1CHGA

Chymotrypsinogen,2.5 angstroms crystal structure, comparison with alpha-chymotrypsin,and implications for zymogen activation
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
245
structure length
226
Chain Sequence
b'CGVPAIQPVLSGLSRIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGVTTSDVVVAGEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSAVCLPSASDDFAAGTTCVTTGWGRLQQASLPLLSNTNCKKYWGTKIKDAMICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQTLAAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHYMOTRYPSINOGEN A
publication title Chymotrypsinogen: 2.5-angstrom crystal structure, comparison with alpha-chymotrypsin, and implications for zymogen activation.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase zymogen (serine proteinase)
total genus 40
structure length 226
sequence length 245
ec nomenclature ec 3.4.21.1: Chymotrypsin.
pdb deposition date 1975-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1chgA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1chgA01
2VIOA 2ZCLP 2ZO3H 3GY7A 1P2OA 4JYTA 5HMAA 3TH3H 1J15A 1T8OA 4KP0A 2G4UA 1YLDA 1EJNA 4DIIH 5AFYH 1UHBA 1CHOG 4HGCA 3PTBA 1DSTA 1JMOH 3RLYH 4CR5A 1D3TB 2EI7A 1SMFE 1AVXA 2TGAA 4Y71A 4ZMAH 2Z94A 1FY8E 1FN8A 2Y5GA 4ABBA 5SGAE 4DGJA 4CRGA 3MU5A 1V2PT 3ZZ8A 2IN2A 1P05A 1O3JA 1GDNA 2SGQE 1BTYA 2ZG0H 4YO9A 1NRNH 4YZUA 1Z6JH 1YPJH 1P0SH 4A7IB 3LJOA 1GI9B 2VWLA 5F8ZA 4Z6AH 2PGQB 4XBDA 2ANKH 1RD3B 4K5ZA 1C1OA 4IMZA 3SGAE 1L1NA 1ZHPA 1SB1H 1LKAA 1IQIA 2O9QA 2CF8H 1RXPA 1FDPA 3MH6A 1GBIA 4DY7B 2B9LA 1C2EA 4Y7BA 5EQSA 1G2LA 4JK5A 2VIVA 1C2MA 5FX5A 1T8LA 3D23A 1HBTH 1YF4A 1YPLH 3UWJH 1K1LA 3LC3A 2KAIB 3E8LA 4MNWA 2A7JA 3SUEA 8GCHG 3RMLH 1MU8B 1UTMA 3UTUH 1O3CA 1OP0A 5LPEA 1GI4A 2Y80A 3QZRA 1QA7A 2QCYA 4HZHA 1SLWB 1M9UA 1O5BB 1ANBA 3QK1A 4NZQA 5C3NA 2EI6A 2HNTE 4FUDA 2QN5T 1SGIB 1AKSB 1K22H 1NFYA 5A8ZA 1C1VH 2J4IA 3TPIZ 2AS9A 2Z9GA 2BOKA 2SGDE 3Q76A 4IN1A 5LPFA 3RU4T 1XUIA 2XBXA 1NT1A 5IYTA 4ABJA 3GCHC 1SL3A 1K1IA 3TJUA 1ETTH 3F68H 1TX8A 1C1UH 3RXUA 1TNHA 1RTLA 5EQRA 1UTKA 1WSSH 4OS7A 4MPVA 2ZA5A 2A7CA 3ATWA 2TBSA 3UNSA 3LJJA 8LPRA 2OLGA 1C1WH 1KDQA 2O8TA 1EXFA 1MTWA 2SGPE 1V2NT 3VB7A 4K60A 1MTNC 1AVGH 2FXRA 4TYDA 5ETXA 4A92A 4ABEA 2XRCA 3UIRA 1MD8A 5E2OA 3GCTF 4UFFH 2ANWA 1GHVH 1ESTA 3KGPA 1C5SA 3D62A 1MTNB 1OWIA 1HAHH 2NU2E 1BTWA 1DS2E 1PPHE 2C93B 1RTKA 1A3EH 1MQ5A 1CHGA 2GCHF 3MHWU 1W7XH 5E0HA 3MH5A 3U1JB 2V3OH 2VIWA 3KCGH 1TAWA 1GHAG 2OCVB 3T62A 5A2MH 2P16A 2XXLA 5EOKA 1O2RA 1XX9A 4WF8A 3GY6A 2A0QB 1MH0A 3ZZ7A 5L2YH 2BY5X 1HIAB 1KTTB 2P8OC 1GMHF 1LHCH 3UR9A 2IOTA 2TGTA 1TBZH 2BD9A 4K1EA 1ZR0A 2Z3DA 1NFUA 3TK5A 3M5LA 4UE7H 2P8OB 4RSPA 2NWNA 1P2QA 1L1JA 2PR3A 1GI8B 3I78A 1GGDC 1AD8H 1QRXA 3A82A 2BVXH 1ANCA 1IHSH 1LMWB 3RUOA 1T8NA 1GI1A 1YPHC 2ZU2A 4F4OC 1GGDB 3LPRA 4MNXA 4UEHH 4X1PU 3HGNA 1GJDB 3F9FA 1O2VA 1TRMA 1YYY1 2BD8A 5CMXH 4AYVB 4MVNA 5JBCS 1O38A 3MI4A 2ZKSA 3RXTA 1C9PA 2ZHFH 1GHXH 4NSVA 2B8OH 3MU4A 3BTEE 5DP8A 1EKBB 4KTSA 1ETSH 1O2LA 5C5NA 2PV9B 2GDEH 2QIQA 2R0LA 3UOUA 3KQBA 1AWHB 2F3CE 3LGTA 1AFQC 2OC7A 2ZGCA 1C1RA 2KAIA 1SHHB 1V2MT 2XBVA 3MWIU 1SGDE 2XC5A 1PJPA 4X6NA 1KY9A 4I31A 1UTNA 4DOQA 3SV6A 1AFQB 2HVXA 1IQHA 1IQJA 2BZAA 1W12U 2RDLA 1DLEA 3ZVBA 1IQMA 1CBWC 2XBWA 1BTXA 1QTFA 1Z8GA 1FPCH 4INLA 1C5RA 3MO6A 3VB3A 1GVZA 1AKSA 2ANMH 1EZXC 1SOTA 1RIWC 3ATKA 5AHGH 1CBWB 2A4GA 3C27B 5FHTA 3GISB 4Y0ZE 4TPIZ 2FS9A 3L3TA 3FZDA 1G36A 1PPFE 3PROA 1GBLA 1SLUB 3U8TH 4Y7AA 1O2XA 1NU7B 5C67A 1G3BA 1TIOA 1XMNB 1H9HE 1N1LA 2BY9X 3BEUA 4KTCA 1MU6B 3BN9A 2OUAA 3U1IB 3MH4A 4Q7ZA 4MDSA 1AUTC 2FOAA 1DT2A 3VB6A 1EAXA 4E06H 1SVPA 3M61U 1D3DB 3ZZ6A 5PTPA 3SU6A 2ASUB 1SGTA 3CENA 4ABDA 3MYWA 4DIHH 2A5KA 4AGJA 1QA0A 1Z71A 1K9OE 1TGNA 4ZHLU 3FP6E 3KIDU 1FUJA 1O2NA 1TPOA 1GMDG 2ZZUH 1VZQH 1LQDB 5GXPA 1ZGIA 1QR3E 3OYPA 2BY6X 1QJ6B 2SNWA 1FNIA 1H8IH 2XBYA 3T5FH 2OBQA 1W14U 4A5TS 1ACBE 5DP5A 1TRYA 3RDZA 1A0LA 1ZOMA 5J4SA 3M36A 1OWEA 3SJKA 1GHYH 3RXPA 4AZ2B 1Y3YA 1VITG 1G9IE 1QRZA 5EPNA 1GHWH 1SQOA 5DP4A 1RTFB 4WMFA 4AOQA 1HIAA 1O2QA 1PQ5A 1PPCE 4K3JA 1L4ZA 2FODA 1HFDA 1CQQA 2STBE 5EXMA 3QDZB 1GMCG 2DE9A 1A2CH 1O2MA 1FIWA 5HGGA 2PUQH 1N6XA 1GDUA 3LH3A 1J17T 1O3LA 3UUZA 3URCA 1GBFA 5E8EH 3KQDA 2VGCC 2THFB 1C2HA 1MZAA 2IJOB 1O2KA 3OSYA 2A2QH 6GCHF 3GICB 3SNEA 3BG4C 3EAJA 3ELAH 1O5CB 2VGCB 5B6OA 2J94A 4AYYB 1OP2A 3RC4A 3UWIA 2GZ7A 3BG4B 2WPKS 3S9CA 2A7HA 4BXWA 1TNLA 3NPSA 2BYAX 3LGUA 1ZSLA 1EZUC 1C1QA 1LVYA 3H5CB 5FXLA 1O5EH 5GJ4B 3SNBA 4O9VA 4OS5A 2Q1JA 1C5XB 2ZWLH 3A86A 1KTSB 2AMPA 1MTVA 1O31A 1TB6H 4FU7A 1QBVH 2WUCA 3PMHB 3HKJB 1P8VC 1FY5A 4J1YA 1FAXA 3OY6U 1F2SE 1O39A 1GJ9B 1NC6A 1FIZA 3M5NA 1QB9A 3HK3B 2ANYA 5H4IB 2ODYB 1EZSC 1AI8H 2BDBA 3BTDE 3D49H 3ZYEA 1TNJA 3A84A 1ZRBA 4A1VA 1AE5A 1CGIE 1TA6A 1QY6A 5AF9H 2BTCE 2VVVA 1ZZZA 1UTOA 1Y5AT 3M7TA 3RMNH 3HKIB 1NRSH 1TNGA 4ABFA 1E35B 3P70B 4GPGA 3L33A 2AIQA 1C1NA 4MTBA 4X8TH 3ENSB 4ISLA 1P9SA 2GZ8A 3RM2H 2J38A 5K7RA 1RRKA 1O5AB 3KEEA 1QQ4A 3M37A 3GYMA 4D7FA 1DICA 1ZGVA 5ESTE 1ZMJA 4UFEH 3A83A 1UTPA 1BMLA 4J2YB 4FU9A 3FAOA 2WPIS 1JIRA 1KIGH 4NG9H 5JBBS 5CHAC 4Z0KA 1KLTA 2VNTA 1NRQH 3ZVEA 3ATIA 3RXOA 1OX1A 1C2IA 1Y3XA 2QAAA 5FPSA 4TWYA 4B73A 1VJ9U 5LH8A 2SGEE 7GCHG 1LPZB 4JZ1A 3P8OA 5CHAB 1DITH 2FOMB 4AG1A 4X8UH 3SW2B 5C1XA 1F0SA 2FS8A 3NK8A 3MFJA 1CT4E 1F5RA 4MPUA 5E2PA 2P59A 2ZHDA 1HAYB 1Z8IB 2GVFA 2R9PA 3ZZCA 4K1SA 1ZTKA 4YESB 3RM0H 5GCHF 3A7XA 1G3CA 3SNCA 4DURA 3AAVA 1HGTH 2VB0A 2A32A 3M3TA 1AMHA 4GLYA 4LOYH 1CGJE 1O3AA 2HWLB 2NU0E 2BX3A 2PKAB 3S9BA 4CH2B 4H6SB 1YPHE 4FUFA 5F8TA 3LC5A 3RXDA 7LPRA 1PPBH 3SJ8A 4ESTE 2VWMA 2A4QA 1H9IE 2AYWA 4U2WA 2LNCA 3EA7A 2HRVA 1EP6A 1ABIH 4AX9H 2D2DA 1BTHH 4BAOB 2G8TA 2NU4E 1O3BA 3PO1C 3BTME 5C1UA 1FV9A 1DXWA 1FZZA 2ZPRA 3QWCH 4D76A 2ZU3A 2ZFFH 1B5GH 1EP5A 4UONA 3QGNB 1XUJA 1Z8RA 4FUBA 3PO1B 3Q00A 3AVZA 1A46H 1BJUA 3SUGA 4TY6A 1JXPA 2F91A 3LOXA 4BOHA 2ZDLA 4PROA 2HALA 2ZFPH 3PLBA 3SJIA 5GWZA 1SGEE 1FONA 3GDSA 1ANDA 1P2IA 1D4PB 1EOJA 4AB9A 1C1PA 4BAHB 4YT7H 1FY1A 4YOIA 2QXIA 2D8WA 1NTPA 1S82A 4Y0YE 1UCYH 1TYNA 3SHCH 2BHGA 1V2KT 4X2WA 4DCDA 4E05H 4X6OA 6LPRA 2WV5A 2V6NA 1EATA 1A4WH 1ZYOA 2VVUA 4KGAA 1O3GA 3ZZ9A 1SG8B 4X2VA 1PQ7A 3L6PA 2FLBH 4ZHAA 4X8VH 4XFQA 2D1JA 3MNSA 1P06A 3H7TA 2BDGA 1LO6A 5DGJA 2A1DB 1Y3WA 1QGFA 2ZCHP 3QTVH 1OOKB 3SUDA 4O3UA 4OS1A 3MOCA 2QXJA 1C2GA 1GBBA 3SOSA 2GDDA 1TONA 2UWOA 2ALVA 1MD7A 1QB1A 2TPIZ 1TQ0B 2FI4E 1QRWA 3RC6A 4OS2A 3KQEA 1BTZA 4FUCA 1TMBH 1YGCH 3EGKH 4GVUA 3UFAA 1ZSKA 3SNDA 2QA9E 3TGIE 3DUXH 3Q77A 1V2LT 1OWKA 1YPGH 1BHXF 2CV3A 5DP6A 6GCHG 5LPRA 3SUFA 2BQ7B 1RJXB 4HFPB 2BB4A 4AFQA 1C5UA 3PMAB 1C5WB 2QGRA 3TH4H 1IHTH 4X0WU 1BQYA 2QXHA 2M5TA 2ZQ2A 3NXPA 1ABJH 1QJ7B 1C5PA 4CBNA 3BV9B 1ZSJA 3BEIB 4JMYA 1K2I1 4O97A 4DJZB 1S84A 2ZECA 3S69A 4CRDA 4WVPE 1UO6A 4INKA 1VJAU 3BIVH 2IPHA 1OXGA 1CA8B 1KXFA 3IWMA 4U01A 1TALA 2P93A 1BRBE 1ZTLA 2GMTC 2AFQB 3T2NA 4JZFH 3TITA 1NN6A 1HDTH 1P9UA 2PTCE 4HTCH 3FVFB 4NZLA 3IITA 4NGAH 2GZ9A 1PPZA 1UK2A 1Z1IA 1EPTB 1XKBC 2GMTB 1THSH 1K21H 1W0ZU 1C2KA 1TNKA 2A5AA 3EA8A 4ZKNU 2H5DA 1G37A 3KN2A 2PKAA 2OC8A 3A7VA 2ZC9H 1YPEH 1OYQA 2I6SA 3KL6A 3Q3YA 3PM3A 4H42U 1UK4A 3GY5A 3QX5H 2G4TA 1S81A 3GY3A 1O3PB 2PSXA 8KME2 1A3BH 5TJXA 2YOLA 2Z9KA 1Y5UT 2ZDAH 3BTQE 4TY7A 1DVAH 2FOGA 3RXEA 1EB2A 1V2WT 3UNRA 3EA9A 4AORA 1F5LA 1GI7B 4OS6A 2DE8A 1SGRE 1D3PB 1GBJA 4JCNA 2FEQH 3RXMA 2W5EA 1P12E 3UY9A 2H1UA 3A8DA 1TMUH 4VGCC 1N6YA 5IDKA 1ELGA 2A2XH 1TX6A 1O5GH 2FOCA 3K6ZA 1ZRKA 2RA3A 3TNTA 1OSSA 1EJAA 4VGCB 1O3KA 1QBNA 5L2ZH 2HOBA 2ZU1A 2BXTH 2ZU4A 7ESTE 3A7TA 3BTKE 5A0AE 1HNEE 1O2SA 4RKOB 1HAIH 1K1MA 2SFAA 1O3DA 1H4WA 2CHAB 5AFZH 3V13A 2C4FH 4FUIA 4D9RA 1TX7A 4CRFA 4D8NA 4XDEA 2ODQA 2P95A 5GCHG 1DLKB 2OQ5A 1C4V2 5A09A 1OWHA 3SHAH 1LPGB 2JKHA 4WH6A 1HAPH 2FOFA 1ELVA 2Y7XA 2PLXA 3M7UA 3O8CA 2SGFE 1XXDA 3HPTB 4NA7A 4SGBE 5A8YA 1GCTC 1GWAA 1WV7H 4GHTA 4B74A 4WMDA 5EU8A 2BQ6B 1LHFH 2Y6TA 1S6FA 4IW4E 1BRUP 1AVWA 1GCTB 1SLXB 4Y6DA 1MQ6A 2R3YA 3ZZAA 1S6HA 2ZIQH 1GJ6A 5K0HA 1MKWH 2ZQ1A 1BHXB 2GT8A 4ABGA 5FX6A 1SOZA 2BLQA 1TPPA 2YNBA 1MBMA 3PWBA 2BD3A 1BA8B 3RU4D 4ZKRU 3W94A 3RMMH 3A8CA 1O2HA 1GJAB 5T6DA 5A0CA 1HAXB 2GGVB 1T4UH 1CE5A 3M5MA 2J9NA 3E3TA 4XE4A 2FOBA 1P02A 2PSYA 4I32A 1DE7H 4Y8XA 4BTIB 3RXJA 1GBDA 2V0BA 3GDVA 1GJ8B 5BRRE 1UMAH 3E1XB 4NWKA 1WYKA 1DY8A 2Q6GA 2W3IA 2O8MA 3SI3H 5FAHA 4B2BA 1BDAA 4CBOA 5GIBA 1UJ1A 1TPSA 1AU8A 1XUFA 2PFEA 2FTMA 2UUFB 2YNAA 2VIPA 4BAKB 2CGAA 4JZDH 3T26A 1INCA 2QXGA 1O2UA 6ESTA 4GHQA 1SLVB 3D65E 4GUXA 4GAWA 3MU0A 1O2PA 3SORA 1E36B 3BF6H 3FP8E 2Z9LA 4H6TA 1NRRH 3PV4A 1WU1A 3SBKA 1W8BH 1MAYA 2J34A 1ZPCA 1T7CA 1XUKA 3ZZ4A 1AY6H 4FVBA 1KYNA 3OTJE 1YPKH 3E0PB 1GHBF 2ZGJA 2B0FA 1AGJA 2GP9B 1C5YB 4AFZA 5AVDA 2FM2A 1O2YA 2F9BH 2C90B 2G5VA 3BIUH 3NUMA 2EC9H 3E0NB 1IAUA 2H6MA 1W0YH 3UPEA 3M3SA 3P8FA 3DFLA 1HRTH 4Y8ZA 1V2VT 1LHEH 1OS8A 4ZKSU 3SJ9A 3QUMP 3O8DA 3T25A 4X1NU 1Z8JB 3MO9A 4CREA 1ARCA 1ZMNA 1N8OB 1VR1H 1XVMA 2QC2A 5EXLA 3B23B 3KQCA 2G81E 3C1KA 2FI3E 4K1TA 4KELA 3LGWA 1Y3VA 1QCPA 5ESBA 1TNIA 2FIRH 4H4FA 1U6QA 2UUYA 2C8YB 3RXCA 1MCTA 4RKJB 3MH7A 4X6PA 4FU8A 3FP7E 3TGKE 2Q6FA 3A7WA 3A80A 3QO6A 3RXIA 1PPGE 2W26A 1PPEE 2H2ZA 2Z7FE 1UCYK 3RXHA 1Z6EA 1BRCE 5F03A 1C5OH 1DUAA 1BBRH 5FCRA 1IOEA 1W13U 1PFXC 3RXQA 2UUJB 3P95A 3R3GB 1NPMA 9ESTA 4AN7A 1JWTA 1TPAE 1CHOF 1QB6A 1H1BA 5JPMH 1BBRE 3UR6A 1CGHA 2ZTZA 5DPAA 3TVJB 2VIQA 4I8JA 4NCYA 5FCKA 1TMTH 3EE0B 5T3HA 3T29A 1QIXB 4MPXA 5EGMA 2ZHQH 2UUKB 4BAMB 3PB1E 1HPGA 2BX4A 2BY8X 5EODA 4ABAA 3SU3A 3RXSA 1LTOA 3DT0H 4A1XA 2VINA 2EA3A 2F9OA 2AERH 2LPRA 1AFEH 4YOJA 1A0JA 3E90B 1FQ3A 1SPJA 3DA9B 3GCTG 2H9HA 3TK9A 2BD2A 1W10U 3V3MA 6CHAB 2EEKA 2XYAA 3GOVB 1GL1A 5C5OA 8ESTE 1SHYA 1PYTD 3ZV8A 1GI2A 3EDXB 3ESTA 1MAXA 3K2UA 2GCHG 1K1NA 4CH8B 2P3FH 1K28D 1NY22 1ZPZA 3TJNA 4I8LA 8GCHF 1IQFA 2PW8H 2F9PA 1A5GH 4FUGA 1O5DH 1QNJA 1A61H 2HPQH 2WINI 3MU1A 4X1SU 5E0GA 2CXVA 2WPMS 2UWLA 1GMHG 2ZFTA 7KMEH 3ZVCA 4X2XA 1NESE 1DXPA 1XM1A 3UQVA 3O8RA 1GL0E 1HLTH 2NU3E 2TRMA 3GY8A 1B0FA 1DY9A 1EQ9A 2QF3A 5DO4H 1YCPH 1Z7KA 4AG2A 1HAVB 1WTHD 3LH1A 1EOLA 1CU1A 2BZ6H 1ELAA 1GJBB 1TGTA 3N7OA 2F83A 1DSUA 2ZFSA 3A89A 2GV7A 4K8BA 2HLCA 1J14A 4IN2A 2PUXB 4WJG2 3SN8A 1LHDH 1K1JA 3S7KB 2HGTH 2PGBB 3RXKA 1ELBA 4YLUA 2TGPZ 3R0FA 3MNBA 3NZIA 2ESTE 1KLJH 4NFFA 4WXIA 3G01A 4O3TA 1YM0A 2VWOA 1V6DA 2BOHB 1D6RA 3M35A 2ZGXH 2OTVA 1SGQE 3MNXA 2V3HH 2ZTYA 2JH6D 3A8BA 1O34A 2FPZA 2W7UA 1LPKB 3GY4A 4ABIA 1BTUA 5HYOA 3PWCA 5HM2A 3A7YA 5TCAA 2SNVA 1EAUA 1JBUH 2Z3EA 3GCOA 2Y81A 1EJMA 2OXSA 1DM4B 1XUGA 1GHAF 3F9HA 3BSQA 1GBMA 3W95A 4E7RG 2PHBA 1D3QB 1F0UA 2FP7B 3SU4A 4ZUHA 1BCUH 5C2ZA 1A1RA 3SU1A 5F8XA 3SGBE 1C2FA 2K1QA 1RGQA 3PMBB 4AFSA 1YCPM 4UD9H 2ZFRH 5EW2H 3Q3XA 3A7ZA 4YOGA 1O2WA 1FN6A 1RS0A 1GVKB 4BANB 1P2KA 2OP9A 5F6MA 3AASA 2ILNA 1VGCB 4BAQB 2ZGHA 3NKKA 4NA9H 2OD3B 2ZHEH 2VIDA 1F0RA 3KHVA 4K69A 3RXGA 4AB8A 1AWFH 5JB9S 4WWYA 1G3EA 2ZI2H 1P11E 4D7GA 2Z9IA 3ZVFA 4M7GA 3E16B 1F7ZA 1O3EA 3DD2H 1P3EA 1THPB 1W11U 2ZU5A 4Y76A 1EASA 5DKMA 2FOHA 2BDCA 4A1TA 3ODFA 4FVDA 1F92A 4YT6H 2DUCA 1C2DA 3GCNA 2BD5A 4GSOA 4IGDA 4ISNA 4MNVA 1GPZA 4ASHA 1C2LA 1MKWK 2Y5HA 1O2GH 3LONA 1TABE 4WH8A 2HPPH 5G4BA 1LDTT 4GCHF 3ZYDA 1QL8A 3K6YA 2BY7X 2RG3A 1DX5M 2FESH 3B9FH 1K1OA 2FI5E 1QQUA 4ABHA 3TIUA 2FX6A 1UCYE 3CP7A 1FY3A 1VCPA 2BMGB 3SU2A 1H9LB 1HB0B 1TBQH 5JBTA 1O2ZA 4BTUB 1TE0A 2XC0A 2A4RA 4SGAE 3FANA 2RA0A 2ZF0H 5GDSH 2FZZA 3RXLA 2ZDVH 1SQAA 3OX7U 2FO9A 3M3VA 1EUFA 1PQ8A 1S0RA 1L2EA 5DP3A 1O30A 2XC4A 3UNQA 4ZKOU 1F0TA 4LXBH 1MKXH 1P03A 3RXFA 1C4Y2 3BEFB 1LVOA 1HAVA 4WXVA 1GBCA 4JZEH 1C2JA 4CR9A 2OC1A 3KF2A 3Q3KA 1GJ7B 1UTLM 3VXFH 3OY5U 5A8XA 3DFJA 3ODDA 4TPYA 2CMYA 1OWJA 3BTGE 3H7OA 3VEQB 1D9IA 4Y8YA 2BD7A 2AGGX 2ODPA 1NFWA 3WY8A 1WQSA 3GY2A 1QL7A 1ESAA 3TLOA 5L6NH 2FOEA 3T27A 1WBGB 2I6QA 1LQEA 3LDXH 4F49A 1O3IA 1HAZB 1V2QT 3A88A 1GMDF 2R2MB 2Z6BD 2GTBA 5TCCA 1EPTC 1O5FH 3T28A 1EAWA 3RMOH 1P2NA 1DWEH 1CA0C 1ZTJA 1J8AA 5DP9A 1SI5H 1DWDH 2G55A 1MTSA 1IQEA 2QYIA 3TJVA 1CA0B 1SGCA 2Q6DA 3F9GA 1DPOA 2QY0B 1UK3A 2ZDKA 2ZHWH 4ZH8A 1BZXE 1VITF 3P92A 1KXCA 1NZQH 1HUTH 1ELFA 5DK1A 1GI3A 4ZXXH 3CS0A 4NIXA 1DFPA 1QURH 2J95A 3BG8A 1QBOA 3U98H 1BITA 4I8KA 4U32A 1GMCF 1BMMH 1T4VH 4RN6A 1T32A 1BUIA 1SGFG 4B2CA 1TWXB 3RXVA 1HYLA 5JBAS 4JYVH 3TNSA 3P8GA 1BBRK 3SU0A 3MU8A 4UFGH 2VU8E 4K8YA 2H9EH 1AO5A 3GCHB 3SV2H 5JYIA 3QGJA 2VH0A 4IMQA 2PTNA 1HXFH 2Y82A 3AAUA 5BPEA 4TWWA 5LGOA 4B76A 5CE1A 4MLFB 5T6GA 4OS4A 2FYRA 2ZP0H 1P09A 2CHAC 4DG4A 2OQUA 3P17H 3PLKA 1BJVA 3UQOA 2C8XB 3I77A 3BTWE 3KNXA 2Z9JA 1YLCA 1E0FD 3MNCA 1V2JT 2Y7ZA 2FX4A 1BMAA 2ZPQA 4X1QU 2C8ZB 4XOJA 2O8LA 3ITIA 2BD4A 3LGIA 1MMJN 1SGYE 4LK4A 1ZJDA 3ZZ3A 3ATLA 1GI6A 1Q31A 1GJ5H 4JK6A 4XBBA 1GJCB 1KXAA 3ZZBA 1MBQA 1XXFA 1LCYA 1O3OA 2BM2A 1O33A 2GKVE 2XTTB 1P57B 4O03A 2XWBI 1ZHMA 2BLVA 3IG6B 1T8MA 1ZLRA 1OWDA 4ZXYH 3SO3A 2GT7A 2FLRH 1IQNA 4FUJA 1LVBA 3AW1A 2ZDMA 3F9EA 5C20A 1HJ9A 2OINA 3B8JA 1FY4A 3QLPH 2GCTC 2H9TH 4E7NA 3SZNA 2TIOA 1O37A 1SGFA 3JZ2B 3QTOH 1BTPA 1C5QA 1GVLA 2AIPA 1C5LH 2AMQA 5DP7A 2BDHA 2R3UA 4NA8A 2GCTB 2PKSC 1TGSZ 4KTUA 1G3DA 1AN1E 1GBAA 2R0KA 3SNAA 4OGXA 1ZPBA 1S0QA 2HNTF 2W3KA 1CT0E 1L4DA 1YCPK 2F9UA 2A5IA 2PKSB 1GHZA 2QF0A 1ZJKA 1F5KU 1PQAA 4ISOA 1AB9C 1O3MA 2P3UB 1G32B 4CHAC 1S5SA 4UFDH 2WPJS 2A45B 5HM9A 2WPHS 1ZMLA 3SV8A 3UOPA 3K65B 2R2WU 4Y10E 1SC8U 3OU0A 1KXBA 1AB9B 1TOMH 3TH2H 5GPIB 4CHAB 2FYQA 1YKTA 3V12A 7GCHF 1T31A 9LPRA 1H8DH 1THRH 1A0HB 4GCHG 3JZ1B 1E38B 2XCFA 1AQ7A 3F1SB 3A87A 3SI4H 4NWLA 1HXEH 3QN7A 1NROH 4THNH 3CS7A 3S7HB 1ANEA 3P6ZB 1EPTA 4Y11E 1V2OT 4Q7XA 1NFXA 5EQQA 3LU9B 1QHRB 4CRCA 1VCQA 1SGNE 1TBRH 1UVPA 3P8NA 4XBCA 1NM6A 2BDIA 4MNYA 1TQ7B 4B1TA 3SV9A 2FWWA 1O36A 4X6MA 3HK6B 4UDWH 3RLWH 1DWCH 2ZGBH 2JH5D 3PLPA 2XCNA 4LZ1H 3VB5A 2WUBA 5EPYA 1ELCA 3SV7A 1Y3UA 3A81A 1DOJA 1DUEA 5I46H 5JDUB 5EG4A 3U69H 1MZDA 1RIWB 3DHKH 1TA2A 4NFEA 1HJ8A 3VB4A 1K1PA 1N8OC 1XKAC 1UVOA 1V2ST 1EX3A 1OKXA 4IS5A 2W7SA 1BT7A 3NCLA 2AEIH 4I33A 2VJ1A 4KKDA 4R0IA 1SGPE 2PWXA 4DW2U 3SQHE 4X1RU 1SR5C 1L1GA 3MO3A 3ZVAA 1Y8TA 3VFEA 1KSNA 2AGIX 2A31A 3VXEH 3STIA 5EXNA 5I25A 2CJIA 1DDJA 1XUHA 2SGAA 1BB0B 1D6WA 4OGYA 2O8UA 3GYLB 2Z3CA 4DT7B 1A5HA 4HI3A 1AHTH 1V2TT 2GV6A 3PYHA 2BVRH 4ZAEA 5EW1H 4CRBA 4Q7YA 3S9AA 1C9TA 1LHGH 1BMNH 1P2MA 4MG3A 3LT3A 5A0BA 1DWBH 1LVMA 5FPTA 3S0NA 5ABWA 1C5MD 2BDAA 1C1SA 3PTNA 3RP2A 4K2YA 1ESBA 1FAKH 1FXYA 2BQWB 1TLDA 2FDAA 2OC0A 2HNTC 4IBLH 4BXSA 3LKWA 1GCDA 3HATH 1NS3A 1P10A 2ZNKH 1C1MA 4U30A 2B7DH 1AIXH 1HV7A 5C1YA 4XSKU 1ELEE 1WQVH 3VPKA 1AE8H 3BTTE 1MUEB 2AGEX 2C3SA 2WV4A 4YM9A 1ORFA 2D26C 1C1TA 2UWPA 4BNRA 1AZZA 2O8WA 3SGQE 6CHAC 4YTAA 1GBHA 2WYGA 1MKXK 1TGCA 2ZPSA 4D9QA 2G51A 1C5ZB 1SFIA 1SSXA 2G52A 4B2AA 1JRTA 3BTFE 1O0DH 3SU5A 3ZV9A 1W7GH 2V35A 1GDQA 4I8HA 2WPLS 2XWAA 3E91A 3M7QA 1WAYB 4NSYA 4MQAA 1B7XB 3EYDA 1P01A 1BOQA 1QFKH 4Y79A 3A8AA 1MCVA 1Z1JA 2ZEBA 1J16A 2B5TB 3K9XB 1G30B 4B71A 1GJ4H 3UREA 1G2MA 3V7TA 2CF9H 3O8BA 3ZVGA 1FJSA 1ARBA 1P2JA 1B0EA 1Q2WA 3QZQA 1PYTC 3LIWA 3AW0A 1FMGA 1BRAA 2WYJA 4ISHH 1O2IA 1VCWA 1C5NH 1SFQB 1YC0A 3TGJE 1ID5H 4FXGH 2AMDA 1S85A 5JB8S 1EZQA 2JH0D 1SQTA 2FTLE 2H5CA 3EQ0H 1SBWA 1E37B 4I7YH 1XVOA 4LZ4B 2CN0H 1TOCB 1TRNA 1UHBB 3A85A 2VH6A 4I8GA 2FMJA 2XW9A 1JOUB 3PMJA 2F9NA 3STJA 2ALPA 3URDA 2F9VA 4R8TB 1HAOH 3TU7H 5FBIA 1KXDA 2JETC 2OBOA 2RCEA 1O32A 1O3FA 3VGCC 1V3XA 1OPHB 2STAE 1GBTA 2GD4B 2AH4X 4ISIH 1UTQA 4ZROA 1C5TA 2JETB 2XNIA 1A7SA 1WTGH 1FLEE 1O2JA 2ZFQH 3VGCB 4NIVA 1YBWA 1JRSA 2BXUH 4Q80A 3LGVA 3ZVDA 1KXEA 2BDYA 2Y5FA 4YLQH 2NU1E 4X8SH 3MTYA 3U8RH 1ELTA 3ZZDA 3ZZ5A 3TJOA 2J92A 1WOFA 1LKBA 5FPYA 4JYUH 1C5VA 1TGBA 3LGYA 1O3HA 3ATMA 3F6UH 4MPWA 4Q2KA 1Y59T 2TGDA 1GG6C 3E6PH 4AFUA 2GX4A 3RXBA 1EB1H 1OP8A 1UVUH 2A4OA 3V0XA 3TK6A 1GG6B 1IQKA 4ZHMU 5HXFA 1S83A 1VGCC 3I29A 1P3CA 4INHA 3U9AH 1EAIA 3FFGA 4B75A 2ULLA 4FUHA 1FI8A 1BIOA 2J2UA 1IQGA 1O2OA 1AZ8A 2ZDNA 1HAGE 1W3CA 5T6FA 1GI5A 1RFNA 3FZZA 5J4QA 1UVTH 3RC5A 1GI0A 1ZHRA 1GBKA 1HJAC 1GHBG 1E34B 1QL9A 3MMGA 2P3TB 5L30H 4QT8C 1IQLA 1YP9A 1YPMH 1QJ1B 2ZTXA 1NU9A 1HJAB 3GDUA 5DJ7A 1NRPH 1UVSH 1KDQB 3RU4E 1CO7E 1CVWH 1WCZA 5DG6A 1O3NA 1X7AC 2G5NA 1UTJA 1O35A 1VITH 4CRAA 1ELDE 4FUEA 1MTUA 3HGPA 3NWUA 4IC6A 4X2YA 1ETRH 2BVSH 1OYTH 1V2UT 1KLIH 2P94A 1O2TA 1GBEA 3U8OH 1NO9H 4JZIA 3SJOA 3BTHE 1CT2E 4NIWA 2VVCA 1W2KH 2EI8A 4AGKA 1CSOE 2C8WB 1P04A 3M5OA 1FPHH 1L0ZA 4WMEA 1Q3XA 1WUNH 1JIMA 4NIYA 1AUJA 4WY3A 1J9CH 2BLOA 2G00A 2BLWA 5FBEA 1A5IA 4BTTB 1HCGA 1V2RT 3RXRA 2QV1A 2VWNA 3SQEE 1C4U2 3RXAA 5E0JA 4DVAU 2ZCKP 1TFXA 4IC5A 1DANH 1Y5BT 4A6LA
chains in the Genus database with same CATH superfamily
2VIOA 2ZCLP 2ZO3H 3GY7A 1P2OA 4JYTA 5HMAA 3TH3H 1J15A 1T8OA 4KP0A 2G4UA 1YLDA 1EJNA 4DIIH 2V7QD 5AFYH 1UHBA 1CHOG 4HGCA 3PTBA 1DSTA 1JMOH 3RLYH 4CR5A 1D3TB 2EI7A 1SMFE 1AVXA 2TGAA 4Y71A 4ZMAH 2Z94A 1FY8E 1FN8A 2Y5GA 4ABBA 5SGAE 4DGJA 4CRGA 3MU5A 1V2PT 4B6FA 3ZZ8A 2IN2A 1P05A 1O3JA 1GDNA 2SGQE 1BTYA 2ZG0H 4YO9A 1NRNH 4YZUA 1Z6JH 1YPJH 1P0SH 4A7IB 3LJOA 1GI9B 2VWLA 5F8ZA 4Z6AH 2PGQB 2CK3D 4XBDA 2ANKH 1RD3B 4K5ZA 1C1OA 4IMZA 3SGAE 1L1NA 1ZHPA 1SB1H 1LKAA 1IQIA 2O9QA 2CF8H 4Q4LA 1RXPA 1FDPA 3MH6A 1GBIA 4DY7B 4F48B 2B9LA 1C2EA 1QZ8A 4Y7BA 5EQSA 1G2LA 4JK5A 3MQKC 2VIVA 1C2MA 5FX5A 1T8LA 3D23A 1HBTH 1YF4A 1YPLH 3UWJH 1K1LA 3LC3A 2KAIB 3E8LA 4MNWA 2A7JA 3SUEA 8GCHG 3RMLH 1MU8B 1UTMA 3UTUH 1O3CA 1OP0A 5LPEA 1GI4A 2Y80A 3QZRA 1QA7A 2QCYA 4HZHA 1SLWB 1M9UA 1O5BB 1ANBA 3QK1A 4NZQA 5C3NA 1BMFD 2EI6A 2HNTE 4FUDA 2QN5T 1SGIB 1AKSB 1K22H 1K0HA 1NFYA 5A8ZA 1C1VH 2J4IA 3PV2A 3TPIZ 2AS9A 2Z9GA 2BOKA 2SGDE 3Q76A 4IN1A 5LPFA 3RU4T 1XUIA 2XBXA 1NT1A 5IYTA 4ABJA 3GCHC 1SL3A 1K1IA 3TJUA 1ETTH 3F68H 1TX8A 1C1UH 3RXUA 1TNHA 1RTLA 3DSGA 5EQRA 1UTKA 1WSSH 4OS7A 4MPVA 2ZA5A 2A7CA 3ATWA 2TBSA 3UNSA 3LJJA 8LPRA 2OLGA 1C1WH 1KDQA 2O8TA 1EXFA 1MTWA 2SGPE 4XD7D 1V2NT 3VB7A 4K60A 1MTNC 1AVGH 2FXRA 4TYDA 5ETXA 1NBMD 4A92A 4ABEA 2XRCA 3UIRA 1MD8A 5E2OA 3GCTF 4UFFH 2ANWA 1GHVH 1ESTA 3KGPA 1C5SA 3D62A 1MTNB 1OWIA 1HAHH 2NU2E 1BTWA 1DS2E 1PPHE 2C93B 1RTKA 1A3EH 1MQ5A 1CHGA 2GCHF 3MHWU 1W7XH 5E0HA 3MH5A 3U1JB 2V3OH 2VIWA 3KCGH 4TSFD 1TAWA 1GHAG 2OCVB 3T62A 5A2MH 2P16A 2XXLA 5EOKA 1O2RA 1XX9A 4WF8A 3GY6A 2A0QB 1MH0A 3ZZ7A 5L2YH 2BY5X 1HIAB 1KTTB 2P8OC 1GMHF 1LHCH 3UR9A 2IOTA 2TGTA 1TBZH 2BD9A 2KCPA 4K1EA 1ZR0A 2Z3DA 1NFUA 3TK5A 3M5LA 4UE7H 3F3BA 2P8OB 4RSPA 5CHBA 2NWNA 1P2QA 1L1JA 2PR3A 1GI8B 3I78A 1GGDC 1AD8H 1QRXA 3A82A 2BVXH 1ANCA 1IHSH 1LMWB 3RUOA 1T8NA 1GI1A 1YPHC 2ZU2A 4HG6A 4F4OC 1GGDB 3LPRA 4MNXA 4UEHH 4X1PU 3HGNA 1GJDB 3F9FA 1O2VA 1TRMA 1YYY1 2BD8A 5CMXH 4AYVB 4MVNA 5JBCS 1O38A 3MI4A 2ZKSA 3RXTA 1C9PA 2ZHFH 1GHXH 4NSVA 2B8OH 3MU4A 3BTEE 5DP8A 1EKBB 4KTSA 1ETSH 1O2LA 5C5NA 2PV9B 2GDEH 2QIQA 2R0LA 3UOUA 3KQBA 1AWHB 2F3CE 3LGTA 1AFQC 2OC7A 2ZGCA 1C1RA 4DT4A 2KAIA 1SHHB 1V2MT 2XBVA 3MWIU 1SGDE 2XC5A 1PJPA 4X6NA 1KY9A 4I31A 1UTNA 4DOQA 3SV6A 1AFQB 2HVXA 1IQHA 1IQJA 2BZAA 1W12U 2RDLA 1DLEA 3ZVBA 1IQMA 1CBWC 2XBWA 1BTXA 1QTFA 1Z8GA 1FPCH 4INLA 3UB0A 1C5RA 3MO6A 3VB3A 1GVZA 1AKSA 2KX4A 2ANMH 1EZXC 1SOTA 1RIWC 3ATKA 5AHGH 1CBWB 2A4GA 2LP6A 3C27B 5FHTA 3GISB 4Y0ZE 4TPIZ 2FS9A 3L3TA 3FZDA 1G36A 1PPFE 3PROA 1GBLA 1SLUB 3U8TH 4Y7AA 1O2XA 1NU7B 5C67A 1G3BA 1TIOA 1XMNB 1H9HE 1N1LA 2BY9X 3BEUA 4KTCA 1MU6B 3BN9A 2OUAA 3U1IB 3MH4A 4Q7ZA 2YMSD 4MDSA 1AUTC 2FOAA 1DT2A 3VB6A 1EAXA 4E06H 1SVPA 3M61U 1SKYE 1D3DB 3ZZ6A 5PTPA 3SU6A 2ASUB 1SGTA 3CENA 4ABDA 3MYWA 4DIHH 2A5KA 4AGJA 1QA0A 1Z71A 1K9OE 1TGNA 4ZHLU 3FP6E 3KIDU 1FUJA 1O2NA 1TPOA 1GMDG 2ZZUH 1VZQH 1LQDB 5GXPA 2JIZD 4P00A 1ZGIA 5C0TA 1QR3E 1COWD 3OYPA 2BY6X 1QJ6B 2SNWA 1FNIA 1H8IH 2M2AA 2XBYA 3T5FH 2OBQA 1W14U 3N7DA 4A5TS 1ACBE 5DP5A 1TRYA 3RDZA 1A0LA 1ZOMA 5J4SA 3M36A 1OWEA 3SJKA 1GHYH 3RXPA 4AZ2B 1Y3YA 1VITG 1G9IE 1QRZA 5EPNA 1GHWH 1SQOA 2W6ID 5DP4A 1RTFB 4WMFA 4AOQA 1HIAA 1O2QA 1PQ5A 1PPCE 4K3JA 1L4ZA 2AHME 2FODA 1HFDA 1CQQA 2STBE 5EXMA 3QDZB 1GMCG 2DE9A 1A2CH 1O2MA 1FIWA 5HGGA 2PUQH 1N6XA 4YXWD 1GDUA 3LH3A 1J17T 1O3LA 3UUZA 3URCA 1GBFA 5E8EH 3KQDA 2VGCC 2THFB 1C2HA 1MZAA 3W1EA 2IJOB 1O2KA 3OSYA 2A2QH 6GCHF 3GICB 3SNEA 3BG4C 3EAJA 3ELAH 1O5CB 2VGCB 5B6OA 2J94A 4AYYB 1OP2A 3RC4A 3UWIA 2GZ7A 3BG4B 2WPKS 3S9CA 2A7HA 4BXWA 1TNLA 3NPSA 2BYAX 3LGUA 1ZSLA 1EZUC 1C1QA 1LVYA 3H5CB 5FXLA 1O5EH 5GJ4B 3SNBA 4O9VA 4OS5A 2Q1JA 1C5XB 2ZWLH 3A86A 1KTSB 2AMPA 1MTVA 1O31A 1TB6H 4FU7A 1QBVH 2WUCA 3PMHB 3HKJB 1P8VC 1FY5A 4J1YA 1FAXA 2IJD1 3OY6U 1F2SE 1O39A 1GJ9B 1NC6A 1FIZA 3M5NA 1QB9A 3HK3B 2ANYA 5H4IB 2ODYB 1EZSC 1AI8H 2BDBA 3BTDE 3D49H 4ZCNA 3ZYEA 1TNJA 3A84A 1ZRBA 4A1VA 1AE5A 1CGIE 1TA6A 1QY6A 5AF9H 2BTCE 2VVVA 1ZZZA 1UTOA 1Y5AT 3M7TA 3RMNH 3HKIB 1NRSH 1TNGA 4ABFA 2KZ4A 1E35B 3P70B 4GPGA 3L33A 2AIQA 1C1NA 2L6OA 4MTBA 4Q63A 4X8TH 3ENSB 4ISLA 1P9SA 2GZ8A 3RM2H 2J38A 5K7RA 1RRKA 1O5AB 3KEEA 1QQ4A 3M37A 3GYMA 4D7FA 1DICA 1ZGVA 5ESTE 1ZMJA 2K8IA 4UFEH 3A83A 1UTPA 1BMLA 4J2YB 4FU9A 3FAOA 2WPIS 1JIRA 1KIGH 4NG9H 5JBBS 5CHAC 4Z0KA 1KLTA 2VNTA 1NRQH 3ZVEA 3ATIA 3RXOA 3WWFA 1OX1A 1C2IA 1Y3XA 2QAAA 5FPSA 4TWYA 4B73A 5EJLA 1VJ9U 5LH8A 2SGEE 7GCHG 1LPZB 4JZ1A 3P8OA 5CHAB 1DITH 2FOMB 4AG1A 4X8UH 3SW2B 5C1XA 1F0SA 2FS8A 3NK8A 3MFJA 1CT4E 1F5RA 4MPUA 5E2PA 2P59A 2ZHDA 1HAYB 1Z8IB 2GVFA 2R9PA 3ZZCA 3KYGA 2KM0A 1ZTKA 4K1SA 4TT3D 4YESB 3RM0H 5GCHF 3A7XA 1G3CA 3SNCA 4DURA 3AAVA 1HGTH 2VB0A 2A32A 3M3TA 1AMHA 4GLYA 4LOYH 2QE7D 1CGJE 1O3AA 2HWLB 2NU0E 2BX3A 2PKAB 3S9BA 4CH2B 4H6SB 1YPHE 4FUFA 5F8TA 3LC5A 3RXDA 7LPRA 1PPBH 3SJ8A 4ESTE 2VWMA 2A4QA 1H9IE 2AYWA 4U2WA 2LNCA 3EA7A 2HRVA 1EP6A 1ABIH 4AX9H 2D2DA 1BTHH 4BAOB 2G8TA 2NU4E 1O3BA 3PO1C 3BTME 5C1UA 1FV9A 1DXWA 1FZZA 2ZPRA 3QWCH 4D76A 2KCOA 2ZFFH 1B5GH 1EP5A 2ZU3A 4UONA 2HVYB 3QGNB 1XUJA 1Z8RA 4FUBA 3PO1B 3Q00A 3AVZA 1A46H 1BJUA 3SUGA 4TY6A 1JXPA 2F91A 3LOXA 4BOHA 2ZDLA 4PROA 2HALA 2ZFPH 3PLBA 3SJIA 5GWZA 1SGEE 1FONA 3GDSA 1ANDA 1P2IA 1D4PB 1EOJA 4AB9A 1C1PA 4BAHB 4YT7H 1FY1A 4YOIA 2QXIA 2D8WA 1NTPA 3FKSD 1S82A 4Y0YE 1UCYH 1TYNA 3SHCH 2BHGA 1V2KT 4X2WA 4DCDA 4E05H 4X6OA 6LPRA 2WV5A 2V6NA 1EATA 1A4WH 3KYFA 1ZYOA 2VVUA 4KGAA 1O3GA 3ZZ9A 1SG8B 4X2VA 1PQ7A 3L6PA 2FLBH 4ZHAA 4X8VH 4XFQA 2D1JA 3MNSA 1P06A 3H7TA 4F55A 2BDGA 1LO6A 5DGJA 1YY3A 2A1DB 1Y3WA 1QGFA 2ZCHP 3QTVH 1OOKB 3SUDA 4O3UA 4OS1A 3MOCA 2QXJA 1C2GA 1GBBA 3SOSA 2GDDA 1TONA 2UWOA 2ALVA 1MD7A 1QB1A 4FETA 2TPIZ 1TQ0B 2FI4E 1QRWA 3RC6A 4OS2A 3KQEA 1BTZA 4FUCA 1TMBH 1YGCH 3EGKH 4GVUA 3UFAA 1ZSKA 3SNDA 2QA9E 3TGIE 3DUXH 2KFWA 3Q77A 1V2LT 1OWKA 1YPGH 1BHXF 2CV3A 5DP6A 6GCHG 5LPRA 3SUFA 2BQ7B 1RJXB 5IK2D 4HFPB 2BB4A 4AFQA 1C5UA 5C17A 3PMAB 1C5WB 2QGRA 3TH4H 1IHTH 4X0WU 1BQYA 2QXHA 2M5TA 2ZQ2A 3NXPA 1ABJH 1QJ7B 1C5PA 4CBNA 3BV9B 1ZSJA 3BEIB 4JMYA 1K2I1 4O97A 4DJZB 1S84A 2ZECA 3S69A 4CRDA 4WVPE 1UO6A 4INKA 1VJAU 3BIVH 2IPHA 1OXGA 1CA8B 1KXFA 3IWMA 4U01A 1TALA 2P93A 1BRBE 1ZTLA 5EJZA 2EQNA 2GMTC 2AFQB 3T2NA 4JZFH 3TITA 1NN6A 1HDTH 1P9UA 2PTCE 4HTCH 3FVFB 4NZLA 3IITA 4NGAH 2GZ9A 1PPZA 1UK2A 1Z1IA 1EPTB 1XKBC 2GMTB 5HIYA 1THSH 1K21H 3F0OA 1W0ZU 1C2KA 1TNKA 2A5AA 3EA8A 4ZKNU 1E1QD 2H5DA 1G37A 3KN2A 2PKAA 2OC8A 3A7VA 2ZC9H 1YPEH 1OYQA 2I6SA 3KL6A 3Q3YA 3PM3A 4H42U 1UK4A 3GY5A 3QX5H 2G4TA 1S81A 3GY3A 1O3PB 2PSXA 8KME2 4OM9A 1A3BH 5TJXA 2YOLA 2Z9KA 1Y5UT 2ZDAH 3BTQE 4TY7A 1DVAH 2FOGA 3RXEA 3VG8A 1EB2A 1V2WT 3UNRA 3EA9A 4AORA 1F5LA 1GI7B 4OS6A 2DE8A 1SGRE 1D3PB 1GBJA 5CDFE 4JCNA 2FEQH 3RXMA 2W5EA 1P12E 3UY9A 2H1UA 3A8DA 1TMUH 4VGCC 1N6YA 5IDKA 1ELGA 2A2XH 1TX6A 1O5GH 1W0KD 4FOUC 2FOCA 3K6ZA 1ZRKA 2RA3A 3TNTA 1OSSA 1EJAA 4VGCB 1O3KA 1QBNA 5L2ZH 2HOBA 2ZU1A 2BXTH 2ZU4A 7ESTE 3A7TA 3BTKE 5A0AE 1HNEE 1O2SA 4RKOB 1HAIH 1K1MA 2SFAA 1O3DA 1H4WA 2CHAB 5AFZH 3V13A 2C4FH 4FUIA 4D9RA 1TX7A 4CRFA 4D8NA 4XDEA 2ODQA 2P95A 5GCHG 1DLKB 2OQ5A 1WDIA 1C4V2 5A09A 1OWHA 3SHAH 1LPGB 2JKHA 4WH6A 1HAPH 2EY4C 2FOFA 4I86A 1ELVA 2Y7XA 2PLXA 3M7UA 3O8CA 2SGFE 1XXDA 3HPTB 4NA7A 4SGBE 5A8YA 1GCTC 1GWAA 2WPDD 1WV7H 4GHTA 4B74A 4WMDA 5EU8A 2BQ6B 1LHFH 5B6LA 2Y6TA 1S6FA 4IW4E 1BRUP 1AVWA 1GCTB 1SLXB 4Y6DA 1MQ6A 2R3YA 4ASUD 3ZZAA 1S6HA 2ZIQH 1GJ6A 3OTPA 5K0HA 1MKWH 2ZQ1A 1BHXB 2GT8A 4ABGA 5FX6A 1SOZA 2BLQA 1TPPA 2YNBA 1MBMA 3PWBA 2BD3A 1BA8B 3RU4D 4ZKRU 3W94A 3RMMH 3A8CA 1O2HA 1GJAB 3DSOA 5T6DA 5A0CA 1HAXB 2GGVB 1T4UH 1CE5A 4ACAA 3M5MA 2J9NA 3E3TA 4XE4A 2FOBA 1P02A 2PSYA 4I32A 1DE7H 4Y8XA 4BTIB 3RXJA 1GBDA 2V0BA 3GDVA 1GJ8B 5BRRE 1UMAH 3E1XB 4NWKA 1WYKA 1DY8A 2Q6GA 2W3IA 2O8MA 3SI3H 5FAHA 4B2BA 1BDAA 4CBOA 5GIBA 1UJ1A 1TPSA 1OHHD 1AU8A 1XUFA 2PFEA 2FTMA 2UUFB 2YNAA 2VIPA 2KCAA 4BAKB 2CGAA 4JZDH 3T26A 1INCA 2QXGA 1O2UA 6ESTA 2HLDD 4GHQA 1SLVB 3D65E 4GUXA 4GAWA 3MU0A 1O2PA 1YLNA 3SORA 1E36B 3BF6H 3FP8E 2Z9LA 4H6TA 1NRRH 3PV4A 1WU1A 3SBKA 1W8BH 1MAYA 3KQ5A 2J34A 1ZPCA 1T7CA 1XUKA 3ZZ4A 1AY6H 4FVBA 1KYNA 3OTJE 2WSSD 1YPKH 3E0PB 1GHBF 2ZGJA 2B0FA 1AGJA 2GP9B 1C5YB 4AFZA 5AVDA 2FM2A 1O2YA 2F9BH 2C90B 2G5VA 3BIUH 3NUMA 2EC9H 4XRNA 3E0NB 1IAUA 2H6MA 1W0YH 3UPEA 1S6LA 3M3SA 3P8FA 3DFLA 1HRTH 4Y8ZA 1V2VT 1LHEH 1OS8A 4ZKSU 3SJ9A 3QUMP 3O8DA 3T25A 4X1NU 1Z8JB 2YMSC 3MO9A 4CREA 1ARCA 1ZMNA 1N8OB 1VR1H 1XVMA 2QC2A 3FOAA 5EXLA 3B23B 3KQCA 2YMSB 2G81E 3C1KA 2FI3E 4K1TA 4KELA 3LGWA 1Y3VA 1QCPA 5ESBA 1TNIA 2FIRH 4H4FA 1U6QA 2UUYA 2C8YB 3RXCA 1MCTA 4RKJB 3PRBA 3MH7A 4X6PA 4FU8A 3FP7E 3TGKE 2Q6FA 3A7WA 3A80A 3QO6A 3RXIA 2XOKD 1PPGE 2LELA 1PPEE 2H2ZA 2W26A 2Z7FE 1UCYK 3RXHA 1Z6EA 1BRCE 5F03A 1C5OH 1DUAA 1BBRH 5FCRA 1IOEA 1W13U 1PFXC 3RXQA 5GNDA 2UUJB 3P95A 3R3GB 1NPMA 9ESTA 3SYJA 4AN7A 1JWTA 1TPAE 1CHOF 1QB6A 1H1BA 5JPMH 1BBRE 3UR6A 1CGHA 2ZTZA 5DPAA 3TVJB 2VIQA 4I8JA 4NCYA 2RDEA 5FCKA 1TMTH 3EE0B 5T3HA 3T29A 1QIXB 4MPXA 5EGMA 2ZHQH 2UUKB 4BAMB 3PB1E 1HPGA 2BX4A 2BY8X 5EODA 4ABAA 3SU3A 3RXSA 1LTOA 3DT0H 4A1XA 2VINA 2EA3A 2JDID 2F9OA 2AERH 2LPRA 1AFEH 4YOJA 1A0JA 3E90B 1FQ3A 2QF4A 1SPJA 3DA9B 3GCTG 2H9HA 3TK9A 2BD2A 1W10U 3V3MA 6CHAB 2EEKA 2XYAA 3GOVB 1GL1A 5C5OA 3DCLA 8ESTE 1SHYA 1PYTD 3ZV8A 1GI2A 3EDXB 3ESTA 1MAXA 3K2UA 2GCHG 1K1NA 4CH8B 2P3FH 1K28D 1NY22 1ZPZA 3TJNA 4I8LA 8GCHF 1IQFA 2PW8H 2F9PA 1A5GH 4FUGA 1O5DH 1QNJA 1A61H 2HPQH 2WINI 3MU1A 4X1SU 5E0GA 3DSPA 2CXVA 2WPMS 2UWLA 1GMHG 2ZFTA 7KMEH 3ZVCA 4X2XA 1NESE 1DXPA 1XM1A 3UQVA 1UW7A 3O8RA 1GL0E 1HLTH 2NU3E 2TRMA 3GY8A 1B0FA 1DY9A 2VBCA 1EQ9A 2QF3A 5DO4H 1YCPH 1Z7KA 4AG2A 1HAVB 3H09A 1FX0B 1WTHD 3LH1A 1EOLA 1CU1A 2BZ6H 1ELAA 1GJBB 1TGTA 3N7OA 3OFND 2F83A 1DSUA 2ZFSA 3A89A 2GV7A 4K8BA 2HLCA 1J14A 4IN2A 2PUXB 4WJG2 3SN8A 1LHDH 1K1JA 3S7KB 2HGTH 2PGBB 3RXKA 1ELBA 4YLUA 2TGPZ 3R0FA 3MNBA 3NZIA 5KEDA 2ESTE 1KLJH 4NFFA 1NBME 4WXIA 3G01A 4O3TA 1YM0A 2VWOA 1V6DA 2BOHB 1D6RA 3M35A 2ZGXH 2OTVA 1SGQE 3MNXA 2V3HH 2ZTYA 2JH6D 2QF5A 1O34A 2FPZA 3A8BA 2W7UA 1LPKB 3GY4A 4ABIA 4RT1A 1BTUA 5HYOA 3PWCA 5HM2A 3A7YA 5TCAA 2SNVA 1EAUA 1JBUH 2Z3EA 2J97A 2L74A 3GCOA 2Y81A 1EJMA 2OXSA 1DM4B 1XUGA 1GHAF 3F9HA 3BSQA 1GBMA 3W95A 4E7RG 5KECA 2PHBA 1D3QB 1F0UA 3NRLA 2FP7B 3SU4A 4ZUHA 1BCUH 5C2ZA 1A1RA 3SU1A 5F8XA 3SGBE 1C2FA 2K1QA 1RGQA 3PMBB 4AFSA 1YCPM 4UD9H 2ZFRH 5EW2H 3Q3XA 3A7ZA 4YOGA 1O2WA 1FN6A 1RS0A 1GVKB 4BANB 1P2KA 2OP9A 5F6MA 3AASA 2ILNA 1VGCB 4BAQB 2ZGHA 3NKKA 4NA9H 2OD3B 2ZHEH 2VIDA 1F0RA 3KHVA 4K69A 3RXGA 4AB8A 1AWFH 5JB9S 4WWYA 1G3EA 2ZI2H 1P11E 4D7GA 1EFRD 2Z9IA 3ZVFA 4M7GA 5DN6D 3E16B 1F7ZA 1O3EA 3DD2H 1P3EA 1THPB 1W11U 2ZU5A 4Y76A 1EASA 5DKMA 2FOHA 2BDCA 4A1TA 3ODFA 4FVDA 1F92A 4YT6H 2DUCA 1C2DA 3GCNA 2BD5A 4GSOA 4IGDA 4ISNA 4MNVA 1GPZA 4ASHA 1C2LA 1MKWK 2Y5HA 1O2GH 3LONA 1TABE 4WH8A 2HPPH 5G4BA 1LDTT 4GCHF 3F0PA 3ZYDA 2WZQA 1QL8A 3K6YA 2BY7X 2RG3A 3N7EA 1DX5M 2FESH 3B9FH 1K1OA 2FI5E 1QQUA 4ABHA 3TIUA 2JJ1D 2FX6A 1UCYE 3CP7A 1FY3A 1VCPA 2BMGB 3SU2A 1H9LB 1HB0B 1TBQH 5JBTA 1O2ZA 4BTUB 1TE0A 2XC0A 2A4RA 4SGAE 3FANA 2RA0A 2ZF0H 5GDSH 2FZZA 3RXLA 3U28C 2ZDVH 1SQAA 3OX7U 2FO9A 3M3VA 1EUFA 1PQ8A 1S0RA 1L2EA 5DP3A 1O30A 2XC4A 3UNQA 4ZKOU 1F0TA 4LXBH 1MKXH 1P03A 3RXFA 1C4Y2 5F53A 3BEFB 1LVOA 2WHXA 1HAVA 4WXVA 1GBCA 4JZEH 1C2JA 4CR9A 2OC1A 3KF2A 3F2FA 3Q3KA 1GJ7B 1UTLM 3VXFH 3OY5U 5A8XA 3DFJA 3ODDA 4TPYA 2CMYA 1OWJA 3BTGE 3H7OA 3VEQB 1D9IA 4Y8YA 2BD7A 2AGGX 2W6JD 2ODPA 1NFWA 3WY8A 1WQSA 3GY2A 1QL7A 1ESAA 3TLOA 5L6NH 2FOEA 3T27A 1WBGB 2I6QA 1LQEA 3LDXH 4F49A 1O3IA 1HAZB 1V2QT 3A88A 1GMDF 2R2MB 2OK5A 2Z6BD 2GTBA 5TCCA 1EPTC 1O5FH 3T28A 1EAWA 3RMOH 1P2NA 1DWEH 1CA0C 1ZTJA 1J8AA 5DP9A 2K0QA 1SI5H 1DWDH 2G55A 1MTSA 1IQEA 2QYIA 5C0UA 3TJVA 1CA0B 1SGCA 4AC9A 2Q6DA 3F9GA 4M9FA 1DPOA 2J5UA 2QY0B 1UK3A 2ZDKA 2ZHWH 4ZH8A 1BZXE 1VITF 3P92A 1KXCA 1NZQH 1HUTH 1ELFA 5DK1A 1GI3A 4ZXXH 3CS0A 4NIXA 1DFPA 1QURH 2J95A 3BG8A 1QBOA 3U98H 5DSFA 1BITA 4I8KA 4U32A 1GMCF 1BMMH 1T4VH 4RN6A 1T32A 1BUIA 1SGFG 4B2CA 1TWXB 3RXVA 1HYLA 5JBAS 4JYVH 3TNSA 3P8GA 1BBRK 3SU0A 3MU8A 4UFGH 2VU8E 4K8YA 2H9EH 3OE7D 1AO5A 3GCHB 3SV2H 3WWBA 5JYIA 3QGJA 2VH0A 4IMQA 2PTNA 1HXFH 2Y82A 3AAUA 5BPEA 1SQRA 4TWWA 5LGOA 3FN8A 2KR7A 4B76A 5CE1A 4MLFB 5T6GA 4OS4A 2FYRA 2ZP0H 1P09A 2CHAC 4DG4A 2OQUA 3P17H 3PLKA 1BJVA 3UQOA 2C8XB 3I77A 3BTWE 3KNXA 2Z9JA 1YLCA 1E0FD 3MNCA 1V2JT 2Y7ZA 2FX4A 1BMAA 2ZPQA 4X1QU 2C8ZB 4XOJA 2O8LA 3ITIA 2BD4A 3LGIA 1MMJN 1SGYE 4LK4A 1ZJDA 3ZZ3A 3ATLA 3OAAD 1GI6A 1Q31A 1GJ5H 4JK6A 4XBBA 1GJCB 1KXAA 3ZZBA 1MBQA 1XXFA 1LCYA 1O3OA 2BM2A 1O33A 2GKVE 2XTTB 1P57B 4O03A 4Z1MD 2XWBI 1ZHMA 2BLVA 3IG6B 1T8MA 1ZLRA 1OWDA 4ZXYH 3PRDA 3SO3A 2GT7A 2FLRH 1IQNA 4FUJA 1LVBA 3AW1A 2ZDMA 3F9EA 5C20A 1HJ9A 2OINA 3B8JA 1FY4A 3QLPH 2GCTC 2H9TH 4E7NA 3SZNA 2TIOA 1O37A 1SGFA 3JZ2B 3QTOH 1BTPA 1C5QA 1GVLA 2AIPA 1C5LH 2AMQA 5DP7A 2BDHA 5FL7D 2R3UA 4NA8A 2GCTB 2PKSC 2JJ2D 1TGSZ 4KTUA 1G3DA 1AN1E 1GBAA 2R0KA 3SNAA 4OGXA 1ZPBA 1S0QA 2HNTF 5EIYA 2W3KA 1CT0E 1L4DA 1YCPK 2F9UA 2A5IA 2PKSB 1GHZA 2QF0A 1ZJKA 3EE7A 1F5KU 1PQAA 4ISOA 1AB9C 1O3MA 2P3UB 1G32B 4CHAC 1S5SA 4UFDH 2WPJS 2A45B 5HM9A 2WPHS 1ZMLA 3SV8A 3UOPA 3K65B 2R2WU 4Y10E 1SC8U 3OU0A 1KXBA 1AB9B 1TOMH 3TH2H 5GPIB 4CHAB 2FYQA 1YKTA 3V12A 7GCHF 1T31A 9LPRA 1H8DH 1THRH 1A0HB 4GCHG 3JZ1B 1E38B 2XCFA 1AQ7A 3F1SB 3A87A 3SI4H 4NWLA 1HXEH 3QN7A 1NROH 4THNH 3CS7A 3S7HB 1ANEA 3P6ZB 1EPTA 4Y11E 1V2OT 4Q7XA 1NFXA 5EQQA 3LU9B 1QHRB 2V3MA 4CRCA 1VCQA 1SGNE 1TBRH 1UVPA 3P8NA 4XBCA 1NM6A 2BDIA 4MNYA 1TQ7B 4B1TA 3F2GA 3SV9A 2J98B 2FWWA 1O36A 4X6MA 3HK6B 4UDWH 4RT0A 1DWCH 3RLWH 1H8ED 2ZGBH 2JH5D 3PLPA 2XCNA 4LZ1H 3VB5A 2WUBA 5EPYA 1ELCA 3SV7A 1Y3UA 3A81A 1DOJA 1DUEA 5I46H 5JDUB 5EG4A 3U69H 1MZDA 1RIWB 3DHKH 1TA2A 4NFEA 1HJ8A 3VB4A 1K1PA 1N8OC 1XKAC 1UVOA 1V2ST 1EX3A 1OKXA 4IS5A 2W7SA 1BT7A 3NCLA 2AEIH 4I33A 2VJ1A 4KKDA 4R0IA 1SGPE 2PWXA 4DW2U 3SQHE 4X1RU 1SR5C 1L1GA 3MO3A 3ZVAA 1Y8TA 3VFEA 1KSNA 2AGIX 2A31A 3VXEH 3STIA 5EXNA 5I25A 2CJIA 1DDJA 2IPQX 1XUHA 2SGAA 1BB0B 1D6WA 4OGYA 2O8UA 3GYLB 2Z3CA 4DT7B 1A5HA 3UAIC 4HI3A 1AHTH 1V2TT 2GV6A 3PYHA 2BVRH 1YWUA 4ZAEA 5EW1H 4CRBA 4Q7YA 3S9AA 1C9TA 1LHGH 1BMNH 1P2MA 4MG3A 3LT3A 5A0BA 1DWBH 1LVMA 5FPTA 2F43B 3S0NA 5ABWA 3F2HA 1C5MD 2BDAA 1H8HD 1C1SA 3PTNA 3RP2A 4K2YA 1ESBA 1FAKH 1FXYA 2BQWB 1TLDA 1W0JD 2FDAA 2OC0A 2HNTC 4IBLH 4BXSA 3LKWA 1GCDA 3HATH 1NS3A 1P10A 2ZNKH 1C1MA 3CNRA 4U30A 2B7DH 1WXRA 1AIXH 1HV7A 5C1YA 4XSKU 1ELEE 1WQVH 3VPKA 1AE8H 3BTTE 1MUEB 2AGEX 2C3SA 2WV4A 4YM9A 1ORFA 2D26C 1C1TA 2UWPA 4BNRA 1AZZA 2O8WA 3SGQE 6CHAC 4YTAA 1GBHA 2WYGA 2XNDD 1MKXK 1TGCA 2ZPSA 4D9QA 2G51A 1C5ZB 1SFIA 1SSXA 2G52A 4B2AA 1JRTA 3BTFE 1O0DH 3SU5A 3ZV9A 1W7GH 3PV5A 2V35A 1GDQA 4I8HA 5EJ1A 2WPLS 2XWAA 3E91A 3M7QA 1WAYB 4NSYA 4MQAA 1B7XB 3EYDA 1P01A 1BOQA 1QFKH 4Y79A 3A8AA 1MCVA 1Z1JA 2ZEBA 1J16A 2B5TB 3K9XB 1G30B 4B71A 1GJ4H 3UREA 1G2MA 3V7TA 2CF9H 3O8BA 3ZVGA 1FJSA 1ARBA 3FO8D 1P2JA 1B0EA 1Q2WA 3QZQA 1PYTC 3LIWA 3AW0A 1FMGA 1BRAA 1E1RD 2WYJA 4ISHH 1O2IA 1VCWA 1C5NH 1SFQB 1YC0A 3TGJE 1ID5H 4FXGH 2AMDA 1S85A 5JB8S 1EZQA 2JH0D 1SQTA 2FTLE 2H5CA 3EQ0H 3ZIAD 1SBWA 1E37B 4I7YH 1XVOA 4LZ4B 2CN0H 2J98A 1TOCB 1TRNA 1UHBB 3A85A 2VH6A 4I8GA 5T1VA 2FMJA 2XW9A 1JOUB 3PMJA 2F9NA 3STJA 2ALPA 3URDA 2F9VA 5HKKD 4R8TB 3GS9A 1HAOH 3TU7H 5FBIA 1KXDA 2JETC 2OBOA 2RCEA 1O32A 1O3FA 3VGCC 1V3XA 1OPHB 3SZEA 2STAE 1GBTA 2GD4B 2AH4X 4ISIH 1UTQA 4ZROA 1C5TA 2JETB 2XNIA 1A7SA 1WTGH 1FLEE 1O2JA 2ZFQH 3VGCB 4NIVA 1YBWA 1JRSA 2BXUH 4Q80A 3LGVA 3ZVDA 1KXEA 2BDYA 2Y5FA 4YLQH 2NU1E 4X8SH 3MTYA 3U8RH 1ELTA 3ZZDA 3ZZ5A 3TJOA 2J92A 1WOFA 1LKBA 5FPYA 4JYUH 1C5VA 1TGBA 5HIZA 3LGYA 1O3HA 3ATMA 3F6UH 4MPWA 4Q2KA 1Y59T 2TGDA 1GG6C 3E6PH 4AFUA 2GX4A 3RXBA 4B6EA 1EB1H 1OP8A 1UVUH 2A4OA 3V0XA 3TK6A 1GG6B 1IQKA 4ZHMU 2PP6A 5HXFA 1S83A 1VGCC 3I29A 1P3CA 2F4LA 4INHA 3U9AH 2RFKC 2WV9A 1EAIA 3FFGA 4B75A 2ULLA 4FUHA 1FI8A 1BIOA 2J2UA 1IQGA 1O2OA 5C94A 1AZ8A 2ZDNA 1HAGE 1W3CA 5T6FA 1GI5A 1RFNA 3FZZA 5J4QA 1UVTH 3RC5A 1GI0A 1ZHRA 1GBKA 1HJAC 1VKYA 1GHBG 1E34B 1QL9A 3MMGA 2P3TB 5L30H 4QT8C 1IQLA 1YP9A 1YPMH 4ACBA 1QJ1B 2ZTXA 1NU9A 1HJAB 3GDUA 5DJ7A 1NRPH 1UVSH 1KDQB 3RU4E 1CO7E 1CVWH 1WCZA 5DG6A 3N99A 1O3NA 1X7AC 2G5NA 1UTJA 1O35A 1VITH 4CRAA 1ELDE 3OEED 4FUEA 1MTUA 3HGPA 3NWUA 4IC6A 4X2YA 1ETRH 2BVSH 1OYTH 1V2UT 1KLIH 2P94A 1O2TA 1GBEA 3U8OH 1NO9H 4JZIA 3SJOA 3AK5A 3BTHE 2GJGA 3OEHD 1CT2E 4RI0A 1KMHB 4NIWA 2VVCA 1W2KH 2EI8A 4AGKA 1CSOE 2C8WB 1P04A 3M5OA 1FPHH 1L0ZA 3WW7A 4WMEA 1Q3XA 1WUNH 1JIMA 4NIYA 1AUJA 4WY3A 1J9CH 2BLOA 2G00A 2KCYA 2BLWA 5FBEA 1A5IA 4BTTB 1HCGA 1V2RT 3RXRA 2QV1A 2VWNA 3SQEE 1C4U2 3RXAA 5E0JA 4DVAU 1MABB 2ZCKP 1TFXA 4IC5A 4P02A 1E79D 1DANH 1Y5BT 5KGOA 4A6LA
chains in the Genus database with same CATH topology
2VIOA 2ZCLP 2ZO3H 3GY7A 1P2OA 4JYTA 5HMAA 3TH3H 1J15A 1T8OA 4KP0A 2G4UA 1YLDA 1EJNA 4DIIH 5AFYH 1UHBA 1CHOG 4HGCA 3PTBA 1DSTA 1JMOH 3RLYH 4CR5A 1D3TB 2EI7A 1SMFE 1AVXA 2TGAA 4Y71A 4ZMAH 2Z94A 1FY8E 1FN8A 2Y5GA 4ABBA 5SGAE 4DGJA 4CRGA 3MU5A 1V2PT 3ZZ8A 2IN2A 1P05A 1O3JA 1GDNA 2SGQE 1BTYA 2ZG0H 4YO9A 1NRNH 4YZUA 1Z6JH 1YPJH 1P0SH 4A7IB 3LJOA 1GI9B 2VWLA 5F8ZA 4Z6AH 2PGQB 4XBDA 2ANKH 1RD3B 4K5ZA 1C1OA 4IMZA 3SGAE 1L1NA 1ZHPA 1SB1H 1LKAA 1IQIA 2O9QA 2CF8H 1RXPA 1FDPA 3MH6A 1GBIA 4DY7B 2B9LA 1C2EA 4Y7BA 5EQSA 1G2LA 4JK5A 2VIVA 1C2MA 5FX5A 1T8LA 3D23A 1HBTH 1YF4A 1YPLH 3UWJH 1K1LA 3LC3A 2KAIB 3E8LA 4MNWA 2A7JA 3SUEA 8GCHG 3RMLH 1MU8B 1UTMA 3UTUH 1O3CA 1OP0A 5LPEA 1GI4A 2Y80A 3QZRA 1QA7A 2QCYA 4HZHA 1SLWB 1M9UA 1O5BB 1ANBA 3QK1A 4NZQA 5C3NA 2EI6A 2HNTE 4FUDA 2QN5T 1SGIB 1AKSB 1K22H 1NFYA 5A8ZA 1C1VH 2J4IA 3TPIZ 2AS9A 2Z9GA 2BOKA 2SGDE 3Q76A 4IN1A 5LPFA 3RU4T 1XUIA 2XBXA 1NT1A 5IYTA 4ABJA 3GCHC 1SL3A 1K1IA 3TJUA 1ETTH 3F68H 1TX8A 1C1UH 3RXUA 1TNHA 1RTLA 5EQRA 1UTKA 1WSSH 4OS7A 4MPVA 2ZA5A 2A7CA 3ATWA 2TBSA 3UNSA 3LJJA 8LPRA 2OLGA 1C1WH 1KDQA 2O8TA 1EXFA 1MTWA 2SGPE 1V2NT 3VB7A 4K60A 1MTNC 1AVGH 2FXRA 4TYDA 5ETXA 4A92A 4ABEA 2XRCA 3UIRA 1MD8A 5E2OA 3GCTF 4UFFH 2ANWA 1GHVH 1ESTA 3KGPA 1C5SA 3D62A 1MTNB 1OWIA 1HAHH 2NU2E 1BTWA 1DS2E 1PPHE 2C93B 1RTKA 1A3EH 1MQ5A 1CHGA 2GCHF 3MHWU 1W7XH 5E0HA 3MH5A 3U1JB 2V3OH 2VIWA 3KCGH 1TAWA 1GHAG 2OCVB 3T62A 5A2MH 2P16A 2XXLA 5EOKA 1O2RA 1XX9A 4WF8A 3GY6A 2A0QB 1MH0A 3ZZ7A 5L2YH 2BY5X 1HIAB 1KTTB 2P8OC 1GMHF 1LHCH 3UR9A 2IOTA 2TGTA 1TBZH 2BD9A 4K1EA 1ZR0A 2Z3DA 1NFUA 3TK5A 3M5LA 4UE7H 2P8OB 4RSPA 2NWNA 1P2QA 1L1JA 2PR3A 1GI8B 3I78A 1GGDC 1AD8H 1QRXA 3A82A 2BVXH 1ANCA 1IHSH 1LMWB 3RUOA 1T8NA 1GI1A 1YPHC 2ZU2A 4F4OC 1GGDB 3LPRA 4MNXA 4UEHH 4X1PU 3HGNA 1GJDB 3F9FA 1O2VA 1TRMA 1YYY1 2BD8A 5CMXH 4AYVB 4MVNA 5JBCS 1O38A 3MI4A 2ZKSA 3RXTA 1C9PA 2ZHFH 1GHXH 4NSVA 2B8OH 3MU4A 3BTEE 5DP8A 1EKBB 4KTSA 1ETSH 1O2LA 5C5NA 2PV9B 2GDEH 2QIQA 2R0LA 3UOUA 3KQBA 1AWHB 2F3CE 3LGTA 1AFQC 2OC7A 2ZGCA 1C1RA 2KAIA 1SHHB 1V2MT 2XBVA 3MWIU 1SGDE 2XC5A 1PJPA 4X6NA 1KY9A 4I31A 1UTNA 4DOQA 3SV6A 1AFQB 2HVXA 1IQHA 1IQJA 2BZAA 1W12U 2RDLA 1DLEA 3ZVBA 1IQMA 1CBWC 2XBWA 1BTXA 1QTFA 1Z8GA 1FPCH 4INLA 1C5RA 3MO6A 3VB3A 1GVZA 1AKSA 2ANMH 1EZXC 1SOTA 1RIWC 3ATKA 5AHGH 1CBWB 2A4GA 3C27B 5FHTA 3GISB 4Y0ZE 4TPIZ 2FS9A 3L3TA 3FZDA 1G36A 1PPFE 3PROA 1GBLA 1SLUB 3U8TH 4Y7AA 1O2XA 1NU7B 5C67A 1G3BA 1TIOA 1XMNB 1H9HE 1N1LA 2BY9X 3BEUA 4KTCA 1MU6B 3BN9A 2OUAA 3U1IB 3MH4A 4Q7ZA 4MDSA 1AUTC 2FOAA 1DT2A 3VB6A 1EAXA 4E06H 1SVPA 3M61U 1D3DB 3ZZ6A 5PTPA 3SU6A 2ASUB 1SGTA 3CENA 4ABDA 3MYWA 4DIHH 2A5KA 4AGJA 1QA0A 1Z71A 1K9OE 1TGNA 4ZHLU 3FP6E 3KIDU 1FUJA 1O2NA 1TPOA 1GMDG 2ZZUH 1VZQH 1LQDB 5GXPA 1ZGIA 1QR3E 3OYPA 2BY6X 1QJ6B 2SNWA 1FNIA 1H8IH 2XBYA 3T5FH 2OBQA 1W14U 4A5TS 1ACBE 5DP5A 1TRYA 3RDZA 1A0LA 1ZOMA 5J4SA 3M36A 1OWEA 3SJKA 1GHYH 3RXPA 4AZ2B 1Y3YA 1VITG 1G9IE 1QRZA 5EPNA 1GHWH 1SQOA 5DP4A 1RTFB 4WMFA 4AOQA 1HIAA 1O2QA 1PQ5A 1PPCE 4K3JA 1L4ZA 2FODA 1HFDA 1CQQA 2STBE 5EXMA 3QDZB 1GMCG 2DE9A 1A2CH 1O2MA 1FIWA 5HGGA 2PUQH 1N6XA 1GDUA 3LH3A 1J17T 1O3LA 3UUZA 3URCA 1GBFA 5E8EH 3KQDA 2VGCC 2THFB 1C2HA 1MZAA 2IJOB 1O2KA 3OSYA 2A2QH 6GCHF 3GICB 3SNEA 3BG4C 3EAJA 3ELAH 1O5CB 2VGCB 5B6OA 2J94A 4AYYB 1OP2A 3RC4A 3UWIA 2GZ7A 3BG4B 2WPKS 3S9CA 2A7HA 4BXWA 1TNLA 3NPSA 2BYAX 3LGUA 1ZSLA 1EZUC 1C1QA 1LVYA 3H5CB 5FXLA 1O5EH 5GJ4B 3SNBA 4O9VA 4OS5A 2Q1JA 1C5XB 2ZWLH 3A86A 1KTSB 2AMPA 1MTVA 1O31A 1TB6H 4FU7A 1QBVH 2WUCA 3PMHB 3HKJB 1P8VC 1FY5A 4J1YA 1FAXA 3OY6U 1F2SE 1O39A 1GJ9B 1NC6A 1FIZA 3M5NA 1QB9A 3HK3B 2ANYA 5H4IB 2ODYB 1EZSC 1AI8H 2BDBA 3BTDE 3D49H 3ZYEA 1TNJA 3A84A 1ZRBA 4A1VA 1AE5A 1CGIE 1TA6A 1QY6A 5AF9H 2BTCE 2VVVA 1ZZZA 1UTOA 1Y5AT 3M7TA 3RMNH 3HKIB 1NRSH 1TNGA 4ABFA 1E35B 3P70B 4GPGA 3L33A 2AIQA 1C1NA 4MTBA 4X8TH 3ENSB 4ISLA 1P9SA 2GZ8A 3RM2H 2J38A 5K7RA 1RRKA 1O5AB 3KEEA 1QQ4A 3M37A 3GYMA 4D7FA 1DICA 1ZGVA 5ESTE 1ZMJA 4UFEH 3A83A 1UTPA 1BMLA 4J2YB 4FU9A 3FAOA 2WPIS 1JIRA 1KIGH 4NG9H 5JBBS 5CHAC 4Z0KA 1KLTA 2VNTA 1NRQH 3ZVEA 3ATIA 3RXOA 1OX1A 1C2IA 1Y3XA 2QAAA 5FPSA 4TWYA 4B73A 1VJ9U 5LH8A 2SGEE 7GCHG 1LPZB 4JZ1A 3P8OA 5CHAB 1DITH 2FOMB 4AG1A 4X8UH 3SW2B 5C1XA 1F0SA 2FS8A 3NK8A 3MFJA 1CT4E 1F5RA 4MPUA 5E2PA 2P59A 2ZHDA 1HAYB 1Z8IB 2GVFA 2R9PA 3ZZCA 4K1SA 1ZTKA 4YESB 3RM0H 5GCHF 3A7XA 1G3CA 3SNCA 4DURA 3AAVA 1HGTH 2VB0A 2A32A 3M3TA 1AMHA 4GLYA 4LOYH 1CGJE 1O3AA 2HWLB 2NU0E 2BX3A 2PKAB 3S9BA 4CH2B 4H6SB 1YPHE 4FUFA 5F8TA 3LC5A 3RXDA 7LPRA 1PPBH 3SJ8A 4ESTE 2VWMA 2A4QA 1H9IE 2AYWA 4U2WA 2LNCA 3EA7A 2HRVA 1EP6A 1ABIH 4AX9H 2D2DA 1BTHH 4BAOB 2G8TA 2NU4E 1O3BA 3PO1C 3BTME 5C1UA 1FV9A 1DXWA 1FZZA 2ZPRA 3QWCH 4D76A 2ZU3A 2ZFFH 1B5GH 1EP5A 4UONA 3QGNB 1XUJA 1Z8RA 4FUBA 3PO1B 3Q00A 3AVZA 1A46H 1BJUA 3SUGA 4TY6A 1JXPA 2F91A 3LOXA 4BOHA 2ZDLA 4PROA 2HALA 2ZFPH 3PLBA 3SJIA 5GWZA 1SGEE 1FONA 3GDSA 1ANDA 1P2IA 1D4PB 1EOJA 4AB9A 1C1PA 4BAHB 4YT7H 1FY1A 4YOIA 2QXIA 2D8WA 1NTPA 1S82A 4Y0YE 1UCYH 1TYNA 3SHCH 2BHGA 1V2KT 4X2WA 4DCDA 4E05H 4X6OA 6LPRA 2WV5A 2V6NA 1EATA 1A4WH 1ZYOA 2VVUA 4KGAA 1O3GA 3ZZ9A 1SG8B 4X2VA 1PQ7A 3L6PA 2FLBH 4ZHAA 4X8VH 4XFQA 2D1JA 3MNSA 1P06A 3H7TA 2BDGA 1LO6A 5DGJA 2A1DB 1Y3WA 1QGFA 2ZCHP 3QTVH 1OOKB 3SUDA 4O3UA 4OS1A 3MOCA 2QXJA 1C2GA 1GBBA 3SOSA 2GDDA 1TONA 2UWOA 2ALVA 1MD7A 1QB1A 2TPIZ 1TQ0B 2FI4E 1QRWA 3RC6A 4OS2A 3KQEA 1BTZA 4FUCA 1TMBH 1YGCH 3EGKH 4GVUA 3UFAA 1ZSKA 3SNDA 2QA9E 3TGIE 3DUXH 3Q77A 1V2LT 1OWKA 1YPGH 1BHXF 2CV3A 5DP6A 6GCHG 5LPRA 3SUFA 2BQ7B 1RJXB 4HFPB 2BB4A 4AFQA 1C5UA 3PMAB 1C5WB 2QGRA 3TH4H 1IHTH 4X0WU 1BQYA 2QXHA 2M5TA 2ZQ2A 3NXPA 1ABJH 1QJ7B 1C5PA 4CBNA 3BV9B 1ZSJA 3BEIB 4JMYA 1K2I1 4O97A 4DJZB 1S84A 2ZECA 3S69A 4CRDA 4WVPE 1UO6A 4INKA 1VJAU 3BIVH 2IPHA 1OXGA 1CA8B 1KXFA 3IWMA 4U01A 1TALA 2P93A 1BRBE 1ZTLA 2GMTC 2AFQB 3T2NA 4JZFH 3TITA 1NN6A 1HDTH 1P9UA 2PTCE 4HTCH 3FVFB 4NZLA 3IITA 4NGAH 2GZ9A 1PPZA 1UK2A 1Z1IA 1EPTB 1XKBC 2GMTB 1THSH 1K21H 1W0ZU 1C2KA 1TNKA 2A5AA 3EA8A 4ZKNU 2H5DA 1G37A 3KN2A 2PKAA 2OC8A 3A7VA 2ZC9H 1YPEH 1OYQA 2I6SA 3KL6A 3Q3YA 3PM3A 4H42U 1UK4A 3GY5A 3QX5H 2G4TA 1S81A 3GY3A 1O3PB 2PSXA 8KME2 1A3BH 5TJXA 2YOLA 2Z9KA 1Y5UT 2ZDAH 3BTQE 4TY7A 1DVAH 2FOGA 3RXEA 1EB2A 1V2WT 3UNRA 3EA9A 4AORA 1F5LA 1GI7B 4OS6A 2DE8A 1SGRE 1D3PB 1GBJA 4JCNA 2FEQH 3RXMA 2W5EA 1P12E 3UY9A 2H1UA 3A8DA 1TMUH 4VGCC 1N6YA 5IDKA 1ELGA 2A2XH 1TX6A 1O5GH 2FOCA 3K6ZA 1ZRKA 2RA3A 3TNTA 1OSSA 1EJAA 4VGCB 1O3KA 1QBNA 5L2ZH 2HOBA 2ZU1A 2BXTH 2ZU4A 7ESTE 3A7TA 3BTKE 5A0AE 1HNEE 1O2SA 4RKOB 1HAIH 1K1MA 2SFAA 1O3DA 1H4WA 2CHAB 5AFZH 3V13A 2C4FH 4FUIA 4D9RA 1TX7A 4CRFA 4D8NA 4XDEA 2ODQA 2P95A 5GCHG 1DLKB 2OQ5A 1C4V2 5A09A 1OWHA 3SHAH 1LPGB 2JKHA 4WH6A 1HAPH 2FOFA 1ELVA 2Y7XA 2PLXA 3M7UA 3O8CA 2SGFE 1XXDA 3HPTB 4NA7A 4SGBE 5A8YA 1GCTC 1GWAA 1WV7H 4GHTA 4B74A 4WMDA 5EU8A 2BQ6B 1LHFH 2Y6TA 1S6FA 4IW4E 1BRUP 1AVWA 1GCTB 1SLXB 4Y6DA 1MQ6A 2R3YA 3ZZAA 1S6HA 2ZIQH 1GJ6A 5K0HA 1MKWH 2ZQ1A 1BHXB 2GT8A 4ABGA 5FX6A 1SOZA 2BLQA 1TPPA 2YNBA 1MBMA 3PWBA 2BD3A 1BA8B 3RU4D 4ZKRU 3W94A 3RMMH 3A8CA 1O2HA 1GJAB 5T6DA 5A0CA 1HAXB 2GGVB 1T4UH 1CE5A 3M5MA 2J9NA 3E3TA 4XE4A 2FOBA 1P02A 2PSYA 4I32A 1DE7H 4Y8XA 4BTIB 3RXJA 1GBDA 2V0BA 3GDVA 1GJ8B 5BRRE 1UMAH 3E1XB 4NWKA 1WYKA 1DY8A 2Q6GA 2W3IA 2O8MA 3SI3H 5FAHA 4B2BA 1BDAA 4CBOA 5GIBA 1UJ1A 1TPSA 1AU8A 1XUFA 2PFEA 2FTMA 2UUFB 2YNAA 2VIPA 4BAKB 2CGAA 4JZDH 3T26A 1INCA 2QXGA 1O2UA 6ESTA 4GHQA 1SLVB 3D65E 4GUXA 4GAWA 3MU0A 1O2PA 3SORA 1E36B 3BF6H 3FP8E 2Z9LA 4H6TA 1NRRH 3PV4A 1WU1A 3SBKA 1W8BH 1MAYA 2J34A 1ZPCA 1T7CA 1XUKA 3ZZ4A 1AY6H 4FVBA 1KYNA 3OTJE 1YPKH 3E0PB 1GHBF 2ZGJA 2B0FA 1AGJA 2GP9B 1C5YB 4AFZA 5AVDA 2FM2A 1O2YA 2F9BH 2C90B 2G5VA 3BIUH 3NUMA 2EC9H 3E0NB 1IAUA 2H6MA 1W0YH 3UPEA 3M3SA 3P8FA 3DFLA 1HRTH 4Y8ZA 1V2VT 1LHEH 1OS8A 4ZKSU 3SJ9A 3QUMP 3O8DA 3T25A 4X1NU 1Z8JB 3MO9A 4CREA 1ARCA 1ZMNA 1N8OB 1VR1H 1XVMA 2QC2A 5EXLA 3B23B 3KQCA