1CHGA

Chymotrypsinogen,2.5 angstroms crystal structure, comparison with alpha-chymotrypsin,and implications for zymogen activation
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
245
structure length
226
Chain Sequence
b'CGVPAIQPVLSGLSRIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGVTTSDVVVAGEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSAVCLPSASDDFAAGTTCVTTGWGRLQQASLPLLSNTNCKKYWGTKIKDAMICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQTLAAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Chymotrypsinogen: 2.5-angstrom crystal structure, comparison with alpha-chymotrypsin, and implications for zymogen activation.
pubmed doi rcsb
molecule keywords CHYMOTRYPSINOGEN A
source organism Bos taurus
molecule tags Hydrolase zymogen (serine proteinase)
total genus 40
structure length 226
sequence length 245
ec nomenclature ec 3.4.21.1: Chymotrypsin.
pdb deposition date 1975-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1chgA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1chgA01
4ZH8A 1GHAF 2AS9A 4LOYH 1S81A 2OC8A 5FHTA 2ZGBH 5C1UA 1IHTH 1AN1E 1ID5H 1TX8A 2YNBA 1ZHPA 1ELCA 3NXPA 4TWYA 1H9HE 4ZUHA 4B2AA 3HK3B 4DOQA 5GIBA 1AGJA 1TNIA 1TFXA 3PLBA 2A0QB 4PROA 1H4WA 1TX7A 4K5ZA 2TIOA 1OKXA 5H4IB 2BDHA 4NSVA 2ANYA 1W11U 1ELVA 1LVYA 1W12U 2FI3E 1UVOA 1BMMH 1WAYB 3A84A 4Q7YA 4K60A 1HAVA 3W94A 3AW0A 1ZRKA 2QAAA 1CO7E 1A5GH 1HXEH 4H6SB 3TJVA 2IOTA 2UUKB 3A8DA 1P9UA 3TGIE 1F0RA 3SU5A 2VNTA 3V3MA 1A0LA 2BX4A 2IPHA 1BMAA 2STAE 3CS0A 5AFYH 1RIWB 2ZQ1A 1P3CA 4CBNA 4I32A 4DT7B 2A2QH 3SV6A 4ZMAH 1C5LH 2JH6D 2FIRH 4X6MA 2FO9A 4CRDA 1FPCH 3M3SA 3LIWA 1FI8A 3UIRA 1RTKA 1O3DA 1UTNA 1BTWA 1O2RA 3RXFA 1AIXH 2TGDA 1T32A 1ESTA 1C1PA 1C5UA 1E38B 1TRYA 1QB6A 1VJAU 4TWWA 2SGQE 2BD8A 1QL9A 5HXFA 1GMDF 3M37A 3T2NA 4DG4A 1EP5A 4TPIZ 1V2NT 2WYGA 3F9GA 4K1TA 1S0QA 3K2UA 1LHEH 3UNSA 3RXTA 2NU2E 4H6TA 4Y8XA 5C1YA 5EQQA 2JETC 4MTBA 2QF3A 3HGPA 1SQTA 7LPRA 1O3AA 2ZPSA 1FDPA 2ZTXA 2FWWA 2OQUA 2XC0A 1EJAA 4Z0KA 1YF4A 1DANH 1SLVB 1E37B 6CHAB 1LO6A 4MQAA 1S83A 4IW4E 5DP7A 1O2WA 4SGBE 2BD9A 3MH4A 1KXBA 2NU0E 4HGCA 4K1SA 4DURA 1JIMA 2ZDMA 1B5GH 5EODA 3E16B 2A7CA 3CENA 1QR3E 1A3BH 1UTMA 3UPEA 1SHHB 1C5QA 5JDUB 2ZU3A 4BNRA 1AUTC 4OS6A 1K1LA 1NU9A 2F9BH 4GHQA 4BOHA 5IDKA 2WV5A 8KME2 4D7FA 3MU5A 1C2EA 4ZROA 2O8TA 3R3GB 1HBTH 2CF9H 1O2QA 3GOVB 3BTEE 3CS7A 1SFQB 2PR3A 1HAPH 3IWMA 1D6RA 2XBXA 1QGFA 1YLCA 2G51A 2Z3DA 2M5TA 1SGCA 7KMEH 3LGWA 6GCHG 1GJBB 2Z9GA 2FZZA 3E90B 2G52A 3SV2H 1L2EA 2Z7FE 1MZDA 1QBOA 1THRH 1O0DH 3KL6A 1IQFA 2XRCA 1ELEE 1SL3A 2ZHWH 1HAOH 3SZNA 3PMAB 3T27A 2P3FH 6LPRA 3A7ZA 1O3OA 2A5IA 1CT2E 2SNVA 4KELA 1TA2A 2BQ7B 1IQMA 1LHFH 1O3MA 3KF2A 2Y82A 1NTPA 4X8SH 1RFNA 4CBOA 1D6WA 3IITA 4X2VA 1C5NH 4O97A 3G01A 3TJUA 1SMFE 1D9IA 2AERH 2ZDVH 3LH1A 1ANEA 4FUFA 4LZ4B 1E36B 1QNJA 3S69A 3UUZA 4Q7XA 2ZI2H 1O38A 2SNWA 2H2ZA 2AH4X 1V2LT 3RDZA 3LC5A 3MNBA 1VGCB 1TNHA 1UMAH 1YPKH 4Y7BA 5A0AE 1K1JA 3RXSA 1SOTA 1V2TT 3PROA 1V3XA 1UVPA 5GXPA 2PKAB 1JIRA 3ZZBA 4Y10E 1Z8JB 2J92A 4ESTE 3VGCB 2AYWA 1ELFA 1EUFA 1MCTA 1E34B 1OWHA 2ODQA 1GHBG 4X1QU 3F1SB 1TOCB 1BCUH 1C4Y2 4SGAE 1EAIA 1MUEB 1BMNH 4LK4A 1PPFE 5A8ZA 1C2MA 1QBVH 4ABAA 3HPTB 1P3EA 2QA9E 1ZSLA 2AEIH 2WINI 4U2WA 4B75A 2BX3A 4BTIB 2ZPQA 4X6OA 1EQ9A 4OS4A 2F9OA 1FY1A 1O3LA 3BTDE 2JH0D 1HAGE 1F5RA 1TQ0B 2ZP0H 4VGCC 2OUAA 2EI7A 1G37A 2C8XB 1XKAC 1YGCH 1DY9A 1Z8IB 1NO9H 4IGDA 5FBIA 3GY3A 4BTUB 3RC4A 4YESB 7ESTE 4WMFA 1CGIE 1LKBA 1NU7B 3RMMH 1MBQA 1AO5A 1EZQA 1MTNB 5TCAA 3EA8A 2ZFFH 1LQEA 2W26A 3ENSB 3SQEE 1EPTB 2GVFA 3HGNA 1QY6A 1J14A 1NROH 1J9CH 1FN6A 4X1NU 3SU1A 2AGEX 2ODYB 2OP9A 4B1TA 2IJOB 2VH6A 2FX4A 3MMGA 1C5WB 3HATH 2QF0A 1QJ6B 2BY7X 3P70B 3ZYEA 3RMLH 2ZWLH 3PB1E 1F2SE 4AFQA 4FUJA 2GZ9A 4ABBA 1GDQA 3QZRA 1HYLA 1DXPA 1H9IE 1OYQA 4XOJA 2G8TA 1GGDB 3B9FH 2FODA 2ODPA 3BTFE 1NRQH 3UOPA 4MNXA 3ZZ6A 1ANDA 5E2PA 3RMNH 1XKBC 1V2OT 3OYPA 3GCHC 3A7VA 2TPIZ 2AIQA 3SV9A 1WUNH 3ZZ4A 1TQ7B 1ZTJA 3D49H 2G4UA 1BRCE 1GHXH 1O37A 1AVWA 1GHAG 1YPGH 2JH5D 3M7UA 5F8XA 3FP8E 2D8WA 5JYIA 2DE8A 1P2OA 5FAHA 4WWYA 1O2YA 1IQKA 1F0TA 1EASA 1BTPA 4ABJA 1GL1A 2VWMA 1SG8B 3EQ0H 1ZJDA 2VWNA 3SUDA 1L1GA 1YBWA 4NZLA 1WU1A 3ITIA 1G30B 3P8NA 7GCHF 3SJ8A 3RXKA 1QURH 4FXGH 1HJAC 4A1XA 4AX9H 1QTFA 3KQBA 3A7YA 2QV1A 2Z9IA 3LGVA 2P8OC 1PPHE 2VGCB 4R0IA 2FYRA 1YLDA 4GCHF 1F5LA 4YT6H 2HPPH 3TNSA 4BXWA 1G3BA 2BB4A 1ESAA 3PTBA 3LC3A 3WY8A 5A09A 1C2KA 1FZZA 2I6QA 1CBWB 4X1PU 3A87A 4ZKSU 3RXPA 2OQ5A 4JK6A 3RXDA 2P59A 2STBE 2QXIA 1MZAA 1PYTD 1SGRE 3T62A 4ABIA 1QB9A 1HDTH 2KAIB 3W95A 3E91A 1KXEA 3TU7H 3GDSA 4I8JA 2NU1E 2NWNA 5DK1A 3BTQE 4I31A 1C1TA 5T3HA 3H7TA 1AVGH 1NN6A 5LPFA 2H5DA 4A92A 5FPYA 1V2JT 1P02A 1KXCA 2OD3B 2UWLA 2Q6GA 5JBCS 2PKSB 4Q2KA 1UTPA 1WV7H 2HNTE 1A2CH 1GMDG 1QQUA 1YPHC 3TGJE 2LPRA 1FN8A 4Y0YE 4BAHB 1EZUC 3F9EA 3STJA 1XVOA 4R8TB 1BTZA 1WBGB 2ESTE 4WVPE 3DA9B 2XBWA 2ZEBA 2P94A 2V6NA 1RXPA 1DITH 1MQ5A 3A7WA 3ZZ7A 3OX7U 5E0JA 1A61H 1IQJA 1C5MD 2ZDLA 3A8BA 3BTTE 1OWKA 3VB6A 2B9LA 1IOEA 2ANKH 1TWXB 3SNDA 3F6UH 1A0JA 1MAXA 1W3CA 1NFUA 2C90B 9LPRA 4CR9A 1MU6B 4KTUA 1BITA 5A2MH 3SU6A 4X6NA 2J9NA 1SGTA 1TNGA 1ZLRA 3RXLA 1S6FA 1V6DA 1EAUA 3QGNB 2QXJA 2BY6X 1TRNA 4K3JA 1C1SA 1YCPH 5F6MA 1MD8A 2OCVB 4Y6DA 3A80A 3TJOA 5GDSH 1V2RT 2W3IA 3HKJB 2CMYA 1LHCH 1O31A 1AWFH 2QYIA 1TOMH 4D7GA 5DP9A 4WMEA 1O2UA 1V2PT 2GCHG 1TYNA 2ZGCA 4NA9H 2FS8A 1SBWA 2CJIA 1OP0A 2XBYA 4FUIA 1AFQC 1G3EA 3M7TA 5A0BA 1O30A 1ZSKA 1FUJA 1AB9C 3PO1B 5DP3A 2R2MB 2Y5HA 4HFPB 1G3CA 1O39A 3FFGA 4UE7H 2ANMH 3U98H 4I7YH 4D9RA 4DVAU 1ZZZA 1DSTA 1SLUB 4IBLH 3AW1A 1SOZA 2ZFPH 2Z3EA 4WH8A 4UFGH 1GBKA 3SO3A 4OS7A 1DX5M 4JYUH 1O3NA 2OINA 5EOKA 1QIXB 1FNIA 4MPWA 4MPVA 1UVUH 1Y3UA 3ZVEA 1T8LA 3MU1A 1TMUH 4FUBA 4XSKU 1A5HA 3RXVA 1TIOA 2VWLA 5CHAB 1P01A 1V2UT 1GJDB 1MCVA 1O3FA 1O5FH 1MTUA 3EE0B 4ZAEA 1KXDA 4THNH 1W8BH 2FS9A 1LDTT 2FTLE 1V2ST 1FIWA 1QL8A 1UCYE 3M61U 1GI8B 1Q31A 3LJJA 4IMQA 1C2DA 4CRAA 5J4QA 2ZU4A 3GCTG 1GJ9B 3V0XA 3V12A 1MKXH 4Y71A 1TRMA 3BEIB 1AHTH 2BQ6B 2FOHA 1UO6A 3TIUA 1FAKH 5EPNA 2AMDA 1ZGIA 4ZXYH 3BF6H 3SN8A 1L4ZA 3MU0A 3SUEA 1GBIA 2PKAA 1HJ9A 4X1RU 1C5TA 1X7AC 1GBBA 1PPZA 2A31A 5F8ZA 2CHAC 1O2OA 1GVZA 4AFZA 1KSNA 1KXAA 1GG6B 2I6SA 1TX6A 1SLWB 1MBMA 5DP4A 4DIIH 1AUJA 4JYVH 4DCDA 1AZZA 5G4BA 3PYHA 3SU0A 3H7OA 4OS5A 4NWKA 1FXYA 1SGQE 3ZVBA 4X0WU 2H9EH 4GUXA 3BTWE 3RU4E 3DUXH 2HALA 1DWEH 3BG4C 4IN2A 2BQWB 4FVDA 1DLKB 4MPXA 3P8GA 1KTSB 4MNYA 4CHAB 5EG4A 5A8XA 1YCPK 5B6OA 1MKWH 1EAXA 3R0FA 4MNWA 3H5CB 2PTCE 1WSSH 3BG8A 1OWDA 4LXBH 3MYWA 2FP7B 5L2YH 3VB5A 4GVUA 4Z6AH 1LVMA 1GI2A 3U1JB 1DFPA 1MMJN 4WMDA 3M3TA 3I77A 1C1RA 4ZXXH 1QJ1B 3RXQA 3MFJA 4NCYA 4ZKNU 2TRMA 4F49A 1AKSA 5JB9S 1UHBB 3SGQE 5BPEA 1N8OB 2BLQA 3BEUA 4AG2A 3PMJA 2ZGXH 3Q76A 5JBAS 1HV7A 1O3PB 1G2LA 3UFAA 2ZHFH 3LU9B 1HAIH 1BBRH 2RCEA 3TGKE 1H8DH 1QRWA 3U8RH 2XXLA 2FOGA 4AORA 1IQEA 1ABJH 1S5SA 1ZJKA 2BVSH 3MHWU 1QBNA 4OS1A 3ATWA 1L4DA 3SV7A 5DGJA 2GV6A 1LKAA 5JBTA 3KQEA 3AAUA 4AYVB 7GCHG 1Y8TA 5LH8A 4MLFB 1Y5AT 3EA9A 2WPHS 3QLPH 4JZFH 4B74A 3SOSA 1LVOA 1C5ZB 2XCFA 1GI4A 2VIVA 3Q00A 5C5NA 1LHDH 1GI5A 3URCA 4GCHG 3UNRA 1QHRB 1O2XA 3FANA 2WUBA 4INLA 2EEKA 2GDEH 1ANBA 3SHAH 2GCTC 5DJ7A 3RC5A 1NS3A 2BVXH 3AASA 3K65B 1TGBA 4FUHA 4AG1A 4CH2B 1N6YA 2BZAA 1HUTH 2AGGX 1LQDB 5EXNA 2ZCKP 1T4UH 1AD8H 3RMOH 2PSYA 2FYQA 2OXSA 3U8TH 2GMTB 1ORFA 3GDVA 4XBCA 5FBEA 1TAWA 3SU2A 2RA0A 1KDQA 1ARCA 2EI8A 4FU9A 1A3EH 3BN9A 1PFXC 4FU8A 4JYTA 3MNXA 3E3TA 1DICA 5EW1H 1TPSA 1BRUP 2ZDAH 5TJXA 3ZVGA 2SGFE 4CRBA 1T7CA 1DY8A 1QA0A 1WYKA 3PMBB 1GVLA 1AE8H 2KAIA 4NIVA 3UOUA 4DIHH 1BQYA 2GDDA 4NZQA 3E8LA 1MU8B 1GBJA 2GCHF 2TBSA 1F0UA 3QTOH 2VIWA 1DUEA 2QC2A 3K9XB 3M35A 3OTJE 1C5RA 1D3PB 1Z1IA 2D26C 1GBCA 3TK9A 8GCHF 2Z94A 1EATA 1HAXB 1TPOA 1S82A 3UREA 1C5SA 5C67A 3P95A 3KGPA 5JPMH 5C2ZA 2QCYA 3ATIA 4KP0A 1CA0C 1C1MA 1LCYA 4ISOA 1P2MA 3LGYA 1WQSA 3TH4H 1A0HB 4CRGA 2O8MA 5HM2A 1VCWA 1DWCH 2VH0A 3OU0A 1EB2A 1W0YH 2ZECA 2FOAA 2AIPA 4X2YA 4INHA 4YLQH 3ZVFA 2Z6BD 1D4PB 4Q7ZA 5DP6A 2BZ6H 4BXSA 3BIUH 2TGPZ 4UEHH 1ZMJA 1O2IA 4NSYA 1XMNB 5F8TA 2FOMB 2A7JA 1GBLA 2BD7A 1OP2A 1NFXA 3U1IB 2XYAA 4Y8ZA 2A5AA 3TJNA 3GCTF 3TH3H 1ANCA 1C1VH 3FZDA 3ZZ9A 1W7GH 1O3KA 5FX6A 2VIOA 2PV9B 3BTKE 1JOUB 3A88A 2IN2A 1UTLM 1VZQH 3L6PA 3QWCH 3MU4A 3IG6B 4X8UH 4BTTB 5K0HA 1PJPA 2ANWA 4AB8A 2P3TB 1VITF 2QXGA 2PHBA 2OC7A 3M5LA 3LGUA 1P2NA 2DE9A 5E8EH 4ZKRU 2C93B 3SI4H 1AI8H 4YTAA 1QL7A 2JETB 3S7HB 1Y3WA 2HOBA 4HI3A 2VIQA 5F03A 2H6MA 4YO9A 1FV9A 1L1JA 5EPYA 2XC5A 1P9SA 1KLJH 1AFEH 1OS8A 1GI9B 2XNIA 3U9AH 2QIQA 2VVUA 2FOFA 4NGAH 1C5PA 3VXEH 1O2MA 3K6ZA 1DOJA 1FJSA 3M5NA 1S84A 1PPGE 3TITA 3FZZA 1GMCF 3SNEA 3BTME 2B5TB 1L1NA 4UFFH 5L6NH 1P09A 2ULLA 1DVAH 1CU1A 1BBRE 1C1WH 4KGAA 1UTJA 1XXFA 3RXJA 3LPRA 2ZA5A 4K1EA 1UCYH 2ASUB 1GHZA 3QUMP 4MDSA 1FQ3A 2W7UA 4X2WA 2BY9X 1Z6JH 2VINA 2C8WB 1NM6A 1SGFG 2GKVE 2V3HH 1G36A 2BVRH 4A6LA 3KHVA 1GHYH 5J4SA 1EXFA 1DT2A 1VCQA 2XCNA 1C1UH 4CR5A 3QN7A 2BD3A 2GTBA 2VVCA 1DPOA 1V2KT 3A82A 1DM4B 1FLEE 1GI7B 2VU8E 3P92A 3SGAE 2UWPA 2C3SA 4BAQB 3CP7A 1J15A 3NZIA 3V13A 1PQ7A 1O5EH 1K1IA 5DG6A 1ZRBA 4Y8YA 1WOFA 1C9TA 3B23B 1PYTC 3K6YA 3VB3A 2BMGB 1ELDE 1O2NA 5ESTE 3PMHB 1UTKA 3D62A 3UQOA 2HRVA 3RXOA 5DPAA 1IHSH 2ZKSA 1SGIB 2FTMA 3UR6A 1C4U2 2WPMS 3PLKA 1D3DB 1KXFA 4XFQA 4FUDA 3BIVH 2F9NA 1GWAA 1DWBH 3Q77A 1FY3A 3I29A 3ZZDA 1MD7A 1W14U 3KN2A 1YP9A 3O8RA 3SBKA 1O2TA 2FOEA 1O32A 5E0HA 1Z6EA 1HIAB 1UVTH 1LTOA 1P11E 3P17H 1UHBA 2R0LA 5ESBA 2FEQH 3LGIA 2BTCE 1W2KH 2BXTH 4ABDA 4HZHA 1GI3A 2CV3A 3UWJH 4JK5A 3UWIA 2F9VA 2SGAA 2Y5GA 4JZEH 1JMOH 3EDXB 3QO6A 4MG3A 2O8LA 2RG3A 1HFDA 3RXRA 3I78A 1ESBA 4E06H 4ISNA 1O3GA 2VJ1A 1UVSH 2SGPE 3OSYA 3S9BA 3LT3A 2D2DA 1BT7A 3URDA 4MPUA 1UTQA 3NCLA 3SNBA 3SQHE 5AVDA 1PQ5A 4VGCB 1BJUA 2C8ZB 3ZVDA 4D76A 2BXUH 1HB0B 5ETXA 2PSXA 3OY5U 2VIPA 1KYNA 1O2KA 2V35A 2ZIQH 3SORA 1BTUA 1XUIA 3S9AA 3VFEA 2ZG0H 1YPMH 2BD5A 2VB0A 3PWBA 2V3OH 1UCYK 3A8AA 3HK6B 3MH7A 4UDWH 4TPYA 3SJKA 5EXLA 4O3TA 1GI0A 3EGKH 1QRXA 3P8OA 4JCNA 1IQIA 1AE5A 4XBDA 2ZCHP 4A1VA 1XUFA 3A8CA 3NUMA 4Y7AA 2UUYA 4K69A 1JBUH 1B0EA 3MWIU 1SVPA 4JZ1A 1OXGA 1FMGA 2TGAA 1DLEA 2A45B 2ZQ2A 4NFFA 1C2IA 1TGCA 3VPKA 2PUQH 1LPKB 2FI5E 3A86A 4LZ1H 1EP6A 1QB1A 1TLDA 1ZYOA 2Y81A 3GCHB 1O36A 2BOKA 3QTVH 1ZMLA 1SB1H 1RGQA 2BLWA 1ABIH 1F7ZA 1SGDE 1WQVH 1YYY1 1ZOMA 2ALVA 4B71A 1HAHH 2Y6TA 2WYJA 1WTHD 1G3DA 2BLOA 1FIZA 2Z9KA 1AZ8A 1ACBE 3LONA 3T26A 1Y59T 2FPZA 4ISIH 8GCHG 1ELBA 3ZZ3A 3V7TA 1RIWC 1XUJA 2UWOA 4B76A 2PFEA 2HLCA 2GV7A 4ZHMU 4ASHA 5AFZH 2SGEE 4MNVA 2P93A 4ZHAA 1OWJA 2ZFTA 1A4WH 1HJAB 1INCA 1O3HA 2ZNKH 4DGJA 5GCHF 2H9TH 1F5KU 4NIWA 5T6GA 1QRZA 1HLTH 1C9PA 2GT8A 3GDUA 3Q3KA 3FP6E 1P05A 1HCGA 3SW2B 2HWLB 4NFEA 1YPHE 1MAYA 4E7NA 2FXRA 2ZDKA 5PTPA 1C1QA 1SGFA 5HMAA 3KEEA 4X8VH 1LPZB 1UK2A 4K2YA 2FOCA 4FUGA 4E05H 4WF8A 1TNJA 3N7OA 1GI1A 4YOIA 4B2CA 4AYYB 4HTCH 4KTCA 3RXIA 4Y0ZE 4WH6A 1SC8U 1HPGA 2QGRA 3EAJA 2VWOA 1EJNA 1SLXB 1GCTB 1FY5A 1S0RA 2RA3A 2BY8X 1K22H 3DHKH 6CHAC 3QDZB 1BMLA 1CGJE 1SGPE 4NG9H 2A4OA 3M5MA 1K1NA 1P10A 2FESH 4JZDH 5A0CA 5DP5A 1VITG 1BB0B 1O5AB 3GICB 1A7SA 4RKJB 3L33A 2VIDA 2G5VA 4KTSA 3KQCA 3SJ9A 3VXFH 2PWXA 1LVBA 4J2YB 1O35A 3KNXA 2GZ8A 3P6ZB 3SHCH 2YOLA 2QXHA 1K2I1 4E7RG 2ZHDA 4I8KA 1BOQA 1VCPA 2GZ7A 1ETSH 1HNEE 3UY9A 3E0PB 2ZU5A 1G2MA 1C4V2 1O5BB 4K8BA 4U01A 1TMTH 2EA3A 4O03A 4O9VA 3RXAA 1QJ7B 2A7HA 1GMCG 1C5YB 5JB8S 1MTWA 4D9QA 4BAOB 1RTFB 3F9HA 4F4OC 4YT7H 3DT0H 1OOKB 2C8YB 1IAUA 1BZXE 1EPTA 2JKHA 2OTVA 1D3QB 3RXHA 1O2GH 1EOJA 3ZVCA 4UONA 3RM0H 1P57B 4A7IB 4UD9H 2NU4E 4AN7A 2EC9H 2BDAA 1C2HA 1V2MT 1NY22 1FPHH 1T31A 4AFUA 1AFQB 1OX1A 1D3TB 4X2XA 5DO4H 5C20A 1PPCE 4NA8A 1IQGA 1VGCC 1ZGVA 5EGMA 2Q1JA 1AB9B 3GYMA 3ODDA 1KIGH 1BTXA 1KTTB 4YM9A 1NRNH 4Y11E 4D8NA 1P12E 3VGCC 1PPEE 3BV9B 1JXPA 3A81A 1RJXB 2CN0H 2WPJS 1Y3YA 1BHXB 3FVFB 4RSPA 3RXUA 4GLYA 1NRPH 1P2KA 2BDIA 4RN6A 1O5CB 3RXCA 1Y3VA 1O3JA 4YLUA 3BEFB 1MKXK 1W13U 1NPMA 1CSOE 1O2SA 1H1BA 2K1QA 4I8LA 1GBDA 2BDGA 1MTVA 1J8AA 2R2WU 1ZHRA 1IQNA 1GBHA 2RDLA 3QGJA 2BDCA 2A4GA 1AY6H 1DWDH 2GT7A 2NU3E 4UFDH 1YM0A 1TGTA 3SGBE 3U8OH 1Y5BT 4OGYA 1DE7H 1CHOG 1GDUA 3DD2H 2SGDE 3ODFA 5L2ZH 3RXEA 2R3YA 1J17T 3A85A 3TH2H 4B73A 2ZFSA 1OWIA 1J16A 2O8WA 1DXWA 3RXGA 2XWAA 1AWHB 1EOLA 1MTNC 4JMYA 5FCRA 3VB7A 3ATLA 3C1KA 1EPTC 2FMJA 1RTLA 2CHAB 3QX5H 4X6PA 2O8UA 3AVZA 2H9HA 3B8JA 1E0FD 2Y80A 4WY3A 5C1XA 3M3VA 3F68H 1N6XA 1XUGA 1GHWH 1HIAA 1MH0A 4BAMB 2P16A 2XTTB 4I8HA 1GJCB 1MKWK 1G32B 1Z71A 3SUGA 2P95A 1FONA 1DSUA 2FI4E 3O8CA 2H5CA 2ZGJA 1P2QA 4FU7A 1GGDC 2BM2A 1DUAA 1BRBE 1NFWA 3MI4A 1PQAA 3TK6A 1ZHMA 3BG4B 1WCZA 3MO9A 2OC0A 3SU4A 1K1MA 3QZQA 1TNLA 4AGJA 1TPAE 4M7GA 4Y79A 5LPRA 2V0BA 2D1JA 1GCDA 5DP8A 1SGYE 4BAKB 1GJ7B 3KCGH 1V2WT 4DY7B 3EA7A 1C5XB 1TBRH 1TPPA 5AHGH 1BUIA 3MO6A 5EXMA 4AFSA 2HGTH 2OLGA 4CRCA 1W0ZU 1VITH 1GPZA 4JZIA 3RLYH 4INKA 4Q80A 1THPB 5T6FA 3BTGE 1VR1H 1BBRK 5EQRA 1QCPA 3T28A 5FPTA 1TBQH 2J4IA 5A8YA 1IQLA 1SR5C 3GISB 6ESTA 3MOCA 3RU4T 2LNCA 1E35B 1ZTKA 1XM1A 1V2QT 1XX9A 4GPGA 1HAYB 1O2JA 3RP2A 1W7XH 1M9UA 3OY6U 2G55A 2Z9JA 1KLIH 1PPBH 3GY5A 2OBOA 1BTHH 2VGCC 1HJ8A 4AOQA 1GMHG 1F92A 2PUXB 1SI5H 1EB1H 4OGXA 1EJMA 4XBBA 1O2LA 1CE5A 1GJ8B 3GY6A 3RM2H 5FX5A 4MVNA 4O3UA 1GDNA 1CBWC 1TONA 1XUKA 3C27B 1SGNE 3DFJA 1C2JA 1NRRH 1L0ZA 1SQAA 1TABE 5IYTA 1Z8GA 3MNSA 4H42U 5EQSA 4YOGA 3GY7A 2ZU2A 1C2GA 4IC5A 3BTHE 2HNTF 1K21H 5L30H 5GCHG 2ZTZA 1YKTA 1GJ5H 2P3UB 3NWUA 2G5NA 1SPJA 2ZU1A 2CXVA 2G00A 1NC6A 2DUCA 2ZFRH 4BANB 1K1PA 1CT4E 1TGSZ 2PKSC 3GY4A 4IS5A 1GHVH 2GCTB 3RLWH 1YCPM 4U30A 3UNQA 3SNAA 1GJ4H 4U32A 2F3CE 2ZO3H 3TVJB 1ZPBA 2J34A 1AQ7A 1TE0A 3ZZ5A 1C1NA 2W7SA 5I46H 1ETRH 2BLVA 3LH3A 4ABHA 4ABEA 1K28D 3AAVA 1CGHA 1ZTLA 5GJ4B 3E0NB 1C2FA 5T6DA 1BA8B 1HAVB 4X8TH 1S6HA 2B0FA 2ZGHA 1OP8A 2CF8H 5CMXH 2ZC9H 1Y3XA 3T29A 5SGAE 3SI3H 1AKSB 4ISHH 3QK1A 1GBAA 2ZPRA 5C3NA 1O3BA 3O8BA 3ATMA 1P2IA 3ZZCA 2PGBB 2GD4B 3ZYDA 2A32A 4RKOB 3ZV9A 4A1TA 2HNTC 3GCNA 1ARBA 3TPIZ 4TY6A 3JZ2B 3S0NA 4NIXA 3FP7E 1V2VT 3M36A 1NZQH 1GJAB 3NK8A 1O3EA 1EZXC 2XC4A 3NKKA 3MO3A 3ELAH 2FM2A 3D65E 1CT0E 2J2UA 1WTGH 2ZFQH 3UR9A 1EX3A 4DW2U 2AGIX 1JRTA 2F83A 1SSXA 1CQQA 4CH8B 2YNAA 2BY5X 5FPSA 1MTSA 3LOXA 5CE1A 2A2XH 1O2ZA 3MH6A 5FXLA 1CHGA 2BDYA 1CA0B 3SJOA 1T8OA 4DJZB 1F0SA 1PQ8A 3SV8A 2XWBI 4I33A 1HXFH 1CA8B 4NA7A 3A7XA 3MH5A 3P8FA 3PO1C 1K1OA 4YZUA 1BJVA 3TK5A 2AMPA 1QFKH 1LPGB 2BYAX 1UK4A 2F91A 2FLRH 3ZZAA 1GBEA 2J95A 1XXDA 2ALPA 2ZHQH 2PTNA 4QT8C 3RXMA 3M5OA 5LGOA 2BDBA 2AMQA 1O33A 3HKIB 3A89A 5EW2H 4GAWA 1CHOF 2Y7XA 3NPSA 1ELTA 1KLTA 4H4FA 1YPEH 5CHAC 1QA7A 5E0GA 4ZHLU 1KDQB 1GBFA 1JRSA 5C5OA 4FUEA 4ISLA 1THSH 1OYTH 1QQ4A 1OPHB 1FY4A 3ZVAA 4IMZA 1T4VH 5AF9H 2FLBH 4IN1A 1GJ6A 1S85A 4ZKOU 1Y5UT 1FY8E 2G81E 3MNCA 2F9PA 4TYDA 3FAOA 3T5FH 2BOHB 1DS2E 1XVMA 2BD4A 1P03A 5HYOA 1O2VA 2B8OH 3O8DA 1A46H 2Z9LA 1K9OE 1LHGH 1NRSH 2WV4A 1FAXA 1OWEA 3ESTA 1C1OA 1GCTC 1CVWH 1ETTH 4A5TS 2OBQA 1DDJA 3DFLA 4FUCA 3UTUH 1ZMNA 2ZZUH 1W10U 3BSQA 5GPIB 1ELGA 4FVBA 1O3CA 1GG6C 1O3IA 1TNKA 2Y5FA 4K8YA 3PLPA 1NFYA 4ABFA 2UUJB 1A5IA 3Q3XA 1N1LA 6GCHF 1O5DH 3M7QA 3ZV8A 4CRFA 3PTNA 8ESTE 2F9UA 1ZPCA 4CREA 2W3KA 3RC6A 2UUFB 2AFQB 1Z7KA 1YC0A 3A83A 3D23A 2GX4A 1TGNA 2C4FH 1O2PA 2R3UA 2Q6DA 3GYLB 2EI6A 1Z8RA 3Q3YA 2H1UA 1AVXA 1BIOA 4CHAC 2OC1A 3PV4A 2ZCLP 5GWZA 3TNTA 1C2LA 1RRKA 3ATKA 4AB9A 2ZTYA 1VJ9U 5BRRE 1P04A 2XBVA 1P0SH 2FX6A 3LDXH 1SHYA 1TB6H 3SUFA 1Z1JA 3E6PH 3KIDU 2HVXA 1BHXF 1NT1A 2A4QA 3GY2A 1U6QA 2A4RA 2FDAA 4Y76A 9ESTA 3GCOA 5E2OA 1G9IE 3JZ1B 1GMHF 5JBBS 2J94A 4X1SU 1H8IH 1P2JA 4IC6A 1GBTA 2WPLS 4UFEH 3GY8A 1GI6A 1N8OC 3VEQB 2W5EA 2G4TA 1EZSC 2ZF0H 3E1XB 4WJG2 2GGVB 5TCCA 3SU3A 3S9CA 5ABWA 1YPJH 1GVKB 2TGTA 5FCKA 3A7TA 1UJ1A 4WXVA 1NESE 1EKBB 1BRAA 1SQOA 2WPIS 1EAWA 1GHBF 4YOJA 2FOBA 2CGAA 4GSOA 5K7RA 2QN5T 4TY7A 1TALA 3LJOA 1C5OH 4KKDA 3MTYA 2ILNA 1T8MA 2P8OB 3RU4D 1BDAA 5LPEA 1P8VC 1KY9A 4WXIA 4AZ2B 5HGGA 2A5KA 2GP9B 1O34A 5I25A 4NWLA 3L3TA 3S7KB 3T25A 3SJIA 3STIA 2QY0B 4J1YA 3RXBA 1A1RA 2J38A 2XW9A 5HM9A 1GL0E 4XDEA 2O9QA 3SNCA 1C5VA 1ELAA 4ABGA 1RD3B 2SFAA 3F9FA 1TMBH 3LKWA 1ZSJA 2PW8H 1UK3A 1ZPZA 4XE4A 8LPRA 3RUOA 1YPLH 1AU8A 4I8GA 2B7DH 1JWTA 1BTYA 1TBZH 1ZR0A 1Q2WA 2PGQB 2R9PA 1O2HA 3TLOA 1O5GH 1OSSA 3PWCA 4B2BA 2R0KA 2HPQH 3UQVA 1MQ6A 1AMHA 1Q3XA 2GMTC 2ZDNA 1XUHA 1LMWB 1IQHA 3KQDA 1B0FA 2PLXA 2WPKS 1H9LB 5DKMA 4AGKA 5EU8A 1HGTH 1GBMA 3VB4A 4NIYA 3U69H 1SGEE 1T8NA 1TA6A 3PM3A 1SFIA 1RS0A 2Q6FA 1UTOA 2Z3CA 1HRTH 2A1DB 2BHGA 2ZHEH 4GHTA 4OS2A 3EYDA 3LGTA 3ZZ8A 1B7XB 2Y7ZA 1P06A 2VVVA 3MU8A 2WUCA 2THFB 2BD2A 1HAZB
chains in the Genus database with same CATH superfamily
4ZH8A 1GHAF 2AS9A 4LOYH 1S81A 2OC8A 5FHTA 2ZGBH 5C1UA 1IHTH 1AN1E 3OEED 1ID5H 1TX8A 2YNBA 1ZHPA 1ELCA 3NXPA 4TWYA 1H9HE 4TSFD 4ZUHA 4B2AA 3HK3B 4DOQA 5GIBA 1AGJA 1TNIA 1TFXA 3PLBA 2A0QB 4PROA 1H4WA 1TX7A 2QF5A 4K5ZA 2TIOA 1OKXA 5H4IB 2BDHA 4NSVA 2ANYA 1W11U 1ELVA 1LVYA 1W12U 2FI3E 1UVOA 3OAAD 1BMMH 1WAYB 3A84A 4Q7YA 4K60A 1HAVA 3W94A 3AW0A 1ZRKA 2QAAA 1CO7E 1A5GH 1HXEH 4H6SB 3TJVA 2IOTA 2UUKB 3A8DA 1P9UA 3TGIE 1F0RA 3SU5A 2VNTA 3V3MA 1A0LA 2BX4A 2IPHA 1BMAA 2STAE 3CS0A 5AFYH 1RIWB 2ZQ1A 1P3CA 4CBNA 4I32A 4DT7B 2A2QH 4XRNA 3WWFA 3SV6A 4ZMAH 1C5LH 2JH6D 2FIRH 4X6MA 2FO9A 4CRDA 1FPCH 3M3SA 3LIWA 1FI8A 3UIRA 1RTKA 1O3DA 1UTNA 1BTWA 1O2RA 3RXFA 1AIXH 2TGDA 1T32A 1BMFD 1ESTA 2KZ4A 1C1PA 2L6OA 1C5UA 1E38B 2RDEA 1TRYA 1QB6A 1VJAU 4TWWA 2SGQE 2BD8A 1QL9A 5HXFA 1GMDF 3M37A 3T2NA 4DG4A 1EP5A 4TPIZ 1V2NT 2WYGA 3F9GA 4P02A 4K1TA 1S0QA 3K2UA 1LHEH 3UNSA 3RXTA 2NU2E 4H6TA 4Y8XA 5C1YA 5EQQA 2JETC 4MTBA 2QF3A 3HGPA 1SQTA 7LPRA 1O3AA 2ZPSA 1FDPA 2ZTXA 2FWWA 4ZCNA 2OQUA 2XC0A 1EJAA 4Z0KA 1YF4A 1DANH 1SLVB 1E37B 6CHAB 1LO6A 4MQAA 1S83A 4IW4E 5DP7A 1O2WA 4SGBE 2BD9A 3MH4A 1KXBA 3EE7A 2NU0E 4HGCA 4K1SA 4DURA 1JIMA 2ZDMA 1B5GH 5EODA 3E16B 2A7CA 3CENA 1QR3E 1A3BH 3FN8A 1UTMA 3UPEA 1SHHB 1C5QA 5JDUB 2ZU3A 4BNRA 1AUTC 4OS6A 1K1LA 1NU9A 2F9BH 4GHQA 4BOHA 5IDKA 2WV5A 8KME2 4D7FA 3MU5A 1C2EA 2JDID 4ZROA 2O8TA 3R3GB 1HBTH 2CF9H 1O2QA 3GOVB 2WHXA 3BTEE 3CS7A 1SFQB 2PR3A 1HAPH 3IWMA 1D6RA 2XBXA 1QGFA 1YLCA 2G51A 2Z3DA 2M5TA 1SGCA 7KMEH 3LGWA 6GCHG 1GJBB 2Z9GA 2FZZA 3E90B 2G52A 3SV2H 1L2EA 2Z7FE 1MZDA 1QBOA 1THRH 1O0DH 3KL6A 1IQFA 2XRCA 1ELEE 1SL3A 2ZHWH 1HAOH 3SZNA 3PMAB 3T27A 2P3FH 6LPRA 3A7ZA 1O3OA 2A5IA 1CT2E 2SNVA 4KELA 1TA2A 2BQ7B 1IQMA 1LHFH 1O3MA 3KF2A 2Y82A 5C17A 1EFRD 2M2AA 1NTPA 4X8SH 1RFNA 4CBOA 1D6WA 3IITA 4X2VA 1C5NH 4O97A 3G01A 3TJUA 1SMFE 1D9IA 2AERH 2ZDVH 3WW7A 3LH1A 1ANEA 4FUFA 4LZ4B 1E36B 1QNJA 3S69A 3UUZA 4Q7XA 2ZI2H 1O38A 2SNWA 2H2ZA 2QF4A 2AH4X 1V2LT 3RDZA 3H09A 3LC5A 3MNBA 1VGCB 1TNHA 1UMAH 1YPKH 4Y7BA 5A0AE 1K1JA 3RXSA 1SOTA 1V2TT 3PROA 1V3XA 1UVPA 5GXPA 2PKAB 1JIRA 4Q4LA 3ZZBA 4Y10E 1Z8JB 2J92A 4ESTE 3VGCB 2AYWA 1ELFA 1EUFA 1MCTA 1E34B 1OWHA 2ODQA 1GHBG 4X1QU 3F1SB 1TOCB 1BCUH 1C4Y2 4SGAE 1EAIA 1MUEB 1BMNH 4LK4A 1PPFE 5A8ZA 1C2MA 1QBVH 4ABAA 3HPTB 1P3EA 2QA9E 1ZSLA 2AEIH 2WINI 4U2WA 4B75A 2BX3A 4BTIB 2ZPQA 3CNRA 4X6OA 1EQ9A 4OS4A 2F9OA 1FY1A 1O3LA 3BTDE 2JH0D 1HAGE 1F5RA 1TQ0B 2ZP0H 4VGCC 2OUAA 2EI7A 1G37A 2C8XB 2J5UA 1XKAC 1YGCH 1DY9A 1Z8IB 1NO9H 4IGDA 5FBIA 3GY3A 2KCYA 4BTUB 3RC4A 4YESB 7ESTE 4WMFA 1CGIE 1LKBA 1NU7B 3RMMH 1MBQA 1AO5A 1EZQA 1MTNB 5TCAA 3EA8A 2ZFFH 1LQEA 2W26A 3ENSB 3SQEE 1EPTB 2GVFA 3HGNA 3PV5A 1QY6A 1J14A 1NROH 1J9CH 1FN6A 4X1NU 3SU1A 2AGEX 2ODYB 2OP9A 4B1TA 2IJOB 2VH6A 2FX4A 3MMGA 1C5WB 3HATH 2QF0A 1QJ6B 2BY7X 3P70B 3ZYEA 3RMLH 2ZWLH 3PB1E 1F2SE 4AFQA 4FUJA 2GZ9A 4ABBA 1GDQA 3QZRA 1HYLA 1DXPA 1H9IE 1OYQA 4XOJA 2G8TA 1GGDB 3B9FH 2FODA 2CK3D 2ODPA 3BTFE 1NRQH 3UOPA 4MNXA 3ZZ6A 1ANDA 5E2PA 3RMNH 1XKBC 1V2OT 2KM0A 3OYPA 3GCHC 3A7VA 2TPIZ 2AIQA 3SV9A 1WUNH 3ZZ4A 1TQ7B 1ZTJA 3D49H 2G4UA 1BRCE 1GHXH 1O37A 1AVWA 1GHAG 1YPGH 2JH5D 3M7UA 5F8XA 3FP8E 2D8WA 5KEDA 5JYIA 2DE8A 1P2OA 5FAHA 4WWYA 1O2YA 1IQKA 1F0TA 1EASA 1BTPA 4ABJA 1GL1A 2VWMA 1SG8B 3EQ0H 5EJZA 1ZJDA 2VWNA 3SUDA 1L1GA 1YBWA 4NZLA 1WU1A 3ITIA 1G30B 3P8NA 7GCHF 1KMHB 3SJ8A 3RXKA 1QURH 4FXGH 1HJAC 4A1XA 4AX9H 1QTFA 3KQBA 3A7YA 2HVYB 2QV1A 2Z9IA 3LGVA 2P8OC 1PPHE 2VGCB 5C0TA 4R0IA 2FYRA 1YLDA 4GCHF 1F5LA 4YT6H 2HPPH 3TNSA 4BXWA 1G3BA 2BB4A 1ESAA 3PTBA 3LC3A 3WY8A 5A09A 1E1QD 1C2KA 1FZZA 2I6QA 1CBWB 4X1PU 3A87A 4ZKSU 3RXPA 2OQ5A 4JK6A 2WSSD 3RXDA 2P59A 2STBE 2QXIA 1MZAA 1PYTD 1SGRE 3T62A 4ABIA 1QB9A 1HDTH 2KAIB 3W95A 3E91A 1KXEA 3TU7H 3GDSA 4I8JA 2NU1E 2NWNA 5DK1A 3BTQE 4I31A 1C1TA 5T3HA 3H7TA 1AVGH 1NN6A 5LPFA 2H5DA 4A92A 5FPYA 1V2JT 1P02A 1KXCA 2OD3B 2UWLA 2Q6GA 5JBCS 2PKSB 4Q2KA 1UTPA 1WV7H 2HNTE 1A2CH 1GMDG 1QQUA 1YPHC 3TGJE 2LPRA 1FN8A 4Y0YE 4BAHB 1EZUC 3F9EA 3STJA 1XVOA 4R8TB 1BTZA 1WBGB 2ESTE 4WVPE 3DA9B 2XBWA 2ZEBA 2P94A 1NBMD 2V6NA 1RXPA 1DITH 1MQ5A 3A7WA 3ZZ7A 3OX7U 5E0JA 1A61H 1IQJA 1C5MD 2ZDLA 3A8BA 3BTTE 1OWKA 3VB6A 2B9LA 1IOEA 2ANKH 1TWXB 3SNDA 3F6UH 1A0JA 1MAXA 1W3CA 1NFUA 2C90B 4YXWD 9LPRA 4CR9A 1MU6B 4KTUA 1BITA 3UB0A 5A2MH 3SU6A 4X6NA 2J9NA 1SGTA 1TNGA 1ZLRA 3RXLA 1S6FA 1V6DA 1EAUA 3QGNB 2QXJA 2BY6X 1TRNA 4K3JA 1C1SA 1YCPH 5F6MA 1MD8A 2OCVB 4Y6DA 3A80A 3TJOA 3WWBA 5GDSH 1FX0B 1V2RT 2W3IA 3HKJB 1MABB 2CMYA 1LHCH 1O31A 2HLDD 1AWFH 2QYIA 1TOMH 4D7GA 4F48B 5DP9A 4WMEA 1O2UA 1V2PT 2GCHG 1TYNA 2ZGCA 4NA9H 2FS8A 3F0OA 1SBWA 2CJIA 1OP0A 2XBYA 4FUIA 1AFQC 1G3EA 2WZQA 3M7TA 5A0BA 1O30A 1ZSKA 1FUJA 1AB9C 3PO1B 5DP3A 2R2MB 2Y5HA 4HFPB 1G3CA 1O39A 3FFGA 4UE7H 2ANMH 3U98H 4I7YH 4D9RA 4DVAU 2LELA 1ZZZA 3MQKC 1DSTA 1SLUB 3F2HA 4IBLH 2W6ID 3AW1A 1SOZA 2ZFPH 2Z3EA 4P00A 4WH8A 4RI0A 4UFGH 1GBKA 3SO3A 4OS7A 1DX5M 4JYUH 1O3NA 2OINA 5EOKA 1QIXB 1FNIA 4MPWA 4MPVA 1UVUH 1Y3UA 3ZVEA 1T8LA 3MU1A 1TMUH 4FUBA 4XSKU 1A5HA 3RXVA 1TIOA 2VWLA 5CHAB 1P01A 1V2UT 1GJDB 1MCVA 1O3FA 1O5FH 1MTUA 3EE0B 4ZAEA 1KXDA 4THNH 1W8BH 2FS9A 1LDTT 2FTLE 1V2ST 1FIWA 1QL8A 1UCYE 3M61U 1GI8B 1Q31A 3LJJA 4IMQA 1C2DA 4CRAA 5J4QA 2ZU4A 3GCTG 1GJ9B 3F3BA 2KCOA 4FOUC 3V0XA 3V12A 1MKXH 4Y71A 3ZIAD 1TRMA 3BEIB 1AHTH 2BQ6B 2FOHA 1UO6A 3TIUA 1FAKH 5EPNA 2AMDA 1ZGIA 4ZXYH 3BF6H 3SN8A 1L4ZA 3MU0A 3SUEA 1GBIA 2PKAA 1HJ9A 4X1RU 1C5TA 1X7AC 1GBBA 1PPZA 2A31A 1YY3A 5F8ZA 2CHAC 1O2OA 1GVZA 4AFZA 1KSNA 1KXAA 1GG6B 2I6SA 1TX6A 1SLWB 1MBMA 5DP4A 4DIIH 3GS9A 1AUJA 4JYVH 4DCDA 1AZZA 4Z1MD 5G4BA 3PYHA 3SU0A 3H7OA 4OS5A 4NWKA 1FXYA 1SGQE 3ZVBA 4X0WU 2H9EH 4GUXA 3BTWE 3RU4E 3DUXH 2HALA 1DWEH 3BG4C 4IN2A 2BQWB 4FVDA 1DLKB 4MPXA 3P8GA 4RT0A 1KTSB 4MNYA 4CHAB 5EG4A 5A8XA 1YCPK 5B6OA 1MKWH 1EAXA 1S6LA 3R0FA 4MNWA 3H5CB 2PTCE 1WSSH 3BG8A 2J98B 1OWDA 2AHME 4LXBH 3MYWA 2FP7B 5L2YH 3VB5A 4GVUA 4Z6AH 1LVMA 1GI2A 3U1JB 1DFPA 1MMJN 4WMDA 3M3TA 3I77A 1C1RA 4ZXXH 1QJ1B 3RXQA 3MFJA 4NCYA 4ZKNU 2TRMA 4F49A 1AKSA 5JB9S 1UHBB 3SGQE 5BPEA 1N8OB 2BLQA 3BEUA 4AG2A 3F2FA 2ZGXH 3PMJA 3Q76A 5JBAS 1HV7A 1O3PB 1G2LA 3UFAA 2ZHFH 3LU9B 1HAIH 1BBRH 2RCEA 3TGKE 1H8DH 1QRWA 3U8RH 2XXLA 2FOGA 4AORA 1IQEA 1ABJH 1S5SA 1ZJKA 2BVSH 3MHWU 1QBNA 4OS1A 3ATWA 1L4DA 3SV7A 5DGJA 2GV6A 1LKAA 5JBTA 3KQEA 3AAUA 4AYVB 7GCHG 1Y8TA 5LH8A 4ACAA 4MLFB 2GJGA 1Y5AT 3EA9A 2WPHS 3QLPH 4JZFH 4B74A 3SOSA 1LVOA 1C5ZB 2XCFA 1GI4A 2VIVA 3Q00A 5C5NA 1LHDH 1GI5A 3URCA 4GCHG 3UNRA 1QHRB 1O2XA 4RT1A 3FANA 5CHBA 2WUBA 4INLA 2EEKA 2GDEH 1ANBA 3SHAH 2GCTC 5DJ7A 3RC5A 1NS3A 2BVXH 3AASA 3K65B 1TGBA 4FUHA 4AG1A 4CH2B 1N6YA 2BZAA 1HUTH 2AGGX 1LQDB 5EXNA 2ZCKP 1T4UH 1AD8H 3RMOH 2PSYA 2FYQA 2OXSA 3U8TH 2GMTB 1ORFA 3GDVA 4XBCA 5FBEA 1TAWA 3SU2A 2RA0A 1KDQA 1ARCA 2EI8A 4FU9A 1A3EH 3OEHD 3BN9A 1PFXC 4FU8A 4JYTA 3MNXA 3E3TA 1DICA 5EW1H 1TPSA 1BRUP 2ZDAH 5TJXA 3ZVGA 2SGFE 4CRBA 1T7CA 1DY8A 1QA0A 1WYKA 3PMBB 1GVLA 1AE8H 2KAIA 4NIVA 3UOUA 4DIHH 1BQYA 2GDDA 3SZEA 4NZQA 2PP6A 3E8LA 1MU8B 1GBJA 2GCHF 2TBSA 2K8IA 1F0UA 3QTOH 2VIWA 1DUEA 2QC2A 3K9XB 3M35A 3OTJE 1C5RA 3UAIC 1D3PB 1Z1IA 2D26C 1GBCA 3TK9A 8GCHF 5CDFE 2Z94A 1EATA 1HAXB 1TPOA 1S82A 3UREA 1C5SA 5C67A 3P95A 3KGPA 5JPMH 5C2ZA 2QCYA 3ATIA 4KP0A 1CA0C 1C1MA 1LCYA 4ISOA 1P2MA 3LGYA 1WQSA 3TH4H 1A0HB 4CRGA 2O8MA 5HM2A 1VCWA 1DWCH 2VH0A 3OU0A 1EB2A 1W0YH 2ZECA 2FOAA 2AIPA 4X2YA 4INHA 4YLQH 3ZVFA 2Z6BD 5EIYA 1D4PB 5FL7D 4Q7ZA 5DP6A 2BZ6H 4BXSA 3BIUH 2TGPZ 4UEHH 1ZMJA 1O2IA 4NSYA 1XMNB 5F8TA 2FOMB 2A7JA 1GBLA 2BD7A 1OP2A 1NFXA 3U1IB 2XYAA 4Y8ZA 2A5AA 1SQRA 3TJNA 3GCTF 3TH3H 1ANCA 1C1VH 3FZDA 3ZZ9A 1W7GH 1O3KA 5FX6A 2VIOA 2PV9B 3BTKE 1JOUB 3A88A 2IN2A 1UTLM 1VZQH 3L6PA 3QWCH 3MU4A 3IG6B 4X8UH 4BTTB 5K0HA 1PJPA 2ANWA 4AB8A 1VKYA 2P3TB 1VITF 2QXGA 2PHBA 2OC7A 3M5LA 3LGUA 1P2NA 2DE9A 5E8EH 4ZKRU 2C93B 3SI4H 1AI8H 1W0KD 4YTAA 1QL7A 2JETB 3S7HB 1Y3WA 2HOBA 4HI3A 2VIQA 5F03A 2H6MA 4YO9A 1FV9A 1L1JA 5EPYA 2XC5A 1P9SA 1KLJH 1AFEH 1OS8A 1GI9B 2XNIA 3U9AH 2QIQA 2VVUA 2FOFA 4NGAH 2XNDD 1C5PA 3VXEH 1O2MA 3K6ZA 1DOJA 1FJSA 3M5NA 1S84A 1PPGE 3TITA 3FZZA 1GMCF 3SNEA 3BTME 2B5TB 1L1NA 4UFFH 5L6NH 1P09A 2ULLA 2EY4C 1DVAH 1CU1A 1BBRE 4B6FA 1C1WH 4KGAA 1UTJA 1XXFA 3RXJA 3LPRA 2ZA5A 4FETA 4K1EA 1UCYH 2ASUB 1GHZA 3QUMP 4MDSA 1FQ3A 2W7UA 4X2WA 2BY9X 1Z6JH 2VINA 2C8WB 1NM6A 1SGFG 2GKVE 2V3HH 1G36A 2BVRH 4A6LA 3KHVA 3DCLA 1GHYH 5J4SA 1EXFA 1DT2A 1VCQA 2V7QD 2XCNA 1C1UH 4CR5A 3QN7A 2BD3A 2GTBA 2VVCA 1W0JD 1DPOA 1V2KT 3A82A 1DM4B 1FLEE 1GI7B 2VU8E 3P92A 3SGAE 4OM9A 2UWPA 2C3SA 2KCPA 4BAQB 3CP7A 1J15A 3NZIA 3V13A 1PQ7A 2YMSD 1O5EH 1K1IA 2J97A 5DG6A 1ZRBA 4Y8YA 1WOFA 2VBCA 1C9TA 3B23B 3F2GA 1PYTC 3K6YA 3VB3A 2BMGB 1ELDE 4ACBA 1O2NA 5ESTE 3PMHB 4TT3D 1UTKA 3D62A 3UQOA 2HRVA 3RXOA 5DPAA 1IHSH 4M9FA 2ZKSA 1SGIB 2FTMA 3UR6A 1C4U2 2WPMS 3PLKA 1D3DB 1KXFA 4XFQA 4FUDA 2J98A 3BIVH 2F9NA 1GWAA 1DWBH 3Q77A 1FY3A 3I29A 3ZZDA 1MD7A 1W14U 3KN2A 1YP9A 3O8RA 3SBKA 1O2TA 2FOEA 1O32A 5E0HA 1Z6EA 1HIAB 3N7DA 4DT4A 1UVTH 1LTOA 1P11E 3P17H 1UHBA 2R0LA 5ESBA 2FEQH 3LGIA 2BTCE 1W2KH 2BXTH 2JJ2D 4ABDA 4HZHA 1GI3A 2CV3A 3UWJH 4JK5A 3UWIA 2F9VA 2SGAA 2Y5GA 4JZEH 1JMOH 3EDXB 3QO6A 4MG3A 4ASUD 2O8LA 2RG3A 1HFDA 3RXRA 3I78A 1ESBA 4E06H 4ISNA 1O3GA 2VJ1A 1UVSH 2SGPE 3OSYA 3S9BA 3LT3A 2D2DA 1BT7A 2JIZD 3URDA 4MPUA 1UTQA 3NCLA 4I86A 3SNBA 3SQHE 5AVDA 1PQ5A 4VGCB 1YLNA 1BJUA 2C8ZB 3ZVDA 4D76A 2BXUH 3N7EA 1HB0B 5ETXA 2PSXA 3OY5U 2VIPA 1KYNA 1O2KA 2V35A 2ZIQH 4XD7D 3SORA 5C94A 1BTUA 1XUIA 2V3MA 3S9AA 3VFEA 2ZG0H 1YPMH 2BD5A 2VB0A 3PWBA 2V3OH 1UCYK 3A8AA 3HK6B 2WV9A 3MH7A 4UDWH 4TPYA 3SJKA 5EXLA 4O3TA 1GI0A 2YMSB 3EGKH 1QRXA 3P8OA 4JCNA 1IQIA 1AE5A 4XBDA 2ZCHP 4A1VA 1XUFA 3A8CA 3NUMA 4Y7AA 2UUYA 4K69A 1JBUH 1B0EA 3MWIU 1SVPA 4JZ1A 1OXGA 1FMGA 3U28C 2TGAA 1DLEA 2A45B 2ZQ2A 4NFFA 1C2IA 1TGCA 3VPKA 2PUQH 1LPKB 2FI5E 3A86A 4LZ1H 1EP6A 1QB1A 1TLDA 1ZYOA 2Y81A 3GCHB 1O36A 2BOKA 3QTVH 1ZMLA 1COWD 1SB1H 4Q63A 1RGQA 2BLWA 1ABIH 1F7ZA 1SGDE 1WQVH 1YYY1 5EJLA 1ZOMA 2ALVA 4B71A 1HAHH 2Y6TA 2WYJA 1WTHD 1G3DA 2BLOA 1FIZA 2Z9KA 1AZ8A 1ACBE 3LONA 3T26A 1Y59T 2FPZA 4ISIH 8GCHG 1ELBA 3ZZ3A 3V7TA 1RIWC 1XUJA 2UWOA 4B76A 2PFEA 2HLCA 2GV7A 4ZHMU 4ASHA 5AFZH 2SGEE 3OE7D 4MNVA 2P93A 4ZHAA 1OWJA 3OFND 2ZFTA 1A4WH 3PV2A 1HJAB 2EQNA 1INCA 1O3HA 1NBME 2ZNKH 4DGJA 5GCHF 2H9TH 1F5KU 4NIWA 5T6GA 1QRZA 1HLTH 1C9PA 2GT8A 3GDUA 3Q3KA 3FP6E 3W1EA 1P05A 1HCGA 3SW2B 2HWLB 3FOAA 4NFEA 1YPHE 1MAYA 4E7NA 2FXRA 2ZDKA 5PTPA 1C1QA 1SGFA 5HMAA 3KEEA 4X8VH 1LPZB 1UK2A 4K2YA 2FOCA 4FUGA 4E05H 4WF8A 1TNJA 3N7OA 3F0PA 1GI1A 4YOIA 4B2CA 4AYYB 4HTCH 4KTCA 3RXIA 4Y0ZE 4WH6A 1SC8U 1HPGA 2KR7A 2QGRA 3EAJA 2VWOA 1EJNA 1SLXB 1GCTB 1FY5A 1S0RA 2RA3A 3NRLA 2BY8X 1K22H 3DHKH 6CHAC 3QDZB 1BMLA 3DSGA 1CGJE 1SKYE 1SGPE 4NG9H 2A4OA 3M5MA 1K1NA 1P10A 2FESH 4JZDH 5A0CA 5DP5A 1VITG 1BB0B 2W6JD 1O5AB 3GICB 1A7SA 4RKJB 3L33A 2VIDA 2G5VA 4KTSA 3KQCA 3SJ9A 3VXFH 2PWXA 1LVBA 4J2YB 1O35A 3KNXA 5C0UA 2GZ8A 3P6ZB 3SHCH 2YOLA 2QXHA 1K2I1 4E7RG 2ZHDA 4I8KA 1BOQA 1VCPA 2GZ7A 1ETSH 1HNEE 3UY9A 3E0PB 2ZU5A 1G2MA 1C4V2 1O5BB 4K8BA 4U01A 1TMTH 2EA3A 4O03A 4O9VA 3RXAA 1QJ7B 2A7HA 1GMCG 1C5YB 1YWUA 5JB8S 1MTWA 2RFKC 4D9QA 4BAOB 1RTFB 3F9HA 4F4OC 4YT7H 3DT0H 1OOKB 2C8YB 1IAUA 1BZXE 1EPTA 2JKHA 2OTVA 1D3QB 3RXHA 1O2GH 3N99A 1EOJA 3ZVCA 4UONA 3RM0H 1P57B 4A7IB 4UD9H 2NU4E 4AN7A 2EC9H 2BDAA 1K0HA 1C2HA 1V2MT 1NY22 1FPHH 1T31A 4AFUA 1AFQB 1OX1A 1D3TB 4X2XA 5DO4H 5C20A 1PPCE 4NA8A 1IQGA 1VGCC 1ZGVA 5EGMA 2Q1JA 1AB9B 3GYMA 3ODDA 1KIGH 1BTXA 1KTTB 4YM9A 1NRNH 4Y11E 4D8NA 1P12E 3VGCC 1PPEE 3BV9B 1JXPA 3A81A 1RJXB 2CN0H 2WPJS 1Y3YA 1BHXB 3FVFB 4RSPA 3RXUA 4GLYA 1NRPH 1P2KA 2BDIA 4RN6A 1O5CB 3RXCA 1Y3VA 1O3JA 4YLUA 3BEFB 1MKXK 1W13U 1NPMA 1CSOE 1O2SA 1H1BA 2K1QA 4I8LA 1GBDA 2BDGA 1MTVA 1J8AA 2R2WU 1ZHRA 1H8HD 1IQNA 1GBHA 2RDLA 3QGJA 2BDCA 2A4GA 1AY6H 1DWDH 2GT7A 2NU3E 4UFDH 1YM0A 1TGTA 3SGBE 3U8OH 1Y5BT 4OGYA 1DE7H 1CHOG 1GDUA 3DD2H 2SGDE 3ODFA 5L2ZH 3RXEA 2R3YA 1J17T 3A85A 3TH2H 4B73A 2ZFSA 1OWIA 1J16A 2O8WA 1DXWA 5T1VA 3RXGA 1E79D 2XWAA 1AWHB 1EOLA 1MTNC 4JMYA 5FCRA 3VB7A 3ATLA 3C1KA 1EPTC 2FMJA 1RTLA 2CHAB 3QX5H 3PRBA 4X6PA 2O8UA 3AVZA 2H9HA 3B8JA 1E0FD 2Y80A 4WY3A 5C1XA 3M3VA 3F68H 1N6XA 1XUGA 1GHWH 1HIAA 1MH0A 4BAMB 2P16A 2XTTB 4I8HA 1GJCB 1MKWK 1G32B 1Z71A 3SUGA 2P95A 1FONA 1DSUA 2FI4E 3O8CA 2H5CA 2ZGJA 1P2QA 4FU7A 1GGDC 2BM2A 1DUAA 1BRBE 1NFWA 3MI4A 1PQAA 3TK6A 1ZHMA 3BG4B 1WCZA 3MO9A 2OC0A 3SU4A 1K1MA 3QZQA 1TNLA 4AGJA 1TPAE 4M7GA 4Y79A 5LPRA 2V0BA 2D1JA 1GCDA 5DP8A 5KECA 1SGYE 4BAKB 1GJ7B 3KCGH 1V2WT 4DY7B 3EA7A 1C5XB 1TBRH 1TPPA 2KCAA 5AHGH 1BUIA 3MO6A 5EXMA 4AFSA 2HGTH 2OLGA 4CRCA 1W0ZU 1VITH 1GPZA 4JZIA 3RLYH 4INKA 4Q80A 1THPB 5T6FA 3BTGE 1VR1H 1BBRK 5EQRA 1QCPA 3T28A 5FPTA 1TBQH 2J4IA 5A8YA 1IQLA 1SR5C 3GISB 6ESTA 3MOCA 3RU4T 2LNCA 1E35B 1ZTKA 1XM1A 1V2QT 1XX9A 4GPGA 1HAYB 1O2JA 1QZ8A 3RP2A 1W7XH 1M9UA 3OY6U 2G55A 2Z9JA 1E1RD 1KLIH 1PPBH 3GY5A 2OBOA 1BTHH 2VGCC 3KYGA 1HJ8A 4AOQA 1GMHG 1F92A 2PUXB 1SI5H 1EB1H 4OGXA 1EJMA 4XBBA 1O2LA 1CE5A 1GJ8B 3GY6A 3RM2H 5FX5A 4MVNA 5HKKD 4O3UA 1GDNA 1CBWC 1TONA 1XUKA 3C27B 1SGNE 3DFJA 1C2JA 2KFWA 1NRRH 1L0ZA 1SQAA 1TABE 5IYTA 1Z8GA 3MNSA 4H42U 5EQSA 4YOGA 3GY7A 2ZU2A 1C2GA 4IC5A 3KYFA 3BTHE 2HNTF 1K21H 5L30H 5GCHG 2ZTZA 1YKTA 1GJ5H 2P3UB 3NWUA 2G5NA 1SPJA 2ZU1A 2CXVA 2G00A 1NC6A 2DUCA 2ZFRH 4BANB 2K0QA 2XOKD 1K1PA 1CT4E 1TGSZ 2PKSC 3GY4A 2LP6A 4IS5A 1GHVH 2GCTB 3RLWH 1YCPM 4U30A 3UNQA 3SNAA 1GJ4H 5KGOA 4U32A 2F3CE 2ZO3H 3TVJB 1ZPBA 2J34A 1AQ7A 1TE0A 3ZZ5A 1C1NA 2W7SA 5I46H 1ETRH 2BLVA 3LH3A 3VG8A 4ABHA 4ABEA 1K28D 3AAVA 1CGHA 1ZTLA 5GJ4B 3E0NB 1C2FA 5T6DA 1BA8B 1HAVB 4X8TH 1S6HA 2B0FA 2ZGHA 1OP8A 2CF8H 5CMXH 2ZC9H 1Y3XA 3T29A 2KX4A 3SI3H 5SGAE 1AKSB 4ISHH 3QK1A 1GBAA 2ZPRA 5C3NA 1O3BA 3O8BA 3ATMA 1P2IA 3ZZCA 2PGBB 2GD4B 3ZYDA 2A32A 4RKOB 3ZV9A 4A1TA 2HNTC 3GCNA 2YMSC 1ARBA 3TPIZ 4TY6A 3JZ2B 3S0NA 4NIXA 3FP7E 1V2VT 3M36A 1NZQH 1GJAB 3NK8A 1O3EA 1EZXC 2XC4A 3NKKA 3MO3A 3ELAH 2FM2A 3D65E 1CT0E 5B6LA 2J2UA 2QE7D 1WTGH 2WPDD 2ZFQH 3UR9A 1EX3A 4DW2U 1UW7A 2AGIX 1JRTA 2F83A 1SSXA 1CQQA 4CH8B 2YNAA 2BY5X 5FPSA 1MTSA 3KQ5A 3LOXA 5CE1A 2A2XH 1O2ZA 3MH6A 5FXLA 1CHGA 2BDYA 1CA0B 3SJOA 1T8OA 4DJZB 3AK5A 1F0SA 1PQ8A 3SV8A 2XWBI 4I33A 1HXFH 1CA8B 4NA7A 3A7XA 3MH5A 3P8FA 3PO1C 1K1OA 4YZUA 1BJVA 3TK5A 2AMPA 1QFKH 1LPGB 2BYAX 1UK4A 2F91A 2FLRH 3ZZAA 1GBEA 2J95A 1XXDA 5F53A 2ALPA 2ZHQH 2PTNA 4QT8C 3RXMA 3M5OA 5LGOA 2BDBA 2AMQA 1O33A 4HG6A 3HKIB 3A89A 5EW2H 3DSOA 4GAWA 1CHOF 2Y7XA 3NPSA 1ELTA 1KLTA 4H4FA 1YPEH 5CHAC 4AC9A 1QA7A 5E0GA 4ZHLU 1KDQB 1GBFA 1JRSA 5C5OA 4FUEA 4ISLA 1THSH 1OYTH 1QQ4A 1OPHB 1FY4A 1WXRA 3SYJA 3ZVAA 4IMZA 1T4VH 5AF9H 2FLBH 4IN1A 1GJ6A 1S85A 4ZKOU 1Y5UT 1FY8E 2G81E 3MNCA 2F9PA 4TYDA 3FAOA 3T5FH 2BOHB 1DS2E 1XVMA 2BD4A 1P03A 5HYOA 1O2VA 2B8OH 3O8DA 1A46H 2Z9LA 1K9OE 1LHGH 1NRSH 2WV4A 1FAXA 1OWEA 3ESTA 1C1OA 1GCTC 1CVWH 1ETTH 4A5TS 2OBQA 1DDJA 3DFLA 4FUCA 3UTUH 1ZMNA 2ZZUH 1W10U 3BSQA 5GPIB 1ELGA 4FVBA 1O3CA 5DN6D 1GG6C 1O3IA 1TNKA 2Y5FA 4K8YA 3PLPA 1NFYA 2L74A 4ABFA 2IJD1 3FKSD 2UUJB 1A5IA 3Q3XA 1N1LA 6GCHF 1O5DH 3M7QA 3ZV8A 4CRFA 3PTNA 8ESTE 2F9UA 1ZPCA 4CREA 2W3KA 3RC6A 2UUFB 2AFQB 1Z7KA 1YC0A 2JJ1D 3A83A 3D23A 2GX4A 1TGNA 2C4FH 1O2PA 2R3UA 2Q6DA 3GYLB 2EI6A 1Z8RA 3Q3YA 2H1UA 1AVXA 1BIOA 4CHAC 2OC1A 5GNDA 3PV4A 2ZCLP 3PRDA 5GWZA 3TNTA 1C2LA 1RRKA 3ATKA 4AB9A 5HIYA 2ZTYA 1VJ9U 1H8ED 5BRRE 1P04A 2XBVA 1P0SH 2FX6A 3LDXH 1SHYA 1TB6H 3SUFA 1Z1JA 3E6PH 3KIDU 2HVXA 1BHXF 1NT1A 2A4QA 3GY2A 1U6QA 2A4RA 2FDAA 4Y76A 9ESTA 3GCOA 5E2OA 1G9IE 3JZ1B 1GMHF 5JBBS 2J94A 4X1SU 4F55A 1H8IH 1P2JA 4IC6A 1GBTA 2WPLS 4UFEH 3GY8A 1GI6A 1N8OC 3VEQB 2W5EA 2G4TA 1EZSC 2F43B 2ZF0H 3E1XB 2GGVB 4WJG2 5TCCA 3SU3A 2F4LA 3S9CA 5ABWA 1YPJH 1GVKB 2TGTA 5FCKA 3A7TA 1UJ1A 4WXVA 1WDIA 1NESE 1EKBB 1BRAA 1SQOA 2WPIS 1EAWA 1GHBF 4YOJA 2FOBA 2CGAA 4GSOA 5K7RA 2QN5T 4TY7A 3OTPA 3DSPA 1TALA 3LJOA 1C5OH 4KKDA 3MTYA 2ILNA 1T8MA 2P8OB 3RU4D 1BDAA 5LPEA 1P8VC 1KY9A 4WXIA 4AZ2B 5HGGA 2A5KA 2GP9B 1O34A 5I25A 5EJ1A 4NWLA 3L3TA 3S7KB 3T25A 3SJIA 3STIA 2QY0B 4J1YA 3RXBA 1A1RA 2J38A 2XW9A 5HM9A 1GL0E 4XDEA 5IK2D 2O9QA 3SNCA 1C5VA 5HIZA 5DSFA 1ELAA 4ABGA 1RD3B 2SFAA 3F9FA 1TMBH 3LKWA 1ZSJA 2IPQX 2PW8H 1UK3A 1ZPZA 4XE4A 8LPRA 3RUOA 1YPLH 1AU8A 4I8GA 2B7DH 1JWTA 1BTYA 1TBZH 1ZR0A 1Q2WA 4B6EA 2PGQB 2R9PA 1O2HA 3TLOA 1O5GH 1OSSA 3PWCA 4B2BA 2R0KA 2HPQH 3UQVA 1MQ6A 1AMHA 1Q3XA 2GMTC 2ZDNA 1XUHA 1LMWB 1IQHA 3KQDA 1B0FA 2PLXA 2WPKS 1H9LB 5DKMA 3FO8D 4AGKA 5EU8A 1HGTH 1GBMA 3VB4A 1OHHD 4NIYA 3U69H 1SGEE 1T8NA 1TA6A 3PM3A 1SFIA 1RS0A 2Q6FA 1UTOA 2Z3CA 1HRTH 2A1DB 2BHGA 2ZHEH 4GHTA 4OS2A 3EYDA 3LGTA 3ZZ8A 1B7XB 2OK5A 2Y7ZA 1P06A 2VVVA 3MU8A 2WUCA 2THFB 2BD2A 1HAZB
chains in the Genus database with same CATH topology
4ZH8A 1GHAF 2AS9A 4LOYH 1S81A 2OC8A 5FHTA 2ZGBH 5C1UA 1IHTH 1AN1E 1ID5H 1TX8A 2YNBA 1ZHPA 1ELCA 3NXPA 4TWYA 1H9HE 4ZUHA 4B2AA 3HK3B 4DOQA 5GIBA 1AGJA 1TNIA 1TFXA 3PLBA 2A0QB 4PROA 1H4WA 1TX7A 4K5ZA 2TIOA 1OKXA 5H4IB 2BDHA 4NSVA 2ANYA 1W11U 1ELVA 1LVYA 1W12U 2FI3E 1UVOA 1BMMH 1WAYB 3A84A 4Q7YA 4K60A 1HAVA 3W94A 3AW0A 1ZRKA 2QAAA 1CO7E 1A5GH 1HXEH 4H6SB 3TJVA 2IOTA 2UUKB 3A8DA 1P9UA 3TGIE 1F0RA 3SU5A 2VNTA 3V3MA 1A0LA 2BX4A 2IPHA 1BMAA 2STAE 3CS0A 5AFYH 1RIWB 2ZQ1A 1P3CA 4CBNA 4I32A 4DT7B 2A2QH 3SV6A 4ZMAH 1C5LH 2JH6D 2FIRH 4X6MA 2FO9A 4CRDA 1FPCH 3M3SA 3LIWA 1FI8A 3UIRA 1RTKA 1O3DA 1UTNA 1BTWA 1O2RA 3RXFA 1AIXH 2TGDA 1T32A 1ESTA 1C1PA 1C5UA 1E38B 1TRYA 1QB6A 1VJAU 4TWWA 2SGQE 2BD8A 1QL9A 5HXFA 1GMDF 3M37A 3T2NA 4DG4A 1EP5A 4TPIZ 1V2NT 2WYGA 3F9GA 4K1TA 1S0QA 3K2UA 1LHEH 3UNSA 3RXTA 2NU2E 4H6TA 4Y8XA 5C1YA 5EQQA 2JETC 4MTBA 2QF3A 3HGPA 1SQTA 7LPRA 1O3AA 2ZPSA 1FDPA 2ZTXA 2FWWA 2OQUA 2XC0A 1EJAA 4Z0KA 1YF4A 1DANH 1SLVB 1E37B 6CHAB 1LO6A 4MQAA 1S83A 4IW4E 5DP7A 1O2WA 4SGBE 2BD9A 3MH4A 1KXBA 2NU0E 4HGCA 4K1SA 4DURA 1JIMA 2ZDMA 1B5GH 5EODA 3E16B 2A7CA 3CENA 1QR3E 1A3BH 1UTMA 3UPEA 1SHHB 1C5QA 5JDUB 2ZU3A 4BNRA 1AUTC 4OS6A 1K1LA 1NU9A 2F9BH 4GHQA 4BOHA 5IDKA 2WV5A 8KME2 4D7FA 3MU5A 1C2EA 4ZROA 2O8TA 3R3GB 1HBTH 2CF9H 1O2QA 3GOVB 3BTEE 3CS7A 1SFQB 2PR3A 1HAPH 3IWMA 1D6RA 2XBXA 1QGFA 1YLCA 2G51A 2Z3DA 2M5TA 1SGCA 7KMEH 3LGWA 6GCHG 1GJBB 2Z9GA 2FZZA 3E90B 2G52A 3SV2H 1L2EA 2Z7FE 1MZDA 1QBOA 1THRH 1O0DH 3KL6A 1IQFA 2XRCA 1ELEE 1SL3A 2ZHWH 1HAOH 3SZNA 3PMAB 3T27A 2P3FH 6LPRA 3A7ZA 1O3OA 2A5IA 1CT2E 2SNVA 4KELA 1TA2A 2BQ7B 1IQMA 1LHFH 1O3MA 3KF2A 2Y82A 1NTPA 4X8SH 1RFNA 4CBOA 1D6WA 3IITA 4X2VA 1C5NH 4O97A 3G01A 3TJUA 1SMFE 1D9IA 2AERH 2ZDVH 3LH1A 1ANEA 4FUFA 4LZ4B 1E36B 1QNJA 3S69A 3UUZA 4Q7XA 2ZI2H 1O38A 2SNWA 2H2ZA 2AH4X 1V2LT 3RDZA 3LC5A 3MNBA 1VGCB 1TNHA 1UMAH 1YPKH 4Y7BA 5A0AE 1K1JA 3RXSA 1SOTA 1V2TT 3PROA 1V3XA 1UVPA 5GXPA 2PKAB 1JIRA 3ZZBA 4Y10E 1Z8JB 2J92A 4ESTE 3VGCB 2AYWA 1ELFA 1EUFA 1MCTA 1E34B 1OWHA 2ODQA 1GHBG 4X1QU 3F1SB 1TOCB 1BCUH 1C4Y2 4SGAE 1EAIA 1MUEB 1BMNH 4LK4A 1PPFE 5A8ZA 1C2MA 1QBVH 4ABAA 3HPTB 1P3EA 2QA9E 1ZSLA 2AEIH 2WINI 4U2WA 4B75A 2BX3A 4BTIB 2ZPQA 4X6OA 1EQ9A 4OS4A 2F9OA 1FY1A 1O3LA 3BTDE 2JH0D 1HAGE 1F5RA 1TQ0B 2ZP0H 4VGCC 2OUAA 2EI7A 1G37A 2C8XB 1XKAC 1YGCH 1DY9A 1Z8IB 1NO9H 4IGDA 5FBIA 3GY3A 4BTUB 3RC4A 4YESB 7ESTE 4WMFA 1CGIE 1LKBA 1NU7B 3RMMH 1MBQA 1AO5A 1EZQA 1MTNB 5TCAA 3EA8A 2ZFFH 1LQEA 2W26A 3ENSB 3SQEE 1EPTB 2GVFA 3HGNA 1QY6A 1J14A 1NROH 1J9CH 1FN6A 4X1NU 3SU1A 2AGEX 2ODYB 2OP9A 4B1TA 2IJOB 2VH6A 2FX4A 3MMGA 1C5WB 3HATH 2QF0A 1QJ6B 2BY7X 3P70B 3ZYEA 3RMLH 2ZWLH 3PB1E 1F2SE 4AFQA 4FUJA 2GZ9A 4ABBA 1GDQA 3QZRA 1HYLA 1DXPA 1H9IE 1OYQA 4XOJA 2G8TA 1GGDB 3B9FH 2FODA 2ODPA 3BTFE 1NRQH 3UOPA 4MNXA 3ZZ6A 1ANDA 5E2PA 3RMNH 1XKBC 1V2OT 3OYPA 3GCHC 3A7VA 2TPIZ 2AIQA 3SV9A 1WUNH 3ZZ4A 1TQ7B 1ZTJA 3D49H 2G4UA 1BRCE 1GHXH 1O37A 1AVWA 1GHAG 1YPGH 2JH5D 3M7UA 5F8XA 3FP8E 2D8WA 5JYIA 2DE8A 1P2OA 5FAHA 4WWYA 1O2YA 1IQKA 1F0TA 1EASA 1BTPA 4ABJA 1GL1A 2VWMA 1SG8B 3EQ0H 1ZJDA 2VWNA 3SUDA 1L1GA 1YBWA 4NZLA 1WU1A 3ITIA 1G30B 3P8NA 7GCHF 3SJ8A 3RXKA 1QURH 4FXGH 1HJAC 4A1XA 4AX9H 1QTFA 3KQBA 3A7YA 2QV1A 2Z9IA 3LGVA 2P8OC 1PPHE 2VGCB 4R0IA 2FYRA 1YLDA 4GCHF 1F5LA 4YT6H 2HPPH 3TNSA 4BXWA 1G3BA 2BB4A 1ESAA 3PTBA 3LC3A 3WY8A 5A09A 1C2KA 1FZZA 2I6QA 1CBWB 4X1PU 3A87A 4ZKSU 3RXPA 2OQ5A 4JK6A 3RXDA 2P59A 2STBE 2QXIA 1MZAA 1PYTD 1SGRE 3T62A 4ABIA 1QB9A 1HDTH 2KAIB 3W95A 3E91A 1KXEA 3TU7H 3GDSA 4I8JA 2NU1E 2NWNA 5DK1A 3BTQE 4I31A 1C1TA 5T3HA 3H7TA 1AVGH 1NN6A 5LPFA 2H5DA 4A92A 5FPYA 1V2JT 1P02A 1KXCA 2OD3B 2UWLA 2Q6GA 5JBCS 2PKSB 4Q2KA 1UTPA 1WV7H 2HNTE 1A2CH 1GMDG 1QQUA 1YPHC 3TGJE 2LPRA 1FN8A 4Y0YE 4BAHB 1EZUC 3F9EA 3STJA 1XVOA 4R8TB 1BTZA 1WBGB 2ESTE 4WVPE 3DA9B 2XBWA 2ZEBA 2P94A 2V6NA 1RXPA 1DITH 1MQ5A 3A7WA 3ZZ7A 3OX7U 5E0JA 1A61H 1IQJA 1C5MD 2ZDLA 3A8BA 3BTTE 1OWKA 3VB6A 2B9LA 1IOEA 2ANKH 1TWXB 3SNDA 3F6UH 1A0JA 1MAXA 1W3CA 1NFUA 2C90B 9LPRA 4CR9A 1MU6B 4KTUA 1BITA 5A2MH 3SU6A 4X6NA 2J9NA 1SGTA 1TNGA 1ZLRA 3RXLA 1S6FA 1V6DA 1EAUA 3QGNB 2QXJA 2BY6X 1TRNA 4K3JA 1C1SA 1YCPH 5F6MA 1MD8A 2OCVB 4Y6DA 3A80A 3TJOA 5GDSH 1V2RT 2W3IA 3HKJB 2CMYA 1LHCH 1O31A 1AWFH 2QYIA 1TOMH 4D7GA 5DP9A 4WMEA 1O2UA 1V2PT 2GCHG 1TYNA 2ZGCA 4NA9H 2FS8A 1SBWA 2CJIA 1OP0A 2XBYA 4FUIA 1AFQC 1G3EA 3M7TA 5A0BA 1O30A 1ZSKA 1FUJA 1AB9C 3PO1B 5DP3A 2R2MB 2Y5HA 4HFPB 1G3CA 1O39A 3FFGA 4UE7H 2ANMH 3U98H 4I7YH 4D9RA 4DVAU 1ZZZA 1DSTA 1SLUB 4IBLH 3AW1A 1SOZA 2ZFPH 2Z3EA 4WH8A 4UFGH 1GBKA 3SO3A 4OS7A 1DX5M 4JYUH 1O3NA 2OINA 5EOKA 1QIXB 1FNIA 4MPWA 4MPVA 1UVUH 1Y3UA 3ZVEA 1T8LA 3MU1A 1TMUH 4FUBA 4XSKU 1A5HA 3RXVA 1TIOA 2VWLA 5CHAB 1P01A 1V2UT 1GJDB 1MCVA 1O3FA 1O5FH 1MTUA 3EE0B 4ZAEA 1KXDA 4THNH 1W8BH 2FS9A 1LDTT 2FTLE 1V2ST 1FIWA 1QL8A 1UCYE 3M61U 1GI8B 1Q31A 3LJJA 4IMQA 1C2DA 4CRAA 5J4QA 2ZU4A 3GCTG 1GJ9B 3V0XA 3V12A 1MKXH 4Y71A 1TRMA 3BEIB 1AHTH 2BQ6B 2FOHA 1UO6A 3TIUA 1FAKH 5EPNA 2AMDA 1ZGIA 4ZXYH 3BF6H 3SN8A 1L4ZA 3MU0A 3SUEA 1GBIA 2PKAA 1HJ9A 4X1RU 1C5TA 1X7AC 1GBBA 1PPZA 2A31A 5F8ZA 2CHAC 1O2OA 1GVZA 4AFZA 1KSNA 1KXAA 1GG6B 2I6SA 1TX6A 1SLWB 1MBMA 5DP4A 4DIIH 1AUJA 4JYVH 4DCDA 1AZZA 5G4BA 3PYHA 3SU0A 3H7OA 4OS5A 4NWKA 1FXYA 1SGQE 3ZVBA 4X0WU 2H9EH 4GUXA 3BTWE 3RU4E 3DUXH 2HALA 1DWEH 3BG4C 4IN2A 2BQWB 4FVDA 1DLKB 4MPXA 3P8GA 1KTSB 4MNYA 4CHAB 5EG4A 5A8XA 1YCPK 5B6OA 1MKWH 1EAXA 3R0FA 4MNWA 3H5CB 2PTCE 1WSSH 3BG8A 1OWDA 4LXBH 3MYWA 2FP7B 5L2YH 3VB5A 4GVUA 4Z6AH 1LVMA 1GI2A 3U1JB 1DFPA 1MMJN 4WMDA 3M3TA 3I77A 1C1RA 4ZXXH 1QJ1B 3RXQA 3MFJA 4NCYA 4ZKNU 2TRMA 4F49A 1AKSA 5JB9S 1UHBB 3SGQE 5BPEA 1N8OB 2BLQA 3BEUA 4AG2A 3PMJA 2ZGXH 3Q76A 5JBAS 1HV7A 1O3PB 1G2LA 3UFAA 2ZHFH 3LU9B 1HAIH 1BBRH 2RCEA 3TGKE 1H8DH 1QRWA 3U8RH 2XXLA 2FOGA 4AORA 1IQEA 1ABJH 1S5SA 1ZJKA 2BVSH 3MHWU 1QBNA 4OS1A 3ATWA 1L4DA 3SV7A 5DGJA 2GV6A 1LKAA 5JBTA 3KQEA 3AAUA 4AYVB 7GCHG 1Y8TA 5LH8A 4MLFB 1Y5AT 3EA9A 2WPHS 3QLPH 4JZFH 4B74A 3SOSA 1LVOA 1C5ZB 2XCFA 1GI4A 2VIVA 3Q00A 5C5NA 1LHDH 1GI5A 3URCA 4GCHG 3UNRA 1QHRB 1O2XA 3FANA 2WUBA 4INLA 2EEKA 2GDEH 1ANBA 3SHAH 2GCTC 5DJ7A 3RC5A 1NS3A 2BVXH 3AASA 3K65B 1TGBA 4FUHA 4AG1A 4CH2B 1N6YA 2BZAA 1HUTH 2AGGX 1LQDB 5EXNA 2ZCKP 1T4UH 1AD8H 3RMOH 2PSYA 2FYQA 2OXSA 3U8TH 2GMTB 1ORFA 3GDVA 4XBCA 5FBEA 1TAWA 3SU2A 2RA0A 1KDQA 1ARCA 2EI8A 4FU9A 1A3EH 3BN9A 1PFXC 4FU8A 4JYTA 3MNXA 3E3TA 1DICA 5EW1H 1TPSA 1BRUP 2ZDAH 5TJXA 3ZVGA 2SGFE 4CRBA 1T7CA 1DY8A 1QA0A 1WYKA 3PMBB 1GVLA 1AE8H 2KAIA 4NIVA 3UOUA 4DIHH 1BQYA 2GDDA 4NZQA 3E8LA 1MU8B 1GBJA 2GCHF 2TBSA 1F0UA 3QTOH 2VIWA 1DUEA 2QC2A 3K9XB 3M35A 3OTJE 1C5RA 1D3PB 1Z1IA 2D26C 1GBCA 3TK9A 8GCHF 2Z94A 1EATA 1HAXB 1TPOA 1S82A 3UREA 1C5SA 5C67A 3P95A 3KGPA 5JPMH 5C2ZA 2QCYA 3ATIA 4KP0A 1CA0C 1C1MA 1LCYA 4ISOA 1P2MA 3LGYA 1WQSA 3TH4H 1A0HB 4CRGA 2O8MA 5HM2A 1VCWA 1DWCH 2VH0A 3OU0A 1EB2A 1W0YH 2ZECA 2FOAA 2AIPA 4X2YA 4INHA 4YLQH 3ZVFA 2Z6BD 1D4PB 4Q7ZA 5DP6A 2BZ6H 4BXSA 3BIUH 2TGPZ 4UEHH 1ZMJA 1O2IA 4NSYA 1XMNB 5F8TA 2FOMB 2A7JA 1GBLA 2BD7A 1OP2A 1NFXA 3U1IB 2XYAA 4Y8ZA 2A5AA 3TJNA 3GCTF 3TH3H 1ANCA 1C1VH 3FZDA 3ZZ9A 1W7GH 1O3KA 5FX6A 2VIOA 2PV9B 3BTKE 1JOUB 3A88A 2IN2A 1UTLM 1VZQH 3L6PA 3QWCH 3MU4A 3IG6B 4X8UH 4BTTB 5K0HA 1PJPA 2ANWA 4AB8A 2P3TB 1VITF 2QXGA 2PHBA 2OC7A 3M5LA 3LGUA 1P2NA 2DE9A 5E8EH 4ZKRU 2C93B 3SI4H 1AI8H 4YTAA 1QL7A 2JETB 3S7HB 1Y3WA 2HOBA 4HI3A 2VIQA 5F03A 2H6MA 4YO9A 1FV9A 1L1JA 5EPYA 2XC5A 1P9SA 1KLJH 1AFEH 1OS8A 1GI9B 2XNIA 3U9AH 2QIQA 2VVUA 2FOFA 4NGAH 1C5PA 3VXEH 1O2MA 3K6ZA 1DOJA 1FJSA 3M5NA 1S84A 1PPGE 3TITA 3FZZA 1GMCF 3SNEA 3BTME 2B5TB 1L1NA 4UFFH 5L6NH 1P09A 2ULLA 1DVAH 1CU1A 1BBRE 1C1WH 4KGAA 1UTJA 1XXFA 3RXJA 3LPRA 2ZA5A 4K1EA 1UCYH 2ASUB 1GHZA 3QUMP 4MDSA 1FQ3A 2W7UA 4X2WA 2BY9X 1Z6JH 2VINA 2C8WB 1NM6A 1SGFG 2GKVE 2V3HH 1G36A 2BVRH 4A6LA 3KHVA 1GHYH 5J4SA 1EXFA 1DT2A 1VCQA 2XCNA 1C1UH 4CR5A 3QN7A 2BD3A 2GTBA 2VVCA </