1CHGA

Chymotrypsinogen,2.5 angstroms crystal structure, comparison with alpha-chymotrypsin,and implications for zymogen activation
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
245
structure length
226
Chain Sequence
CGVPAIQPVLSGLSRIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGVTTSDVVVAGEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSAVCLPSASDDFAAGTTCVTTGWGRLQQASLPLLSNTNCKKYWGTKIKDAMICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQTLAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Chymotrypsinogen: 2.5-angstrom crystal structure, comparison with alpha-chymotrypsin, and implications for zymogen activation.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase zymogen (serine proteinase)
molecule keywords CHYMOTRYPSINOGEN A
total genus 40
structure length 226
sequence length 245
ec nomenclature ec 3.4.21.1: Chymotrypsin.
pdb deposition date 1975-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1chgA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1chgA01
2FYRA 4IW4E 3ZZDA 1AKSB 2BQWB 1AZ8A 5L2YH 4X6MA 2PSXA 7ESTE 2HNTF 1O2LA 3NPSA 3RXGA 1KLIH 2C8YB 1LCYA 3QGNB 4AGJA 6GCHF 1O36A 1K2I1 2FWWA 4ZROA 2OUAA 2Z94A 1GJ6A 2NU2E 1E37B 4WXIA 1IQFA 4B2AA 4BAMB 4CHAC 4GHQA 3LGUA 4ZHAA 4ZXYH 4R8TB 2BD2A 3BTEE 3F9GA 3LGTA 6GCHG 3QN7A 1QHRB 3ZZ3A 4AB8A 3LDXH 4OS1A 2VIPA 3E90B 2OXSA 2ZGXH 1HXEH 3D62A 1ELCA 3TK5A 1L0ZA 1T7CA 2WYJA 2ZA5A 1EUFA 1FAKH 1B5GH 3FAOA 4YOGA 1OOKB 1AI8H 2PKSB 2R2WU 2XW9A 1MU6B 3QX5H 4MPVA 2BY8X 3LPRA 3ENSB 1GJ7B 1LVYA 1E34B 1SOTA 3URCA 1SOZA 3RDZA 3PM3A 1GJBB 1V2MT 4ZH8A 4Q7XA 2QA9E 3GCNA 1C9PA 3SGAE 1HIAB 2GVFA 1CHOF 4WWYA 3H7TA 3AVZA 3VXFH 5C1YA 4D7GA 3A88A 1O32A 2BD4A 3P8NA 2ZFFH 3BTHE 8KME2 2A5AA 4I33A 4NIXA 2VVUA 1INCA 1O2QA 2HRVA 3KGPA 4YTAA 1ESAA 5LPRA 2AMQA 3GY7A 4FUEA 2GP9B 5C1XA 2A4RA 5LPFA 3P95A 1MTWA 1GCDA 4YLUA 3AAUA 3PLBA 2WV5A 3Q3YA 1XXFA 5L2ZH 3ODFA 3U1JB 1BRBE 2PHBA 4I7YH 2AIQA 2ZF0H 1V2LT 3LJJA 1OX1A 2ZDMA 2BVRH 3N7OA 5A8XA 3GISB 1H9IE 3TIUA 1V6DA 1BHXF 1O3LA 5FBEA 2CMYA 2Q6GA 3RXBA 1Z8IB 3EAJA 3TVJB 1F0UA 1UTPA 3QO6A 1C2JA 1DXWA 3BTDE 1MQ6A 2J2UA 5HYOA 5J4QA 1C5QA 4NG9H 3VB6A 5HM2A 2EI8A 1O5FH 3A8AA 3MFJA 4TWWA 2FI3E 3SU6A 1O2YA 4U01A 2PFEA 4DG4A 3UQOA 1F7ZA 1GHBG 2R3YA 2ULLA 3BTQE 1HAVB 4WY3A 1EZUC 3A84A 1TYNA 3DUXH 1P12E 2I6SA 3I29A 1GJAB 1ELBA 2GCTC 1C5MD 1CA0C 1EJNA 2ZU5A 3T25A 4K1TA 1YLDA 1DSUA 4ZUHA 1NM6A 1C1UH 2ZI2H 1CU1A 1GHVH 1HAXB 2CF8H 2QCYA 7GCHF 3OYPA 4Q2KA 4DT7B 1N8OB 2PW8H 4X1SU 1FPCH 1H1BA 2G4TA 2IN2A 1K21H 1P06A 3ZZAA 4JZDH 3OX7U 2VNTA 2A32A 2XBYA 1DFPA 3LGVA 4GAWA 1GVZA 1VJAU 3A7TA 3CP7A 1D3TB 1OSSA 2J34A 3KIDU 1QB6A 5BRRE 2Q6DA 1GI5A 1JMOH 1G2LA 1IHSH 1MBQA 1V2RT 1LO6A 3EYDA 4IBLH 3RXRA 2WUCA 3TH4H 1SGFG 4DJZB 4JCNA 2FOCA 5E2OA 2QXHA 3LGWA 3TGKE 3I78A 4F49A 2KAIB 5DP6A 2P95A 1P9UA 2BDAA 1P2JA 2UWPA 3VGCC 3Q3KA 1WBGB 1P04A 3A80A 2J92A 3A7XA 1DWBH 2OQ5A 2QV1A 3RLYH 1PQAA 1AUTC 3STIA 1ZSKA 3K6YA 3RXOA 3O8RA 1O3FA 5EW1H 1GBTA 1A1RA 1C5PA 3SU1A 2BD5A 5EQSA 1UK3A 1FDPA 4ISIH 1N1LA 3T29A 5HM9A 2PKSC 1MH0A 1OWKA 3EDXB 1BTUA 3SORA 3HK6B 1CO7E 1F5LA 2A4QA 2FOEA 1EP5A 2SNVA 4I8LA 5C3NA 5EQRA 1QL9A 3TJUA 1GDUA 1O30A 1GBDA 1GJ8B 1UK2A 3GCOA 4DOQA 2GT7A 3ATLA 2Z3EA 5DKMA 2GDDA 1C4V2 3K9XB 1BBRH 5EPYA 4Y71A 4BAQB 2ZU1A 1HLTH 1JRSA 1SLVB 2R0LA 4IC6A 2B5TB 4X8TH 1IQIA 3NZIA 2EC9H 2THFB 2STBE 2TRMA 4MG3A 4U2WA 1KIGH 2P94A 3MU8A 2W3IA 1P57B 2BDHA 2R2MB 2H5DA 2FOAA 4VGCC 4NIYA 1QB1A 4HZHA 1OWHA 4KELA 4MNXA 5AHGH 3PYHA 2CN0H 2VJ1A 4LOYH 3ZYEA 1ID5H 1QJ1B 1FY8E 1F5RA 3WY8A 2AGGX 1CHOG 1PQ8A 5L6NH 1OKXA 2Z9LA 1O34A 1FY4A 2AYWA 1GBJA 1BTPA 2ZZUH 2BDYA 3PMAB 1O3IA 3GDVA 5LPEA 3QK1A 3SO3A 5AFYH 3MH4A 1A46H 3BTTE 3ZVEA 1ARCA 1P3CA 5T6FA 4BNRA 1C5SA 1O3MA 1PQ7A 1YPGH 3SHCH 1B0FA 1H8DH 2C93B 4A1TA 2ASUB 2BY9X 4ISNA 3EQ0H 2ESTE 3SJIA 4CRAA 2HPPH 1ZYOA 1SVPA 1UVUH 1HAVA 1ZPZA 2Y5FA 1V2OT 2ZU3A 3E6PH 3OY5U 1PFXC 2QC2A 2BM2A 5CE1A 1O3DA 3LU9B 2G8TA 4KP0A 2JH6D 2W26A 3M5MA 5EU8A 2ZPQA 2LPRA 1UHBA 1IQMA 1ZRBA 2F3CE 3B8JA 4XBDA 4X6NA 2ZHQH 3TGIE 1SGNE 1SGCA 1LDTT 1DDJA 1TA2A 4F4OC 1OP8A 3ZVFA 4X8SH 3I77A 3SJ9A 4Y7AA 3U69H 4BTIB 1TFXA 1BQYA 1SMFE 4ABAA 3HKJB 1GBMA 1LHGH 2ZIQH 3PB1E 1GJ5H 2BLQA 1YCPH 1C1QA 1C2MA 2FLRH 2QF0A 4TY6A 2W7SA 2BVXH 3T2NA 1SGDE 1ELDE 1KXAA 1B7XB 7KMEH 2XYAA 3ZV8A 3QLPH 1QJ7B 1TAWA 1UHBB 4MPWA 4ZKNU 1V2TT 1SHYA 1SQOA 1O5CB 1Y5UT 1NFWA 2UUFB 1OYQA 5GXPA 1T4VH 1DY9A 1ANDA 1JBUH 1S81A 3SJKA 1O2NA 1ORFA 1MMJN 3M7TA 2QXGA 5C20A 1ZHRA 1MKWH 1PPBH 1RIWB 1TGNA 2ALPA 2A5KA 2ANKH 1DOJA 3HGNA 2AGIX 1QURH 3KQBA 1C1VH 2CV3A 4ZMAH 1K1PA 1UO6A 2FOHA 3NUMA 4Q80A 5C5OA 1ZMJA 3SW2B 4NZQA 1C1WH 4TPYA 2PTCE 2EA3A 3RXVA 1WTHD 4BAOB 1YM0A 2UUYA 3TK6A 1UVOA 4I8KA 1C1PA 5DK1A 1UJ1A 1GJ9B 1O5BB 1MTVA 2FODA 3MNCA 1EB1H 2PLXA 3L33A 2Y5HA 2PUQH 4JZ1A 2BLVA 5EPNA 1CT4E 1XVOA 3OY6U 5L30H 3RXUA 2ZGJA 2FESH 1T8LA 3BTME 3RXCA 1F5KU 3E3TA 3OU0A 1A0LA 1XVMA 3ZYDA 5F8XA 1DSTA 4Q7ZA 1YYY1 1YCPK 3PV4A 4HTCH 1SGTA 4Z6AH 2ZFQH 3S9AA 3V7TA 1ANEA 1C5ZB 1WAYB 1MD7A 1J15A 5ESTE 5JDUB 1RGQA 1GDNA 1O3NA 2ZC9H 3BIVH 2AERH 5T6GA 3T5FH 1MQ5A 3STJA 1FPHH 1EOLA 1Z8GA 5LGOA 3TH2H 2VH0A 2F9NA 3DT0H 1G30B 1P2KA 4CRCA 2YOLA 1E35B 3PO1B 8ESTE 1G37A 1HJAB 1N6YA 5AFZH 2VWMA 4DIHH 1T4UH 2QAAA 3TU7H 2PTNA 4O97A 4OGYA 2H2ZA 4A7IB 2UUJB 2JETC 2IJOB 2AS9A 4QT8C 3B23B 1EAWA 1C5XB 4JZIA 5C67A 1C5YB 1GGDC 1QRWA 2BQ7B 2OBQA 1J8AA 2WUBA 2VIQA 4NWKA 1BZXE 3ZZ7A 1GBIA 4CRDA 4E7NA 1KLTA 1FJSA 1GL1A 1GVLA 1Z6JH 2HLCA 1O2RA 1SGRE 4BOHA 2OD3B 1A2CH 1SGFA 4ISHH 1GBEA 3SJOA 1QRXA 3PWBA 1TOCB 4JMYA 1CA8B 2PV9B 2GGVB 4X2YA 5JBBS 3P70B 3SUDA 1G3EA 2ZTZA 1VITH 1ZHMA 3PLPA 1TGSZ 5TJXA 1O2WA 2BDGA 1O2MA 1ZTKA 5B6OA 3IG6B 1BCUH 2RA0A 4ISLA 1F2SE 3MH5A 4UD9H 1O3BA 2QXIA 3R3GB 2BDCA 1PYTC 1TX7A 1NROH 1RXPA 3TJNA 4B76A 4AORA 2WINI 4DURA 1DUAA 2SGQE 2FI5E 4NCYA 1TGTA 3ELAH 4K1EA 3T27A 2Y82A 2Z9GA 2ZHFH 3MH7A 2NU0E 1TGCA 5FXLA 1NRNH 1L1NA 1TWXB 3EA8A 5EQQA 4UONA 1QA7A 1QQ4A 4K5ZA 2TPIZ 5FX5A 3GOVB 3M3TA 1MD8A 3SUGA 1ZGIA 1A3EH 4AYYB 2TIOA 1SGPE 1YCPM 1OWDA 1FN8A 5CMXH 1EKBB 2NU3E 2PSYA 1Q31A 1MTUA 1UTLM 1TBRH 1EZQA 5A8ZA 3DFLA 1SPJA 3ZVGA 3F9EA 3SQHE 3GY2A 2XRCA 1RD3B 1MTSA 4YESB 1GHZA 3K2UA 3SI3H 5I46H 2VIDA 1HRTH 2ALVA 3O8CA 1O3HA 1MAXA 2ZCKP 1A5HA 1GMCF 1IQNA 2VVVA 7GCHG 5A0BA 2VGCB 3EA7A 4FUDA 3U98H 4Q7YA 1DY8A 3MU1A 3QTOH 1MCTA 1VZQH 1OWJA 1O31A 3IWMA 1W12U 2EI7A 2ODPA 2Y7XA 2A1DB 1JIMA 2GT8A 1TMTH 3U8TH 2ZNKH 1ANCA 2ZGHA 1WSSH 3SN8A 1SGEE 3M5NA 1H8IH 3TPIZ 1AUJA 1Z7KA 1P9SA 2RG3A 1EOJA 2ZQ2A 4GUXA 2ZDNA 1L1GA 2SGDE 1MU8B 2OC1A 1BRCE 4UFGH 1C1MA 1IQLA 2J9NA 1G3DA 4ZKOU 1XUKA 1GMHF 4KGAA 3BEUA 2VIOA 8GCHF 2OP9A 1K22H 3V0XA 2FPZA 2VIVA 5GCHG 1MZAA 3M3VA 2G4UA 2VVCA 1A5GH 5E0JA 5H4IB 3SJ8A 1TPSA 1SG8B 3NK8A 1V2WT 2O8MA 2XCNA 1BTWA 6CHAB 1LKAA 1KTSB 1QGFA 1O35A 1AZZA 1V2VT 3RP2A 1W10U 3LOXA 1K1LA 1PPFE 1HB0B 2A5IA 3HK3B 5EGMA 4MVNA 2G5VA 1V2PT 1BB0B 1V2ST 2ZPRA 1GCTC 1O3EA 2VINA 3FANA 2V3HH 3H5CB 2ZDLA 1O3CA 2BY6X 4FVBA 4U32A 2WPKS 2Z6BD 1FY5A 1PPEE 3M5OA 1P2NA 1ETTH 1HAZB 1TMUH 1Y59T 2FXRA 4PROA 2BX3A 1HGTH 3TITA 1AE5A 2DE8A 4ABBA 1X7AC 3A7ZA 2XBWA 3A85A 3CS7A 1FN6A 1C2KA 1LVBA 1EZSC 4D9QA 3V12A 4GHTA 1Z8JB 1H9LB 1C1SA 1OP2A 1AIXH 4LXBH 4YO9A 1UTOA 5A8YA 4XBBA 1AY6H 1C2GA 1SGQE 4XBCA 3UOPA 1ETSH 4U30A 3RXKA 1Y5AT 4CRGA 1EXFA 3PLKA 3M7UA 1BMNH 1TGBA 2FYQA 3SZNA 5JB8S 1GI0A 5EXMA 2NWNA 3P17H 3VB7A 1A7SA 1Z6EA 1A0JA 5DP7A 3BG4B 3U1IB 3QDZB 5EXLA 1MKXK 3VPKA 3ATIA 4K1SA 3TK9A 4JK6A 3A8CA 1GGDB 1MBMA 1J14A 2BOHB 1H4WA 1KDQB 3UQVA 2JETB 1XMNB 2AEIH 2C8WB 1E36B 2WV4A 2HGTH 3RM2H 3UWIA 1HJAC 4B1TA 1GJDB 2GDEH 1FUJA 1T31A 1JXPA 3KN2A 5GIBA 1C5OH 1BBRK 1HYLA 4IMQA 1VCQA 4INKA 3NKKA 4I31A 4B73A 1VGCB 1TPOA 2C8ZB 2O8LA 1GVKB 3RXSA 1BBRE 3E16B 1GCTB 1D3PB 2B9LA 1NFUA 4Y8XA 5HXFA 1OS8A 5GDSH 1TBQH 2IOTA 4UFEH 2GV6A 1SR5C 1TRYA 1OYTH 2WPLS 3ODDA 6ESTA 1AMHA 1UCYH 1MZDA 1ELFA 2XNIA 1LHDH 1CGIE 3ESTA 3MNXA 1O2PA 1OXGA 1YP9A 1SSXA 3JZ1B 1V2QT 1YGCH 2P8OB 1HAYB 1BHXB 3UOUA 2A7HA 1WOFA 1CBWB 1QR3E 1NPMA 4Z0KA 5A0CA 3TJOA 2P3FH 3TJVA 1YPLH 1AQ7A 1YPKH 2V35A 5C2ZA 3B9FH 3UNRA 1QA0A 1ZTJA 2C3SA 4TY7A 4ZXXH 3ATWA 3U9AH 1CE5A 2RDLA 4AFQA 4BANB 2V0BA 2XCFA 3GY8A 1TQ7B 2A4GA 1TALA 3GY4A 2CXVA 1J17T 4YT7H 1V2UT 4AFUA 4HFPB 1XUJA 1LHFH 1V2KT 2RCEA 3JZ2B 5T6DA 4CR9A 1FLEE 2ZDAH 1OP0A 4O9VA 1GI7B 2D2DA 4JYVH 2BZAA 3BIUH 4DCDA 4CH2B 2J95A 1C9TA 5PTPA 1TB6H 2OQUA 3A81A 1HAPH 2H9HA 2FTLE 4K2YA 2BXTH 3UREA 2B0FA 1O37A 3FP8E 4MDSA 3SV8A 3E0NB 3MOCA 3VB4A 1AB9B 3D49H 1W2KH 1CGJE 2VH6A 2Z3CA 5T3HA 1ZSJA 1WV7H 4CRFA 1HIAA 3A82A 1YPHC 3M35A 2FI4E 3GY3A 1CHGA 1UVSH 4ABFA 4GCHG 3MNBA 2FOGA 2P93A 1BJVA 1GMDF 3KQDA 3TGJE 1Y3VA 4XDEA 1WUNH 1BIOA 2UWLA 3GCHB 1JOUB 5GCHF 1YPHE 2GX4A 1IHTH 1Z8RA 2UWOA 2ZU2A 4AOQA 3VFEA 2Y6TA 1BTZA 1D9IA 3GCTG 3H7OA 3FP6E 5E0HA 2W7UA 3KQCA 2BLWA 1HJ8A 3RXAA 1LPKB 1RJXB 1TE0A 1QB9A 1S82A 3PMJA 5A2MH 2F9OA 1IQKA 1S83A 5IDKA 1MTNB 2IPHA 1A4WH 2FEQH 3LONA 2ANWA 1O2GH 4HI3A 1L4ZA 1GBLA 2BOKA 2FX4A 2TGDA 2K1QA 1SC8U 5CHAB 1T8NA 5LH8A 1GJCB 1TQ0B 1CQQA 4A5TS 2ZGBH 1FMGA 1GBBA 1NESE 1BTYA 3PMBB 1BRAA 3TLOA 3AW1A 4OS5A 2FOBA 3FP7E 2OC7A 1V2NT 1NTPA 5BPEA 1NN6A 2ZG0H 2STAE 1O5DH 2Q1JA 2TGAA 4E06H 2YNBA 1FXYA 2ZEBA 3L6PA 3UR6A 3W94A 4NSVA 2FM2A 2PR3A 1O2TA 1P8VC 1DLEA 3T62A 4K8BA 1IQJA 2F9BH 2ZPSA 4O3UA 3ZVCA 3RXHA 1QBOA 1YPEH 1QFKH 4Y8YA 2I6QA 4YZUA 3KEEA 2CHAC 4J2YB 1O3KA 4J1YA 1HBTH 1Y8TA 1EZXC 1XUGA 4A92A 1SFIA 3A87A 1ESBA 3E91A 3QUMP 1KXDA 3NCLA 2P8OC 1LTOA 1ZJDA 1FIZA 1HPGA 3HKIB 1AVXA 3D65E 3S7KB 3PMHB 2H9TH 2BHGA 1Q2WA 4WH6A 1AFQC 3W95A 5AVDA 2H5CA 1S85A 2A45B 2G55A 1IQGA 1Z1JA 3MO9A 2J94A 2B7DH 1BITA 1UTQA 1C2FA 4CBNA 2WPHS 1NT1A 1LVMA 3T26A 2BD9A 4ABIA 2AFQB 3ZV9A 2OTVA 5K0HA 2HNTC 1Y3UA 3SU2A 1UMAH 2JH5D 4A6LA 4NA7A 4LZ4B 1ZMNA 1O3AA 1PPGE 3UIRA 4ZKRU 3C27B 3BV9B 5C5NA 1C5RA 2D26C 2OBOA 5A09A 3NXPA 5F8ZA 3EGKH 2FS9A 1EQ9A 2BZ6H 4NZLA 3DA9B 2W3KA 1P11E 3ZZCA 1RTLA 1SQAA 1W7GH 4JYTA 1NY22 4MPUA 4X0WU 3RMNH 2FOMB 1BDAA 1C1TA 1PPHE 1JRTA 3QZQA 3BG4C 1DICA 2Y81A 2SFAA 3EA9A 2QYIA 1HDTH 4CHAB 1ESTA 1AVWA 1MTNC 1HAIH 4JYUH 4Y10E 1DWCH 1AN1E 3RXIA 5EW2H 1XUIA 1DX5M 3A7YA 1BUIA 4ISOA 4Y76A 3SUEA 1C4U2 1HUTH 3OSYA 1ZJKA 1NZQH 1S0RA 5F03A 3RLWH 3MO3A 1A61H 1G36A 2VU8E 3GDUA 4B2BA 1CA0B 1GI3A 1ZGVA 2FZZA 4FXGH 3GYLB 1O5AB 2G5NA 2ZTXA 3SNBA 2NU4E 2BXUH 1FAXA 2ZHDA 1ABIH 1AU8A 4E05H 3ZZ9A 4ABHA 2NU1E 2F9UA 1HAOH 2PGBB 3Q00A 4X1NU 1C2LA 1SLUB 1YPMH 1AGJA 4DW2U 1P0SH 5FPTA 3F1SB 1IQHA 2WPMS 1C5UA 2A7JA 4INLA 1DITH 3SU3A 3BEIB 4BTTB 1Y3WA 1Q3XA 1GG6C 4WVPE 3P8FA 4O3TA 1JWTA 2J38A 3RMMH 1FY3A 3GY5A 1C1NA 1CSOE 4IS5A 5FPSA 1D6WA 3ZVBA 2OC8A 5G4BA 4NGAH 2VWOA 3BTWE 4ZHMU 1XUFA 2Y5GA 2Z7FE 3IITA 3TH3H 1S6HA 2XBVA 4SGAE 4WMDA 2GMTC 2BY7X 1UTJA 2FOFA 2BMGB 1Y3XA 1AWHB 3S9BA 4K8YA 2SGEE 2A4OA 2Y80A 5JPMH 3MTYA 3SNEA 4THNH 2XC5A 3ZVAA 5DGJA 1G2MA 1P3EA 1VCWA 1SGYE 2HOBA 4WH8A 5DPAA 3SNCA 2CHAB 4IC5A 2A2XH 1C1OA 1KXCA 1EAXA 3GCTF 1KXFA 2ZCHP 3FZDA 5EODA 3UPEA 2ZHWH 4ZKSU 2ZKSA 2SGFE 2AMPA 3SGQE 1O39A 1MAYA 1FIWA 3SGBE 4O03A 1FV9A 1O5GH 5DP4A 1D3DB 3F68H 3RXLA 5F8TA 4Y6DA 1VJ9U 2C8XB 4OS2A 1W13U 2BDBA 2DUCA 3MO6A 4K69A 4KTUA 1TPPA 5DG6A 1LVOA 2ZFSA 1HAHH 2H9EH 1WCZA 2JKHA 1YBWA 4IN2A 5GWZA 4IN1A 4MNWA 5TCAA 1LKBA 1GMCG 1F0SA 5CHAC 2Z3DA 3UR9A 2XWBI 4UEHH 3A8BA 2BB4A 1ZRKA 1CT0E 8GCHG 1C2IA 1THSH 1FNIA 2QN5T 1W8BH 3SNAA 4INHA 2AGEX 4FU8A 4UFFH 1TRMA 2OLGA 4Y8ZA 5E0GA 1EJMA 1THRH 3LC5A 1N6XA 3V13A 5EG4A 3P8OA 1C5TA 9LPRA 3EE0B 4UDWH 1SLXB 3SOSA 3MHWU 4FUHA 5FCRA 6LPRA 2BY5X 1TIOA 1TABE 1Z71A 1ZPCA 4CRBA 3G01A 1GJ4H 2VB0A 2GD4B 1K1OA 5DJ7A 4AG2A 1QBVH 3MYWA 5DP3A 1DANH 1GBHA 1QL7A 1M9UA 1O2VA 1L4DA 1MCVA 1NU7B 2GTBA 3MU4A 1GI1A 1F0RA 2R0KA 1SLWB 1L1JA 3MU0A 4FUIA 1AHTH 4RSPA 1C5WB 4LZ1H 1K1IA 1T32A 1HV7A 1GHXH 3GICB 1SB1H 1AB9C 2F9PA 4TWYA 1W7XH 3RC6A 3RXDA 1SQTA 1P10A 4NIWA 5JBTA 2UUKB 4H6SB 3M3SA 4NIVA 1E38B 3QZRA 2OC0A 3DHKH 3KNXA 1BMAA 1UCYK 1DXPA 1E0FD 1QTFA 4MPXA 3E8LA 1GHWH 1GHYH 1K9OE 5A0AE 2PUXB 5J4SA 4FUCA 1NRRH 2P3UB 3A7VA 3F9FA 3AW0A 3ITIA 2ILNA 1RFNA 1C2EA 2ZWLH 3RXJA 2XTTB 1GG6B 1D6RA 2BYAX 4YLQH 1O2ZA 3UNQA 2LNCA 2C4FH 1C5LH 4B74A 2A0QB 1UTMA 1GBAA 1UTNA 3RXEA 2FP7B 5ABWA 1ZHPA 4OS4A 1DT2A 3TNTA 1FZZA 1O2IA 1BJUA 1C2HA 2Z9IA 4X8VH 4AG1A 5ETXA 5FHTA 4CBOA 3FZZA 4AX9H 1HCGA 1BMMH 2OINA 2HALA 5E2PA 1KLJH 2TGPZ 3VGCB 1GI2A 1GWAA 2ZDVH 5K7RA 4IGDA 1HNEE 1O2SA 1UVTH 1UTKA 4GCHF 1KYNA 1CVWH 1NRSH 1P2OA 1LMWB 4FVDA 4H42U 4MNVA 2HPQH 2VWNA 9ESTA 1WU1A 1BMLA 1FQ3A 2CGAA 1GHAF 5GPIB 4K60A 2G00A 1PPCE 4FUGA 3UNSA 3DD2H 3SNDA 1BT7A 1LPZB 3U8RH 3MI4A 5TCCA 2FX6A 1O2HA 2CF9H 5JBAS 1AE8H 1O3OA 3UTUH 1GBCA 2H1UA 2WYGA 3LGIA 4OS7A 1NO9H 3KF2A 1CT2E 5SGAE 2TBSA 3NWUA 5FAHA 2P59A 4AYVB 1TA6A 1ZLRA 1ABJH 1Y3YA 2EI6A 2AMDA 1DWEH 1VGCC 5AF9H 2SGPE 3Q3XA 4X6PA 3L3TA 1S5SA 1G9IE 3LKWA 4K3JA 1ZR0A 4XFQA 2GV7A 4CREA 4OS6A 2ZGCA 1QIXB 3LH1A 1L2EA 2GCTB 3F6UH 4KTCA 2V6NA 3RU4E 2O8TA 1ELAA 1XKBC 1YLCA 1D3QB 3RXPA 3P92A 5DP5A 1F92A 1SI5H 4BXWA 2XC4A 1GI4A 3QTVH 3C1KA 1EB2A 4DVAU 1TNLA 1GDQA 2ZFTA 1ZPBA 4OGXA 1DM4B 2ZU4A 1EASA 2GCHF 4DGJA 4B71A 4DY7B 1O2UA 3PWCA 1RRKA 1F0TA 1GI9B 3T28A 1H9HE 4AB9A 3QGJA 1P05A 2Z9KA 4Y0YE 3E1XB 1CBWC 2FTMA 1EJAA 1V2JT 3CS0A 2GCHG 2WPJS 4X2WA 2Z9JA 3RC5A 1LHCH 4RKJB 2FO9A 4NFFA 1EPTA 1QJ6B 4CH8B 2O8WA 1AFQB 2FIRH 4B75A 1T8MA 3QWCH 3URDA 1GHBF 1GL0E 3O8DA 4FUJA 1T8OA 2FLBH 2FMJA 3VB5A 3HATH 3M5LA 3LT3A 2ZFRH 4CR5A 1TNGA 1A0HB 1LPGB 1O2OA 2QGRA 3BTGE 4X1PU 2G51A 1RTKA 2O9QA 1O3GA 2YNAA 2ZP0H 1RIWC 3UFAA 4MLFB 1TOMH 3SI4H 1ZTLA 4BXSA 3MMGA 1OWEA 1JIRA 1ZZZA 1ELGA 4BTUB 1AD8H 1DLKB 3MU5A 4D7FA 5C1UA 4X8UH 2EEKA 3ATMA 4Y79A 3RMOH 4X6OA 3CENA 3LGYA 3RMLH 4X1RU 5FCKA 1NFYA 2A31A 5F6MA 4NA9H 1TRNA 1UK4A 3SV6A 4UFDH 3A86A 4TYDA 4I32A 1NRQH 2VIWA 1O3JA 3A83A 1ELEE 3GY6A 2M5TA 4UE7H 1VITG 2B8OH 3MH6A 2C90B 2WPIS 4X2XA 2QIQA 3ATKA 1SL3A 2BVSH 2HWLB 1OPHB 3E0PB 1EAIA 5I25A 1P2MA 4WJG2 3UY9A 4GVUA 5GJ4B 1S6FA 1O0DH 1BTXA 3M37A 4MTBA 1P02A 2V3OH 1ZOMA 4JZFH 1ANBA 3BF6H 1QBNA 3GCHC 4AZ2B 7LPRA 3K65B 4WXVA 4H6TA 3A7WA 1C5VA 5DP8A 2XC0A 1AWFH 4FUBA 3KL6A 1NC6A 1TBZH 2JH0D 2PKAA 3RU4D 4AFZA 2QY0B 4SGBE 3O8BA 2FDAA 3LIWA 4I8GA 3GDSA 4I8HA 3S69A 2F9VA 1SGIB 1ARBA 1C2DA 2XBXA 3RC4A 4RN6A 1EPTB 1Y5BT 4FUFA 4MNYA 4YT6H 4BAHB 1O5EH 4YOIA 1VITF 5JB9S 1TONA 1KDQA 2BTCE 2W5EA 3RUOA 1XXDA 3A8DA 1BTHH 1KY9A 1ETRH 1TNHA 3LH3A 3BN9A 4R0IA 1C4Y2 2A2QH 3PTBA 1EPTC 3FFGA 1EX3A 1BOQA 1IOEA 1HJ9A 4ABJA 1W3CA 4GLYA 1GI8B 1UCYE 1W0ZU 4AGKA 5DO4H 2FS8A 4D8NA 2BX4A 3BG8A 1GBKA 4A1XA 3RU4T 2Q6FA 2QF3A 4AFSA 4IMZA 4YOJA 2J4IA 1UVPA 1P2QA 4NA8A 1DE7H 1YF4A 4MQAA 1LQDB 4A1VA 4I8JA 1SHHB 3ZZ5A 4ZHLU 1G3CA 5HGGA 1W11U 1LHEH 2VWLA 3AASA 1A3BH 1TMBH 4X2VA 1GPZA 3PO1C 3A89A 2P16A 1MUEB 3SV2H 1BA8B 5EXNA 4ASHA 1YPJH 3RXQA 4AN7A 1ZMLA 3KCGH 3SHAH 3DFJA 2OCVB 3P6ZB 1A5IA 1DUEA 4JZEH 1OWIA 3VB3A 1GMDG 1QRZA 3MNSA 2BD7A 1SFQB 3HPTB 1ELTA 1O3PB 3RM0H 4FU7A 3M7QA 3M36A 2GZ9A 4HGCA 1ACBE 2ZTYA 2G81E 1S0QA 2PWXA 4X1QU 2Y7ZA 2F83A 1NU9A 4GSOA 1KTTB 1QL8A 4B2CA 1TX6A 2PGQB 1K1NA 2HNTE 4XE4A 2BDIA 4WMEA 4D9RA 4NFEA 1YKTA 1XKAC 1K28D 5IYTA 1SBWA 2KAIA 1TNKA 1WYKA 3PROA 2R9PA 1KSNA 3RXTA 4ABGA 1NRPH 3BSQA 1PYTD 1C1RA 1O2KA 1QQUA 4Y11E 5ESBA 8LPRA 3ZZ4A 1ELVA 1AFEH 5JBCS 4E7RG 2G52A 1VCPA 3UUZA 2GZ8A 4JK5A 2O8UA 1WTGH 4RKOB 1AO5A 3P8GA 4ABDA 2R3UA 1O33A 1QCPA 5EOKA 1VR1H 1HXFH 3HGPA 3SV9A 1G32B 1O38A 1XUHA 3OTJE 3SU4A 1RTFB 2QXJA 1HAGE 1WQSA 1FY1A 1TLDA 1V3XA 1XM1A 2SGAA 2ZHEH 1XX9A 4LK4A 1NFXA 3LJOA 3Q77A 5FBIA 3Q76A 1U6QA 1KXBA 1K1JA 1W0YH 1Z1IA 3KHVA 4Y0ZE 3V3MA 4NSYA 3BTFE 2ZCLP 1EP6A 3VXEH 3MWIU 2D8WA 1PQ5A 2H6MA 4BAKB 4D76A 3SU0A 1YC0A 3BTKE 2AH4X 3FVFB 1WQVH 1J16A 4ABEA 2ZFPH 3RXMA 1O2XA 1S84A 3KQEA 4WF8A 5JYIA 1P03A 1QY6A 1DS2E 2GZ7A 3K6ZA 1C5NH 1N8OC 2RA3A 4VGCB 1BRUP 1QNJA 1P01A 4GPGA 1B0EA 1IQEA 4XSKU 1TNJA 4FU9A 1GMHG 1G3BA 3ZZBA 2AIPA 1ZSLA 2CJIA 3LC3A 1FONA 3SU5A 1THPB 3M61U 2XXLA 3S7HB 2BD3A 3ZZ6A 1AVGH 1MKWK 2XWAA 4ESTE 5HMAA 2ODYB 3PTNA 3SUFA 2TGTA 2PKAB 2VGCC 3SBKA 3SQEE 4YM9A 3F9HA 4NWLA 1NS3A 2SNWA 1MKXH 3S0NA 2DE9A 1TPAE 2GMTB 3S9CA 4H4FA 2ZQ1A 4KKDA 1DWDH 2A7CA 1P09A 2P3TB 1EAUA 1TNIA 2D1JA 4TPIZ 3UWJH 1CGHA 1DPOA 1AKSA 3ZZ8A 4WMFA 1EATA 1GI6A 4KTSA 5E8EH 4ZAEA 2BLOA 3ZVDA 3TNSA 6CHAC 1RS0A 3BEFB 2ODQA 1P2IA 2GKVE 1LQEA 5DP9A 1GHAG 1GBFA 5FPYA 1FI8A 3R0FA 4Y7BA 1D4PB 1J9CH 3AAVA 1TX8A 2ANMH 1HFDA 1PJPA 1K1MA 2F91A 3RXFA 1PPZA 2ZO3H 4DIIH 2ANYA 2BQ6B 4XOJA 2HVXA 3SV7A 5FX6A 1KXEA 1O2JA 1W14U 4M7GA 3U8OH 2BD8A 1DVAH 2ZDKA 1IAUA 2ZECA 3D23A 3VEQB 3GYMA
chains in the Genus database with same CATH superfamily
2FYRA 4IW4E 3ZZDA 1AKSB 2BQWB 1AZ8A 5L2YH 4X6MA 2PSXA 7ESTE 2HNTF 4B6FA 1O2LA 3NPSA 3RXGA 1KLIH 2C8YB 1LCYA 3QGNB 4AGJA 6GCHF 1O36A 1K2I1 2FWWA 4ZROA 2OUAA 2Z94A 1GJ6A 2NU2E 1E37B 4WXIA 1IQFA 4B2AA 4BAMB 4CHAC 4GHQA 3LGUA 4ZHAA 4ZXYH 4R8TB 2BD2A 3BTEE 3F9GA 3LGTA 6GCHG 3QN7A 1QHRB 3ZZ3A 4AB8A 3LDXH 4OS1A 2VIPA 3E90B 2OXSA 2ZGXH 3F2HA 1HXEH 3D62A 1ELCA 2LP6A 3TK5A 1L0ZA 1T7CA 2WYJA 2ZA5A 1EUFA 3SYJA 1FAKH 1B5GH 3FAOA 4YOGA 1OOKB 1AI8H 2PKSB 2R2WU 2XW9A 1MU6B 3QX5H 4MPVA 2BY8X 3LPRA 3ENSB 1GJ7B 1LVYA 3MQKC 3F2GA 1E34B 1SOTA 3URCA 1SOZA 3RDZA 3PM3A 1GJBB 1V2MT 4ZH8A 4Q7XA 2QA9E 3GCNA 1C9PA 3SGAE 1HIAB 2GVFA 1CHOF 4WWYA 3H7TA 3AVZA 4FOUC 5C1YA 3VXFH 4D7GA 3A88A 1O32A 2BD4A 3P8NA 2ZFFH 3BTHE 8KME2 2A5AA 4I33A 4NIXA 2VVUA 1INCA 1O2QA 2HRVA 3KGPA 4YTAA 1ESAA 5LPRA 2AMQA 3GY7A 4FUEA 2GP9B 5C1XA 2A4RA 5LPFA 3P95A 1MTWA 1GCDA 2KFWA 4YLUA 3AAUA 3PLBA 2WV5A 3Q3YA 1XXFA 5L2ZH 3ODFA 3U1JB 1BRBE 2PHBA 4I7YH 2AIQA 2ZF0H 1V2LT 3LJJA 1OX1A 2ZDMA 2BVRH 3N7OA 5A8XA 3GISB 1H9IE 3N7DA 3TIUA 1V6DA 1BHXF 1O3LA 5FBEA 2CMYA 2Q6GA 3RXBA 1Z8IB 3EAJA 3TVJB 1F0UA 1UTPA 3QO6A 1C2JA 1DXWA 3BTDE 1MQ6A 2J2UA 5HYOA 5J4QA 1C5QA 4NG9H 3KYFA 3VB6A 5HM2A 2EI8A 1O5FH 3A8AA 3MFJA 4TWWA 2FI3E 3SU6A 5C0UA 1O2YA 4U01A 2PFEA 4DG4A 3UQOA 1F7ZA 1GHBG 2R3YA 2ULLA 3PRBA 3BTQE 1HAVB 4WY3A 1EZUC 3A84A 1TYNA 3DUXH 1P12E 2I6SA 3I29A 1GJAB 1ELBA 2GCTC 1C5MD 1CA0C 1EJNA 2ZU5A 3T25A 3AK5A 4K1TA 1YLDA 1DSUA 2K8IA 4HG6A 3W1EA 4RT0A 4ZUHA 1NM6A 1S6LA 1C1UH 4P00A 2ZI2H 1CU1A 1GHVH 1HAXB 2CF8H 2QCYA 7GCHF 3OYPA 4Q2KA 4DT7B 1N8OB 2PW8H 4X1SU 2WHXA 5EJ1A 1FPCH 1H1BA 2G4TA 2IN2A 1K21H 1P06A 3ZZAA 4JZDH 3OX7U 2VNTA 2A32A 2XBYA 1DFPA 3LGVA 4GAWA 1GVZA 1VJAU 3A7TA 3CP7A 1D3TB 1OSSA 2J34A 3KIDU 1QB6A 5BRRE 2Q6DA 1GI5A 1JMOH 1G2LA 1IHSH 1MBQA 5KECA 1V2RT 1LO6A 3EYDA 4IBLH 3RXRA 2WUCA 3TH4H 1SGFG 4DJZB 2V3MA 4JCNA 2FOCA 5E2OA 2QXHA 3LGWA 3TGKE 3I78A 4XD7D 4F49A 2KAIB 5DP6A 2P95A 1P9UA 2BDAA 4I86A 1P2JA 2UWPA 3NRLA 3VGCC 3Q3KA 1WBGB 1P04A 3A80A 2J92A 3A7XA 1DWBH 2OQ5A 4YXWD 2QV1A 3RLYH 1PQAA 1AUTC 3STIA 1ZSKA 3K6YA 3RXOA 3O8RA 1O3FA 5EW1H 1NBMD 1GBTA 1A1RA 1C5PA 3SU1A 2BD5A 5EQSA 1UK3A 1FDPA 4ISIH 1N1LA 3T29A 5HM9A 2PKSC 1MH0A 1OWKA 3EDXB 1BTUA 3SORA 3HK6B 1CO7E 1F5LA 2A4QA 2FOEA 2J98A 1EP5A 3DCLA 2SNVA 4I8LA 5C3NA 5EQRA 1QL9A 3TJUA 1GDUA 1O30A 1GBDA 1GJ8B 1UK2A 3ZIAD 3GCOA 4DOQA 3N7EA 2F43B 2GT7A 3ATLA 2Z3EA 5DKMA 2GDDA 1C4V2 3K9XB 1BBRH 5EPYA 4Y71A 4BAQB 2ZU1A 1HLTH 1JRSA 1SLVB 2R0LA 4IC6A 2B5TB 4X8TH 1IQIA 3NZIA 2EC9H 5HIYA 5GNDA 2THFB 2STBE 2TRMA 2KCYA 4MG3A 4U2WA 1KIGH 2P94A 3MU8A 2W3IA 1P57B 2BDHA 1SQRA 2R2MB 2H5DA 2FOAA 4VGCC 4NIYA 1QB1A 4HZHA 1OWHA 4Q4LA 4KELA 4MNXA 5AHGH 3PYHA 2CN0H 2VJ1A 4LOYH 3ZYEA 1ID5H 1QJ1B 1FY8E 1F5RA 1BMFD 3WY8A 2AGGX 1CHOG 1PQ8A 5L6NH 1OKXA 2Z9LA 3H09A 1O34A 1FY4A 2AYWA 1GBJA 1BTPA 2ZZUH 2BDYA 3PMAB 1O3IA 3GDVA 5LPEA 3QK1A 3SO3A 5AFYH 3MH4A 1A46H 3BTTE 3ZVEA 1ARCA 1P3CA 5T6FA 4BNRA 1C5SA 1O3MA 1PQ7A 2J5UA 1YPGH 3UB0A 3SHCH 1B0FA 1H8DH 2C93B 1YLNA 4A1TA 2ASUB 2BY9X 4ISNA 3EQ0H 2ESTE 3SJIA 4CRAA 2LELA 2HPPH 1ZYOA 1SVPA 1UVUH 1HAVA 1ZPZA 2Y5FA 1V2OT 2ZU3A 3E6PH 3OY5U 1PFXC 2QC2A 2BM2A 5CE1A 1O3DA 3LU9B 2G8TA 4KP0A 5KEDA 2JH6D 2W26A 3M5MA 5EU8A 2ZPQA 2LPRA 1UHBA 1IQMA 1ZRBA 2F3CE 3B8JA 4XBDA 4X6NA 2ZHQH 3TGIE 1SGNE 1SGCA 1LDTT 1DDJA 1TA2A 4F4OC 1OP8A 2V7QD 3ZVFA 4X8SH 3I77A 3SJ9A 4Y7AA 3U69H 4BTIB 1TFXA 1BQYA 1SMFE 4ABAA 3HKJB 1GBMA 1LHGH 2ZIQH 3PB1E 1GJ5H 2BLQA 1YCPH 1C1QA 1C2MA 2FLRH 2QF0A 4TY6A 2M2AA 2W7SA 2BVXH 3T2NA 1SGDE 5B6LA 1ELDE 2JJ1D 1KXAA 1B7XB 7KMEH 2XYAA 3ZV8A 3QLPH 1QJ7B 1TAWA 1UHBB 4MPWA 4ZKNU 1V2TT 1SHYA 1SQOA 1O5CB 1Y5UT 1NFWA 2UUFB 1OYQA 5GXPA 1T4VH 1WXRA 1DY9A 1ANDA 1JBUH 1S81A 3SJKA 1O2NA 1ORFA 1MMJN 3M7TA 2QXGA 5C20A 1ZHRA 1MKWH 1PPBH 1RIWB 1TGNA 2ALPA 2A5KA 2ANKH 1DOJA 3HGNA 2AGIX 1QURH 3KQBA 1C1VH 2CV3A 4ZMAH 1K1PA 1UO6A 2FOHA 3NUMA 4Q80A 5C5OA 1ZMJA 3SW2B 4NZQA 1C1WH 4TPYA 2PTCE 1VKYA 2EA3A 3RXVA 1WTHD 4BAOB 1YM0A 2UUYA 3TK6A 1UVOA 4I8KA 1C1PA 5DK1A 1UJ1A 1GJ9B 1O5BB 1MTVA 2FODA 3MNCA 1EB1H 2PLXA 3L33A 2Y5HA 1UW7A 2PUQH 3DSGA 4JZ1A 2BLVA 5EPNA 1CT4E 1XVOA 3OY6U 5L30H 3RXUA 2ZGJA 2FESH 1T8LA 3BTME 1COWD 3RXCA 3OAAD 1F5KU 3E3TA 3OU0A 4ACAA 1A0LA 1XVMA 3ZYDA 5F8XA 1DSTA 4Q7ZA 1YYY1 1K0HA 1YCPK 3PV4A 4HTCH 1SGTA 4Z6AH 2ZFQH 3S9AA 3V7TA 1ANEA 1C5ZB 4XRNA 1WAYB 1MD7A 1J15A 5ESTE 5JDUB 1RGQA 1GDNA 5HKKD 1O3NA 2ZC9H 3BIVH 2AERH 5T6GA 3T5FH 2IPQX 1MQ5A 3STJA 1FPHH 1EOLA 1Z8GA 4AC9A 5LGOA 3TH2H 2VH0A 2F9NA 3DT0H 1G30B 1P2KA 4CRCA 2YOLA 4ZCNA 3FO8D 1E35B 3PO1B 8ESTE 1G37A 1HJAB 1N6YA 2KX4A 5AFZH 2VWMA 4DIHH 1T4UH 2QAAA 3TU7H 5EIYA 2PTNA 4O97A 4OGYA 2H2ZA 4A7IB 2UUJB 2JETC 2IJOB 2AS9A 4QT8C 3B23B 1EAWA 1C5XB 4JZIA 5C67A 1C5YB 1GGDC 1QRWA 2RFKC 2BQ7B 2OBQA 1J8AA 2WUBA 2VIQA 4NWKA 1BZXE 3ZZ7A 1GBIA 4CRDA 4E7NA 1KLTA 1FJSA 1GL1A 1GVLA 2L74A 1Z6JH 2HLCA 3N99A 1O2RA 1SGRE 2KM0A 4BOHA 2OD3B 1A2CH 1SGFA 4ISHH 1GBEA 3SJOA 1QRXA 3PWBA 1TOCB 4JMYA 1CA8B 2PV9B 2GGVB 4X2YA 5JBBS 3P70B 3SUDA 1G3EA 2ZTZA 1VITH 1ZHMA 3PLPA 1TGSZ 5TJXA 1O2WA 2BDGA 1O2MA 1ZTKA 5B6OA 3IG6B 1BCUH 2RA0A 4ISLA 1F2SE 3MH5A 4UD9H 1O3BA 2QXIA 3R3GB 2BDCA 1PYTC 1TX7A 1NROH 1RXPA 3TJNA 4B76A 4AORA 2WINI 4DURA 1DUAA 1KMHB 2SGQE 2FI5E 4NCYA 1TGTA 3ELAH 4K1EA 3T27A 2Y82A 2Z9GA 2ZHFH 3MH7A 2NU0E 1TGCA 5FXLA 1NRNH 1L1NA 1TWXB 3EA8A 5EQQA 4UONA 1QA7A 1QQ4A 3PV5A 4K5ZA 2TPIZ 5FX5A 3GOVB 3M3TA 1MD8A 3SUGA 1ZGIA 1A3EH 4AYYB 2TIOA 1SGPE 1YCPM 1OWDA 1FN8A 1QZ8A 5CMXH 1EKBB 2NU3E 2PSYA 1Q31A 1MTUA 1UTLM 1TBRH 1EZQA 5A8ZA 3DFLA 1SPJA 3ZVGA 3F9EA 3SQHE 3GY2A 2XRCA 1RD3B 1MTSA 4YESB 1GHZA 3K2UA 3SI3H 5I46H 2VIDA 1HRTH 2ALVA 3O8CA 1O3HA 1MAXA 2ZCKP 1A5HA 1GMCF 1IQNA 2VVVA 7GCHG 5A0BA 2VGCB 3EA7A 4FUDA 3U98H 4Q7YA 1DY8A 3MU1A 3QTOH 1MCTA 1VZQH 1OWJA 1O31A 3IWMA 1W12U 2EI7A 2ODPA 2Y7XA 2A1DB 1JIMA 2GT8A 1TMTH 3U8TH 2ZNKH 1ANCA 2ZGHA 1WSSH 3SN8A 1SGEE 2AHME 3M5NA 1H8IH 3TPIZ 1AUJA 1Z7KA 1P9SA 2RG3A 1EOJA 2ZQ2A 4GUXA 2ZDNA 1L1GA 2SGDE 1MU8B 2OC1A 1BRCE 4UFGH 1C1MA 1IQLA 2J9NA 1G3DA 2EQNA 4ZKOU 1XUKA 1GMHF 4KGAA 3BEUA 2VIOA 8GCHF 2OP9A 1K22H 3V0XA 2FPZA 2VIVA 5GCHG 1MZAA 3M3VA 2G4UA 2VVCA 1A5GH 5E0JA 5H4IB 3SJ8A 1TPSA 1SG8B 3NK8A 1V2WT 2O8MA 2XCNA 1BTWA 6CHAB 1LKAA 1KTSB 1QGFA 5CDFE 1O35A 5FL7D 1AZZA 1V2VT 3RP2A 1W10U 3LOXA 1K1LA 1PPFE 1HB0B 2A5IA 3HK3B 5EGMA 4MVNA 2G5VA 1V2PT 1BB0B 1V2ST 2ZPRA 1GCTC 1O3EA 2VINA 3FANA 2V3HH 3H5CB 2ZDLA 1O3CA 2BY6X 4FVBA 4U32A 2WPKS 2Z6BD 1FY5A 1PPEE 3M5OA 1P2NA 1ETTH 4DT4A 1HAZB 1TMUH 1Y59T 2FXRA 4PROA 2BX3A 1HGTH 3TITA 1AE5A 2WPDD 2DE8A 4ABBA 1X7AC 3A7ZA 2XBWA 3A85A 3CS7A 1FN6A 1C2KA 1LVBA 1EZSC 4D9QA 3V12A 4GHTA 1Z8JB 1H9LB 1C1SA 1OP2A 1AIXH 4LXBH 4YO9A 1UTOA 5A8YA 4XBBA 1AY6H 1C2GA 1SGQE 4XBCA 3UOPA 1ETSH 4U30A 3RXKA 1Y5AT 4CRGA 1EXFA 3PLKA 3M7UA 1BMNH 1TGBA 2FYQA 4FETA 3SZNA 5JB8S 1GI0A 5EXMA 2NWNA 3P17H 3VB7A 1A7SA 1Z6EA 1A0JA 5DP7A 3BG4B 3U1IB 3QDZB 5EXLA 1MKXK 3VPKA 3ATIA 4K1SA 3TK9A 4JK6A 3A8CA 1GGDB 1MBMA 1J14A 2BOHB 1H4WA 1KDQB 3UQVA 2JETB 1XMNB 2AEIH 2C8WB 1E36B 2WV4A 2HGTH 3RM2H 3UWIA 1HJAC 4B1TA 1GJDB 2JDID 2GDEH 1FUJA 1T31A 4B6EA 1JXPA 3KN2A 5GIBA 1C5OH 1BBRK 2KZ4A 1HYLA 4IMQA 1VCQA 4INKA 3NKKA 4I31A 4B73A 1VGCB 1TPOA 2C8ZB 2O8LA 1GVKB 3RXSA 1BBRE 3E16B 1GCTB 1D3PB 2B9LA 1NFUA 4Y8XA 5HXFA 1OS8A 5GDSH 1TBQH 2IOTA 4UFEH 2GV6A 1SR5C 1TRYA 1OYTH 2WPLS 3ODDA 6ESTA 1AMHA 1UCYH 1MZDA 2J97A 2WSSD 1ELFA 2XNIA 1LHDH 1CGIE 3ESTA 3MNXA 1O2PA 1OXGA 1YP9A 1SSXA 3JZ1B 1V2QT 1YGCH 2P8OB 1HAYB 1BHXB 3UOUA 2A7HA 1WOFA 1CBWB 1QR3E 3F2FA 1NPMA 4Z0KA 5A0CA 3TJOA 1W0JD 2P3FH 3TJVA 1YPLH 1AQ7A 1YPKH 2V35A 5C2ZA 3B9FH 3UNRA 1QA0A 1ZTJA 2C3SA 4TY7A 4ZXXH 3ATWA 3U9AH 1CE5A 2RDLA 4AFQA 4BANB 2V0BA 2XCFA 3GY8A 1TQ7B 2A4GA 1TALA 3GY4A 4Q63A 2CXVA 1J17T 4YT7H 1V2UT 4AFUA 2CK3D 4HFPB 1XUJA 1LHFH 1V2KT 2RCEA 3JZ2B 5T6DA 4CR9A 1FLEE 2ZDAH 1OP0A 4O9VA 1GI7B 2D2DA 4JYVH 2BZAA 3BIUH 4DCDA 4CH2B 2J95A 2W6JD 1C9TA 1FX0B 5PTPA 1TB6H 2OQUA 3A81A 1HAPH 1MABB 3WW7A 2H9HA 2FTLE 4K2YA 2BXTH 3UREA 2B0FA 1O37A 3FP8E 4MDSA 3SV8A 3E0NB 3MOCA 3VB4A 1AB9B 2OK5A 3D49H 1W2KH 1CGJE 2VH6A 2Z3CA 3EE7A 5T3HA 1ZSJA 2JJ2D 1WV7H 4CRFA 1HIAA 3A82A 1YPHC 3M35A 2FI4E 3GY3A 1CHGA 1UVSH 4ABFA 4GCHG 3MNBA 2FOGA 2P93A 1BJVA 1GMDF 3KQDA 2KCOA 3TGJE 1Y3VA 4XDEA 1WUNH 1BIOA 2UWLA 3GCHB 1JOUB 5GCHF 1YPHE 1EFRD 2GX4A 1IHTH 1Z8RA 3FKSD 2UWOA 2ZU2A 2W6ID 4AOQA 3VFEA 2Y6TA 1BTZA 1D9IA 3GCTG 3H7OA 3FP6E 5E0HA 2W7UA 3KQCA 2BLWA 1HJ8A 3RXAA 1LPKB 1RJXB 1TE0A 1QB9A 1S82A 3PMJA 5A2MH 2F9OA 1IQKA 1S83A 5IDKA 1MTNB 2IPHA 1A4WH 2FEQH 3LONA 2ANWA 1O2GH 4HI3A 1L4ZA 1GBLA 2BOKA 2FX4A 2TGDA 2K1QA 1SC8U 5CHAB 1T8NA 5LH8A 1GJCB 1TQ0B 1CQQA 4A5TS 2ZGBH 1FMGA 1GBBA 1NESE 1BTYA 3PMBB 1BRAA 3TLOA 3AW1A 4OS5A 2FOBA 3FP7E 2OC7A 1V2NT 1NTPA 5BPEA 1NN6A 2ZG0H 2STAE 1O5DH 2Q1JA 2TGAA 4E06H 2YNBA 1FXYA 2ZEBA 3L6PA 3UR6A 3W94A 4NSVA 2FM2A 2PR3A 1O2TA 1P8VC 1DLEA 2QE7D 3T62A 4K8BA 1IQJA 2F9BH 2ZPSA 4O3UA 3ZVCA 3RXHA 1QBOA 1YPEH 1QFKH 4Y8YA 2I6QA 4YZUA 3KEEA 2CHAC 4J2YB 1O3KA 4J1YA 1HBTH 1Y8TA 1EZXC 1XUGA 4A92A 5HIZA 2J98B 1SFIA 3A87A 1ESBA 3E91A 3QUMP 1KXDA 3NCLA 2P8OC 1LTOA 5F53A 1ZJDA 1FIZA 1HPGA 3HKIB 1AVXA 3D65E 3S7KB 3OEED 3PMHB 2H9TH 2BHGA 1Q2WA 4WH6A 1AFQC 3W95A 5AVDA 2GJGA 3OE7D 2H5CA 1S85A 2A45B 2G55A 1IQGA 1Z1JA 3MO9A 2J94A 2B7DH 1BITA 1UTQA 1C2FA 4CBNA 2WPHS 1NT1A 1LVMA 2RDEA 5EJLA 3T26A 2BD9A 4ABIA 2AFQB 3ZV9A 2OTVA 5K0HA 2HNTC 1Y3UA 3SU2A 1UMAH 2JH5D 4A6LA 4NA7A 4LZ4B 1ZMNA 1O3AA 1PPGE 3UIRA 4ZKRU 3C27B 3BV9B 5C5NA 1C5RA 2D26C 2OBOA 5A09A 3NXPA 5F8ZA 3EGKH 2FS9A 1EQ9A 2BZ6H 4NZLA 3DA9B 2W3KA 1P11E 3ZZCA 1RTLA 1SQAA 1W7GH 4JYTA 3FN8A 1NY22 4MPUA 4X0WU 3RMNH 2FOMB 1BDAA 1C1TA 1PPHE 5C94A 5T1VA 1JRTA 3QZQA 3BG4C 1DICA 2Y81A 2SFAA 3EA9A 2QYIA 1HDTH 4CHAB 1ESTA 1AVWA 1MTNC 1E79D 1HAIH 4JYUH 4Y10E 1DWCH 1AN1E 3RXIA 5EW2H 1XUIA 1DX5M 3A7YA 1BUIA 4ISOA 4Y76A 3SUEA 1C4U2 1HUTH 3OSYA 1ZJKA 1NZQH 1S0RA 5F03A 3RLWH 3MO3A 1A61H 1G36A 2VU8E 3GDUA 4B2BA 1CA0B 1GI3A 1ZGVA 2FZZA 4FXGH 3GYLB 1O5AB 2G5NA 2ZTXA 3SNBA 2NU4E 2BXUH 1FAXA 2ZHDA 1ABIH 1AU8A 4E05H 3ZZ9A 2WZQA 3F0PA 4ABHA 2NU1E 2F9UA 1HAOH 2PGBB 3Q00A 3UAIC 3DSOA 4X1NU 1C2LA 1SLUB 1YPMH 1AGJA 4DW2U 1P0SH 5FPTA 3F1SB 1IQHA 2WPMS 1C5UA 2A7JA 3OEHD 4INLA 1DITH 3SU3A 3BEIB 3OFND 1Y3WA 4BTTB 1Q3XA 1GG6C 4WVPE 3P8FA 4O3TA 1JWTA 2J38A 3RMMH 1FY3A 3GY5A 1C1NA 5CHBA 1CSOE 4IS5A 5FPSA 1D6WA 3ZVBA 2OC8A 5G4BA 4NGAH 2VWOA 3BTWE 4ZHMU 1XUFA 2Y5GA 2Z7FE 3IITA 3TH3H 1S6HA 2XBVA 4SGAE 4WMDA 2GMTC 2BY7X 1UTJA 2FOFA 2BMGB 1Y3XA 1AWHB 3S9BA 4K8YA 2SGEE 2A4OA 2Y80A 5JPMH 3MTYA 3SNEA 4THNH 5C0TA 2XC5A 3ZVAA 5DGJA 1G2MA 1P3EA 1VCWA 1SGYE 2HOBA 4WH8A 5DPAA 3SNCA 2CHAB 4IC5A 2A2XH 1C1OA 1KXCA 1EAXA 3GCTF 1KXFA 2ZCHP 3FZDA 5EODA 3UPEA 2ZHWH 4ZKSU 2ZKSA 2SGFE 1YY3A 2AMPA 3SGQE 1O39A 1MAYA 1FIWA 3SGBE 4O03A 2PP6A 1FV9A 1O5GH 5DP4A 1D3DB 3F68H 3RXLA 5F8TA 4Y6DA 1VJ9U 2C8XB 4OS2A 1W13U 2BDBA 2DUCA 3MO6A 4K69A 4KTUA 1TPPA 5DG6A 2QF4A 1LVOA 2ZFSA 1HAHH 2H9EH 1WCZA 2JKHA 1YBWA 4IN2A 5GWZA 4IN1A 4P02A 4MNWA 5TCAA 2L6OA 1LKBA 1SKYE 1GMCG 2YMSD 1F0SA 5CHAC 2Z3DA 3UR9A 2XWBI 4UEHH 3A8BA 2BB4A 1ZRKA 1CT0E 8GCHG 1C2IA 1THSH 1FNIA 2QN5T 1W8BH 3SNAA 4INHA 2AGEX 4M9FA 4FU8A 4UFFH 1TRMA 2OLGA 2HVYB 4Y8ZA 5E0GA 1EJMA 1THRH 3LC5A 1N6XA 3V13A 5EG4A 3P8OA 1C5TA 9LPRA 3EE0B 4UDWH 1SLXB 3SOSA 3MHWU 4FUHA 5FCRA 6LPRA 2BY5X 1TIOA 1TABE 1Z71A 1ZPCA 3KQ5A 4CRBA 3G01A 1GJ4H 2VB0A 2GD4B 1K1OA 5DJ7A 4AG2A 1QBVH 3MYWA 5DP3A 1DANH 1GBHA 1QL7A 1M9UA 1O2VA 1L4DA 1MCVA 1NU7B 2GTBA 3MU4A 1GI1A 1F0RA 2R0KA 1SLWB 2F4LA 1L1JA 3MU0A 4FUIA 1AHTH 4RSPA 1C5WB 4F48B 4LZ1H 1K1IA 1T32A 1HV7A 1GHXH 3GICB 1SB1H 1AB9C 2F9PA 4TWYA 1W7XH 3RC6A 3RXDA 1SQTA 3CNRA 1P10A 4NIWA 5JBTA 2UUKB 4H6SB 3M3SA 4NIVA 1E38B 3QZRA 2OC0A 3DHKH 3KNXA 1BMAA 1UCYK 1DXPA 1E0FD 1QTFA 4MPXA 3E8LA 1GHWH 1GHYH 1K9OE 5A0AE 2PUXB 5J4SA 4FUCA 1NRRH 2P3UB 3A7VA 3F9FA 3SZEA 3AW0A 3ITIA 2ILNA 1RFNA 1C2EA 2ZWLH 3RXJA 2XTTB 1GG6B 1D6RA 2BYAX 4YLQH 1O2ZA 3UNQA 2LNCA 2C4FH 1C5LH 4B74A 2A0QB 1UTMA 1GBAA 1UTNA 3RXEA 2FP7B 5ABWA 1ZHPA 4TSFD 4OS4A 1DT2A 3TNTA 1FZZA 1O2IA 1BJUA 1C2HA 2Z9IA 4X8VH 4AG1A 5ETXA 5FHTA 4CBOA 3FZZA 4AX9H 1HCGA 1BMMH 2OINA 2HALA 5E2PA 1KLJH 2TGPZ 3VGCB 1GI2A 4OM9A 1GWAA 1H8ED 2ZDVH 4IGDA 5K7RA 1HNEE 1O2SA 1UVTH 4ACBA 1UTKA 4GCHF 1KYNA 1CVWH 1NRSH 1P2OA 1LMWB 4FVDA 4H42U 4MNVA 2HPQH 2VWNA 9ESTA 1WU1A 1BMLA 1FQ3A 2CGAA 1GHAF 5GPIB 4K60A 2G00A 1PPCE 4FUGA 3UNSA 3DD2H 3SNDA 1BT7A 1LPZB 3U8RH 3MI4A 5TCCA 2FX6A 2VBCA 1O2HA 2CF9H 5JBAS 1AE8H 1O3OA 3UTUH 2QF5A 1GBCA 2H1UA 2WYGA 3LGIA 4OS7A 1NO9H 3KF2A 1CT2E 5DSFA 5SGAE 2TBSA 3NWUA 5FAHA 5EJZA 2P59A 4AYVB 1TA6A 1ZLRA 1ABJH 1Y3YA 2EI6A 2AMDA 1DWEH 1VGCC 2IJD1 5AF9H 2SGPE 3Q3XA 4X6PA 3L3TA 1S5SA 5KGOA 1G9IE 3LKWA 4K3JA 1ZR0A 4XFQA 2GV7A 4CREA 4OS6A 2ZGCA 1QIXB 3LH1A 1L2EA 2GCTB 3F6UH 4KTCA 2V6NA 3RU4E 2O8TA 1ELAA 1XKBC 1YLCA 1D3QB 3RXPA 3P92A 5DP5A 1F92A 1SI5H 4BXWA 2XC4A 1GI4A 3QTVH 3C1KA 1EB2A 4DVAU 1TNLA 1GDQA 2ZFTA 1ZPBA 2YMSC 4OGXA 1DM4B 2ZU4A 1EASA 2GCHF 4DGJA 4B71A 4DY7B 1O2UA 3PWCA 1RRKA 1F0TA 1GI9B 3GS9A 3T28A 1H9HE 4AB9A 3QGJA 1P05A 2Z9KA 4Y0YE 3E1XB 1CBWC 2FTMA 1EJAA 1V2JT 3CS0A 2GCHG 2WPJS 4X2WA 2Z9JA 3RC5A 1LHCH 4RKJB 2FO9A 4NFFA 1WDIA 1EPTA 1QJ6B 4CH8B 2O8WA 1AFQB 2FIRH 4B75A 1T8MA 3QWCH 3URDA 1GHBF 1GL0E 3O8DA 4FUJA 1T8OA 2FLBH 2FMJA 3VB5A 5C17A 3HATH 3M5LA 3LT3A 2ZFRH 4CR5A 1TNGA 1A0HB 1LPGB 1O2OA 2QGRA 3BTGE 4X1PU 2G51A 1RTKA 2O9QA 1O3GA 2K0QA 2YNAA 1W0KD 2ZP0H 1RIWC 3UFAA 4MLFB 1TOMH 3SI4H 1ZTLA 4BXSA 3MMGA 1OWEA 1JIRA 1ZZZA 3U28C 1ELGA 4BTUB 1AD8H 1DLKB 3MU5A 4D7FA 5C1UA 4X8UH 2EEKA 3ATMA 4Y79A 3RMOH 4X6OA 3CENA 3LGYA 3RMLH 4X1RU 5FCKA 1NFYA 2A31A 5F6MA 4NA9H 1TRNA 1UK4A 3SV6A 4UFDH 3A86A 4TYDA 4I32A 1NRQH 2VIWA 1O3JA 3A83A 1ELEE 3GY6A 2M5TA 4UE7H 1VITG 2B8OH 3MH6A 2C90B 2WPIS 1H8HD 4F55A 4X2XA 2QIQA 3ATKA 1SL3A 2BVSH 2HWLB 1OPHB 3E0PB 1EAIA 5I25A 1P2MA 4WJG2 3UY9A 4GVUA 5GJ4B 1S6FA 3PRDA 1O0DH 1BTXA 3M37A 4MTBA 1P02A 2V3OH 1ZOMA 3FOAA 4JZFH 1ANBA 3BF6H 1QBNA 3GCHC 4AZ2B 7LPRA 3K65B 2KCAA 4WXVA 4H6TA 2KR7A 3A7WA 1C5VA 5DP8A 2XC0A 1AWFH 4FUBA 3KL6A 1NC6A 1TBZH 2JH0D 2PKAA 3RU4D 4TT3D 4AFZA 2QY0B 4SGBE 3O8BA 2FDAA 3LIWA 4I8GA 3GDSA 4I8HA 3S69A 2F9VA 1SGIB 1ARBA 1C2DA 2XBXA 3RC4A 4RN6A 1EPTB 1Y5BT 4FUFA 4MNYA 4YT6H 4BAHB 1O5EH 4YOIA 1VITF 5JB9S 1TONA 1KDQA 2BTCE 2W5EA 3RUOA 1XXDA 3A8DA 1BTHH 1KY9A 1ETRH 1TNHA 3LH3A 3BN9A 4R0IA 1C4Y2 2A2QH 3PTBA 1EPTC 3FFGA 1EX3A 1BOQA 1IOEA 1HJ9A 4ABJA 1W3CA 4GLYA 1GI8B 1UCYE 1W0ZU 4AGKA 5DO4H 2FS8A 4D8NA 2BX4A 3BG8A 1GBKA 4ASUD 4A1XA 3RU4T 2Q6FA 2QF3A 4AFSA 5DN6D 4IMZA 4YOJA 2J4IA 1UVPA 1P2QA 4NA8A 1DE7H 1YF4A 4MQAA 1LQDB 4A1VA 4I8JA 1SHHB 1E1QD 3ZZ5A 2WV9A 4ZHLU 1G3CA 5HGGA 1W11U 1LHEH 2VWLA 3AASA 3F3BA 1A3BH 1TMBH 4X2VA 1GPZA 3PO1C 3A89A 2P16A 1MUEB 3SV2H 1BA8B 5EXNA 4ASHA 1YPJH 3RXQA 4AN7A 1ZMLA 3KCGH 3SHAH 3DFJA 2OCVB 3PV2A 3P6ZB 1A5IA 1DUEA 4JZEH 1OWIA 3VB3A 1GMDG 1QRZA 3MNSA 2BD7A 1SFQB 3HPTB 1ELTA 1O3PB 3RM0H 4FU7A 3WWFA 3M7QA 3M36A 2GZ9A 4HGCA 1ACBE 2ZTYA 2G81E 1S0QA 2PWXA 4X1QU 2Y7ZA 2F83A 1NU9A 4GSOA 1KTTB 1QL8A 4B2CA 1TX6A 2PGQB 1K1NA 1YWUA 2HNTE 4XE4A 2BDIA 4WMEA 4D9RA 4NFEA 1YKTA 1XKAC 1K28D 5IYTA 4Z1MD 1SBWA 4RI0A 2KAIA 3VG8A 1TNKA 1WYKA 4RT1A 3PROA 2R9PA 1KSNA 3RXTA 4ABGA 2YMSB 1NRPH 3BSQA 1PYTD 1C1RA 1O2KA 1QQUA 4Y11E 5ESBA 8LPRA 3ZZ4A 1ELVA 1AFEH 5JBCS 4E7RG 2G52A 1VCPA 3UUZA 2GZ8A 4JK5A 2O8UA 3KYGA 1NBME 1WTGH 4RKOB 1AO5A 3P8GA 4ABDA 2R3UA 1O33A 1QCPA 5EOKA 1VR1H 1HXFH 3HGPA 3SV9A 1G32B 1O38A 1XUHA 2JIZD 3OTJE 3SU4A 1RTFB 2QXJA 1HAGE 2EY4C 1WQSA 1FY1A 1TLDA 1V3XA 1XM1A 2SGAA 2ZHEH 3F0OA 1XX9A 4LK4A 1NFXA 3LJOA 3Q77A 5FBIA 3Q76A 1U6QA 2KCPA 1KXBA 1K1JA 1W0YH 1Z1IA 3KHVA 4Y0ZE 3V3MA 4NSYA 3BTFE 2ZCLP 1EP6A 3VXEH 3MWIU 2D8WA 1PQ5A 2H6MA 4BAKB 2HLDD 4D76A 3SU0A 1YC0A 3BTKE 2AH4X 3FVFB 1E1RD 3DSPA 1WQVH 1J16A 4ABEA 2ZFPH 3RXMA 1O2XA 1S84A 3KQEA 4WF8A 5JYIA 1P03A 1QY6A 1DS2E 2XOKD 2GZ7A 3K6ZA 1C5NH 1N8OC 2RA3A 4VGCB 1BRUP 1QNJA 1P01A 4GPGA 1B0EA 1IQEA 4XSKU 3WWBA 1TNJA 4FU9A 1GMHG 1G3BA 3ZZBA 2AIPA 1ZSLA 2CJIA 3LC3A 1FONA 3SU5A 1THPB 3M61U 2XXLA 3S7HB 2BD3A 3ZZ6A 1AVGH 1MKWK 2XWAA 4ESTE 5HMAA 2ODYB 1OHHD 3PTNA 3SUFA 2TGTA 2PKAB 2VGCC 3SBKA 3SQEE 4YM9A 3F9HA 4NWLA 1NS3A 2SNWA 1MKXH 3S0NA 2DE9A 1TPAE 2GMTB 3S9CA 4H4FA 2ZQ1A 4KKDA 1DWDH 2A7CA 1P09A 2P3TB 1EAUA 1TNIA 2D1JA 4TPIZ 3UWJH 1CGHA 1DPOA 1AKSA 3ZZ8A 4WMFA 1EATA 1GI6A 4KTSA 5E8EH 4ZAEA 2XNDD 2BLOA 3ZVDA 3TNSA 6CHAC 1RS0A 3BEFB 2ODQA 1P2IA 2GKVE 1LQEA 5DP9A 1GHAG 1GBFA 5FPYA 1FI8A 3R0FA 4Y7BA 1D4PB 1J9CH 3AAVA 1TX8A 2ANMH 3OTPA 1HFDA 1PJPA 1K1MA 2F91A 3RXFA 1PPZA 5IK2D 2ZO3H 4DIIH 2ANYA 2BQ6B 4XOJA 2HVXA 3SV7A 5FX6A 1KXEA 1O2JA 1W14U 4M7GA 3U8OH 2BD8A 1DVAH 2ZDKA 1IAUA 2ZECA 3D23A 3VEQB 3GYMA
chains in the Genus database with same CATH topology
2FYRA 4IW4E 3ZZDA 1AKSB 2BQWB 1AZ8A 5L2YH 4X6MA 2PSXA 7ESTE 2HNTF 1O2LA 3NPSA 3RXGA 1KLIH 2C8YB 1LCYA 3QGNB 4AGJA 6GCHF 1O36A 1K2I1 2FWWA 4ZROA 2OUAA 2Z94A 1GJ6A 2NU2E 1E37B 4WXIA 1IQFA 4B2AA 4BAMB 4CHAC 4GHQA 3LGUA 4ZHAA 4ZXYH 4R8TB 2BD2A 3BTEE 3F9GA 3LGTA 6GCHG 3QN7A 1QHRB 3ZZ3A 4AB8A 3LDXH 4OS1A 2VIPA 3E90B 2OXSA 2ZGXH 1HXEH 3D62A 1ELCA 3TK5A 1L0ZA 1T7CA 2WYJA 2ZA5A 1EUFA 1FAKH 1B5GH 3FAOA 4YOGA 1OOKB 1AI8H 2PKSB 2R2WU 2XW9A 1MU6B 3QX5H 4MPVA 2BY8X 3LPRA 3ENSB 1GJ7B 1LVYA 1E34B 1SOTA 3URCA 1SOZA 3RDZA 3PM3A 1GJBB 1V2MT 4ZH8A 4Q7XA 2QA9E 3GCNA 1C9PA 3SGAE 1HIAB 2GVFA 1CHOF 4WWYA 3H7TA 3AVZA 3VXFH 5C1YA 4D7GA 3A88A 1O32A 2BD4A 3P8NA 2ZFFH 3BTHE 8KME2 2A5AA 4I33A 4NIXA 2VVUA 1INCA 1O2QA 2HRVA 3KGPA 4YTAA 1ESAA 5LPRA 2AMQA 3GY7A 4FUEA 2GP9B 5C1XA 2A4RA 5LPFA 3P95A 1MTWA 1GCDA 4YLUA 3AAUA 3PLBA 2WV5A 3Q3YA 1XXFA 5L2ZH 3ODFA 3U1JB 1BRBE 2PHBA 4I7YH 2AIQA 2ZF0H 1V2LT 3LJJA 1OX1A 2ZDMA 2BVRH 3N7OA 5A8XA 3GISB 1H9IE 3TIUA 1V6DA 1BHXF 1O3LA 5FBEA 2CMYA 2Q6GA 3RXBA 1Z8IB 3EAJA 3TVJB 1F0UA 1UTPA 3QO6A 1C2JA 1DXWA 3BTDE 1MQ6A 2J2UA 5HYOA 5J4QA 1C5QA 4NG9H 3VB6A 5HM2A 2EI8A 1O5FH 3A8AA 3MFJA 4TWWA 2FI3E 3SU6A 1O2YA 4U01A 2PFEA 4DG4A 3UQOA 1F7ZA 1GHBG 2R3YA 2ULLA 3BTQE 1HAVB 4WY3A 1EZUC 3A84A 1TYNA 3DUXH 1P12E 2I6SA 3I29A 1GJAB 1ELBA 2GCTC 1C5MD 1CA0C 1EJNA 2ZU5A 3T25A 4K1TA 1YLDA 1DSUA 4ZUHA 1NM6A 1C1UH 2ZI2H 1CU1A 1GHVH 1HAXB 2CF8H 2QCYA 7GCHF 3OYPA 4Q2KA 4DT7B 1N8OB 2PW8H 4X1SU 1FPCH 1H1BA 2G4TA 2IN2A 1K21H 1P06A 3ZZAA 4JZDH 3OX7U 2VNTA 2A32A 2XBYA 1DFPA 3LGVA 4GAWA 1GVZA 1VJAU 3A7TA 3CP7A 1D3TB 1OSSA 2J34A 3KIDU 1QB6A 5BRRE 2Q6DA 1GI5A 1JMOH 1G2LA 1IHSH 1MBQA 1V2RT 1LO6A 3EYDA 4IBLH 3RXRA 2WUCA 3TH4H 1SGFG 4DJZB 4JCNA 2FOCA 5E2OA 2QXHA 3LGWA 3TGKE 3I78A 4F49A 2KAIB 5DP6A 2P95A 1P9UA 2BDAA 1P2JA 2UWPA 3VGCC 3Q3KA 1WBGB 1P04A 3A80A 2J92A 3A7XA 1DWBH 2OQ5A 2QV1A 3RLYH 1PQAA 1AUTC 3STIA 1ZSKA 3K6YA 3RXOA 3O8RA 1O3FA 5EW1H 1GBTA 1A1RA 1C5PA 3SU1A 2BD5A 5EQSA 1UK3A 1FDPA 4ISIH 1N1LA 3T29A 5HM9A 2PKSC 1MH0A 1OWKA 3EDXB 1BTUA 3SORA 3HK6B 1CO7E 1F5LA 2A4QA 2FOEA 1EP5A 2SNVA 4I8LA 5C3NA 5EQRA 1QL9A 3TJUA 1GDUA 1O30A 1GBDA 1GJ8B 1UK2A 3GCOA 4DOQA 2GT7A 3ATLA 2Z3EA 5DKMA 2GDDA 1C4V2 3K9XB 1BBRH 5EPYA 4Y71A 4BAQB 2ZU1A 1HLTH 1JRSA 1SLVB 2R0LA 4IC6A 2B5TB 4X8TH 1IQIA 3NZIA 2EC9H 2THFB 2STBE 2TRMA 4MG3A 4U2WA 1KIGH 2P94A 3MU8A 2W3IA 1P57B 2BDHA 2R2MB 2H5DA 2FOAA 4VGCC 4NIYA 1QB1A 4HZHA 1OWHA 4KELA 4MNXA 5AHGH 3PYHA 2CN0H 2VJ1A 4LOYH 3ZYEA 1ID5H 1QJ1B 1FY8E 1F5RA 3WY8A 2AGGX 1CHOG 1PQ8A 5L6NH 1OKXA 2Z9LA 1O34A 1FY4A 2AYWA 1GBJA 1BTPA 2ZZUH 2BDYA 3PMAB 1O3IA 3GDVA 5LPEA 3QK1A 3SO3A 5AFYH 3MH4A 1A46H 3BTTE 3ZVEA 1ARCA 1P3CA 5T6FA 4BNRA 1C5SA 1O3MA 1PQ7A 1YPGH 3SHCH 1B0FA 1H8DH 2C93B 4A1TA 2ASUB 2BY9X 4ISNA 3EQ0H 2ESTE 3SJIA 4CRAA 2HPPH 1ZYOA 1SVPA 1UVUH 1HAVA 1ZPZA 2Y5FA 1V2OT 2ZU3A 3E6PH 3OY5U 1PFXC 2QC2A 2BM2A 5CE1A 1O3DA 3LU9B 2G8TA 4KP0A 2JH6D 2W26A 3M5MA 5EU8A 2ZPQA 2LPRA 1UHBA 1IQMA 1ZRBA 2F3CE 3B8JA 4XBDA 4X6NA 2ZHQH 3TGIE 1SGNE 1SGCA 1LDTT 1DDJA 1TA2A 4F4OC 1OP8A 3ZVFA 4X8SH 3I77A 3SJ9A 4Y7AA 3U69H 4BTIB 1TFXA 1BQYA 1SMFE 4ABAA 3HKJB 1GBMA 1LHGH 2ZIQH 3PB1E 1GJ5H 2BLQA 1YCPH 1C1QA 1C2MA 2FLRH 2QF0A 4TY6A 2W7SA 2BVXH 3T2NA 1SGDE 1ELDE 1KXAA 1B7XB 7KMEH 2XYAA 3ZV8A 3QLPH 1QJ7B 1TAWA 1UHBB 4MPWA 4ZKNU 1V2TT 1SHYA 1SQOA 1O5CB 1Y5UT 1NFWA 2UUFB 1OYQA 5GXPA 1T4VH 1DY9A 1ANDA 1JBUH 1S81A 3SJKA 1O2NA 1ORFA 1MMJN 3M7TA 2QXGA 5C20A 1ZHRA 1MKWH 1PPBH 1RIWB 1TGNA 2ALPA 2A5KA 2ANKH 1DOJA 3HGNA 2AGIX 1QURH 3KQBA 1C1VH 2CV3A 4ZMAH 1K1PA 1UO6A 2FOHA 3NUMA 4Q80A 5C5OA 1ZMJA 3SW2B 4NZQA 1C1WH 4TPYA 2PTCE 2EA3A 3RXVA 1WTHD 4BAOB 1YM0A 2UUYA 3TK6A 1UVOA 4I8KA 1C1PA 5DK1A 1UJ1A 1GJ9B 1O5BB 1MTVA 2FODA 3MNCA 1EB1H 2PLXA 3L33A 2Y5HA 2PUQH 4JZ1A 2BLVA 5EPNA 1CT4E 1XVOA 3OY6U 5L30H 3RXUA 2ZGJA 2FESH 1T8LA 3BTME 3RXCA 1F5KU 3E3TA 3OU0A 1A0LA 1XVMA 3ZYDA 5F8XA 1DSTA 4Q7ZA 1YYY1 1YCPK 3PV4A 4HTCH 1SGTA 4Z6AH 2ZFQH 3S9AA 3V7TA 1ANEA 1C5ZB 1WAYB 1MD7A 1J15A 5ESTE 5JDUB 1RGQA 1GDNA 1O3NA 2ZC9H 3BIVH 2AERH 5T6GA 3T5FH 1MQ5A 3STJA 1FPHH 1EOLA 1Z8GA 5LGOA 3TH2H 2VH0A 2F9NA 3DT0H 1G30B 1P2KA 4CRCA 2YOLA 1E35B 3PO1B 8ESTE 1G37A 1HJAB 1N6YA 5AFZH 2VWMA 4DIHH 1T4UH 2QAAA 3TU7H 2PTNA 4O97A 4OGYA 2H2ZA 4A7IB 2UUJB 2JETC 2IJOB 2AS9A 4QT8C 3B23B 1EAWA 1C5XB 4JZIA 5C67A 1C5YB 1GGDC 1QRWA 2BQ7B 2OBQA 1J8AA 2WUBA 2VIQA 4NWKA 1BZXE 3ZZ7A 1GBIA 4CRDA 4E7NA 1KLTA 1FJSA 1GL1A 1GVLA 1Z6JH 2HLCA 1O2RA 1SGRE 4BOHA 2OD3B 1A2CH 1SGFA 4ISHH 1GBEA 3SJOA 1QRXA 3PWBA 1TOCB 4JMYA 1CA8B 2PV9B 2GGVB 4X2YA 5JBBS 3P70B 3SUDA 1G3EA 2ZTZA 1VITH 1ZHMA 3PLPA 1TGSZ 5TJXA 1O2WA 2BDGA 1O2MA 1ZTKA 5B6OA 3IG6B 1BCUH 2RA0A 4ISLA 1F2SE 3MH5A 4UD9H 1O3BA 2QXIA 3R3GB 2BDCA 1PYTC 1TX7A 1NROH 1RXPA 3TJNA 4B76A 4AORA 2WINI 4DURA 1DUAA 2SGQE 2FI5E 4NCYA 1TGTA 3ELAH 4K1EA 3T27A 2Y82A 2Z9GA 2ZHFH 3MH7A 2NU0E 1TGCA 5FXLA 1NRNH 1L1NA 1TWXB 3EA8A 5EQQA 4UONA 1QA7A 1QQ4A 4K5ZA 2TPIZ 5FX5A 3GOVB 3M3TA 1MD8A 3SUGA 1ZGIA 1A3EH 4AYYB 2TIOA 1SGPE 1YCPM 1OWDA 1FN8A 5CMXH 1EKBB 2NU3E 2PSYA 1Q31A 1MTUA 1UTLM 1TBRH 1EZQA 5A8ZA 3DFLA 1SPJA 3ZVGA 3F9EA 3SQHE 3GY2A 2XRCA 1RD3B 1MTSA 4YESB 1GHZA 3K2UA 3SI3H 5I46H 2VIDA 1HRTH 2ALVA 3O8CA 1O3HA 1MAXA 2ZCKP 1A5HA 1GMCF 1IQNA 2VVVA 7GCHG 5A0BA 2VGCB 3EA7A 4FUDA 3U98H 4Q7YA 1DY8A 3MU1A 3QTOH 1MCTA 1VZQH 1OWJA 1O31A 3IWMA 1W12U 2EI7A 2ODPA 2Y7XA 2A1DB 1JIMA 2GT8A 1TMTH 3U8TH 2ZNKH 1ANCA 2ZGHA 1WSSH 3SN8A 1SGEE 3M5NA 1H8IH 3TPIZ 1AUJA 1Z7KA 1P9SA 2RG3A 1EOJA 2ZQ2A 4GUXA 2ZDNA 1L1GA 2SGDE 1MU8B 2OC1A 1BRCE 4UFGH 1C1MA 1IQLA 2J9NA 1G3DA 4ZKOU 1XUKA 1GMHF 4KGAA 3BEUA 2VIOA 8GCHF 2OP9A 1K22H 3V0XA 2FPZA 2VIVA 5GCHG 1MZAA 3M3VA 2G4UA 2VVCA 1A5GH 5E0JA 5H4IB 3SJ8A 1TPSA 1SG8B 3NK8A 1V2WT 2O8MA 2XCNA 1BTWA 6CHAB 1LKAA 1KTSB 1QGFA 1O35A 1AZZA 1V2VT 3RP2A 1W10U 3LOXA 1K1LA 1PPFE 1HB0B 2A5IA 3HK3B 5EGMA 4MVNA 2G5VA 1V2PT 1BB0B 1V2ST 2ZPRA 1GCTC 1O3EA 2VINA 3FANA 2V3HH 3H5CB 2ZDLA 1O3CA 2BY6X 4FVBA 4U32A 2WPKS 2Z6BD 1FY5A 1PPEE 3M5OA 1P2NA 1ETTH 1HAZB 1TMUH 1Y59T 2FXRA 4PROA 2BX3A 1HGTH 3TITA 1AE5A 2DE8A 4ABBA 1X7AC 3A7ZA 2XBWA 3A85A 3CS7A 1FN6A 1C2KA 1LVBA 1EZSC 4D9QA 3V12A 4GHTA 1Z8JB 1H9LB 1C1SA 1OP2A 1AIXH 4LXBH 4YO9A 1UTOA 5A8YA 4XBBA 1AY6H 1C2GA 1SGQE 4XBCA 3UOPA 1ETSH 4U30A 3RXKA 1Y5AT 4CRGA 1EXFA 3PLKA 3M7UA 1BMNH 1TGBA 2FYQA 3SZNA 5JB8S 1GI0A 5EXMA 2NWNA 3P17H 3VB7A 1A7SA 1Z6EA 1A0JA 5DP7A 3BG4B 3U1IB 3QDZB 5EXLA 1MKXK 3VPKA 3ATIA 4K1SA 3TK9A 4JK6A 3A8CA 1GGDB 1MBMA 1J14A 2BOHB 1H4WA 1KDQB 3UQVA 2JETB 1XMNB 2AEIH 2C8WB 1E36B 2WV4A 2HGTH 3RM2H 3UWIA 1HJAC 4B1TA 1GJDB 2GDEH 1FUJA 1T31A 1JXPA 3KN2A 5GIBA 1C5OH 1BBRK 1HYLA 4IMQA 1VCQA 4INKA 3NKKA 4I31A 4B73A 1VGCB 1TPOA 2C8ZB 2O8LA 1GVKB 3RXSA 1BBRE 3E16B 1GCTB 1D3PB 2B9LA 1NFUA 4Y8XA 5HXFA 1OS8A 5GDSH 1TBQH 2IOTA 4UFEH 2GV6A 1SR5C 1TRYA 1OYTH 2WPLS 3ODDA 6ESTA 1AMHA 1UCYH 1MZDA 1ELFA 2XNIA 1LHDH 1CGIE 3ESTA 3MNXA 1O2PA 1OXGA 1YP9A 1SSXA 3JZ1B 1V2QT 1YGCH 2P8OB 1HAYB 1BHXB 3UOUA 2A7HA 1WOFA 1CBWB 1QR3E 1NPMA 4Z0KA 5A0CA 3TJOA 2P3FH 3TJVA 1YPLH 1AQ7A 1YPKH 2V35A 5C2ZA 3B9FH 3UNRA 1QA0A 1ZTJA 2C3SA 4TY7A 4ZXXH 3ATWA 3U9AH 1CE5A 2RDLA 4AFQA 4BANB 2V0BA 2XCFA 3GY8A 1TQ7B 2A4GA 1TALA 3GY4A 2CXVA 1J17T 4YT7H 1V2UT 4AFUA 4HFPB 1XUJA 1LHFH 1V2KT 2RCEA 3JZ2B 5T6DA 4CR9A 1FLEE 2ZDAH 1OP0A 4O9VA 1GI7B 2D2DA 4JYVH 2BZAA 3BIUH 4DCDA 4CH2B 2J95A 1C9TA 5PTPA 1TB6H 2OQUA 3A81A 1HAPH 2H9HA 2FTLE 4K2YA 2BXTH 3UREA 2B0FA 1O37A 3FP8E 4MDSA 3SV8A 3E0NB 3MOCA 3VB4A 1AB9B 3D49H 1W2KH 1CGJE 2VH6A 2Z3CA 5T3HA 1ZSJA 1WV7H 4CRFA 1HIAA 3A82A 1YPHC 3M35A 2FI4E 3GY3A 1CHGA 1UVSH 4ABFA 4GCHG 3MNBA 2FOGA 2P93A 1BJVA 1GMDF 3KQDA 3TGJE 1Y3VA 4XDEA 1WUNH 1BIOA 2UWLA 3GCHB 1JOUB 5GCHF 1YPHE 2GX4A 1IHTH 1Z8RA 2UWOA 2ZU2A 4AOQA 3VFEA 2Y6TA 1BTZA 1D9IA 3GCTG 3H7OA 3FP6E 5E0HA 2W7UA 3KQCA 2BLWA 1HJ8A 3RXAA 1LPKB 1RJXB 1TE0A 1QB9A 1S82A 3PMJA 5A2MH 2F9OA 1IQKA 1S83A 5IDKA 1MTNB 2IPHA 1A4WH 2FEQH 3LONA 2ANWA 1O2GH