDVA 1GCTB 1CSOE 2P8OC 1EPTB 3KL6A 1A0JA 4Y11E 1JRTA 1BTPA 1O0DH 3GCHB 4ABBA 2BD3A 3RXVA 3M61U 3RP2A 3S0NA 1UVPA 1GGDC 3RMOH 1IHSH 3S7KB 1P11E 1UTNA 4YM9A 1GBBA 3TGKE 1V2LT 2F83A 3TIUA 4FUGA 2ZFPH 3LH3A 3LOXA 4KTUA 4CRGA 1O30A 2FOFA 1Y3YA 1TLDA 2BD5A 8ESTE 3RLYH 3ZZAA 1DOJA 5DGJA 3A87A 2ZFSA 3BG4C 4NA8A 1YKTA 4CHAC 2Y81A 4MVNA 2VGCB 1O3EA 3E3TA 2DE8A 1TPPA 2BD2A 1GBLA 1O5FH 1RFNA 4NIYA 1BRUP 1QBVH 3SU6A 2QCYA 3UTUH 1K9OE 3UQVA 5AFYH 2GMTC 1D6RA 1LHEH 2ZTXA 1EZQA 1C5QA 1EAIA 1V2OT 2D1JA 1QA7A 1C5OH 2TGDA 2OQ5A 4AB9A 1C4U2 1NESE 1NM6A 1Y5AT 1ZR0A 5EQQA 3SU1A 4K8BA 1NS3A 1CO7E 1EXFA 3SHCH 1MH0A 1TIOA 4CRFA 1W10U 1AU8A 1QRXA 1EATA 4IGDA 3M5LA 2A5IA 1O2UA 4FUFA 2VVUA 2VIDA 2HNTF 1ABJH 1QL8A 3GY7A 3VB6A 1AFQC 1UTMA 4B73A 3CENA 1O5GH 1DT2A 1GHZA 3TPIZ 1CHOF 1HAVA 5FBIA 1O3JA 4OS6A 3SNBA 1XVOA 1WYKA 1QCPA 1O32A 3TJVA 4O97A 4WWYA 1L4DA 4JZEH 1CQQA 4VGCB 1O2GH 3TH3H 1O3CA 2V6NA 1GBIA 1EKBB 2I6QA 2IJOB 5GDSH 5DP3A 2FOEA 3LIWA 1EOLA 3MNSA 2F3CE 5FPYA 5K0HA 3BEUA 1KXAA 3NKKA 3A83A 4DOQA 1HAOH 2GZ7A 4BXWA 1P2OA 2W7UA 2Q1JA 2PFEA 1QRWA 3M37A 3O8BA 2Z9GA 1FLEE 2H5CA 4X2VA 4A7IB 4I8KA 4ABDA 5A0BA 2AIPA 1WTHD 5C1XA 2ZG0H 6CHAB 4K60A 1SQAA 1S6HA 1TYNA 1AFEH 4KTSA 5JBBS 3L6PA 4DCDA 3ZZ6A 1SGFG 2EI6A 2FTLE 1BMLA 1C1RA 2EEKA 3ODFA 4FUHA 3LU9B 3RXAA 2G4TA 2BVSH 1TAWA 2PKAB 2BOHB 3QGNB 4I33A 2G52A 1VITG 3EA8A 4B74A 2NWNA 1HJ8A 5C1UA 1CA0B 2BLVA 3VB3A 1EJAA 1P8VC 5FCRA 2SNVA 3M5NA 4X1RU 4X8VH 3RXJA 3T27A 4B76A 2J38A 5L2YH 1W7XH 4YTAA 3T2NA 4RN6A 1ORFA 2A5KA 1HCGA 1DWEH 1GI4A 1MZDA 1RRKA 1IOEA 3RC6A 5A2MH 5F8XA 1GDNA 2STBE 4HZHA 2GZ9A 1LHGH 5T6FA 3P70B 2BDHA 2AMQA 1EP5A 5DKMA 4WF8A 5JBCS 1GJCB 6GCHF 4JZFH 1YCPH 1P3EA 4X1NU 4ZKRU 2AGEX 2R0LA 1W11U 2G55A 1S0QA 2J92A 2RA3A 1SGTA 2F9NA 2FM2A 3ZZ5A 2HWLB 1F0SA 3QX5H 1ELCA 1H9LB 3GCHC 3F9EA 3WY8A 4F4OC 2D2DA 1AZZA 3SV2H 1GHWH 3M36A 2W3IA 1C2HA 4DT7B 2UUKB 1A5IA 4Q80A 1LHCH 3QN7A 2J2UA 1MCTA 1WSSH 3SU3A 4J1YA 1FAXA 1TGSZ 4H42U 5F8TA 1V2NT 2XBXA 3ZZ7A 2C90B 3EYDA 3QO6A 2PR3A 4Z6AH 2PKSB 1AE5A 1RD3B 4ISOA 4ZUHA 1KXCA 4NA7A 1GG6B 1N1LA 2VGCC 2Q6DA 1OKXA 2WPMS 4WMEA 1GI6A 2P95A 4Y8XA 1HGTH 3T25A 4IW4E 4Q2KA 5C2ZA 3RU4D 2SGAA 4MPUA 5C3NA 1FPCH 1ZTLA 1SGCA 2ZU4A 4BAKB 1C1SA 3SN8A 2ZZUH 3BTWE 1AKSB 4IN2A 2PHBA 3LKWA 1GHBF 5F03A 1DXPA 5I25A 3P92A 1G9IE 1P06A 1AHTH 2G5VA 4Q7ZA 2W26A 4TWYA 4X6PA 1BUIA 1DWBH 2ZKSA 2VH0A 3PWCA 2P94A 3LGWA 2PGBB 3KHVA 1XXFA 3P95A 3VB5A 1GI8B 3A7XA 4K8YA 3Q00A 3BTQE 2HALA 3B23B 3FANA 1VCPA 3BF6H 4JK5A 3RXEA 1H9HE 3DFJA 1DLEA 3RXCA 3ZVGA 3ZVEA 2FTMA 5DP8A 1GJDB 5F6MA 1A3BH 1O2PA 3SI3H 3KF2A 2BDYA 2BXUH 2WINI 2PW8H 4CRBA 1NRSH 6ESTA 1O3BA 2Z3DA 5GCHG 1A61H 5HM2A 3MO3A 5L30H 1BMAA 2ZHWH 2R9PA 1EZUC 4B2AA 5J4QA 3VGCB 2QA9E 2ZIQH 3O8DA 3ZVFA 1FY3A 3E16B 3Q77A 3U98H 3LONA 1GI0A 1MUEB 1QQ4A 3TGJE 5A09A 1O3DA 1UCYK 2G5NA 3BEIB 1FIWA 1O2IA 2ANYA 6CHAC 3SO3A 1ARBA 2BDBA 5G4BA 1C4Y2 1GMCG 1NC6A 1TNJA 2FOBA 2BQ7B 2G51A 2IOTA 3MFJA 1MAYA 2RDLA 4BNRA 1G3EA 1P2KA 1HLTH 2ZHFH 3RXOA 3BTGE 3RXKA 2VIQA 2GZ8A 1O2TA 1O5CB 1P2QA 1SMFE 2ILNA 5EW2H 2EA3A 4MTBA 1CGHA 1O34A 2XWAA 2VIVA 4QT8C 2FLRH 3GOVB 4ASHA 1N6YA 1V2WT 1HJAB 1K1MA 2V0BA 2ZI2H 3PLKA 4ESTE 3S9AA 3VEQB 3DA9B 1W0ZU 3QUMP 1UJ1A 1BITA 1G3DA 3NUMA 4OS1A 5T6DA 2EI7A 4WJG2 2GT8A 2GX4A 4TY7A 4GHQA 1YF4A 3K65B 1RXPA 3PYHA 2BQ6B 1Y8TA 1ZJDA 2TGAA 2ZU1A 4NFFA 1YPEH 4YZUA 2A7JA 2F9UA 3E8LA 4I8JA 5DPAA 1T8NA 2ANKH 1IQIA 3E1XB 3QK1A 4X6MA 2AERH 5TCAA 1HPGA 2GT7A 1P04A 2OC0A 2B9LA 3W95A 2VWLA 1QTFA 2ODYB 2WPJS 1O2MA 1PPFE 2OCVB 1MU6B 3ELAH 1Z8IB 3GY2A 5C20A 1TPOA 4IC5A 1KTSB 5FPTA 2GGVB 1GGDB 1GBTA 2BM2A 3QLPH 8KME2 1FIZA 2GV7A 2GV6A 4JZIA 1EJNA 3PMJA 1EUFA 1ZGIA 3GCNA 1E38B 1WTGH 4NZLA 5HMAA 2OQUA 5E0HA 1GBAA 3SJ9A 2WPLS 2PKSC 2ZF0H 2BY7X 4CR9A 3RXMA 4LZ1H 1Y5UT 3PO1C 1L2EA 3RXFA 3CS7A 1ZPZA 2WPHS 1O35A 1FXYA 1TRMA 2AMPA 1LVMA 1CGIE 5CMXH 2VNTA 1WUNH 4ZKSU 1TGBA 4ZMAH 5FCKA 3S9BA 1C2LA 3VXFH 4UFFH 1BIOA 1UTLM 2FX6A 1D3PB 2GMTB 1GHXH 5EQSA 5EG4A 1HAVB 2CXVA 3MU8A 1GCDA 3FVFB 2BVXH 2PTNA 3A80A 2FI3E 2XW9A 2AS9A 3FAOA 3FFGA 2R3UA 3SU0A 3UOUA 1A0LA 1TA2A 1A5HA 2AYWA 1LDTT 4UFDH 2XNIA 2F9BH 2ZU2A 3P8NA 1AVWA 1TB6H 2OINA 3RDZA 4AYVB 1BBRE 1C1WH 1FONA 5CHAC 3U69H 3ZVDA 3ZZCA 4NIXA 1HUTH 4WVPE 2HNTE 4NGAH 1SGYE 3EGKH 1QL9A 1HIAA 2W7SA 5K7RA 1E37B 1P12E 5EPNA 3R0FA 3A7ZA 4M7GA 1O3MA 1UVOA 1ZYOA 5EXNA 3TH4H 3VB4A 1L1JA 5AFZH 1BRAA 4ISHH 1O36A 1MD7A 2ZQ1A 1V3XA 4DIHH 3E90B 3ZZ3A 1ZPBA 1BTYA 4AGKA 1YPJH 3VGCC 3ZZ8A 2VH6A 1V2QT 2A5AA 3MNXA 4NZQA 1L0ZA 1CVWH 4Y0ZE 2AFQB 3P17H 4U32A 4DIIH 1VJ9U 3KQBA 4LOYH 4H6SB 1GJ4H 1J15A 3I78A 4Y10E 1IQNA 4MQAA 1SLUB 2Q6GA 2ZWLH 2FI4E 3MH7A 1WU1A 4NIVA 4YT6H 1C1QA 2LPRA 4UDWH 2GCHG 2VU8E 1Y3WA 8GCHF 3ATIA 3IWMA 2OC1A 1EAUA 5C67A 1ID5H 1BTWA 1O5EH 1TWXB 4DVAU 1SOTA 2FS8A 3HK3B 1GI7B 3BEFB 1C5XB 2V3HH 2XTTB 3EA7A 1O5DH 5C1YA 1SQOA 2F9VA 1K1LA 1YGCH 5DP9A 2G00A 1C1VH 3BTDE 2ZGBH 4MDSA 3T26A 1HJAC 1WQSA 2HPPH 3OSYA 1HAIH 1DLKB 3KQCA 5JDUB 4A5TS 3SORA 1LQDB 1GDQA 3ATLA 2ZEBA 1P2MA 1GWAA 1NFXA 1NZQH 1WOFA 1LPGB 3A8CA 1D3DB 1Z6JH 3GY3A 2CV3A 1TOMH 4MNWA 4O9VA 2CGAA 4UE7H 1M9UA 2BVRH 2UWLA 4ISLA 1ELAA 2F9PA 1MBMA 1VJAU 4FUDA 1UK2A 3HKIB 4B75A 5E2OA 3OX7U 1MKXH 5GPIB 1PPHE 1S84A 1ZSJA 1ZMLA 1AE8H 3M35A 1D9IA 1CT0E 3CS0A 3V0XA 4INLA 2FI5E 3MU0A 1DSTA 3TJNA 1O2WA 3A84A 2ZPSA 1XX9A 1A2CH 1Z8JB 5AHGH 3VPKA 2A1DB 1EASA 3SU4A 2AIQA 1O33A 1CGJE 1MTSA 3LGTA 2FMJA 4ZHMU 1TQ0B 1FY8E 1OYTH 4TY6A 4BANB 1BHXF 3F9GA 4XBDA 2QAAA 5GJ4B 4IS5A 2PSXA 2BD7A 1W14U 3CP7A 2TGTA 5DJ7A 4AGJA 3SJIA 1AD8H 2BX3A 3GCTG 3D23A 1PJPA 2NU3E 3ATWA 1UTKA 1C1PA 2FOHA 2XC4A 5FPSA 1FN8A 2H6MA 3Q3XA 4AZ2B 1NT1A 1KYNA 1HAHH 2OBQA 2K1QA 1FQ3A 1QB1A 4AG1A 3BIVH 1AMHA 1DWCH 2OLGA 1V2JT 2HOBA 3TK9A 3H7TA 1LKBA 3MH5A 1F5RA 1A0HB 1ELEE 2P3FH 3GYMA 4X6NA 5FAHA 2R2MB 1HBTH 2VIWA 5E0JA 1B5GH 2AGIX 1G30B 3UY9A 2BLWA 1UMAH 3F6UH 2OUAA 1GMDF 1HDTH 1YPHE 1W0YH 2G4UA 1UTOA 3HPTB 1OWEA 1GBDA 2Z9KA 5LPRA 2Z3CA 4FU7A 1T4VH 3DT0H 3AAVA 2BLQA 4E05H 1NU7B 2HRVA 1SB1H 5F8ZA 1O2VA 1BTXA 9ESTA 3I77A 1IQFA 3RXQA 1K21H 4ABGA 1MKWH 2C8ZB 2G81E 2I6SA 3AASA 2QN5T 3PMAB 4MG3A 3RMLH 1QGFA 5EXLA 3G01A 2QIQA 1BHXB 3PLBA 1SLWB 1OS8A 2XRCA 1DUEA 5TCCA 4DY7B 1KY9A 1IHTH 2TPIZ 2ZFTA 3BTFE 1O2XA 1C5UA 1DITH 1XUGA 4BTUB 4I7YH 3I29A 2ZDLA 1YCPK 1KLJH 3GY4A 4XE4A 1O3AA 2Y5HA 4AB8A 1ZRBA 1BA8B 1J17T 2J94A 2ZGXH 5BPEA 2UWPA 3HGNA 1FI8A 1TBRH 1KLIH 3SV6A 2STAE 3O8CA 1DXWA 2ZU3A 2CHAC 3MYWA 3RXIA 5A0CA 2FESH 2KAIA 4XOJA 1O39A 1SR5C 1GJ7B 1KXFA 1YLDA 2AGGX 1GBFA 2Y7ZA 2ZCLP 1O2JA 4UEHH 4FU8A 1TMBH 4HI3A 2DE9A 3DUXH 3A88A 2FDAA 3A89A 1GBKA 2VWNA 1GHAF 3U1JB 3A8AA 1G3CA 5DP4A 1SFQB 4IBLH 2ZU5A 2ZFFH 3SV8A 4WMDA 4H4FA 4ZKOU 1EZSC 4K5ZA 4DG4A 2V3OH 2C8WB 1YP9A 1QJ1B 1O5AB 3A86A 3SNEA 1IQLA 3ZYEA 1DDJA 2ESTE 1XKBC 3MMGA 3QTVH 1QBOA 1SHHB 2FOGA 3NXPA 3HKJB 3SUEA 3MU1A 1C5RA 2Q6FA 4CRAA 3MO6A 4B2CA 5JBAS 1C5PA 1NN6A 2CF8H 1GBCA 2A4RA 2Z9LA 1EAWA 3F9HA 1A46H 3M3VA 1GHVH 4ABFA 3SUFA 1E36B 2ZFRH 1IQKA 5A8ZA 2FPZA 3E91A 1DY8A 3NPSA 3SGBE 1O2NA 3E6PH 1P03A 1AUJA 2XC0A 1VR1H 1LTOA 1T8OA 1ZTJA 4MPWA 2Y80A 4OS7A 2A2QH 2FZZA 4XBCA 3STIA 4YT7H 1NPMA 4KTCA 2O8TA 3SNDA 3TU7H 1TX6A 1BMMH 3PO1B 2UWOA 2ZDNA 1P0SH 1UTQA 1ELTA 1L1GA 1MMJN 4JYTA 1S5SA 1AQ7A 2ZHDA 3U9AH 2XYAA 1GHYH 1MCVA 1FPHH 4SGBE 5JB9S 1BRCE 1XUKA 5HGGA 1V2VT 2JETB 2ZP0H 5ABWA 1AUTC 3GY6A 5JPMH 2VINA 2A4OA 1OP2A 1P05A 1P9SA 1ZSLA 4E7NA 2FP7B 5E2PA 1K1IA 1ZMJA 1CHOG 3RU4T 1HIAB 3SV7A 1A1RA 3PTBA 2QV1A 3LC3A 4GSOA 3F9FA 1XMNB 1GI5A 3KNXA 2NU2E 3MNBA 1BTZA 5HM9A 4DGJA 5SGAE 1O3PB 1PQ5A 1Z1IA 3ZVCA 4J2YB 3M7QA 1Z8RA 1YYY1 2VJ1A 2O9QA 1JRSA 5CHAB 4ABJA 3ZYDA 1L4ZA 1O3LA 3B8JA 4LZ4B 4RKJB 2WPIS 3QZQA 2VWMA 1GVKB 4FUIA 4X2WA 3E0PB 4X2YA 1GI9B 4I8GA 2HVXA 3K9XB 1EB2A 2UUYA 3SU2A 3PM3A 4AYYB 1Q2WA 3MNCA 3SI4H 5HXFA 3UPEA 2ZTZA 3RC5A 1SGFA 2QXIA 2SGFE 2H9HA 1OWIA 4O03A 2ZQ2A 1MQ5A 1TBQH 3M7TA 5CE1A 2Y5GA 4OS4A 2J34A 3DD2H 1ARCA 5FBEA 1IQMA 3A82A 5E0GA 1OYQA 1C2DA 2XWBI 3SZNA 4BAOB 1EQ9A 4ZHLU 1SBWA 4D9RA 1ZHRA 1TQ7B 1LO6A 5DP7A 3SOSA 1G36A 2SGEE 2XCFA 3TNSA 1SHYA 1VGCC 2IPHA 1WAYB 2ZNKH 3KQDA 3VB7A 3SHAH 1O2OA 1SGDE 4AFQA 4XFQA 1D3TB 3MU4A 1YBWA 1Z7KA 4A92A 2AMDA 2JH0D 3AW1A 3EE0B 2Z9JA 6GCHG 1QNJA 2ZDKA 4WY3A 3RXPA 3UR6A 1TMTH 3RC4A 1Q31A 3T29A 1HYLA 1V6DA 4Z0KA 2CF9H 3TLOA 1OXGA 2B7DH 1ZZZA 4IN1A 2J95A 2BQWB 2EI8A 4Y0YE 1DY9A 1N8OC 1RS0A 4NFEA 2B8OH 5B6OA 1BJVA 4KKDA 1V2TT 1JIMA 2BY9X 2FOMB 2HGTH 3M5OA 1MTUA 4Y8YA 3VXEH 1UCYE 2F9OA 2Y82A 1PYTD 1P3CA 2THFB 4CBOA 1QBNA 4JZDH 1BZXE 4U30A 2QXGA 1Y3XA 2ZHEH 4AORA 3NK8A 8LPRA 3OYPA 1O2QA 1VITH 4JYUH 1QHRB 2ZPQA 3T28A 3R3GB 1HAZB 1C5WB 1TE0A 3ODDA 1HV7A 1NRQH 5E8EH 1C2FA 1AO5A 5T6GA 2ZCHP 3RXUA 2W5EA 3KEEA 1ANDA 2Z6BD 1JBUH 1TNHA 1LHFH 5EXMA 3UUZA 1UHBA 1BMNH 1PFXC 3SJKA 4AOQA 4BOHA 1ANEA 4PROA 1SQTA 1GJAB 7KMEH 1Z1JA 1P01A 4GLYA 2FYQA 4YLUA 4ZH8A 4CRCA 2GTBA 1C5YB 1S85A 1XUFA 1H8DH 3BSQA 1QA0A 3ZV8A 1B0EA 2BHGA 3UNSA 3MH4A 1TGTA 4FUCA 1QRZA 1AWHB 4GPGA 1EX3A 4X2XA 1TBZH 2JETC 4UFEH 2FYRA 2O8UA 1ZRKA 2SGDE 1J8AA 2C3SA 3V3MA 1FY5A 2R0KA 3OY5U 3Q76A 2D26C 1LKAA 1DVAH 1FY4A 1C5LH 1C2GA 2A4QA 1QR3E 3A8DA 1S83A 4YOIA 5LH8A 3C27B 1FZZA 1ELDE 1LHDH 2FEQH 4F49A 2YNBA 2GDEH 1ZOMA 1C4V2 3PTNA 4DJZB 1V2UT 4FVBA 3SUGA 1AVGH 1YPLH 3GCTF 3TNTA 1SGIB 1Z8GA 1ELBA 1SGNE 1WBGB 1GJBB 1SL3A 2FX4A 1YPMH 1BBRH 7GCHG 1KXEA 1ANCA 1TNKA 5IYTA 2A45B 2GVFA 2BDGA 3K2UA 1O2RA 1O3FA 2NU4E 1ACBE 1ZGVA 2A31A 3LGVA 3L3TA 1AY6H 2GKVE 2R2WU 1C1NA 1SGPE 3RM0H 3ZVBA 1UTJA 3HK6B 4FUEA 3BIUH 3LH1A 5EGMA 3F1SB 3GICB 1QQUA 3K6ZA 2KAIB 4A6LA 1CE5A 1GBHA 2CMYA 3U1IB 2PUXB 3SU5A 1HNEE 1OWJA 4NA9H 1GI2A 3L33A 4Y79A 1D3QB 1G2MA 5GXPA 2YOLA 2PSYA 2H5DA 2LNCA 2BZ6H 3OTJE 2BXTH 1CT2E 1C2EA 2ZDAH 1EB1H 4X8SH 1ZHMA 4K3JA 4D7GA 2JH5D 3BTHE 3ZV9A 1UVSH 2CHAB 1THRH 1ELFA 2SGPE 3SUDA 2ZFQH 1A5GH 3PMHB 1DWDH 1XVMA 1KIGH 4A1XA 4CREA 2ULLA 3TJUA 3U8RH 1DM4B 2FXRA 3FZDA 1E35B 1WQVH 2XBWA 4HGCA 4K1EA 2J9NA 3QZRA 4CR5A 3U8OH 4INKA 3EA9A 1KSNA 3P8FA 3SQEE 2RCEA 3AVZA 4FVDA 3RXHA 1YCPM 1TGNA 5JB8S 1BTHH 1TRYA 2OP9A 4AFZA 2P3UB 1C1MA 1XKAC 2ALPA 2BD4A 1VITF 5ESBA 2BD9A 1BT7A 2HLCA 1Q3XA 1BJUA 1QL7A 4ABAA 1HAGE 1S6FA 1WV7H 1ZJKA 1SPJA 1XUHA 1QB9A 1C9TA 3BTKE 1HXFH 1DFPA 5EQRA 2GCTC 1NFWA 1TA6A 2UUFB 2ASUB 1L1NA 1ETTH 1P57B 4DURA 1XM1A 3GYLB 3B9FH 3UNQA 1T7CA 2FOCA 4CH2B 4YOJA 1PPZA 4E7RG 2Z9IA 1GL1A 1D4PB 1OOKB 3M3SA 2OTVA 4BTIB 5AVDA 1KXDA 3EDXB 2OC8A 3LGUA 4BAQB 4XBBA 1DE7H 4MNYA 5C5NA 2PWXA 1ZSKA 1ELVA 4B71A 4NSVA 4YLQH 1HJ9A 1F0TA 2TIOA 3H7OA 2OD3B 3BG8A 5IDKA 3BTEE 1G2LA 2B5TB 3NWUA 1V2PT 4ISIH 1MKWK 1BRBE 1C5TA 2A32A 2VWOA 5ETXA 5JYIA 4A1VA 1PPCE 3D49H 1LCYA 1W12U 3GY8A 4X1PU 1AZ8A 3EAJA 1A3EH 4GCHG 4I8HA 4X6OA 1SGEE 1CHGA 2SGQE 2P59A 1THSH 1RIWC 1BB0B 3A7TA 2FODA 1TMUH 2BYAX 3UOPA 2WUCA 1O2LA 2FWWA 2C4FH 1C1OA 1IQHA 4LK4A 2VVVA 3FP7E 1C5NH 2ZGJA 4JK6A 7ESTE 3RXRA 2ANMH 2M5TA 2OC7A 3RU4E 4BTTB 2BD8A 2BZAA 3SGAE 3N7OA 1PPEE 3A7WA 4WH6A 1ETSH 3SNCA 4GAWA 1JOUB 4WMFA 1P02A 1QFKH 3MH6A 3TITA 2XC5A 4Y71A 3FZZA 2FO9A 3FP8E 4NCYA 3ZZDA 3IITA 4KGAA 1FNIA 1PPGE 1QY6A 3BTME 3URCA 4UFGH 1QURH 2O8LA 4FUBA 8GCHG 1PYTC 3PV4A 2P16A 1UVTH 4ZKNU 1GMHG 1XUJA 3FP6E 7LPRA 4MPVA 2A7CA 1E0FD 4MLFB 1C9PA 4OS2A 4NSYA 4KELA 4NWKA 1F5KU 2ALVA 2P3TB 3LC5A 1MAXA 1VCWA 2Y5FA 1P10A 2GD4B 4WXIA 1AB9B 2A0QB 4MNVA 1Z71A 3ATKA 4GVUA 1ESBA 3ZZBA 3QTOH 1NY22 1FAKH 4OS5A 1VGCB 1VCQA 2Z94A 1AWFH 2BDAA 3TK6A 1AVXA 4KP0A 3A7YA 3BV9B 1T8LA 2BDIA 1SFIA 3S69A 2QF3A 1H1BA 3LGIA 1T4UH 4IMQA 1J9CH 2QF0A 3PROA 3IG6B 5GCHF 3ZZ9A 1KLTA 1F2SE 1O2SA 1NTPA 1ZPCA 2D8WA 3TJOA 3MI4A 5FXLA 1EJMA 5DK1A 3ZVAA 1AIXH 1F0UA 1FUJA 2EC9H 5L6NH 1NU9A 1T8MA 4XSKU 2ZDVH 5TJXA 1INCA 4ZAEA 1HRTH 1N8OB 1D6WA 1UK4A 3SW2B 1C2MA 2ZHQH 1K1NA 4Y76A 1TX7A 1UVUH 2C8XB 1CU1A 1TOCB 1CBWB 1UHBB 1GMCF 2QXHA 1FDPA 1JWTA 2ZGCA 2FS9A 1ZTKA 3ZZ4A 4TWWA 1G3BA 1F7ZA 3SJ8A 4D8NA 4ABEA 2V35A 2OBOA 2ODQA 4JMYA 1O3OA 3MWIU 1OPHB 3TGIE 3MTYA 4UD9H 1X7AC 4YESB 3SGQE 1K28D 4I32A 1JIRA 1TNLA 3VFEA 2OXSA 3KIDU 4O3TA 1MQ6A 2BTCE 3ENSB 3RUOA 2WPKS 5ESTE 3LPRA 1GJ9B 5DG6A 5FHTA 1GPZA 4TPYA 2GDDA 4K1SA 1TGCA 1T32A 1GBJA 5EW1H 1MU8B 1GCTC 1SGRE 2QC2A 3NZIA 3D65E 4Y7BA 1O3IA 1EPTC 1HAYB 4INHA 3D62A 2A4GA 4I31A 3RXTA 1FV9A 3K6YA 3STJA 1HAXB 3QDZB 5L2ZH 1MTWA 3JZ1B 3GY5A 1PPBH 1MTVA 1YM0A 1KDQA 2ZC9H 1V2ST 1O3HA 3P8OA 3KCGH 1S0RA 3OY6U 1DUAA 1T31A 3M7UA 1H9IE 1TPSA 1J14A 1TALA 1P2IA 4ABHA 1GMDG 4U2WA 1GJ6A 3SV9A 1ABIH 3O8RA 3RXBA 1P9UA 1EPTA 1B7XB 1MZAA 2UUJB 1GVLA 1MTNB 3PB1E 1ZHPA 4LXBH 1CT4E 1XUIA 2Y6TA 1EP6A 5LPEA 3AAUA 4TYDA 1KXBA 2ZCKP 4NWLA 4ZXXH 4I8LA 1OP8A 1GBMA 1S81A 1P2NA 3Q3KA 3RLWH 2RG3A 2Z3EA 3H5CB 1C1UH 3A7VA 1WCZA 2BLOA 3GCOA 4NIWA 1OSSA 4RSPA 5LPFA 1PQ7A 5FX6A 2SNWA 2VB0A 3BTTE 2H9EH 1SLVB 1V2MT 1HB0B 3ITIA 1LVBA 1IQJA 3RMNH 2DUCA 1O2KA 2R3YA 2BB4A 1P09A 2BY6X 1BOQA 3UR9A 3SNAA 4B1TA 4D76A 4JCNA 2H9TH 1GI3A 1BCUH 4VGCC 5A8XA 4R0IA 3MHWU 4Q7XA 2BY8X 4CRDA 1P2JA 1AB9C 3A8BA 1SLXB 1IAUA 1QJ6B 1ELGA 4YO9A 2WV4A 5AF9H 5A8YA 2A7HA 2PV9B 1GHAG 1RTFB 1K1JA 2TRMA 2XBVA 4X8UH 4CBNA 3PLPA 4B2BA 4MPXA 1G32B 3KQEA 3UNRA 1PQAA 4K69A 4OGXA 2BY5X 3V12A 2TGPZ 4FU9A 1UK3A 3A81A 7GCHF 3TK5A 1HFDA 4CH8B 4O3UA 5DP6A 4X8TH 3OU0A 4XDEA 3SJOA 1YPGH 1EOJA 1ANBA 1JMOH 5PTPA 1YC0A 2JH6D 3S9CA 2XBYA 3HATH 2VVCA 3HGPA 3UFAA 4AX9H 1C2JA 3DHKH 2PUQH 4GUXA 1CA0C 1RTLA 3EQ0H 1C5MD 1Y5BT 1O31A 4FXGH 5DO4H 2AEIH 5GWZA 1O2ZA 1OP0A 1CBWC 3T5FH 1HXEH 2P93A 2QY0B 3RXDA 1O38A 3SQHE 1W3CA 1DANH 5JBTA 5GIBA 2HNTC 1W2KH 1GL0E 2GCHF 2ZDMA 1N6XA 1OWDA 1AN1E 1QIXB 4BAHB 1GJ8B 1C2IA 2PKAA 4Y6DA 1B0FA 4ABIA 1LVOA 1C5SA 1YPKH 1UCYH 1C5ZB 4JYVH 1S82A 5DP5A 3E0NB 3PMBB 2GCTB 2GP9B 1MD8A 2HPQH 4D7FA 1V2KT 2W3KA 2O8MA 1RTKA 3MU5A 1F5LA 5EODA 1V2RT 1ZMNA 1FY1A 1TX8A 3ATMA 1DPOA 1GVZA 2ZGHA 2YNAA 2P8OB 1GHBG 4E06H 1TONA 1KTTB 1O3KA 5EPYA 2Z7FE 2RA0A 1BTUA 3RXLA 1NRRH 1K22H 1SSXA 2WYJA 5BRRE 3C1KA 3GDUA 4Q7YA
chains in the Genus database with same CATH superfamily
1K1OA 2ZTYA 1BBRK 1GI1A 3URDA 1A7SA 4Y8ZA 1MBQA 2FLBH 4GHTA 2A2XH 1W7GH 1GG6C 1TRNA 2WUBA 3BG4B 2WV5A 1SC8U 5A0AE 4CHAB 1LVYA 3TVJB 2IN2A 1W13U 1MTNC 2VIPA 1AI8H 1LPZB 1FMGA 4NG9H 2BOKA 2FIRH 3Q3YA 3U8TH 1OX1A 1G37A 1RIWB 3RMMH 4I86A 2CN0H 5EU8A 5IK2D 2F91A 4WXVA 1ESTA 3A85A 1U6QA 3V13A 2SFAA 1ZLRA 3JZ2B 3P8GA 1DS2E 1E34B 3RXGA 3LT3A 4BAMB 3KN2A 1QB6A 4F55A 1NFYA 3F68H 3V7TA 1DX5M 4TSFD 2TBSA 1SI5H 1SG8B 1AGJA 1C2KA 2PLXA 5T3HA 1NO9H 1TNGA 2ZA5A 4D9QA 2H1UA 4FUJA 1Y3UA 2EY4C 3MO9A 4K2YA 4YOGA 1ETRH 3LJJA 4ISNA 2QYIA 4X1SU 3UWIA 3UREA 4TPIZ 3BN9A 1AFQB 1THPB 2C8YB 2Y7XA 1K2I1 1DICA 1F0RA 2AH4X 1NRNH 1AKSA 4ZXYH 2PGQB 4ZHAA 4X0WU 1H8IH 1UO6A 3GDSA 2C93B 2VIOA 1TABE 4GCHF 3RXSA 4BXSA 2V7QD 4H6TA 4AG2A 2O8WA 3QGJA 2G8TA 2NU1E 1ESAA 4WH8A 1TPAE 4ZROA 1OWHA 4R8TB 1LMWB 1LPKB 2BMGB 1SVPA 4JZ1A 2QE7D 1Z6EA 1HAPH 4SGAE 2WYGA 1MKXK 4MNXA 4UONA 1O2YA 3UQOA 4U01A 3SBKA 1CA8B 1RGQA 2BDCA 1W8BH 3M5MA 2JKHA 2ZPRA 5J4SA 2XXLA 2KX4A 1SOZA 4HTCH 1NFUA 4X1QU 1RJXB 1F92A 5C17A 1C1TA 1GJ5H 3OFND 1O3NA 1Y3VA 1UTPA 1FN6A 2BX4A 1IQGA 2J4IA 4AFUA 3KGPA 3DFLA 1C5VA 1J16A 4OGYA 5EOKA 2ZO3H 3RM2H 1O5BB 5EJLA 2QGRA 4XD7D 5H4IB 3PWBA 3LJOA 1FJSA 1GMHF 3QWCH 5LGOA 3AW0A 1Y59T 2B0FA 3UWJH 3GISB 1PQ8A 1EAXA 2XCNA 2ODPA 1GBEA 2ZECA 1JXPA 9LPRA 1DSUA 4DW2U 1GDUA 5DN6D 1BDAA 1TNIA 2CJIA 5HYOA 2NU0E 3S7HB 1YPHC 1LQEA 5I46H 3UIRA 6LPRA 1NROH 3MOCA 5C5OA 1O2HA 4THNH 4AFSA 3OEHD 4RKOB 1OWKA 3W94A 3NCLA 1O37A 1BQYA 4K1TA 1O3GA 5FX5A 3T62A 1A4WH 1NRPH 2QXJA 4IC6A 1TFXA 1KDQB 4HFPB 2H2ZA 3P6ZB 4A1TA 1XXDA 3TH2H 1IQEA 1EZXC 2FOAA 1YLCA 1H4WA 1QJ7B 2PTCE 4Y7AA 2HLDD 4AN7A 5HKKD 3ESTA 3LDXH 4IMZA 2ANWA 3PV5A 3LGYA 3M3TA 3N7EA 1VZQH 1SGQE 1K1PA 3GDVA 1GCTB 1CSOE 2P8OC 1EPTB 3KL6A 1A0JA 4Y11E 1JRTA 1BTPA 1O0DH 3GCHB 4ABBA 2BD3A 3RXVA 3M61U 3RP2A 3S0NA 1UVPA 1GGDC 3RMOH 1IHSH 3S7KB 1P11E 1UTNA 4YM9A 1GBBA 3TGKE 1V2LT 2F83A 3TIUA 4FUGA 2ZFPH 3LH3A 3LOXA 4KTUA 2M2AA 4CRGA 1O30A 2FOFA 1Y3YA 1TLDA 2BD5A 8ESTE 3RLYH 3ZZAA 1DOJA 5DGJA 3A87A 2ZFSA 3BG4C 4NA8A 1YKTA 4CHAC 2Y81A 4MVNA 2VGCB 1O3EA 3E3TA 2DE8A 1TPPA 2BD2A 1GBLA 1O5FH 1E1RD 1RFNA 4NIYA 1BRUP 1QBVH 3SU6A 2QCYA 3UTUH 1K9OE 3UQVA 5AFYH 3OE7D 2GMTC 1SKYE 1D6RA 1LHEH 2ZTXA 1EZQA 1C5QA 1EAIA 1V2OT 2D1JA 1QA7A 1C5OH 2TGDA 2OQ5A 4AB9A 1C4U2 1NESE 1NM6A 1Y5AT 1ZR0A 5EQQA 3SU1A 4K8BA 1NS3A 1CO7E 1EXFA 3SHCH 4F48B 1MH0A 1TIOA 4CRFA 1W0JD 1W10U 1AU8A 1QRXA 1EATA 4IGDA 2KCOA 3M5LA 2A5IA 1O2UA 4FUFA 2VVUA 2VIDA 2HNTF 1ABJH 1QL8A 3GY7A 3VB6A 1AFQC 1UTMA 4B73A 3CENA 1O5GH 1DT2A 1GHZA 3TPIZ 1CHOF 1HAVA 5FBIA 1O3JA 4OS6A 3SNBA 1XVOA 1WYKA 1QCPA 1O32A 3TJVA 4O97A 4WWYA 1L4DA 4JZEH 1CQQA 4VGCB 1O2GH 3TH3H 1O3CA 2V6NA 1GBIA 1EKBB 2I6QA 2IJOB 5GDSH 5DP3A 2FOEA 3LIWA 1EOLA 3MNSA 2F3CE 5FPYA 5K0HA 3BEUA 1KXAA 3NKKA 3A83A 4DOQA 1HAOH 2GZ7A 4BXWA 1P2OA 2W7UA 2Q1JA 2PFEA 1QRWA 3M37A 3O8BA 2Z9GA 1FLEE 2H5CA 4X2VA 4A7IB 4I8KA 4ABDA 5A0BA 2AIPA 1WTHD 5C1XA 2ZG0H 6CHAB 4K60A 1SQAA 1S6HA 1TYNA 1AFEH 4KTSA 5JBBS 3L6PA 4DCDA 3ZZ6A 1SGFG 2EI6A 2FTLE 1BMLA 1C1RA 2EEKA 3ODFA 4FUHA 3LU9B 3RXAA 3FN8A 2G4TA 2BVSH 1H8HD 1TAWA 2PKAB 2BOHB 3QGNB 4I33A 2G52A 1VITG 3EA8A 4B74A 2NWNA 1HJ8A 5C1UA 2KM0A 1CA0B 2BLVA 3VB3A 1EJAA 1P8VC 5FCRA 2SNVA 3M5NA 4X1RU 4X8VH 3RXJA 3T27A 4B76A 2J38A 5L2YH 4RT0A 1W7XH 4YTAA 3T2NA 4RN6A 1WXRA 1ORFA 2A5KA 1HCGA 2YMSB 1DWEH 1GI4A 1MZDA 1RRKA 1IOEA 3RC6A 5A2MH 5F8XA 1GDNA 2STBE 4HZHA 2GZ9A 1LHGH 5T6FA 3P70B 3WWBA 2BDHA 2AMQA 1EP5A 5DKMA 4WF8A 5JBCS 1GJCB 6GCHF 2LP6A 4JZFH 1YCPH 1P3EA 4X1NU 4ZKRU 2W6ID 2AGEX 3KYFA 2R0LA 1W11U 2G55A 1S0QA 2J92A 2RA3A 1SGTA 2F9NA 2FM2A 3ZZ5A 2HWLB 1F0SA 3QX5H 1ELCA 1H9LB 3GCHC 3F9EA 3WY8A 4F4OC 2D2DA 1AZZA 3SV2H 1GHWH 3M36A 2W3IA 1C2HA 4DT7B 2UUKB 1A5IA 4Q80A 1LHCH 3QN7A 2J2UA 1MCTA 1WSSH 3SU3A 4J1YA 1FAXA 1TGSZ 4H42U 5F8TA 1V2NT 2XBXA 1NBMD 3ZZ7A 2C90B 3EYDA 3QO6A 2PR3A 2F4LA 4Z6AH 1AE5A 2PKSB 1RD3B 4ISOA 4ZUHA 1KXCA 4NA7A 4ZCNA 1GG6B 1N1LA 2VGCC 2Q6DA 1OKXA 2WPMS 4WMEA 1GI6A 2P95A 4Y8XA 5C94A 1HGTH 3T25A 4IW4E 4Q2KA 5C2ZA 3RU4D 2SGAA 4MPUA 5C3NA 1FPCH 1ZTLA 1SGCA 2ZU4A 4BAKB 1C1SA 3SN8A 2ZZUH 3BTWE 1AKSB 4IN2A 2PHBA 3LKWA 1GHBF 1COWD 5F03A 1DXPA 5I25A 2PP6A 3P92A 1G9IE 1P06A 1AHTH 3DSOA 2G5VA 4Q7ZA 2W26A 4TWYA 2F43B 4X6PA 1BUIA 1DWBH 2ZKSA 2VH0A 3PWCA 2P94A 3LGWA 2PGBB 3KHVA 1XXFA 3P95A 3VB5A 1GI8B 3A7XA 4K8YA 3Q00A 3BTQE 2HALA 3B23B 3FANA 1VCPA 3BF6H 4JK5A 3RXEA 1H9HE 3DFJA 1DLEA 3RXCA 3ZVGA 3ZVEA 2FTMA 5DP8A 1GJDB 5F6MA 1A3BH 1O2PA 3SI3H 3KF2A 2BDYA 2BXUH 2WINI 2PW8H 4CRBA 1NRSH 6ESTA 1O3BA 2Z3DA 5GCHG 1A61H 5HM2A 3MO3A 5L30H 1BMAA 2ZHWH 2R9PA 3W1EA 2RFKC 1EZUC 4B2AA 5J4QA 3VGCB 2QA9E 2ZIQH 3O8DA 3ZVFA 1FY3A 3E16B 3Q77A 3U98H 3LONA 1GI0A 1MUEB 1QQ4A 3TGJE 5A09A 1O3DA 1UCYK 2G5NA 3BEIB 1FIWA 1O2IA 2ANYA 6CHAC 3SO3A 3F2FA 1ARBA 2BDBA 5G4BA 1C4Y2 1GMCG 1NC6A 1TNJA 2FOBA 2BQ7B 2G51A 2IOTA 3MFJA 1MAYA 2RDLA 4BNRA 1G3EA 1P2KA 1HLTH 2XOKD 2ZHFH 3RXOA 3BTGE 4XRNA 3RXKA 2VIQA 2GZ8A 1O2TA 4B6FA 1O5CB 1P2QA 1SMFE 2EQNA 2ILNA 5EW2H 2EA3A 4MTBA 1CGHA 1O34A 2XWAA 2VIVA 4QT8C 2FLRH 3GOVB 4ASHA 1N6YA 1V2WT 1HJAB 1K1MA 2V0BA 2ZI2H 5HIYA 3PLKA 4ESTE 3S9AA 3VEQB 3DA9B 1W0ZU 3QUMP 1UJ1A 1BITA 1G3DA 3NUMA 4OS1A 5T6DA 5KEDA 2EI7A 4WJG2 2GT8A 2GX4A 4TY7A 4GHQA 1YF4A 3K65B 1RXPA 3PYHA 2BQ6B 2WZQA 1Y8TA 1ZJDA 2TGAA 2ZU1A 4NFFA 1YPEH 4YZUA 2A7JA 2F9UA 3SYJA 3E8LA 4I8JA 5DPAA 1T8NA 2ANKH 1IQIA 3E1XB 3QK1A 4X6MA 2AERH 5TCAA 1HPGA 2GT7A 1P04A 2OC0A 2B9LA 3W95A 2VWLA 1QTFA 2ODYB 3F2HA 2WPJS 1O2MA 1PPFE 2OCVB 1MU6B 5CDFE 3ELAH 1Z8IB 3GY2A 5C20A 1TPOA 4IC5A 1KTSB 5FPTA 1YLNA 2GGVB 1GGDB 1GBTA 2BM2A 3QLPH 8KME2 1FIZA 5B6LA 2GV7A 2GV6A 4JZIA 1EJNA 3PMJA 1EUFA 1ZGIA 3GCNA 1E38B 1WTGH 4NZLA 5HMAA 2OQUA 5E0HA 1GBAA 3SJ9A 2WPLS 2PKSC 2ZF0H 2BY7X 4CR9A 3RXMA 4LZ1H 1Y5UT 3PO1C 1L2EA 4ACAA 3RXFA 3CS7A 1ZPZA 2WPHS 1O35A 1FXYA 1TRMA 2AMPA 1LVMA 1CGIE 5CMXH 2VNTA 1WUNH 4ZKSU 2KCAA 1TGBA 4ZMAH 5FCKA 3S9BA 1C2LA 3VXFH 4UFFH 1BIOA 1UTLM 2FX6A 1D3PB 2GMTB 1GHXH 2K0QA 5EQSA 5EG4A 1HAVB 2CXVA 3MU8A 1GCDA 3FVFB 2BVXH 2PTNA 3A80A 2FI3E 2XW9A 2AS9A 3FAOA 3FFGA 2R3UA 3SU0A 3UOUA 1A0LA 1TA2A 1A5HA 3WWFA 2AYWA 1LDTT 4UFDH 2XNIA 2F9BH 2ZU2A 3P8NA 1AVWA 1TB6H 2OINA 3RDZA 4AYVB 1BBRE 2W6JD 1C1WH 1FONA 5CHAC 3U69H 3ZVDA 3ZZCA 4NIXA 1HUTH 4WVPE 2HNTE 4NGAH 1SGYE 3EGKH 1QL9A 1HIAA 2W7SA 5K7RA 1E37B 1P12E 5EPNA 3R0FA 3A7ZA 4M7GA 1O3MA 1UVOA 1ZYOA 5EXNA 3TH4H 3VB4A 1L1JA 5AFZH 1K0HA 2KFWA 1BRAA 4ISHH 1O36A 1MD7A 2ZQ1A 1V3XA 4DIHH 3E90B 3ZZ3A 1ZPBA 1BTYA 4AGKA 1YPJH 3VGCC 3ZZ8A 2VH6A 1V2QT 2A5AA 3MNXA 4NZQA 1L0ZA 1CVWH 4Y0ZE 2AFQB 3P17H 4U32A 4DIIH 1VJ9U 3KQBA 4LOYH 4H6SB 1GJ4H 1YY3A 1J15A 3I78A 4Y10E 1IQNA 4MQAA 1SLUB 2Q6GA 3FO8D 2J97A 2FI4E 2ZWLH 3MH7A 1WU1A 4NIVA 4YT6H 1C1QA 2LPRA 4UDWH 2GCHG 2VU8E 1Y3WA 8GCHF 3ATIA 3IWMA 2OC1A 1EAUA 5C67A 1ID5H 1BTWA 1O5EH 2J98A 1TWXB 4DVAU 1SOTA 2FS8A 3HK3B 1GI7B 3BEFB 1C5XB 2V3HH 2XTTB 3EA7A 1O5DH 5C1YA 1SQOA 2F9VA 1K1LA 1YGCH 5DP9A 2G00A 1C1VH 3BTDE 2ZGBH 4MDSA 3T26A 1HJAC 1WQSA 2HPPH 3OSYA 1HAIH 4FETA 1DLKB 3KQCA 5JDUB 4A5TS 3SORA 1LQDB 1GDQA 3ATLA 2ZEBA 1P2MA 1GWAA 1NFXA 1NZQH 1WOFA 1LPGB 3A8CA 1D3DB 1Z6JH 3GY3A 2CV3A 2IPQX 1TOMH 4MNWA 4O9VA 2CGAA 4UE7H 1M9UA 2BVRH 2UWLA 4ISLA 1ELAA 2F9PA 3F2GA 1MBMA 1VJAU 4FUDA 1UK2A 3HKIB 4B75A 5E2OA 3OX7U 1MKXH 5GPIB 1PPHE 1S84A 1ZSJA 3KYGA 1ZMLA 1AE8H 3M35A 3OEED 1D9IA 1CT0E 3CS0A 3V0XA 4INLA 2FI5E 3MU0A 3MQKC 1DSTA 3TJNA 1O2WA 3A84A 2ZPSA 1XX9A 1A2CH 2KR7A 1Z8JB 5AHGH 3VPKA 2A1DB 1EASA 3SU4A 3PV2A 2AIQA 1O33A 1CGJE 1MTSA 3LGTA 2FMJA 4ZHMU 1TQ0B 1FY8E 1OYTH 4TY6A 4BANB 1BHXF 3F9GA 4XBDA 2QAAA 5GJ4B 4IS5A 2PSXA 2BD7A 1W14U 3CP7A 2TGTA 5DJ7A 4AGJA 3SJIA 1AD8H 2BX3A 3GCTG 3D23A 1PJPA 2NU3E 3ATWA 1UTKA 1C1PA 2FOHA 2XC4A 5FPSA 1FN8A 2H6MA 3Q3XA 4AZ2B 1NT1A 1KYNA 1HAHH 2OBQA 2K1QA 1FQ3A 1QB1A 4AG1A 3BIVH 1AMHA 1DWCH 2LELA 1V2JT 2HOBA 2OLGA 3TK9A 3H7TA 1LKBA 3MH5A 1F5RA 1A0HB 1ELEE 2P3FH 3GYMA 4X6NA 5FAHA 2R2MB 1HBTH 2VIWA 5E0JA 1B5GH 2JJ1D 3DSPA 2AGIX 4ACBA 1G30B 3UY9A 2BLWA 1UMAH 3F6UH 2OUAA 1GMDF 1HDTH 1YPHE 1W0YH 2G4UA 1UTOA 3HPTB 1OWEA 1GBDA 2Z9KA 5LPRA 2KCYA 2Z3CA 4FU7A 1T4VH 3DT0H 3AAVA 2BLQA 4E05H 1NU7B 2HRVA 1SB1H 5F8ZA 1O2VA 1BTXA 9ESTA 3I77A 1IQFA 3RXQA 1K21H 4ABGA 1MKWH 2C8ZB 2G81E 2I6SA 3AASA 2QN5T 3PMAB 4MG3A 3RMLH 1QGFA 5EXLA 3G01A 2QIQA 1BHXB 3PLBA 1SLWB 1OS8A 2XRCA 1DUEA 5TCCA 4DY7B 1KY9A 1IHTH 5T1VA 2TPIZ 2ZFTA 3BTFE 1O2XA 1C5UA 1DITH 1XUGA 4BTUB 4I7YH 3I29A 2ZDLA 1E79D 1YCPK 1KLJH 3GY4A 4XE4A 1O3AA 2Y5HA 4AB8A 1ZRBA 1BA8B 1J17T 2J94A 2ZGXH 5BPEA 2UWPA 3HGNA 1FI8A 1TBRH 1KLIH 3SV6A 2STAE 3O8CA 1DXWA 2ZU3A 2CHAC 3MYWA 3RXIA 5A0CA 2FESH 2KAIA 4XOJA 1O39A 1SR5C 1GJ7B 1KXFA 1YLDA 2AGGX 1GBFA 2Y7ZA 2ZCLP 4TT3D 1O2JA 4UEHH 4FU8A 1TMBH 4HI3A 2DE9A 3DUXH 3A88A 2FDAA 3A89A 5DSFA 1GBKA 2VWNA 1GHAF 3U1JB 3A8AA 1G3CA 5DP4A 1SFQB 4IBLH 2ZU5A 2ZFFH 3SV8A 4WMDA 4H4FA 4ZKOU 1EZSC 4K5ZA 4DG4A 2V3OH 2C8WB 1YP9A 1QJ1B 1O5AB 3A86A 3SNEA 1IQLA 3ZYEA 1DDJA 2ESTE 1XKBC 3MMGA 3QTVH 1QBOA 1SHHB 2FOGA 3NXPA 3HKJB 3SUEA 3MU1A 1C5RA 2Q6FA 4CRAA 3MO6A 4B2CA 5JBAS 1C5PA 1NN6A 2CF8H 1GBCA 2A4RA 2Z9LA 1EAWA 3F9HA 1A46H 3M3VA 1GHVH 4ABFA 3SUFA 1E36B 3WW7A 2ZFRH 1IQKA 5A8ZA 2FPZA 3E91A 1DY8A 3NPSA 3SGBE 1O2NA 3E6PH 1P03A 1AUJA 2XC0A 1VR1H 1LTOA 1T8OA 1ZTJA 4MPWA 2Y80A 4OS7A 2A2QH 2FZZA 3PRBA 4XBCA 3STIA 4YT7H 1NPMA 4KTCA 2O8TA 2WHXA 3SNDA 3TU7H 1TX6A 1BMMH 3PO1B 2UWOA 2ZDNA 1P0SH 1UTQA 1KMHB 1ELTA 1L1GA 1MMJN 4JYTA 1S5SA 1AQ7A 2ZHDA 2WV9A 3U9AH 2XYAA 4Z1MD 1GHYH 1MCVA 1FPHH 4SGBE 5JB9S 1BRCE 1XUKA 5HGGA 1V2VT 2JETB 2ZP0H 5ABWA 1AUTC 3GY6A 5JPMH 2VINA 2A4OA 1OP2A 5F53A 1P05A 1P9SA 1ZSLA 4E7NA 2FP7B 5E2PA 1K1IA 1ZMJA 1CHOG 3RU4T 1HIAB 3SV7A 1A1RA 1MABB 3PTBA 2QV1A 3LC3A 4GSOA 3F9FA 1XMNB 1GI5A 3KNXA 2NU2E 2V3MA 3MNBA 1BTZA 5HM9A 4DGJA 5SGAE 1O3PB 1PQ5A 1Z1IA 3ZVCA 3GS9A 4J2YB 3M7QA 1Z8RA 1YYY1 2VJ1A 2O9QA 1JRSA 5CHAB 4ABJA 3ZYDA 1L4ZA 1O3LA 1YWUA 3B8JA 4LZ4B 4RKJB 2WPIS 3QZQA 2VWMA 1GVKB 4FUIA 4X2WA 3E0PB 4X2YA 1GI9B 4I8GA 2HVXA 3K9XB 1EB2A 2UUYA 3SU2A 3PM3A 4AYYB 1Q2WA 3MNCA 3SI4H 5HXFA 3UPEA 4RI0A 2ZTZA 3RC5A 1SGFA 2QXIA 2SGFE 2J98B 3PRDA 2H9HA 1OWIA 4O03A 2ZQ2A 1MQ5A 1TBQH 3M7TA 5CE1A 2Y5GA 4OS4A 2J34A 3DD2H 1ARCA 5FBEA 1IQMA 3A82A 5E0GA 1OYQA 1C2DA 2XWBI 3SZNA 4BAOB 1EQ9A 3OAAD 4ZHLU 1SBWA 4D9RA 1ZHRA 1TQ7B 1LO6A 5DP7A 3SOSA 1G36A 2SGEE 2XCFA 3TNSA 1SHYA 1VGCC 2IPHA 1WAYB 2ZNKH 3KQDA 3VB7A 3SHAH 1O2OA 1SGDE 4AFQA 4XFQA 1D3TB 3MU4A 1YBWA 1Z7KA 4A92A 2AMDA 2JH0D 3AW1A 3EE0B 2Z9JA 6GCHG 1QNJA 2ZDKA 4WY3A 3RXPA 3UR6A 1TMTH 3RC4A 1Q31A 3T29A 1HYLA 1V6DA 4Z0KA 2CF9H 3TLOA 1OXGA 2B7DH 3N99A 1ZZZA 4IN1A 2J95A 2BQWB 2EI8A 4Q63A 4Y0YE 1DY9A 1N8OC 1RS0A 4NFEA 2B8OH 5B6OA 1BJVA 3CNRA 4KKDA 1V2TT 1JIMA 2BY9X 2FOMB 2HGTH 3M5OA 1MTUA 4Y8YA 3VXEH 1UCYE 1EFRD 2F9OA 2Y82A 1PYTD 3FOAA 1P3CA 5EJ1A 2THFB 4CBOA 1QBNA 4JZDH 1BZXE 4U30A 2QXGA 1Y3XA 2ZHEH 4AORA 3NK8A 8LPRA 3OYPA 1O2QA 1VITH 4JYUH 1QHRB 2ZPQA 3T28A 3R3GB 1HAZB 1C5WB 1TE0A 3ODDA 1HV7A 1NRQH 5E8EH 1C2FA 1AO5A 5T6GA 2ZCHP 3RXUA 1H8ED 2W5EA 3KEEA 1ANDA 2Z6BD 1JBUH 1TNHA 1LHFH 5EXMA 3UUZA 3AK5A 1UHBA 1BMNH 1PFXC 3SJKA 4AOQA 4BOHA 1ANEA 4PROA 1SQTA 1GJAB 4YXWD 7KMEH 1Z1JA 1P01A 4GLYA 2FYQA 4YLUA 1OHHD 4ZH8A 4CRCA 2GTBA 1C5YB 1S85A 1XUFA 1H8DH 3BSQA 1QA0A 3ZV8A 1B0EA 2BHGA 3UNSA 3MH4A 1TGTA 4FUCA 1QRZA 1AWHB 4GPGA 3DSGA 1EX3A 4X2XA 1TBZH 2JETC 4UFEH 2FYRA 2O8UA 1ZRKA 2SGDE 1J8AA 2C3SA 3V3MA 2XNDD 1FY5A 1SQRA 2R0KA 3OY5U 3Q76A 2D26C 1LKAA 1DVAH 3F3BA 1FY4A 1C5LH 1C2GA 2A4QA 1QR3E 3N7DA 3A8DA 1S83A 4YOIA 5LH8A 3C27B 1FZZA 3KQ5A 1ELDE 1LHDH 2FEQH 4F49A 2YNBA 2GDEH 1ZOMA 1C4V2 3PTNA 4DJZB 1V2UT 4FVBA 3SUGA 1AVGH 1YPLH 3GCTF 3TNTA 1SGIB 1Z8GA 1ELBA 1SGNE 1WBGB 1GJBB 1SL3A 2FX4A 1YPMH 1BBRH 7GCHG 1KXEA 1ANCA 1TNKA 5IYTA 2A45B 2GVFA 2BDGA 3K2UA 1O2RA 1O3FA 2NU4E 1ACBE 1ZGVA 2A31A 3LGVA 3L3TA 1AY6H 2GKVE 2R2WU 1C1NA 1SGPE 3RM0H 3ZVBA 1UTJA 3HK6B 4FUEA 3BIUH 3LH1A 2QF5A 5EGMA 3F1SB 3GICB 1QQUA 3K6ZA 2KAIB 4A6LA 1CE5A 1GBHA 2CMYA 3U1IB 2PUXB 3SU5A 5KECA 1HNEE 1OWJA 4NA9H 1GI2A 4P02A 3L33A 4Y79A 1D3QB 1G2MA 5GXPA 2YOLA 2PSYA 2H5DA 2LNCA 2BZ6H 3OTJE 2BXTH 1CT2E 1C2EA 2ZDAH 1EB1H 4X8SH 1ZHMA 4K3JA 4D7GA 2JH5D 3BTHE 3ZV9A 1UVSH 2CHAB 1THRH 1ELFA 2SGPE 3SUDA 3F0OA 2ZFQH 1A5GH 3PMHB 1DWDH 4P00A 1XVMA 1KIGH 3ZIAD 4A1XA 4CREA 2ULLA 3TJUA 3U8RH 1DM4B 2FXRA 3FZDA 1E35B 1WQVH 2XBWA 4HGCA 4K1EA 2J9NA 3QZRA 4CR5A 3U8OH 4INKA 3EA9A 1KSNA 3P8FA 3SQEE 2RCEA 3AVZA 4FVDA 3RXHA 1YCPM 1TGNA 5JB8S 1BTHH 1TRYA 2OP9A 5CHBA 2P3UB 4AFZA 1C1MA 1XKAC 2ALPA 2BD4A 1VITF 5ESBA 2BD9A 1BT7A 2HLCA 5EJZA 1Q3XA 1BJUA 1QL7A 4ABAA 1HAGE 1S6FA 1WV7H 1ZJKA 1SPJA 1XUHA 1QB9A 1C9TA 3BTKE 1HXFH 1W0KD 2GJGA 1DFPA 5EQRA 2GCTC 1NFWA 1TA6A 1VKYA 2ASUB 2UUFB 1L1NA 1ETTH 2VBCA 1P57B 4DURA 1XM1A 3GYLB 3B9FH 3UNQA 1T7CA 2FOCA 4CH2B 4YOJA 1PPZA 4E7RG 3U28C 2Z9IA 1GL1A 1D4PB 1OOKB 3M3SA 2OTVA 4BTIB 5AVDA 1KXDA 3EDXB 2OC8A 3LGUA 4BAQB 4XBBA 1DE7H 4MNYA 5HIZA 5C5NA 2PWXA 1ZSKA 1ELVA 2JIZD 4B71A 4NSVA 4YLQH 1HJ9A 1F0TA 2TIOA 3H7OA 2OD3B 3BG8A 5IDKA 3BTEE 1G2LA 2B5TB 2L74A 3NWUA 3H09A 1V2PT 4ISIH 1MKWK 1BRBE 1C5TA 2A32A 2VWOA 5ETXA 5JYIA 2JDID 4A1VA 1PPCE 3D49H 1LCYA 1W12U 3GY8A 4X1PU 1AZ8A 3EAJA 1A3EH 1NBME 4GCHG 4I8HA 4X6OA 1SGEE 1CHGA 2SGQE 2P59A 3UB0A 1THSH 1RIWC 1BB0B 3A7TA 2FODA 1TMUH 2BYAX 2YMSD 3UOPA 2WUCA 1O2LA 4HG6A 2FWWA 5C0TA 2C4FH 1C1OA 1IQHA 4LK4A 2VVVA 3FP7E 1C5NH 2ZGJA 4JK6A 7ESTE 3RXRA 2ANMH 2M5TA 2OC7A 3RU4E 4BTTB 2BD8A 2IJD1 2BZAA 3SGAE 3N7OA 1PPEE 3A7WA 4WH6A 1ETSH 3SNCA 4GAWA 1JOUB 4WMFA 4Q4LA 1P02A 1QFKH 3MH6A 3TITA 2XC5A 4Y71A 3FZZA 2FO9A 3FP8E 4NCYA 1E1QD 3ZZDA 3IITA 4KGAA 1FNIA 1PPGE 1QY6A 3BTME 3URCA 4UFGH 1QURH 2O8LA 4FUBA 8GCHG 1PYTC 3PV4A 2J5UA 2P16A 1UVTH 4ZKNU 1GMHG 2RDEA 1XUJA 3FP6E 7LPRA 3OTPA 4MPVA 2A7CA 1E0FD 4MLFB 1C9PA 4OS2A 2KZ4A 4NSYA 4KELA 4NWKA 5GNDA 1F5KU 2K8IA 2ALVA 2P3TB 3LC5A 1MAXA 1VCWA 2Y5FA 1P10A 2GD4B 4WXIA 1AB9B 2A0QB 2WPDD 4MNVA 5KGOA 1Z71A 3ATKA 4GVUA 1ESBA 3ZZBA 3QTOH 1NY22 1FAKH 2CK3D 4OS5A 1VGCB 1VCQA 2Z94A 1AWFH 2BDAA 3TK6A 1AVXA 4KP0A 3A7YA 3BV9B 1BMFD 1T8LA 2BDIA 1SFIA 3S69A 2QF3A 1H1BA 3LGIA 1T4UH 4IMQA 1J9CH 2QF0A 3PROA 3IG6B 5GCHF 3ZZ9A 1KLTA 1F2SE 1O2SA 1NTPA 1ZPCA 2D8WA 3TJOA 3MI4A 5FXLA 1EJMA 5DK1A 3ZVAA 1AIXH 1F0UA 1FUJA 2EC9H 2OK5A 5L6NH 1NU9A 1T8MA 4XSKU 2ZDVH 5TJXA 1INCA 4ZAEA 1HRTH 1N8OB 1D6WA 1UK4A 3SW2B 3UAIC 1C2MA 2ZHQH 1K1NA 4Y76A 1TX7A 1UVUH 2C8XB 1CU1A 1TOCB 1CBWB 1UHBB 2WSSD 1GMCF 2QXHA 4AC9A 1FDPA 1JWTA 2ZGCA 2FS9A 1ZTKA 3ZZ4A 4TWWA 1G3BA 1F7ZA 3SJ8A 4D8NA 4ABEA 2V35A 3VG8A 2OBOA 2ODQA 4JMYA 1O3OA 3MWIU 1OPHB 3TGIE 3MTYA 3FKSD 4UD9H 1X7AC 4YESB 3SGQE 1K28D 4I32A 1JIRA 1TNLA 3VFEA 2OXSA 3KIDU 4O3TA 1MQ6A 2BTCE 3ENSB 3RUOA 4ASUD 2WPKS 5ESTE 3LPRA 1GJ9B 5DG6A 5FHTA 1QZ8A 1GPZA 4TPYA 5FL7D 2GDDA 4K1SA 1TGCA 1FX0B 1T32A 1GBJA 5EW1H 1MU8B 1GCTC 1SGRE 2QC2A 3NZIA 3D65E 4Y7BA 1O3IA 1EPTC 1HAYB 4INHA 3D62A 2A4GA 4I31A 3RXTA 1FV9A 3K6YA 3STJA 1HAXB 3QDZB 5L2ZH 1MTWA 3JZ1B 3GY5A 1PPBH 1MTVA 1YM0A 1KDQA 2ZC9H 1V2ST 4RT1A 1O3HA 3P8OA 3KCGH 1S0RA 3OY6U 1DUAA 1T31A 3M7UA 1H9IE 2JJ2D 1TPSA 1J14A 1TALA 1P2IA 4ABHA 1GMDG 3EE7A 5EIYA 4U2WA 1GJ6A 3SV9A 1ABIH 5C0UA 3O8RA 3RXBA 1P9UA 1EPTA 1B7XB 1MZAA 1S6LA 2UUJB 1GVLA 1MTNB 3PB1E 1UW7A 1ZHPA 4LXBH 1CT4E 1XUIA 2Y6TA 1EP6A 5LPEA 3AAUA 4TYDA 4OM9A 1KXBA 2ZCKP 4NWLA 4ZXXH 4I8LA 1OP8A 1GBMA 1S81A 1P2NA 3Q3KA 3RLWH 2RG3A 2Z3EA 3NRLA 3H5CB 1C1UH 2L6OA 3A7VA 1WCZA 2BLOA 3GCOA 4NIWA 1OSSA 4RSPA 5LPFA 1PQ7A 5FX6A 2SNWA 3F0PA 2VB0A 4B6EA 3BTTE 2H9EH 1SLVB 1V2MT 4M9FA 1HB0B 3ITIA 1LVBA 1IQJA 3RMNH 2DUCA 1O2KA 3SZEA 2R3YA 2BB4A 1P09A 2BY6X 1BOQA 3UR9A 3SNAA 2AHME 4B1TA 4JCNA 4D76A 2H9TH 1GI3A 1BCUH 4VGCC 5A8XA 4R0IA 3MHWU 4Q7XA 2BY8X 4CRDA 1P2JA 1AB9C 3A8BA 1SLXB 1IAUA 3DCLA 1QJ6B 1ELGA 1WDIA 4YO9A 2WV4A 5AF9H 5A8YA 2A7HA 2PV9B 1GHAG 1RTFB 4FOUC 1K1JA 2TRMA 2XBVA 4X8UH 4CBNA 3PLPA 4B2BA 4MPXA 1G32B 3KQEA 3UNRA 1PQAA 4K69A 4OGXA 2BY5X 3V12A 2TGPZ 4FU9A 1UK3A 3A81A 7GCHF 3TK5A 1HFDA 4CH8B 4O3UA 5DP6A 4X8TH 3OU0A 4XDEA 3SJOA 4DT4A 1YPGH 1EOJA 1ANBA 1JMOH 5PTPA 1YC0A 2JH6D 3S9CA 2XBYA 3HATH 2VVCA 3HGPA 3UFAA 4AX9H 1C2JA 3DHKH 2PUQH 4GUXA 1CA0C 1RTLA 3EQ0H 1C5MD 1Y5BT 1O31A 4FXGH 5DO4H 2AEIH 5GWZA 2HVYB 1O2ZA 1OP0A 2KCPA 1CBWC 3T5FH 1HXEH 2P93A 2QY0B 3RXDA 1O38A 3SQHE 1W3CA 1DANH 5JBTA 5GIBA 2HNTC 1W2KH 1GL0E 2GCHF 2ZDMA 1N6XA 2YMSC 1OWDA 1AN1E 1QIXB 4BAHB 1GJ8B 1C2IA 2PKAA 4Y6DA 1B0FA 4ABIA 1LVOA 1C5SA 1YPKH 1UCYH 1C5ZB 4JYVH 1S82A 5DP5A 3E0NB 3PMBB 2GCTB 2GP9B 1MD8A 2HPQH 4D7FA 1V2KT 2W3KA 2O8MA 1RTKA 3MU5A 1F5LA 5EODA 1V2RT 1ZMNA 1FY1A 1TX8A 3ATMA 1DPOA 1GVZA 2ZGHA 2YNAA 2QF4A 2P8OB 1GHBG 4E06H 1TONA 1KTTB 1O3KA 5EPYA 2Z7FE 2RA0A 1BTUA 3RXLA 1NRRH 1K22H 1SSXA 2WYJA 5BRRE 3C1KA 3GDUA 4Q7YA
chains in the Genus database with same CATH topology
1K1OA 2ZTYA 1BBRK 1GI1A 3URDA 1A7SA 4Y8ZA 1MBQA 2FLBH 4GHTA 2A2XH 1W7GH 1GG6C 1TRNA 2WUBA 3BG4B 2WV5A 1SC8U 5A0AE 4CHAB 1LVYA 3TVJB 2IN2A 1W13U 1MTNC 2VIPA 1AI8H 1LPZB 1FMGA 4NG9H 2BOKA 2FIRH 3Q3YA 3U8TH 1OX1A 1G37A 1RIWB 3RMMH 2CN0H 5EU8A 2F91A 4WXVA 1ESTA 3A85A 1U6QA 3V13A 2SFAA 1ZLRA 3JZ2B 3P8GA 1DS2E 1E34B 3RXGA 3LT3A 4BAMB 3KN2A 1QB6A 1NFYA 3F68H 3V7TA 1DX5M 2TBSA 1SI5H 1SG8B 1AGJA 1C2KA 2PLXA 5T3HA 1NO9H 1TNGA 2ZA5A 4D9QA 2H1UA 4FUJA 1Y3UA 3MO9A 4K2YA 4YOGA 1ETRH 3LJJA 4ISNA 2QYIA 4X1SU 3UWIA 3UREA 4TPIZ 3BN9A 1AFQB 1THPB 2C8YB 2Y7XA 1K2I1 1DICA 1F0RA 2AH4X 1NRNH 1AKSA 4ZXYH 2PGQB 4ZHAA 4X0WU 1H8IH 1UO6A 3GDSA 2C93B 2VIOA 1TABE 4GCHF 3RXSA 4BXSA 5HYOA 4H6TA 4AG2A 2O8WA 3QGJA 2G8TA 2NU1E 1ESAA 4WH8A 1TPAE 4ZROA 1OWHA 4R8TB 1LMWB 1LPKB 2BMGB 1SVPA 4JZ1A 1Z6EA 1HAPH 4SGAE 2WYGA 1MKXK 4MNXA 4UONA 1O2YA 3UQOA 4U01A 3SBKA 1CA8B 1RGQA 2BDCA 1W8BH 3M5MA 2JKHA 2ZPRA 5J4SA 2XXLA 1SOZA 4HTCH 1NFUA 4X1QU 1RJXB 1F92A 1C1TA 1GJ5H 1O3NA 1Y3VA 1UTPA 1FN6A 2BX4A 1IQGA 2J4IA 4AFUA 3KGPA 3DFLA 1C5VA 1J16A 4OGYA 5EOKA 2ZO3H 3RM2H 1O5BB 2QGRA 5H4IB 3PWBA 3LJOA 1FJSA 1GMHF 3QWCH 5LGOA 3AW0A 1Y59T 2B0FA 3UWJH 3GISB 1PQ8A 1EAXA 2XCNA 2ODPA 1GBEA 2ZECA 1JXPA 9LPRA 1DSUA 4DW2U 1GDUA 1BDAA 1TNIA 2CJIA 2NU0E 3S7HB 1YPHC 1LQEA 5I46H 3UIRA 6LPRA 1NROH 3MOCA 5C5OA 1O2HA 4THNH 4AFSA 4RKOB 1OWKA 3W94A 3NCLA 1O37A 1BQYA 4K1TA 1O3GA 5FX5A 3T62A 1A4WH 1NRPH 2QXJA 4IC6A 1TFXA 1KDQB 4HFPB 2H2ZA 3P6ZB 4A1TA 1XXDA 3TH2H 1IQEA 1EZXC 2FOAA 1YLCA 1H4WA 1QJ7B 2PTCE 4Y7AA 4AN7A 3ESTA 3LDXH 4IMZA 2ANWA 3LGYA 3M3TA 1VZQH 1SGQE 1K1PA 3GDVA 1GCTB 1CSOE 2P8OC 1EPTB 3KL6A 1A0JA 4Y11E 1JRTA 1BTPA 1O0DH 3GCHB 4ABBA 2BD3A 3RXVA 3M61U 3RP2A 3S0NA 1UVPA 1GGDC 3RMOH 1IHSH 3S7KB 1P11E 1UTNA 4YM9A 1GBBA 3TGKE 1V2LT 2F83A 3TIUA 4FUGA 2ZFPH 3LH3A 3LOXA 4KTUA 4CRGA 1O30A 2FOFA 1Y3YA 1TLDA 2BD5A 8ESTE 3RLYH 3ZZAA 1DOJA 5DGJA 3A87A 2ZFSA 3BG4C 4NA8A 1YKTA 4CHAC 2Y81A 4MVNA 2VGCB 1O3EA 3E3TA 2DE8A 1TPPA 2BD2A 1GBLA 1O5FH 1RFNA 4NIYA 1BRUP 1QBVH 3SU6A 2QCYA 3UTUH 1K9OE 3UQVA 5AFYH 2GMTC 1D6RA 1LHEH 2ZTXA 1EZQA 1C5QA 1EAIA 1V2OT 2D1JA 1QA7A 1C5OH 2TGDA 2OQ5A 4AB9A 1C4U2 1NESE 1NM6A 1Y5AT 1ZR0A 5EQQA 3SU1A 4K8BA 1NS3A 1CO7E 1EXFA 3SHCH 1MH0A 1TIOA 4CRFA 1W10U 1AU8A 1QRXA 1EATA 4IGDA 3M5LA 2A5IA 1O2UA 4FUFA 2VVUA 2VIDA 2HNTF 1ABJH 1QL8A 3GY7A 3VB6A 1AFQC 1UTMA 4B73A 3CENA 1O5GH 1DT2A 1GHZA 3TPIZ 1CHOF 1HAVA 5FBIA 1O3JA 4OS6A 3SNBA 1XVOA 1WYKA 1QCPA 1O32A 3TJVA 4O97A 4WWYA 1L4DA 4JZEH 1CQQA 4VGCB 1O2GH 3TH3H 1O3CA 2V6NA 1GBIA 1EKBB 2I6QA 2IJOB 5GDSH 5DP3A 2FOEA 3LIWA 1EOLA 3MNSA 2F3CE 5FPYA 5K0HA 3BEUA 1KXAA 3NKKA 3A83A 4DOQA 1HAOH 2GZ7A 4BXWA 1P2OA 2W7UA 2Q1JA 2PFEA 1QRWA 3M37A 3O8BA 2Z9GA 1FLEE 2H5CA 4X2VA 4A7IB 4I8KA 4ABDA 5A0BA 2AIPA 1WTHD 5C1XA 2ZG0H 6CHAB 4K60A 1SQAA 1S6HA 1TYNA 1AFEH 4KTSA 5JBBS 3L6PA 4DCDA 3ZZ6A 1SGFG 2EI6A 2FTLE 1BMLA 1C1RA 2EEKA 3ODFA 4FUHA 3LU9B 3RXAA 2G4TA 2BVSH 1TAWA 2PKAB 2BOHB 3QGNB 4I33A 2G52A 1VITG 3EA8A 4B74A 2NWNA 1HJ8A 5C1UA 1CA0B 2BLVA 3VB3A 1EJAA 1P8VC 5FCRA 2SNVA 3M5NA 4X1RU 4X8VH 3RXJA 3T27A 4B76A 2J38A 5L2YH 1W7XH 4YTAA 3T2NA 4RN6A 1ORFA 2A5KA 1HCGA 1DWEH 1GI4A 1MZDA 1RRKA 1IOEA 3RC6A 5A2MH 5F8XA 1GDNA 2STBE 4HZHA 2GZ9A 1LHGH 5T6FA 3P70B 2BDHA 2AMQA 1EP5A 5DKMA 4WF8A 5JBCS 1GJCB 6GCHF 4JZFH 1YCPH 1P3EA 4X1NU 4ZKRU 2AGEX 2R0LA 1W11U 2G55A 1S0QA 2J92A 2RA3A 1SGTA 2F9NA 2FM2A 3ZZ5A 2HWLB 1F0SA 3QX5H 1ELCA 1H9LB 3GCHC 3F9EA 3WY8A 4F4OC 2D2DA 1AZZA 3SV2H 1GHWH 3M36A 2W3IA 1C2HA 4DT7B 2UUKB 1A5IA 4Q80A 1LHCH 3QN7A 2J2UA 1MCTA 1WSSH 3SU3A 4J1YA 1FAXA 1TGSZ 4H42U 5F8TA 1V2NT 2XBXA 3ZZ7A 2C90B 3EYDA 3QO6A 2PR3A 4Z6AH 2PKSB 1AE5A 1RD3B 4ISOA 4ZUHA 1KXCA 4NA7A 1GG6B 1N1LA 2VGCC 2Q6DA 1OKXA 2WPMS 4WMEA 1GI6A 2P95A 4Y8XA 1HGTH 3T25A 4IW4E 4Q2KA 5C2ZA 3RU4D 2SGAA 4MPUA 5C3NA 1FPCH 1ZTLA 1SGCA 2ZU4A 4BAKB 1C1SA 3SN8A 2ZZUH 3BTWE 1AKSB 4IN2A 2PHBA 3LKWA 1GHBF 5F03A 1DXPA 5I25A 3P92A 1G9IE 1P06A 1AHTH 2G5VA 4Q7ZA 2W26A 4TWYA 4X6PA 1BUIA 1DWBH 2ZKSA 2VH0A 3PWCA 2P94A 3LGWA 2PGBB 3KHVA 1XXFA 3P95A 3VB5A 1GI8B 3A7XA 4K8YA 3Q00A 3BTQE 2HALA 3B23B 3FANA 1VCPA 3BF6H 4JK5A 3RXEA 1H9HE 3DFJA 1DLEA 3RXCA 3ZVGA 3ZVEA 2FTMA 5DP8A 1GJDB 5F6MA 1A3BH 1O2PA 3SI3H 3KF2A 2BDYA 2BXUH 2WINI 2PW8H 4CRBA 1NRSH 6ESTA 1O3BA 2Z3DA 5GCHG 1A61H 5HM2A 3MO3A 5L30H 1BMAA 2ZHWH 2R9PA 1EZUC 4B2AA 5J4QA 3VGCB 2QA9E 2ZIQH 3O8DA 3ZVFA 1FY3A 3E16B 3Q77A 3U98H 3LONA 1GI0A 1MUEB 1QQ4A 3TGJE 5A09A 1O3DA 1UCYK 2G5NA 3BEIB 1FIWA 1O2IA 2ANYA 6CHAC 3SO3A 1ARBA 2BDBA 5G4BA 1C4Y2 1GMCG 1NC6A 1TNJA 2FOBA 2BQ7B 2G51A 2IOTA 3MFJA 1MAYA 2RDLA 4BNRA 1G3EA 1P2KA 1HLTH 2ZHFH 3RXOA 3BTGE 3RXKA 2VIQA 2GZ8A 1O2TA 1O5CB 1P2QA 1SMFE 2ILNA 5EW2H 2EA3A 4MTBA 1CGHA 1O34A 2XWAA 2VIVA 4QT8C 2FLRH 3GOVB 4ASHA 1N6YA 1V2WT 1HJAB 1K1MA 2V0BA 2ZI2H 3PLKA 4ESTE 3S9AA 3VEQB 3DA9B 1W0ZU 3QUMP 1UJ1A 1BITA 1G3DA 3NUMA 4OS1A 5T6DA 2EI7A 4WJG2 2GT8A 2GX4A 4TY7A 4GHQA 1YF4A 3K65B 1RXPA 3PYHA 2BQ6B 1Y8TA 1ZJDA 2TGAA 2ZU1A 4NFFA 1YPEH 4YZUA 2A7JA 2F9UA 3E8LA 4I8JA 5DPAA 1T8NA 2ANKH 1IQIA 3E1XB 3QK1A 4X6MA 2AERH 5TCAA 1HPGA 2GT7A 1P04A 2OC0A 2B9LA 3W95A 2VWLA 1QTFA 2ODYB 2WPJS 1O2MA 1PPFE 2OCVB 1MU6B 3ELAH 1Z8IB 3GY2A 5C20A 1TPOA 4IC5A 1KTSB 5FPTA 2GGVB 1GGDB 1GBTA 2BM2A 3QLPH 8KME2 1FIZA 2GV7A 2GV6A 4JZIA 1EJNA 3PMJA 1EUFA 1ZGIA 3GCNA 1E38B 1WTGH 4NZLA 5HMAA 2OQUA 5E0HA 1GBAA 3SJ9A 2WPLS 2PKSC 2ZF0H 2BY7X 4CR9A 3RXMA 4LZ1H 1Y5UT 3PO1C 1L2EA 3RXFA 3CS7A 1ZPZA 2WPHS 1O35A 1FXYA 1TRMA 2AMPA 1LVMA 1CGIE 5CMXH 2VNTA 1WUNH 4ZKSU 1TGBA 4ZMAH 5FCKA 3S9BA 1C2LA 3VXFH 4UFFH 1BIOA 1UTLM 2FX6A 1D3PB 2GMTB 1GHXH 5EQSA 5EG4A 1HAVB 2CXVA 3MU8A 1GCDA 3FVFB 2BVXH 2PTNA 3A80A 2FI3E 2XW9A 2AS9A 3FAOA 3FFGA 2R3UA 3SU0A 3UOUA 1A0LA 1TA2A 1A5HA 2AYWA 1LDTT 4UFDH 2XNIA 2F9BH 2ZU2A 3P8NA 1AVWA 1TB6H 2OINA 3RDZA 4AYVB 1BBRE 1C1WH 1FONA 5CHAC 3U69H 3ZVDA 3ZZCA 4NIXA 1HUTH 4WVPE 2HNTE 4NGAH 1SGYE 3EGKH 1QL9A 1HIAA 2W7SA 5K7RA 1E37B 1P12E 5EPNA 3R0FA 3A7ZA 4M7GA 1O3MA 1UVOA 1ZYOA 5EXNA 3TH4H 3VB4A 1L1JA 5AFZH 1BRAA 4ISHH 1O36A 1MD7A 2ZQ1A 1V3XA 4DIHH 3E90B 3ZZ3A 1ZPBA 1BTYA 4AGKA 1YPJH 3VGCC 3ZZ8A 2VH6A 1V2QT 2A5AA 3MNXA 4NZQA 1L0ZA 1CVWH 4Y0ZE 2AFQB 3P17H 4U32A 4DIIH 1VJ9U 3KQBA 4LOYH 4H6SB 1GJ4H 1J15A 3I78A 4Y10E 1IQNA 4MQAA 1SLUB 2Q6GA 2ZWLH 2FI4E 3MH7A 1WU1A 4NIVA 4YT6H 1C1QA 2LPRA 4UDWH 2GCHG 2VU8E 1Y3WA 8GCHF 3ATIA 3IWMA 2OC1A 1EAUA 5C67A 1ID5H 1BTWA 1O5EH 1TWXB 4DVAU 1SOTA 2FS8A 3HK3B 1GI7B 3BEFB 1C5XB 2V3HH 2XTTB 3EA7A 1O5DH 5C1YA 1SQOA 2F9VA 1K1LA 1YGCH 5DP9A 2G00A 1C1VH 3BTDE 2ZGBH 4MDSA 3T26A 1HJAC 1WQSA 2HPPH 3OSYA 1HAIH 1DLKB 3KQCA 5JDUB 4A5TS 3SORA 1LQDB 1GDQA 3ATLA 2ZEBA 1P2MA 1GWAA 1NFXA 1NZQH 1WOFA 1LPGB 3A8CA 1D3DB 1Z6JH 3GY3A 2CV3A 1TOMH 4MNWA 4O9VA 2CGAA 4UE7H 1M9UA 2BVRH 2UWLA 4ISLA 1ELAA 2F9PA 1MBMA 1VJAU 4FUDA 1UK2A 3HKIB 4B75A 5E2OA 3OX7U 1MKXH 5GPIB 1PPHE 1S84A 1ZSJA 1ZMLA 1AE8H 3M35A 1D9IA 1CT0E 3CS0A 3V0XA 4INLA 2FI5E 3MU0A 1DSTA 3TJNA 1O2WA 3A84A 2ZPSA 1XX9A 1A2CH 1Z8JB 5AHGH 3VPKA 2A1DB 1EASA 3SU4A 2AIQA 1O33A 1CGJE 1MTSA 3LGTA 2FMJA 4ZHMU 1TQ0B 1FY8E 1OYTH 4TY6A 4BANB 1BHXF 3F9GA 4XBDA 2QAAA 5GJ4B 4IS5A 2PSXA 2BD7A 1W14U 3CP7A 2TGTA 5DJ7A 4AGJA 3SJIA 1AD8H 2BX3A 3GCTG 3D23A 1PJPA 2NU3E 3ATWA 1UTKA 1C1PA 2FOHA 2XC4A 5FPSA 1FN8A 2H6MA 3Q3XA 4AZ2B 1NT1A 1KYNA 1HAHH 2OBQA 2K1QA 1FQ3A 1QB1A 4AG1A 3BIVH 1AMHA 1DWCH 2OLGA 1V2JT 2HOBA 3TK9A 3H7TA 1LKBA 3MH5A 1F5RA 1A0HB 1ELEE 2P3FH 3GYMA 4X6NA 5FAHA 2R2MB 1HBTH 2VIWA 5E0JA 1B5GH 2AGIX 1G30B 3UY9A 2BLWA 1UMAH 3F6UH 2OUAA 1GMDF 1HDTH 1YPHE 1W0YH 2G4UA 1UTOA 3HPTB 1OWEA 1GBDA 2Z9KA 5LPRA 2Z3CA 4FU7A 1T4VH 3DT0H 3AAVA 2BLQA 4E05H 1NU7B 2HRVA 1SB1H 5F8ZA 1O2VA 1BTXA 9ESTA 3I77A 1IQFA 3RXQA 1K21H 4ABGA 1MKWH 2C8ZB 2G81E 2I6SA 3AASA 2QN5T 3PMAB 4MG3A 3RMLH 1QGFA 5EXLA 3G01A 2QIQA 1BHXB 3PLBA 1SLWB 1OS8A 2XRCA 1DUEA 5TCCA 4DY7B 1KY9A 1IHTH 2TPIZ 2ZFTA 3BTFE 1O2XA 1C5UA 1DITH 1XUGA 4BTUB 4I7YH 3I29A 2ZDLA 1YCPK 1KLJH 3GY4A 4XE4A 1O3AA 2Y5HA