2KCPA

Solution structure of 30s ribosomal protein s8e; from methanothermobacter thermautotrophicus, northeaststructural genomics consortium (nesg) target tr71d
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
98
structure length
98
Chain Sequence
GDRRVRLIRTRGGNTKVRLASDTRINVVDPETGKVEIAEIRNVVENTANPHFVRRNIITRGAVVETNLGNVRVTSRPGQDGVINGVLIRELEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosomal protein
molecule keywords 30S ribosomal protein S8e
publication title SOLUTION STRUCTURE OF 30S RIBOSOMAL PROTEIN S8E FROM Methanothermobacter thermautotrophicus, NORTHEASTSTRUCTURAL GENOMICS CONSORTIUM (NESG) TARGET
rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
total genus 12
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2008-12-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.310 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2kcpA01
2KCOA 2KCYA 2KCPA
chains in the Genus database with same CATH superfamily
1KTSB 4TY6A 3SV2H 3D65E 1BMLA 1BIOA 1GGDC 1GJ8B 4CBNA 2Z9LA 1P2KA 4Q63A 2XC0A 2GTBA 5GWZA 3SHCH 5FCRA 2VGCC 1SOTA 4FUIA 1GHAG 2SGAA 2J9NA 3MOCA 2KCAA 3RMOH 1JXPA 2FI5E 1DSTA 4Z6AH 1MH0A 1TOMH 2GV6A 3H7TA 4GAWA 4NSVA 3QTOH 4XOJA 4NWLA 1G36A 1GI5A 3ZZ8A 2HWLB 1BRAA 1GJ5H 3NXPA 3BTEE 2Z7FE 5AFZH 3HKIB 3JZ1B 2L74A 4IW4E 3RLWH 1YPLH 1O2QA 3UAIC 3Q00A 2AERH 2J94A 2P8OC 2QXHA 3F0OA 1QQ4A 2G4UA 4X1RU 1GJCB 1ZHPA 1O2RA 1UTJA 1IQJA 3RXMA 2TBSA 1DUAA 1PQ5A 4HTCH 2ZFSA 3FKSD 2OK5A 2CHAC 5F8ZA 1OX1A 2BDBA 1X7AC 1TIOA 4P02A 7KMEH 3GCNA 2ZHDA 1WU1A 1O34A 1LVMA 2BQ7B 3RMMH 2ZHWH 4K1EA 1O3FA 1EX3A 1K1PA 1TBQH 1FQ3A 3FANA 1Z1JA 1UJ1A 2PKAB 4DCDA 1TYNA 1L4ZA 1ABIH 1P3CA 5LPEA 2OQ5A 4OS6A 1TMBH 3NZIA 2XBWA 1W0KD 2ZU2A 1C4U2 1GHAF 2KFWA 2D8WA 3FP6E 1RGQA 5FPSA 4UD9H 1GPZA 4UFGH 1VGCB 3KYFA 4Y7BA 4CH8B 1EASA 1EP6A 1UTMA 3UR6A 1SLXB 4BAOB 4TPYA 4ZHAA 4YOJA 5LPRA 4I32A 1HXFH 2DE8A 2M5TA 3OE7D 1F5LA 2KR7A 5CHAC 4YOIA 3BTGE 2ZP0H 3TPIZ 1GHXH 1LTOA 1KLJH 2B8OH 1YPHC 5HIYA 1SHHB 1O3DA 1KXEA 4A92A 1NU9A 1MUEB 1GBHA 2BM2A 3A8BA 2TIOA 2NU4E 5C1YA 1Z6EA 1MBMA 1GBCA 1DFPA 3FZZA 3VB6A 5JPMH 1VKYA 1VCPA 2Z6BD 4O03A 2GMTB 1F0UA 5T3HA 1TNHA 1ZPCA 2OC1A 2A5IA 3LU9B 5EU8A 3MI4A 3BIUH 1A0LA 1ESAA 2BOHB 2A5AA 1W0JD 4E7NA 1UK2A 4JZFH 1CU1A 1PPFE 1C1SA 1FAKH 2W3KA 4AYYB 3CS7A 1W10U 1C2JA 3S7KB 3RXJA 1OP8A 3MMGA 1COWD 2ZFPH 3M7UA 4I31A 4MPUA 3D23A 3RXBA 2ZTYA 2F9NA 3FN8A 1P2MA 1BTYA 1GCDA 5ABWA 4SGAE 1TPSA 4MPWA 5IK2D 2A4GA 4MQAA 2K0QA 2OD3B 5B6LA 3S9BA 1GG6C 3KL6A 4NCYA 3ZZ5A 1BBRE 5HM9A 3LGWA 3K6YA 1PQAA 1A7SA 3GY8A 1AKSB 3LGIA 3GOVB 5F6MA 1AN1E 4DURA 4VGCB 4ABIA 2G4TA 2G51A 1SLUB 4IN2A 3RXFA 4DY7B 1T4VH 2C90B 1K2I1 2D2DA 2FODA 1G32B 2WPMS 3PTNA 2FOAA 2BDIA 5E2OA 1ORFA 3VB4A 2WUBA 2PP6A 3ZZCA 2P94A 4ESTE 1GDQA 1LVBA 4TWYA 1XMNB 2ZFQH 1H8IH 1TQ7B 3SHAH 1GDNA 4FETA 1F0SA 1ZRKA 3PB1E 1BCUH 4K8BA 1AVWA 1FY3A 1MU8B 1A5HA 4U30A 3ZZAA 2GVFA 1CGJE 1GBFA 2CJIA 2ZPSA 4YLUA 4JK6A 5AF9H 1XKAC 3C1KA 2YMSB 2J4IA 1EZUC 1THPB 1O3GA 1O5BB 4IC6A 4ZHLU 2AMQA 2ZU4A 1CBWC 1SLWB 3FOAA 4DOQA 2J38A 1GJDB 1K21H 1WXRA 3LH3A 2J92A 1B7XB 1V2KT 3PWBA 1L1NA 4B74A 1NFUA 1VITF 2GCHF 1RRKA 1RD3B 4AC9A 1T8LA 2FX4A 1O2ZA 1RXPA 4JZIA 1AQ7A 1AWHB 2LPRA 3GY2A 3QGNB 3SU3A 1H9LB 4XBBA 4DJZB 4ZH8A 4ZMAH 1DXWA 1V2TT 1K1JA 1MD7A 4GHQA 3TNSA 1C1OA 1HJ8A 1CT4E 4YT7H 2QF0A 1VJ9U 1BZXE 1IQFA 1YLNA 3SQHE 2R3YA 3TH4H 2W5EA 4YOGA 5FX6A 5C20A 1TNIA 1EZXC 1EXFA 2ZI2H 1LHFH 1HNEE 1MQ5A 4XDEA 4Y0ZE 3MYWA 1Q31A 1SGRE 1B0EA 2YNBA 5JBCS 3SV6A 3U28C 2K8IA 1S82A 1Z8GA 3PO1B 1A3BH 4I8KA 3AW0A 4FUBA 1CHOG 1QBOA 2NU2E 2PV9B 1QHRB 4AFUA 8GCHF 2XTTB 3P8FA 3V12A 2ZU5A 1S83A 1VJAU 1GHYH 1P04A 1KXCA 2ZIQH 1UTLM 2Y81A 1XUFA 1OP0A 1F2SE 1LKBA 5T1VA 1HBTH 1LPGB 1EAIA 1FNIA 3A89A 2R3UA 3O8RA 3O8CA 1Y3YA 1W11U 3W1EA 2W6JD 3N7DA 3SORA 4X8VH 2PKSC 2ZTZA 2I6QA 5A0AE 4X1QU 4B6EA 5SGAE 2ZDAH 3M3VA 2P95A 2TGTA 2P93A 1SKYE 3QN7A 5BRRE 2O9QA 4ABGA 1NPMA 2ZU1A 3SGQE 1NROH 1NBME 9ESTA 1DY9A 3FZDA 1GBKA 1IAUA 1ZZZA 2B0FA 5T6DA 5A8YA 4Y76A 1BRBE 1FY5A 2VJ1A 4DG4A 3F0PA 2UUFB 1JIRA 2EC9H 4ZKOU 5EXMA 3NRLA 4Z1MD 3LGYA 2P3UB 4NA9H 1NFWA 4UFDH 1RS0A 3R3GB 1TALA 3TK6A 2BQ6B 2XCFA 5J4SA 4ZKSU 3M3TA 2IPHA 3GY3A 3H5CB 2ZHQH 2ZCHP 2F9VA 1GI3A 4K5ZA 2BLVA 5HKKD 1CA0C 1H4WA 4NIVA 1VZQH 4NA8A 5HYOA 4WMEA 5C1UA 1EAXA 1BT7A 1GI6A 4X0WU 4UFEH 3A7VA 1L1JA 1SQAA 1K1MA 1INCA 3MHWU 1EAWA 1O38A 2PUXB 2G52A 1ETRH 3W95A 2Z9GA 4UDWH 5GJ4B 2ZA5A 3UR9A 2Q6GA 2WPKS 1C2MA 2GZ9A 3ZIAD 2F43B 1K1IA 4XRNA 4CRGA 4FU8A 4GPGA 2FM2A 2G5VA 3B9FH 5L2ZH 3T2NA 2KCPA 3A88A 4KTSA 1V2OT 5E8EH 1W7GH 1WQVH 1OWJA 3SU1A 3QDZB 2A2XH 1O5DH 2FOMB 5C2ZA 1MKWK 1BTHH 3O8BA 1YPGH 3NWUA 3SI4H 2AS9A 4TWWA 2QN5T 4I7YH 2A7JA 1FMGA 2ZGHA 3GY7A 2PUQH 2A2QH 2HPQH 3QK1A 3MQKC 1K0HA 4Q7YA 4UEHH 2V35A 2VVVA 1RIWB 5EXNA 1T8NA 5GCHG 3MH5A 2F4LA 1Z6JH 3IWMA 4WH8A 4I8HA 1O36A 2OTVA 4ACBA 1BDAA 2SFAA 1P2NA 3SJIA 2BY6X 4H6SB 2A4QA 3MU0A 4MNVA 5DN6D 4TYDA 1FAXA 4B75A 1DLEA 1LPZB 3FO8D 1WAYB 3E6PH 4NZLA 2D26C 2XC5A 5DP7A 4AOQA 5C67A 3BIVH 2FOHA 3GICB 5EJLA 4WJG2 2F83A 4TY7A 2FP7B 2GV7A 6CHAB 4FUCA 1DDJA 1DSUA 4ABDA 4BXSA 2RA3A 3E0PB 2ANWA 2ODQA 3TJNA 4B1TA 1UVOA 2OLGA 1HGTH 1FZZA 3GDUA 2FPZA 4OM9A 3P8GA 3UY9A 5F03A 1ZSLA 1TAWA 1DUEA 2GDEH 1Y8TA 5F53A 1GI7B 4FUJA 4JYTA 1HUTH 1V2LT 2HRVA 3F2FA 4ASUD 3AVZA 3F9GA 1RTFB 2KM0A 1GI4A 1UHBA 4FU7A 1OSSA 5GCHF 2JKHA 1F92A 4Z0KA 4ZKRU 3VB5A 5E0GA 5PTPA 1O37A 4Q80A 2UUKB 3M61U 1EJNA 3MU8A 1O5FH 3WWFA 3LONA 5HIZA 1QRZA 1AUTC 4F55A 4DT4A 3DT0H 3SJOA 1H8ED 3MTYA 4JYUH 5T6GA 3DFLA 3F9EA 3HGNA 4AORA 5DSFA 4X6OA 1JOUB 1SGQE 2WPJS 5HGGA 4AG2A 1CO7E 3ZVAA 4INLA 5KGOA 1V3XA 1H9HE 3W94A 4M7GA 2HOBA 1BTXA 3PLBA 1V2PT 3JZ2B 1O3KA 2BLOA 2QGRA 1A0JA 4GHTA 1TNKA 4GCHF 4NIXA 4P00A 2Y5FA 4B73A 3DSOA 4YO9A 2WYJA 1KYNA 1GVKB 1WDIA 1P9SA 1AU8A 4NFEA 4YZUA 3PLKA 3R0FA 3OTPA 4ZXYH 1HIAA 1HLTH 1SGYE 2OBOA 3A82A 1P03A 3HATH 1ZMLA 2SGPE 3SN8A 5TCCA 4ASHA 7LPRA 2ZGJA 1ZMJA 3SW2B 2G8TA 3DSGA 4NA7A 2VVCA 1HPGA 1A61H 3M7QA 3L6PA 3RXUA 4DGJA 3RXHA 2OC8A 3A86A 1O2PA 3A7WA 1P2OA 2B5TB 4Y8ZA 1F0TA 3ZVDA 4X2WA 3RXLA 1XUIA 1O3IA 4YT6H 3SUGA 1N8OC 1TNLA 4YLQH 5DPAA 3PRBA 1AVXA 4U01A 1TNGA 5E2PA 2QF4A 1GMHF 1MTWA 4ABFA 2ZQ1A 1GBEA 3VXEH 2B9LA 2O8UA 4MLFB 4DIIH 2BVSH 4AFZA 3EE7A 1HJ9A 1JRSA 4X1SU 3PV5A 1ID5H 2F91A 1BHXF 4I8GA 1O2WA 1ANCA 4XSKU 1UVUH 1GVLA 3OEED 1J17T 2OBQA 2RDEA 2ZCLP 1NU7B 2FWWA 3A84A 2ANYA 1TE0A 3FP7E 4AZ2B 2XBXA 1VITH 1A5IA 1TA2A 4NG9H 4X2VA 2BQWB 3GCOA 3MO9A 4H42U 4I33A 1C5YB 2HALA 1DWDH 3BG4B 3QTVH 3G01A 2FXRA 1RJXB 1E35B 1UO6A 3RDZA 1O5GH 2H9TH 1AFEH 1NESE 1MTNC 2QA9E 3EA7A 3PLPA 4ACAA 1TMUH 4Y10E 2A31A 5EW2H 5C17A 2ZDNA 1SGFG 1SQRA 2FIRH 1NTPA 3RXGA 3ZVFA 5JBTA 3T28A 1KIGH 2DUCA 1XXFA 4XBDA 3TH2H 3RXPA 1UK3A 4LXBH 1GBBA 1UCYH 2BVXH 1S6HA 2SGQE 3UNQA 2THFB 1TMTH 4A5TS 1C1RA 1TNJA 1UK4A 2HNTF 4IBLH 1CGIE 2W6ID 1XXDA 1BMFD 2ZZUH 1V2RT 1NZQH 4IMZA 1TX6A 1C1UH 3UOPA 3MO3A 1BQYA 1C5LH 3UFAA 3RXRA 1EJMA 3RC6A 4CHAB 1IQLA 1ESTA 3RU4D 1UHBB 2QC2A 1C2DA 2ZHFH 3VB3A 4XFQA 4RN6A 3KNXA 2Z94A 3AAVA 1C2FA 2LELA 3U8RH 1AB9C 2KCOA 5ETXA 1MABB 4LOYH 2ASUB 3UUZA 4CR5A 1NM6A 5T6FA 1HCGA 2J97A 3V0XA 4B2CA 1TX8A 5GPIB 3SJKA 2H5DA 1PYTD 5JB8S 1O2SA 1ESBA 1O3AA 1UCYK 1IOEA 3BF6H 4O97A 3QUMP 7GCHG 1OP2A 3QO6A 4Y6DA 1Q3XA 3F6UH 3AK5A 4AGKA 1MBQA 4DT7B 1CA8B 1OS8A 2XRCA 5FBEA 2IJD1 2AIQA 2VNTA 3QLPH 1CT0E 3SU2A 1L0ZA 3LDXH 3E90B 5C3NA 2B7DH 4Q2KA 4WXVA 3SO3A 5BPEA 1DICA 3KCGH 2ZDVH 3LGVA 1BMMH 1A0HB 4AB8A 5C94A 1DX5M 3PTBA 1EPTC 3ESTA 5AFYH 2CN0H 3M35A 3OSYA 4E05H 4FUGA 2ZFFH 6LPRA 1BOQA 3BEFB 4RI0A 4I8LA 2Z9JA 3SV7A 3PM3A 3H7OA 3K6ZA 3I29A 1HAOH 3FP8E 1F7ZA 3GY5A 1QJ6B 3GISB 5HM2A 1P2JA 2BD3A 1SMFE 2VINA 4INKA 4ABBA 4UONA 5FCKA 3NKKA 1Z8IB 2FI4E 3BTTE 1O5AB 4OGYA 1SFQB 3KIDU 2QF5A 3P95A 1THSH 1OWHA 3PROA 1E36B 1ZSKA 4U32A 1SR5C 1YY3A 1HJAC 1NY22 2BD4A 4X6PA 1C5RA 1MAYA 1QBNA 3F1SB 3SV8A 1GBAA 1IQNA 1C4Y2 1PJPA 2NU1E 3EGKH 4OGXA 2O8LA 3AAUA 1MU6B 3GYMA 3Q3YA 2Z9KA 3UQOA 2W3IA 2ZDMA 2SGDE 1V2MT 1P57B 1WSSH 2J34A 1DITH 2CF9H 4Y79A 2AFQB 1FN6A 3M5OA 5B6OA 1ELAA 4K3JA 1RTLA 2G00A 2A5KA 1GJ6A 1V2WT 4MG3A 3VGCC 4WVPE 1EQ9A 3A7TA 3EQ0H 1NN6A 1AFQC 1W0ZU 1SHYA 4RSPA 3RXOA 1WTHD 4CR9A 1ZLRA 4BNRA 2XC4A 3QZQA 4RT0A 1ABJH 1J14A 1NS3A 1QJ7B 1C1QA 4NGAH 1C9PA 1GHBG 2Y5HA 4E06H 3SGAE 4INHA 5AVDA 1YCPH 1O2OA 1ZRBA 1O3MA 3RXDA 4BOHA 3RLYH 1G3EA 1S0QA 1MTSA 2ZO3H 1DLKB 2BVRH 3MH7A 2BD9A 4WMDA 5K0HA 2WHXA 1W2KH 4ABAA 1KLIH 1KXFA 1MTVA 2GP9B 5JBAS 1Z1IA 2Z3CA 2Z9IA 3GCHC 2HVYB 1DWEH 1FONA 3T29A 1SVPA 2BXTH 3ENSB 3MU4A 4TSFD 1QCPA 3EE0B 1N6XA 5DP3A 1LO6A 1WQSA 2R2WU 4Q7XA 3UNRA 2GCTC 1DWBH 1YPJH 4ZXXH 2OC0A 2F9OA 3PMJA 3TITA 5FAHA 1O2GH 3BN9A 2R0LA 1P0SH 3QX5H 1WOFA 2P3TB 2R2MB 4DVAU 1PQ8A 2BDGA 1GCTB 1C1TA 1GWAA 5KECA 3D62A 2JDID 4JK5A 1PPZA 4CRDA 3A7YA 2AMDA 1YCPK 2SNWA 1ARCA 3KQEA 4ABHA 4A6LA 1EPTA 2XXLA 2JETC 2Y82A 3DSPA 1GHBF 2XOKD 4QT8C 1A1RA 3LT3A 1ETTH 3LC3A 3MH4A 3ZZDA 1SBWA 1HAXB 2RDLA 2V6NA 5EXLA 3KQDA 2H5CA 1THRH 1AUJA 3O8DA 2XNDD 1K22H 1DANH 1TRYA 1BUIA 2LNCA 1KSNA 1O2XA 3QZRA 4FXGH 3BTME 3FAOA 3UIRA 1ELCA 3SOSA 3HK3B 2C8YB 2OUAA 2STBE 1QGFA 1OHHD 4NFFA 1EB2A 1K28D 3GYLB 1K1NA 1EUFA 2GDDA 4IN1A 3UREA 2KAIA 4ZCNA 1KXDA 2YOLA 4K60A 1GL0E 3A7XA 3KHVA 5EPYA 1GBJA 1Y5BT 1AMHA 1QA7A 1SFIA 1C5NH 1C5TA 1GL1A 1D3DB 1QL8A 1P05A 2WSSD 4JCNA 3M7TA 3A8DA 2IN2A 3P92A 3ZVCA 2G55A 2XCNA 2VWMA 1BJUA 4HG6A 4XE4A 2QV1A 2PTCE 3RM2H 3TK5A 3GS9A 2J95A 1GGDB 2ALPA 1JWTA 2WYGA 2BY9X 2VVUA 3L3TA 4JZEH 3N7OA 3RXQA 3A87A 2M2AA 4Q7ZA 3K9XB 2VGCB 3U8OH 2ZQ2A 2VIVA 1QRXA 1LHCH 1MKWH 2WPHS 1C1PA 5I25A 2O8TA 3ZV8A 3LOXA 4IC5A 1CHOF 2ZCKP 1BTZA 2FTLE 2J5UA 1FY8E 3CS0A 1ZTLA 1H8DH 2VU8E 1E0FD 1SGFA 2HVXA 1VGCC 1W7XH 1LQEA 4GVUA 4X2XA 4I8JA 5HXFA 1A4WH 3RC5A 3LH1A 1P3EA 5GNDA 3ZYDA 8LPRA 2P8OB 3TJVA 2FOEA 4OS7A 1YCPM 1O2IA 1UW7A 2G5NA 3CENA 4NZQA 3T26A 5C5NA 1W0YH 4MNWA 3BTDE 1HFDA 2CHAB 3SUEA 1C2GA 1ZHRA 3F2HA 3BTFE 4ZUHA 3PV2A 2DE9A 3M37A 5K7RA 4HFPB 1DPOA 2VWOA 4YTAA 3ZV9A 2BHGA 3WY8A 4D7GA 1V2UT 3V7TA 1DXPA 1EFRD 3CNRA 1HXEH 1ELGA 1F0RA 2WPIS 1O5CB 5KEDA 2C93B 4JMYA 2ZDKA 3ATMA 3U98H 2GMTC 5C1XA 5CMXH 1K9OE 1LVYA 3SBKA 2ZG0H 2A4RA 2GZ7A 1GVZA 1YGCH 1BRCE 2BYAX 3EYDA 2Q6FA 2ZHEH 1HAVA 2R0KA 3PMAB 1GDUA 2BY7X 4OS1A 3TJUA 1VCQA 2YMSD 2O8WA 3VEQB 1XM1A 1SGNE 4K1TA 2ZU3A 5LH8A 1YP9A 1FUJA 1IHSH 1XX9A 4U2WA 2VIPA 2BMGB 1FPHH 5CHAB 4A1VA 1PPCE 3L33A 3RXIA 3SGBE 3SUFA 5ESBA 2FZZA 5TJXA 2NU3E 2F9BH 2H9EH 3PMBB 4CRCA 2ODYB 2FYRA 1BHXB 1A5GH 3NK8A 3SU6A 2HPPH 1ZTKA 2A1DB 2CMYA 5CHBA 2JH0D 2UWOA 1YBWA 2Y7ZA 2TRMA 2Y6TA 5DJ7A 5FX5A 4M9FA 3VPKA 1ANEA 2BZAA 1UTOA 2A7CA 1DVAH 2OP9A 1GHWH 4MNYA 1TGTA 2A7HA 3HGPA 5FXLA 4X1PU 2OXSA 4VGCC 2VB0A 4NSYA 4BXWA 3TGJE 3ZZ7A 3A8CA 1C5OH 1VCWA 5FPTA 3T27A 1C5ZB 2Z3EA 1O2JA 4HGCA 4KELA 2ESTE 2QXGA 2A0QB 1WCZA 5C5OA 4OS2A 1T8MA 1AGJA 4Q4LA 2XWBI 1K1OA 2FDAA 3AW1A 3RXTA 9LPRA 3RXCA 1AO5A 5JB9S 2ZF0H 1HAIH 1SG8B 1WTGH 1TQ0B 2BXUH 2ILNA 2KAIB 3DCLA 4FU9A 4KP0A 3P8NA 3EAJA 1MTUA 1ETSH 3ATWA 1L2EA 4J1YA 3T62A 5A2MH 2GJGA 1C9TA 1EOJA 2PGQB 1GG6B 2YMSC 1TB6H 1HDTH 3RXVA 3K65B 2WV5A 5E0HA 4ISHH 3Q77A 1SB1H 2QAAA 2RCEA 1FY1A 4LK4A 1T7CA 3P17H 2XBYA 5F8TA 1D9IA 1S84A 1Y3UA 1DM4B 2BD7A 3MU1A 4AN7A 3LIWA 5LPFA 1QL7A 1F5RA 2VH6A 3U9AH 1V2NT 1E1QD 1YM0A 2HGTH 4K2YA 1C5XB 5FL7D 1J8AA 1G9IE 3VB7A 1IQMA 4ABEA 1O33A 3RP2A 1TABE 5GIBA 1QNJA 4ZKNU 3ODFA 4ISNA 1E37B 3URDA 3UWIA 3K2UA 1Y5UT 4LZ4B 2ZDLA 1EATA 1O2KA 2XYAA 3PMHB 3STJA 1LHEH 2VIQA 3ZVBA 5A8ZA 1YC0A 1SL3A 4HZHA 1HAPH 5GXPA 1G2MA 1V2JT 1C1VH 1OYTH 1XUGA 5JDUB 1PQ7A 2BD5A 2CV3A 2H6MA 1TLDA 4Y0YE 1QURH 5FBIA 3BV9B 3S69A 1Y3XA 2TPIZ 3BSQA 2WINI 5A8XA 5EG4A 4WH6A 1O31A 3RU4E 3U8TH 1A3EH 1CBWB 1J9CH 1TPOA 3PO1C 1C5UA 4CREA 1K1LA 1TBZH 1AE5A 1MCTA 2BDHA 1MMJN 2OC7A 3TVJB 3P6ZB 4JZDH 1W14U 2GD4B 2WUCA 4TT3D 1C2IA 1J16A 1LQDB 5L6NH 2FO9A 2ZGXH 2WPLS 1UVSH 2Y5GA 3MU5A 1GJ4H 1C1MA 1S6FA 3HPTB 3N99A 2TGAA 1MD8A 2I6SA 3E16B 1GJ9B 1W8BH 3ZZ9A 1HAYB 1ELVA 4CRBA 4FVBA 2OINA 3SI3H 3RMNH 5DP9A 1KXAA 4X8UH 3BTWE 3TGKE 2HNTE 1IQKA 2Q1JA 4X6MA 2OCVB 3EDXB 4XBCA 3UPEA 3FVFB 1HAVB 1JRTA 5L30H 1PPGE 1ZTJA 1AI8H 1MKXH 1GJBB 1IQIA 1UTKA 1NC6A 1ZSJA 3EA9A 1BMAA 3ZYEA 3M5NA 1QBVH 1YF4A 3D49H 4E7RG 1TFXA 1KXBA 3OEHD 4BAMB 5FHTA 3MNXA 2PWXA 2VIOA 1LCYA 2ZPQA 4BTUB 1HV7A 1OXGA 1NRSH 4ABJA 3SZEA 1L1GA 4YESB 1BTPA 2PHBA 1ELBA 3TH3H 2BLQA 3VFEA 3LC5A 5G4BA 3UWJH 3SU0A 1S81A 1EAUA 1N6YA 1ZGVA 2PKSB 3I77A 1DWCH 1NFXA 1C1NA 1GI0A 2RA0A 1IHTH 1T32A 4WMFA 5AHGH 4K8YA 4DW2U 2BD8A 3TJOA 3URCA 2BLWA 4OS5A 1SI5H 2QXIA 2WPDD 4UE7H 3TIUA 1H8HD 4X6NA 2A32A 2ZECA 1YWUA 5DK1A 4BTTB 1MKXK 3EA8A 1BBRK 4GLYA 2EQNA 1SPJA 1Z71A 2NU0E 4MDSA 1MCVA 2KCYA 1OWKA 3H09A 3T5FH 2BDAA 1Z8RA 4CH2B 4NIWA 1CSOE 4KTCA 1DOJA 3RXSA 3P8OA 1YLDA 4BTIB 3F3BA 1O2MA 3MH6A 2V3OH 1C1WH 3BG8A 1AVGH 1P8VC 1CA0B 2H2ZA 5DGJA 5J4QA 1G3DA 3VXFH 4D7FA 2ALVA 4MPXA 3A83A 1O39A 3A85A 3E0NB 2KX4A 4KKDA 1LKAA 4R8TB 3KQ5A 4OS4A 1O0DH 4LZ1H 4AB9A 1UTQA 5CDFE 1TGCA 1D3PB 1RIWC 1ANBA 2K1QA 1HAZB 1NRPH 2QCYA 4NWKA 1SGCA 1OOKB 3F9HA 1NRRH 2H9HA 3M5LA 2AMPA 3PYHA 2ZTXA 5A0CA 1C2HA 1GBIA 1O3LA 1SC8U 3DUXH 1L4DA 3UTUH 4B6FA 3SQEE 3F68H 1OPHB 3MWIU 1SGEE 2ZFTA 4MVNA 1HIAB 2NWNA 4O9VA 1XKBC 1MAXA 2LP6A 3TNTA 3I78A 4AFSA 3DA9B 6CHAC 3S7HB 3BTQE 1AHTH 1CVWH 2G81E 2BX3A 2AHME 5EW1H 1NRQH 1SGTA 1GBDA 4H4FA 2STAE 3RXAA 1DY8A 1P11E 4X8TH 1E79D 2FLBH 2RFKC 2AEIH 4RT1A 1GJAB 1AE8H 1YKTA 1O2TA 1SGDE 1WYKA 2PW8H 1FPCH 1WUNH 4BANB 2FLRH 2O8MA 7GCHF 3ZZ3A 4B2BA 1QY6A 3Q76A 1WV7H 3FFGA 1E34B 1B0FA 1DT2A 2VIWA 7ESTE 1FV9A 3B23B 3IITA 1P02A 2TGPZ 2A45B 1QQUA 1ZJDA 3MFJA 1EOLA 1C5VA 2A4OA 3QWCH 1O2NA 1V6DA 1E1RD 1UVTH 2OQUA 4K69A 1PYTC 1EZSC 4RKOB 2GKVE 4GSOA 1C2LA 1O3OA 3ZZ4A 1Z7KA 1TPPA 3WW7A 2QIQA 1FIZA 2HNTC 1QL9A 1FXYA 3CP7A 2FOCA 5A09A 3STIA 4BAKB 1EKBB 4YXWD 4I86A 1VITG 2GCHG 3M5MA 1A2CH 4IS5A 1MQ6A 1Y59T 1LVOA 1O2LA 2GX4A 4FUHA 1ZJKA 1KY9A 1SGIB 1AY6H 3SNAA 1YLCA 1T31A 4Y71A 1EJAA 5DP4A 2GZ8A 3UOUA 1O2HA 1GHVH 3LJJA 1C4V2 3UB0A 2C8XB 4JYVH 4ZHMU 4B2AA 2P16A 1G37A 3V3MA 1LHDH 2WZQA 4WF8A 3NUMA 1UCYE 3ZZBA 4F48B 2V0BA 3MNCA 1GI9B 3WWBA 2ZEBA 1YPKH 3TU7H 2CGAA 1T4UH 1OYQA 3RU4T 2SNVA 1GJ7B 1S5SA 1G3CA 3OYPA 3M36A 2EA3A 1GI8B 4F4OC 4MPVA 1QB1A 2PR3A 5DG6A 1E38B 3KN2A 1ELEE 1XVMA 2QYIA 3M3SA 4O3TA 8GCHG 1P10A 4CRAA 1IQEA 1LPKB 1ZHMA 2ZC9H 1GMCG 1ELFA 1H9IE 1JIMA 2ZPRA 2ANKH 3MNBA 5EODA 2AGGX 1H1BA 3OFND 1ANDA 1JMOH 2AYWA 4AYVB 3C27B 2VH0A 1OKXA 3E91A 3OX7U 2FTMA 1KDQA 4H6TA 4Y7AA 4AGJA 5EQQA 3RXKA 3SUDA 1SQOA 1V2VT 4A1TA 3AASA 2W7SA 3HKJB 1YPMH 5EQRA 3S9AA 2EY4C 4ISIH 1BB0B 4BAQB 4MTBA 1W13U 1PPHE 4B76A 1N1LA 1ZPZA 3KQCA 4D9QA 2GT7A 2V7QD 2FESH 1J15A 4ZROA 3SU4A 3RMLH 2XBVA 3OY5U 2BTCE 1CT2E 2XW9A 2HLDD 3GY4A 5LGOA 1OWDA 2JJ1D 4THNH 3E1XB 1OWEA 2QF3A 3BG4C 4UFFH 2W7UA 5JBBS 1AD8H 1QJ1B 1XUJA 4A1XA 1FI8A 2ZGBH 2QE7D 4YM9A 5IDKA 2RG3A 1QB9A 1QB6A 4SGBE 8ESTE 1O30A 2SGEE 1C5SA 1JBUH 2TGDA 2WV9A 3RC4A 1N8OB 1TPAE 3RXEA 3LGTA 6ESTA 1XUKA 1HYLA 1TONA 1XUHA 1GMCF 2EEKA 3SNCA 3E8LA 1Y3WA 3ZVGA 4K1SA 3LPRA 2J2UA 3KGPA 1GBTA 2WV4A 1T8OA 1O3NA 2F3CE 3ATLA 2ZGCA 1BTUA 1OWIA 1RTKA 5EJZA 1TGNA 1NFYA 1O2YA 2CXVA 3SYJA 4D76A 1B5GH 4IGDA 1C5WB 1ZOMA 1KTTB 5DP6A 1FN8A 2JH5D 2QY0B 4CBOA 2FOGA 2FOBA 5EPNA 4AG1A 2SGFE 1BITA 2P59A 3GDSA 2IPQX 3DHKH 4ISLA 2VWNA 2BY8X 3HK6B 1FX0B 1GBMA 4TPIZ 3A8AA 1P12E 1AZ8A 3KQBA 3MNSA 5JYIA 1HRTH 4CHAC 5H4IB 2FS8A 2CK3D 1TA6A 1W12U 2Z3DA 2FX6A 2ZWLH 2EI7A 1P9UA 3SNEA 1M9UA 1MTNB 3SNBA 1SSXA 1LDTT 3RUOA 4F49A 4B71A 3GDVA 2BZ6H 2D1JA 3A81A 5DP5A 1BRUP 2PTNA 4KGAA 2BB4A 1D6RA 4X8SH 2H1UA 3SZNA 1SOZA 3F2GA 2KZ4A 3T25A 1BTWA 3VG8A 1NRNH 2ODPA 1Y3VA 2UUYA 1ZMNA 1S6LA 2C3SA 2Y7XA 3PRDA 4FUDA 5TCAA 1RFNA 5DP8A 3S0NA 1MZAA 3ATKA 1AIXH 1C5MD 4J2YB 1S0RA 3UQVA 1C5PA 3TLOA 3KF2A 1O3JA 3DFJA 2FS9A 5I46H 1P01A 3U1IB 1O32A 1HAGE 2ANMH 1CGHA 1UMAH 4R0IA 1FJSA 3OAAD 2J98A 3F9FA 2PSYA 1W3CA 1AZZA 4MNXA 1G2LA 5HMAA 3Q3KA 1TX7A 1EZQA 3ATIA 3U1JB 3IG6B 2ZKSA 1BA8B 2BDCA 4JZ1A 2Q6DA 4FVDA 1FDPA 1O2VA 2BX4A 1YYY1 2ZNKH 4PROA 1AB9B 4Y8YA 1A46H 1TRNA 1YPEH 5EGMA 2AGIX 2IJOB 1WBGB 1O5EH 4X2YA 1XVOA 2FOFA 4O3UA 2PFEA 2EI8A 3PWCA 3LKWA 4WXIA 2XWAA 2EI6A 1P2IA 1QTFA 2ZFRH 3OTJE 2BDYA 3GY6A 3TK9A 2BOKA 1S85A 1F5KU 1GHZA 2F9UA 5IYTA 5A0BA 1NBMD 3ODDA 3KEEA 2AIPA 1GMDG 2GT8A 3BTHE 3TGIE 1IQHA 3B8JA 1QZ8A 3GCTG 1KDQB 1EPTB 1MZDA 1O3BA 3NCLA 1O3EA 1ZR0A 1ELTA 4FUFA 1NT1A 3UNSA 1GI1A 1Y5AT 1UTPA 3N7EA 1P09A 4Y11E 1UTNA 4AFQA 1DS2E 1QR3E 3BEUA 2UWPA 2FMJA 2FYQA 2PSXA 1D3TB 1UVPA 2GGVB 2UUJB 5C0UA 8KME2 4A7IB 1VR1H 1LHGH 3OU0A 4ZAEA 3U69H 1IQGA 3P70B 2V3HH 1C5QA 2JJ2D 2CF8H 1ZPBA 1ACBE 5DO4H 4GCHG 1C2EA 6GCHG 2V3MA 2FEQH 2PKAA 1CHGA 2R9PA 1HJAB 2AGEX 3DD2H 3Q3XA 2HLCA 3OY6U 3S9CA 1G3BA 2VIDA 1D4PB 3LJOA 3ZVEA 1QIXB 4Y8XA 2VBCA 5E0JA 3ELAH 2BY5X 1P2QA 1QRWA 1GMDF 3NPSA 1Q2WA 3SU5A 1EB1H 5EOKA 1HB0B 3GCTF 4WY3A 2L6OA 4CRFA 3A80A 1PPEE 1D6WA 2F9PA 3E3TA 1ARBA 4X1NU 3ZZ6A 1BMNH 4ISOA 2FI3E 3SJ9A 1ZGIA 1D3QB 5GDSH 1O35A 4KTUA 2YNAA 1SQTA 3VGCB 2C8ZB 1YPHE 4RKJB 1AFQB 1GMHG 2IOTA 2QXJA 1GCTC 1PPBH 3ITIA 4HI3A 4FOUC 5EIYA 2W26A 4BAHB 1TGSZ 5FPYA 2P3FH 1V2QT 1AWFH 4FUEA 1TOCB 1GBLA 1LMWB 6GCHF 1HAHH 1FIWA 1KMHB 1TBRH 1GI2A 4WWYA 1FY4A 1CE5A 1CQQA 3SNDA 4NIYA 1U6QA 1O3HA 5C0TA 1QA0A 1QFKH 2PLXA 1ELDE 4XD7D 5F8XA 3SJ8A 1ZYOA 1PFXC 1FLEE 1SLVB 1Z8JB 3RM0H 3A7ZA 1BJVA 2C4FH 3BEIB 4GUXA 3GCHB 5EQSA 1TWXB 1TGBA 1NO9H 2UWLA 2VWLA 4DIHH 5DKMA 1KLTA 2GCTB 4D8NA 4IMQA 3BTKE 3MO6A 5CE1A 2J98B 2JIZD 3QGJA 2AH4X 1EP5A 3KYGA 3LGUA 3SV9A 2PGBB 1V2ST 1O2UA 1O3PB 1C2KA 1O3CA 5L2YH 4D9RA 1DE7H 1SGPE 1G30B 2Y80A 2C8WB 2BD2A 1TRMA 2XNIA 5ESTE 2JETB 4AX9H 1AKSA 1BBRH 2JH6D 1P06A 5EJ1A 3PV4A 3V13A 2ULLA
chains in the Genus database with same CATH topology
3L6PA 3KNXA 5EQRA 4A92A 2YMSB 2OC8A 2FP7B 3KF2A 1RTLA 2LELA 2VBCA 2YMSD 2KCOA 2XCFA 4Q63A 5ETXA 1MABB 4ZCNA 3U1IB 4B76A 1N1LA 2WPDD 2YOLA 3FOAA 2V7QD 3SUGA 1WXRA 2F9VA 5EPYA 1H8HD 3SU4A 1E1RD 3PRBA 4A1VA 4U01A 5GPIB 3SU5A 5HKKD 2KCAA 4B74A 3OAAD 1NS3A 2QF4A 3SUFA 1JXPA 5ESBA 2WSSD 1W3CA 2L6OA 2HLDD 2OC1A 4OM9A 1BT7A 2JJ1D 4B75A 4NWLA 3AK5A 2KCYA 2XCNA 3WW7A 3SU6A 3H09A 3U1JB 2QV1A 3PV5A 3GS9A 5F53A 4A1XA 5CHBA 2QE7D 4WH6A 3F2FA 2IJD1 3SU3A 5IDKA 4ASUD 1W0JD 3OEED 3SU2A 4KTCA 1DXWA 1CU1A 3E90B 2OBQA 2KM0A 3P8OA 4M9FA 4YXWD 2M2AA 5GJ4B 3F3BA 2WHXA 2IJOB 3M5MA 2WV9A 3RC4A 3F0OA 2OC7A 3ZIAD 1COWD 2F43B 3LKWA 4TT3D 3LOXA 4I31A 2FM2A 4I33A 5FPYA 2J5UA 3FN8A 4R8TB 3FKSD 2OK5A 4TSFD 2KCPA 5FPTA 5IK2D 4RI0A 3UB0A 3WWFA 3LONA 3N99A 5CDFE 3SU1A 2A4GA 4F55A 3SV7A 2OC0A 1KMHB 2K0QA 3SYJA 4DT4A 2F9UA 5B6LA 2K1QA 4NWKA 3SV6A 1H8ED 2K8IA 1NBMD 2FOMB 2OINA 2WZQA 3KEEA 3M5LA 4Q4LA 4WF8A 5DSFA 3RC5A 5C0TA 5GNDA 5C17A 4XD7D 3O8BA 3WWBA 5EPNA 2P59A 1FX0B 3OYPA 1W0KD 2JDID 2QF5A 5EQSA 4B6FA 5T1VA 3N7EA 2KFWA 5H4IB 3DCLA 3SUEA 3O8RA 1RGQA 3P8NA 5FPSA 3O8CA 3F2HA 3DSPA 3W1EA 2W6JD 3N7DA 2XOKD 3PV2A 2CK3D 4B73A 1A1RA 3KN2A 3DSOA 3M5NA 2F4LA 3OEHD 2GGVB 2YMSC 4WH8A 5C0UA 2JIZD 4B6EA 3O8DA 3SV8A 2XNDD 4B71A 3OTPA 1SKYE 3SV9A 2W6ID 2AHME 1BMFD 1DXPA 1EFRD 2OBOA 4I32A 2JJ2D 3OE7D 2KR7A 1DY8A 1NBME 2A4QA 4A1TA 1E79D 4FETA 3OFND 5DN6D 4TYDA 1DY9A 1E1QD 3F2GA 2XNIA 2KZ4A 4JMYA 4K8BA 3RC6A 3SZEA 3VG8A 5FL7D 3FO8D 1S6LA 3PRDA 1OHHD 2A4RA 3F0PA 2GVFA 5EQQA 3EYDA 3SUDA 3M5OA 2O8MA 3NRLA 4Z1MD 3SU0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KCO A;  2KCY A;  2KCP A; 
#chains in the Genus database with same CATH topology
 1KTS B;  4TY6 A;  3SV2 H;  3D65 E;  1BML A;  1BIO A;  1GGD C;  1GJ8 B;  4CBN A;  2Z9L A;  1P2K A;  4Q63 A;  2XC0 A;  2GTB A;  5GWZ A;  3SHC H;  5FCR A;  2VGC C;  1SOT A;  4FUI A;  1GHA G;  2SGA A;  2J9N A;  3MOC A;  2KCA A;  3RMO H;  1JXP A;  2FI5 E;  1DST A;  4Z6A H;  1MH0 A;  1TOM H;  2GV6 A;  3H7T A;  4GAW A;  4NSV A;  3QTO H;  4XOJ A;  4NWL A;  1G36 A;  1GI5 A;  3ZZ8 A;  2HWL B;  1BRA A;  1GJ5 H;  3NXP A;  3BTE E;  2Z7F E;  5AFZ H;  3HKI B;  3JZ1 B;  2L74 A;  4IW4 E;  3RLW H;  1YPL H;  1O2Q A;  3UAI C;  3Q00 A;  2AER H;  2J94 A;  2P8O C;  2QXH A;  3F0O A;  1QQ4 A;  2G4U A;  4X1R U;  1GJC B;  1ZHP A;  1O2R A;  1UTJ A;  1IQJ A;  3RXM A;  2TBS A;  1DUA A;  1PQ5 A;  4HTC H;  2ZFS A;  3FKS D;  2OK5 A;  2CHA C;  5F8Z A;  1OX1 A;  2BDB A;  1X7A C;  1TIO A;  4P02 A;  7KME H;  3GCN A;  2ZHD A;  1WU1 A;  1O34 A;  1LVM A;  2BQ7 B;  3RMM H;  2ZHW H;  4K1E A;  1O3F A;  1EX3 A;  1K1P A;  1TBQ H;  1FQ3 A;  3FAN A;  1Z1J A;  1UJ1 A;  2PKA B;  4DCD A;  1TYN A;  1L4Z A;  1ABI H;  1P3C A;  5LPE A;  2OQ5 A;  4OS6 A;  1TMB H;  3NZI A;  2XBW A;  1W0K D;  2ZU2 A;  1C4U 2;  1GHA F;  2KFW A;  2D8W A;  3FP6 E;  1RGQ A;  5FPS A;  4UD9 H;  1GPZ A;  4UFG H;  1VGC B;  3KYF A;  4Y7B A;  4CH8 B;  1EAS A;  1EP6 A;  1UTM A;  3UR6 A;  1SLX B;  4BAO B;  4TPY A;  4ZHA A;  4YOJ A;  5LPR A;  4I32 A;  1HXF H;  2DE8 A;  2M5T A;  3OE7 D;  1F5L A;  2KR7 A;  5CHA C;  4YOI A;  3BTG E;  2ZP0 H;  3TPI Z;  1GHX H;  1LTO A;  1KLJ H;  2B8O H;  1YPH C;  5HIY A;  1SHH B;  1O3D A;  1KXE A;  4A92 A;  1NU9 A;  1MUE B;  1GBH A;  2BM2 A;  3A8B A;  2TIO A;  2NU4 E;  5C1Y A;  1Z6E A;  1MBM A;  1GBC A;  1DFP A;  3FZZ A;  3VB6 A;  5JPM H;  1VKY A;  1VCP A;  2Z6B D;  4O03 A;  2GMT B;  1F0U A;  5T3H A;  1TNH A;  1ZPC A;  2OC1 A;  2A5I A;  3LU9 B;  5EU8 A;  3MI4 A;  3BIU H;  1A0L A;  1ESA A;  2BOH B;  2A5A A;  1W0J D;  4E7N A;  1UK2 A;  4JZF H;  1CU1 A;  1PPF E;  1C1S A;  1FAK H;  2W3K A;  4AYY B;  3CS7 A;  1W10 U;  1C2J A;  3S7K B;  3RXJ A;  1OP8 A;  3MMG A;  1COW D;  2ZFP H;  3M7U A;  4I31 A;  4MPU A;  3D23 A;  3RXB A;  2ZTY A;  2F9N A;  3FN8 A;  1P2M A;  1BTY A;  1GCD A;  5ABW A;  4SGA E;  1TPS A;  4MPW A;  5IK2 D;  2A4G A;  4MQA A;  2K0Q A;  2OD3 B;  5B6L A;  3S9B A;  1GG6 C;  3KL6 A;  4NCY A;  3ZZ5 A;  1BBR E;  5HM9 A;  3LGW A;  3K6Y A;  1PQA A;  1A7S A;  3GY8 A;  1AKS B;  3LGI A;  3GOV B;  5F6M A;  1AN1 E;  4DUR A;  4VGC B;  4ABI A;  2G4T A;  2G51 A;  1SLU B;  4IN2 A;  3RXF A;  4DY7 B;  1T4V H;  2C90 B;  1K2I 1;  2D2D A;  2FOD A;  1G32 B;  2WPM S;  3PTN A;  2FOA A;  2BDI A;  5E2O A;  1ORF A;  3VB4 A;  2WUB A;  2PP6 A;  3ZZC A;  2P94 A;  4EST E;  1GDQ A;  1LVB A;  4TWY A;  1XMN B;  2ZFQ H;  1H8I H;  1TQ7 B;  3SHA H;  1GDN A;  4FET A;  1F0S A;  1ZRK A;  3PB1 E;  1BCU H;  4K8B A;  1AVW A;  1FY3 A;  1MU8 B;  1A5H A;  4U30 A;  3ZZA A;  2GVF A;  1CGJ E;  1GBF A;  2CJI A;  2ZPS A;  4YLU A;  4JK6 A;  5AF9 H;  1XKA C;  3C1K A;  2YMS B;  2J4I A;  1EZU C;  1THP B;  1O3G A;  1O5B B;  4IC6 A;  4ZHL U;  2AMQ A;  2ZU4 A;  1CBW C;  1SLW B;  3FOA A;  4DOQ A;  2J38 A;  1GJD B;  1K21 H;  1WXR A;  3LH3 A;  2J92 A;  1B7X B;  1V2K T;  3PWB A;  1L1N A;  4B74 A;  1NFU A;  1VIT F;  2GCH F;  1RRK A;  1RD3 B;  4AC9 A;  1T8L A;  2FX4 A;  1O2Z A;  1RXP A;  4JZI A;  1AQ7 A;  1AWH B;  2LPR A;  3GY2 A;  3QGN B;  3SU3 A;  1H9L B;  4XBB A;  4DJZ B;  4ZH8 A;  4ZMA H;  1DXW A;  1V2T T;  1K1J A;  1MD7 A;  4GHQ A;  3TNS A;  1C1O A;  1HJ8 A;  1CT4 E;  4YT7 H;  2QF0 A;  1VJ9 U;  1BZX E;  1IQF A;  1YLN A;  3SQH E;  2R3Y A;  3TH4 H;  2W5E A;  4YOG A;  5FX6 A;  5C20 A;  1TNI A;  1EZX C;  1EXF A;  2ZI2 H;  1LHF H;  1HNE E;  1MQ5 A;  4XDE A;  4Y0Z E;  3MYW A;  1Q31 A;  1SGR E;  1B0E A;  2YNB A;  5JBC S;  3SV6 A;  3U28 C;  2K8I A;  1S82 A;  1Z8G A;  3PO1 B;  1A3B H;  4I8K A;  3AW0 A;  4FUB A;  1CHO G;  1QBO A;  2NU2 E;  2PV9 B;  1QHR B;  4AFU A;  8GCH F;  2XTT B;  3P8F A;  3V12 A;  2ZU5 A;  1S83 A;  1VJA U;  1GHY H;  1P04 A;  1KXC A;  2ZIQ H;  1UTL M;  2Y81 A;  1XUF A;  1OP0 A;  1F2S E;  1LKB A;  5T1V A;  1HBT H;  1LPG B;  1EAI A;  1FNI A;  3A89 A;  2R3U A;  3O8R A;  3O8C A;  1Y3Y A;  1W11 U;  3W1E A;  2W6J D;  3N7D A;  3SOR A;  4X8V H;  2PKS C;  2ZTZ A;  2I6Q A;  5A0A E;  4X1Q U;  4B6E A;  5SGA E;  2ZDA H;  3M3V A;  2P95 A;  2TGT A;  2P93 A;  1SKY E;  3QN7 A;  5BRR E;  2O9Q A;  4ABG A;  1NPM A;  2ZU1 A;  3SGQ E;  1NRO H;  1NBM E;  9EST A;  1DY9 A;  3FZD A;  1GBK A;  1IAU A;  1ZZZ A;  2B0F A;  5T6D A;  5A8Y A;  4Y76 A;  1BRB E;  1FY5 A;  2VJ1 A;  4DG4 A;  3F0P A;  2UUF B;  1JIR A;  2EC9 H;  4ZKO U;  5EXM A;  3NRL A;  4Z1M D;  3LGY A;  2P3U B;  4NA9 H;  1NFW A;  4UFD H;  1RS0 A;  3R3G B;  1TAL A;  3TK6 A;  2BQ6 B;  2XCF A;  5J4S A;  4ZKS U;  3M3T A;  2IPH A;  3GY3 A;  3H5C B;  2ZHQ H;  2ZCH P;  2F9V A;  1GI3 A;  4K5Z A;  2BLV A;  5HKK D;  1CA0 C;  1H4W A;  4NIV A;  1VZQ H;  4NA8 A;  5HYO A;  4WME A;  5C1U A;  1EAX A;  1BT7 A;  1GI6 A;  4X0W U;  4UFE H;  3A7V A;  1L1J A;  1SQA A;  1K1M A;  1INC A;  3MHW U;  1EAW A;  1O38 A;  2PUX B;  2G52 A;  1ETR H;  3W95 A;  2Z9G A;  4UDW H;  5GJ4 B;  2ZA5 A;  3UR9 A;  2Q6G A;  2WPK S;  1C2M A;  2GZ9 A;  3ZIA D;  2F43 B;  1K1I A;  4XRN A;  4CRG A;  4FU8 A;  4GPG A;  2FM2 A;  2G5V A;  3B9F H;  5L2Z H;  3T2N A;  2KCP A;  3A88 A;  4KTS A;  1V2O T;  5E8E H;  1W7G H;  1WQV H;  1OWJ A;  3SU1 A;  3QDZ B;  2A2X H;  1O5D H;  2FOM B;  5C2Z A;  1MKW K;  1BTH H;  3O8B A;  1YPG H;  3NWU A;  3SI4 H;  2AS9 A;  4TWW A;  2QN5 T;  4I7Y H;  2A7J A;  1FMG A;  2ZGH A;  3GY7 A;  2PUQ H;  2A2Q H;  2HPQ H;  3QK1 A;  3MQK C;  1K0H A;  4Q7Y A;  4UEH H;  2V35 A;  2VVV A;  1RIW B;  5EXN A;  1T8N A;  5GCH G;  3MH5 A;  2F4L A;  1Z6J H;  3IWM A;  4WH8 A;  4I8H A;  1O36 A;  2OTV A;  4ACB A;  1BDA A;  2SFA A;  1P2N A;  3SJI A;  2BY6 X;  4H6S B;  2A4Q A;  3MU0 A;  4MNV A;  5DN6 D;  4TYD A;  1FAX A;  4B75 A;  1DLE A;  1LPZ B;  3FO8 D;  1WAY B;  3E6P H;  4NZL A;  2D26 C;  2XC5 A;  5DP7 A;  4AOQ A;  5C67 A;  3BIV H;  2FOH A;  3GIC B;  5EJL A;  4WJG 2;  2F83 A;  4TY7 A;  2FP7 B;  2GV7 A;  6CHA B;  4FUC A;  1DDJ A;  1DSU A;  4ABD A;  4BXS A;  2RA3 A;  3E0P B;  2ANW A;  2ODQ A;  3TJN A;  4B1T A;  1UVO A;  2OLG A;  1HGT H;  1FZZ A;  3GDU A;  2FPZ A;  4OM9 A;  3P8G A;  3UY9 A;  5F03 A;  1ZSL A;  1TAW A;  1DUE A;  2GDE H;  1Y8T A;  5F53 A;  1GI7 B;  4FUJ A;  4JYT A;  1HUT H;  1V2L T;  2HRV A;  3F2F A;  4ASU D;  3AVZ A;  3F9G A;  1RTF B;  2KM0 A;  1GI4 A;  1UHB A;  4FU7 A;  1OSS A;  5GCH F;  2JKH A;  1F92 A;  4Z0K A;  4ZKR U;  3VB5 A;  5E0G A;  5PTP A;  1O37 A;  4Q80 A;  2UUK B;  3M61 U;  1EJN A;  3MU8 A;  1O5F H;  3WWF A;  3LON A;  5HIZ A;  1QRZ A;  1AUT C;  4F55 A;  4DT4 A;  3DT0 H;  3SJO A;  1H8E D;  3MTY A;  4JYU H;  5T6G A;  3DFL A;  3F9E A;  3HGN A;  4AOR A;  5DSF A;  4X6O A;  1JOU B;  1SGQ E;  2WPJ S;  5HGG A;  4AG2 A;  1CO7 E;  3ZVA A;  4INL A;  5KGO A;  1V3X A;  1H9H E;  3W94 A;  4M7G A;  2HOB A;  1BTX A;  3PLB A;  1V2P T;  3JZ2 B;  1O3K A;  2BLO A;  2QGR A;  1A0J A;  4GHT A;  1TNK A;  4GCH F;  4NIX A;  4P00 A;  2Y5F A;  4B73 A;  3DSO A;  4YO9 A;  2WYJ A;  1KYN A;  1GVK B;  1WDI A;  1P9S A;  1AU8 A;  4NFE A;  4YZU A;  3PLK A;  3R0F A;  3OTP A;  4ZXY H;  1HIA A;  1HLT H;  1SGY E;  2OBO A;  3A82 A;  1P03 A;  3HAT H;  1ZML A;  2SGP E;  3SN8 A;  5TCC A;  4ASH A;  7LPR A;  2ZGJ A;  1ZMJ A;  3SW2 B;  2G8T A;  3DSG A;  4NA7 A;  2VVC A;  1HPG A;  1A61 H;  3M7Q A;  3L6P A;  3RXU A;  4DGJ A;  3RXH A;  2OC8 A;  3A86 A;  1O2P A;  3A7W A;  1P2O A;  2B5T B;  4Y8Z A;  1F0T A;  3ZVD A;  4X2W A;  3RXL A;  1XUI A;  1O3I A;  4YT6 H;  3SUG A;  1N8O C;  1TNL A;  4YLQ H;  5DPA A;  3PRB A;  1AVX A;  4U01 A;  1TNG A;  5E2P A;  2QF4 A;  1GMH F;  1MTW A;  4ABF A;  2ZQ1 A;  1GBE A;  3VXE H;  2B9L A;  2O8U A;  4MLF B;  4DII H;  2BVS H;  4AFZ A;  3EE7 A;  1HJ9 A;  1JRS A;  4X1S U;  3PV5 A;  1ID5 H;  2F91 A;  1BHX F;  4I8G A;  1O2W A;  1ANC A;  4XSK U;  1UVU H;  1GVL A;  3OEE D;  1J17 T;  2OBQ A;  2RDE A;  2ZCL P;  1NU7 B;  2FWW A;  3A84 A;  2ANY A;  1TE0 A;  3FP7 E;  4AZ2 B;  2XBX A;  1VIT H;  1A5I A;  1TA2 A;  4NG9 H;  4X2V A;  2BQW B;  3GCO A;  3MO9 A;  4H42 U;  4I33 A;  1C5Y B;  2HAL A;  1DWD H;  3BG4 B;  3QTV H;  3G01 A;  2FXR A;  1RJX B;  1E35 B;  1UO6 A;  3RDZ A;  1O5G H;  2H9T H;  1AFE H;  1NES E;  1MTN C;  2QA9 E;  3EA7 A;  3PLP A;  4ACA A;  1TMU H;  4Y10 E;  2A31 A;  5EW2 H;  5C17 A;  2ZDN A;  1SGF G;  1SQR A;  2FIR H;  1NTP A;  3RXG A;  3ZVF A;  5JBT A;  3T28 A;  1KIG H;  2DUC A;  1XXF A;  4XBD A;  3TH2 H;  3RXP A;  1UK3 A;  4LXB H;  1GBB A;  1UCY H;  2BVX H;  1S6H A;  2SGQ E;  3UNQ A;  2THF B;  1TMT H;  4A5T S;  1C1R A;  1TNJ A;  1UK4 A;  2HNT F;  4IBL H;  1CGI E;  2W6I D;  1XXD A;  1BMF D;  2ZZU H;  1V2R T;  1NZQ H;  4IMZ A;  1TX6 A;  1C1U H;  3UOP A;  3MO3 A;  1BQY A;  1C5L H;  3UFA A;  3RXR A;  1EJM A;  3RC6 A;  4CHA B;  1IQL A;  1EST A;  3RU4 D;  1UHB B;  2QC2 A;  1C2D A;  2ZHF H;  3VB3 A;  4XFQ A;  4RN6 A;  3KNX A;  2Z94 A;  3AAV A;  1C2F A;  2LEL A;  3U8R H;  1AB9 C;  2KCO A;  5ETX A;  1MAB B;  4LOY H;  2ASU B;  3UUZ A;  4CR5 A;  1NM6 A;  5T6F A;  1HCG A;  2J97 A;  3V0X A;  4B2C A;  1TX8 A;  5GPI B;  3SJK A;  2H5D A;  1PYT D;  5JB8 S;  1O2S A;  1ESB A;  1O3A A;  1UCY K;  1IOE A;  3BF6 H;  4O97 A;  3QUM P;  7GCH G;  1OP2 A;  3QO6 A;  4Y6D A;  1Q3X A;  3F6U H;  3AK5 A;  4AGK A;  1MBQ A;  4DT7 B;  1CA8 B;  1OS8 A;  2XRC A;  5FBE A;  2IJD 1;  2AIQ A;  2VNT A;  3QLP H;  1CT0 E;  3SU2 A;  1L0Z A;  3LDX H;  3E90 B;  5C3N A;  2B7D H;  4Q2K A;  4WXV A;  3SO3 A;  5BPE A;  1DIC A;  3KCG H;  2ZDV H;  3LGV A;  1BMM H;  1A0H B;  4AB8 A;  5C94 A;  1DX5 M;  3PTB A;  1EPT C;  3EST A;  5AFY H;  2CN0 H;  3M35 A;  3OSY A;  4E05 H;  4FUG A;  2ZFF H;  6LPR A;  1BOQ A;  3BEF B;  4RI0 A;  4I8L A;  2Z9J A;  3SV7 A;  3PM3 A;  3H7O A;  3K6Z A;  3I29 A;  1HAO H;  3FP8 E;  1F7Z A;  3GY5 A;  1QJ6 B;  3GIS B;  5HM2 A;  1P2J A;  2BD3 A;  1SMF E;  2VIN A;  4INK A;  4ABB A;  4UON A;  5FCK A;  3NKK A;  1Z8I B;  2FI4 E;  3BTT E;  1O5A B;  4OGY A;  1SFQ B;  3KID U;  2QF5 A;  3P95 A;  1THS H;  1OWH A;  3PRO A;  1E36 B;  1ZSK A;  4U32 A;  1SR5 C;  1YY3 A;  1HJA C;  1NY2 2;  2BD4 A;  4X6P A;  1C5R A;  1MAY A;  1QBN A;  3F1S B;  3SV8 A;  1GBA A;  1IQN A;  1C4Y 2;  1PJP A;  2NU1 E;  3EGK H;  4OGX A;  2O8L A;  3AAU A;  1MU6 B;  3GYM A;  3Q3Y A;  2Z9K A;  3UQO A;  2W3I A;  2ZDM A;  2SGD E;  1V2M T;  1P57 B;  1WSS H;  2J34 A;  1DIT H;  2CF9 H;  4Y79 A;  2AFQ B;  1FN6 A;  3M5O A;  5B6O A;  1ELA A;  4K3J A;  1RTL A;  2G00 A;  2A5K A;  1GJ6 A;  1V2W T;  4MG3 A;  3VGC C;  4WVP E;  1EQ9 A;  3A7T A;  3EQ0 H;  1NN6 A;  1AFQ C;  1W0Z U;  1SHY A;  4RSP A;  3RXO A;  1WTH D;  4CR9 A;  1ZLR A;  4BNR A;  2XC4 A;  3QZQ A;  4RT0 A;  1ABJ H;  1J14 A;  1NS3 A;  1QJ7 B;  1C1Q A;  4NGA H;  1C9P A;  1GHB G;  2Y5H A;  4E06 H;  3SGA E;  4INH A;  5AVD A;  1YCP H;  1O2O A;  1ZRB A;  1O3M A;  3RXD A;  4BOH A;  3RLY H;  1G3E A;  1S0Q A;  1MTS A;  2ZO3 H;  1DLK B;  2BVR H;  3MH7 A;  2BD9 A;  4WMD A;  5K0H A;  2WHX A;  1W2K H;  4ABA A;  1KLI H;  1KXF A;  1MTV A;  2GP9 B;  5JBA S;  1Z1I A;  2Z3C A;  2Z9I A;  3GCH C;  2HVY B;  1DWE H;  1FON A;  3T29 A;  1SVP A;  2BXT H;  3ENS B;  3MU4 A;  4TSF D;  1QCP A;  3EE0 B;  1N6X A;  5DP3 A;  1LO6 A;  1WQS A;  2R2W U;  4Q7X A;  3UNR A;  2GCT C;  1DWB H;  1YPJ H;  4ZXX H;  2OC0 A;  2F9O A;  3PMJ A;  3TIT A;  5FAH A;  1O2G H;  3BN9 A;  2R0L A;  1P0S H;  3QX5 H;  1WOF A;  2P3T B;  2R2M B;  4DVA U;  1PQ8 A;  2BDG A;  1GCT B;  1C1T A;  1GWA A;  5KEC A;  3D62 A;  2JDI D;  4JK5 A;  1PPZ A;  4CRD A;  3A7Y A;  2AMD A;  1YCP K;  2SNW A;  1ARC A;  3KQE A;  4ABH A;  4A6L A;  1EPT A;  2XXL A;  2JET C;  2Y82 A;  3DSP A;  1GHB F;  2XOK D;  4QT8 C;  1A1R A;  3LT3 A;  1ETT H;  3LC3 A;  3MH4 A;  3ZZD A;  1SBW A;  1HAX B;  2RDL A;  2V6N A;  5EXL A;  3KQD A;  2H5C A;  1THR H;  1AUJ A;  3O8D A;  2XND D;  1K22 H;  1DAN H;  1TRY A;  1BUI A;  2LNC A;  1KSN A;  1O2X A;  3QZR A;  4FXG H;  3BTM E;  3FAO A;  3UIR A;  1ELC A;  3SOS A;  3HK3 B;  2C8Y B;  2OUA A;  2STB E;  1QGF A;  1OHH D;  4NFF A;  1EB2 A;  1K28 D;  3GYL B;  1K1N A;  1EUF A;  2GDD A;  4IN1 A;  3URE A;  2KAI A;  4ZCN A;  1KXD A;  2YOL A;  4K60 A;  1GL0 E;  3A7X A;  3KHV A;  5EPY A;  1GBJ A;  1Y5B T;  1AMH A;  1QA7 A;  1SFI A;  1C5N H;  1C5T A;  1GL1 A;  1D3D B;  1QL8 A;  1P05 A;  2WSS D;  4JCN A;  3M7T A;  3A8D A;  2IN2 A;  3P92 A;  3ZVC A;  2G55 A;  2XCN A;  2VWM A;  1BJU A;  4HG6 A;  4XE4 A;  2QV1 A;  2PTC E;  3RM2 H;  3TK5 A;  3GS9 A;  2J95 A;  1GGD B;  2ALP A;  1JWT A;  2WYG A;  2BY9 X;  2VVU A;  3L3T A;  4JZE H;  3N7O A;  3RXQ A;  3A87 A;  2M2A A;  4Q7Z A;  3K9X B;  2VGC B;  3U8O H;  2ZQ2 A;  2VIV A;  1QRX A;  1LHC H;  1MKW H;  2WPH S;  1C1P A;  5I25 A;  2O8T A;  3ZV8 A;  3LOX A;  4IC5 A;  1CHO F;  2ZCK P;  1BTZ A;  2FTL E;  2J5U A;  1FY8 E;  3CS0 A;  1ZTL A;  1H8D H;  2VU8 E;  1E0F D;  1SGF A;  2HVX A;  1VGC C;  1W7X H;  1LQE A;  4GVU A;  4X2X A;  4I8J A;  5HXF A;  1A4W H;  3RC5 A;  3LH1 A;  1P3E A;  5GND A;  3ZYD A;  8LPR A;  2P8O B;  3TJV A;  2FOE A;  4OS7 A;  1YCP M;  1O2I A;  1UW7 A;  2G5N A;  3CEN A;  4NZQ A;  3T26 A;  5C5N A;  1W0Y H;  4MNW A;  3BTD E;  1HFD A;  2CHA B;  3SUE A;  1C2G A;  1ZHR A;  3F2H A;  3BTF E;  4ZUH A;  3PV2 A;  2DE9 A;  3M37 A;  5K7R A;  4HFP B;  1DPO A;  2VWO A;  4YTA A;  3ZV9 A;  2BHG A;  3WY8 A;  4D7G A;  1V2U T;  3V7T A;  1DXP A;  1EFR D;  3CNR A;  1HXE H;  1ELG A;  1F0R A;  2WPI S;  1O5C B;  5KED A;  2C93 B;  4JMY A;  2ZDK A;  3ATM A;  3U98 H;  2GMT C;  5C1X A;  5CMX H;  1K9O E;  1LVY A;  3SBK A;  2ZG0 H;  2A4R A;  2GZ7 A;  1GVZ A;  1YGC H;  1BRC E;  2BYA X;  3EYD A;  2Q6F A;  2ZHE H;  1HAV A;  2R0K A;  3PMA B;  1GDU A;  2BY7 X;  4OS1 A;  3TJU A;  1VCQ A;  2YMS D;  2O8W A;  3VEQ B;  1XM1 A;  1SGN E;  4K1T A;  2ZU3 A;  5LH8 A;  1YP9 A;  1FUJ A;  1IHS H;  1XX9 A;  4U2W A;  2VIP A;  2BMG B;  1FPH H;  5CHA B;  4A1V A;  1PPC E;  3L33 A;  3RXI A;  3SGB E;  3SUF A;  5ESB A;  2FZZ A;  5TJX A;  2NU3 E;  2F9B H;  2H9E H;  3PMB B;  4CRC A;  2ODY B;  2FYR A;  1BHX B;  1A5G H;  3NK8 A;  3SU6 A;  2HPP H;  1ZTK A;  2A1D B;  2CMY A;  5CHB A;  2JH0 D;  2UWO A;  1YBW A;  2Y7Z A;  2TRM A;  2Y6T A;  5DJ7 A;  5FX5 A;  4M9F A;  3VPK A;  1ANE A;  2BZA A;  1UTO A;  2A7C A;  1DVA H;  2OP9 A;  1GHW H;  4MNY A;  1TGT A;  2A7H A;  3HGP A;  5FXL A;  4X1P U;  2OXS A;  4VGC C;  2VB0 A;  4NSY A;  4BXW A;  3TGJ E;  3ZZ7 A;  3A8C A;  1C5O H;  1VCW A;  5FPT A;  3T27 A;  1C5Z B;  2Z3E A;  1O2J A;  4HGC A;  4KEL A;  2EST E;  2QXG A;  2A0Q B;  1WCZ A;  5C5O A;  4OS2 A;  1T8M A;  1AGJ A;  4Q4L A;  2XWB I;  1K1O A;  2FDA A;  3AW1 A;  3RXT A;  9LPR A;  3RXC A;  1AO5 A;  5JB9 S;  2ZF0 H;  1HAI H;  1SG8 B;  1WTG H;  1TQ0 B;  2BXU H;  2ILN A;  2KAI B;  3DCL A;  4FU9 A;  4KP0 A;  3P8N A;  3EAJ A;  1MTU A;  1ETS H;  3ATW A;  1L2E A;  4J1Y A;  3T62 A;  5A2M H;  2GJG A;  1C9T A;  1EOJ A;  2PGQ B;  1GG6 B;  2YMS C;  1TB6 H;  1HDT H;  3RXV A;  3K65 B;  2WV5 A;  5E0H A;  4ISH H;  3Q77 A;  1SB1 H;  2QAA A;  2RCE A;  1FY1 A;  4LK4 A;  1T7C A;  3P17 H;  2XBY A;  5F8T A;  1D9I A;  1S84 A;  1Y3U A;  1DM4 B;  2BD7 A;  3MU1 A;  4AN7 A;  3LIW A;  5LPF A;  1QL7 A;  1F5R A;  2VH6 A;  3U9A H;  1V2N T;  1E1Q D;  1YM0 A;  2HGT H;  4K2Y A;  1C5X B;  5FL7 D;  1J8A A;  1G9I E;  3VB7 A;  1IQM A;  4ABE A;  1O33 A;  3RP2 A;  1TAB E;  5GIB A;  1QNJ A;  4ZKN U;  3ODF A;  4ISN A;  1E37 B;  3URD A;  3UWI A;  3K2U A;  1Y5U T;  4LZ4 B;  2ZDL A;  1EAT A;  1O2K A;  2XYA A;  3PMH B;  3STJ A;  1LHE H;  2VIQ A;  3ZVB A;  5A8Z A;  1YC0 A;  1SL3 A;  4HZH A;  1HAP H;  5GXP A;  1G2M A;  1V2J T;  1C1V H;  1OYT H;  1XUG A;  5JDU B;  1PQ7 A;  2BD5 A;  2CV3 A;  2H6M A;  1TLD A;  4Y0Y E;  1QUR H;  5FBI A;  3BV9 B;  3S69 A;  1Y3X A;  2TPI Z;  3BSQ A;  2WIN I;  5A8X A;  5EG4 A;  4WH6 A;  1O31 A;  3RU4 E;  3U8T H;  1A3E H;  1CBW B;  1J9C H;  1TPO A;  3PO1 C;  1C5U A;  4CRE A;  1K1L A;  1TBZ H;  1AE5 A;  1MCT A;  2BDH A;  1MMJ N;  2OC7 A;  3TVJ B;  3P6Z B;  4JZD H;  1W14 U;  2GD4 B;  2WUC A;  4TT3 D;  1C2I A;  1J16 A;  1LQD B;  5L6N H;  2FO9 A;  2ZGX H;  2WPL S;  1UVS H;  2Y5G A;  3MU5 A;  1GJ4 H;  1C1M A;  1S6F A;  3HPT B;  3N99 A;  2TGA A;  1MD8 A;  2I6S A;  3E16 B;  1GJ9 B;  1W8B H;  3ZZ9 A;  1HAY B;  1ELV A;  4CRB A;  4FVB A;  2OIN A;  3SI3 H;  3RMN H;  5DP9 A;  1KXA A;  4X8U H;  3BTW E;  3TGK E;  2HNT E;  1IQK A;  2Q1J A;  4X6M A;  2OCV B;  3EDX B;  4XBC A;  3UPE A;  3FVF B;  1HAV B;  1JRT A;  5L30 H;  1PPG E;  1ZTJ A;  1AI8 H;  1MKX H;  1GJB B;  1IQI A;  1UTK A;  1NC6 A;  1ZSJ A;  3EA9 A;  1BMA A;  3ZYE A;  3M5N A;  1QBV H;  1YF4 A;  3D49 H;  4E7R G;  1TFX A;  1KXB A;  3OEH D;  4BAM B;  5FHT A;  3MNX A;  2PWX A;  2VIO A;  1LCY A;  2ZPQ A;  4BTU B;  1HV7 A;  1OXG A;  1NRS H;  4ABJ A;  3SZE A;  1L1G A;  4YES B;  1BTP A;  2PHB A;  1ELB A;  3TH3 H;  2BLQ A;  3VFE A;  3LC5 A;  5G4B A;  3UWJ H;  3SU0 A;  1S81 A;  1EAU A;  1N6Y A;  1ZGV A;  2PKS B;  3I77 A;  1DWC H;  1NFX A;  1C1N A;  1GI0 A;  2RA0 A;  1IHT H;  1T32 A;  4WMF A;  5AHG H;  4K8Y A;  4DW2 U;  2BD8 A;  3TJO A;  3URC A;  2BLW A;  4OS5 A;  1SI5 H;  2QXI A;  2WPD D;  4UE7 H;  3TIU A;  1H8H D;  4X6N A;  2A32 A;  2ZEC A;  1YWU A;  5DK1 A;  4BTT B;  1MKX K;  3EA8 A;  1BBR K;  4GLY A;  2EQN A;  1SPJ A;  1Z71 A;  2NU0 E;  4MDS A;  1MCV A;  2KCY A;  1OWK A;  3H09 A;  3T5F H;  2BDA A;  1Z8R A;  4CH2 B;  4NIW A;  1CSO E;  4KTC A;  1DOJ A;  3RXS A;  3P8O A;  1YLD A;  4BTI B;  3F3B A;  1O2M A;  3MH6 A;  2V3O H;  1C1W H;  3BG8 A;  1AVG H;  1P8V C;  1CA0 B;  2H2Z A;  5DGJ A;  5J4Q A;  1G3D A;  3VXF H;  4D7F A;  2ALV A;  4MPX A;  3A83 A;  1O39 A;  3A85 A;  3E0N B;  2KX4 A;  4KKD A;  1LKA A;  4R8T B;  3KQ5 A;  4OS4 A;  1O0D H;  4LZ1 H;  4AB9 A;  1UTQ A;  5CDF E;  1TGC A;  1D3P B;  1RIW C;  1ANB A;  2K1Q A;  1HAZ B;  1NRP H;  2QCY A;  4NWK A;  1SGC A;  1OOK B;  3F9H A;  1NRR H;  2H9H A;  3M5L A;  2AMP A;  3PYH A;  2ZTX A;  5A0C A;  1C2H A;  1GBI A;  1O3L A;  1SC8 U;  3DUX H;  1L4D A;  3UTU H;  4B6F A;  3SQE E;  3F68 H;  1OPH B;  3MWI U;  1SGE E;  2ZFT A;  4MVN A;  1HIA B;  2NWN A;  4O9V A;  1XKB C;  1MAX A;  2LP6 A;  3TNT A;  3I78 A;  4AFS A;  3DA9 B;  6CHA C;  3S7H B;  3BTQ E;  1AHT H;  1CVW H;  2G81 E;  2BX3 A;  2AHM E;  5EW1 H;  1NRQ H;  1SGT A;  1GBD A;  4H4F A;  2STA E;  3RXA A;  1DY8 A;  1P11 E;  4X8T H;  1E79 D;  2FLB H;  2RFK C;  2AEI H;  4RT1 A;  1GJA B;  1AE8 H;  1YKT A;  1O2T A;  1SGD E;  1WYK A;  2PW8 H;  1FPC H;  1WUN H;  4BAN B;  2FLR H;  2O8M A;  7GCH F;  3ZZ3 A;  4B2B A;  1QY6 A;  3Q76 A;  1WV7 H;  3FFG A;  1E34 B;  1B0F A;  1DT2 A;  2VIW A;  7EST E;  1FV9 A;  3B23 B;  3IIT A;  1P02 A;  2TGP Z;  2A45 B;  1QQU A;  1ZJD A;  3MFJ A;  1EOL A;  1C5V A;  2A4O A;  3QWC H;  1O2N A;  1V6D A;  1E1R D;  1UVT H;  2OQU A;  4K69 A;  1PYT C;  1EZS C;  4RKO B;  2GKV E;  4GSO A;  1C2L A;  1O3O A;  3ZZ4 A;  1Z7K A;  1TPP A;  3WW7 A;  2QIQ A;  1FIZ A;  2HNT C;  1QL9 A;  1FXY A;  3CP7 A;  2FOC A;  5A09 A;  3STI A;  4BAK B;  1EKB B;  4YXW D;  4I86 A;  1VIT G;  2GCH G;  3M5M A;  1A2C H;  4IS5 A;  1MQ6 A;  1Y59 T;  1LVO A;  1O2L A;  2GX4 A;  4FUH A;  1ZJK A;  1KY9 A;  1SGI B;  1AY6 H;  3SNA A;  1YLC A;  1T31 A;  4Y71 A;  1EJA A;  5DP4 A;  2GZ8 A;  3UOU A;  1O2H A;  1GHV H;  3LJJ A;  1C4V 2;  3UB0 A;  2C8X B;  4JYV H;  4ZHM U;  4B2A A;  2P16 A;  1G37 A;  3V3M A;  1LHD H;  2WZQ A;  4WF8 A;  3NUM A;  1UCY E;  3ZZB A;  4F48 B;  2V0B A;  3MNC A;  1GI9 B;  3WWB A;  2ZEB A;  1YPK H;  3TU7 H;  2CGA A;  1T4U H;  1OYQ A;  3RU4 T;  2SNV A;  1GJ7 B;  1S5S A;  1G3C A;  3OYP A;  3M36 A;  2EA3 A;  1GI8 B;  4F4O C;  4MPV A;  1QB1 A;  2PR3 A;  5DG6 A;  1E38 B;  3KN2 A;  1ELE E;  1XVM A;  2QYI A;  3M3S A;  4O3T A;  8GCH G;  1P10 A;  4CRA A;  1IQE A;  1LPK B;  1ZHM A;  2ZC9 H;  1GMC G;  1ELF A;  1H9I E;  1JIM A;  2ZPR A;  2ANK H;  3MNB A;  5EOD A;  2AGG X;  1H1B A;  3OFN D;  1AND A;  1JMO H;  2AYW A;  4AYV B;  3C27 B;  2VH0 A;  1OKX A;  3E91 A;  3OX7 U;  2FTM A;  1KDQ A;  4H6T A;  4Y7A A;  4AGJ A;  5EQQ A;  3RXK A;  3SUD A;  1SQO A;  1V2V T;  4A1T A;  3AAS A;  2W7S A;  3HKJ B;  1YPM H;  5EQR A;  3S9A A;  2EY4 C;  4ISI H;  1BB0 B;  4BAQ B;  4MTB A;  1W13 U;  1PPH E;  4B76 A;  1N1L A;  1ZPZ A;  3KQC A;  4D9Q A;  2GT7 A;  2V7Q D;  2FES H;  1J15 A;  4ZRO A;  3SU4 A;  3RML H;  2XBV A;  3OY5 U;  2BTC E;  1CT2 E;  2XW9 A;  2HLD D;  3GY4 A;  5LGO A;  1OWD A;  2JJ1 D;  4THN H;  3E1X B;  1OWE A;  2QF3 A;  3BG4 C;  4UFF H;  2W7U A;  5JBB S;  1AD8 H;  1QJ1 B;  1XUJ A;  4A1X A;  1FI8 A;  2ZGB H;  2QE7 D;  4YM9 A;  5IDK A;  2RG3 A;  1QB9 A;  1QB6 A;  4SGB E;  8EST E;  1O30 A;  2SGE E;  1C5S A;  1JBU H;  2TGD A;  2WV9 A;  3RC4 A;  1N8O B;  1TPA E;  3RXE A;  3LGT A;  6EST A;  1XUK A;  1HYL A;  1TON A;  1XUH A;  1GMC F;  2EEK A;  3SNC A;  3E8L A;  1Y3W A;  3ZVG A;  4K1S A;  3LPR A;  2J2U A;  3KGP A;  1GBT A;  2WV4 A;  1T8O A;  1O3N A;  2F3C E;  3ATL A;  2ZGC A;  1BTU A;  1OWI A;  1RTK A;  5EJZ A;  1TGN A;  1NFY A;  1O2Y A;  2CXV A;  3SYJ A;  4D76 A;  1B5G H;  4IGD A;  1C5W B;  1ZOM A;  1KTT B;  5DP6 A;  1FN8 A;  2JH5 D;  2QY0 B;  4CBO A;  2FOG A;  2FOB A;  5EPN A;  4AG1 A;  2SGF E;  1BIT A;  2P59 A;  3GDS A;  2IPQ X;  3DHK H;  4ISL A;  2VWN A;  2BY8 X;  3HK6 B;  1FX0 B;  1GBM A;  4TPI Z;  3A8A A;  1P12 E;  1AZ8 A;  3KQB A;  3MNS A;  5JYI A;  1HRT H;  4CHA C;  5H4I B;  2FS8 A;  2CK3 D;  1TA6 A;  1W12 U;  2Z3D A;  2FX6 A;  2ZWL H;  2EI7 A;  1P9U A;  3SNE A;  1M9U A;  1MTN B;  3SNB A;  1SSX A;  1LDT T;  3RUO A;  4F49 A;  4B71 A;  3GDV A;  2BZ6 H;  2D1J A;  3A81 A;  5DP5 A;  1BRU P;  2PTN A;  4KGA A;  2BB4 A;  1D6R A;  4X8S H;  2H1U A;  3SZN A;  1SOZ A;  3F2G A;  2KZ4 A;  3T25 A;  1BTW A;  3VG8 A;  1NRN H;  2ODP A;  1Y3V A;  2UUY A;  1ZMN A;  1S6L A;  2C3S A;  2Y7X A;  3PRD A;  4FUD A;  5TCA A;  1RFN A;  5DP8 A;  3S0N A;  1MZA A;  3ATK A;  1AIX H;  1C5M D;  4J2Y B;  1S0R A;  3UQV A;  1C5P A;  3TLO A;  3KF2 A;  1O3J A;  3DFJ A;  2FS9 A;  5I46 H;  1P01 A;  3U1I B;  1O32 A;  1HAG E;  2ANM H;  1CGH A;  1UMA H;  4R0I A;  1FJS A;  3OAA D;  2J98 A;  3F9F A;  2PSY A;  1W3C A;  1AZZ A;  4MNX A;  1G2L A;  5HMA A;  3Q3K A;  1TX7 A;  1EZQ A;  3ATI A;  3U1J B;  3IG6 B;  2ZKS A;  1BA8 B;  2BDC A;  4JZ1 A;  2Q6D A;  4FVD A;  1FDP A;  1O2V A;  2BX4 A;  1YYY 1;  2ZNK H;  4PRO A;  1AB9 B;  4Y8Y A;  1A46 H;  1TRN A;  1YPE H;  5EGM A;  2AGI X;  2IJO B;  1WBG B;  1O5E H;  4X2Y A;  1XVO A;  2FOF A;  4O3U A;  2PFE A;  2EI8 A;  3PWC A;  3LKW A;  4WXI A;  2XWA A;  2EI6 A;  1P2I A;  1QTF A;  2ZFR H;  3OTJ E;  2BDY A;  3GY6 A;  3TK9 A;  2BOK A;  1S85 A;  1F5K U;  1GHZ A;  2F9U A;  5IYT A;  5A0B A;  1NBM D;  3ODD A;  3KEE A;  2AIP A;  1GMD G;  2GT8 A;  3BTH E;  3TGI E;  1IQH A;  3B8J A;  1QZ8 A;  3GCT G;  1KDQ B;  1EPT B;  1MZD A;  1O3B A;  3NCL A;  1O3E A;  1ZR0 A;  1ELT A;  4FUF A;  1NT1 A;  3UNS A;  1GI1 A;  1Y5A T;  1UTP A;  3N7E A;  1P09 A;  4Y11 E;  1UTN A;  4AFQ A;  1DS2 E;  1QR3 E;  3BEU A;  2UWP A;  2FMJ A;  2FYQ A;  2PSX A;  1D3T B;  1UVP A;  2GGV B;  2UUJ B;  5C0U A;  8KME 2;  4A7I B;  1VR1 H;  1LHG H;  3OU0 A;  4ZAE A;  3U69 H;  1IQG A;  3P70 B;  2V3H H;  1C5Q A;  2JJ2 D;  2CF8 H;  1ZPB A;  1ACB E;  5DO4 H;  4GCH G;  1C2E A;  6GCH G;  2V3M A;  2FEQ H;  2PKA A;  1CHG A;  2R9P A;  1HJA B;  2AGE X;  3DD2 H;  3Q3X A;  2HLC A;  3OY6 U;  3S9C A;  1G3B A;  2VID A;  1D4P B;  3LJO A;  3ZVE A;  1QIX B;  4Y8X A;  2VBC A;  5E0J A;  3ELA H;  2BY5 X;  1P2Q A;  1QRW A;  1GMD F;  3NPS A;  1Q2W A;  3SU5 A;  1EB1 H;  5EOK A;  1HB0 B;  3GCT F;  4WY3 A;  2L6O A;  4CRF A;  3A80 A;  1PPE E;  1D6W A;  2F9P A;  3E3T A;  1ARB A;  4X1N U;  3ZZ6 A;  1BMN H;  4ISO A;  2FI3 E;  3SJ9 A;  1ZGI A;  1D3Q B;  5GDS H;  1O35 A;  4KTU A;  2YNA A;  1SQT A;  3VGC B;  2C8Z B;  1YPH E;  4RKJ B;  1AFQ B;  1GMH G;  2IOT A;  2QXJ A;  1GCT C;  1PPB H;  3ITI A;  4HI3 A;  4FOU C;  5EIY A;  2W26 A;  4BAH B;  1TGS Z;  5FPY A;  2P3F H;  1V2Q T;  1AWF H;  4FUE A;  1TOC B;  1GBL A;  1LMW B;  6GCH F;  1HAH H;  1FIW A;  1KMH B;  1TBR H;  1GI2 A;  4WWY A;  1FY4 A;  1CE5 A;  1CQQ A;  3SND A;  4NIY A;  1U6Q A;  1O3H A;  5C0T A;  1QA0 A;  1QFK H;  2PLX A;  1ELD E;  4XD7 D;  5F8X A;  3SJ8 A;  1ZYO A;  1PFX C;  1FLE E;  1SLV B;  1Z8J B;  3RM0 H;  3A7Z A;  1BJV A;  2C4F H;  3BEI B;  4GUX A;  3GCH B;  5EQS A;  1TWX B;  1TGB A;  1NO9 H;  2UWL A;  2VWL A;  4DIH H;  5DKM A;  1KLT A;  2GCT B;  4D8N A;  4IMQ A;  3BTK E;  3MO6 A;  5CE1 A;  2J98 B;  2JIZ D;  3QGJ A;  2AH4 X;  1EP5 A;  3KYG A;  3LGU A;  3SV9 A;  2PGB B;  1V2S T;  1O2U A;  1O3P B;  1C2K A;  1O3C A;  5L2Y H;  4D9R A;  1DE7 H;  1SGP E;  1G30 B;  2Y80 A;  2C8W B;  2BD2 A;  1TRM A;  2XNI A;  5EST E;  2JET B;  4AX9 H;  1AKS A;  1BBR H;  2JH6 D;  1P06 A;  5EJ1 A;  3PV4 A;  3V13 A;  2ULL A; 
#chains in the Genus database with same CATH homology
 3L6P A;  3KNX A;  5EQR A;  4A92 A;  2YMS B;  2OC8 A;  2FP7 B;  3KF2 A;  1RTL A;  2LEL A;  2VBC A;  2YMS D;  2KCO A;  2XCF A;  4Q63 A;  5ETX A;  1MAB B;  4ZCN A;  3U1I B;  4B76 A;  1N1L A;  2WPD D;  2YOL A;  3FOA A;  2V7Q D;  3SUG A;  1WXR A;  2F9V A;  5EPY A;  1H8H D;  3SU4 A;  1E1R D;  3PRB A;  4A1V A;  4U01 A;  5GPI B;  3SU5 A;  5HKK D;  2KCA A;  4B74 A;  3OAA D;  1NS3 A;  2QF4 A;  3SUF A;  1JXP A;  5ESB A;  2WSS D;  1W3C A;  2L6O A;  2HLD D;  2OC1 A;  4OM9 A;  1BT7 A;  2JJ1 D;  4B75 A;  4NWL A;  3AK5 A;  2KCY A;  2XCN A;  3WW7 A;  3SU6 A;  3H09 A;  3U1J B;  2QV1 A;  3PV5 A;  3GS9 A;  5F53 A;  4A1X A;  5CHB A;  2QE7 D;  4WH6 A;  3F2F A;  2IJD 1;  3SU3 A;  5IDK A;  4ASU D;  1W0J D;  3OEE D;  3SU2 A;  4KTC A;  1DXW A;  1CU1 A;  3E90 B;  2OBQ A;  2KM0 A;  3P8O A;  4M9F A;  4YXW D;  2M2A A;  5GJ4 B;  3F3B A;  2WHX A;  2IJO B;  3M5M A;  2WV9 A;  3RC4 A;  3F0O A;  2OC7 A;  3ZIA D;  1COW D;  2F43 B;  3LKW A;  4TT3 D;  3LOX A;  4I31 A;  2FM2 A;  4I33 A;  5FPY A;  2J5U A;  3FN8 A;  4R8T B;  3FKS D;  2OK5 A;  4TSF D;  2KCP A;  5FPT A;  5IK2 D;  4RI0 A;  3UB0 A;  3WWF A;  3LON A;  3N99 A;  5CDF E;  3SU1 A;  2A4G A;  4F55 A;  3SV7 A;  2OC0 A;  1KMH B;  2K0Q A;  3SYJ A;  4DT4 A;  2F9U A;  5B6L A;  2K1Q A;  4NWK A;  3SV6 A;  1H8E D;  2K8I A;  1NBM D;  2FOM B;  2OIN A;  2WZQ A;  3KEE A;  3M5L A;  4Q4L A;  4WF8 A;  5DSF A;  3RC5 A;  5C0T A;  5GND A;  5C17 A;  4XD7 D;  3O8B A;  3WWB A;  5EPN A;  2P59 A;  1FX0 B;  3OYP A;  1W0K D;  2JDI D;  2QF5 A;  5EQS A;  4B6F A;  5T1V A;  3N7E A;  2KFW A;  5H4I B;  3DCL A;  3SUE A;  3O8R A;  1RGQ A;  3P8N A;  5FPS A;  3O8C A;  3F2H A;  3DSP A;  3W1E A;  2W6J D;  3N7D A;  2XOK D;  3PV2 A;  2CK3 D;  4B73 A;  1A1R A;  3KN2 A;  3DSO A;  3M5N A;  2F4L A;  3OEH D;  2GGV B;  2YMS C;  4WH8 A;  5C0U A;  2JIZ D;  4B6E A;  3O8D A;  3SV8 A;  2XND D;  4B71 A;  3OTP A;  1SKY E;  3SV9 A;  2W6I D;  2AHM E;  1BMF D;  1DXP A;  1EFR D;  2OBO A;  4I32 A;  2JJ2 D;  3OE7 D;  2KR7 A;  1DY8 A;  1NBM E;  2A4Q A;  4A1T A;  1E79 D;  4FET A;  3OFN D;  5DN6 D;  4TYD A;  1DY9 A;  1E1Q D;  3F2G A;  2XNI A;  2KZ4 A;  4JMY A;  4K8B A;  3RC6 A;  3SZE A;  3VG8 A;  5FL7 D;  3FO8 D;  1S6L A;  3PRD A;  1OHH D;  2A4R A;  3F0P A;  2GVF A;  5EQQ A;  3EYD A;  3SUD A;  3M5O A;  2O8M A;  3NRL A;  4Z1M D;  3SU0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...