1CHGA

Chymotrypsinogen,2.5 angstroms crystal structure, comparison with alpha-chymotrypsin,and implications for zymogen activation
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
245
structure length
226
Chain Sequence
CGVPAIQPVLSGLSRIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGVTTSDVVVAGEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSAVCLPSASDDFAAGTTCVTTGWGRLQQASLPLLSNTNCKKYWGTKIKDAMICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQTLAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase zymogen (serine proteinase)
molecule keywords CHYMOTRYPSINOGEN A
publication title Chymotrypsinogen: 2.5-angstrom crystal structure, comparison with alpha-chymotrypsin, and implications for zymogen activation.
pubmed doi rcsb
source organism Bos taurus
total genus 40
structure length 226
sequence length 245
ec nomenclature ec 3.4.21.1: Chymotrypsin.
pdb deposition date 1975-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1chgA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1chgA01
5EPNA 5C20A 1ZGIA 4AFQA 1OWEA 3ELAH 4Y0ZE 3SNEA 3H7TA 3I29A 2ZCHP 2ANMH 1F0UA 4X6NA 2GTBA 4ZKOU 3VGCB 4SGBE 1L4ZA 2FI4E 1RIWB 1YPHC 3GYMA 4FUJA 5FHTA 1W8BH 1DT2A 2BD7A 5GJ4B 1GDUA 3D23A 3VB3A 2FMJA 2FOEA 3UFAA 1SGPE 1AVXA 2WYGA 4KTCA 5JPMH 1T8NA 5C1UA 1D6RA 1FDPA 2CMYA 1O37A 1RXPA 3GCHB 1O3JA 1QHRB 1J14A 1TPPA 1SC8U 3VXFH 2OQUA 3STIA 1L1JA 4AB8A 3MNSA 4UEHH 5JDUB 1F5KU 1C5ZB 1MCVA 4WMDA 1GI7B 5DG6A 4BOHA 3BV9B 1DPOA 3PMBB 1BTUA 2XCNA 3P8OA 3SUDA 3KIDU 1SGIB 1H4WA 1MD8A 2BDIA 1ZTKA 4JCNA 1KXBA 2GGVB 4TWWA 1LPZB 2PKSC 2ZGBH 3A83A 4YT7H 2NU3E 3GCOA 2CJIA 3SBKA 1UTNA 4MPXA 3SGAE 3TLOA 1LHDH 1TBZH 2ZFFH 3MU5A 1YKTA 3LKWA 5DK1A 2Y81A 1ANCA 4SGAE 3RMOH 3RP2A 1G2MA 1O3HA 1S85A 2F9OA 1O3NA 3Q77A 4I32A 1OKXA 1T32A 1G36A 3ODDA 4Y8YA 1XUGA 2F9NA 4JZFH 1FN8A 4ZMAH 3RU4D 2HNTC 3E0PB 3TK6A 3BG4B 3VB6A 3M5MA 3OU0A 4YLQH 2BDHA 2F9PA 4AX9H 1KXAA 5H4IB 3E0NB 1DITH 4JZIA 2JKHA 2BDAA 1AVGH 1G3CA 3EE0B 3RDZA 5E8EH 4ZAEA 1QGFA 4O3UA 4D8NA 5FX6A 1A46H 2WINI 2OP9A 3SV8A 1EAWA 2ZHDA 1Y3XA 5LPRA 1NY22 4X8VH 2ZU4A 1CE5A 1MU6B 3Q76A 1Z8GA 3ZVCA 3TK5A 4ABEA 1WCZA 3FZDA 2FOFA 1T7CA 1O3EA 3RUOA 2W7SA 1CU1A 2A1DB 4NGAH 1NESE 1C2JA 3F9EA 1GG6B 3DFJA 2FI3E 2R3YA 1QBNA 5TJXA 2BY7X 3EDXB 3PTBA 1UK4A 2ZU2A 1BQYA 1XMNB 3UIRA 2FOAA 4X1NU 4ZHMU 4A1VA 1RJXB 3GOVB 4MPVA 1V2UT 1C1RA 1ZGVA 4Y8XA 3CP7A 3NWUA 2SGPE 4CBNA 2VU8E 2STBE 1TFXA 1WU1A 4JK5A 3FP6E 3ATIA 1EUFA 4KELA 3W95A 1G37A 2WUCA 1UTQA 1XUIA 5I25A 1BJUA 2P59A 2SGEE 1K9OE 3SJIA 1C5UA 3PB1E 1UVUH 3P17H 1UTPA 1QQUA 3M7UA 3RXSA 3M35A 3HK6B 1FNIA 3VEQB 5DP9A 1GDNA 4FVBA 3S0NA 1TNJA 2P3FH 3ZZ7A 2OBQA 4CRBA 4DCDA 5JBTA 1VGCC 3UR6A 1P9UA 3A84A 2PGQB 5DP3A 2ZCLP 5EQRA 3BTQE 1GMDG 1AB9C 4FU8A 2WYJA 5FPSA 4K1TA 4FUIA 1ZPBA 2A32A 4FUEA 4DVAU 5HM9A 2ZPSA 1TAWA 1LKAA 1V2KT 3JZ2B 5ESTE 3UOUA 4WF8A 1TRYA 2VIQA 2R3UA 4BXSA 4INHA 1KXFA 3A89A 2ZGXH 2QIQA 1P01A 1LHCH 3QN7A 1ZHMA 2ZKSA 2JETC 2A31A 1HBTH 3BEUA 3MFJA 2FODA 1CSOE 3HK3B 1TNKA 4BNRA 2ZU1A 4D9QA 4H6SB 1O3FA 4AFUA 1J8AA 1HAVA 1H1BA 2PR3A 2A4OA 5EW2H 4XSKU 4AZ2B 2FYRA 1TBQH 2BDYA 3UPEA 4Y7AA 4R8TB 1ZHRA 4DY7B 1YF4A 1DWEH 4FU7A 1TGNA 1T4UH 4AGKA 3FP8E 4CH8B 2R0LA 4ZKRU 1HIAA 4X1SU 3A85A 4K8BA 4K60A 1KXCA 1C2DA 3AASA 1D3QB 3ZZ6A 4H4FA 1ELGA 1TNIA 2G81E 3SN8A 4Q7YA 5C67A 2ZGCA 1GBEA 5GCHF 1T8MA 1CT2E 5GIBA 2PKAB 1GMCG 1EAXA 4BAQB 5K7RA 1Z1IA 1HAGE 1QIXB 3LONA 1GJ4H 4X8SH 4GCHG 2A7JA 4ABDA 4AB9A 2XWBI 1ESAA 1ETSH 1BOQA 3M3VA 1GWAA 2QXGA 2NU1E 1QQ4A 1GBFA 1GHAG 5E2PA 4DT7B 3KQBA 2CHAB 4BAOB 2VINA 2ZIQH 1NO9H 1AFQB 1SGDE 4CHAC 2HWLB 1TA2A 5J4SA 1HPGA 3M3TA 1Y3WA 2P16A 1O33A 3V7TA 4CRAA 2ILNA 1PYTD 4B2AA 1YCPM 4MDSA 1GHBF 3RXFA 1V2PT 2PSYA 4MQAA 4CR9A 1TQ7B 2XC4A 4NA8A 3A8DA 1Z6JH 1QB1A 1XKBC 2BD5A 2Z3DA 3K9XB 1C2LA 1K1MA 2OC0A 3RXIA 3T25A 1HGTH 1LKBA 3SUEA 4DOQA 3U8TH 2BY9X 1UTLM 2FLRH 1P57B 1QL7A 1SBWA 1CGIE 4GPGA 1P2QA 1C2KA 2C8YB 2HNTF 3O8RA 4HZHA 5T3HA 1V2WT 3ZZBA 1EJMA 3HGPA 3UOPA 5E0JA 2P8OB 2QAAA 1E37B 1EZXC 3GICB 2FS8A 5BRRE 4IMQA 2YNAA 2XC5A 3MH4A 3CS0A 5J4QA 2GX4A 1LVBA 1RTLA 3ZVGA 4K3JA 5ABWA 1LO6A 4GCHF 2AIQA 3UNSA 2VWNA 1DUEA 1EASA 1TMUH 5DP4A 1HJ8A 2XBVA 2VVUA 1C4Y2 2A2XH 5CHAB 1Z7KA 1F2SE 1C1TA 1FN6A 1FY1A 1M9UA 3TPIZ 3SGQE 1MBMA 1P2OA 1Y3UA 1MQ5A 3B23B 3PLPA 3BTTE 3TJUA 1NPMA 5A8YA 2GZ8A 1U6QA 1W0ZU 1TNLA 1GJAB 1VR1H 3NK8A 1O3OA 3NCLA 2Y7ZA 3QZRA 1D3DB 3STJA 1ELVA 4ZKSU 2OD3B 2O8TA 1MCTA 1FJSA 1GPZA 4BTUB 4MPWA 2CV3A 1XVOA 1OP0A 1MTWA 1AZZA 2G4UA 2PV9B 1UCYK 2WPMS 1ZZZA 1GDQA 4YLUA 1HV7A 2TBSA 3TJOA 2WPIS 2AYWA 1ESBA 1O39A 4Y76A 1ZSLA 3O8DA 2PLXA 2VVVA 2A4GA 4YOJA 1LVYA 1C4V2 1BJVA 3HGNA 2UWPA 3B8JA 4IMZA 3T5FH 2XCFA 1C5TA 4CRCA 2VVCA 2ODYB 1UK2A 2QGRA 4XE4A 3ZZ4A 1AUJA 4MVNA 3ZYEA 1C5SA 1MTNC 2Z9JA 1ZLRA 1UVSH 4Y71A 4ISLA 1CHOF 1GGDB 1LPGB 1ZRBA 4KTUA 3RC4A 3AVZA 1BMMH 2A4QA 4YM9A 3OY6U 2ZDLA 4U30A 1OS8A 2FXRA 3MTYA 3SNBA 1P03A 1IQHA 1HJAB 4JYVH 3AW1A 2ZNKH 1Y5UT 5HGGA 1AGJA 5IYTA 4UFDH 3TU7H 2H9TH 3RXPA 1K1IA 4X8UH 1O32A 3SJOA 1ZSJA 3RXKA 1THPB 1Q3XA 1BTXA 3BEIB 1IAUA 4A1TA 1AKSB 2XBXA 1H9HE 1TGBA 1GI5A 1G9IE 1CT4E 3KQEA 1SQAA 3F9GA 1BBRE 5BPEA 2BD9A 2Z7FE 3TGJE 4Q7XA 4LZ1H 5T6GA 3VB4A 5HXFA 2BMGB 4X6OA 4NSYA 1CO7E 5AF9H 1TX6A 1IQKA 1SLVB 1HAPH 1N1LA 1FPHH 4ESTE 5FX5A 4NIVA 2IOTA 3KF2A 1BTYA 2A7HA 2FX6A 3ZVEA 3GCNA 1TIOA 2UUKB 4MNXA 2KAIA 2ULLA 3K65B 1AI8H 1TGCA 1EAIA 1NRRH 1OWDA 5FBEA 2HPQH 3BTKE 1C1MA 1GBCA 2GCHG 5A0CA 3URDA 2AMPA 1IQNA 1SGTA 4CR5A 1HB0B 2FEQH 5FPTA 3E90B 2BY8X 5C5OA 1QJ7B 1LVOA 4X6MA 3NUMA 1EJAA 1O5CB 3A8CA 3S9CA 3ZZAA 2F9BH 2ZFSA 3BTME 1SGYE 4X2WA 2RCEA 1QL9A 2HRVA 3KL6A 1UVTH 1YP9A 5HM2A 2Z94A 3O8CA 1UHBB 1GBKA 3Q00A 2GVFA 3A7YA 1F7ZA 2QC2A 1BTWA 4AFZA 1E35B 1MU8B 4UDWH 1HAIH 1O2WA 2FOHA 1GL1A 3SHAH 3F9HA 5DP8A 2AS9A 1FIZA 3PO1B 1GJCB 4A7IB 1C9PA 2UUFB 4U01A 1YPHE 1XM1A 1ELAA 5F8XA 3UTUH 2XNIA 3GDUA 3NPSA 4INLA 1HAOH 1AUTC 1XXFA 1N8OC 2BY5X 2I6QA 1BDAA 1BB0B 5DGJA 4E06H 1F0RA 3A82A 4ABIA 1V2NT 1O2IA 1BZXE 2BVSH 2GCHF 1YBWA 2BY6X 2ZHEH 2Y5FA 2OLGA 4E7NA 3TH2H 2OCVB 4B74A 1V2OT 2ANWA 1DM4B 4BAMB 4VGCB 4HI3A 2C8XB 1MKWH 1GJ8B 1L4DA 1S83A 1NFYA 1FXYA 1ANDA 1FLEE 2BM2A 5C1YA 1FONA 4YOGA 1O3PB 5DP6A 2CGAA 3GY5A 3GY6A 1FMGA 3RXTA 5GDSH 3SU2A 2VIWA 4WY3A 1V2MT 1C1UH 2ZFPH 1JXPA 1H9LB 1GHZA 1NROH 4B2CA 1K22H 2PUXB 2A4RA 2BLWA 3EA8A 7ESTE 1WAYB 1Y3VA 6CHAC 2ZDMA 1C2HA 1MD7A 1SOTA 4MNVA 2HNTE 3ZVFA 4FUHA 1ETRH 3HKJB 1FAKH 4NFFA 1HXEH 3SUFA 4K8YA 1Y59T 2C90B 2HALA 2TGAA 2ZQ1A 1GCTC 3UQOA 4K1EA 1O35A 1XUFA 1C4U2 1FPCH 1OP8A 3SOSA 5B6OA 5EW1H 1TB6H 4OS5A 1MTVA 1J17T 2TGTA 5ETXA 2ZHQH 3RXLA 1DWDH 1W14U 2JH0D 1ZMLA 3UREA 2G8TA 1QJ1B 1LHGH 5JBAS 4BTIB 5E0GA 4I8GA 3RM0H 3V3MA 1JRTA 1VJ9U 4GSOA 4FUFA 1QA0A 2AFQB 4MTBA 1YCPH 3QZQA 3SZNA 4CBOA 1C1SA 1EB1H 3P8FA 1O2UA 2H6MA 3JZ1B 1TPAE 5DPAA 3KGPA 2XTTB 1KDQA 3E91A 3OTJE 4NWLA 1YC0A 1ZYOA 3URCA 1O3IA 4BANB 1KTTB 1HNEE 3FFGA 1Q31A 3BSQA 4IN1A 1A5IA 1BHXF 3GYLB 1C1QA 2WV4A 2ZU3A 1HJ9A 3D49H 4O3TA 1IQEA 1N6XA 1ABJH 3E3TA 1HXFH 1MZDA 4FXGH 9LPRA 4IN2A 4NIYA 3P70B 1CA0B 1VITG 4X2VA 3BN9A 4JYTA 2XBWA 3A80A 4FU9A 3MH5A 1AE5A 3MH6A 4GLYA 2ZP0H 1P05A 1DOJA 1W13U 3KQDA 3BF6H 2GKVE 1A1RA 3ZZDA 2GMTB 2J2UA 1AE8H 1T8OA 3RXVA 1EPTB 1E0FD 1QBOA 3PTNA 5TCCA 4OGYA 3EQ0H 5JB8S 4I8JA 4AG1A 1O2RA 2AGIX 1WQVH 1RRKA 3NKKA 1ZPCA 2ANKH 3R0FA 1KTSB 2ESTE 1T31A 2BQ7B 2VWOA 5JBBS 1IHSH 2B5TB 1TMBH 1T4VH 2XW9A 1HYLA 1HIAB 2ZFQH 2G51A 1S82A 4E7RG 2YNBA 4X1RU 2GT7A 1TX8A 3ZVBA 1P06A 1A4WH 1EATA 2G5VA 4TY7A 2STAE 2SGDE 2ZCKP 1S6HA 1MUEB 2ZC9H 2V6NA 1C1OA 1ETTH 1EJNA 1V2VT 3L3TA 3LPRA 2FLBH 2GCTC 3C27B 2BXUH 2YOLA 4LZ4B 4ABAA 2XXLA 4R0IA 1CBWB 1GBDA 2VGCC 1P11E 1MQ6A 1TGTA 2B0FA 1Y3YA 1GBIA 1W10U 4UD9H 2DE9A 3U8RH 3UQVA 5C5NA 1NRSH 3FP7E 1C1PA 2FESH 2GT8A 5PTPA 4RN6A 1ESTA 1UJ1A 1H9IE 1NTPA 1O3DA 3R3GB 3ZYDA 3SNCA 3TH4H 4I8HA 2VIVA 3ZV9A 4BAKB 2UWOA 1TPSA 4BXWA 2VWMA 1LQDB 3ITIA 1DICA 3SQHE 3SI4H 3L6PA 1QNJA 3A7XA 5F03A 1PQAA 1F0TA 2HGTH 3LJJA 3LGYA 3M5NA 2Q6DA 1V2LT 1SHYA 3VXEH 4Q7ZA 1T8LA 2PWXA 1TNHA 3VGCC 1GVKB 1O0DH 1ELBA 1Z1JA 3OSYA 1YPJH 5DJ7A 1SOZA 4DIHH 2ZF0H 3TVJB 4NZLA 9ESTA 3KEEA 1OWIA 3QGJA 3GCHC 1QR3E 2B8OH 2K1QA 3BTFE 3LGUA 3SW2B 1SGFG 4GUXA 3LT3A 1V2JT 1GMDF 1O2GH 1O2LA 1LPKB 1A5HA 4BAHB 2Z9LA 2OTVA 3FZZA 3ENSB 3NZIA 1SGRE 1DLKB 3E6PH 1W12U 2QXIA 8KME2 2CF8H 1MZAA 1DE7H 3PMAB 4LK4A 2JH6D 5DO4H 1K1PA 1C1WH 3FANA 1OPHB 3HATH 1UMAH 7GCHG 3PROA 1NZQH 3LU9B 1S81A 2W5EA 2FIRH 3EA9A 1DY8A 3MO3A 4KKDA 5EODA 4BTTB 1MTSA 2F9VA 2SFAA 4AOQA 2R2MB 1JIRA 2J38A 3F9FA 4TYDA 2BD4A 2Q1JA 3QDZB 4MLFB 2G5NA 3BG4C 5A09A 2A5IA 2A0QB 3UWJH 2BDGA 1GL0E 1L1NA 2OC8A 3DD2H 3NXPA 3U1JB 1SGEE 2BZ6H 3SJ9A 1PQ5A 1GBMA 4HTCH 3QGNB 3GY8A 4Y7BA 3RXOA 2Z6BD 1ZPZA 1IQMA 1GMCF 1GHVH 4FUDA 4JMYA 1C2MA 1O2YA 1K1OA 1SGCA 1NRQH 3D65E 1W2KH 4Y10E 2G00A 1GJ5H 1GHAF 1C5MD 1TBRH 4NG9H 4AYYB 1AFEH 2ZTYA 3VPKA 4B2BA 2TGPZ 4J1YA 1LHFH 5JBCS 2FDAA 4LOYH 2GV6A 2PFEA 3SU3A 3GY4A 1ABIH 7GCHF 1GG6C 4QT8C 2PTCE 2AH4X 2THFB 1P12E 1AN1E 2FWWA 1UK3A 5E2OA 1W11U 3VB5A 3TGIE 4NIWA 1OYTH 4AN7A 1ARCA 3GDSA 3LH3A 3M3SA 1ORFA 3SO3A 3GISB 4K5ZA 3AW0A 3RXJA 2H5DA 3RMLH 2ZDNA 7KMEH 2QY0B 5L6NH 2BB4A 2FM2A 4B76A 1ZTLA 4RSPA 1P09A 1GI4A 3A81A 3AAVA 4NFEA 4Y8ZA 1D3PB 2UUYA 2VH6A 3RM2H 2H2ZA 4JZEH 4X8TH 3SJ8A 3MOCA 2Q6GA 1TYNA 1GI2A 1P10A 2BX3A 1ZMJA 2ZG0H 1PQ7A 3Q3YA 1GI6A 5CE1A 1JBUH 3PWCA 1WSSH 1JOUB 3LH1A 1JIMA 4GVUA 1YPGH 1C2EA 3DUXH 2SGQE 4D7GA 4WWYA 1DY9A 3M7QA 1EKBB 4X0WU 4INKA 1SQOA 1C2FA 3MU1A 1LQEA 1E36B 2KAIB 1KLIH 5AFZH 1SHHB 1C5NH 2SGAA 5LPEA 1BBRH 3MU0A 1D6WA 1HDTH 3RXEA 1W0YH 6GCHG 1IQFA 3F1SB 2BVRH 4NZQA 2ALVA 1OWJA 1G32B 1Q2WA 2EI8A 2EA3A 3RXQA 1QRWA 1HAYB 4X1PU 2TIOA 4X2XA 1CHGA 2PKSB 4B1TA 1V2ST 3SU0A 1K1JA 4ZUHA 4AGJA 3GY7A 2PUQH 1C9TA 1HAXB 1SGQE 8LPRA 3PM3A 1MAXA 3RXCA 5A8ZA 2Z9GA 1GMHG 2F9UA 2BTCE 2EC9H 1A0JA 2H9EH 4I8KA 3RXDA 1EOLA 5LPFA 1IOEA 3RMNH 1UTJA 1O5GH 1O30A 1ELFA 4DIIH 4WMEA 2FOCA 4ZH8A 5FPYA 1NM6A 4NA9H 1L0ZA 2I6SA 2QF0A 3DT0H 1BA8B 2WPLS 4U32A 5AFYH 1EOJA 1YGCH 1P0SH 1LMWB 1GJ6A 1SFQB 2AMDA 2Y5HA 4TWYA 3TIUA 2BOKA 2B7DH 4OGXA 2RDLA 2OUAA 4WH8A 4Y6DA 3F6UH 1LVMA 1TMTH 4RKOB 2FOMB 1PPGE 1B0FA 1FZZA 3MO6A 4CH2B 1BTPA 3QTOH 6GCHF 2PHBA 2CHAC 1CVWH 3OX7U 5LGOA 1F5LA 2HVXA 1TX7A 1AFQC 1G30B 3UWIA 4JK6A 1K2I1 3ODFA 5AHGH 1C5RA 2ASUB 1ARBA 1WTHD 5FBIA 4UFEH 3BG8A 2C3SA 2PTNA 2F83A 7LPRA 1UO6A 1YPKH 1C1VH 1MBQA 2ALPA 4B71A 2Y5GA 3ATMA 1AY6H 4E05H 1W7XH 1SSXA 3L33A 3HKIB 4CREA 1AU8A 2HLCA 1DXWA 2DUCA 1AWHB 6LPRA 1JRSA 1AQ7A 1YPEH 2W3KA 3U69H 2QXHA 5L2YH 1G2LA 1AD8H 1ID5H 1O3GA 1F0SA 1CGJE 3SHCH 5A0BA 1HCGA 1B5GH 1NRPH 3LC5A 3V12A 2P8OC 3CS7A 1QJ6B 1ZJDA 4IC6A 4UONA 3ATWA 2ANYA 1OWHA 3T29A 4WVPE 5LH8A 1MKXH 2OXSA 1O2SA 2ZFTA 1IHTH 1TPOA 2BX4A 1AO5A 1NU9A 1YYY1 2TGDA 1OXGA 5F6MA 1EZUC 1A0HB 5ESBA 3M36A 1SG8B 3RC5A 1OX1A 4DJZB 1SQTA 2QF3A 1L1GA 1O34A 1SGFA 1C5XB 1THRH 4TPYA 5CHAC 3KNXA 2ZQ2A 1O2QA 1VGCB 1AKSA 1TOMH 3O8BA 3P6ZB 3F68H 5F8TA 2XYAA 1AB9B 2V3HH 1G3DA 2FX4A 1FAXA 4X1QU 4FUGA 1DXPA 4NWKA 1PPHE 1JWTA 1P8VC 2V35A 4LXBH 3RC6A 3MNXA 1LCYA 2VB0A 2A45B 1PPEE 1VCQA 3PMHB 2V0BA 1BMNH 1KDQB 1MMJN 1SLWB 1H8IH 3RMMH 2JETB 3N7OA 1WBGB 1PPFE 2AIPA 1FUJA 1YPLH 1BT7A 3HPTB 2J9NA 2Q6FA 3MU4A 3Q3XA 2XRCA 1HRTH 1Z8IB 2NU2E 3MMGA 1CT0E 5T6FA 1C2IA 2P95A 1MKWK 2W7UA 3LDXH 1F92A 3UNRA 4FUBA 1A61H 1O3LA 1GI0A 2RG3A 3SJKA 3OY5U 1PJPA 1Z6EA 4I33A 3LC3A 2ZDKA 2ZA5A 1F5RA 1ANBA 4AYVB 3T26A 5GXPA 5JB9S 3LGVA 3M37A 4Z0KA 3TNSA 1O5AB 1DUAA 3MI4A 1TA6A 2Y7XA 2WPKS 1GBLA 2BZAA 3S9AA 2ZO3H 1FY5A 5EPYA 4X2YA 2BD2A 2BHGA 1V3XA 1UHBA 3RU4E 3BIUH 5A2MH 2BYAX 1LDTT 1WV7H 1DX5M 4ZHAA 3S9BA 1NU7B 2ZPRA 4Y79A 1GJBB 2HOBA 1INCA 3S69A 5T6DA 2UWLA 2LNCA 1GGDC 1YPMH 2O8LA 1GVZA 2ZTZA 5C1XA 2ZDAH 3M61U 5EOKA 1BIOA 2ZI2H 3IITA 4CRGA 1S84A 3U9AH 4YOIA 4XOJA 1SI5H 1BUIA 3LIWA 4ISHH 3P95A 1BITA 2ZPQA 2LPRA 2FPZA 3I77A 4CHAB 1HJAC 2O8UA 2BVXH 1P3CA 3AAUA 1K28D 2O9QA 1GCDA 1P2JA 1O3KA 3S7KB 2OQ5A 2ZEBA 1YCPK 5K0HA 1FY4A 1G3EA 1S0QA 1XUKA 1GVLA 1TWXB 1O2NA 1CGHA 3ZZ9A 3A8BA 3SU5A 4PROA 5A8XA 2BXTH 3MYWA 1OOKB 1O2KA 2GP9B 3SU1A 2C93B 4CRFA 1TNGA 1KLTA 1YLCA 2J95A 1EP6A 2Y82A 3ATLA 2H5CA 3LGTA 1C5PA 4ISNA 2VIOA 1P2KA 4TY6A 3M5LA 3MWIU 1PPBH 3MU8A 4FVDA 3RU4T 1QA7A 1BCUH 1SVPA 1WUNH 3SI3H 1NRNH 3SQEE 1ZRKA 2VH0A 3T62A 4WJG2 4OS6A 2ZGJA 1GHXH 4UFFH 1HAVB 1YLDA 4UFGH 2FTMA 1XKAC 2Z3EA 4HGCA 3TJNA 2W26A 1SMFE 3BTGE 1J9CH 1P04A 1WQSA 3KHVA 4YT6H 1GBHA 1FV9A 2J34A 2VIDA 1NC6A 1DWBH 1O5FH 1C5WB 1Y5BT 3KCGH 1DWCH 2QA9E 1KXEA 2PGBB 5C2ZA 1KY9A 2ODQA 4A92A 3QK1A 2C8WB 3SNAA 2G4TA 3QUMP 2H9HA 4WXIA 3S7HB 3ZVDA 3SGBE 1O2TA 3PLBA 4TPIZ 1O3MA 1VJAU 4OS4A 1E34B 1SR5C 1VITF 1ELDE 3FAOA 3PO1C 2J4IA 3A7TA 4NIXA 5E0HA 1ZMNA 2FS9A 4IGDA 2BDBA 1FQ3A 4NSVA 4AG2A 4AORA 2OC7A 1TALA 1V2RT 1YM0A 1A3BH 1MAYA 4OS2A 1GJDB 1FY8E 2D1JA 2FI5E 2VIPA 2FOBA 5EG4A 3RXBA 1TE0A 3IWMA 3RLYH 4H6TA 4F49A 4ABFA 1V2QT 1RS0A 5GCHG 2D2DA 2BLOA 4DURA 1UTMA 2NU4E 5GPIB 3GY2A 2F3CE 4I7YH 2ZTXA 1QRZA 4U2WA 2O8MA 1EXFA 4Y0YE 2GDDA 1DVAH 3QWCH 4VGCC 5F8ZA 3PV4A 3SV9A 1ELTA 1MTNB 2JH5D 4KGAA 2C4FH 1GI9B 1GJ7B 1ZJKA 4DW2U 4OS1A 1K1LA 5IDKA 3CENA 1WYKA 3P8GA 1B7XB 1EPTA 2WV5A 1RIWC 2GZ9A 4Z6AH 5C3NA 1GHBG 1BMAA 1OSSA 3QTVH 2BQ6B 3UUZA 3BTWE 2A2QH 1SLXB 3SV6A 2ZHFH 1SB1H 3TJVA 1O2MA 1C5LH 1QTFA 3RLWH 3TH3H 1Z71A 3RXMA 2IJOB 1P2IA 1BHXB 1VCPA 2BOHB 2O8WA 2BD3A 2P93A 1VCWA 2PW8H 1KXDA 3SV2H 4HFPB 2G52A 5GWZA 1O2JA 4IW4E 2CXVA 1IQGA 4A5TS 3FVFB 1DANH 4ASHA 3SU4A 4O9VA 3H7OA 1P3EA 2CF9H 1QB6A 1KLJH 2AEIH 2IN2A 1NN6A 1GI1A 1EZSC 1Z8JB 3ESTA 4JYUH 1A0LA 1TGSZ 3K6YA 1HAHH 3RXHA 1DSUA 1RGQA 1TRMA 3H5CB 4ISIH 3UR9A 1TQ0B 2BD8A 2EI7A 2A7CA 2NWNA 4RKJB 4ABHA 1XXDA 4YESB 4DGJA 5DP7A 3PYHA 5DP5A 3VB7A 2G55A 1PYTC 2D26C 3EYDA 2B9LA 1QFKH 3GCTG 2AMQA 3U1IB 3E1XB 3ZV8A 3I78A 4I8LA 4Q2KA 4XBBA 2QCYA 1BTHH 4IC5A 3ZZ8A 1DSTA 1XVMA 1H8DH 1LTOA 1C5QA 1OWKA 1A3EH 1QL8A 4XBDA 1ANEA 3PWBA 1RD3B 3EA7A 2GD4B 1ACBE 2DE8A 2RA3A 1O31A 1NT1A 3SORA 1CA0C 4F4OC 4K2YA 3DFLA 4GAWA 8ESTE 4MNYA 1O2PA 2FOGA 1AHTH 4X6PA 4UE7H 1C1NA 4D9RA 4THNH 1P2MA 1GHYH 1SLUB 2GMTC 3M7TA 4ZXXH 1ZR0A 4YZUA 1EPTC 5EXNA 3SU6A 1FI8A 3GDVA 1GI3A 3C1KA 2WUBA 1SL3A 2PKAA 1TONA 2H1UA 1RTFB 2FTLE 1ZHPA 2WPHS 1N8OB 4YTAA 1O2ZA 3T2NA 3A88A 4MG3A 1A7SA 1ZSKA 1THSH 2UUJB 3RXUA 1D3TB 4H42U 5EXMA 1SFIA 1IQIA 2XBYA 3GCTF 1WOFA 1EAUA 4MPUA 1HFDA 1CHOG 1UCYH 3ZZCA 1AMHA 3DA9B 4K69A 4I31A 3T27A 1BRUP 1EP5A 1CA8B 1W3CA 2EI6A 3ATKA 1GBBA 8GCHG 1ZTJA 2A5KA 1C5YB 4ABBA 1OYQA 1C5VA 1N6YA 1P02A 2C8ZB 3BTEE 1CBWC 1CQQA 1UVPA 3MNBA 2TRMA 2Z3CA 2ZGHA 5EGMA 3V13A 1MH0A 2P3UB 3G01A 5TCAA 2R0KA 1O3AA 2ZDVH 1BTZA 1FIWA 4ZROA 1O5EH 1NFXA 2QV1A 4YO9A 2PSXA 3QLPH 2Y80A 1IQLA 2GDEH 3OYPA 3Q3KA 6CHAB 1S5SA 2OC1A 1TABE 1JMOH 1RFNA 3A7WA 2XC0A 1KIGH 2D8WA 4NA7A 4Q80A 1UTKA 2AGEX 2BLVA 1UTOA 1EQ9A 2OINA 2HPPH 2ZZUH 1UCYE 1GCTB 1SGNE 2A5AA 2IPHA 2F91A 3EGKH 3V0XA 4B73A 2NU0E 2ZU5A 4O03A 4GHTA 2TPIZ 3ZZ5A 1GBAA 1GBTA 3P92A 1BBRK 1O36A 5EQQA 2Z9IA 2QXJA 4K1SA 1QURH 4XFQA 3RXAA 5JYIA 1VITH 1A5GH 4ABJA 3B9FH 1O5BB 2P94A 1GBJA 3KQCA 1MTUA 1PPCE 5L30H 1Y8TA 1HLTH 5I46H 4NCYA 1D9IA 3E16B 1QCPA 5HYOA 1BRCE 1AZ8A 2W3IA 2VJ1A 2QYIA 4A6LA 1O2XA 2R2WU 2AERH 5CMXH 1GHWH 2VWLA 1DFPA 8GCHF 2CN0H 2R9PA 3EAJA 1BMLA 2XWAA 5G4BA 1AVWA 1X7AC 2GV7A 4XBCA 1EX3A 3LGWA 1K21H 1L2EA 4IBLH 3BTDE 4WMFA 5A0AE 1QB9A 2BLQA 1SPJA 3QO6A 1LHEH 3U8OH 1QRXA 1EB2A 3LOXA 1B0EA 3UY9A 3SNDA 2SGFE 3LGIA 5AVDA 1AWFH 3QX5H 1NS3A 3D62A 3KN2A 2J94A 1Z8RA 2WPJS 1FY3A 4ZKNU 1V6DA 1HUTH 3UNQA 3PMJA 1EZQA 3W94A 3P8NA 3BEFB 3BIVH 3T28A 4AFSA 3E8LA 1BRAA 3DHKH 1VZQH 4OS7A 3K2UA 3TITA 4WXVA 1GI8B 4KTSA 4ZXYH 5FXLA 1AIXH 3IG6B 1E38B 3WY8A 2ODPA 2QN5T 3TK9A 3VFEA 1ELEE 6ESTA 1GMHF 2ZWLH 1S0RA 3MO9A 1W7GH 2J92A 3M5OA 1QY6A 2V3OH 2FO9A 4A1XA 1ZOMA 1K1NA 3MHWU 5FCKA 2BDCA 1QBVH 1TOCB 1RTKA 3A7VA 3U98H 1TLDA 1ELCA 2ZHWH 4MNWA 1NFUA 2OBOA 4M7GA 4DG4A 2AGGX 2ZECA 1KYNA 1XX9A 1XUJA 1C2GA 4IS5A 2BQWB 3PLKA 2Z9KA 1DDJA 1PFXC 3TGKE 2M5TA 1PQ8A 2ZFRH 1O2HA 1O3BA 3ZZ3A 1NFWA 1S6FA 3GY3A 4J2YB 2SNVA 3TNTA 1WTGH 5HMAA 4FUCA 5FAHA 1TRNA 2GCTB 1MKXK 2VNTA 1GJ9B 1D4PB 1XUHA 1OP2A 2VGCB 3A86A 4D7FA 1IQJA 2FZZA 3A87A 5EU8A 3A7ZA 4ZHLU 1P9SA 2P3TB 5L2ZH 3RXRA 5EXLA 1DLEA 1O5DH 3LJOA 1O2OA 4ISOA 3MH7A 1C5OH 1KSNA 3SUGA 3BTHE 1V2TT 2FP7B 2SNWA 4JZDH 3A8AA 4Y11E 1O3CA 1O2VA 1J15A 3RXGA 1HAZB 1BRBE 1G3BA 2EEKA 4KP0A 1UVOA 3MNCA 4JZ1A 2GZ7A 4WH6A 3ZVAA 1J16A 4CRDA 4XDEA 3SV7A 1PPZA 5FCRA 2Y6TA 4D76A 1P2NA 2FYQA 4O97A 4ABGA 1A2CH 3K6ZA 5SGAE 2RA0A 5DKMA 1Y5AT 4GHQA 1O38A 4B75A 1DS2E 5EQSA
chains in the Genus database with same CATH superfamily
5EPNA 5C20A 1ZGIA 4AFQA 1OWEA 3ELAH 4Y0ZE 3SNEA 3H7TA 3I29A 2ZCHP 2ANMH 1F0UA 4X6NA 2GTBA 4ZKOU 2V7QD 3VGCB 4SGBE 1L4ZA 2FI4E 1RIWB 1YPHC 3GYMA 4FUJA 5FHTA 1W8BH 1DT2A 2BD7A 3N99A 1GDUA 3D23A 5GJ4B 3VB3A 2FMJA 2FOEA 3UFAA 1SGPE 1AVXA 2WYGA 4KTCA 5JPMH 1T8NA 5C1UA 1D6RA 1FDPA 2CMYA 2K0QA 1O37A 1RXPA 3GCHB 1O3JA 1QHRB 1J14A 1TPPA 2EQNA 1SC8U 3VXFH 2OQUA 3STIA 1L1JA 2QF5A 4AB8A 3MNSA 4UEHH 5JDUB 1F5KU 1C5ZB 1MCVA 4WMDA 1GI7B 5DG6A 4BOHA 3BV9B 1DPOA 3PMBB 1BTUA 2XCNA 3P8OA 3SUDA 3KIDU 1SGIB 1H4WA 1MD8A 2BDIA 1ZTKA 2KFWA 4JCNA 1KXBA 4ASUD 2GGVB 4TWWA 1LPZB 2PKSC 2ZGBH 3A83A 4YT7H 2NU3E 3GCOA 2CJIA 3SBKA 1UTNA 4MPXA 3SGAE 3TLOA 1LHDH 1TBZH 2ZFFH 3MU5A 1YKTA 3LKWA 5DK1A 2Y81A 1ANCA 4SGAE 3RMOH 3RP2A 1G2MA 1O3HA 1S85A 2F9OA 2OK5A 1O3NA 3OAAD 3Q77A 4I32A 1OKXA 1T32A 1G36A 2IJD1 3ODDA 4Y8YA 1XUGA 2F9NA 4JZFH 1FN8A 4ZMAH 3RU4D 2HNTC 3E0PB 1E1QD 3TK6A 3BG4B 3VB6A 3M5MA 3DSGA 3OU0A 4YLQH 2BDHA 2F9PA 4AX9H 1KXAA 5H4IB 3E0NB 1DITH 4JZIA 2JKHA 2BDAA 1AVGH 1G3CA 3EE0B 3RDZA 5E8EH 4ZAEA 1QGFA 5EIYA 4O3UA 4D8NA 1SQRA 5FX6A 1A46H 2WINI 2OP9A 3SV8A 1EAWA 2ZHDA 1Y3XA 5LPRA 1NY22 4X8VH 2ZU4A 1CE5A 1MU6B 3Q76A 1Z8GA 3ZVCA 3CNRA 3TK5A 4ABEA 1WCZA 3FZDA 2FOFA 1T7CA 1O3EA 3RUOA 2WZQA 2W7SA 1CU1A 2A1DB 4NGAH 1NESE 1C2JA 3FN8A 3F9EA 1GG6B 3DFJA 2FI3E 2R3YA 1KMHB 1QBNA 5TJXA 2BY7X 3EDXB 3PTBA 1UK4A 2ZU2A 1BQYA 1XMNB 3UIRA 2FOAA 4X1NU 4ZHMU 4A1VA 1RJXB 3GOVB 4MPVA 1V2UT 1C1RA 1ZGVA 4Y8XA 3CP7A 3NWUA 2SGPE 3OFND 2VU8E 2STBE 4CBNA 2JJ1D 1TFXA 1WU1A 4JK5A 1QZ8A 3FP6E 3ATIA 1EUFA 4KELA 3W95A 2KCAA 1G37A 2WUCA 1UTQA 1XUIA 5I25A 1BJUA 2KCYA 2P59A 5F53A 2SGEE 1K9OE 3SJIA 1C5UA 3PB1E 1UVUH 4B6EA 3P17H 1UTPA 1QQUA 3M7UA 3RXSA 3M35A 3HK6B 1FNIA 3VEQB 5DP9A 1GDNA 4FVBA 3S0NA 1TNJA 4TT3D 2P3FH 3ZZ7A 2OBQA 4CRBA 4DCDA 5JBTA 1VGCC 3UR6A 1P9UA 3A84A 2PGQB 5DP3A 2ZCLP 5EQRA 3BTQE 1GMDG 1AB9C 4FU8A 2WYJA 5FPSA 4K1TA 4FUIA 1ZPBA 2A32A 4FUEA 4DVAU 5HM9A 2ZPSA 1TAWA 1LKAA 1V2KT 3JZ2B 5ESTE 3UOUA 4WF8A 1TRYA 2VIQA 2R3UA 4BXSA 4INHA 1KXFA 3A89A 2ZGXH 2QIQA 1P01A 1LHCH 3QN7A 1ZHMA 2ZKSA 2JETC 2A31A 1HBTH 3BEUA 4FOUC 3MFJA 2FODA 1CSOE 3HK3B 1TNKA 4BNRA 2ZU1A 4D9QA 4H6SB 2KR7A 1O3FA 4AFUA 1J8AA 1HAVA 1H1BA 2PR3A 2A4OA 2QF4A 5EW2H 4XSKU 2W6ID 4AZ2B 2FYRA 1TBQH 2BDYA 3UPEA 4Y7AA 4R8TB 1ZHRA 4DY7B 1YF4A 1DWEH 4FU7A 1TGNA 2F4LA 1T4UH 4AGKA 3FP8E 4CH8B 3ZIAD 2R0LA 4ZKRU 1HIAA 4X1SU 3A85A 4K8BA 4K60A 1KXCA 1C2DA 3AASA 3FKSD 1D3QB 3ZZ6A 4H4FA 1ELGA 1TNIA 2G81E 3SN8A 4Q7YA 5FL7D 5C67A 2ZGCA 1GBEA 5GCHF 1T8MA 1CT2E 5GIBA 2PKAB 3F2HA 3OEED 1GMCG 1EAXA 4BAQB 5K7RA 1Z1IA 1HAGE 1QIXB 3LONA 1GJ4H 4X8SH 4GCHG 2A7JA 3UAIC 4ABDA 4AB9A 2XWBI 1ESAA 1ETSH 1BOQA 3M3VA 1GWAA 2QXGA 2NU1E 1QQ4A 1GBFA 1GHAG 5E2PA 2JIZD 3KQBA 2CHAB 4BAOB 4DT7B 2VINA 2ZIQH 1NO9H 1AFQB 1SGDE 4CHAC 2HWLB 1TA2A 5J4SA 1HPGA 3U28C 3M3TA 1Y3WA 2P16A 1O33A 3V7TA 4CRAA 2ILNA 1PYTD 1WDIA 4B2AA 1YCPM 4MDSA 1GHBF 3RXFA 1V2PT 2PSYA 4MQAA 4CR9A 1TQ7B 2XC4A 4NA8A 3A8DA 1Z6JH 1QB1A 1XKBC 2BD5A 2Z3DA 3K9XB 1C2LA 1K1MA 2OC0A 3RXIA 3T25A 1HGTH 1LKBA 3SUEA 4DOQA 3U8TH 2BY9X 1UTLM 2FLRH 1P57B 1QL7A 1SBWA 1CGIE 4GPGA 1P2QA 1C2KA 2C8YB 2HNTF 3O8RA 4HZHA 5T3HA 1V2WT 3ZZBA 1EJMA 3HGPA 3UOPA 5E0JA 2P8OB 2QAAA 1E37B 1EZXC 3GICB 2FS8A 5BRRE 4IMQA 2YNAA 2XC5A 3MH4A 3CS0A 2W6JD 2GX4A 1LVBA 5J4QA 1RTLA 3ZVGA 4K3JA 5ABWA 1LO6A 4GCHF 2AIQA 3UNSA 2VWNA 1DUEA 1EASA 1TMUH 5DP4A 1HJ8A 2XBVA 2VVUA 1C4Y2 1E79D 2A2XH 5CHAB 1COWD 1Z7KA 1F2SE 1C1TA 1FN6A 1FY1A 1M9UA 3TPIZ 3SGQE 1MBMA 1P2OA 1Y3UA 1MQ5A 2HVYB 2YMSB 3B23B 3PLPA 3BTTE 3TJUA 1NPMA 5A8YA 2GZ8A 2AHME 1U6QA 1W0ZU 1TNLA 1GJAB 1VR1H 3NK8A 1O3OA 3NCLA 2Y7ZA 3QZRA 1D3DB 3STJA 1ELVA 4ZKSU 2OD3B 2O8TA 1MCTA 1FJSA 1GPZA 4BTUB 4MPWA 2CV3A 1XVOA 1OP0A 1MTWA 1AZZA 1EFRD 2G4UA 1UCYK 2PV9B 2WPMS 1ZZZA 1GDQA 4YLUA 1HV7A 2TBSA 3TJOA 2WPIS 2AYWA 2LELA 1ESBA 1O39A 4Y76A 1ZSLA 3O8DA 2PLXA 2VVVA 2A4GA 2HLDD 4YOJA 1LVYA 1C4V2 1BJVA 3KYGA 3HGNA 2UWPA 5EJ1A 3B8JA 4IMZA 3T5FH 2XCFA 1C5TA 4CRCA 2VVCA 2ODYB 1UK2A 2QGRA 4XE4A 3ZZ4A 1AUJA 4MVNA 3ZYEA 1C5SA 1MTNC 2Z9JA 1ZLRA 1UVSH 4Y71A 4ISLA 1CHOF 1GGDB 1LPGB 1ZRBA 4KTUA 3RC4A 3AVZA 1BMMH 2A4QA 4YM9A 3OY6U 2ZDLA 4U30A 1OS8A 2FXRA 3MTYA 3SNBA 1P03A 1IQHA 4HG6A 1HJAB 4JYVH 3AW1A 2ZNKH 1Y5UT 5HGGA 1AGJA 5IYTA 4UFDH 3TU7H 2H9TH 3RXPA 1K1IA 4X8UH 1O32A 3SJOA 1ZSJA 3RXKA 1THPB 1Q3XA 1BTXA 3BEIB 1IAUA 4A1TA 1AKSB 2XBXA 1H9HE 1TGBA 1GI5A 1G9IE 1CT4E 3KQEA 1SQAA 3F9GA 1BBRE 5BPEA 2BD9A 2Z7FE 3TGJE 4Q7XA 4LZ1H 5T6GA 3VB4A 5HXFA 2BMGB 4X6OA 4NSYA 1CO7E 5AF9H 1TX6A 1IQKA 1SLVB 1HAPH 1N1LA 1FPHH 4ESTE 5FX5A 3PRBA 4NIVA 2IOTA 3KF2A 1BTYA 2A7HA 2FX6A 3ZVEA 3GCNA 1TIOA 2UUKB 4MNXA 2KAIA 2ULLA 3K65B 1AI8H 1TGCA 1EAIA 1NRRH 1OWDA 5FBEA 2HPQH 3BTKE 3MQKC 1C1MA 1GBCA 2GCHG 5A0CA 3URDA 2AMPA 1IQNA 1SGTA 4CR5A 1HB0B 2FEQH 5FPTA 3E90B 2F43B 2BY8X 3F2FA 5C5OA 1QJ7B 1LVOA 4X6MA 3NUMA 1EJAA 1O5CB 3A8CA 3S9CA 3ZZAA 2F9BH 2ZFSA 3BTME 1SGYE 4X2WA 2RCEA 1QL9A 3NRLA 2HRVA 3KL6A 1UVTH 1YP9A 5HM2A 2Z94A 3O8CA 1UHBB 2IPQX 1GBKA 3Q00A 2GVFA 3A7YA 1F7ZA 2QC2A 1BTWA 4AFZA 1E35B 1MU8B 4UDWH 1HAIH 1O2WA 2FOHA 3FOAA 1GL1A 2XOKD 3SHAH 3F9HA 5DP8A 2AS9A 1FIZA 3PO1B 1GJCB 4A7IB 1C9PA 2UUFB 4U01A 1YPHE 2J5UA 1XM1A 1ELAA 5F8XA 3UTUH 2XNIA 3GDUA 3NPSA 4INLA 1HAOH 1AUTC 1XXFA 1N8OC 2BY5X 2I6QA 1BDAA 1BB0B 5DGJA 2VBCA 4E06H 5HKKD 1F0RA 3A82A 4ABIA 1V2NT 3F3BA 1O2IA 1BZXE 2BVSH 3KYFA 2GCHF 1YBWA 2BY6X 2ZHEH 2Y5FA 2OLGA 4E7NA 3TH2H 3N7DA 2OCVB 4B74A 1V2OT 2KZ4A 2ANWA 1DM4B 4BAMB 2L74A 4VGCB 4HI3A 2C8XB 2RFKC 1MKWH 1GJ8B 1L4DA 1S83A 1NFYA 1FXYA 1ANDA 1FLEE 2BM2A 5C1YA 1FONA 4YOGA 1O3PB 5DP6A 2CGAA 3GY5A 3GY6A 1FMGA 3RXTA 5GDSH 3SU2A 2VIWA 4WY3A 1V2MT 1C1UH 2ZFPH 1JXPA 1H9LB 1GHZA 1NROH 4B2CA 1K22H 2PUXB 1SKYE 2A4RA 2BLWA 3EA8A 7ESTE 1WAYB 1Y3VA 2WSSD 6CHAC 3AK5A 2ZDMA 1C2HA 1MD7A 1SOTA 4MNVA 2HNTE 3ZVFA 4FUHA 1ETRH 3HKJB 1FAKH 4NFFA 1HXEH 3SUFA 4K8YA 1Y59T 2C90B 2HALA 2TGAA 2ZQ1A 1GCTC 3UQOA 4K1EA 1O35A 1XUFA 1C4U2 1FPCH 1OP8A 3SOSA 5B6OA 5EW1H 1TB6H 4OS5A 1MTVA 1J17T 2L6OA 2TGTA 5ETXA 3N7EA 2ZHQH 2J98A 3RXLA 1DWDH 1W14U 2JH0D 1ZMLA 3UREA 2G8TA 1QJ1B 1LHGH 2KM0A 5JBAS 4BTIB 1BMFD 5E0GA 4I8GA 3RM0H 3V3MA 1JRTA 1VJ9U 4GSOA 3DSOA 5C94A 4FUFA 1QA0A 2AFQB 4MTBA 1YCPH 3QZQA 3SZNA 4CBOA 1C1SA 1EB1H 3P8FA 1O2UA 2H6MA 3JZ1B 1TPAE 5DPAA 2LP6A 3KGPA 2XTTB 1KDQA 3E91A 3OTJE 4Z1MD 4NWLA 1YC0A 1ZYOA 3URCA 1O3IA 4BANB 1KTTB 1HNEE 3FFGA 1Q31A 3BSQA 4IN1A 1A5IA 4RT1A 1BHXF 3GYLB 1C1QA 2WV4A 2ZU3A 1HJ9A 3D49H 3PV5A 4O3TA 1IQEA 1N6XA 1ABJH 3F2GA 3E3TA 1HXFH 1MZDA 4FXGH 9LPRA 4IN2A 4NIYA 3P70B 1CA0B 1VITG 4X2VA 3BN9A 4JYTA 2XBWA 3A80A 4FU9A 3MH5A 1AE5A 3MH6A 4GLYA 2ZP0H 2KCOA 1P05A 4P00A 1DOJA 1W13U 3KQDA 3BF6H 2GKVE 1A1RA 3ZZDA 2GMTB 2J2UA 1AE8H 1T8OA 3RXVA 1EPTB 1E0FD 5HIYA 4ACAA 1QBOA 3PTNA 5TCCA 4OGYA 3EQ0H 4Q63A 5JB8S 4I8JA 4AG1A 1O2RA 2AGIX 1WQVH 1RRKA 2GJGA 3NKKA 4F55A 1ZPCA 2ANKH 3R0FA 1KTSB 2ESTE 1T31A 2BQ7B 2VWOA 5JBBS 1IHSH 2B5TB 1TMBH 1T4VH 2XW9A 1HYLA 1HIAB 2ZFQH 1FX0B 2G51A 1S82A 4E7RG 2YNBA 4X1RU 2GT7A 1TX8A 3ZVBA 1P06A 1A4WH 1EATA 2G5VA 4TY7A 2STAE 2SGDE 2ZCKP 1S6HA 1MUEB 1YLNA 2ZC9H 2V6NA 1C1OA 1ETTH 1EJNA 1V2VT 5KECA 3L3TA 3LPRA 2FLBH 2GCTC 3C27B 2BXUH 2YOLA 4LZ4B 4ABAA 2XXLA 4R0IA 1CBWB 1GBDA 2VGCC 1P11E 1MQ6A 1TGTA 2B0FA 1Y3YA 1GBIA 1W10U 4UD9H 2DE9A 3U8RH 3UQVA 5C5NA 1NRSH 3FP7E 1C1PA 2FESH 2GT8A 5PTPA 4RN6A 1ESTA 1UJ1A 1H9IE 1NTPA 1O3DA 3R3GB 3ZYDA 3SNCA 3TH4H 4I8HA 2VIVA 3ZV9A 4BAKB 2UWOA 1TPSA 4BXWA 2VWMA 1LQDB 3ITIA 1DICA 3SQHE 3SI4H 3L6PA 1QNJA 3A7XA 5F03A 4AC9A 1PQAA 1F0TA 2HGTH 3LJJA 4B6FA 3LGYA 3M5NA 2Q6DA 1V2LT 1SHYA 3VXEH 4Q7ZA 5GNDA 1T8LA 2PWXA 1TNHA 3VGCC 1GVKB 1O0DH 1ELBA 1Z1JA 3OSYA 1YPJH 5DJ7A 1SOZA 4DIHH 2ZF0H 3TVJB 4NZLA 9ESTA 3KEEA 1OWIA 3QGJA 3GCHC 1QR3E 2B8OH 2K1QA 3BTFE 3LGUA 3SW2B 1SGFG 4GUXA 3LT3A 1V2JT 1GMDF 1O2GH 1O2LA 1LPKB 1A5HA 4BAHB 2Z9LA 2OTVA 3WWFA 3FZZA 3ENSB 3NZIA 1SGRE 1DLKB 3E6PH 1W12U 2QXIA 8KME2 2CF8H 1MZAA 1DE7H 3PMAB 2XNDD 4LK4A 2JH6D 5DO4H 1K1PA 1C1WH 3FANA 1OPHB 5KGOA 3HATH 1UMAH 7GCHG 3PROA 1NZQH 3LU9B 1S81A 2W5EA 2FIRH 3EA9A 1DY8A 3MO3A 4KKDA 5EODA 4BTTB 1MTSA 2F9VA 2SFAA 4AOQA 2R2MB 1JIRA 2J38A 1H8ED 3F9FA 4TYDA 2BD4A 2Q1JA 3QDZB 4MLFB 2G5NA 3BG4C 5A09A 2A5IA 2A0QB 3UWJH 2BDGA 1GL0E 1L1NA 2OC8A 3DD2H 3OE7D 3NXPA 3U1JB 1SGEE 2BZ6H 3SJ9A 1VKYA 1PQ5A 1GBMA 4HTCH 3QGNB 3GY8A 4Y7BA 3RXOA 2Z6BD 1ZPZA 1IQMA 2CK3D 1GMCF 1GHVH 4FUDA 4JMYA 1C2MA 1O2YA 1K1OA 1SGCA 1NRQH 3D65E 1W2KH 4Y10E 2G00A 1GJ5H 1GHAF 1C5MD 1TBRH 4NG9H 4AYYB 1AFEH 2ZTYA 3VPKA 4B2BA 2TGPZ 4J1YA 1LHFH 5JBCS 2FDAA 4LOYH 2GV6A 2PFEA 3SU3A 3GY4A 1ABIH 7GCHF 1GG6C 3SYJA 4QT8C 2PTCE 2AH4X 2THFB 1P12E 2WPDD 1AN1E 2FWWA 1UK3A 5E2OA 1W11U 3VB5A 3TGIE 4NIWA 1OYTH 4AN7A 1ARCA 3GDSA 3LH3A 3M3SA 1ORFA 3SO3A 3GISB 4K5ZA 3AW0A 3RXJA 2H5DA 3RMLH 2ZDNA 7KMEH 2QY0B 5L6NH 2BB4A 2FM2A 4B76A 1ZTLA 4RSPA 1P09A 1UW7A 1GI4A 3A81A 3AAVA 4NFEA 4Y8ZA 1D3PB 2UUYA 2VH6A 3RM2H 2H2ZA 4JZEH 4X8TH 3SJ8A 3MOCA 2Q6GA 1TYNA 1GI2A 1P10A 2BX3A 1ZMJA 2ZG0H 1PQ7A 3Q3YA 1GI6A 5CE1A 1JBUH 3PWCA 1WSSH 1JOUB 3LH1A 1JIMA 4GVUA 1YPGH 1C2EA 3DUXH 2SGQE 4D7GA 4WWYA 1DY9A 3M7QA 1EKBB 4X0WU 4INKA 1SQOA 1C2FA 3MU1A 1LQEA 1E36B 2KAIB 1KLIH 5AFZH 1SHHB 1C5NH 5B6LA 5KEDA 2SGAA 5LPEA 1BBRH 3MU0A 1D6WA 1HDTH 3RXEA 1W0YH 6GCHG 1IQFA 3F1SB 2BVRH 4NZQA 2ALVA 4YXWD 1OWJA 1G32B 1Q2WA 2EI8A 2EA3A 1W0KD 1QRWA 3OEHD 3RXQA 4RT0A 1HAYB 4X1PU 2WHXA 2TIOA 4X2XA 3EE7A 1CHGA 2PKSB 4B1TA 1V2ST 3SU0A 1K1JA 4ZUHA 4AGJA 3GY7A 2PUQH 1C9TA 1HAXB 1SGQE 8LPRA 3PM3A 1MAXA 3RXCA 5A8ZA 2Z9GA 1GMHG 2F9UA 2BTCE 2EC9H 1A0JA 2H9EH 4I8KA 3RXDA 1EOLA 5DSFA 5LPFA 1IOEA 3RMNH 1UTJA 1O5GH 1O30A 1ELFA 4DIIH 4WMEA 2FOCA 4ZH8A 5FPYA 1NM6A 4NA9H 1L0ZA 2I6SA 2QF0A 3DT0H 1BA8B 2WPLS 4U32A 5AFYH 1EOJA 1YGCH 1WXRA 1P0SH 1LMWB 1GJ6A 1SFQB 2AMDA 2Y5HA 4TWYA 3TIUA 2BOKA 2B7DH 4OGXA 2RDLA 2OUAA 4WH8A 4Y6DA 3F6UH 1LVMA 1TMTH 4RKOB 2FOMB 1PPGE 1B0FA 1FZZA 3MO6A 4CH2B 1BTPA 3QTOH 6GCHF 2PHBA 2CHAC 1CVWH 3OX7U 5LGOA 1F5LA 2HVXA 1TX7A 1AFQC 1G30B 3UWIA 4JK6A 1K2I1 3ODFA 5AHGH 1C5RA 2ASUB 1ARBA 1WTHD 5FBIA 4UFEH 3BG8A 2C3SA 2PTNA 5DN6D 2F83A 7LPRA 1UO6A 1YPKH 1C1VH 1MBQA 2ALPA 4B71A 2Y5GA 3ATMA 1AY6H 4E05H 1W7XH 1SSXA 3L33A 3HKIB 4CREA 1AU8A 2HLCA 1DXWA 2DUCA 5EJLA 1AWHB 6LPRA 1JRSA 1AQ7A 1YPEH 2W3KA 3U69H 2QXHA 5L2YH 1G2LA 1AD8H 1ID5H 1O3GA 1F0SA 4ZCNA 1CGJE 3SHCH 5A0BA 1HCGA 1B5GH 1NRPH 3LC5A 3V12A 2P8OC 3CS7A 1QJ6B 1ZJDA 4IC6A 4UONA 3ATWA 2ANYA 1OWHA 3T29A 4WVPE 5LH8A 1MKXH 2OXSA 1O2SA 2ZFTA 1IHTH 1TPOA 2BX4A 1AO5A 1NU9A 1YYY1 2TGDA 1OXGA 5F6MA 1EZUC 1A0HB 5ESBA 3M36A 1SG8B 3RC5A 1OX1A 4I86A 4DJZB 1SQTA 2QF3A 2J98B 1L1GA 1O34A 1SGFA 1C5XB 1THRH 4TPYA 5CHAC 3KNXA 2ZQ2A 1O2QA 1VGCB 1AKSA 1TOMH 3O8BA 3P6ZB 3F68H 5F8TA 2XYAA 1AB9B 2V3HH 2YMSC 1G3DA 2PP6A 4P02A 2FX4A 1FAXA 4X1QU 4FUGA 1DXPA 4NWKA 1PPHE 1JWTA 1P8VC 2V35A 4LXBH 3RC6A 3MNXA 1LCYA 2VB0A 2A45B 1PPEE 1VCQA 3PMHB 2V0BA 1BMNH 1KDQB 1MMJN 1SLWB 1H8IH 3RMMH 2JETB 3N7OA 1WBGB 1PPFE 2AIPA 1FUJA 1YPLH 3DSPA 3FO8D 3HPTB 1BT7A 2J9NA 2Q6FA 3MU4A 3Q3XA 2XRCA 3UB0A 1HRTH 1Z8IB 2NU2E 3MMGA 1CT0E 5T6FA 1C2IA 2P95A 1MKWK 2W7UA 3LDXH 1F92A 3UNRA 4FUBA 1A61H 1O3LA 1GI0A 2RG3A 3SJKA 3OY5U 1PJPA 1Z6EA 4I33A 2J97A 3LC3A 2ZDKA 2ZA5A 1F5RA 1ANBA 4AYVB 3T26A 5GXPA 5JB9S 3LGVA 3M37A 4Z0KA 3TNSA 1O5AB 4OM9A 1DUAA 3MI4A 1TA6A 2Y7XA 2WPKS 1GBLA 2BZAA 3S9AA 2ZO3H 4XD7D 1FY5A 5EPYA 4X2YA 2BD2A 2BHGA 1V3XA 1UHBA 1OHHD 3RU4E 3BIUH 5A2MH 2BYAX 1LDTT 1WV7H 1DX5M 4ZHAA 3S9BA 1NU7B 2ZPRA 4Y79A 1GJBB 1E1RD 1INCA 2HOBA 3S69A 5T6DA 2UWLA 2LNCA 1GGDC 1YPMH 2O8LA 3H09A 1GVZA 2ZTZA 5C1XA 2ZDAH 3M61U 5EOKA 5C0UA 1BIOA 2ZI2H 3IITA 4CRGA 1S84A 3U9AH 4YOIA 4XOJA 1SI5H 1BUIA 3LIWA 4ISHH 3P95A 1BITA 2ZPQA 2LPRA 2FPZA 3I77A 4CHAB 1HJAC 2O8UA 2BVXH 1P3CA 3AAUA 1K28D 2O9QA 1GCDA 1P2JA 1O3KA 3S7KB 2OQ5A 2ZEBA 1YCPK 5K0HA 1FY4A 1G3EA 1S0QA 1XUKA 1GVLA 1TWXB 1O2NA 1CGHA 3ZZ9A 3A8BA 3SU5A 4PROA 5A8XA 2BXTH 2JJ2D 3MYWA 1OOKB 1O2KA 3PV2A 2GP9B 3SU1A 2C93B 4CRFA 4DT4A 1TNGA 2KX4A 1KLTA 1YLCA 2J95A 1EP6A 2Y82A 3ATLA 2H5CA 3LGTA 1C5PA 4ISNA 2VIOA 1P2KA 4TY6A 3M5LA 3MWIU 1PPBH 3MU8A 4FVDA 3RU4T 1QA7A 1BCUH 1SVPA 1WUNH 3SI3H 1W0JD 1NRNH 3SQEE 1ZRKA 1K0HA 2VH0A 3T62A 4WJG2 4OS6A 2ZGJA 1GHXH 4UFFH 1HAVB 1YLDA 4UFGH 2FTMA 1XKAC 2Z3EA 4HGCA 3TJNA 2W26A 1SMFE 3BTGE 1J9CH 1P04A 1WQSA 5CHBA 3KHVA 4YT6H 1GBHA 1FV9A 4ACBA 2J34A 2VIDA 1NC6A 1DWBH 1O5FH 1C5WB 1Y5BT 3KCGH 1DWCH 3SZEA 2QA9E 1KXEA 2PGBB 5C2ZA 1KY9A 2ODQA 4A92A 2KCPA 3QK1A 2C8WB 3SNAA 2G4TA 3QUMP 2H9HA 4WXIA 3S7HB 3ZVDA 3SGBE 1O2TA 3PLBA 5IK2D 4TPIZ 1O3MA 1VJAU 4OS4A 1E34B 1SR5C 1VITF 1ELDE 3FAOA 3PO1C 2J4IA 3A7TA 4NIXA 5E0HA 1ZMNA 2FS9A 4IGDA 2BDBA 1FQ3A 4NSVA 4AG2A 4AORA 2OC7A 1TALA 1V2RT 1YM0A 1A3BH 1MAYA 4OS2A 1GJDB 1FY8E 2D1JA 2FI5E 2VIPA 2FOBA 5EG4A 3RXBA 1TE0A 3IWMA 3RLYH 4H6TA 4F49A 4ABFA 1V2QT 1RS0A 5GCHG 2D2DA 2BLOA 4DURA 1UTMA 2NU4E 5GPIB 3GY2A 2F3CE 4I7YH 2ZTXA 1QRZA 4U2WA 2O8MA 1EXFA 4Y0YE 2GDDA 2EY4C 1DVAH 3QWCH 4VGCC 5F8ZA 3PV4A 3SV9A 1ELTA 1MTNB 2JH5D 4KGAA 2C4FH 4FETA 1GI9B 1GJ7B 3WW7A 1ZJKA 4DW2U 4OS1A 1K1LA 5IDKA 3CENA 1WYKA 3P8GA 1B7XB 1EPTA 2WV5A 1RIWC 2GZ9A 4Z6AH 5C3NA 4Q4LA 1GHBG 1BMAA 1OSSA 3QTVH 2BQ6B 3UUZA 3BTWE 2A2QH 1SLXB 3SV6A 2ZHFH 1SB1H 3TJVA 1O2MA 1C5LH 1QTFA 3RLWH 3TH3H 1Z71A 3RXMA 2IJOB 1P2IA 1BHXB 1VCPA 2BOHB 2O8WA 2BD3A 2P93A 1VCWA 2PW8H 1KXDA 3SV2H 4HFPB 2G52A 5GWZA 1O2JA 4IW4E 2CXVA 1IQGA 4A5TS 3FVFB 1DANH 4ASHA 3SU4A 4O9VA 3H7OA 1P3EA 2CF9H 1QB6A 1KLJH 2AEIH 2IN2A 1NN6A 1GI1A 1EZSC 1Z8JB 3ESTA 4JYUH 1A0LA 1TGSZ 3K6YA 1HAHH 3RXHA 1DSUA 1RGQA 1TRMA 3H5CB 4ISIH 3UR9A 1TQ0B 2BD8A 2EI7A 2A7CA 2NWNA 4RKJB 4ABHA 1XXDA 4YESB 4DGJA 5DP7A 3PYHA 5DP5A 2M2AA 3VB7A 2G55A 1PYTC 2D26C 3EYDA 4TSFD 2B9LA 1QFKH 3GCTG 2AMQA 3U1IB 3E1XB 3ZV8A 3I78A 4I8LA 4Q2KA 4XBBA 2QCYA 1BTHH 4IC5A 3ZZ8A 1DSTA 1XVMA 1H8DH 1LTOA 1C5QA 1OWKA 3KQ5A 1A3EH 1QL8A 2QE7D 4XBDA 1ANEA 3PWBA 1RD3B 3EA7A 2GD4B 1ACBE 2DE8A 2RA3A 1O31A 1NT1A 3SORA 1CA0C 4F4OC 4K2YA 3DFLA 4GAWA 8ESTE 3WWBA 4MNYA 1O2PA 2FOGA 1AHTH 4X6PA 3GS9A 4UE7H 1C1NA 4D9RA 4THNH 1P2MA 3OTPA 1GHYH 1SLUB 2GMTC 3M7TA 4ZXXH 1ZR0A 4YZUA 1EPTC 5EXNA 3SU6A 1FI8A 3GDVA 1GI3A 2JDID 3C1KA 2WUBA 5EJZA 1SL3A 2PKAA 1TONA 2H1UA 1RTFB 2FTLE 1ZHPA 2WPHS 3VG8A 1N8OB 4YTAA 1O2ZA 3T2NA 1S6LA 3A88A 4MG3A 1A7SA 1ZSKA 1THSH 3PRDA 2UUJB 3RXUA 1D3TB 4H42U 5EXMA 1SFIA 1IQIA 2XBYA 3GCTF 1WOFA 1EAUA 4MPUA 1HFDA 1CHOG 1UCYH 3ZZCA 1AMHA 3DA9B 4K69A 4I31A 3T27A 1BRUP 1EP5A 1CA8B 1W3CA 2EI6A 3ATKA 1GBBA 8GCHG 1ZTJA 2A5KA 1C5YB 1NBME 4ABBA 1OYQA 1C5VA 1N6YA 1P02A 2C8ZB 3BTEE 1CBWC 1CQQA 1UVPA 3MNBA 2TRMA 2Z3CA 2ZGHA 5EGMA 3V13A 1MH0A 2P3UB 3G01A 5TCAA 2R0KA 1O3AA 2ZDVH 1BTZA 1FIWA 4ZROA 1O5EH 1NFXA 2QV1A 4YO9A 2PSXA 3QLPH 2Y80A 1IQLA 2GDEH 3OYPA 3Q3KA 6CHAB 1S5SA 2OC1A 1TABE 1JMOH 1RFNA 4XRNA 3A7WA 2XC0A 1KIGH 2D8WA 4NA7A 4Q80A 1UTKA 2AGEX 2BLVA 1UTOA 1EQ9A 1YY3A 2HPPH 2OINA 1UCYE 2ZZUH 1GCTB 1SGNE 2A5AA 2IPHA 2F91A 3EGKH 3V0XA 4B73A 2NU0E 2ZU5A 4O03A 4GHTA 2TPIZ 3ZZ5A 1GBAA 1GBTA 3P92A 1BBRK 1O36A 5EQQA 2Z9IA 2QXJA 4K1SA 1QURH 4XFQA 3RXAA 3W1EA 5JYIA 1VITH 1A5GH 4ABJA 3B9FH 1O5BB 2P94A 1GBJA 3KQCA 1NBMD 1MTUA 1PPCE 5L30H 1Y8TA 1HLTH 5I46H 4NCYA 1D9IA 3E16B 1QCPA 5HYOA 1BRCE 1AZ8A 2W3IA 2VJ1A 2QYIA 4A6LA 1O2XA 2R2WU 2AERH 5CMXH 1GHWH 2VWLA 1DFPA 8GCHF 2WV9A 2CN0H 2R9PA 3EAJA 5HIZA 1BMLA 2XWAA 5G4BA 1AVWA 1X7AC 2GV7A 4XBCA 1EX3A 3LGWA 1K21H 1L2EA 4IBLH 3BTDE 4WMFA 5A0AE 1QB9A 2BLQA 1SPJA 3QO6A 1LHEH 3U8OH 1QRXA 1EB2A 3LOXA 1B0EA 3UY9A 3SNDA 2SGFE 3LGIA 5AVDA 1AWFH 3QX5H 1NS3A 3D62A 3KN2A 2J94A 1Z8RA 2WPJS 1FY3A 4ZKNU 1V6DA 2RDEA 1HUTH 3UNQA 3PMJA 1EZQA 3W94A 3P8NA 3BEFB 4RI0A 3BIVH 3T28A 4AFSA 3E8LA 1BRAA 3DHKH 1VZQH 4OS7A 3K2UA 3TITA 4WXVA 1GI8B 4KTSA 4ZXYH 5FXLA 1AIXH 1YWUA 3IG6B 1E38B 3WY8A 2ODPA 2QN5T 3TK9A 3VFEA 1ELEE 6ESTA 1GMHF 2ZWLH 1S0RA 3MO9A 5C0TA 5T1VA 1W7GH 2J92A 3M5OA 1QY6A 2V3OH 2FO9A 4A1XA 1ZOMA 1K1NA 3MHWU 5FCKA 2BDCA 1QBVH 1H8HD 1TOCB 1RTKA 3A7VA 3U98H 1TLDA 1ELCA 2ZHWH 4MNWA 1NFUA 2OBOA 4M7GA 4DG4A 2AGGX 2ZECA 1KYNA 1XX9A 1XUJA 1C2GA 4IS5A 2BQWB 3PLKA 2Z9KA 1DDJA 1PFXC 3TGKE 2K8IA 2M5TA 1PQ8A 2ZFRH 1O2HA 1O3BA 3ZZ3A 1NFWA 1S6FA 3GY3A 5CDFE 4J2YB 2SNVA 3TNTA 1WTGH 5HMAA 4FUCA 5FAHA 1TRNA 2GCTB 1MKXK 2VNTA 1GJ9B 3DCLA 1D4PB 3F0PA 1XUHA 1OP2A 2VGCB 4F48B 3A86A 4D7FA 1IQJA 2FZZA 3A87A 5EU8A 3A7ZA 4ZHLU 1P9SA 2P3TB 5L2ZH 2YMSD 3RXRA 5EXLA 1DLEA 2V3MA 1O5DH 3LJOA 1O2OA 4ISOA 3MH7A 1C5OH 1KSNA 3SUGA 3BTHE 1V2TT 2FP7B 2SNWA 4M9FA 4JZDH 3A8AA 4Y11E 1O3CA 1O2VA 1J15A 3RXGA 1HAZB 1BRBE 1G3BA 2EEKA 4KP0A 1UVOA 3MNCA 4JZ1A 2GZ7A 4WH6A 3ZVAA 1J16A 4CRDA 4XDEA 3SV7A 1PPZA 1MABB 5FCRA 2Y6TA 3F0OA 4D76A 1P2NA 2FYQA 4O97A 4ABGA 1A2CH 3K6ZA 5SGAE 2RA0A 5DKMA 1Y5AT 5C17A 4GHQA 1O38A 4B75A 1DS2E 5EQSA
chains in the Genus database with same CATH topology
5EPNA 5C20A 1ZGIA 4AFQA 1OWEA 3ELAH 4Y0ZE 3SNEA 3H7TA 3I29A 2ZCHP 2ANMH 1F0UA 4X6NA 2GTBA 4ZKOU 3VGCB 4SGBE 1L4ZA 2FI4E 1RIWB 1YPHC 3GYMA 4FUJA 5FHTA 1W8BH 1DT2A 2BD7A 5GJ4B 1GDUA 3D23A 3VB3A 2FMJA 2FOEA 3UFAA 1SGPE 1AVXA 2WYGA 4KTCA 5JPMH 1T8NA 5C1UA 1D6RA 1FDPA 2CMYA 1O37A 1RXPA 3GCHB 1O3JA 1QHRB 1J14A 1TPPA 1SC8U 3VXFH 2OQUA 3STIA 1L1JA 4AB8A 3MNSA 4UEHH 5JDUB 1F5KU 1C5ZB 1MCVA 4WMDA 1GI7B 5DG6A 4BOHA 3BV9B 1DPOA 3PMBB 1BTUA 2XCNA 3P8OA 3SUDA 3KIDU 1SGIB 1H4WA 1MD8A 2BDIA 1ZTKA 4JCNA 1KXBA 2GGVB 4TWWA 1LPZB 2PKSC 2ZGBH 3A83A 4YT7H 2NU3E 3GCOA 2CJIA 3SBKA 1UTNA 4MPXA 3SGAE 3TLOA 1LHDH 1TBZH 2ZFFH 3MU5A 1YKTA 3LKWA 5DK1A 2Y81A 1ANCA 4SGAE 3RMOH 3RP2A 1G2MA 1O3HA 1S85A 2F9OA 1O3NA 3Q77A 4I32A 1OKXA 1T32A 1G36A 3ODDA 4Y8YA 1XUGA 2F9NA 4JZFH 1FN8A 4ZMAH 3RU4D 2HNTC 3E0PB 3TK6A 3BG4B 3VB6A 3M5MA 3OU0A 4YLQH 2BDHA 2F9PA 4AX9H 1KXAA 5H4IB 3E0NB 1DITH 4JZIA 2JKHA 2BDAA 1AVGH 1G3CA 3EE0B 3RDZA 5E8EH 4ZAEA 1QGFA 4O3UA 4D8NA 5FX6A 1A46H 2WINI 2OP9A 3SV8A 1EAWA 2ZHDA 1Y3XA 5LPRA 1NY22 4X8VH 2ZU4A 1CE5A 1MU6B 3Q76A 1Z8GA 3ZVCA 3TK5A 4ABEA 1WCZA 3FZDA 2FOFA 1T7CA 1O3EA 3RUOA 2W7SA 1CU1A 2A1DB 4NGAH 1NESE 1C2JA 3F9EA 1GG6B 3DFJA 2FI3E 2R3YA 1QBNA 5TJXA 2BY7X 3EDXB 3PTBA 1UK4A 2ZU2A 1BQYA 1XMNB 3UIRA 2FOAA 4X1NU 4ZHMU 4A1VA 1RJXB 3GOVB 4MPVA 1V2UT 1C1RA 1ZGVA 4Y8XA 3CP7A 3NWUA 2SGPE 4CBNA 2VU8E 2STBE 1TFXA 1WU1A 4JK5A 3FP6E 3ATIA 1EUFA 4KELA 3W95A 1G37A 2WUCA 1UTQA 1XUIA 5I25A 1BJUA 2P59A 2SGEE 1K9OE 3SJIA 1C5UA 3PB1E 1UVUH 3P17H 1UTPA 1QQUA 3M7UA 3RXSA 3M35A 3HK6B 1FNIA 3VEQB 5DP9A 1GDNA 4FVBA 3S0NA 1TNJA 2P3FH 3ZZ7A 2OBQA 4CRBA 4DCDA 5JBTA 1VGCC 3UR6A 1P9UA 3A84A 2PGQB 5DP3A 2ZCLP 5EQRA 3BTQE 1GMDG 1AB9C 4FU8A 2WYJA 5FPSA 4K1TA 4FUIA 1ZPBA 2A32A 4FUEA 4DVAU 5HM9A 2ZPSA 1TAWA 1LKAA 1V2KT 3JZ2B 5ESTE 3UOUA 4WF8A 1TRYA 2VIQA 2R3UA 4BXSA 4INHA 1KXFA 3A89A 2ZGXH 2QIQA 1P01A 1LHCH 3QN7A 1ZHMA 2ZKSA 2JETC 2A31A 1HBTH 3BEUA 3MFJA 2FODA 1CSOE 3HK3B 1TNKA 4BNRA 2ZU1A 4D9QA 4H6SB 1O3FA 4AFUA 1J8AA 1HAVA 1H1BA 2PR3A 2A4OA 5EW2H 4XSKU 4AZ2B 2FYRA 1TBQH 2BDYA 3UPEA 4Y7AA 4R8TB 1ZHRA 4DY7B 1YF4A 1DWEH 4FU7A 1TGNA 1T4UH 4AGKA 3FP8E 4CH8B 2R0LA 4ZKRU 1HIAA 4X1SU 3A85A 4K8BA 4K60A 1KXCA 1C2DA 3AASA 1D3QB 3ZZ6A 4H4FA 1ELGA 1TNIA 2G81E 3SN8A 4Q7YA 5C67A 2ZGCA 1GBEA 5GCHF 1T8MA 1CT2E 5GIBA 2PKAB 1GMCG 1EAXA 4BAQB 5K7RA 1Z1IA 1HAGE 1QIXB 3LONA 1GJ4H 4X8SH 4GCHG 2A7JA 4ABDA 4AB9A 2XWBI 1ESAA 1ETSH 1BOQA 3M3VA 1GWAA 2QXGA 2NU1E 1QQ4A 1GBFA 1GHAG 5E2PA 4DT7B 3KQBA 2CHAB 4BAOB 2VINA 2ZIQH 1NO9H 1AFQB 1SGDE 4CHAC 2HWLB 1TA2A 5J4SA 1HPGA 3M3TA 1Y3WA 2P16A 1O33A 3V7TA 4CRAA 2ILNA 1PYTD 4B2AA 1YCPM 4MDSA 1GHBF 3RXFA 1V2PT 2PSYA 4MQAA 4CR9A 1TQ7B 2XC4A 4NA8A 3A8DA 1Z6JH 1QB1A 1XKBC 2BD5A 2Z3DA 3K9XB 1C2LA 1K1MA 2OC0A 3RXIA 3T25A 1HGTH 1LKBA 3SUEA 4DOQA 3U8TH 2BY9X 1UTLM 2FLRH 1P57B 1QL7A 1SBWA 1CGIE 4GPGA 1P2QA 1C2KA 2C8YB 2HNTF 3O8RA 4HZHA 5T3HA 1V2WT 3ZZBA 1EJMA 3HGPA 3UOPA 5E0JA 2P8OB 2QAAA 1E37B 1EZXC 3GICB 2FS8A 5BRRE 4IMQA 2YNAA 2XC5A 3MH4A 3CS0A 5J4QA 2GX4A 1LVBA 1RTLA 3ZVGA 4K3JA 5ABWA 1LO6A 4GCHF 2AIQA 3UNSA 2VWNA 1DUEA 1EASA 1TMUH 5DP4A 1HJ8A 2XBVA 2VVUA 1C4Y2 2A2XH 5CHAB 1Z7KA 1F2SE 1C1TA 1FN6A 1FY1A 1M9UA 3TPIZ 3SGQE 1MBMA 1P2OA 1Y3UA 1MQ5A 3B23B 3PLPA 3BTTE 3TJUA 1NPMA 5A8YA 2GZ8A 1U6QA 1W0ZU 1TNLA 1GJAB 1VR1H 3NK8A 1O3OA 3NCLA 2Y7ZA 3QZRA 1D3DB 3STJA 1ELVA 4ZKSU 2OD3B 2O8TA 1MCTA 1FJSA 1GPZA 4BTUB 4MPWA 2CV3A 1XVOA 1OP0A 1MTWA 1AZZA 2G4UA 2PV9B 1UCYK 2WPMS 1ZZZA 1GDQA 4YLUA 1HV7A 2TBSA 3TJOA 2WPIS 2AYWA 1ESBA 1O39A 4Y76A 1ZSLA 3O8DA 2PLXA 2VVVA 2A4GA 4YOJA 1LVYA 1C4V2 1BJVA 3HGNA 2UWPA 3B8JA 4IMZA 3T5FH 2XCFA 1C5TA 4CRCA 2VVCA 2ODYB 1UK2A 2QGRA 4XE4A 3ZZ4A 1AUJA 4MVNA 3ZYEA 1C5SA 1MTNC 2Z9JA 1ZLRA 1UVSH 4Y71A 4ISLA 1CHOF 1GGDB 1LPGB 1ZRBA 4KTUA 3RC4A 3AVZA 1BMMH 2A4QA 4YM9A 3OY6U 2ZDLA 4U30A 1OS8A 2FXRA 3MTYA 3SNBA 1P03A 1IQHA 1HJAB 4JYVH 3AW1A 2ZNKH 1Y5UT 5HGGA 1AGJA 5IYTA 4UFDH 3TU7H 2H9TH 3RXPA 1K1IA 4X8UH 1O32A 3SJOA 1ZSJA 3RXKA 1THPB 1Q3XA 1BTXA 3BEIB 1IAUA 4A1TA 1AKSB 2XBXA 1H9HE 1TGBA 1GI5A 1G9IE 1CT4E 3KQEA 1SQAA 3F9GA 1BBRE 5BPEA 2BD9A 2Z7FE 3TGJE 4Q7XA 4LZ1H 5T6GA 3VB4A 5HXFA 2BMGB 4X6OA 4NSYA 1CO7E 5AF9H 1TX6A 1IQKA 1SLVB 1HAPH 1N1LA 1FPHH 4ESTE 5FX5A 4NIVA 2IOTA 3KF2A 1BTYA 2A7HA 2FX6A 3ZVEA 3GCNA 1TIOA 2UUKB 4MNXA 2KAIA 2ULLA 3K65B 1AI8H 1TGCA 1EAIA 1NRRH 1OWDA 5FBEA 2HPQH 3BTKE 1C1MA 1GBCA 2GCHG 5A0CA 3URDA 2AMPA 1IQNA 1SGTA 4CR5A 1HB0B 2FEQH 5FPTA 3E90B 2BY8X 5C5OA 1QJ7B 1LVOA 4X6MA 3NUMA 1EJAA 1O5CB 3A8CA 3S9CA 3ZZAA 2F9BH 2ZFSA 3BTME 1SGYE 4X2WA 2RCEA 1QL9A 2HRVA 3KL6A 1UVTH 1YP9A 5HM2A 2Z94A 3O8CA 1UHBB 1GBKA 3Q00A 2GVFA 3A7YA 1F7ZA 2QC2A 1BTWA 4AFZA 1E35B 1MU8B 4UDWH 1HAIH 1O2WA 2FOHA 1GL1A 3SHAH 3F9HA 5DP8A 2AS9A 1FIZA 3PO1B 1GJCB 4A7IB 1C9PA 2UUFB 4U01A 1YPHE 1XM1A 1ELAA 5F8XA 3UTUH 2XNIA 3GDUA 3NPSA 4INLA 1HAOH 1AUTC 1XXFA 1N8OC 2BY5X 2I6QA 1BDAA 1BB0B 5DGJA 4E06H 1F0RA 3A82A 4ABIA 1V2NT 1O2IA 1BZXE 2BVSH 2GCHF 1YBWA 2BY6X 2ZHEH 2Y5FA 2OLGA 4E7NA 3TH2H 2OCVB 4B74A 1V2OT 2ANWA 1DM4B 4BAMB 4VGCB 4HI3A 2C8XB 1MKWH 1GJ8B 1L4DA 1S83A 1NFYA 1FXYA 1ANDA 1FLEE 2BM2A 5C1YA 1FONA 4YOGA 1O3PB 5DP6A 2CGAA 3GY5A 3GY6A 1FMGA 3RXTA 5GDSH 3SU2A 2VIWA 4WY3A 1V2MT 1C1UH 2ZFPH 1JXPA 1H9LB 1GHZA 1NROH 4B2CA 1K22H 2PUXB 2A4RA 2BLWA 3EA8A 7ESTE 1WAYB 1Y3VA 6CHAC 2ZDMA 1C2HA 1MD7A 1SOTA 4MNVA 2HNTE 3ZVFA 4FUHA 1ETRH 3HKJB 1FAKH 4NFFA 1HXEH 3SUFA 4K8YA 1Y59T 2C90B 2HALA 2TGAA 2ZQ1A 1GCTC 3UQOA 4K1EA 1O35A 1XUFA 1C4U2 1FPCH 1OP8A 3SOSA 5B6OA 5EW1H 1TB6H 4OS5A 1MTVA 1J17T 2TGTA 5ETXA 2ZHQH 3RXLA 1DWDH 1W14U 2JH0D 1ZMLA 3UREA 2G8TA 1QJ1B 1LHGH 5JBAS 4BTIB 5E0GA 4I8GA 3RM0H 3V3MA 1JRTA 1VJ9U 4GSOA 4FUFA 1QA0A 2AFQB 4MTBA 1YCPH 3QZQA 3SZNA 4CBOA 1C1SA 1EB1H 3P8FA 1O2UA 2H6MA 3JZ1B 1TPAE 5DPAA 3KGPA 2XTTB 1KDQA 3E91A 3OTJE 4NWLA 1YC0A 1ZYOA 3URCA 1O3IA 4BANB 1KTTB 1HNEE 3FFGA 1Q31A 3BSQA 4IN1A 1A5IA 1BHXF 3GYLB 1C1QA 2WV4A 2ZU3A 1HJ9A 3D49H 4O3TA 1IQEA 1N6XA 1ABJH 3E3TA 1HXFH 1MZDA 4FXGH 9LPRA 4IN2A 4NIYA 3P70B 1CA0B 1VITG 4X2VA 3BN9A 4JYTA 2XBWA 3A80A 4FU9A 3MH5A 1AE5A 3MH6A 4GLYA 2ZP0H 1P05A 1DOJA 1W13U 3KQDA 3BF6H 2GKVE 1A1RA 3ZZDA 2GMTB 2J2UA 1AE8H 1T8OA 3RXVA 1EPTB 1E0FD 1QBOA 3PTNA 5TCCA 4OGYA 3EQ0H 5JB8S 4I8JA 4AG1A 1O2RA 2AGIX 1WQVH 1RRKA 3NKKA 1ZPCA 2ANKH 3R0FA 1KTSB 2ESTE 1T31A 2BQ7B 2VWOA 5JBBS 1IHSH 2B5TB 1TMBH 1T4VH 2XW9A 1HYLA 1HIAB 2ZFQH 2G51A 1S82A 4E7RG 2YNBA 4X1RU 2GT7A 1TX8A 3ZVBA 1P06A 1A4WH 1EATA 2G5VA 4TY7A 2STAE 2SGDE 2ZCKP 1S6HA 1MUEB 2ZC9H 2V6NA 1C1OA 1ETTH 1EJNA 1V2VT 3L3TA 3LPRA 2FLBH 2GCTC 3C27B 2BXUH 2YOLA 4LZ4B 4ABAA 2XXLA 4R0IA 1CBWB 1GBDA 2VGCC 1P11E 1MQ6A 1TGTA 2B0FA 1Y3YA 1GBIA 1W10U 4UD9H 2DE9A 3U8RH 3UQVA 5C5NA 1NRSH 3FP7E 1C1PA 2FESH 2GT8A 5PTPA 4RN6A 1ESTA 1UJ1A 1H9IE 1NTPA 1O3DA 3R3GB 3ZYDA 3SNCA 3TH4H 4I8HA 2VIVA 3ZV9A 4BAKB 2UWOA 1TPSA 4BXWA 2VWMA 1LQDB 3ITIA 1DICA 3SQHE 3SI4H 3L6PA 1QNJA 3A7XA 5F03A 1PQAA 1F0TA 2HGTH 3LJJA 3LGYA 3M5NA 2Q6DA 1V2LT 1SHYA 3VXEH 4Q7ZA 1T8LA 2PWXA 1TNHA 3VGCC 1GVKB 1O0DH 1ELBA 1Z1JA 3OSYA 1YPJH 5DJ7A 1SOZA 4DIHH 2ZF0H 3TVJB 4NZLA 9ESTA 3KEEA 1OWIA 3QGJA 3GCHC 1QR3E 2B8OH 2K1QA 3BTFE 3LGUA 3SW2B 1SGFG 4GUXA 3LT3A 1V2JT 1GMDF 1O2GH 1O2LA 1LPKB 1A5HA 4BAHB 2Z9LA 2OTVA 3FZZA 3ENSB 3NZIA 1SGRE 1DLKB 3E6PH 1W12U 2QXIA 8KME2 2CF8H 1MZAA 1DE7H 3PMAB 4LK4A 2JH6D 5DO4H 1K1PA 1C1WH 3FANA 1OPHB 3HATH 1UMAH 7GCHG 3PROA 1NZQH 3LU9B 1S81A 2W5EA 2FIRH 3EA9A 1DY8A 3MO3A 4KKDA 5EODA 4BTTB 1MTSA 2F9VA 2SFAA 4AOQA 2R2MB 1JIRA 2J38A 3F9FA 4TYDA 2BD4A 2Q1JA 3QDZB 4MLFB 2G5NA 3BG4C 5A09A 2A5IA 2A0QB 3UWJH 2BDGA 1GL0E 1L1NA 2OC8A 3DD2H 3NXPA 3U1JB 1SGEE 2BZ6H 3SJ9A 1PQ5A 1GBMA 4HTCH 3QGNB 3GY8A 4Y7BA 3RXOA 2Z6BD 1ZPZA 1IQMA 1GMCF 1GHVH 4FUDA 4JMYA 1C2MA 1O2YA 1K1OA 1SGCA 1NRQH 3D65E 1W2KH 4Y10E 2G00A 1GJ5H 1GHAF 1C5MD 1TBRH 4NG9H 4AYYB 1AFEH 2ZTYA 3VPKA 4B2BA 2TGPZ 4J1YA 1LHFH 5JBCS 2FDAA 4LOYH 2GV6A 2PFEA 3SU3A 3GY4A 1ABIH 7GCHF 1GG6C