1CHGA

Chymotrypsinogen,2.5 angstroms crystal structure, comparison with alpha-chymotrypsin,and implications for zymogen activation
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
245
structure length
226
Chain Sequence
CGVPAIQPVLSGLSRIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGVTTSDVVVAGEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSAVCLPSASDDFAAGTTCVTTGWGRLQQASLPLLSNTNCKKYWGTKIKDAMICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQTLAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Chymotrypsinogen: 2.5-angstrom crystal structure, comparison with alpha-chymotrypsin, and implications for zymogen activation.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase zymogen (serine proteinase)
molecule keywords CHYMOTRYPSINOGEN A
total genus 40
structure length 226
sequence length 245
ec nomenclature ec 3.4.21.1: Chymotrypsin.
pdb deposition date 1975-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1chgA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1chgA01
1GBHA 2BDAA 4A1XA 1T7CA 2ZHFH 2F3CE 1O3HA 1K2I1 3ZVDA 2QGRA 1RIWC 1C2MA 1TGBA 4I7YH 4Q7ZA 3AW1A 1WSSH 3OTJE 1TRYA 2FZZA 2AGGX 3ZZ6A 1MCTA 2J95A 2GVFA 4MTBA 2SNWA 2ZTYA 1O3BA 4JYVH 1T8LA 1AE5A 1HAOH 1DX5M 5HYOA 5A8ZA 2BXUH 2P8OC 3A88A 2BOHB 2Z9LA 1O31A 4ISIH 4AZ2B 5SGAE 2AS9A 1TNHA 1SI5H 3T28A 2TGTA 4BAQB 2FX6A 4K60A 4K3JA 1SOZA 2TIOA 2WUBA 2ZFRH 1A61H 1SLUB 1Z8JB 2QF0A 2SNVA 3GCNA 3LJOA 1QA0A 1E37B 4YLUA 2BQ6B 2ZCKP 1V3XA 1C5YB 1DWCH 3PWCA 4YLQH 5CMXH 4BANB 2P59A 1BRCE 1LMWB 4YESB 1AB9C 1FZZA 5EPYA 2A7HA 1VCQA 1P04A 3RXLA 2FOAA 4BXSA 2WINI 1TYNA 2ZHEH 1AIXH 1D3TB 2O8WA 1EJNA 1KXCA 5EQQA 3Q3KA 1ESTA 1OYTH 1YPHE 1O3NA 2A4OA 3A85A 5HXFA 2BDIA 3H7TA 1Y5UT 2ZGCA 1KXEA 1DWBH 2FOMB 2BYAX 1QIXB 5A8YA 1ZRKA 4RKJB 3Q00A 3I78A 1TNGA 2G5VA 1KLIH 2ODQA 4LZ4B 2F83A 3ZZ8A 2A7JA 4K1TA 1P57B 1UVSH 2C8ZB 1P2NA 1CT4E 1GI0A 1O2ZA 2VVVA 2ZPSA 1YPKH 2NU4E 1EKBB 4FVBA 2A5IA 1LPZB 3KQBA 3LH1A 1V2MT 4FUBA 5C5NA 2G81E 2C8WB 1GBAA 2A0QB 2XBWA 4E05H 5E8EH 3SHAH 1ZHPA 2VINA 3SQHE 2ZQ1A 3ZZ5A 1MH0A 4UDWH 4DURA 2GCHG 2VIVA 1IQIA 2Z9GA 4CH8B 1ELTA 1UVOA 2CN0H 3SV2H 1QFKH 5C1UA 2Z94A 1GGDB 1EZUC 1C4Y2 2PR3A 1TALA 4ZAEA 1T4VH 2GGVB 5AFZH 2Z3DA 3QTVH 2H9EH 4FU9A 2WYGA 2XXLA 3SGAE 3V13A 2G55A 3GY2A 3OU0A 1O2LA 5C5OA 1RTKA 1S0RA 3LGWA 1C1TA 1D3QB 2ZGBH 1WTGH 1DSUA 1UTPA 2G8TA 2VGCB 4LOYH 1CGHA 2VU8E 4SGBE 2BZAA 2YNBA 4E7RG 4ABDA 1VITF 1EZSC 4Y0YE 5K7RA 4TYDA 1L1NA 1N6XA 3SZNA 2Y81A 4AOQA 4AFQA 1YKTA 3CP7A 2A4QA 3MH5A 3FZZA 4AGKA 1GHBF 2ZTZA 3QZQA 1AWFH 4NFEA 1M9UA 2RDLA 4UEHH 2V3HH 4XBDA 2HNTC 2ZA5A 5DP5A 2QA9E 1NFXA 3UQOA 3SNBA 2BD7A 1THPB 2D26C 1AKSB 1HGTH 1FPCH 3ZZ4A 1GMHF 3URCA 1F0TA 1IQLA 1AKSA 3BTKE 1ELAA 4I33A 1GBIA 1ZJDA 1DE7H 1TGSZ 1ZMLA 1Y5AT 4FUGA 1QGFA 3GY7A 2BVRH 2C93B 1ELGA 1K1MA 1BMMH 1O5AB 1ZPCA 1PQ7A 2GD4B 2TBSA 1E0FD 1P11E 1BTYA 5EQRA 4B2AA 1ZSLA 5E0GA 3MNCA 4D7FA 6CHAB 4KTUA 3ZZCA 1Z8IB 5LPRA 2STBE 3RXCA 4X6PA 3GY8A 1EX3A 5F8ZA 2UWLA 4ZHAA 2ZCHP 1GG6C 4Y7AA 2FO9A 3FAOA 3UTUH 1DWDH 3SU5A 5C3NA 2DE8A 1T32A 1ELEE 1BZXE 1TA6A 2PSYA 2Y5GA 3GDUA 4ISLA 4ABEA 3OSYA 4GUXA 3AAUA 5A0CA 2H2ZA 2PW8H 2SGPE 2ALPA 3P8GA 4AG1A 6ESTA 3A84A 1NT1A 2G51A 3DFLA 1EP5A 1CHGA 4KELA 1WOFA 1W10U 5FPYA 1YPEH 1OWJA 3DFJA 1V2UT 3ATWA 4HI3A 3EGKH 2ZFSA 2F9PA 5FCKA 1S0QA 5JBAS 1SC8U 2LNCA 3V0XA 2I6SA 3UNQA 1C2IA 1PYTD 3I77A 3TLOA 1TBRH 1GDQA 1Z71A 2H9HA 3PTNA 4O3TA 1GBEA 1OP2A 1T4UH 3SW2B 2VWMA 1PFXC 2Q6DA 1ARBA 1RGQA 1F5RA 1GI3A 1BRBE 4FUDA 1GHYH 2ZZUH 1GJ4H 1THSH 1K28D 1VGCC 1ZHMA 3PLPA 1IHTH 3A7TA 1NU7B 1GJAB 1YYY1 3UOUA 2EI8A 2Y7XA 1XMNB 2ULLA 4XOJA 4TY7A 1S83A 1HAZB 3UFAA 4YM9A 1SQOA 2Y82A 1HIAB 1Y5BT 1D6RA 3ZZ7A 5AF9H 3TH2H 3ZZAA 1YP9A 3BTQE 3QWCH 1SG8B 3GY3A 5LPFA 1ZHRA 1QBNA 1YLDA 3K6YA 4X0WU 1OP0A 4GAWA 1C1QA 5TCAA 2P16A 1O5CB 3RUOA 2TGDA 1AQ7A 3A7ZA 3QGJA 4MDSA 3S7HB 3E16B 4K8BA 2JKHA 4IC5A 1C1NA 5EW1H 1HLTH 4B73A 2PSXA 3RMMH 1EPTA 3MO9A 1V2RT 2Y5FA 2ZFTA 1IQKA 4K2YA 1HAYB 1G3EA 3OY6U 2Y7ZA 4HGCA 2BHGA 3DT0H 1QRWA 4BAHB 2H5DA 3TK6A 1WAYB 1PPHE 1GDUA 1ORFA 2BVSH 4IC6A 1H8DH 2ANMH 3PB1E 5DJ7A 1T8MA 1TPPA 1SPJA 1QNJA 3NK8A 1TWXB 1RIWB 5DGJA 1MKXK 3GY4A 3BTME 4OS6A 5GXPA 4I8GA 1O5FH 1D3PB 2AGIX 3FP8E 1GHWH 1ZSJA 1BOQA 2ZECA 1D3DB 4MNXA 3UNSA 3SV6A 4YTAA 1K1NA 1GHVH 2ODPA 4WJG2 1GJ5H 2J2UA 2GT8A 1ZZZA 2WPIS 3E0PB 1GPZA 3B23B 4ABBA 1XUKA 2G52A 1W0YH 2TPIZ 1VITG 5FPSA 2YOLA 3ZVAA 2PWXA 1V2QT 1BQYA 3LDXH 4HTCH 2SGEE 1ZPZA 2FESH 5GPIB 4AG2A 1TFXA 3NCLA 3Q76A 3GOVB 3MH6A 2ZDLA 2GMTC 3BG4B 5EGMA 2EA3A 8ESTE 1OP8A 2W3KA 1KIGH 1C9TA 2JH5D 4AN7A 1WUNH 3RMOH 5GWZA 4NCYA 5LPEA 1ZRBA 2FEQH 3UWJH 5DPAA 5LH8A 1O2KA 2CHAC 1TB6H 1OPHB 5EXMA 3ZVBA 1GI1A 4VGCB 3EA8A 1HJ8A 9LPRA 5GIBA 1PPEE 2NU2E 2A2XH 3A8CA 3QO6A 2ZPQA 3BTEE 4UE7H 4WF8A 1F0SA 5DP8A 1GJ6A 5HGGA 2BDBA 1HUTH 2BLVA 3BV9B 2VVUA 2OXSA 1PPGE 1HYLA 3GCTG 1MU8B 3PLBA 1MTSA 2XC4A 3V7TA 3DHKH 4I8JA 2P94A 3E91A 4NGAH 1ABJH 3U9AH 2ZHWH 4Q2KA 1SLVB 1XXFA 2ZP0H 2OC1A 1FI8A 4YOIA 1NC6A 1NTPA 1V2NT 3RXOA 4HZHA 2BMGB 4UFDH 3CS0A 1BMAA 1P03A 1WCZA 3PWBA 3MWIU 1TIOA 2PFEA 2ZI2H 4RN6A 1NU9A 4PROA 1QHRB 1DS2E 2ZF0H 1RD3B 2LPRA 2GKVE 4OS7A 1FV9A 3M3SA 3KEEA 1AVXA 1NN6A 1MQ5A 1CT0E 1MAXA 2BLWA 1NRPH 2TGPZ 1G2LA 3LU9B 4TWWA 1GI9B 1GMHG 3QLPH 4Q80A 4ZUHA 3ATLA 1OWIA 2ZU5A 5E0HA 1BA8B 6CHAC 3A87A 4DT7B 1SGQE 3RMLH 2STAE 3ATKA 1GWAA 2H5CA 2B5TB 1TAWA 1JXPA 1NZQH 1NRNH 2UWPA 1SQTA 3SORA 4ABIA 1P09A 3FP6E 5FHTA 2FDAA 2FOGA 2FS9A 5GJ4B 1UCYE 5HMAA 4NSVA 1AZZA 5BPEA 1C2HA 3OYPA 4ISNA 1HXEH 1DOJA 1FY5A 1DY9A 3UQVA 3A86A 1BTXA 3Q3YA 2JH0D 5FBEA 4A1TA 4GPGA 5DP3A 4ZH8A 1EOJA 3ESTA 1MBMA 1PQ8A 5A0BA 1LPKB 1CBWC 1O33A 1L1JA 3ZZ3A 1V2VT 1JIMA 2BZ6H 2W26A 3T2NA 1TE0A 4UONA 1NPMA 2P3FH 4X6OA 3EAJA 2ZG0H 1O3LA 1QTFA 2DUCA 4IN1A 1QL8A 3HGPA 2FX4A 3GYMA 3EYDA 2WPKS 1G3BA 1YM0A 3SO3A 1LVYA 1GCDA 1C1WH 2A5KA 2W5EA 1FN6A 2Q1JA 1CBWB 2A4GA 4IMQA 2R9PA 1ZSKA 2B0FA 2UUFB 3RP2A 4AFSA 1QJ7B 3M3TA 1EPTB 4NFFA 2Z7FE 3AAVA 2Z9KA 2IOTA 1ABIH 4Q7XA 1QQ4A 2ZCLP 4Y6DA 2AIQA 3BIUH 3F9GA 1QB6A 2VVCA 3B9FH 3D62A 4D7GA 1TGTA 1QRZA 4CRCA 1SGFG 3F9EA 2FI5E 3BG8A 1S84A 2AH4X 1VCPA 2BY9X 1GCTC 2PGQB 2B9LA 1GI4A 1P9UA 2G4UA 1SFQB 1ARCA 1ESBA 2FI4E 3CENA 1GBKA 1HAHH 1V2PT 2OBOA 2ZU2A 3GDVA 1O3AA 1FN8A 4JK6A 5T6FA 1KTTB 1H4WA 4H42U 4FVDA 5DP4A 1ZGIA 3SV7A 1PPBH 2R0KA 1OKXA 1S6HA 3VEQB 3M7QA 3Q3XA 1O2RA 3RXQA 3BEFB 2XC0A 4FU8A 1HPGA 1J17T 4K8YA 4JCNA 3STIA 2FOBA 1OXGA 3EQ0H 1C5VA 3RU4D 2SGDE 1CSOE 2UUJB 4X1NU 2V35A 1CGIE 1Q3XA 3A83A 2WUCA 1QBOA 4IS5A 2ILNA 5EOKA 1F5KU 2PTCE 3IWMA 3RXRA 4NIXA 3MMGA 4U2WA 2A7CA 1AGJA 1ZR0A 4D76A 1A5IA 5TCCA 3PLKA 1BBRH 4OS1A 3TJUA 1T8NA 4ZHLU 5FXLA 1RTLA 2ZFFH 2BTCE 1X7AC 1TRNA 5TJXA 1HAVB 2HNTF 4YOGA 2VIPA 1AVWA 1TNIA 1JBUH 1BTPA 1CGJE 2THFB 4DG4A 3HGNA 1IQGA 1HAVA 5L30H 2BB4A 1O34A 1ETRH 1EUFA 3K2UA 3TGIE 4GHQA 2GX4A 1BBRK 1O5DH 1FMGA 4YZUA 1XVMA 5A2MH 1CQQA 1HIAA 2PKSC 1Y3YA 2IN2A 1A2CH 1DITH 1GCTB 4D8NA 2WPHS 3SU4A 2FOCA 3KIDU 4XSKU 1O5EH 1C2EA 2QCYA 4INKA 1AVGH 3PMJA 1EB2A 3GCHC 3RXKA 1O3KA 4Y8YA 1RJXB 1SGRE 3HK6B 1GMCG 1G32B 1C5UA 1O2SA 3GCHB 1MKWH 2AMDA 4ZKOU 3O8CA 2OQUA 1S6FA 2OC0A 2EEKA 5I46H 4TWYA 1LHDH 3TIUA 1O2OA 1HAXB 2ZQ2A 1PPZA 3GICB 3KN2A 3RXVA 4A92A 2UWOA 2ASUB 2BLQA 3M5MA 2ZWLH 4I32A 1W8BH 1UMAH 1THRH 1UK4A 3F68H 1UHBB 2ZHQH 3BTHE 4X1PU 1QBVH 2TRMA 2FYRA 5JYIA 3SN8A 1O37A 3N7OA 2BY8X 4CRGA 4NA8A 5L2YH 1V2WT 2BQWB 1O3GA 2BVXH 1AFQC 1CU1A 1Q2WA 1UCYH 4SGAE 5K0HA 3BIVH 1EASA 4X8VH 1YC0A 3MH4A 1H1BA 3FP7E 1WYKA 1A3EH 1FAXA 1JRTA 1W13U 2ZFQH 5F03A 2GCHF 2CV3A 1J14A 1DLKB 1QY6A 1GHAG 3RXGA 1H9IE 2PUXB 1GJBB 4FUJA 1F7ZA 1VJ9U 1GJCB 1V2ST 1DUAA 2VWLA 2XWBI 1BTHH 4O03A 3TU7H 1P2KA 4K5ZA 2KAIB 8LPRA 3RLYH 4ZKNU 4B1TA 4WH6A 2R2MB 4K69A 4UFEH 5A09A 2ZTXA 4JZEH 5EW2H 1IQHA 2P93A 3U8OH 2BX3A 1K1LA 1RXPA 1UVTH 2TGAA 3LONA 3T29A 1INCA 5A8XA 1AN1E 4KTSA 2P8OB 2PV9B 4AB8A 1GBLA 3LJJA 1L1GA 2G5NA 2XRCA 2PKAA 2KAIA 2GMTB 1NY22 3K6ZA 1NRRH 4J1YA 2XWAA 3RXBA 4FUFA 3SUEA 1CVWH 1QL7A 3P8NA 1EJMA 1IQMA 4WVPE 3PYHA 4R0IA 1SGPE 4AFUA 4X2WA 3RC5A 1Y3VA 2QXGA 1A3BH 1BB0B 1J8AA 4RKOB 1FY3A 1P9SA 1HDTH 1GJDB 4I31A 1ETTH 3P17H 1XUHA 2IPHA 4NZLA 1FPHH 3ZZDA 1UVUH 3BTFE 4AB9A 4WWYA 1LDTT 3SU3A 2B8OH 3E90B 2WPMS 4Y8ZA 5FX5A 5L6NH 1ELBA 2OQ5A 2QXHA 3BG4C 3BTGE 4BOHA 2ZPRA 2PKAB 5ESBA 1BMLA 1KXDA 1TNKA 3RM0H 4ABHA 1LVOA 3E0NB 1UTOA 3B8JA 3BF6H 4XBCA 1ZOMA 1DANH 3JZ1B 4ESTE 2CHAB 3SGBE 1DDJA 3ZYEA 3SJ8A 4I8HA 1P2IA 1TNJA 3MU4A 1LHFH 1ANBA 1MU6B 1P10A 1GDNA 1TABE 5EU8A 1KTSB 2QN5T 1MAYA 1XUIA 3M7UA 3SNEA 2VH0A 1SOTA 1TMUH 9ESTA 4AYVB 5JBCS 3A8AA 1G3CA 2F9BH 5FCRA 4LK4A 4X1QU 3DUXH 1HRTH 2Q6FA 4CREA 3Q77A 2Z9IA 1YGCH 1AWHB 1F2SE 4DY7B 1TQ0B 3SV8A 4D9QA 1TNLA 4JYTA 3KQEA 1YPLH 1C2DA 2OP9A 3R0FA 2FTLE 4MPWA 2ANYA 4DVAU 2ANKH 3VB4A 1ZYOA 4X8UH 1KYNA 5J4SA 1QR3E 3A8DA 1BRAA 1HFDA 2QAAA 3MH7A 1IAUA 2RCEA 5AVDA 1RTFB 2HNTE 1RS0A 1SMFE 2CJIA 1AFQB 2JH6D 2QYIA 4Y71A 3L3TA 2ZDNA 4O9VA 2ZDAH 4OS4A 1SHYA 4NZQA 1NRQH 2ZC9H 1P2MA 4IW4E 1Z1JA 5PTPA 3NUMA 5ESTE 1UK3A 1CT2E 1S5SA 2Z3EA 4OGXA 3KL6A 1Y8TA 1ELVA 4CH2B 1O3IA 4B76A 2C4FH 4JZ1A 1GBCA 1K9OE 1TGNA 1Y3UA 2BD2A 3VGCC 2XYAA 1OOKB 1FIWA 1WTHD 2FOHA 5AHGH 1AU8A 2FLBH 2BDCA 2O8UA 1YPMH 4X6NA 1EOLA 2WV5A 3SU2A 1C2JA 3HKIB 2ALVA 2SGFE 3TGKE 1BCUH 3D49H 3ZZBA 1O5BB 5JDUB 3ATMA 3TJNA 1FY4A 3VB5A 4LZ1H 1E35B 1B7XB 4FU7A 2VIOA 3QZRA 4WXVA 2P3TB 3VGCB 1W7GH 3MNSA 3LT3A 4X2XA 1GI7B 1DXPA 1QB9A 1HJ9A 1GL0E 2HWLB 2AYWA 3MU8A 4ZKRU 1LKBA 3ZVGA 1LHEH 4AYYB 5C1XA 3RXSA 2BDHA 2WPLS 4B71A 2FS8A 1AMHA 2D2DA 5HM9A 5F8XA 3SI4H 2R3UA 2HRVA 4ABAA 3A7YA 1LKAA 1SLXB 3FFGA 3AVZA 3M61U 2ZDVH 2J92A 2XCFA 1L4ZA 1P0SH 2OLGA 1O2WA 2AIPA 4BAOB 5AFYH 3TH3H 1SGCA 1SGTA 2ZHDA 2BOKA 3LOXA 1YBWA 1CHOF 3FANA 3A89A 2PGBB 3S7KB 1C5OH 4DGJA 2NU0E 2R2WU 2HGTH 2QF3A 1W2KH 1AHTH 1DT2A 4ISHH 1AB9B 3BEUA 3GYLB 3VFEA 5DP6A 2ZDKA 4OS5A 2F9NA 1O2MA 4AFZA 1CA8B 4X8SH 1A1RA 3T27A 1O2YA 4R8TB 2SGAA 1GBBA 3SJ9A 2R0LA 3ZV9A 3D23A 4XBBA 1O2HA 2CGAA 2FTMA 4MNYA 3OX7U 5E2PA 3WY8A 1YCPM 3H7OA 3LGIA 1O36A 4Y11E 4CRFA 4THNH 1H8IH 1XUGA 2A32A 3A81A 3LC5A 3RU4E 4NG9H 1EP6A 2GZ9A 1GHAF 2PKSB 3LC3A 1C2GA 1ZLRA 3SI3H 2XTTB 3KF2A 5T6DA 1O2UA 3RXUA 1XX9A 1V2JT 1TPOA 1GVZA 3VB6A 3LIWA 2R3YA 2A1DB 3K9XB 2ZGJA 5A0AE 3PMAB 4JYUH 1O0DH 1EPTC 1YCPK 3T26A 1MUEB 3MYWA 4KKDA 5HM2A 4BAMB 1O2PA 3ATIA 1ACBE 4FUIA 1C5TA 2O9QA 2Q6GA 1BUIA 5DP7A 1BJVA 4A6LA 1Y59T 4O3UA 5GCHG 4ASHA 1YPJH 4BNRA 1XM1A 7GCHG 1K1IA 1QB1A 5DO4H 5J4QA 1GBTA 1HAIH 1E34B 4WY3A 3MHWU 3ODFA 2FP7B 4FUEA 4GCHF 1TONA 1P3CA 5JPMH 3H5CB 3HPTB 1LVBA 1MBQA 2HOBA 4ISOA 3M36A 3P8FA 2QXIA 4B75A 4I8LA 5DK1A 2AFQB 2EC9H 1C5XB 1A0JA 3A8BA 3SBKA 5I25A 1HBTH 2RG3A 1CE5A 1N8OC 1A46H 2Y6TA 5FAHA 1Z8GA 2BY5X 4WMDA 2C8XB 1IOEA 4IMZA 2FYQA 2VWOA 4GHTA 3V3MA 1WQVH 3UWIA 2FODA 3E1XB 2FIRH 1C4V2 1XUJA 1OWEA 3RU4T 3BN9A 2JETC 3MU0A 1GBFA 2VIDA 1C5SA 1FY8E 4TPIZ 2VWNA 1VJAU 1L2EA 4BXWA 2F91A 1U6QA 3MI4A 4FXGH 1WV7H 5EXNA 3AASA 4GVUA 5T6GA 2GDEH 3LKWA 1SBWA 4ZXYH 1DY8A 2WPJS 3PO1C 4M7GA 2ZU3A 3PROA 2BD3A 1JMOH 1TBZH 1IQJA 4TPYA 2UUYA 2CF8H 1W12U 4XDEA 5JBBS 2J4IA 2VGCC 1LQDB 4ABJA 1H9LB 1Z1IA 3BSQA 1EAWA 2CF9H 5B6OA 2ZGXH 3KCGH 1QJ1B 2GT7A 4NIVA 1HCGA 4BTUB 1E38B 3RDZA 5GCHF 1P8VC 5JBTA 5FX6A 4CHAB 2ZEBA 3NXPA 1N1LA 3EE0B 4B2CA 1UVPA 2Z6BD 1LPGB 1GHBG 2XNIA 3G01A 1OS8A 1MZDA 1UTLM 2W3IA 3F6UH 3TJOA 1ANEA 1G37A 1ELDE 3F1SB 1JOUB 1O2QA 5C67A 1N6YA 3QX5H 1DPOA 1C5MD 1LHGH 5BRRE 3RXPA 4DIIH 1DICA 1O2IA 1P02A 3ELAH 4Y10E 3LPRA 1XUFA 1SLWB 1C1OA 1CA0B 3SNAA 2J94A 1WU1A 1C2LA 3O8DA 1HV7A 2EI6A 3I29A 4B2BA 3A80A 4F49A 3L6PA 1SL3A 1OWDA 1TQ7B 2VNTA 3C1KA 1C2FA 2VIWA 4Z0KA 4Z6AH 1GGDC 1O3OA 2RA3A 1ELFA 1ETSH 4ABGA 3MU1A 2BY7X 3SJKA 1TX7A 1SGYE 2BM2A 4J2YB 1GMDF 2OINA 4XE4A 3VB3A 1MKXH 2AMPA 2HLCA 3F9HA 5CE1A 1P12E 1E36B 4CBNA 1AD8H 1RRKA 1DSTA 2XC5A 6GCHF 5FBIA 1BMNH 1TX8A 4DJZB 3S0NA 4U01A 2C3SA 2RA0A 3MU5A 2G00A 1RFNA 1Q31A 2ZU1A 1DXWA 3A7VA 3P95A 2QXJA 3MO3A 1SR5C 3JZ2B 1SHHB 1TPSA 4AGJA 3UIRA 1AO5A 3U1JB 1GVKB 3ENSB 3QK1A 3ZV8A 3M37A 3PV4A 3BTTE 1ANDA 5DKMA 4B74A 2CXVA 3U69H 2D8WA 1BRUP 1TMTH 4Q7YA 2BD9A 1XVOA 4LXBH 1EATA 1JWTA 4K1SA 5EODA 1HAPH 7GCHF 3SQEE 2V0BA 5EG4A 1C5ZB 1BTWA 2BD8A 4JMYA 1SFIA 1QJ6B 2ZNKH 1HXFH 2IJOB 1ELCA 3T5FH 4DOQA 4KTCA 2F9UA 1GHZA 1NRSH 5F6MA 4KP0A 3ZVFA 2XCNA 1AUJA 4JZDH 5C2ZA 1G3DA 1SGNE 1NS3A 4KGAA 4I8KA 3RXIA 2B7DH 1KLTA 5CHAB 6GCHG 1FIZA 2SFAA 3FVFB 3RM2H 1C5PA 1UTJA 1GI5A 3KHVA 3BTDE 1AI8H 3URDA 5FPTA 4Y76A 1UCYK 3RC6A 3GCOA 3RXDA 1C9PA 2PUQH 1TMBH 2ZU4A 3UOPA 1VGCB 3W95A 4H6TA 1FXYA 2VH6A 1C1MA 1ZTKA 2UUKB 1MZAA 1BDAA 4F4OC 3M3VA 3SUDA 3ZZ9A 4CHAC 3E6PH 1XXDA 4X6MA 2GCTB 1G30B 1O2GH 3S9AA 1EZQA 3M7TA 2FPZA 2VB0A 2EI7A 3SUGA 1P3EA 1LTOA 1V6DA 2ZFPH 3IITA 2PTNA 1AZ8A 4UD9H 2GP9B 3F9FA 3PM3A 1BITA 1UJ1A 1TOMH 3R3GB 2OD3B 2H1UA 1K22H 1XKAC 1S85A 2FM2A 2OTVA 1TLDA 1NESE 1IQFA 3UR6A 3D65E 3MFJA 4GLYA 2BQ7B 3QTOH 1SVPA 3UUZA 1W11U 4E06H 1C5QA 1J16A 1P2QA 3A7XA 1OWHA 1AUTC 2V3OH 4BTIB 5IYTA 1S82A 1O3FA 4NA7A 1BTUA 1BHXF 1C2KA 4YT6H 1QRXA 3U1IB 1TA2A 1V2KT 1NFUA 1O2NA 1V2TT 1OWKA 7LPRA 3SU1A 5DG6A 1B0FA 1O2XA 3UR9A 2Z3CA 1D9IA 3KGPA 1K21H 4NIYA 1O2JA 2JETB 3PTBA 1HB0B 3VB7A 1C5NH 1CA0C 1NROH 1EAUA 4O97A 1Z6EA 1FQ3A 2VIQA 2P3UB 3K65B 3P70B 3NZIA 4RSPA 3VPKA 3LH3A 1O2TA 1ZPBA 1PPCE 3PMBB 2AGEX 1MTVA 1UTKA 4MNWA 2NU1E 2H9TH 1HJAB 2FWWA 1TX6A 2BY6X 4BAKB 5JB8S 1YPGH 3RXTA 3M35A 1EQ9A 2OUAA 3HATH 1VITH 1UTNA 4BTTB 1ZMJA 4OS2A 2XBXA 1J9CH 4WMEA 4WH8A 3VXEH 1PPFE 3S69A 1QL9A 3EA7A 3U8RH 3MNBA 3S9CA 1PQAA 3ZYDA 2ODYB 4INLA 1KXAA 4MPXA 2WV4A 2BD5A 5C20A 2QC2A 1GMDG 2I6QA 1KY9A 4CR9A 3ZVEA 1C1VH 1TPAE 1KDQA 3TITA 3W94A 5IDKA 4IBLH 1B0EA 1ZMNA 3PO1B 4DIHH 1QA7A 3BTWE 3QUMP 3O8BA 2VJ1A 4Y79A 1DFPA 3DD2H 3TK5A 1UTQA 2P95A 4JZIA 2D1JA 1AFEH 1GI2A 2FMJA 1H9HE 1W3CA 5EQSA 1MCVA 1C4U2 1BBRE 3KQDA 3GY6A 1A4WH 1G2MA 1CHOG 1UTMA 3RXJA 2ESTE 4NSYA 3SU0A 3T62A 1FONA 3TNSA 2SGQE 1UO6A 2A31A 1A7SA 4AORA 4FUCA 2ZGHA 1PQ5A 2K1QA 1JRSA 4MVNA 7KMEH 2OCVB 1QCPA 3QN7A 1BTZA 2BDGA 5EXLA 1IQEA 1O3EA 1YCPH 4UFGH 1GJ8B 3ITIA 2C90B 3T25A 4X1RU 2DE9A 4QT8C 1A5HA 4NIWA 1AY6H 2F9OA 1W0ZU 1EB1H 1S81A 2F9VA 2PLXA 2H6MA 1IQNA 1O39A 3HK3B 4D9RA 2A45B 1GVLA 1O32A 3GCTF 5DP9A 1PJPA 1KXBA 4UFFH 1KSNA 3A82A 2GDDA 8GCHG 3M5OA 1BIOA 3RXEA 4U32A 3SV9A 3UNRA 1V2LT 4A1VA 1MTWA 2QY0B 2FOFA 2A5AA 5EPNA 1O5GH 1JIRA 1ZTJA 3SJIA 4INHA 5L2ZH 3QGNB 1O30A 1VZQH 1OYQA 3SJOA 3U98H 1O3MA 1MTUA 3A7WA 4YT7H 1GBDA 1GBJA 3BEIB 4Y7BA 3NPSA 2FXRA 3UY9A 8KME2 1F0RA 1NM6A 5F8TA 2O8LA 1HAGE 1C1UH 3TVJB 4GCHG 3C27B 4X2YA 2YNAA 1SGEE 1FY1A 3AW0A 4CRBA 1TRMA 3SNDA 1T8OA 1FJSA 1DUEA 3RXAA 8GCHF 2QIQA 7ESTE 1GMCF 1SGFA 4AX9H 3ODDA 4GSOA 5E2OA 3SHCH 3RXHA 1C1PA 5G4BA 3IG6B 3MO6A 4ZMAH 1P01A 3MTYA 3MNXA 4K1EA 1D4PB 1O2VA 1VCWA 2BD4A 2O8MA 3E3TA 1WQSA 3SUFA 3FZDA 2C8YB 2CMYA 1SB1H 1OSSA 2WYJA 1FAKH 1LO6A 4YOJA 1EXFA 2HPQH 4MG3A 3ZVCA 4DCDA 1AE8H 3LGTA 1YF4A 1ESAA 4X1SU 1EAIA 1GHXH 1GBMA 2AMQA 3DA9B 3LGVA 4MLFB 3TPIZ 1ID5H 1GI8B 1FUJA 2BX4A 3TNTA 3UPEA 5GDSH 1G9IE 1TBQH 4Y0ZE 3V12A 2W7UA 3U8TH 3M5LA 1EJAA 1C5LH 2GZ7A 1GI6A 1KXFA 1V2OT 5ABWA 1GG6B 3VXFH 1CO7E 1B5GH 2QV1A 2NWNA 3HKJB 2XBYA 2ZDMA 3M5NA 1W7XH 5CHAC 3RXFA 2AEIH 1HNEE 1T31A 1SGIB 1Y3WA 4WXIA 2GV6A 2OC8A 1ANCA 5C1YA 3GISB 3LGUA 1F92A 2HALA 1K1PA 2W7SA 4OGYA 1A5GH 1K1OA 1TGCA 3NWUA 1EZXC 2ZO3H 3NKKA 2FI3E 4DW2U 1A0LA 3P92A 1O3JA 1MD8A 3TK9A 2Y5HA 4TY6A 4ABFA 1ZGVA 1C1SA 2Y80A 1P05A 4MQAA 1C5RA 3RC4A 1F5LA 1MQ6A 1KLJH 1GJ7B 1TOCB 1DVAH 4Y8XA 1Z8RA 2BLOA 3EDXB 1UHBA 1O3PB 1P06A 2A2QH 1MMJN 1PYTC 1QQUA 2PHBA 1C1RA 4HFPB 4CRAA 2BXTH 1UK2A 1C5WB 2O8TA 5ETXA 1NO9H 3E8LA 5LGOA 1P2JA 1WBGB 1Z7KA 2OC7A 3KQCA 3EA9A 3P6ZB 3SU6A 4JK5A 3TH4H 1BHXB 3LGYA 2ZIQH 3KNXA 6LPRA 5H4IB 2M5TA 1ZJKA 1VR1H 4H6SB 4X2VA 1LVMA 3GY5A 4CRDA 3P8OA 1EAXA 1G36A 3SNCA 2ZKSA 2HPPH 2NU3E 1GL1A 1SGDE 2GZ8A 1YLCA 2J34A 4JZFH 1SSXA 1O3CA 1MKWK 2Z9JA 2ANWA 1IHSH 3O8RA 1O38A 2G4TA 3GDSA 4X8TH 1FNIA 1F0UA 1K1JA 1LQEA 4ZKSU 2BDYA 1QURH 4XFQA 4NWLA 1YPHC 3RXMA 1MTNC 4MPUA 1HJAC 1Z6JH 4IGDA 1GJ9B 2V6NA 4MNVA 4YO9A 4NA9H 1XKBC 3SOSA 1BT7A 3L33A 4MPVA 4CR5A 3QDZB 2XBVA 1O35A 1DM4B 3RMNH 1LCYA 3UREA 3STJA 1L0ZA 1MTNB 4H4FA 1L4DA 2FOEA 2OBQA 4ZHMU 1BJUA 1ZTLA 4ZROA 5E0JA 1NFYA 3CS7A 4A7IB 3RLWH 1OX1A 3PMHB 3S9BA 1LHCH 2J38A 4FUHA 5JB9S 1FLEE 3TGJE 1MD7A 2GV7A 1DWEH 1SQAA 2GCTC 3TJVA 1W14U 1FDPA 1Y3XA 5T3HA 4NWKA 4WMFA 2XW9A 1A0HB 1DLEA 3SGQE 4E7NA 1NFWA 2A4RA 1N8OB 4A5TS 1P2OA 4ZXXH 1KDQB 1J15A 4VGCC 4CBOA 2GTBA 2FLRH 4IN2A 3MOCA 1O3DA 3OY5U 1D6WA 2J9NA 2AERH 4U30A 2HVXA
chains in the Genus database with same CATH superfamily
1GBHA 2BDAA 4A1XA 1T7CA 2ZHFH 2F3CE 1O3HA 1K2I1 3ZVDA 2QGRA 1RIWC 1C2MA 1TGBA 4I7YH 4Q7ZA 3AW1A 1WSSH 3OTJE 1TRYA 2FZZA 2AGGX 3ZZ6A 1MCTA 2J95A 2GVFA 4MTBA 2SNWA 2ZTYA 1O3BA 4JYVH 1T8LA 1AE5A 1HAOH 1DX5M 5HYOA 5A8ZA 2BXUH 2P8OC 3A88A 2BOHB 2Z9LA 1O31A 4ISIH 4AZ2B 2CK3D 5SGAE 2AS9A 1TNHA 1SI5H 3T28A 2TGTA 4BAQB 2FX6A 3GS9A 4K60A 4K3JA 1SOZA 2TIOA 2WUBA 2ZFRH 1A61H 1SLUB 1Z8JB 2QF0A 2SNVA 3GCNA 2J98A 3LJOA 1QA0A 1E37B 4YLUA 3SYJA 2BQ6B 2ZCKP 1V3XA 1C5YB 1DWCH 1BMFD 3PWCA 4YLQH 5CMXH 4BANB 2P59A 1BRCE 1EFRD 1LMWB 4YESB 1AB9C 1FZZA 5EPYA 2V7QD 2A7HA 1VCQA 1P04A 3F2FA 2FOAA 3RXLA 4BXSA 2WINI 1TYNA 2ZHEH 1AIXH 1D3TB 2O8WA 1EJNA 1KXCA 5EQQA 3Q3KA 1ESTA 1OYTH 1YPHE 1O3NA 2A4OA 3A85A 5HXFA 2BDIA 1NBMD 3H7TA 1Y5UT 2ZGCA 4P00A 1KXEA 1DWBH 2FOMB 2BYAX 1QIXB 2KM0A 5A8YA 1ZRKA 4RKJB 3Q00A 3I78A 1TNGA 2G5VA 1KLIH 2ODQA 4LZ4B 2F83A 3ZZ8A 2A7JA 4K1TA 1P57B 3SZEA 1UVSH 2C8ZB 5DN6D 1P2NA 1CT4E 1GI0A 1O2ZA 2VVVA 2ZPSA 1YPKH 2NU4E 1EKBB 4FVBA 2A5IA 1LPZB 3KQBA 3LH1A 1V2MT 2KR7A 4FUBA 5C5NA 2G81E 2C8WB 1GBAA 2A0QB 2XBWA 4E05H 2V3MA 5E8EH 3SHAH 3F2HA 1ZHPA 2VINA 3SQHE 2ZQ1A 3ZZ5A 1MH0A 4UDWH 5EJ1A 4DURA 2GCHG 2VIVA 1IQIA 2Z9GA 4CH8B 1ELTA 1UVOA 2CN0H 3SV2H 1QFKH 5C1UA 2Z94A 1GGDB 1EZUC 1C4Y2 3OE7D 2PR3A 1TALA 4ZAEA 1T4VH 2GGVB 5AFZH 2Z3DA 3QTVH 4TSFD 2H9EH 4FU9A 2WYGA 2XXLA 3DSOA 3SGAE 3V13A 2G55A 3GY2A 3OU0A 1O2LA 5C5OA 1RTKA 1S0RA 3LGWA 1C1TA 1D3QB 2ZGBH 2RFKC 1WTGH 1DSUA 1UTPA 2G8TA 2VGCB 4LOYH 1CGHA 2VU8E 4SGBE 2BZAA 2YNBA 4E7RG 4ABDA 1VITF 1EZSC 4Y0YE 5CHBA 5K7RA 4TYDA 1L1NA 1N6XA 3SZNA 2Y81A 4AOQA 4AFQA 1YKTA 3CP7A 2A4QA 3MH5A 3FZZA 4AGKA 1GHBF 2ZTZA 3QZQA 1AWFH 4NFEA 3PV5A 1M9UA 2RDLA 4UEHH 1W0JD 2V3HH 2EQNA 2HNTC 2ZA5A 4XBDA 5DP5A 2QA9E 1WXRA 2WHXA 1NFXA 3UQOA 3SNBA 2BD7A 1THPB 2D26C 1AKSB 1HGTH 1FPCH 5EIYA 3ZZ4A 1GMHF 3DSGA 3URCA 2JJ1D 4ASUD 1F0TA 1IQLA 1AKSA 3BTKE 1ELAA 4I33A 1GBIA 1ZJDA 1DE7H 1TGSZ 1ZMLA 1Y5AT 4FUGA 1QGFA 3GY7A 2BVRH 2C93B 1ELGA 1K1MA 1BMMH 1O5AB 1ZPCA 1PQ7A 2GD4B 2TBSA 1E0FD 1P11E 1BTYA 5EQRA 5GNDA 4OM9A 4B2AA 1ZSLA 5C17A 5E0GA 3MNCA 4D7FA 6CHAB 4KTUA 3ZZCA 1Z8IB 5LPRA 2STBE 3RXCA 4X6PA 3GY8A 1EX3A 5F8ZA 2UWLA 4ZHAA 2ZCHP 1GG6C 4Y7AA 2FO9A 3FAOA 5C0UA 3UTUH 1DWDH 3SU5A 5C3NA 2DE8A 1T32A 1ELEE 1BZXE 1TA6A 2PSYA 2Y5GA 3GDUA 4ISLA 4ABEA 2W6ID 3OSYA 4GUXA 3AAUA 5A0CA 2H2ZA 2PW8H 2SGPE 2ALPA 3P8GA 4AG1A 6ESTA 3A84A 1NT1A 2G51A 3DFLA 1EP5A 1CHGA 4KELA 1WOFA 1W10U 5FPYA 1YPEH 1OWJA 3DFJA 1V2UT 3ATWA 3EE7A 4HI3A 3EGKH 2ZFSA 3WWFA 2F9PA 5FCKA 1S0QA 5JBAS 1SC8U 2LNCA 3V0XA 2I6SA 3UNQA 1C2IA 1PYTD 3I77A 3TLOA 1TBRH 1GDQA 1Z71A 2H9HA 3PTNA 4O3TA 1GBEA 1OP2A 1T4UH 3SW2B 2VWMA 1PFXC 2Q6DA 1ARBA 1RGQA 1F5RA 1GI3A 1BRBE 4FUDA 1GHYH 2ZZUH 1GJ4H 1THSH 1K28D 1VGCC 1ZHMA 3PLPA 1IHTH 1SKYE 3A7TA 1NU7B 1GJAB 1YYY1 3UOUA 2EI8A 2Y7XA 3OEHD 1XMNB 2ULLA 4XOJA 4TY7A 1S83A 1HAZB 3UFAA 4YM9A 1SQOA 2Y82A 1HIAB 1Y5BT 1D6RA 3ZZ7A 5AF9H 3TH2H 3ZZAA 1YP9A 3BTQE 3QWCH 1SG8B 3GY3A 5LPFA 1ZHRA 1QBNA 1YLDA 3K6YA 4X0WU 1OP0A 4GAWA 1C1QA 5TCAA 2P16A 1O5CB 3RUOA 2TGDA 4I86A 1AQ7A 3A7ZA 3QGJA 4MDSA 3S7HB 3E16B 4K8BA 2JKHA 4IC5A 1C1NA 5B6LA 5EW1H 1HLTH 4B73A 2PSXA 3RMMH 1EPTA 3MO9A 1V2RT 2Y5FA 2ZFTA 1IQKA 4K2YA 1HAYB 1G3EA 3OY6U 5HKKD 2Y7ZA 4HGCA 2BHGA 2WV9A 3DT0H 1QRWA 4BAHB 2H5DA 3TK6A 1WAYB 1PPHE 1GDUA 1ORFA 2BVSH 4IC6A 1H8DH 2ANMH 3PB1E 5DJ7A 1OHHD 1T8MA 1TPPA 1SPJA 1QNJA 3NK8A 2K0QA 1TWXB 1RIWB 5DGJA 1MKXK 3GY4A 3BTME 4OS6A 5GXPA 4I8GA 1O5FH 1D3PB 2AGIX 3FP8E 1GHWH 1ZSJA 1BOQA 2ZECA 1D3DB 4MNXA 3UNSA 3FKSD 3SV6A 4YTAA 1E79D 1K1NA 1GHVH 2ODPA 4WJG2 1GJ5H 2J2UA 2GT8A 1ZZZA 2WPIS 3E0PB 1GPZA 3B23B 3U28C 4ABBA 1XUKA 2G52A 1W0YH 2TPIZ 1VITG 5FPSA 2YOLA 3ZVAA 2PWXA 1V2QT 1BQYA 3LDXH 3FO8D 4HTCH 2SGEE 1ZPZA 2FESH 5GPIB 4AG2A 1TFXA 3H09A 3NCLA 3Q76A 3GOVB 3MH6A 2KCAA 2ZDLA 2GMTC 3BG4B 5EGMA 1SQRA 2EA3A 8ESTE 1OP8A 2W3KA 1KIGH 1C9TA 2JH5D 4AN7A 1WUNH 3RMOH 5GWZA 4NCYA 5LPEA 1ZRBA 2FEQH 3UWJH 5DPAA 5LH8A 1O2KA 2CHAC 1TB6H 1OPHB 5EXMA 3ZVBA 1GI1A 4VGCB 2L74A 3EA8A 1HJ8A 9LPRA 5GIBA 1PPEE 2NU2E 2A2XH 3A8CA 1H8ED 3QO6A 2ZPQA 3BTEE 4UE7H 4WF8A 1F0SA 5DP8A 1GJ6A 3CNRA 2BDBA 5HGGA 1HUTH 2BLVA 3BV9B 2VVUA 2OXSA 1PPGE 1HYLA 3GCTG 1MU8B 3PLBA 1MTSA 2XC4A 3V7TA 3DHKH 4I8JA 2P94A 3E91A 4NGAH 1ABJH 3U9AH 2ZHWH 4Q2KA 1SLVB 1XXFA 2ZP0H 2OC1A 1FI8A 4YOIA 1NC6A 1NTPA 1V2NT 3RXOA 4HZHA 2BMGB 4UFDH 3CS0A 1BMAA 1P03A 1WCZA 3PWBA 3MWIU 1TIOA 2PFEA 2ZI2H 4RN6A 1NU9A 4PROA 1QHRB 1DS2E 2EY4C 2ZF0H 1RD3B 5F53A 2LPRA 2GKVE 4Z1MD 4OS7A 1FV9A 3M3SA 3KEEA 1AVXA 1NN6A 1MQ5A 1CT0E 1MAXA 2JJ2D 2BLWA 1NRPH 2TGPZ 1G2LA 3LU9B 4TWWA 1GI9B 1GMHG 3QLPH 4Q80A 4ZUHA 3ATLA 1OWIA 2ZU5A 5E0HA 1BA8B 6CHAC 3A87A 4DT7B 1SGQE 3RMLH 2STAE 3ATKA 1GWAA 1YWUA 2B5TB 1TAWA 2H5CA 4B6EA 1JXPA 1NZQH 1NRNH 2UWPA 1SQTA 3SORA 4ABIA 2J98B 1P09A 3FP6E 5FHTA 2FDAA 2FOGA 2FS9A 5GJ4B 1UCYE 5HMAA 4NSVA 1AZZA 5BPEA 1C2HA 3OYPA 4ISNA 1HXEH 1DOJA 1FY5A 1DY9A 3UQVA 3A86A 1BTXA 3Q3YA 5CDFE 2JH0D 5FBEA 4A1TA 4GPGA 5DP3A 4ZH8A 1EOJA 3ESTA 1MBMA 1PQ8A 4FETA 5A0BA 1LPKB 1CBWC 1O33A 1L1JA 3ZZ3A 1V2VT 1JIMA 2BZ6H 2W26A 3T2NA 1TE0A 4UONA 1NPMA 2P3FH 4X6OA 3EAJA 2ZG0H 1O3LA 1QTFA 2DUCA 4IN1A 1QL8A 3HGPA 2FX4A 3GYMA 3EYDA 2WPKS 1G3BA 1YM0A 3SO3A 1LVYA 1GCDA 1C1WH 2A5KA 2W5EA 1FN6A 2Q1JA 1CBWB 2RDEA 2A4GA 4IMQA 2R9PA 1ZSKA 2B0FA 2UUFB 3RP2A 4AFSA 1QJ7B 2QF5A 3M3TA 1EPTB 4NFFA 2Z7FE 3AAVA 2Z9KA 2IOTA 1ABIH 4Q7XA 1QQ4A 2ZCLP 4Y6DA 2AIQA 3BIUH 3F9GA 1QB6A 2VVCA 3B9FH 3D62A 4D7GA 1TGTA 1QRZA 4CRCA 1SGFG 3F9EA 2FI5E 3BG8A 1S84A 2AH4X 1VCPA 2BY9X 1GCTC 2PGQB 2B9LA 1GI4A 1P9UA 2G4UA 1SFQB 1ARCA 1ESBA 2FI4E 3CENA 1GBKA 1HAHH 1V2PT 2OBOA 2ZU2A 3GDVA 1O3AA 1FN8A 2M2AA 4JK6A 5T6FA 1KTTB 1YLNA 1H4WA 4H42U 4FVDA 5DP4A 1ZGIA 3SV7A 1PPBH 2R0KA 1OKXA 1S6HA 3VEQB 3M7QA 3Q3XA 1O2RA 3RXQA 3BEFB 2XC0A 2YMSD 4FU8A 1HPGA 1J17T 4K8YA 4JCNA 3STIA 2FOBA 1OXGA 3EQ0H 1C5VA 3RU4D 2SGDE 1CSOE 2UUJB 4X1NU 3F3BA 2V35A 1CGIE 1Q3XA 3A83A 2WUCA 1QBOA 4IS5A 2ILNA 5EOKA 1F5KU 2PTCE 3IWMA 3RXRA 4NIXA 3MMGA 4U2WA 2A7CA 1AGJA 1ZR0A 4D76A 1A5IA 5TCCA 3PLKA 1BBRH 4OS1A 3TJUA 1T8NA 4ZHLU 5FXLA 1RTLA 2ZFFH 2BTCE 1X7AC 1TRNA 5TJXA 1HAVB 2HNTF 5KGOA 4YOGA 2VIPA 1AVWA 1TNIA 1JBUH 1BTPA 1CGJE 2THFB 4DG4A 3HGNA 1IQGA 1HAVA 5L30H 2BB4A 1O34A 1ETRH 1EUFA 3N99A 1H8HD 3K2UA 3TGIE 4GHQA 2GX4A 1BBRK 1O5DH 1FMGA 4YZUA 1XVMA 5A2MH 1CQQA 1HIAA 2PKSC 4M9FA 1Y3YA 2IN2A 1A2CH 1DITH 1GCTB 4D8NA 2WPHS 3SU4A 2FOCA 3KIDU 2AHME 4XSKU 1O5EH 1C2EA 2QCYA 2YMSC 4INKA 1AVGH 3PMJA 1EB2A 3GCHC 3RXKA 1O3KA 4Y8YA 1RJXB 1SGRE 3HK6B 1GMCG 1G32B 1C5UA 1O2SA 3GCHB 1MKWH 4RT0A 2AMDA 4ZKOU 3O8CA 5KECA 2OQUA 1S6FA 2OC0A 2EEKA 5I46H 4TWYA 1LHDH 3TIUA 1O2OA 1HAXB 2ZQ2A 1PPZA 3WWBA 3GICB 3KN2A 3RXVA 4A92A 2UWOA 2ASUB 2BLQA 3M5MA 2LELA 2ZWLH 4I32A 1W8BH 1UMAH 1THRH 1UK4A 3F68H 1UHBB 2ZHQH 3BTHE 4X1PU 1QBVH 2TRMA 3PRBA 2FYRA 5JYIA 3SN8A 1O37A 3N7OA 2BY8X 4CRGA 4NA8A 5L2YH 2HVYB 1V2WT 2BQWB 1O3GA 2BVXH 1AFQC 1CU1A 3W1EA 1Q2WA 1UCYH 4SGAE 5K0HA 3BIVH 1EASA 3NRLA 4X8VH 1YC0A 3MH4A 1H1BA 3FP7E 1WYKA 1A3EH 1FAXA 1JRTA 1W13U 2QF4A 2ZFQH 5F03A 2GCHF 2CV3A 1J14A 1DLKB 1QY6A 1GHAG 3RXGA 1H9IE 2PUXB 1GJBB 4FUJA 1F7ZA 1VJ9U 1GJCB 1V2ST 1DUAA 2VWLA 2XWBI 1BTHH 4O03A 3TU7H 1P2KA 4K5ZA 3UAIC 2KAIB 8LPRA 3RLYH 4ZKNU 4B1TA 4WH6A 2R2MB 4K69A 4UFEH 5A09A 2ZTXA 4JZEH 4Q4LA 1IQHA 2P93A 3U8OH 5EW2H 5IK2D 2BX3A 1K1LA 1RXPA 1UVTH 2TGAA 3LONA 3T29A 1INCA 2W6JD 5A8XA 1AN1E 4KTSA 2P8OB 2PV9B 4AB8A 1GBLA 3LJJA 1L1GA 2G5NA 2XRCA 2PKAA 1UW7A 2KAIA 2GMTB 1NY22 3K6ZA 1NRRH 4J1YA 2XWAA 3RXBA 4FUFA 3SUEA 1CVWH 1QL7A 3P8NA 1EJMA 1IQMA 4WVPE 3PYHA 4R0IA 1SGPE 4AFUA 4X2WA 3RC5A 1Y3VA 2QXGA 1A3BH 1BB0B 1J8AA 4RKOB 1FY3A 1P9SA 1HDTH 1GJDB 4I31A 1ETTH 3WW7A 3P17H 1XUHA 2IPHA 4NZLA 1FPHH 3ZZDA 1UVUH 3BTFE 4AB9A 4WWYA 1LDTT 3SU3A 2B8OH 3E90B 2WPMS 4Y8ZA 5FX5A 5L6NH 1ELBA 2OQ5A 2QXHA 3BG4C 3BTGE 4BOHA 2ZPRA 2PKAB 5ESBA 1BMLA 1KXDA 1TNKA 3RM0H 4ABHA 1LVOA 3E0NB 1UTOA 3B8JA 3BF6H 4XBCA 1ZOMA 1DANH 3JZ1B 4ESTE 2CHAB 3SGBE 1DDJA 3ZYEA 3SJ8A 4I8HA 1P2IA 2VBCA 1TNJA 3MU4A 1LHFH 1ANBA 1MU6B 1P10A 1GDNA 1TABE 5EU8A 1KTSB 2QN5T 1MAYA 1XUIA 3M7UA 3SNEA 2VH0A 1SOTA 1TMUH 9ESTA 4AYVB 5JBCS 3A8AA 1G3CA 2F9BH 5FCRA 4LK4A 4X1QU 3DUXH 1HRTH 2Q6FA 4CREA 3Q77A 2Z9IA 1YGCH 1AWHB 1F2SE 4DY7B 1TQ0B 3SV8A 4D9QA 1TNLA 4JYTA 3KQEA 1YPLH 1C2DA 2OP9A 3R0FA 2FTLE 4MPWA 2ANYA 4DVAU 2ANKH 3VB4A 1ZYOA 4X8UH 1KYNA 5J4SA 1QR3E 3A8DA 1BRAA 1HFDA 2QAAA 3MH7A 1IAUA 2RCEA 5AVDA 1RTFB 2HNTE 1RS0A 1SMFE 2CJIA 1AFQB 2JH6D 2QYIA 4Y71A 3L3TA 2ZDNA 4O9VA 2ZDAH 4OS4A 1SHYA 4NZQA 1NRQH 2ZC9H 1P2MA 4IW4E 1Z1JA 5PTPA 3NUMA 5ESTE 1UK3A 1CT2E 1S5SA 2Z3EA 4OGXA 3KL6A 1Y8TA 1ELVA 4CH2B 1O3IA 3OTPA 4B76A 2C4FH 4JZ1A 1GBCA 1K9OE 1TGNA 1Y3UA 2BD2A 3VGCC 2XYAA 2JDID 1OOKB 1FIWA 1WTHD 2FOHA 5AHGH 1AU8A 2FLBH 2BDCA 2O8UA 1YPMH 4X6NA 1EOLA 2WV5A 3SU2A 1C2JA 3PRDA 3HKIB 2ALVA 2SGFE 3TGKE 1BCUH 3D49H 3ZZBA 1O5BB 5JDUB 3ATMA 3TJNA 1FY4A 3VB5A 4LZ1H 1E35B 1B7XB 4FU7A 2VIOA 3QZRA 4WXVA 2P3TB 3VGCB 1W7GH 3MNSA 3LT3A 4X2XA 1GI7B 1DXPA 1QB9A 1HJ9A 1GL0E 2HWLB 2AYWA 3MU8A 4ZKRU 1LKBA 3ZVGA 3FOAA 1LHEH 4AYYB 5C1XA 3RXSA 5HIYA 2BDHA 2WPLS 4B71A 2FS8A 1AMHA 2D2DA 5HM9A 5F8XA 3SI4H 2R3UA 3MQKC 2HRVA 4ABAA 3A7YA 1LKAA 1SLXB 3FFGA 4B6FA 3AVZA 3M61U 2ZDVH 2J92A 2XCFA 1L4ZA 1P0SH 2J5UA 2OLGA 1O2WA 2AIPA 4BAOB 5AFYH 3TH3H 1SGCA 1SGTA 2ZHDA 2BOKA 3LOXA 1YBWA 1CHOF 3FANA 3A89A 2PGBB 3S7KB 1C5OH 4DGJA 2NU0E 2R2WU 2HGTH 2QF3A 1W2KH 1AHTH 1DT2A 3N7EA 4ISHH 1AB9B 3BEUA 1MABB 3GYLB 3VFEA 5DP6A 2ZDKA 4OS5A 2F9NA 1O2MA 4AFZA 1CA8B 4X8SH 2KCOA 1A1RA 3T27A 1O2YA 4R8TB 2SGAA 1GBBA 3SJ9A 2R0LA 3ZV9A 3D23A 4XBBA 1O2HA 2CGAA 5EJLA 2FTMA 4MNYA 3OX7U 5E2PA 3WY8A 1YCPM 3H7OA 3LGIA 1O36A 4Y11E 4CRFA 4THNH 1H8IH 1XUGA 2A32A 3A81A 3LC5A 3RU4E 4NG9H 1EP6A 2GZ9A 1GHAF 3VG8A 2PKSB 3LC3A 1C2GA 1ZLRA 3SI3H 2XTTB 3KF2A 2KZ4A 5T6DA 1O2UA 3RXUA 1XX9A 1V2JT 1TPOA 1GVZA 3VB6A 3LIWA 2R3YA 2A1DB 3K9XB 2ZGJA 5A0AE 3PMAB 2QE7D 4JYUH 1O0DH 1EPTC 1YCPK 3T26A 1MUEB 3MYWA 4KKDA 5HM2A 4BAMB 1O2PA 3ATIA 1ACBE 4XRNA 4FUIA 1C5TA 2O9QA 2Q6GA 1BUIA 5DP7A 1BJVA 1K0HA 4A6LA 1Y59T 4O3UA 3DSPA 5GCHG 4ASHA 1YPJH 4BNRA 1XM1A 7GCHG 1K1IA 1QB1A 5DO4H 5J4QA 1GBTA 1HAIH 1E34B 4WY3A 3MHWU 3ODFA 2FP7B 1WDIA 4FUEA 4GCHF 1TONA 1P3CA 5JPMH 3H5CB 3HPTB 1LVBA 1MBQA 2HOBA 4ISOA 3M36A 3FN8A 3P8FA 2QXIA 4B75A 4FOUC 4I8LA 5DK1A 2AFQB 2EC9H 1C5XB 1A0JA 3A8BA 3SBKA 5I25A 1HBTH 2RG3A 1CE5A 1N8OC 1A46H 2Y6TA 5FAHA 1Z8GA 2BY5X 3F0OA 4WMDA 2C8XB 1IOEA 4IMZA 2FYQA 2VWOA 4GHTA 3V3MA 1WQVH 2YMSB 4ACAA 3UWIA 2FODA 3E1XB 2FIRH 1C4V2 2F43B 1XUJA 1OWEA 1YY3A 3RU4T 3BN9A 2JETC 3MU0A 1GBFA 2VIDA 1C5SA 1FY8E 4TPIZ 2VWNA 1VJAU 1L2EA 4BXWA 2F91A 1U6QA 3MI4A 4FXGH 1WV7H 5EXNA 3AASA 4GVUA 3DCLA 5T6GA 2GDEH 3LKWA 1SBWA 4ZXYH 1DY8A 2WPJS 3PO1C 4M7GA 2ZU3A 3PROA 2BD3A 2K8IA 1JMOH 1TBZH 1IQJA 4TPYA 2UUYA 2CF8H 1W12U 4XDEA 5JBBS 2J4IA 2VGCC 1LQDB 4ABJA 1H9LB 1Z1IA 3BSQA 1EAWA 2CF9H 5B6OA 2ZGXH 3KCGH 1QJ1B 2GT7A 4NIVA 1HCGA 4BTUB 1E38B 3RDZA 5GCHF 1P8VC 5JBTA 5FX6A 4CHAB 2ZEBA 3NXPA 1N1LA 3EE0B 4B2CA 1UVPA 2Z6BD 1LPGB 5KEDA 1GHBG 2XNIA 3G01A 1OS8A 1MZDA 1UTLM 2W3IA 3F6UH 3TJOA 1ANEA 1G37A 1ELDE 3F1SB 4HG6A 1JOUB 1O2QA 5C67A 1N6YA 3QX5H 5DSFA 1DPOA 1C5MD 1LHGH 5BRRE 3RXPA 4DIIH 1DICA 1O2IA 1P02A 3ELAH 4Y10E 3LPRA 1XUFA 1SLWB 1C1OA 1CA0B 2WSSD 3SNAA 2J94A 1WU1A 1C2LA 3O8DA 1HV7A 2EI6A 3I29A 4B2BA 3A80A 4F49A 3L6PA 1SL3A 1OWDA 1TQ7B 2VNTA 3C1KA 1C2FA 2VIWA 4Z0KA 3OEED 4Z6AH 1GGDC 1O3OA 2RA3A 4DT4A 1ELFA 1ETSH 4ABGA 3MU1A 3KYFA 2BY7X 3SJKA 1TX7A 1SGYE 2BM2A 4J2YB 1GMDF 2OINA 4XE4A 3VB3A 1MKXH 2AMPA 5C0TA 2HLCA 3F9HA 5CE1A 1P12E 1KMHB 1VKYA 4RT1A 1E36B 4CBNA 1AD8H 1RRKA 1DSTA 2XC5A 6GCHF 5FBIA 1BMNH 1TX8A 4DJZB 4TT3D 3S0NA 4U01A 2C3SA 2RA0A 3MU5A 2G00A 1RFNA 1Q31A 2ZU1A 1DXWA 3A7VA 3P95A 2QXJA 5HIZA 3MO3A 1SR5C 3JZ2B 1SHHB 1TPSA 4AGJA 3UIRA 4YXWD 1AO5A 3U1JB 2KCPA 1GVKB 3ENSB 3QK1A 3ZV8A 3M37A 3PV4A 3BTTE 1ANDA 3OAAD 5DKMA 2CXVA 4B74A 3U69H 2D8WA 1BRUP 1TMTH 4Q7YA 2BD9A 1XVOA 4LXBH 1EATA 1JWTA 4K1SA 5EODA 1HAPH 7GCHF 3SQEE 2V0BA 5EG4A 1C5ZB 1BTWA 2BD8A 4JMYA 1SFIA 1QJ6B 2ZNKH 3N7DA 1HXFH 2IJOB 1ELCA 3T5FH 4DOQA 2KX4A 4KTCA 2F9UA 1GHZA 1NRSH 5F6MA 3ZIAD 2IPQX 2J97A 4KP0A 3ZVFA 2XCNA 1AUJA 4JZDH 5C2ZA 1G3DA 1SGNE 1NS3A 4KGAA 4I8KA 3RXIA 2B7DH 1KLTA 5CHAB 6GCHG 1FIZA 2SFAA 3FVFB 3RM2H 1E1QD 1C5PA 1UTJA 1GI5A 3KHVA 3BTDE 1AI8H 3URDA 5FPTA 4Y76A 1UCYK 3RC6A 3GCOA 3RXDA 1C9PA 2PUQH 1TMBH 2ZU4A 3UOPA 1VGCB 3W95A 4H6TA 1FXYA 2VH6A 1C1MA 1ZTKA 2UUKB 1MZAA 1BDAA 4F4OC 3M3VA 3SUDA 3ZZ9A 4CHAC 3E6PH 1XXDA 4X6MA 2GCTB 1G30B 1O2GH 3S9AA 1EZQA 3M7TA 2FPZA 2VB0A 2EI7A 2XNDD 1P3EA 1LTOA 1V6DA 2ZFPH 3SUGA 3IITA 2PTNA 1AZ8A 2F4LA 4UD9H 2GP9B 3F9FA 3PM3A 1BITA 1UJ1A 1TOMH 3R3GB 2OD3B 2H1UA 1K22H 1XKAC 1S85A 2FM2A 2OTVA 1TLDA 1NESE 1IQFA 3UR6A 3D65E 3MFJA 4GLYA 2BQ7B 3QTOH 1SVPA 3UUZA 1W11U 4E06H 1C5QA 1J16A 1P2QA 3A7XA 1OWHA 1AUTC 2V3OH 4BTIB 5IYTA 1S82A 1O3FA 4NA7A 1BTUA 1BHXF 1C2KA 4ZCNA 4YT6H 1QRXA 3U1IB 1TA2A 1V2KT 1NFUA 1O2NA 1V2TT 1OWKA 7LPRA 3SU1A 1FX0B 5DG6A 1B0FA 1O2XA 1S6LA 2Z3CA 3UR9A 1D9IA 3KGPA 1K21H 4NIYA 1O2JA 2JETB 3PTBA 1HB0B 2PP6A 3VB7A 1C5NH 1CA0C 1NROH 1EAUA 4O97A 1Z6EA 1FQ3A 2VIQA 2P3UB 3K65B 3P70B 3NZIA 4RSPA 3VPKA 3LH3A 4ACBA 1O2TA 1ZPBA 1PPCE 3PMBB 2AGEX 1MTVA 1UTKA 4MNWA 2NU1E 2H9TH 1HJAB 2FWWA 1TX6A 2BY6X 4BAKB 5JB8S 1YPGH 3RXTA 3M35A 1EQ9A 2OUAA 3HATH 1VITH 1UTNA 4BTTB 1ZMJA 4OS2A 2XBXA 1J9CH 4WMEA 4WH8A 3VXEH 1PPFE 3S69A 1QL9A 3EA7A 3U8RH 3MNBA 3S9CA 1PQAA 3ZYDA 2ODYB 4INLA 1KXAA 4AC9A 4MPXA 2WV4A 2BD5A 5C20A 2QC2A 1GMDG 2I6QA 1KY9A 4CR9A 3ZVEA 1C1VH 1TPAE 4RI0A 1KDQA 3TITA 3W94A 5IDKA 4IBLH 1B0EA 1ZMNA 3PO1B 4DIHH 3KYGA 1QA7A 3BTWE 3QUMP 3O8BA 2VJ1A 4Y79A 1DFPA 3DD2H 3TK5A 1UTQA 2P95A 4JZIA 2D1JA 1AFEH 1GI2A 2FMJA 1H9HE 1W3CA 5EQSA 1MCVA 1C4U2 1BBRE 3KQDA 3GY6A 1A4WH 1G2MA 1CHOG 1UTMA 3RXJA 2ESTE 4NSYA 3SU0A 2XOKD 1FONA 3T62A 1NBME 3TNSA 2SGQE 1UO6A 2A31A 1A7SA 4AORA 4FUCA 2ZGHA 1PQ5A 2K1QA 1JRSA 4MVNA 5T1VA 7KMEH 2OCVB 1QCPA 3QN7A 1BTZA 1QZ8A 2BDGA 5EXLA 1IQEA 1O3EA 1YCPH 4UFGH 1GJ8B 3ITIA 2C90B 3T25A 4X1RU 2DE9A 4QT8C 1A5HA 4NIWA 1AY6H 2F9OA 1W0ZU 1EB1H 1S81A 2F9VA 2PLXA 2H6MA 1IQNA 4F55A 1O39A 3HK3B 4D9RA 2A45B 1GVLA 1O32A 3GCTF 5DP9A 1PJPA 1KXBA 4UFFH 1KSNA 3A82A 2GDDA 8GCHG 3M5OA 1BIOA 3RXEA 4U32A 3SV9A 3UNRA 1V2LT 4A1VA 1MTWA 2QY0B 2FOFA 2A5AA 5EPNA 1O5GH 1JIRA 1ZTJA 3SJIA 4INHA 2GJGA 5L2ZH 3QGNB 1O30A 1VZQH 1OYQA 3SJOA 3U98H 1O3MA 1MTUA 3A7WA 4YT7H 1GBDA 1GBJA 3BEIB 4Y7BA 3NPSA 2FXRA 3UY9A 8KME2 1F0RA 1NM6A 5F8TA 2O8LA 1HAGE 1C1UH 3TVJB 4GCHG 4XD7D 3C27B 4X2YA 2YNAA 1SGEE 1FY1A 3AW0A 4CRBA 1TRMA 3SNDA 1T8OA 1FJSA 1DUEA 3RXAA 8GCHF 2QIQA 7ESTE 1GMCF 1SGFA 4AX9H 3ODDA 4GSOA 5E2OA 3SHCH 3RXHA 1C1PA 5G4BA 3IG6B 3MO6A 4ZMAH 1P01A 3MTYA 3MNXA 4K1EA 4F48B 1D4PB 1O2VA 1VCWA 2BD4A 2O8MA 3E3TA 1WQSA 3SUFA 3FZDA 2C8YB 2CMYA 1SB1H 1OSSA 2WYJA 1FAKH 1LO6A 3KQ5A 4YOJA 1EXFA 2HPQH 4MG3A 3ZVCA 2OK5A 4DCDA 1AE8H 3LGTA 1YF4A 1ESAA 4X1SU 3AK5A 1EAIA 1GHXH 1GBMA 2AMQA 3DA9B 3LGVA 4MLFB 3TPIZ 1ID5H 2KFWA 4P02A 1GI8B 1FUJA 2BX4A 3TNTA 3UPEA 5GDSH 1G9IE 1TBQH 4Y0ZE 3V12A 2W7UA 3U8TH 3M5LA 1EJAA 1C5LH 2GZ7A 1GI6A 1KXFA 1V2OT 5ABWA 1GG6B 3VXFH 1CO7E 1B5GH 2QV1A 2NWNA 3HKJB 2XBYA 2ZDMA 3M5NA 1W7XH 5CHAC 3RXFA 2AEIH 1HNEE 1T31A 1SGIB 1Y3WA 4WXIA 2GV6A 2OC8A 1ANCA 5C1YA 3GISB 3LGUA 1F92A 2HALA 1K1PA 2W7SA 4OGYA 1A5GH 1K1OA 1TGCA 3NWUA 1EZXC 2ZO3H 3NKKA 2FI3E 4DW2U 1A0LA 3P92A 1O3JA 3F2GA 1MD8A 3TK9A 2Y5HA 2HLDD 4TY6A 2WPDD 4ABFA 1E1RD 4Q63A 2WZQA 1ZGVA 1C1SA 2Y80A 1P05A 4MQAA 1C5RA 3RC4A 1F5LA 1MQ6A 1KLJH 1GJ7B 1TOCB 1DVAH 4Y8XA 1Z8RA 2BLOA 3EDXB 5EJZA 1UHBA 1O3PB 1P06A 2A2QH 2PHBA 1MMJN 1PYTC 1QQUA 1C1RA 2KCYA 4HFPB 4CRAA 3UB0A 2BXTH 1UK2A 1C5WB 2O8TA 3F0PA 5ETXA 2IJD1 1NO9H 3E8LA 5LGOA 1P2JA 1WBGB 1Z7KA 2OC7A 3KQCA 3EA9A 3P6ZB 3SU6A 4JK5A 2L6OA 3TH4H 1BHXB 3LGYA 2ZIQH 3KNXA 6LPRA 5H4IB 2M5TA 1ZJKA 1VR1H 4H6SB 4X2VA 1LVMA 3GY5A 4CRDA 3P8OA 1EAXA 1G36A 3SNCA 2ZKSA 2HPPH 2NU3E 1GL1A 1SGDE 2GZ8A 1YLCA 2J34A 1COWD 4JZFH 1SSXA 1O3CA 1MKWK 1W0KD 2Z9JA 2ANWA 5C94A 1IHSH 3O8RA 1O38A 2G4TA 3GDSA 4X8TH 1FNIA 1F0UA 1K1JA 1LQEA 4ZKSU 2BDYA 1QURH 4XFQA 4NWLA 1YPHC 3RXMA 1MTNC 4MPUA 1HJAC 1Z6JH 4IGDA 1GJ9B 2V6NA 4MNVA 4YO9A 4NA9H 1XKBC 3SOSA 1BT7A 3L33A 4MPVA 4CR5A 3QDZB 2XBVA 1O35A 1DM4B 5FL7D 3RMNH 1LCYA 3UREA 3STJA 2JIZD 1L0ZA 1MTNB 4H4FA 1L4DA 2FOEA 2OBQA 4ZHMU 1BJUA 1ZTLA 4ZROA 5E0JA 1NFYA 3CS7A 4A7IB 3RLWH 1OX1A 3PMHB 3S9BA 1LHCH 2J38A 4FUHA 5JB9S 3PV2A 1FLEE 3TGJE 1MD7A 2GV7A 1DWEH 1SQAA 2GCTC 3TJVA 1W14U 1FDPA 1Y3XA 5T3HA 4NWKA 4WMFA 2XW9A 1A0HB 1DLEA 3SGQE 4E7NA 1NFWA 2A4RA 1N8OB 4A5TS 1P2OA 4ZXXH 1KDQB 1J15A 4VGCC 4CBOA 2GTBA 2FLRH 4IN2A 3MOCA 1O3DA 3OY5U 1D6WA 2J9NA 2AERH 4U30A 3OFND 2HVXA 2LP6A
chains in the Genus database with same CATH topology
1GBHA 2BDAA 4A1XA 1T7CA 2ZHFH 2F3CE 1O3HA 1K2I1 3ZVDA 2QGRA 1RIWC 1C2MA 1TGBA 4I7YH 4Q7ZA 3AW1A 1WSSH 3OTJE 1TRYA 2FZZA 2AGGX 3ZZ6A 1MCTA 2J95A 2GVFA 4MTBA 2SNWA 2ZTYA 1O3BA 4JYVH 1T8LA 1AE5A 1HAOH 1DX5M 5HYOA 5A8ZA 2BXUH 2P8OC 3A88A 2BOHB 2Z9LA 1O31A 4ISIH 4AZ2B 5SGAE 2AS9A 1TNHA 1SI5H 3T28A 2TGTA 4BAQB 2FX6A 4K60A 4K3JA 1SOZA 2TIOA 2WUBA 2ZFRH 1A61H 1SLUB 1Z8JB 2QF0A 2SNVA 3GCNA 3LJOA 1QA0A 1E37B 4YLUA 2BQ6B 2ZCKP 1V3XA 1C5YB 1DWCH 3PWCA 4YLQH 5CMXH 4BANB 2P59A 1BRCE 1LMWB 4YESB 1AB9C 1FZZA 5EPYA 2A7HA 1VCQA 1P04A 3RXLA 2FOAA 4BXSA 2WINI 1TYNA 2ZHEH 1AIXH 1D3TB 2O8WA 1EJNA 1KXCA 5EQQA 3Q3KA 1ESTA 1OYTH 1YPHE 1O3NA 2A4OA 3A85A 5HXFA 2BDIA 3H7TA 1Y5UT 2ZGCA 1KXEA 1DWBH 2FOMB 2BYAX 1QIXB 5A8YA 1ZRKA 4RKJB 3Q00A 3I78A 1TNGA 2G5VA 1KLIH 2ODQA 4LZ4B 2F83A 3ZZ8A 2A7JA 4K1TA 1P57B 1UVSH 2C8ZB 1P2NA 1CT4E 1GI0A 1O2ZA 2VVVA 2ZPSA 1YPKH 2NU4E 1EKBB 4FVBA 2A5IA 1LPZB 3KQBA 3LH1A 1V2MT 4FUBA 5C5NA 2G81E 2C8WB 1GBAA 2A0QB 2XBWA 4E05H 5E8EH 3SHAH 1ZHPA 2VINA 3SQHE 2ZQ1A 3ZZ5A 1MH0A 4UDWH 4DURA 2GCHG 2VIVA 1IQIA 2Z9GA 4CH8B 1ELTA 1UVOA 2CN0H 3SV2H 1QFKH 5C1UA 2Z94A 1GGDB 1EZUC 1C4Y2 2PR3A 1TALA 4ZAEA 1T4VH 2GGVB 5AFZH 2Z3DA 3QTVH 2H9EH 4FU9A 2WYGA 2XXLA 3SGAE 3V13A 2G55A 3GY2A 3OU0A 1O2LA 5C5OA 1RTKA 1S0RA 3LGWA 1C1TA 1D3QB 2ZGBH 1WTGH 1DSUA 1UTPA 2G8TA 2VGCB 4LOYH 1CGHA 2VU8E 4SGBE 2BZAA 2YNBA 4E7RG 4ABDA 1VITF 1EZSC 4Y0YE 5K7RA 4TYDA 1L1NA 1N6XA 3SZNA 2Y81A 4AOQA 4AFQA 1YKTA 3CP7A 2A4QA 3MH5A 3FZZA 4AGKA 1GHBF 2ZTZA 3QZQA 1AWFH 4NFEA 1M9UA 2RDLA 4UEHH 2V3HH 4XBDA 2HNTC 2ZA5A 5DP5A 2QA9E 1NFXA 3UQOA 3SNBA 2BD7A 1THPB 2D26C 1AKSB 1HGTH 1FPCH 3ZZ4A 1GMHF 3URCA 1F0TA 1IQLA 1AKSA 3BTKE 1ELAA 4I33A 1GBIA 1ZJDA 1DE7H 1TGSZ 1ZMLA 1Y5AT 4FUGA 1QGFA 3GY7A 2BVRH 2C93B 1ELGA 1K1MA 1BMMH 1O5AB 1ZPCA 1PQ7A 2GD4B 2TBSA 1E0FD 1P11E 1BTYA 5EQRA 4B2AA 1ZSLA 5E0GA 3MNCA 4D7FA 6CHAB 4KTUA 3ZZCA 1Z8IB 5LPRA 2STBE 3RXCA 4X6PA 3GY8A 1EX3A 5F8ZA 2UWLA 4ZHAA 2ZCHP 1GG6C 4Y7AA 2FO9A 3FAOA 3UTUH 1DWDH 3SU5A 5C3NA 2DE8A 1T32A 1ELEE 1BZXE 1TA6A 2PSYA 2Y5GA 3GDUA 4ISLA 4ABEA 3OSYA 4GUXA 3AAUA 5A0CA 2H2ZA 2PW8H 2SGPE 2ALPA 3P8GA 4AG1A 6ESTA 3A84A 1NT1A 2G51A 3DFLA 1EP5A 1CHGA 4KELA 1WOFA 1W10U 5FPYA 1YPEH 1OWJA 3DFJA 1V2UT 3ATWA 4HI3A 3EGKH 2ZFSA 2F9PA 5FCKA 1S0QA 5JBAS 1SC8U 2LNCA 3V0XA 2I6SA 3UNQA 1C2IA 1PYTD 3I77A 3TLOA 1TBRH 1GDQA 1Z71A 2H9HA 3PTNA 4O3TA 1GBEA 1OP2A 1T4UH 3SW2B 2VWMA 1PFXC 2Q6DA 1ARBA 1RGQA 1F5RA 1GI3A 1BRBE 4FUDA 1GHYH 2ZZUH 1GJ4H 1THSH 1K28D 1VGCC 1ZHMA 3PLPA 1IHTH 3A7TA 1NU7B 1GJAB 1YYY1 3UOUA 2EI8A 2Y7XA 1XMNB 2ULLA 4XOJA 4TY7A 1S83A 1HAZB 3UFAA 4YM9A 1SQOA 2Y82A 1HIAB 1Y5BT 1D6RA 3ZZ7A 5AF9H 3TH2H 3ZZAA 1YP9A 3BTQE 3QWCH 1SG8B 3GY3A 5LPFA 1ZHRA 1QBNA 1YLDA 3K6YA 4X0WU 1OP0A 4GAWA 1C1QA 5TCAA 2P16A 1O5CB 3RUOA 2TGDA 1AQ7A 3A7ZA 3QGJA 4MDSA 3S7HB 3E16B 4K8BA 2JKHA 4IC5A 1C1NA 5EW1H 1HLTH 4B73A 2PSXA 3RMMH 1EPTA 3MO9A 1V2RT 2Y5FA 2ZFTA 1IQKA 4K2YA 1HAYB 1G3EA 3OY6U 2Y7ZA 4HGCA 2BHGA 3DT0H 1QRWA 4BAHB 2H5DA 3TK6A 1WAYB 1PPHE 1GDUA 1ORFA 2BVSH 4IC6A 1H8DH 2ANMH 3PB1E 5DJ7A 1T8MA 1TPPA 1SPJA 1QNJA 3NK8A 1TWXB 1RIWB 5DGJA 1MKXK 3GY4A 3BTME 4OS6A 5GXPA 4I8GA 1O5FH 1D3PB 2AGIX 3FP8E 1GHWH 1ZSJA 1BOQA 2ZECA 1D3DB 4MNXA 3UNSA 3SV6A 4YTAA 1K1NA 1GHVH 2ODPA 4WJG2 1GJ5H 2J2UA 2GT8A 1ZZZA 2WPIS 3E0PB 1GPZA 3B23B 4ABBA 1XUKA 2G52A 1W0YH 2TPIZ 1VITG 5FPSA 2YOLA 3ZVAA 2PWXA 1V2QT 1BQYA 3LDXH 4HTCH 2SGEE 1ZPZA 2FESH 5GPIB 4AG2A 1TFXA 3NCLA 3Q76A 3GOVB 3MH6A 2ZDLA 2GMTC 3BG4B 5EGMA 2EA3A 8ESTE 1OP8A 2W3KA 1KIGH 1C9TA 2JH5D 4AN7A 1WUNH 3RMOH 5GWZA 4NCYA 5LPEA 1ZRBA 2FEQH 3UWJH 5DPAA 5LH8A 1O2KA 2CHAC 1TB6H 1OPHB 5EXMA 3ZVBA 1GI1A 4VGCB 3EA8A 1HJ8A 9LPRA 5GIBA 1PPEE 2NU2E 2A2XH 3A8CA 3QO6A 2ZPQA 3BTEE 4UE7H 4WF8A 1F0SA 5DP8A 1GJ6A 5HGGA 2BDBA 1HUTH 2BLVA 3BV9B 2VVUA 2OXSA 1PPGE 1HYLA 3GCTG 1MU8B 3PLBA 1MTSA 2XC4A 3V7TA 3DHKH 4I8JA 2P94A 3E91A 4NGAH 1ABJH 3U9AH 2ZHWH 4Q2KA 1SLVB 1XXFA 2ZP0H 2OC1A 1FI8A 4YOIA 1NC6A 1NTPA 1V2NT 3RXOA 4HZHA 2BMGB 4UFDH 3CS0A 1BMAA 1P03A 1WCZA 3PWBA 3MWIU 1TIOA 2PFEA 2ZI2H 4RN6A 1NU9A 4PROA 1QHRB 1DS2E 2ZF0H 1RD3B 2LPRA 2GKVE 4OS7A 1FV9A 3M3SA 3KEEA 1AVXA 1NN6A 1MQ5A 1CT0E 1MAXA 2BLWA 1NRPH 2TGPZ 1G2LA 3LU9B 4TWWA 1GI9B 1GMHG 3QLPH 4Q80A 4ZUHA 3ATLA 1OWIA 2ZU5A 5E0HA 1BA8B 6CHAC 3A87A 4DT7B 1SGQE 3RMLH 2STAE 3ATKA 1GWAA 2H5CA 2B5TB 1TAWA 1JXPA 1NZQH 1NRNH 2UWPA 1SQTA 3SORA 4ABIA 1P09A 3FP6E 5FHTA 2FDAA 2FOGA 2FS9A 5GJ4B 1UCYE 5HMAA 4NSVA 1AZZA 5BPEA 1C2HA 3OYPA 4ISNA 1HXEH 1DOJA 1FY5A 1DY9A 3UQVA 3A86A 1BTXA 3Q3YA 2JH0D 5FBEA 4A1TA 4GPGA 5DP3A 4ZH8A 1EOJA 3ESTA 1MBMA 1PQ8A 5A0BA 1LPKB 1CBWC 1O33A 1L1JA 3ZZ3A 1V2VT 1JIMA 2BZ6H 2W26A 3T2NA 1TE0A 4UONA 1NPMA 2P3FH 4X6OA 3EAJA 2ZG0H 1O3LA 1QTFA 2DUCA 4IN1A 1QL8A 3HGPA 2FX4A 3GYMA 3EYDA 2WPKS 1G3BA 1YM0A 3SO3A 1LVYA 1GCDA 1C1WH 2A5KA 2W5EA 1FN6A 2Q1JA 1CBWB 2A4GA 4IMQA 2R9PA 1ZSKA 2B0FA 2UUFB 3RP2A 4AFSA 1QJ7B 3M3TA 1EPTB 4NFFA 2Z7FE 3AAVA 2Z9KA 2IOTA 1ABIH 4Q7XA 1QQ4A 2ZCLP 4Y6DA 2AIQA 3BIUH 3F9GA 1QB6A 2VVCA 3B9FH 3D62A 4D7GA 1TGTA 1QRZA 4CRCA 1SGFG 3F9EA 2FI5E 3BG8A 1S84A 2AH4X 1VCPA 2BY9X 1GCTC 2PGQB 2B9LA 1GI4A 1P9UA 2G4UA 1SFQB 1ARCA 1ESBA 2FI4E 3CENA 1GBKA 1HAHH 1V2PT 2OBOA 2ZU2A 3GDVA 1O3AA 1FN8A 4JK6A 5T6FA 1KTTB 1H4WA 4H42U 4FVDA 5DP4A 1ZGIA 3SV7A 1PPBH 2R0KA 1OKXA 1S6HA 3VEQB 3M7QA 3Q3XA 1O2RA 3RXQA 3BEFB 2XC0A 4FU8A 1HPGA 1J17T 4K8YA 4JCNA 3STIA 2FOBA 1OXGA 3EQ0H 1C5VA 3RU4D 2SGDE 1CSOE 2UUJB 4X1NU 2V35A 1CGIE 1Q3XA 3A83A 2WUCA 1QBOA 4IS5A 2ILNA 5EOKA 1F5KU 2PTCE 3IWMA 3RXRA 4NIXA 3MMGA 4U2WA 2A7CA 1AGJA 1ZR0A 4D76A 1A5IA 5TCCA 3PLKA 1BBRH 4OS1A 3TJUA 1T8NA 4ZHLU 5FXLA 1RTLA 2ZFFH 2BTCE 1X7AC 1TRNA 5TJXA 1HAVB 2HNTF 4YOGA 2VIPA 1AVWA 1TNIA 1JBUH 1BTPA 1CGJE 2THFB 4DG4A 3HGNA 1IQGA 1HAVA 5L30H 2BB4A 1O34A 1ETRH 1EUFA 3K2UA 3TGIE 4GHQA 2GX4A 1BBRK 1O5DH 1FMGA 4YZUA 1XVMA 5A2MH 1CQQA 1HIAA 2PKSC 1Y3YA 2IN2A 1A2CH 1DITH 1GCTB 4D8NA 2WPHS 3SU4A 2FOCA 3KIDU 4XSKU 1O5EH 1C2EA 2QCYA 4INKA 1AVGH 3PMJA 1EB2A 3GCHC 3RXKA 1O3KA 4Y8YA 1RJXB 1SGRE 3HK6B 1GMCG 1G32B 1C5UA 1O2SA 3GCHB 1MKWH 2AMDA 4ZKOU 3O8CA 2OQUA 1S6FA 2OC0A 2EEKA 5I46H 4TWYA 1LHDH 3TIUA 1O2OA 1HAXB 2ZQ2A 1PPZA 3GICB 3KN2A 3RXVA 4A92A 2UWOA 2ASUB 2BLQA 3M5MA 2ZWLH 4I32A 1W8BH 1UMAH 1THRH 1UK4A 3F68H 1UHBB 2ZHQH 3BTHE 4X1PU 1QBVH 2TRMA 2FYRA 5JYIA 3SN8A 1O37A 3N7OA 2BY8X 4CRGA 4NA8A 5L2YH 1V2WT 2BQWB 1O3GA 2BVXH 1AFQC 1CU1A 1Q2WA 1UCYH 4SGAE 5K0HA 3BIVH 1EASA 4X8VH 1YC0A 3MH4A 1H1BA 3FP7E 1WYKA 1A3EH 1FAXA 1JRTA 1W13U 2ZFQH 5F03A 2GCHF 2CV3A 1J14A 1DLKB 1QY6A 1GHAG 3RXGA 1H9IE 2PUXB 1GJBB 4FUJA 1F7ZA 1VJ9U 1GJCB 1V2ST 1DUAA 2VWLA 2XWBI 1BTHH 4O03A 3TU7H 1P2KA 4K5ZA 2KAIB 8LPRA 3RLYH 4ZKNU 4B1TA 4WH6A 2R2MB 4K69A 4UFEH 5A09A 2ZTXA 4JZEH 5EW2H 1IQHA 2P93A 3U8OH 2BX3A 1K1LA 1RXPA 1UVTH 2TGAA 3LONA 3T29A 1INCA 5A8XA 1AN1E 4KTSA 2P8OB 2PV9B 4AB8A 1GBLA 3LJJA 1L1GA 2G5NA 2XRCA 2PKAA 2KAIA 2GMTB 1NY22 3K6ZA 1NRRH 4J1YA 2XWAA 3RXBA 4FUFA 3SUEA 1CVWH 1QL7A 3P8NA 1EJMA 1IQMA 4WVPE 3PYHA 4R0IA 1SGPE 4AFUA 4X2WA 3RC5A 1Y3VA 2QXGA 1A3BH 1BB0B 1J8AA 4RKOB 1FY3A 1P9SA 1HDTH 1GJDB 4I31A 1ETTH 3P17H 1XUHA 2IPHA 4NZLA 1FPHH 3ZZDA 1UVUH 3BTFE 4AB9A 4WWYA 1LDTT 3SU3A 2B8OH 3E90B 2WPMS 4Y8ZA 5FX5A 5L6NH 1ELBA 2OQ5A 2QXHA 3BG4C 3BTGE 4BOHA 2ZPRA 2PKAB 5ESBA 1BMLA 1KXDA 1TNKA 3RM0H 4ABHA 1LVOA 3E0NB 1UTOA 3B8JA 3BF6H 4XBCA 1ZOMA 1DANH 3JZ1B 4ESTE 2CHAB 3SGBE 1DDJA 3ZYEA 3SJ8A 4I8HA 1P2IA 1TNJA 3MU4A 1LHFH 1ANBA 1MU6B 1P10A 1GDNA 1TABE 5EU8A 1KTSB 2QN5T 1MAYA 1XUIA 3M7UA 3SNEA 2VH0A 1SOTA 1TMUH 9ESTA 4AYVB 5JBCS 3A8AA 1G3CA 2F9BH 5FCRA 4LK4A 4X1QU 3DUXH 1HRTH 2Q6FA 4CREA 3Q77A 2Z9IA 1YGCH 1AWHB 1F2SE 4DY7B 1TQ0B 3SV8A 4D9QA 1TNLA 4JYTA 3KQEA 1YPLH 1C2DA 2OP9A 3R0FA 2FTLE 4MPWA 2ANYA 4DVAU 2ANKH 3VB4A 1ZYOA 4X8UH 1KYNA 5J4SA 1QR3E 3A8DA 1BRAA 1HFDA 2QAAA 3MH7A 1IAUA 2RCEA 5AVDA 1RTFB 2HNTE 1RS0A 1SMFE 2CJIA 1AFQB 2JH6D 2QYIA 4Y71A 3L3TA 2ZDNA 4O9VA 2ZDAH 4OS4A 1SHYA 4NZQA