1CHGA

Chymotrypsinogen,2.5 angstroms crystal structure, comparison with alpha-chymotrypsin,and implications for zymogen activation
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
245
structure length
226
Chain Sequence
CGVPAIQPVLSGLSRIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGVTTSDVVVAGEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSAVCLPSASDDFAAGTTCVTTGWGRLQQASLPLLSNTNCKKYWGTKIKDAMICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQTLAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHYMOTRYPSINOGEN A
publication title Chymotrypsinogen: 2.5-angstrom crystal structure, comparison with alpha-chymotrypsin, and implications for zymogen activation.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase zymogen (serine proteinase)
total genus 40
structure length 226
sequence length 245
ec nomenclature ec 3.4.21.1: Chymotrypsin.
pdb deposition date 1975-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1chgA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1chgA01
3TK9A 3RXTA 2A5AA 2SGQE 1DY8A 1QURH 2TGTA 3ENSB 2VJ1A 4XFQA 1GMHF 2ZP0H 5EQQA 1QGFA 3FZDA 2H5DA 5GXPA 1VCWA 2ZU5A 1FV9A 2RG3A 4Y0ZE 1DWCH 1RD3B 2BDCA 1O5DH 1OWDA 2HOBA 1GDNA 2R0KA 3SHCH 1ZMJA 4ZROA 1Z1IA 1C1TA 2ZHQH 3B8JA 4CH2B 4LZ1H 1A0JA 3PO1C 1FAXA 1O5GH 2VWOA 2CF9H 2R0LA 3TLOA 3LDXH 5FXLA 2Z9LA 1WAYB 3SV2H 3KCGH 1EUFA 2GTBA 1QHRB 1W13U 1ESAA 4IGDA 3UY9A 1O5EH 2A7HA 3EAJA 1NRPH 4THNH 3M7UA 3NZIA 1O2VA 2Y5HA 5GWZA 4AG1A 2ANKH 5A0CA 1SGDE 2ZU3A 4HZHA 2ZGHA 2R3UA 1GHXH 1GJBB 1E35B 3KEEA 5HMAA 3RMLH 3PMBB 2XC4A 2ZECA 4SGAE 1FDPA 1F92A 1AFQC 1ABJH 1PJPA 1Y3VA 1C9TA 1QJ7B 2GDEH 1C9PA 3Q00A 3OX7U 1FIZA 1KSNA 1GHAG 4X1PU 1E38B 1SLUB 3S9BA 1ANDA 1HUTH 1Z71A 1EJAA 4Q7XA 2Y82A 3FP6E 1P8VC 2ZGCA 1TONA 4NFFA 5JBCS 1HAOH 1EJMA 5C20A 3MH7A 3MNXA 1GVZA 2J92A 1EZUC 8ESTE 1FIWA 2GVFA 4AB9A 1O2UA 3G01A 1W0ZU 2OC7A 3TGKE 1XX9A 4XBDA 1E0FD 3NWUA 1C4U2 4FU8A 3QLPH 4AYYB 4WMFA 2RDLA 1LQEA 2F91A 1FY3A 2O8LA 1MH0A 1DOJA 1GHWH 1KXBA 1YCPK 3QZRA 5FAHA 5HM2A 1OX1A 2BX3A 1TOMH 2VH6A 1MD7A 1HIAB 2BYAX 1A61H 4Y79A 1HDTH 2EI6A 4K69A 2GZ7A 3M3VA 3DD2H 1EP6A 2EI8A 4VGCC 5GIBA 1SBWA 4GLYA 1O35A 3PWBA 4FU9A 1SVPA 1CU1A 1Q3XA 2FYQA 1T8LA 2WV5A 1NRRH 1WSSH 1TFXA 3T62A 3TJNA 2NU3E 3P8GA 1TPPA 2XBWA 1NT1A 2BDHA 1LHFH 4X2VA 1LKAA 1CQQA 5C1UA 2A2QH 1QIXB 5EXLA 3SU0A 1XUGA 2PSXA 3PMAB 2F83A 1GL0E 5T6FA 4Q7ZA 1K1PA 1HNEE 1GBMA 2AYWA 1SC8U 4I32A 4X2XA 1DSUA 1EOLA 2CF8H 3F68H 3LONA 5DGJA 4Y8XA 3LGTA 1CA0C 1ELBA 2DE8A 3SNBA 1SMFE 1P03A 3TPIZ 5JB8S 4BTIB 1GG6C 5DP5A 1C1UH 2P16A 3L6PA 2ZTZA 1OP0A 1XXDA 4FUJA 1C5TA 1QFKH 3S0NA 3RU4T 1OSSA 3E8LA 1O2KA 4OS4A 3M5OA 1O2JA 3MFJA 2CJIA 1TBQH 3RXAA 1YPEH 7GCHG 3F9GA 1EB2A 1LPZB 4A6LA 1NRNH 4AGJA 1TABE 2H2ZA 1BUIA 1RFNA 3O8CA 1FPCH 1TNGA 1GBAA 2BXUH 2ZDVH 4DVAU 1BBRH 1CGHA 3RM0H 1V2KT 3MO3A 2XCNA 3ATMA 1ZPZA 2J94A 2ILNA 2BVXH 2C90B 3ZV8A 1NFUA 4DURA 1UTKA 1OKXA 1TGSZ 1BTWA 1ZR0A 3SNCA 1C5RA 4Y8YA 1ZMNA 2FS8A 2FLRH 1ZTKA 4U32A 1NPMA 4E05H 4IW4E 1ELEE 2B7DH 1GBBA 4JZDH 5DPAA 4INHA 3NXPA 3I29A 1AD8H 1SGEE 2Z6BD 2ZPSA 2Z9JA 1C2JA 2GZ9A 1GHAF 1G37A 3L3TA 1CT2E 3DFLA 3SW2B 5EW2H 1V2RT 1C4V2 4R8TB 1KXCA 2FOGA 3FVFB 1K9OE 2AEIH 2TGAA 4LOYH 1P2MA 1QTFA 1CVWH 3UPEA 2ZKSA 2VNTA 4JMYA 3A8CA 5I25A 1EAIA 3MHWU 3PYHA 1DXWA 4D8NA 3TITA 3MH6A 4KELA 1W7XH 1FY1A 5EOKA 2XBXA 1WQVH 2Z9GA 1GBFA 1BJVA 5DP8A 1Z8RA 3RLWH 1AMHA 5FX5A 2GKVE 5DP9A 3LC3A 1SGFA 4RKJB 1P9SA 5TCCA 3LGVA 1HJ8A 1UHBA 4I33A 4X1SU 1O31A 1HXEH 1H8IH 2A4GA 3S9AA 1P09A 3DHKH 2W3KA 1FNIA 1GJ6A 1ORFA 1ELCA 3MU4A 3GY8A 5EQRA 2ULLA 1J9CH 1LHEH 2NU1E 1NTPA 4CHAB 1O2TA 1YLDA 4FXGH 2ZHWH 3LC5A 4MDSA 4AFUA 1THSH 4AG2A 1C2IA 2ZG0H 4MVNA 1L1NA 2QF0A 1YC0A 4AYVB 1BQYA 1C5XB 3HK3B 1QRZA 3SU3A 3SU4A 2ZHFH 1EB1H 4OS2A 5JBAS 2G4TA 2QGRA 4HTCH 2OTVA 1DFPA 1G9IE 2D26C 1ZRKA 1BMLA 3AW1A 3LJJA 3RXRA 1O36A 1H9HE 1ARCA 2BZAA 2D1JA 3F9FA 3VGCB 3VB5A 1ELVA 4Y7BA 2FI3E 1BRUP 1MKWK 1SOZA 1O2RA 4AFSA 1C1NA 1K1OA 1ESTA 4IC5A 4TY6A 1O2GH 1YBWA 2IN2A 1Z6EA 1BZXE 2ZZUH 3A87A 6LPRA 2F9UA 1P2NA 1TBZH 2XC5A 2OBOA 1LVMA 1ELAA 2BOKA 3PMHB 5JPMH 1PQ5A 3A86A 4HFPB 1GBEA 4JZ1A 2QV1A 1ETRH 2G51A 5A8ZA 1O3AA 2I6SA 4HI3A 1O2QA 3LIWA 2A4RA 4X6MA 3RUOA 2P59A 2VVVA 1K1NA 1EZXC 2FMJA 1A3EH 1GDQA 2BDAA 4K8YA 2BY5X 1RIWB 2BY8X 3TIUA 2PKAB 1PPFE 9LPRA 1GVKB 3EYDA 1AE8H 3ELAH 4Z6AH 4KTSA 1RS0A 2OQUA 2TIOA 1BTPA 2GCTB 1IQGA 3M5NA 4MG3A 5C1YA 5BPEA 1QL8A 1WUNH 2BX4A 4ABBA 1QCPA 2LNCA 3AVZA 3URDA 1BJUA 1C1PA 2WPKS 1A0LA 3U8RH 2RCEA 3RXEA 4DGJA 5DP4A 2QAAA 4X2WA 2LPRA 1EZSC 5CMXH 4ISNA 4M7GA 2JETB 1H8DH 3FANA 1S6FA 3RC4A 2ZDMA 3BIVH 1EXFA 1FUJA 5J4QA 1QNJA 1P2KA 5EXNA 1TQ7B 7KMEH 3MNCA 1KTTB 4K3JA 1A7SA 1TQ0B 1Z8JB 4Z0KA 2D2DA 1BRAA 1O38A 2Z7FE 4NSVA 1FZZA 3Q3XA 1AZZA 4K8BA 1ESBA 2FTMA 1QQ4A 2GDDA 3VB7A 1Z6JH 2GMTB 3ZZDA 1TGCA 1KY9A 1ELFA 4OS6A 1E34B 3QTOH 1GMHG 1LTOA 5DG6A 1P01A 4AB8A 1O3IA 1O2XA 1NFWA 1OS8A 4JZIA 2CGAA 2HNTF 3GY5A 1GI0A 4XBBA 1GI1A 1V3XA 1WTGH 1A3BH 1GJ8B 2EI7A 3SNDA 3NCLA 5E0HA 4OS7A 3STJA 3P8FA 1AVXA 1LHGH 2GV7A 3GCHB 2VIPA 4Y8ZA 4Y7AA 2FOFA 1DT2A 1O3MA 1UVTH 1AFEH 1MU6B 1O33A 2P3FH 5EXMA 2A0QB 3T26A 1DVAH 1QA7A 2W7SA 1RIWC 2FX4A 2P8OB 4D76A 1K1JA 4Q2KA 1GVLA 2FO9A 1OOKB 4FVBA 3UIRA 2GCTC 3A7XA 3EQ0H 1YPLH 1SGNE 1UTPA 4JCNA 3SO3A 3ZZ6A 3NK8A 2J38A 2J95A 1DITH 1FI8A 3AW0A 1UCYE 1CGJE 1HPGA 2TRMA 1S6HA 1BMAA 4D9RA 1YLCA 1V2ST 1W12U 3U8OH 3ZVDA 3DT0H 1IAUA 1VCQA 1AU8A 2H5CA 2JETC 1DS2E 1T8MA 3GCTF 4Y10E 2ZFPH 1C1QA 3BG4B 1SGCA 1WV7H 2GZ8A 4E7RG 3BEIB 1GI7B 1KYNA 4JK5A 2SNVA 2GT8A 3RXUA 1MKXH 5FCKA 1GBDA 2Y7ZA 1XKBC 3SJ8A 1SFIA 4AOQA 2G8TA 1O2SA 1SI5H 1C1RA 1JBUH 1EPTB 2J2UA 1RXPA 1V2WT 2H1UA 4WWYA 5FPSA 1LVBA 9ESTA 3ZVEA 1F7ZA 2PWXA 1QR3E 4IC6A 4MTBA 4ABJA 5J4SA 3RXKA 1GMDG 2WV4A 4MNYA 5TCAA 5L30H 3U69H 2HRVA 4CR5A 2BY9X 2PLXA 1UCYK 1MCTA 3BIUH 5BRRE 3SGQE 3A80A 1AFQB 3LH1A 1Q2WA 2Z94A 4CH8B 2Y7XA 4LK4A 2PKSC 5AVDA 4NA7A 2VIOA 4K1EA 4X2YA 1GI3A 3BSQA 1J14A 5FPTA 2AGIX 1O3LA 2P8OC 3BG8A 1V2TT 1F2SE 1FY8E 3GCOA 3EA9A 2D8WA 1DUAA 1ZJKA 2A4QA 2TBSA 1MTUA 1UVUH 4ZHLU 4Q80A 1TNHA 3OSYA 1Y5UT 5EG4A 1OWKA 1NESE 4A7IB 3LOXA 4DT7B 5C67A 3ZZAA 5EODA 1T31A 2HPPH 2ODQA 4WXVA 1O5FH 5SGAE 1O3PB 1GL1A 1SLWB 3PROA 6GCHG 3ESTA 3SU1A 1TA2A 1TNLA 2NU0E 1TAWA 2KAIA 1O5AB 4GUXA 3GYMA 2NU2E 3ZZ7A 3BG4C 3GY7A 3SORA 4A1VA 2BD5A 1MMJN 1N6YA 3M35A 2AGEX 1GHBF 3RMOH 2W3IA 5FCRA 1GHVH 1KDQA 1C5VA 2SNWA 2OC1A 2ZC9H 3E3TA 1D4PB 4X8UH 4ZHAA 2BXTH 1EPTC 3PM3A 4K5ZA 4VGCB 1XMNB 4GCHF 2A5KA 1FXYA 1QRWA 3BTGE 1HAXB 2XC0A 1YPMH 5I46H 2V0BA 1X7AC 1ZSJA 1UTJA 3ZVFA 2C8ZB 3RDZA 3BV9B 3P8OA 3UFAA 4ISIH 4X6OA 4CRDA 2P93A 3A8AA 1C5NH 4OS1A 3RXVA 1MAYA 1CE5A 1WBGB 2PTCE 1D3QB 4MNXA 5IYTA 4A92A 1SQAA 4UEHH 4DY7B 5LGOA 5C5OA 4UONA 1GCDA 1KLIH 4GVUA 4JK6A 2DUCA 1YPKH 2WINI 1BRBE 3RXPA 1CA0B 1GHZA 1GPZA 3ZZ5A 4D9QA 2WYJA 1A5HA 1FN8A 1GG6B 1G3BA 1O32A 4KGAA 3EDXB 1AY6H 2C8XB 3GOVB 1A4WH 1TX8A 1XUKA 3UOPA 1VR1H 1D6RA 1SGQE 5FPYA 2B8OH 2EC9H 5CHAB 1L2EA 1AWFH 1UMAH 1Y3UA 2FPZA 1AUTC 4JZEH 3T29A 1C1SA 1QL9A 5A2MH 3GYLB 3MH4A 3SU2A 5JDUB 1RTKA 3QDZB 2THFB 1K2I1 2P3UB 3A83A 3SGBE 1H9LB 1SPJA 1C4Y2 1O3OA 3K6ZA 6ESTA 1B0EA 1P2JA 1TMUH 3SZNA 1ELDE 1T32A 4UFEH 1GMDF 3TJVA 1M9UA 4YM9A 3OY6U 1GI6A 1BCUH 1G2MA 2W5EA 2RA3A 5E2PA 1C2EA 1DY9A 5LPRA 2ZDKA 4KTUA 4ZKNU 4WY3A 2ZA5A 2GCHF 1O3EA 2HVXA 1H4WA 4ISLA 2FESH 1GHYH 1RGQA 1EJNA 5HYOA 3ODFA 2GT7A 1BMNH 1HJ9A 1N1LA 1AVGH 1ELTA 1ABIH 4J1YA 5PTPA 1O3FA 4CREA 2ANWA 2BVSH 3A82A 1JXPA 1UK2A 1CBWB 1PPGE 1B5GH 2P3TB 1ZSLA 3SN8A 4BOHA 3BTFE 3UWIA 1ZPCA 1DANH 5FBEA 1GI2A 1BITA 1LO6A 1THRH 3MWIU 2OQ5A 1PPCE 5AFZH 2ZCKP 3A7VA 3TH3H 3D49H 1TNJA 1ZTJA 1ETSH 2ANYA 1HIAA 1SQOA 4X1NU 1ARBA 1E37B 3QX5H 3U98H 5F8ZA 2B5TB 4ESTE 6GCHF 2K1QA 2QXHA 3UOUA 4YOJA 1ACBE 2XNIA 2EEKA 1V2VT 1YKTA 3HGNA 4B2CA 4ZKRU 3M61U 3OTJE 4Y76A 2BQWB 3BEFB 4I8LA 3RXSA 4E06H 1S85A 5CHAC 1TGNA 1H1BA 2ZU4A 1P02A 2QIQA 5G4BA 2O8TA 4ZKOU 1BT7A 2SFAA 3RXFA 2ZPRA 4YLQH 1NC6A 3DUXH 4RN6A 2GGVB 3E16B 4FVDA 3A8DA 1K1LA 3TJOA 3SBKA 1ZGVA 1JMOH 4TPYA 1N8OC 4LZ4B 2FIRH 5F6MA 1JIRA 2STAE 3S7HB 1S0RA 3CS0A 1VGCB 4AFZA 5T3HA 4B71A 1NU9A 4ABGA 3SJ9A 3TGJE 1UTMA 4O03A 4K60A 2YOLA 2Q6GA 1IQFA 2JH6D 2FS9A 4ZXXH 4I8GA 4BXSA 4BXWA 2XWAA 1T4UH 2OXSA 2YNAA 4YESB 2FWWA 1A2CH 2VIVA 3RXBA 5DP3A 5GJ4B 4AGKA 8LPRA 1LKBA 5K0HA 1VCPA 4E7NA 4B2BA 3T25A 2FI5E 3K65B 2FM2A 3FZZA 1F5LA 1P3CA 2EA3A 1PQ7A 2ESTE 1CBWC 3NUMA 2B0FA 3BTEE 1S0QA 3P92A 4H6TA 4I8HA 4U2WA 6CHAB 1W3CA 3URCA 2AMQA 3UR9A 4ABEA 1ZSKA 2PUXB 2FOCA 1NRQH 3EGKH 1O34A 1K1IA 2ZGXH 1P9UA 4UFGH 3F6UH 4F4OC 2VWLA 1HGTH 1EATA 1F0UA 1Y5BT 4U30A 3RXIA 4CR9A 1LPGB 1F0SA 1AN1E 1EKBB 3KGPA 3M5LA 4OS5A 4O3UA 3RM2H 1K21H 2M5TA 1W14U 4X6PA 5HXFA 1IQLA 3OYPA 3Q3YA 3RXGA 1VITH 8KME2 2AMDA 1OWEA 3D62A 2PSYA 3RXOA 4K1TA 3T2NA 2FOAA 2VWMA 4XBCA 1UK4A 4IMZA 3P95A 5DJ7A 1SQTA 3SV8A 3UR6A 1SLVB 1O5CB 1GBIA 1G3CA 1TOCB 4I8JA 1HAGE 3RMMH 2F9OA 1MZDA 2BD3A 3A81A 1VGCC 2QXGA 1WOFA 1HJAB 4UD9H 3P17H 1GBCA 4INKA 2ZFQH 3R3GB 5AF9H 2R3YA 1AIXH 3LGUA 1SFQB 1V2MT 2VGCB 1TALA 2FZZA 3P70B 2BY7X 4X8SH 1QB1A 1RJXB 1ZRBA 2JH5D 1KLJH 2YNBA 1MBMA 1W2KH 3GCTG 1C5WB 2Q6DA 5L6NH 4YTAA 1ANEA 1F5RA 1KIGH 2ZF0H 2ZCLP 2GX4A 1C5YB 4FUFA 2FX6A 3SV7A 1NRSH 1W10U 6CHAC 2FOEA 1CO7E 4NA9H 1ZHRA 3SJKA 3LH3A 1CHGA 1XUJA 1IQNA 1CHOG 2FLBH 1SGYE 2FXRA 2H9HA 1NM6A 2VU8E 1HLTH 1GGDC 1GJ9B 4BAKB 1LPKB 3MU8A 4D7FA 2HALA 1B7XB 4XSKU 1TPSA 1YYY1 1O37A 3FAOA 3VXFH 2UUJB 3SI3H 1A0HB 2O8WA 2AIQA 4WVPE 4UFFH 2XCFA 3S7KB 1XUFA 4O9VA 5F8XA 1K1MA 1TGBA 1Z7KA 2ZFFH 1ZHMA 3SHAH 1F0TA 1MBQA 5EGMA 1VJ9U 2UWLA 4ZAEA 1V2UT 3MH5A 2HNTC 2ODPA 1O3GA 1FY5A 4DG4A 3E1XB 1LVOA 4JZFH 4ABIA 2H9EH 1C5OH 1UTOA 4ABAA 2BLQA 1O39A 1V2LT 3RXHA 3W95A 1MD8A 2A7CA 3MNBA 1HJAC 4TWWA 1DUEA 1GI4A 7ESTE 2J4IA 1PYTC 3STIA 1SL3A 3AASA 1E36B 3GDUA 3VFEA 3M5MA 2PKAA 3PMJA 2FOMB 4FUIA 4H6SB 1AGJA 2VGCC 1IQJA 4ABDA 3RXQA 2BY6X 1UJ1A 3SUFA 1EASA 2O8MA 1GWAA 4GPGA 1WQSA 1L4DA 1SLXB 3KQEA 1A5GH 1GHBG 3QN7A 3VPKA 1BBRK 1EZQA 2PR3A 4NSYA 4B73A 5DP7A 4YT7H 4BTUB 8GCHG 1TRMA 1TA6A 1ZOMA 1BTUA 1O3HA 3QK1A 1C5PA 1ZZZA 4GCHG 2CHAB 4DCDA 2BQ7B 3T27A 3UTUH 3HK6B 1GJ7B 3JZ2B 2PKSB 1HAYB 5JYIA 2P95A 2BD4A 1CSOE 1T7CA 3H5CB 3ZYEA 1L1GA 1MZAA 2ZDAH 2ZNKH 1TE0A 2G5NA 2QN5T 4BAMB 1DX5M 4KP0A 1QB6A 1HAVB 4HGCA 5ESTE 5E2OA 2IPHA 5HM9A 1EOJA 2Z3EA 5F8TA 1VJAU 2PGQB 1C2KA 1XUHA 4WMDA 2SGEE 4YOGA 4NZLA 1WTHD 1RTLA 5ESBA 2ZGJA 4TY7A 1AVWA 1YCPH 1YPHC 3GY3A 2G52A 3ODDA 4PROA 1PPZA 2G4UA 1HRTH 2OBQA 3VXEH 2Y5GA 2A2XH 2OUAA 2WYGA 1HBTH 2R2MB 2AFQB 2QCYA 5H4IB 4CBNA 4O97A 2ALPA 1OWJA 3MTYA 4XE4A 3QGNB 3H7OA 1LCYA 1QA0A 1GJDB 1ZYOA 2XXLA 1C5QA 3SV9A 4FUCA 3RC6A 1XVOA 4B76A 1DE7H 2I6QA 3GISB 1TYNA 1QJ1B 1KLTA 2G55A 1YGCH 4K1SA 2CN0H 4XOJA 3T28A 5IDKA 4X1RU 2FTLE 4MPWA 1TX6A 1TB6H 3KIDU 1MTSA 4IN1A 5ABWA 4CRBA 1N6XA 4Q7YA 1CHOF 1OP8A 2PFEA 3ZVAA 4CRAA 3ZYDA 1P2OA 1BTYA 3QTVH 5EQSA 1ZHPA 2V6NA 4AORA 3L33A 2BD9A 4FU7A 4GSOA 2XBVA 3ZZCA 1CT0E 1HV7A 4MPXA 4BAQB 2Z3DA 2Z9IA 3BTME 3DFJA 3CS7A 3A88A 2Y80A 2Z9KA 4ZMAH 4NWKA 1NS3A 3AAUA 1MTNB 3E0NB 2CHAC 2OINA 1LHDH 1AKSB 1MTVA 2ZQ2A 4Y11E 4YO9A 1FN6A 2QF3A 2GCHG 1TGTA 2P94A 3MU0A 2ZCHP 2FODA 4ISHH 1EQ9A 2NWNA 3KHVA 3HGPA 1AE5A 3P8NA 3C1KA 3UQVA 2ASUB 1J15A 1BHXF 1RTFB 1JRTA 3KN2A 2OC0A 3KF2A 3UNQA 1EPTA 4I7YH 1WCZA 1C5UA 2A31A 1AB9C 4WMEA 4ZUHA 4JYTA 1P11E 1DDJA 3EE0B 4ASHA 5K7RA 1ID5H 1DLEA 2VWNA 3QGJA 7LPRA 1WYKA 3TGIE 3SOSA 4INLA 2F9BH 2BLOA 2C4FH 2SGAA 1OPHB 2ZGBH 1CT4E 1PQAA 1KXAA 2QXIA 4NCYA 2H6MA 1XM1A 2J34A 1IOEA 2BDGA 1G2LA 3TVJB 1THPB 2TGPZ 2UUYA 2R9PA 4J2YB 4F49A 1AWHB 4BTTB 2FYRA 3E91A 1O2PA 4KTCA 3RXJA 3LGIA 1GDUA 1D6WA 2BDIA 3BF6H 3QUMP 1ZMLA 1DWDH 4ZKSU 1W7GH 4NZQA 3E90B 1ZGIA 1TRNA 5FBIA 8GCHF 1LQDB 3GY2A 4ZHMU 4X1QU 1OP2A 1HB0B 1C2GA 3PV4A 2CMYA 1VZQH 1NFXA 4RKOB 3UREA 4TYDA 1J16A 3SU6A 2BDYA 4YLUA 3M7TA 2VIWA 1GBKA 3WY8A 1GCTC 2GP9B 1FJSA 2AGGX 3KNXA 1TNKA 1NU7B 2XTTB 1LMWB 1DWBH 1VITF 1SHHB 4NWLA 3TNTA 1O2ZA 1IQKA 3MOCA 1MTNC 2ZQ1A 5GCHG 1G32B 3V13A 5JBTA 3IWMA 1INCA 1J17T 3H7TA 2FOHA 2V35A 3NPSA 3F1SB 1V2PT 3M7QA 1IHTH 3SI4H 3GY6A 3A8BA 4YOIA 1MQ5A 3ATLA 1HYLA 3ZZ9A 3BTWE 1O2IA 1O2OA 1FQ3A 2BDBA 3IITA 4OGXA 1QL7A 3K6YA 3M36A 3BTTE 1HAPH 2G00A 4A5TS 2SGFE 3SQHE 1BTXA 1OWIA 1O30A 3A89A 3PLBA 1D3DB 3A7WA 4SGBE 1DSTA 3SJIA 3W94A 1H9IE 2ZTXA 2TGDA 3SUDA 1OXGA 2FEQH 1QRXA 3K9XB 2ZFSA 1A46H 3M37A 1JIMA 3NKKA 4TWYA 3VEQB 1O3KA 4ABHA 2A32A 1N8OB 4CBOA 1L1JA 3O8DA 3B23B 3SUGA 1MKWH 2O9QA 3FP7E 1NY22 3LPRA 3RU4E 1PPHE 2IJOB 2BLVA 2GV6A 4MNWA 1ETTH 5E0JA 3SNAA 3A7TA 1KXEA 3A7YA 4ZXYH 3MNSA 2BLWA 1NN6A 2PGBB 1KXDA 1V2NT 3UWJH 1P10A 2F9VA 4CRGA 1FMGA 2ZU2A 3MU1A 3EA7A 3LGWA 1TMTH 3TU7H 1C5ZB 5A8XA 4BANB 1AI8H 1C2DA 1B0FA 4ZH8A 5A0BA 2A7JA 1W11U 2SGDE 1PFXC 1A1RA 1GI9B 2VIDA 3C27B 4JYVH 1T8OA 1ANCA 2IOTA 1T4VH 1PPBH 1BOQA 1O5BB 1MKXK 4JYUH 3GCNA 5C2ZA 1CGIE 1D3TB 2O8UA 2XYAA 1ZLRA 5JB9S 5A0AE 5LH8A 1XXFA 3RXDA 1IQEA 4A1TA 3BTDE 1P3EA 4I8KA 5FX6A 1S82A 5AFYH 3KQCA 3ZVCA 2JH0D 4Y6DA 2XRCA 1C2FA 3V12A 1BIOA 1GJ4H 4IN2A 2WUBA 1EAUA 5CE1A 3ZZ8A 1FONA 2OLGA 2DE9A 5DP6A 4BAHB 1UTQA 4FUEA 2BTCE 3OU0A 3ZZBA 1Z1JA 1ZTLA 2BZ6H 1G30B 5L2ZH 2Z3CA 3U1JB 2C3SA 3CP7A 1Y3WA 4B1TA 1P05A 2FDAA 3PLPA 4YT6H 2ZEBA 1GMCG 2C8WB 1AZ8A 1SGFG 3TJUA 4OGYA 3F9HA 3D23A 3AAVA 1GJAB 5B6OA 3FFGA 2ZDLA 5GCHF 1WU1A 5TJXA 3CENA 1BTZA 5L2YH 1TNIA 3V7TA 1GBTA 1O3NA 2A4OA 1TMBH 2R2WU 2VVUA 1UO6A 1AQ7A 4B75A 4NA8A 5LPEA 4Y71A 5EPNA 1FLEE 2BB4A 1AHTH 2OD3B 3UUZA 2BHGA 2PTNA 1P0SH 2C8YB 2ZIQH 4NG9H 3Q76A 3U8TH 2V3HH 3TK6A 1W0YH 3GY4A 5E8EH 1UHBB 4WJG2 4K2YA 4AX9H 1YCPM 4B2AA 1GBLA 2F9NA 4DJZB 3QZQA 1F5KU 4H4FA 3S9CA 3A84A 2ZPQA 1SHYA 3S69A 1MCVA 4ABFA 2GD4B 3SJOA 1ANBA 2CV3A 1TLDA 4Y0YE 1SSXA 5EW1H 2BQ6B 4R0IA 1O3JA 1BA8B 2VH0A 3SUEA 1EAXA 1SR5C 1AUJA 3PLKA 1S84A 1GGDB 1PQ8A 1BB0B 1O0DH 1T8NA 2BMGB 1BRCE 2HNTE 1OYTH 4BAOB 4WH8A 1Z8GA 2ANMH 5F03A 1IHSH 1SGTA 1LHCH 1G3DA 2V3OH 3MYWA 1UTNA 1UK3A 1J8AA 1TRYA 4CRCA 3E6PH 3ZVBA 3BTQE 3V3MA 4BNRA 1O2HA 3BEUA 1TIOA 2F9PA 1S83A 1UVSH 1O3DA 1RRKA 5GPIB 1JOUB 3KQBA 2F3CE 4WXIA 1HFDA 5DK1A 4LXBH 1XUIA 3K2UA 1NO9H 3RP2A 2PV9B 1LDTT 1P57B 1DICA 1O3BA 4GHQA 4QT8C 4X6NA 3PTNA 4FUHA 1C1MA 1UCYH 1OWHA 2WPHS 2ZO3H 1W8BH 4AFQA 3Q3KA 2OCVB 1QBNA 1C2LA 1ELGA 3LKWA 1K28D 2BD7A 5T6DA 5AHGH 1GJCB 2ZFRH 3SQEE 4WF8A 2BD8A 3T5FH 2A5IA 1D3PB 1MU8B 2WPMS 4IS5A 3MI4A 1G3EA 2BVRH 2B9LA 1MTWA 1FY4A 3TNSA 1Q31A 1TPOA 1A5IA 3BTKE 1EAWA 2BOHB 4NIXA 5LPFA 3V0XA 5HGGA 1YPHE 1P2QA 3KL6A 1SB1H 4RSPA 2PUQH 2VB0A 3SNEA 1V6DA 5ETXA 3EA8A 1YF4A 1V2QT 3TH2H 1QQUA 1SOTA 2UUKB 1GJ5H 3VB6A 1GMCF 1P04A 2Y6TA 5A09A 5C5NA 3PWCA 3RC5A 3SGAE 7GCHF 3QWCH 4TPIZ 1HCGA 4DIIH 4MLFB 2HLCA 2H9TH 3ATIA 3PTBA 1C1WH 1JRSA 3D65E 1BBRE 2VVCA 2STBE 1P12E 3I77A 2XWBI 1QB9A 1NROH 2A45B 3HKIB 1LVYA 3LU9B 1O2WA 1G36A 5C3NA 3RU4D 5T6GA 1QJ6B 3RXMA 3HPTB 5EU8A 1HAIH 2Y81A 1XVMA 3Q77A 3U9AH 2WUCA 1Y5AT 4NIWA 2AIPA 3OY5U 4CHAC 1U6QA 3UQOA 1S81A 3QO6A 4DIHH 3ATKA 1IQHA 1O2YA 3F9EA 1MUEB 1C5MD 3LGYA 2ZU1A 5GDSH 1CA8B 3IG6B 1DM4B 1O2MA 1TWXB 1BHXB 4FUGA 3LT3A 4WH6A 1UVPA 2ZTYA 3BTHE 2AH4X 3U1IB 1MAXA 3UNRA 3DA9B 2OC8A 2W7UA 3ITIA 3MMGA 2TPIZ 2RA0A 1L0ZA 1L4ZA 1SGIB 5JBBS 1FPHH 1IQIA 1XKAC 1TX7A 4NFEA 3VGCC 3LJOA 3MO9A 5EPYA 2QC2A 3UNSA 1YPGH 3ZZ4A 2Q6FA 1EX3A 4UFDH 3JZ1B 2UWOA 4H42U 3P6ZB 3HATH 1DPOA 1JWTA 1SG8B 4MPVA 2AMPA 3ATWA 2ZWLH 4DW2U 4CRFA 3TK5A 1VITG 2ZDNA 1PPEE 1C5SA 3M3TA 2AS9A 1EP5A 2VINA 3VB4A 4A1XA 1AB9B 2HWLB 1KXFA 3GDSA 4FUBA 1Y59T 2Q1JA 1P2IA 1C1VH 1GBJA 4B74A 3R0FA 2OP9A 4MNVA 3A85A 1BDAA 2W26A 4X0WU 4NIYA 4D7GA 4KKDA 1BMMH 1K22H 2FP7B 3RMNH 5E0GA 4AZ2B 1UTLM 1D9IA 4X8TH 1DLKB 2ZHEH 1BTHH 2ZFTA 2G81E 2WPIS 1V2JT 1S5SA 4I31A 3O8BA 1MQ6A 5DO4H 2QA9E 4UE7H 2PHBA 2QY0B 1QY6A 3SU5A 1HAVA 3ZV9A 1TBRH 3VB3A 1P06A 2FOBA 3E0PB 1OYQA 3RXCA 3PB1E 1DXPA 4IBLH 4AN7A 2BM2A 1GI8B 2CXVA 4UDWH 3A7ZA 2G5VA 4O3TA 1C2HA 1NZQH 4IMQA 1HAZB 2VIQA 1GCTB 2Y5FA 4YZUA 2A1DB 2QYIA 2ODYB 1F0RA 3RLYH 1AO5A 1V2OT 4U01A 3GDVA 3SV6A 1TPAE 3PO1B 2ZI2H 3N7OA 5DKMA 1YM0A 2QXJA 2GMTC 1QBVH 2HGTH 3MU5A 4GAWA 2WPJS 1KTSB 3KQDA 1DWEH 2AERH 1Y8TA 1YPJH 1HAHH 1O3CA 1C1OA 2XW9A 1UVOA 1O2NA 1SGPE 2XBYA 2J9NA 4FUDA 1GBHA 5A8YA 1ZJDA 1C5LH 2ALVA 3GCHC 2BD2A 2UUFB 2UWPA 4ISOA 1Z8IB 2KAIB 4GHTA 1PYTD 4NGAH 1HXFH 1ZPBA 3B9FH 4MQAA 1SGRE 3MO6A 3BN9A 1GI5A 1Y3YA 1Y3XA 2JKHA 5C1XA 2SGPE 3RXLA 1O2LA 1KDQB 3ZVGA 2C93B 2HPQH 3HKJB 4X8VH 1QBOA 4NIVA 3I78A 2WPLS 3GICB 1AKSA 1NFYA 3M3SA 2ZHDA 2FI4E 1IQMA 1YP9A 2PW8H 1FAKH 3ZZ3A 4MPUA 3FP8E 4DOQA 3O8RA 2NU4E 1C2MA 5FHTA 4XDEA 3TH4H
chains in the Genus database with same CATH superfamily
3TK9A 1KMHB 3RXTA 2A5AA 2SGQE 1DY8A 3WW7A 1QURH 2TGTA 3ENSB 2VJ1A 4XFQA 1GMHF 2ZP0H 5EQQA 1QGFA 3FZDA 2H5DA 5GXPA 3DSGA 1VCWA 2ZU5A 1FV9A 2RG3A 3FOAA 4Y0ZE 1DWCH 4B6FA 1RD3B 2BDCA 1O5DH 1OWDA 2HOBA 1GDNA 2R0KA 3SHCH 1ZMJA 4ZROA 1Z1IA 1C1TA 2ZHQH 3B8JA 4CH2B 4LZ1H 1A0JA 3PO1C 1FAXA 1O5GH 2VWOA 2CF9H 2R0LA 3TLOA 3LDXH 5FXLA 4AC9A 2Z9LA 1WAYB 3SV2H 3KCGH 1EUFA 2GTBA 1QHRB 1W13U 1ESAA 2KCOA 4IGDA 3UY9A 1O5EH 2A7HA 1QZ8A 1NRPH 3EAJA 4THNH 3M7UA 3NZIA 1O2VA 2Y5HA 5GWZA 4AG1A 2ANKH 2K8IA 1SGDE 2ZU3A 4HZHA 2ZGHA 5A0CA 2R3UA 1GHXH 1GJBB 1E35B 3KEEA 5HMAA 3RMLH 3PMBB 2XC4A 2ZECA 4SGAE 1FDPA 1F92A 1AFQC 1ABJH 1PJPA 1Y3VA 1C9TA 1QJ7B 2GDEH 1C9PA 3Q00A 3OX7U 1FIZA 1KSNA 1GHAG 4X1PU 1E38B 1SLUB 3S9BA 1ANDA 1HUTH 1Z71A 1EJAA 4Q7XA 2Y82A 3FP6E 1P8VC 2ZGCA 1TONA 4NFFA 5JBCS 1HAOH 1EJMA 5C20A 3MH7A 3MNXA 1GVZA 2J92A 1EZUC 8ESTE 3VG8A 1FIWA 2GVFA 4AB9A 1O2UA 3G01A 1W0ZU 2OC7A 3TGKE 1NBMD 1XX9A 4XBDA 1E0FD 3NWUA 1C4U2 4FU8A 3QLPH 4AYYB 3F3BA 4WMFA 2RDLA 1LQEA 2F91A 1FY3A 2O8LA 1MH0A 1DOJA 1GHWH 1KXBA 1YCPK 3QZRA 5FAHA 5HM2A 1OX1A 2BX3A 1TOMH 2VH6A 1MD7A 1HIAB 2BYAX 1A61H 4Y79A 1HDTH 2EI6A 4K69A 2GZ7A 3M3VA 3DD2H 1EP6A 2EI8A 4VGCC 5GIBA 1SBWA 1WXRA 1COWD 4GLYA 1O35A 3PWBA 4FU9A 1SVPA 1CU1A 1Q3XA 2FYQA 1T8LA 2WV5A 1NRRH 1WSSH 1TFXA 3T62A 3TJNA 2NU3E 3P8GA 1TPPA 2XBWA 1NT1A 2BDHA 1LHFH 4X2VA 1LKAA 1CQQA 5C1UA 2A2QH 1QIXB 5EXLA 3SU0A 1XUGA 2PSXA 3PMAB 2F83A 1GL0E 5T6FA 4Q7ZA 1K1PA 1HNEE 1GBMA 2AYWA 1SC8U 2J5UA 4I32A 4X2XA 1DSUA 1EOLA 2CF8H 3F68H 3LONA 5DGJA 4Y8XA 3LGTA 1CA0C 1ELBA 2DE8A 3SNBA 1SMFE 1P03A 3TPIZ 5JB8S 4BTIB 1GG6C 5DP5A 1C1UH 2P16A 3L6PA 2ZTZA 1OP0A 1XXDA 4FUJA 4DT4A 1C5TA 1QFKH 3S0NA 3RU4T 1OSSA 3E8LA 3GS9A 1O2KA 4OS4A 3M5OA 1O2JA 3F0OA 3MFJA 2CJIA 3F2GA 1TBQH 3RXAA 1YPEH 7GCHG 3F9GA 1EB2A 1LPZB 4A6LA 1NRNH 4AGJA 1TABE 2H2ZA 1BUIA 1RFNA 3O8CA 1FPCH 1TNGA 1GBAA 2BXUH 2ZDVH 4DVAU 1BBRH 1CGHA 3RM0H 1V2KT 3MO3A 2XCNA 3ATMA 1ZPZA 2J94A 2ILNA 2BVXH 2C90B 3ZV8A 1NFUA 4DURA 1UTKA 1OKXA 1TGSZ 2F4LA 1BTWA 1ZR0A 3SNCA 1C5RA 4Y8YA 1ZMNA 2FS8A 2FLRH 1ZTKA 4U32A 1NPMA 4E05H 4IW4E 1ELEE 2B7DH 1GBBA 4JZDH 3KQ5A 5DPAA 4INHA 3NXPA 3I29A 1AD8H 1SGEE 2Z6BD 2ZPSA 2Z9JA 1C2JA 2GZ9A 1GHAF 1G37A 3L3TA 1CT2E 3DFLA 3CNRA 3SW2B 1V2RT 5EW2H 1C4V2 4R8TB 4RI0A 1KXCA 2FOGA 5C17A 4Q63A 3FVFB 1K9OE 2AEIH 2TGAA 4LOYH 1P2MA 1QTFA 1CVWH 3UPEA 2ZKSA 2VNTA 4JMYA 3A8CA 3N99A 5FL7D 1EAIA 5I25A 3MHWU 3PYHA 1DXWA 4D8NA 3TITA 3MH6A 4KELA 1W7XH 1FY1A 5EOKA 2XBXA 1WQVH 2Z9GA 2HLDD 1GBFA 1BJVA 2YMSC 5DP8A 1Z8RA 3RLWH 1YWUA 1AMHA 5FX5A 2GKVE 5DP9A 3LC3A 1SGFA 4RKJB 1P9SA 5TCCA 3LGVA 1HJ8A 1UHBA 4I33A 4X1SU 1O31A 3OEED 1HXEH 1WDIA 1H8IH 2A4GA 3S9AA 1P09A 3DHKH 2W3KA 1FNIA 1GJ6A 1ORFA 1ELCA 3MU4A 3GY8A 5EQRA 2ULLA 1J9CH 1LHEH 2NU1E 1NTPA 4CHAB 1O2TA 1YLDA 4FXGH 2ZHWH 3LC5A 4MDSA 4AFUA 1THSH 4AG2A 1C2IA 2ZG0H 4MVNA 4F48B 1L1NA 2QF0A 1YC0A 4AYVB 1BQYA 1C5XB 3HK3B 1QRZA 3SU3A 3SU4A 1EFRD 2ZHFH 1EB1H 4OS2A 5JBAS 2G4TA 2QGRA 4HTCH 2OTVA 1DFPA 1G9IE 2D26C 1ZRKA 1BMLA 3AW1A 3MQKC 3LJJA 3RXRA 1O36A 1H9HE 1ARCA 2BZAA 2D1JA 3F9FA 3VGCB 3VB5A 1ELVA 4Y7BA 2FI3E 1BRUP 1MKWK 1SOZA 1O2RA 2J98B 4AFSA 1C1NA 1K1OA 1OHHD 1ESTA 4IC5A 4TY6A 1O2GH 1YBWA 2IN2A 1Z6EA 1BZXE 2ZZUH 3A87A 6LPRA 2F9UA 1P2NA 1TBZH 2XC5A 2KM0A 2OBOA 1LVMA 1ELAA 2BOKA 3PMHB 5JPMH 1PQ5A 3A86A 2J97A 4HFPB 1GBEA 1VKYA 1E1QD 4JZ1A 2QV1A 1ETRH 2G51A 5A8ZA 1O3AA 2I6SA 4HI3A 1O2QA 3LIWA 2A4RA 4X6MA 3RUOA 2P59A 2VVVA 1K1NA 1EZXC 2FMJA 1A3EH 1GDQA 2BDAA 4K8YA 2BY5X 1RIWB 2BY8X 3TIUA 2PKAB 5KGOA 1PPFE 9LPRA 1GVKB 3EYDA 1AE8H 3ELAH 4Z6AH 4KTSA 1RS0A 2OQUA 2TIOA 4M9FA 1BTPA 2GCTB 1IQGA 3M5NA 4MG3A 5C1YA 5BPEA 1QL8A 1WUNH 2BX4A 4ABBA 1QCPA 2LNCA 3AVZA 3URDA 1BJUA 1C1PA 2WPKS 1A0LA 3U8RH 2RCEA 3RXEA 4DGJA 5DP4A 2QAAA 4X2WA 2LPRA 1EZSC 5CMXH 4ISNA 4M7GA 2JETB 1H8DH 3FANA 1S6FA 3RC4A 2ZDMA 3BIVH 1EXFA 1FUJA 5J4QA 1QNJA 1P2KA 5EXNA 1TQ7B 7KMEH 3MNCA 1KTTB 4K3JA 1A7SA 1TQ0B 1Z8JB 4Z0KA 2D2DA 1BRAA 1O38A 2Z7FE 4NSVA 1FZZA 3Q3XA 1AZZA 4K8BA 1ESBA 2FTMA 1QQ4A 1K0HA 2GDDA 3VB7A 1Z6JH 2GMTB 3ZZDA 1TGCA 5HIYA 1KY9A 1ELFA 4OS6A 1E34B 3QTOH 1GMHG 1LTOA 5DG6A 1P01A 4AB8A 1O3IA 1O2XA 1NFWA 1OS8A 4JZIA 2CGAA 4ASUD 2HNTF 3GY5A 1GI0A 4XBBA 1GI1A 2KFWA 3DSOA 1V3XA 1WTGH 1A3BH 1GJ8B 2EI7A 3SNDA 3NCLA 5E0HA 3WWFA 3N7DA 1E1RD 4OS7A 3STJA 3P8FA 1AVXA 1LHGH 2GV7A 3GCHB 2VIPA 4Y8ZA 4Y7AA 5C0UA 2FOFA 1DT2A 1O3MA 1UVTH 3F0PA 1AFEH 1MU6B 1O33A 2P3FH 5EXMA 2A0QB 3T26A 1DVAH 4I86A 1QA7A 2W7SA 1RIWC 2FX4A 2P8OB 4D76A 1K1JA 4Q2KA 1GVLA 1W0JD 2FO9A 1OOKB 4FVBA 3UIRA 2GCTC 3A7XA 3EQ0H 1YPLH 1SGNE 1UTPA 4JCNA 3SO3A 3ZZ6A 3NK8A 2J38A 2J95A 1DITH 1FI8A 3AW0A 1UCYE 1CGJE 1HPGA 2KCYA 2TRMA 1S6HA 1BMAA 4D9RA 1YLCA 2RDEA 1V2ST 1W12U 3F2HA 3U8OH 3ZVDA 3DT0H 1IAUA 1VCQA 1AU8A 2H5CA 2JETC 1DS2E 1T8MA 3GCTF 4Y10E 2ZFPH 1C1QA 3BG4B 1SGCA 1WV7H 2GZ8A 4E7RG 2EY4C 1GI7B 1KYNA 3BEIB 2SNVA 2GT8A 4JK5A 3RXUA 1MKXH 5FCKA 1GBDA 2Y7ZA 1XKBC 3SJ8A 1SFIA 4AOQA 2G8TA 1O2SA 1SI5H 1C1RA 1E79D 1JBUH 1EPTB 2J2UA 1RXPA 1V2WT 2H1UA 4WWYA 5FPSA 1LVBA 9ESTA 3ZVEA 2L74A 1F7ZA 2PWXA 1QR3E 4IC6A 4MTBA 4ABJA 5J4SA 3RXKA 1GMDG 2WV4A 2QF5A 4MNYA 5TCAA 5L30H 3U69H 2HRVA 4CR5A 2BY9X 2PLXA 1UCYK 1YY3A 1MCTA 3BIUH 5BRRE 3SGQE 3A80A 1AFQB 3LH1A 1Q2WA 2Z94A 4CH8B 2Y7XA 4LK4A 2PKSC 5AVDA 4NA7A 2VIOA 4K1EA 4X2YA 1GI3A 2KX4A 1J14A 3BSQA 5FPTA 2AGIX 1O3LA 2P8OC 3BG8A 1V2TT 1F2SE 1FY8E 3GCOA 3EA9A 2D8WA 1DUAA 1ZJKA 2A4QA 2TBSA 1MTUA 1UVUH 4ZHLU 4Q80A 1TNHA 3OSYA 1Y5UT 5EG4A 1OWKA 1NESE 4A7IB 3LOXA 2EQNA 4DT7B 5C67A 3ZZAA 5EODA 4B6EA 1T31A 2HPPH 2ODQA 4WXVA 1O5FH 5SGAE 1O3PB 1GL1A 1SLWB 3PROA 6GCHG 3ESTA 3SU1A 1TA2A 1TNLA 3SZEA 2NU0E 1TAWA 2KAIA 1O5AB 4GUXA 3GYMA 2NU2E 3ZZ7A 3BG4C 3GY7A 3SORA 4A1VA 2BD5A 1MMJN 1N6YA 3M35A 2AGEX 1GHBF 5CDFE 3RMOH 2W3IA 5FCRA 1GHVH 1KDQA 1C5VA 2SNWA 2OC1A 2ZC9H 3E3TA 1D4PB 4X8UH 4ZHAA 2BXTH 1EPTC 3PM3A 4K5ZA 4VGCB 1XMNB 4GCHF 2A5KA 1FXYA 1QRWA 3BTGE 1HAXB 2XC0A 1YPMH 5I46H 2V0BA 1X7AC 1ZSJA 1UTJA 3ZVFA 2C8ZB 3RDZA 3BV9B 3P8OA 3UFAA 4ISIH 4X6OA 4CRDA 2P93A 3A8AA 1C5NH 4OS1A 3RXVA 1MAYA 1CE5A 2WHXA 1WBGB 2PTCE 1D3QB 4MNXA 5IYTA 4A92A 1SQAA 4UEHH 4DY7B 3OAAD 5LGOA 5C5OA 4UONA 1GCDA 1KLIH 4GVUA 4JK6A 2DUCA 1YPKH 2WINI 1BRBE 3RXPA 1CA0B 1GHZA 1GPZA 3ZZ5A 4D9QA 2HVYB 2WYJA 1A5HA 1FN8A 1GG6B 1G3BA 1O32A 4KGAA 3EDXB 1AY6H 2C8XB 3GOVB 1A4WH 1TX8A 1XUKA 3UOPA 1VR1H 1D6RA 1SGQE 5KECA 5FPYA 2B8OH 2EC9H 5CHAB 1L2EA 1AWFH 1UMAH 1Y3UA 2FPZA 1AUTC 4JZEH 2JDID 3T29A 1C1SA 3N7EA 1QL9A 5A2MH 5EJLA 3GYLB 3MH4A 3SU2A 5JDUB 1RTKA 3QDZB 2THFB 3EE7A 1K2I1 2P3UB 3A83A 3WWBA 3SGBE 1H9LB 1SPJA 1C4Y2 1O3OA 3K6ZA 6ESTA 1B0EA 1P2JA 1TMUH 3SZNA 1ELDE 1T32A 4UFEH 1GMDF 3TJVA 1M9UA 4YM9A 3OY6U 1GI6A 1BCUH 1G2MA 2W5EA 2RA3A 3PV5A 5E2PA 1C2EA 5C0TA 1DY9A 5LPRA 2ZDKA 4KTUA 4ZKNU 4WY3A 2ZA5A 2GCHF 1O3EA 2HVXA 1H4WA 4ISLA 2FESH 1GHYH 1RGQA 1EJNA 5HYOA 3ODFA 2GT7A 1BMNH 1HJ9A 1N1LA 1AVGH 1ELTA 1ABIH 2KCAA 4J1YA 5PTPA 1O3FA 4CREA 2ANWA 2BVSH 3A82A 1JXPA 1UK2A 1CBWB 1PPGE 5DN6D 1B5GH 2P3TB 1ZSLA 3SN8A 4BOHA 3BTFE 3UWIA 1ZPCA 1DANH 5FBEA 1GI2A 1BITA 1LO6A 1THRH 3MWIU 2OQ5A 1PPCE 5AFZH 2ZCKP 3A7VA 3TH3H 3D49H 2YMSB 1TNJA 1ZTJA 1ETSH 2ANYA 1HIAA 1SQOA 4X1NU 1ARBA 1E37B 4YXWD 3QX5H 3U98H 5F8ZA 2B5TB 4ESTE 6GCHF 2K1QA 2QXHA 3UOUA 4YOJA 1ACBE 2XNIA 2EEKA 1V2VT 1YKTA 3HGNA 4B2CA 4ZKRU 3M61U 3OTJE 4Y76A 2BQWB 3BEFB 4I8LA 3RXSA 4E06H 1S85A 5CHAC 1TGNA 1H1BA 2ZU4A 1P02A 2QIQA 5G4BA 2L6OA 2O8TA 4ZKOU 1BT7A 2SFAA 3RXFA 2ZPRA 4YLQH 1NC6A 1W0KD 3DUXH 4RN6A 2GGVB 3E16B 4FVDA 3A8DA 1K1LA 3TJOA 3SBKA 1ZGVA 1JMOH 4TPYA 1N8OC 4LZ4B 2FIRH 5F6MA 1JIRA 2STAE 3S7HB 1S0RA 3CS0A 1VGCB 4AFZA 5T3HA 4B71A 1NU9A 4ABGA 3SJ9A 3TGJE 1UTMA 4O03A 4K60A 2YOLA 2Q6GA 1IQFA 2JH6D 2FS9A 4ZXXH 4I8GA 4BXSA 4BXWA 2XWAA 1T4UH 2OXSA 2YNAA 5GNDA 4YESB 2FWWA 1A2CH 2VIVA 3RXBA 3AK5A 5DP3A 5GJ4B 4AGKA 8LPRA 5EIYA 1LKBA 5K0HA 1VCPA 4E7NA 4B2BA 3T25A 5KEDA 2FI5E 3K65B 2FM2A 3FZZA 1F5LA 1P3CA 2EA3A 1PQ7A 2ESTE 1CBWC 3NUMA 4P00A 2B0FA 3BTEE 1S0QA 3P92A 4H6TA 4I8HA 4U2WA 6CHAB 1W3CA 3URCA 2AMQA 3UR9A 4ABEA 1ZSKA 2PUXB 2FOCA 3OTPA 1NRQH 3EGKH 2F43B 1O34A 1K1IA 2ZGXH 1P9UA 4UFGH 3F6UH 4F4OC 2VWLA 1HGTH 1EATA 1F0UA 1Y5BT 4U30A 3RXIA 4CR9A 1LPGB 2QE7D 1F0SA 1AN1E 3SYJA 1EKBB 3KGPA 5F53A 3M5LA 4OS5A 4O3UA 3RM2H 1K21H 2M5TA 1W14U 4X6PA 5HXFA 1IQLA 3OYPA 3Q3YA 3RXGA 1VITH 8KME2 2AMDA 1OWEA 3D62A 2PSYA 3RXOA 4K1TA 3T2NA 2FOAA 2KZ4A 2VWMA 4XBCA 1UK4A 4IMZA 3P95A 5DJ7A 1SQTA 3SV8A 3UR6A 1SLVB 1O5CB 1GBIA 1G3CA 1TOCB 4I8JA 1HAGE 3RMMH 2F9OA 1MZDA 2BD3A 3A81A 1VGCC 2RFKC 2QXGA 1WOFA 1HJAB 4UD9H 3P17H 1GBCA 4INKA 2ZFQH 3R3GB 5AF9H 2R3YA 1AIXH 3LGUA 1SFQB 1V2MT 2VGCB 1TALA 2FZZA 3P70B 2BY7X 4X8SH 1QB1A 1RJXB 1ZRBA 2JH5D 2KCPA 1KLJH 2YNBA 1MBMA 1W2KH 3GCTG 1C5WB 2Q6DA 5L6NH 4YTAA 1ANEA 1F5RA 1KIGH 2ZF0H 2ZCLP 2GX4A 1C5YB 4FUFA 2FX6A 3SV7A 1NRSH 1W10U 6CHAC 2FOEA 1CO7E 4NA9H 1ZHRA 3SJKA 3LH3A 1CHGA 1XUJA 1IQNA 1CHOG 2FLBH 1SGYE 2FXRA 2H9HA 1NM6A 1SQRA 2VU8E 1HLTH 1GGDC 1GJ9B 5HIZA 1LPKB 4BAKB 3MU8A 4D7FA 2HALA 1B7XB 4XSKU 1TPSA 1YYY1 1O37A 3FAOA 3VXFH 2UUJB 3SI3H 1A0HB 2O8WA 2AIQA 4WVPE 4UFFH 2J98A 4XRNA 2XCFA 3S7KB 1XUFA 4O9VA 5F8XA 1K1MA 1TGBA 1Z7KA 2ZFFH 1ZHMA 3SHAH 1F0TA 1MBQA 5EGMA 1VJ9U 2UWLA 4ZAEA 1V2UT 2XNDD 3MH5A 2HNTC 2ODPA 1O3GA 1FY5A 4DG4A 3E1XB 1LVOA 4JZFH 4ABIA 2H9EH 1C5OH 1UTOA 4ABAA 2BLQA 1O39A 1V2LT 3RXHA 3W95A 1MD8A 2A7CA 3MNBA 1HJAC 4TWWA 1DUEA 1GI4A 7ESTE 2J4IA 1PYTC 3STIA 4FOUC 1SL3A 3AASA 1E36B 3GDUA 4P02A 3VFEA 3M5MA 3ZIAD 2PKAA 3PMJA 2FOMB 4FUIA 4H6SB 1AGJA 2VGCC 1IQJA 4ABDA 3RXQA 2BY6X 1UJ1A 3SUFA 1EASA 2CK3D 1UW7A 2O8MA 1GWAA 4GPGA 1WQSA 1L4DA 1SLXB 3KQEA 1A5GH 1GHBG 3QN7A 3VPKA 1BBRK 1EZQA 2PR3A 4NSYA 4B73A 5DP7A 4Q4LA 4YT7H 4BTUB 8GCHG 1TRMA 1TA6A 1ZOMA 1BTUA 1O3HA 1SKYE 3QK1A 1C5PA 1ZZZA 4GCHG 2CHAB 4DCDA 2BQ7B 4RT0A 2OK5A 3T27A 3UTUH 3HK6B 1GJ7B 3JZ2B 2PKSB 1HAYB 5JYIA 4HG6A 2P95A 2BD4A 1CSOE 1T7CA 3H5CB 3ZYEA 1L1GA 1MZAA 2ZDAH 2ZNKH 1TE0A 2G5NA 2QN5T 4BAMB 1DX5M 4KP0A 1QB6A 2M2AA 1HAVB 4HGCA 5ESTE 5E2OA 2IPHA 5HM9A 1EOJA 3OEHD 2Z3EA 5F8TA 1VJAU 2PGQB 1C2KA 1XUHA 4WMDA 2SGEE 4YOGA 4NZLA 1WTHD 1RTLA 5ESBA 2ZGJA 4TY7A 1AVWA 1YCPH 1YPHC 3GY3A 2G52A 3ODDA 4PROA 1PPZA 2G4UA 1HRTH 2OBQA 3VXEH 2Y5GA 2A2XH 2OUAA 2WYGA 1HBTH 3NRLA 2R2MB 2AFQB 2QCYA 5H4IB 4CBNA 4O97A 2ALPA 1OWJA 3MTYA 4XE4A 3QGNB 3H7OA 1LCYA 1QA0A 1GJDB 1ZYOA 2XXLA 1C5QA 3SV9A 4FUCA 3RC6A 1XVOA 4B76A 1DE7H 2I6QA 3GISB 1TYNA 1QJ1B 1KLTA 2G55A 1YGCH 4K1SA 2CN0H 4XOJA 3T28A 5IDKA 4X1RU 2FTLE 4MPWA 1TX6A 1BMFD 1TB6H 3KIDU 1MTSA 4IN1A 5ABWA 4CRBA 1N6XA 4Q7YA 1CHOF 1OP8A 2PFEA 2W6JD 3ZVAA 3ZYDA 4CRAA 1P2OA 1BTYA 3QTVH 5EQSA 1ZHPA 2V6NA 4AORA 3L33A 2BD9A 4FU7A 4GSOA 5CHBA 2XBVA 3ZZCA 1CT0E 1HV7A 4MPXA 4BAQB 2Z3DA 2Z9IA 3BTME 3DFJA 3CS7A 3A88A 2Y80A 2Z9KA 4ZMAH 4NWKA 1NS3A 3AAUA 1MTNB 3E0NB 2CHAC 2OINA 1LHDH 1AKSB 1MTVA 2ZQ2A 4Y11E 4YO9A 1FN6A 2QF3A 2GCHG 1TGTA 2P94A 3MU0A 2ZCHP 2FODA 4ISHH 1EQ9A 2NWNA 3KHVA 3HGPA 1AE5A 3P8NA 3C1KA 3UQVA 2ASUB 1J15A 1BHXF 1RTFB 1JRTA 3KN2A 2OC0A 3KF2A 3UNQA 1EPTA 4I7YH 1WCZA 1C5UA 2A31A 1AB9C 4WMEA 4ZUHA 4JYTA 1P11E 1DDJA 3EE0B 4ASHA 5K7RA 1ID5H 1DLEA 2VWNA 3QGJA 7LPRA 1WYKA 3TGIE 3SOSA 4INLA 2F9BH 2BLOA 2C4FH 2SGAA 1OPHB 2ZGBH 1CT4E 1PQAA 1KXAA 2QXIA 2JJ1D 4NCYA 2H6MA 1XM1A 2J34A 1IOEA 2BDGA 1G2LA 2XOKD 3TVJB 1THPB 2TGPZ 2UUYA 2R9PA 4J2YB 4F49A 1AWHB 4BTTB 2FYRA 2V7QD 3H09A 3E91A 1O2PA 4KTCA 3RXJA 3LGIA 1GDUA 1D6WA 2BDIA 3BF6H 3QUMP 1ZMLA 1DWDH 4ZKSU 1W7GH 4TSFD 4NZQA 3E90B 3DSPA 1ZGIA 1TRNA 5FBIA 8GCHF 1LQDB 3GY2A 4ZHMU 4X1QU 1OP2A 1HB0B 1C2GA 3PV4A 2CMYA 1VZQH 1NFXA 4RKOB 3UREA 4TYDA 1J16A 1H8ED 3SU6A 2BDYA 4YLUA 3M7TA 2VIWA 1GBKA 3WY8A 1GCTC 2GP9B 1FJSA 2AGGX 3KNXA 1TNKA 1NU7B 2XTTB 1LMWB 1DWBH 1VITF 1SHHB 3KYGA 4NWLA 3TNTA 1O2ZA 1IQKA 3MOCA 1MTNC 2ZQ1A 3OE7D 1G32B 5GCHG 3V13A 5JBTA 3IWMA 1INCA 1J17T 3H7TA 2FOHA 2V35A 3NPSA 3F1SB 1V2PT 3M7QA 1IHTH 3SI4H 3GY6A 3A8BA 4YOIA 1MQ5A 3ATLA 1HYLA 3ZZ9A 3BTWE 1O2IA 1O2OA 1FQ3A 2BDBA 3IITA 4OGXA 1QL7A 3K6YA 3M36A 3BTTE 1HAPH 2G00A 4A5TS 2SGFE 3SQHE 1BTXA 1OWIA 1O30A 3A89A 3PLBA 1D3DB 3A7WA 4SGBE 1DSTA 3SJIA 3W94A 1H9IE 2ZTXA 2TGDA 3SUDA 1OXGA 2FEQH 3PV2A 1QRXA 3K9XB 2ZFSA 1A46H 3M37A 1JIMA 3NKKA 4TWYA 3VEQB 1O3KA 4ABHA 2A32A 1N8OB 4CBOA 1L1JA 3O8DA 3B23B 3SUGA 1MKWH 2O9QA 3FP7E 1NY22 3LPRA 3RU4E 1PPHE 2IJOB 4ACAA 2BLVA 2GV6A 4MNWA 1ETTH 5E0JA 2JIZD 3A7TA 3SNAA 1KXEA 3A7YA 4ZXYH 3MNSA 2BLWA 1NN6A 2PGBB 1KXDA 1V2NT 3UWJH 1P10A 2F9VA 4CRGA 1FMGA 1YLNA 2ZU2A 2IPQX 3FKSD 3MU1A 3EA7A 3LGWA 1TMTH 3TU7H 1C5ZB 5A8XA 4BANB 1AI8H 1C2DA 4ZCNA 1B0FA 4ZH8A 5A0BA 2A7JA 1W11U 2SGDE 1PFXC 1A1RA 1GI9B 2VIDA 3C27B 4JYVH 1T8OA 1ANCA 2IOTA 1T4VH 1PPBH 1BOQA 1O5BB 1MKXK 4JYUH 3GCNA 5C2ZA 1CGIE 1D3TB 2O8UA 2XYAA 1ZLRA 5JB9S 5A0AE 5LH8A 1XXFA 3RXDA 1IQEA 4A1TA 3BTDE 1P3EA 4I8KA 5FX6A 1S82A 5AFYH 3KQCA 3ZVCA 2JH0D 4Y6DA 2XRCA 1C2FA 3V12A 4FETA 1BIOA 1GJ4H 4IN2A 2WUBA 1EAUA 5CE1A 3ZZ8A 1FONA 2OLGA 2DE9A 5DP6A 4BAHB 1UTQA 4FUEA 2BTCE 3OU0A 3ZZBA 1Z1JA 1ZTLA 2BZ6H 1G30B 5L2ZH 2Z3CA 3U1JB 2C3SA 3CP7A 1Y3WA 4B1TA 1P05A 2FDAA 3PLPA 4YT6H 2ZEBA 1GMCG 2C8WB 1AZ8A 1SGFG 3TJUA 4OGYA 3F9HA 3D23A 3AAVA 5HKKD 1GJAB 5B6OA 3UAIC 3FFGA 2ZDLA 5GCHF 1WU1A 5TJXA 3CENA 1BTZA 5L2YH 1TNIA 3V7TA 1GBTA 1O3NA 2A4OA 1TMBH 2R2WU 2VVUA 1UO6A 1AQ7A 4B75A 4NA8A 5LPEA 4Y71A 5EPNA 1FLEE 2BB4A 1AHTH 2OD3B 3UUZA 2BHGA 2PTNA 1P0SH 4TT3D 2C8YB 2ZIQH 4NG9H 3Q76A 3U8TH 2V3HH 3TK6A 1W0YH 3GY4A 5E8EH 5C94A 1UHBB 4WJG2 4K2YA 4AX9H 1YCPM 4B2AA 1GBLA 2F9NA 4DJZB 3QZQA 1F5KU 4H4FA 3S9CA 3A84A 2ZPQA 1SHYA 3S69A 1MCVA 4ABFA 2GD4B 3SJOA 1ANBA 2WZQA 2CV3A 1TLDA 4Y0YE 4F55A 1SSXA 5EW1H 2BQ6B 4R0IA 1O3JA 2VBCA 1BA8B 2VH0A 3SUEA 1EAXA 1SR5C 1AUJA 3PLKA 1S84A 1GGDB 1PQ8A 2LELA 1BB0B 1O0DH 1T8NA 2BMGB 1BRCE 2HNTE 1OYTH 4BAOB 4WH8A 3OFND 1Z8GA 2KR7A 2ANMH 5F03A 1IHSH 1SGTA 1LHCH 1G3DA 2V3OH 3MYWA 1UTNA 1H8HD 1UK3A 5IK2D 1J8AA 1TRYA 4CRCA 3E6PH 3ZVBA 5B6LA 3BTQE 3V3MA 4BNRA 1O2HA 3BEUA 1TIOA 2F9PA 1S83A 1UVSH 1O3DA 1RRKA 5GPIB 1JOUB 3KQBA 2F3CE 2WSSD 4WXIA 1HFDA 5DK1A 4LXBH 2AHME 1XUIA 3K2UA 1NO9H 3RP2A 2PV9B 1LDTT 1P57B 1DICA 1O3BA 4GHQA 4QT8C 4X6NA 3PTNA 4FUHA 1C1MA 1UCYH 1OWHA 2WPHS 2ZO3H 4OM9A 1W8BH 4AFQA 3Q3KA 2OCVB 1QBNA 1C2LA 1ELGA 3LKWA 1K28D 2BD7A 5T6DA 2QF4A 5AHGH 1GJCB 2ZFRH 3SQEE 4WF8A 5DSFA 2BD8A 3T5FH 2A5IA 1D3PB 1MU8B 2WPMS 4IS5A 3MI4A 4XD7D 1G3EA 2BVRH 2B9LA 1MTWA 2PP6A 2LP6A 1FY4A 3TNSA 3F2FA 1Q31A 1TPOA 1A5IA 3BTKE 1EAWA 2BOHB 4NIXA 5LPFA 3V0XA 5HGGA 1YPHE 1P2QA 3KL6A 1SB1H 4RSPA 2PUQH 2VB0A 3SNEA 1V6DA 5ETXA 3EA8A 1YF4A 1V2QT 3TH2H 1QQUA 1SOTA 2UUKB 1GJ5H 3VB6A 1GMCF 1P04A 2Y6TA 5A09A 5C5NA 3PWCA 3RC5A 3SGAE 7GCHF 2WV9A 3QWCH 4TPIZ 2K0QA 1HCGA 5T1VA 4DIIH 4MLFB 2HLCA 2H9TH 3ATIA 3PTBA 1C1WH 1JRSA 3FO8D 4ACBA 3D65E 1BBRE 2VVCA 2STBE 1P12E 3I77A 2XWBI 1QB9A 1NROH 2A45B 3HKIB 1LVYA 3LU9B 1O2WA 1G36A 5C3NA 3RU4D 5T6GA 1QJ6B 3RXMA 3HPTB 5EU8A 1S6LA 1HAIH 2Y81A 1XVMA 3Q77A 3U9AH 2WUCA 1Y5AT 4NIWA 2AIPA 3OY5U 4CHAC 1U6QA 3UQOA 1S81A 3QO6A 4DIHH 2YMSD 3ATKA 1IQHA 1O2YA 3F9EA 2GJGA 1MUEB 1C5MD 3LGYA 1NBME 2ZU1A 5GDSH 1CA8B 3IG6B 1DM4B 1O2MA 1TWXB 1BHXB 4FUGA 3LT3A 4WH6A 1UVPA 2ZTYA 3BTHE 2AH4X 3U1IB 1MAXA 3UNRA 3DA9B 2OC8A 2W7UA 3ITIA 3MMGA 2TPIZ 2RA0A 1L0ZA 1L4ZA 1SGIB 5JBBS 1FPHH 1IQIA 1XKAC 1TX7A 4NFEA 3VGCC 3LJOA 3MO9A 5EPYA 2QC2A 3UNSA 1YPGH 3ZZ4A 2Q6FA 1EX3A 4UFDH 3W1EA 3JZ1B 2UWOA 3PRBA 4H42U 3P6ZB 3HATH 1DPOA 1JWTA 1SG8B 4MPVA 2AMPA 3ATWA 2ZWLH 4DW2U 4CRFA 3TK5A 1VITG 2WPDD 2ZDNA 1PPEE 1C5SA 3M3TA 2AS9A 1EP5A 2VINA 4Z1MD 3VB4A 4A1XA 1AB9B 2HWLB 1KXFA 3GDSA 4FUBA 1MABB 1Y59T 1FX0B 2Q1JA 1P2IA 1C1VH 1GBJA 4B74A 3R0FA 2OP9A 4MNVA 3A85A 1BDAA 2W26A 4X0WU 4NIYA 4D7GA 4KKDA 1BMMH 1K22H 2FP7B 3RMNH 5E0GA 4AZ2B 1UTLM 1D9IA 4X8TH 1DLKB 2ZHEH 1BTHH 2ZFTA 2G81E 3U28C 2WPIS 1V2JT 1S5SA 4I31A 3O8BA 1MQ6A 5DO4H 5EJ1A 2QA9E 4UE7H 2PHBA 2QY0B 1QY6A 3SU5A 1HAVA 3ZV9A 1TBRH 3VB3A 1P06A 2FOBA 3E0PB 1OYQA 3RXCA 3PB1E 1DXPA 4IBLH 4AN7A 2BM2A 1GI8B 2CXVA 4UDWH 3A7ZA 2G5VA 4O3TA 1C2HA 1NZQH 4IMQA 1HAZB 2VIQA 1GCTB 2Y5FA 4YZUA 2A1DB 2QYIA 2ODYB 1F0RA 3RLYH 1AO5A 1V2OT 4U01A 3GDVA 3SV6A 1TPAE 3DCLA 3PO1B 2ZI2H 3N7OA 5DKMA 1YM0A 2QXJA 2GMTC 1QBVH 2HGTH 3MU5A 4GAWA 2WPJS 1KTSB 3KQDA 1DWEH 2AERH 1Y8TA 3PRDA 1YPJH 1HAHH 1O3CA 1C1OA 3UB0A 2XW9A 1UVOA 1O2NA 1SGPE 2XBYA 2J9NA 3FN8A 2JJ2D 1GBHA 4FUDA 5A8YA 1ZJDA 1C5LH 2ALVA 3GCHC 2BD2A 2UUFB 2W6ID 2UWPA 4ISOA 1Z8IB 2KAIB 4GHTA 1PYTD 4NGAH 2IJD1 1HXFH 1ZPBA 3B9FH 4MQAA 1SGRE 3MO6A 3BN9A 1GI5A 1Y3YA 1Y3XA 2JKHA 5C1XA 2SGPE 3RXLA 1O2LA 3KYFA 1KDQB 3ZVGA 2V3MA 2C93B 2HPQH 3HKJB 5EJZA 4RT1A 4X8VH 1QBOA 4NIVA 3I78A 2WPLS 3GICB 1AKSA 1NFYA 3M3SA 2ZHDA 2FI4E 1IQMA 1YP9A 2PW8H 1FAKH 3ZZ3A 4MPUA 3FP8E 4DOQA 3O8RA 2NU4E 1C2MA 5FHTA 4XDEA 3TH4H
chains in the Genus database with same CATH topology
3TK9A 3RXTA 2A5AA 2SGQE 1DY8A 1QURH 2TGTA 3ENSB 2VJ1A 4XFQA 1GMHF 2ZP0H 5EQQA 1QGFA 3FZDA 2H5DA 5GXPA 1VCWA 2ZU5A 1FV9A 2RG3A 4Y0ZE 1DWCH 1RD3B 2BDCA 1O5DH 1OWDA 2HOBA 1GDNA 2R0KA 3SHCH 1ZMJA 4ZROA 1Z1IA 1C1TA 2ZHQH 3B8JA 4CH2B 4LZ1H 1A0JA 3PO1C 1FAXA 1O5GH 2VWOA 2CF9H 2R0LA 3TLOA 3LDXH 5FXLA 2Z9LA 1WAYB 3SV2H 3KCGH 1EUFA 2GTBA 1QHRB 1W13U 1ESAA 4IGDA 3UY9A 1O5EH 2A7HA 3EAJA 1NRPH 4THNH 3M7UA 3NZIA 1O2VA 2Y5HA 5GWZA 4AG1A 2ANKH 5A0CA 1SGDE 2ZU3A 4HZHA 2ZGHA 2R3UA 1GHXH 1GJBB 1E35B 3KEEA 5HMAA 3RMLH 3PMBB 2XC4A 2ZECA 4SGAE 1FDPA 1F92A 1AFQC 1ABJH 1PJPA 1Y3VA 1C9TA 1QJ7B 2GDEH 1C9PA 3Q00A 3OX7U 1FIZA 1KSNA 1GHAG 4X1PU 1E38B 1SLUB 3S9BA 1ANDA 1HUTH 1Z71A 1EJAA 4Q7XA 2Y82A 3FP6E 1P8VC 2ZGCA 1TONA 4NFFA 5JBCS 1HAOH 1EJMA 5C20A 3MH7A 3MNXA 1GVZA 2J92A 1EZUC 8ESTE 1FIWA 2GVFA 4AB9A 1O2UA 3G01A 1W0ZU 2OC7A 3TGKE 1XX9A 4XBDA 1E0FD 3NWUA 1C4U2 4FU8A 3QLPH 4AYYB 4WMFA 2RDLA 1LQEA 2F91A 1FY3A 2O8LA 1MH0A 1DOJA 1GHWH 1KXBA 1YCPK 3QZRA 5FAHA 5HM2A 1OX1A 2BX3A 1TOMH 2VH6A 1MD7A 1HIAB 2BYAX 1A61H 4Y79A 1HDTH 2EI6A 4K69A 2GZ7A 3M3VA 3DD2H 1EP6A 2EI8A 4VGCC 5GIBA 1SBWA 4GLYA 1O35A 3PWBA 4FU9A 1SVPA 1CU1A 1Q3XA 2FYQA 1T8LA 2WV5A 1NRRH 1WSSH 1TFXA 3T62A 3TJNA 2NU3E 3P8GA 1TPPA 2XBWA 1NT1A 2BDHA 1LHFH 4X2VA 1LKAA 1CQQA 5C1UA 2A2QH 1QIXB 5EXLA 3SU0A 1XUGA 2PSXA 3PMAB 2F83A 1GL0E 5T6FA 4Q7ZA 1K1PA 1HNEE 1GBMA 2AYWA 1SC8U 4I32A 4X2XA 1DSUA 1EOLA 2CF8H 3F68H 3LONA 5DGJA 4Y8XA 3LGTA 1CA0C 1ELBA 2DE8A 3SNBA 1SMFE 1P03A 3TPIZ 5JB8S 4BTIB 1GG6C 5DP5A 1C1UH 2P16A 3L6PA 2ZTZA 1OP0A 1XXDA 4FUJA 1C5TA 1QFKH 3S0NA 3RU4T 1OSSA 3E8LA 1O2KA 4OS4A 3M5OA 1O2JA 3MFJA 2CJIA 1TBQH 3RXAA 1YPEH 7GCHG 3F9GA 1EB2A 1LPZB 4A6LA 1NRNH 4AGJA 1TABE 2H2ZA 1BUIA 1RFNA 3O8CA 1FPCH 1TNGA 1GBAA 2BXUH 2ZDVH 4DVAU 1BBRH 1CGHA 3RM0H 1V2KT 3MO3A 2XCNA 3ATMA 1ZPZA 2J94A 2ILNA 2BVXH 2C90B 3ZV8A 1NFUA 4DURA 1UTKA 1OKXA 1TGSZ 1BTWA 1ZR0A 3SNCA 1C5RA 4Y8YA 1ZMNA 2FS8A 2FLRH 1ZTKA 4U32A 1NPMA 4E05H 4IW4E 1ELEE 2B7DH 1GBBA 4JZDH 5DPAA 4INHA 3NXPA 3I29A 1AD8H 1SGEE 2Z6BD 2ZPSA 2Z9JA 1C2JA 2GZ9A 1GHAF 1G37A 3L3TA 1CT2E 3DFLA 3SW2B 5EW2H 1V2RT 1C4V2 4R8TB 1KXCA 2FOGA 3FVFB 1K9OE 2AEIH 2TGAA 4LOYH 1P2MA 1QTFA 1CVWH 3UPEA 2ZKSA 2VNTA 4JMYA 3A8CA 5I25A 1EAIA 3MHWU 3PYHA 1DXWA 4D8NA 3TITA 3MH6A 4KELA 1W7XH 1FY1A 5EOKA 2XBXA 1WQVH 2Z9GA 1GBFA 1BJVA 5DP8A 1Z8RA 3RLWH 1AMHA 5FX5A 2GKVE 5DP9A 3LC3A 1SGFA 4RKJB 1P9SA 5TCCA 3LGVA 1HJ8A 1UHBA 4I33A 4X1SU 1O31A 1HXEH 1H8IH 2A4GA 3S9AA 1P09A 3DHKH 2W3KA 1FNIA 1GJ6A 1ORFA 1ELCA 3MU4A 3GY8A 5EQRA 2ULLA 1J9CH 1LHEH 2NU1E 1NTPA 4CHAB 1O2TA 1YLDA 4FXGH 2ZHWH 3LC5A 4MDSA 4AFUA 1THSH 4AG2A 1C2IA 2ZG0H 4MVNA 1L1NA 2QF0A 1YC0A 4AYVB 1BQYA 1C5XB 3HK3B 1QRZA 3SU3A 3SU4A 2ZHFH 1EB1H 4OS2A 5JBAS 2G4TA 2QGRA 4HTCH 2OTVA 1DFPA 1G9IE 2D26C 1ZRKA 1BMLA 3AW1A 3LJJA 3RXRA 1O36A 1H9HE 1ARCA 2BZAA 2D1JA 3F9FA 3VGCB 3VB5A 1ELVA 4Y7BA 2FI3E 1BRUP 1MKWK 1SOZA 1O2RA 4AFSA 1C1NA 1K1OA 1ESTA 4IC5A 4TY6A 1O2GH 1YBWA 2IN2A 1Z6EA 1BZXE 2ZZUH 3A87A 6LPRA 2F9UA 1P2NA 1TBZH 2XC5A 2OBOA 1LVMA 1ELAA 2BOKA 3PMHB 5JPMH 1PQ5A 3A86A 4HFPB 1GBEA 4JZ1A 2QV1A 1ETRH 2G51A 5A8ZA 1O3AA 2I6SA 4HI3A 1O2QA 3LIWA 2A4RA 4X6MA 3RUOA 2P59A 2VVVA 1K1NA 1EZXC 2FMJA 1A3EH 1GDQA 2BDAA 4K8YA 2BY5X 1RIWB 2BY8X 3TIUA 2PKAB 1PPFE 9LPRA 1GVKB 3EYDA 1AE8H 3ELAH 4Z6AH 4KTSA 1RS0A 2OQUA 2TIOA 1BTPA 2GCTB 1IQGA 3M5NA 4MG3A 5C1YA 5BPEA 1QL8A 1WUNH 2BX4A 4ABBA 1QCPA 2LNCA 3AVZA 3URDA 1BJUA 1C1PA 2WPKS 1A0LA 3U8RH 2RCEA 3RXEA 4DGJA 5DP4A 2QAAA 4X2WA 2LPRA 1EZSC 5CMXH 4ISNA 4M7GA 2JETB 1H8DH 3FANA 1S6FA 3RC4A 2ZDMA 3BIVH 1EXFA 1FUJA 5J4QA 1QNJA 1P2KA 5EXNA 1TQ7B 7KMEH 3MNCA 1KTTB 4K3JA 1A7SA 1TQ0B 1Z8JB 4Z0KA 2D2DA 1BRAA 1O38A 2Z7FE 4NSVA 1FZZA 3Q3XA 1AZZA 4K8BA 1ESBA 2FTMA 1QQ4A 2GDDA 3VB7A 1Z6JH 2GMTB 3ZZDA 1TGCA 1KY9A 1ELFA 4OS6A 1E34B 3QTOH 1GMHG 1LTOA 5DG6A 1P01A 4AB8A 1O3IA 1O2XA 1NFWA 1OS8A 4JZIA 2CGAA 2HNTF 3GY5A 1GI0A 4XBBA 1GI1A 1V3XA 1WTGH 1A3BH 1GJ8B 2EI7A 3SNDA 3NCLA 5E0HA 4OS7A 3STJA 3P8FA 1AVXA 1LHGH 2GV7A 3GCHB 2VIPA 4Y8ZA 4Y7AA 2FOFA 1DT2A 1O3MA 1UVTH 1AFEH 1MU6B 1O33A 2P3FH 5EXMA 2A0QB 3T26A 1DVAH 1QA7A 2W7SA 1RIWC 2FX4A 2P8OB 4D76A 1K1JA 4Q2KA 1GVLA 2FO9A 1OOKB 4FVBA 3UIRA 2GCTC 3A7XA 3EQ0H 1YPLH 1SGNE 1UTPA 4JCNA 3SO3A 3ZZ6A 3NK8A 2J38A 2J95A 1DITH 1FI8A 3AW0A 1UCYE 1CGJE 1HPGA 2TRMA 1S6HA 1BMAA 4D9RA 1YLCA 1V2ST 1W12U 3U8OH 3ZVDA 3DT0H 1IAUA 1VCQA 1AU8A 2H5CA 2JETC 1DS2E 1T8MA 3GCTF 4Y10E 2ZFPH 1C1QA 3BG4B 1SGCA 1WV7H 2GZ8A 4E7RG 3BEIB 1GI7B 1KYNA 4JK5A 2SNVA 2GT8A 3RXUA 1MKXH 5FCKA 1GBDA 2Y7ZA 1XKBC 3SJ8A 1SFIA 4AOQA 2G8TA 1O2SA 1SI5H 1C1RA 1JBUH 1EPTB 2J2UA 1RXPA 1V2WT 2H1UA 4WWYA 5FPSA 1LVBA 9ESTA 3ZVEA 1F7ZA 2PWXA 1QR3E 4IC6A 4MTBA 4ABJA 5J4SA 3RXKA 1GMDG 2WV4A 4MNYA 5TCAA 5L30H 3U69H 2HRVA 4CR5A 2BY9X 2PLXA 1UCYK 1MCTA 3BIUH 5BRRE 3SGQE 3A80A 1AFQB 3LH1A 1Q2WA 2Z94A 4CH8B 2Y7XA 4LK4A 2PKSC 5AVDA 4NA7A 2VIOA 4K1EA 4X2YA 1GI3A 3BSQA 1J14A 5FPTA 2AGIX 1O3LA 2P8OC 3BG8A 1V2TT 1F2SE 1FY8E 3GCOA 3EA9A 2D8WA 1DUAA 1ZJKA 2A4QA 2TBSA 1MTUA 1UVUH 4ZHLU 4Q80A 1TNHA 3OSYA 1Y5UT 5EG4A 1OWKA 1NESE 4A7IB 3LOXA 4DT7B 5C67A 3ZZAA 5EODA 1T31A 2HPPH 2ODQA 4WXVA 1O5FH 5SGAE 1O3PB 1GL1A 1SLWB 3PROA 6GCHG 3ESTA 3SU1A 1TA2A 1TNLA 2NU0E 1TAWA 2KAIA 1O5AB 4GUXA 3GYMA 2NU2E 3ZZ7A 3BG4C 3GY7A 3SORA 4A1VA 2BD5A 1MMJN 1N6YA 3M35A 2AGEX 1GHBF 3RMOH 2W3IA 5FCRA 1GHVH 1KDQA 1C5VA 2SNWA 2OC1A 2ZC9H 3E3TA 1D4PB 4X8UH 4ZHAA 2BXTH 1EPTC 3PM3A 4K5ZA 4VGCB 1XMNB 4GCHF 2A5KA 1FXYA 1QRWA 3BTGE 1HAXB 2XC0A 1YPMH 5I46H 2V0BA 1X7AC 1ZSJA 1UTJA 3ZVFA 2C8ZB 3RDZA 3BV9B 3P8OA 3UFAA 4ISIH 4X6OA 4CRDA 2P93A 3A8AA 1C5NH 4OS1A 3RXVA 1MAYA 1CE5A 1WBGB 2PTCE 1D3QB 4MNXA 5IYTA 4A92A 1SQAA 4UEHH 4DY7B 5LGOA 5C5OA 4UONA 1GCDA 1KLIH 4GVUA 4JK6A 2DUCA 1YPKH 2WINI 1BRBE 3RXPA 1CA0B 1GHZA 1GPZA 3ZZ5A 4D9QA 2WYJA 1A5HA 1FN8A 1GG6B 1G3BA 1O32A 4KGAA 3EDXB 1AY6H 2C8XB 3GOVB 1A4WH 1TX8A 1XUKA 3UOPA 1VR1H 1D6RA 1SGQE 5FPYA 2B8OH 2EC9H 5CHAB 1L2EA 1AWFH 1UMAH 1Y3UA 2FPZA 1AUTC 4JZEH 3T29A 1C1SA 1QL9A 5A2MH 3GYLB 3MH4A 3SU2A 5JDUB 1RTKA 3QDZB 2THFB 1K2I1 2P3UB 3A83A 3SGBE 1H9LB 1SPJA 1C4Y2 1O3OA 3K6ZA 6ESTA 1B0EA 1P2JA 1TMUH 3SZNA 1ELDE 1T32A 4UFEH 1GMDF 3TJVA 1M9UA 4YM9A 3OY6U 1GI6A 1BCUH 1G2MA 2W5EA 2RA3A 5E2PA 1C2EA 1DY9A 5LPRA 2ZDKA 4KTUA 4ZKNU 4WY3A 2ZA5A 2GCHF 1O3EA 2HVXA 1H4WA 4ISLA 2FESH 1GHYH 1RGQA 1EJNA 5HYOA 3ODFA 2GT7A 1BMNH 1HJ9A 1N1LA 1AVGH 1ELTA 1ABIH 4J1YA 5PTPA 1O3FA 4CREA 2ANWA 2BVSH 3A82A 1JXPA 1UK2A 1CBWB 1PPGE 1B5GH 2P3TB 1ZSLA 3SN8A 4BOHA 3BTFE 3UWIA 1ZPCA 1DANH 5FBEA 1GI2A 1BITA 1LO6A 1THRH 3MWIU 2OQ5A 1PPCE 5AFZH 2ZCKP 3A7VA 3TH3H 3D49H 1TNJA 1ZTJA 1ETSH 2ANYA 1HIAA 1SQOA 4X1NU 1ARBA 1E37B 3QX5H 3U98H 5F8ZA 2B5TB 4ESTE 6GCHF 2K1QA 2QXHA 3UOUA 4YOJA 1ACBE 2XNIA 2EEKA 1V2VT 1YKTA 3HGNA 4B2CA 4ZKRU 3M61U 3OTJE 4Y76A 2BQWB 3BEFB 4I8LA 3RXSA 4E06H 1S85A 5CHAC 1TGNA 1H1BA 2ZU4A 1P02A 2QIQA 5G4BA 2O8TA 4ZKOU 1BT7A 2SFAA 3RXFA 2ZPRA 4YLQH 1NC6A 3DUXH 4RN6A 2GGVB 3E16B 4FVDA 3A8DA 1K1LA 3TJOA 3SBKA 1ZGVA 1JMOH 4TPYA 1N8OC 4LZ4B 2FIRH 5F6MA 1JIRA 2STAE 3S7HB 1S0RA 3CS0A 1VGCB 4AFZA 5T3HA 4B71A 1NU9A 4ABGA 3SJ9A 3TGJE 1UTMA 4O03A 4K60A 2YOLA 2Q6GA 1IQFA 2JH6D 2FS9A 4ZXXH 4I8GA 4BXSA 4BXWA 2XWAA 1T4UH 2OXSA 2YNAA 4YESB 2FWWA 1A2CH 2VIVA 3RXBA 5DP3A 5GJ4B 4AGKA 8LPRA 1LKBA 5K0HA 1VCPA 4E7NA 4B2BA 3T25A 2FI5E 3K65B 2FM2A 3FZZA 1F5LA 1P3CA 2EA3A 1PQ7A 2ESTE 1CBWC 3NUMA 2B0FA 3BTEE 1S0QA 3P92A 4H6TA 4I8HA 4U2WA 6CHAB 1W3CA 3URCA 2AMQA 3UR9A 4ABEA 1ZSKA 2PUXB 2FOCA 1NRQH 3EGKH 1O34A 1K1IA 2ZGXH 1P9UA 4UFGH 3F6UH 4F4OC 2VWLA 1HGTH 1EATA 1F0UA 1Y5BT 4U30A 3RXIA 4CR9A 1LPGB 1F0SA 1AN1E 1EKBB 3KGPA 3M5LA 4OS5A 4O3UA 3RM2H 1K21H 2M5TA 1W14U 4X6PA 5HXFA 1IQLA 3OYPA 3Q3YA 3RXGA 1VITH 8KME2 2AMDA 1OWEA 3D62A 2PSYA 3RXOA 4K1TA 3T2NA 2FOAA 2VWMA 4XBCA 1UK4A 4IMZA 3P95A 5DJ7A 1SQTA 3SV8A 3UR6A 1SLVB 1O5CB 1GBIA 1G3CA 1TOCB 4I8JA 1HAGE 3RMMH 2F9OA 1MZDA 2BD3A 3A81A 1VGCC 2QXGA 1WOFA 1HJAB