2KCPA

Solution structure of 30s ribosomal protein s8e; from methanothermobacter thermautotrophicus, northeaststructural genomics consortium (nesg) target tr71d
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
98
structure length
98
Chain Sequence
GDRRVRLIRTRGGNTKVRLASDTRINVVDPETGKVEIAEIRNVVENTANPHFVRRNIITRGAVVETNLGNVRVTSRPGQDGVINGVLIRELEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30S ribosomal protein S8e
publication title SOLUTION STRUCTURE OF 30S RIBOSOMAL PROTEIN S8E FROM Methanothermobacter thermautotrophicus, NORTHEASTSTRUCTURAL GENOMICS CONSORTIUM (NESG) TARGET
rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Ribosomal protein
total genus 12
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2008-12-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.310 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2kcpA01
2KCOA 2KCYA 2KCPA
chains in the Genus database with same CATH superfamily
1H9LB 1K28D 2G00A 3M5LA 5G4BA 3P95A 3MI4A 1WBGB 2BQ7B 1ZYOA 9ESTA 1GJ9B 4Y79A 1CA0C 5C1XA 2CK3D 2EI8A 1DS2E 3OY6U 1O2RA 3QTVH 1A5IA 3PTBA 1DFPA 1DM4B 3LU9B 2RFKC 3TGIE 1BTXA 2JH6D 1PPBH 3Q3KA 2STBE 1ZTLA 2BTCE 2ZKSA 1G2LA 1NFYA 3EYDA 5HKKD 4LZ1H 6CHAB 1ELEE 1RFNA 3QGNB 1C4V2 2WSSD 2YNBA 4FUDA 4X6PA 1MU6B 3BTQE 3AK5A 1TGNA 2ZDAH 3GY7A 4FVBA 3SU3A 1QR3E 4Y10E 4CHAB 3D62A 1JOUB 1O2WA 5CE1A 4RT1A 4H6SB 1P2JA 1BMLA 1QRXA 1BDAA 1KYNA 1SFQB 2LELA 5DP7A 1AY6H 2W5EA 1CQQA 2BVSH 2FPZA 3EA8A 7GCHG 3SV9A 2DUCA 5FX5A 4MQAA 1SGFA 3T26A 2ZF0H 4NSVA 3RXLA 2WPMS 3Q3XA 3A8CA 1EUFA 3KQCA 4NCYA 4AG1A 1RIWC 3LDXH 4CRGA 1WV7H 2G81E 3MNBA 4Q2KA 3TITA 3DA9B 3SU1A 1DWCH 1BJVA 1ZGVA 3GCHC 1TGSZ 2FP7B 3PMAB 1NT1A 2ZCKP 1LVYA 1F0RA 1HJ8A 2ZU3A 3Q76A 1SC8U 1EP5A 1B7XB 1K1NA 1SGCA 3TK9A 1SGFG 1UHBA 1TQ0B 4IBLH 2TBSA 6GCHF 2KZ4A 2YMSC 1J17T 2GTBA 3T2NA 1G2MA 1UVPA 1YPGH 1C1NA 1LPGB 1N6XA 5DP5A 1O5DH 2YMSD 1YF4A 3EA7A 3GOVB 5FPTA 1BMMH 1AWFH 2BDAA 1RTLA 2SGAA 3U8TH 2H9HA 3F9FA 3HGPA 2ZTYA 2PHBA 2ZPSA 3MH4A 3QN7A 5DG6A 1TONA 4FUEA 5E0GA 2D2DA 1QNJA 3OE7D 1HAPH 1TNHA 2BB4A 4P00A 1GBEA 3LGWA 2BY5X 2EY4C 1HBTH 2VWNA 1XVMA 8LPRA 1GHAF 1F0TA 3LH3A 1MKWH 1V2KT 2FMJA 4ABBA 3M5MA 2EI6A 1SR5C 4WH6A 1O3IA 5IK2D 1FXYA 1GBCA 5DK1A 1Z8JB 5IDKA 2O8TA 3OSYA 4ZHAA 1MABB 2BYAX 1SLUB 2AYWA 1AZZA 2AIPA 2Q6DA 4HG6A 2XRCA 2CXVA 3NRLA 6GCHG 5JB8S 1PFXC 3OU0A 4I32A 1TBRH 3PMJA 3W1EA 4GHTA 2P8OC 5T1VA 2AGIX 1O2MA 2ZP0H 1ZJKA 1ELFA 4D8NA 1KTTB 3PO1C 2BDYA 1YPHC 3ODFA 2JKHA 4DVAU 1HNEE 2I6QA 1JMOH 2BX3A 1GMDF 4SGBE 2C8XB 2KAIA 1O37A 1MBQA 4E7RG 5EPYA 5DP9A 2PGBB 2PFEA 1ZMJA 4RKJB 1O2PA 1TBQH 1SLXB 1GBJA 1W10U 2V3MA 2BD3A 1GGDC 3OTPA 2P93A 1SVPA 2BLQA 4CBOA 1TLDA 2SGFE 4WMFA 5F03A 1IQEA 4E05H 3A85A 2WUBA 2J94A 4FXGH 3MU8A 1C1SA 5C17A 2XBXA 1GHAG 5EJ1A 2P3FH 2VIPA 1TRYA 2QXIA 3MMGA 5GCHG 2ZCLP 4WMEA 4OS1A 1HJAC 2ANYA 2VJ1A 2XCNA 1C2DA 4DIIH 4M7GA 1WSSH 1MBMA 1GG6B 1G3CA 2W3KA 1CBWB 1OXGA 4HFPB 3BTDE 3E6PH 4THNH 2J92A 4ZKSU 3L3TA 1ANCA 2J98A 2Y80A 1J15A 1SOTA 1WQVH 2TGDA 3BTFE 1M9UA 1GI1A 1Y3VA 3UAIC 3GY6A 1HYLA 2RA3A 1NTPA 5E0JA 3GICB 2AGGX 4ASHA 5HIZA 2C4FH 2ALVA 2BD4A 2FODA 1NY22 4AYVB 1NBME 1GMDG 1LVBA 1OP0A 1O3KA 2OK5A 3VPKA 1GDQA 3KQBA 1BT7A 4OS6A 1GI8B 2VIVA 4X1PU 1TA6A 3SJOA 3RC4A 1S83A 2OC1A 1THPB 1YWUA 4I8JA 5FXLA 3SU6A 1H4WA 1NBMD 2PKSC 1FY1A 1P2KA 3MU1A 2ZHDA 1P04A 1MKXH 1HAVB 2FOHA 1BJUA 3O8BA 4LOYH 3RLYH 3M3VA 1C2GA 2BLOA 4TT3D 1PQ8A 4YOJA 3BEIB 3BIUH 3QGJA 1SHHB 4UFEH 1FMGA 2R2WU 4NG9H 4ABAA 1WQSA 1MH0A 1C5YB 1YKTA 2GT8A 3FP8E 3MHWU 1QGFA 2L74A 1BTUA 2XC0A 2ZGBH 8KME2 2XBWA 3WWFA 4KP0A 1ZZZA 1C1OA 5DN6D 2ZFTA 3KQ5A 1A3EH 3O8RA 5C3NA 2ZHWH 4CH8B 1DICA 1WTGH 2VH0A 3MU4A 1PPZA 4B73A 1NRNH 1HPGA 2KFWA 2L6OA 2UUYA 4AORA 2AS9A 3ZVGA 1MD8A 1BMFD 2G5VA 1KXDA 1GJ7B 1S82A 4NIVA 1GI4A 2P59A 1S6LA 1O36A 1NROH 1TNKA 4GHQA 3FFGA 1GPZA 4K8BA 1TPOA 3SHAH 4IN2A 4JCNA 1P3CA 1FAKH 2BM2A 2QAAA 4UFDH 1O3BA 5FCRA 4JYTA 2A4QA 4ISOA 3WY8A 3FP6E 2FOCA 1QB9A 4DGJA 3QO6A 4I31A 1NFXA 5A09A 3DSPA 2VIQA 2BY6X 4KTSA 4NWLA 4R0IA 1JIRA 1CT4E 3DFJA 1AE5A 1MUEB 1C5MD 2RA0A 3KYGA 1W0ZU 3URDA 3MU0A 4WF8A 1DXWA 1FLEE 5IYTA 3RLWH 1JBUH 4B71A 4AFZA 4MPWA 4UONA 1UCYK 3SNDA 2FI5E 3A8BA 4K60A 1KLIH 1EPTC 2OTVA 4CREA 1ZHPA 6ESTA 3N7EA 2ULLA 1PQAA 1PPGE 1LHGH 2JETB 3TGJE 2BLVA 1O2XA 2Y5GA 1LHCH 3ATKA 4J1YA 1E37B 3S7KB 1O30A 4H4FA 4I7YH 2DE9A 1A0HB 1TX6A 1THRH 3ZIAD 1UTOA 1ABJH 3P6ZB 3LGTA 1HGTH 4FETA 3RXHA 2A7HA 1V2UT 1QQ4A 1FNIA 1TALA 2FLBH 1T7CA 1KLJH 2FIRH 2BD5A 4X1NU 4INHA 3S0NA 2A45B 2B5TB 5ESBA 3F0OA 1UMAH 1GI2A 1L0ZA 4Y8ZA 1TMBH 1D3TB 1ZOMA 2JH0D 3Q77A 1VCWA 2TIOA 2WYGA 3RUOA 1Z6JH 5GWZA 1LVMA 1SGPE 2A5AA 4GLYA 1UTMA 3SU4A 1ETSH 2PWXA 5HYOA 3V7TA 1EZUC 3SU5A 1ORFA 1C5XB 2TGPZ 1RXPA 1BMAA 1C2JA 1O3NA 1C5WB 3N99A 1GHXH 1C5VA 2OD3B 1IQHA 3B9FH 2Z7FE 3M3TA 4FUGA 1GVKB 3HATH 5ETXA 5L2ZH 1XXFA 2AMQA 3UOPA 4AGKA 2CGAA 1SGRE 2Q1JA 2FOEA 1RTFB 1G3BA 3RXOA 1PPCE 2ZFFH 1MCVA 1F5KU 1KXAA 3VB5A 5SGAE 4ABDA 5FHTA 3SNAA 5EXLA 4RI0A 3RXIA 2IJD1 2UWLA 2ZFQH 1TPSA 1VCPA 2QXHA 1UW7A 2C8ZB 2JJ1D 1UVOA 2GDEH 2ZZUH 1SHYA 1VR1H 4DG4A 3PYHA 2EC9H 3RMLH 1P2NA 1EASA 4MLFB 4XRNA 1CT2E 4YOIA 3ESTA 1V2PT 2AMDA 2RG3A 3RP2A 2V7QD 1VJAU 1O39A 1XUHA 2W26A 3ZZ8A 1O32A 2G5NA 1AVWA 1EJAA 3GY5A 1AUJA 1JXPA 4D9QA 3RM0H 1SI5H 2ILNA 3NXPA 4MPUA 1O3OA 4Z6AH 3AAUA 1BITA 3K2UA 1CHOF 1T32A 2Q6FA 2QF5A 4VGCC 4ZXXH 4H42U 1FX0B 3T27A 1S81A 2SGEE 2KX4A 2VINA 1E35B 3ZYDA 1G37A 2BD2A 4XD7D 5E2PA 5KEDA 1Z6EA 1O3AA 1YLNA 2OCVB 3OAAD 2FWWA 5LPFA 3SU0A 4D7FA 5ABWA 4B2AA 1UCYE 1J8AA 2QE7D 3I29A 1EOLA 1YYY1 4OM9A 1AFQC 2Z9IA 3M61U 3LOXA 4BXSA 1NRSH 5TCCA 3RXFA 1KSNA 1IOEA 4FU7A 5T3HA 2A2QH 1S6FA 2ZDNA 3RXSA 1FDPA 4DW2U 3ZZ9A 3TU7H 1A2CH 1VGCB 1P02A 3UFAA 4O3UA 1Z71A 3K6ZA 4ZUHA 1PPFE 1BQYA 1QBNA 3TJOA 2A2XH 1CHGA 2ZTXA 1WOFA 1YCPH 3E91A 4XBBA 1SMFE 1GI0A 1UJ1A 4INLA 5EODA 1SSXA 1F5LA 1Y5UT 3ATIA 1MTSA 2VVUA 5C5OA 1A4WH 2CMYA 1TGBA 3KHVA 1GI5A 1CHOG 5I46H 1MKWK 4ACAA 3DFLA 1LHEH 2G52A 5F8ZA 2PW8H 4HTCH 1OYQA 4OS2A 2ZHFH 1TE0A 5C1UA 1HIAA 1EATA 2VB0A 3F9EA 3P70B 1A5HA 1UVUH 4K3JA 2GT7A 1P09A 2NWNA 1G9IE 3A7ZA 3T5FH 1UK2A 2F91A 2J38A 3MTYA 4ABHA 5LPRA 1SB1H 3KQDA 1ZPBA 2PLXA 3IITA 3SN8A 3QTOH 2F9OA 4DT4A 5L6NH 1N8OC 2KCOA 5AF9H 4O97A 3K65B 5KGOA 6LPRA 1TX8A 3RXTA 3M7UA 1AN1E 3BEFB 1A0JA 2ZU5A 2PSYA 1P9SA 1TBZH 4MDSA 2GZ8A 1EZQA 1GJCB 1G36A 3RMMH 5JYIA 5HXFA 1O3HA 4CR5A 1QBVH 2ZU4A 1XXDA 4FU8A 3TJVA 2F9UA 4YLQH 2A5IA 2WPHS 5BPEA 1TFXA 3SV8A 2XBYA 3Q3YA 1ZMNA 3MO3A 5FBIA 3VEQB 2K8IA 3A86A 3PMBB 4HI3A 3M5OA 1W7GH 1W13U 3LGIA 1BTZA 1SGIB 2QXGA 1F5RA 1A1RA 1LVOA 5KECA 3H09A 2ZGJA 4K69A 2ZI2H 3UNQA 3BN9A 1DT2A 3SNEA 2P16A 7LPRA 2UWOA 4FUBA 2NU3E 4X1RU 1E1RD 3M7TA 2QY0B 3NUMA 4ABIA 3IWMA 1EAUA 1C2LA 1O38A 1O2NA 1V2RT 4KGAA 4F48B 5T6DA 2F9BH 2XW9A 2O8MA 3NKKA 1A5GH 3VG8A 5B6LA 1E34B 1YPLH 1IQNA 1Y3YA 3PV2A 2A7CA 1QQUA 1GJ6A 1QZ8A 2Y5FA 1S84A 1RJXB 4ABFA 1O3FA 4AB9A 1EAXA 2Y6TA 1HUTH 2F3CE 1GBMA 2HNTF 9LPRA 3IG6B 3NCLA 2PKAB 2BMGB 2OXSA 4JZIA 1C2MA 3ZZCA 4XE4A 3UPEA 3EQ0H 1QJ1B 2XXLA 3A89A 5FX6A 5GNDA 1GMHF 4BAHB 3C1KA 3JZ1B 2THFB 1GHWH 1O2SA 4SGAE 2P94A 1FPHH 4AB8A 3A80A 1N6YA 4X1SU 3HKIB 2ZWLH 4CH2B 3TIUA 1MQ5A 1SL3A 5CHBA 1AB9C 4IW4E 1WYKA 2ZCHP 3SUFA 4WVPE 4ACBA 1OWJA 1GJDB 2XBVA 3M5NA 1JIMA 4INKA 3UOUA 2W3IA 5C0TA 1MKXK 3F9GA 1IQGA 2VIOA 1XM1A 2QF3A 3VXEH 1AKSB 1C5RA 2H9EH 1QTFA 1WDIA 3AASA 2CV3A 4R8TB 1Q2WA 1AFEH 1GI9B 1F2SE 1K1JA 4UFFH 3RXBA 3GDVA 3PMHB 3TLOA 3RXGA 5CMXH 2QCYA 3UUZA 3UNSA 1J16A 4FU9A 2VIDA 3LKWA 2D26C 3UQVA 1MTNB 4ISNA 2PTNA 3MO6A 1ELBA 3GYMA 1XUIA 1ELTA 4A5TS 1GI6A 3OFND 4WXIA 3SNBA 3FVFB 1GL1A 3KCGH 4FUHA 2V35A 4YO9A 4LXBH 2GMTC 1HV7A 3LGUA 1K2I1 1FZZA 3NPSA 1ZHRA 3FZDA 2FOBA 1GMHG 1CA0B 1GCTC 4TPYA 1LKBA 1ELDE 4BXWA 1ZPZA 3LJJA 4CRBA 2Y7ZA 1T8LA 2ZDMA 2KCAA 5L2YH 1FJSA 1MAXA 2HVXA 1C2IA 2C8WB 3EE7A 1IQIA 4NWKA 3A8AA 3BTHE 1BUIA 1O34A 1VKYA 5DP6A 1L1JA 4DOQA 3E0NB 2BY8X 3A87A 3V3MA 2A4RA 1AVGH 2GGVB 1DOJA 1ZTJA 1LDTT 3LJOA 1TQ7B 1C1MA 1FV9A 3BF6H 3MH6A 4X6OA 1GJ5H 1K9OE 1TB6H 2HNTC 2H5DA 1YPHE 1CU1A 1QY6A 1Z8RA 3F3BA 3U8RH 2G4TA 5F53A 2SGQE 5B6OA 1LKAA 1W0KD 4NA9H 2OBQA 5A0CA 1O3GA 2W6ID 4TYDA 3MNSA 3E1XB 2C8YB 4OS7A 4Z0KA 4BOHA 1QCPA 1BRAA 1RIWB 1H1BA 5JBAS 1FQ3A 2ZHQH 4M9FA 1KXFA 4ABJA 5AHGH 1NRPH 1NZQH 5EQSA 1TMUH 4WWYA 3EDXB 1TOMH 4Y0YE 5DO4H 4AC9A 4RN6A 4WY3A 1O3JA 4X8UH 3F68H 1CVWH 5GXPA 3GCHB 1HAYB 1W3CA 3GCNA 2FYRA 1GBIA 1C1VH 2OLGA 4ISIH 2VVVA 4B1TA 2KCPA 3RXPA 3TJUA 3ZVFA 2IJOB 3LC5A 4OGXA 1P10A 2HOBA 5DSFA 2G4UA 1D6WA 3OEHD 3MYWA 3DSGA 4ZHLU 2YMSB 5EGMA 2A1DB 1LPKB 2VGCC 3BTEE 1SQAA 2QN5T 4ZMAH 1EP6A 1JRSA 5EJLA 1O33A 1W11U 3E0PB 3E90B 3UR6A 2SNWA 1LCYA 5AFZH 4F4OC 2ZC9H 3V12A 1ZR0A 4UD9H 1GHVH 2R3YA 3ZZ5A 3H5CB 4GAWA 2J34A 3MH5A 4IC6A 4DY7B 1C5OH 1ELAA 5EIYA 1NO9H 2ZDVH 1NESE 1BTPA 1FY8E 4RT0A 2IPQX 3ZVBA 1AGJA 1T31A 3W95A 4DT7B 5A2MH 5C94A 5E0HA 1ARCA 5DKMA 7ESTE 3E3TA 1EAWA 1P12E 3SOSA 2WPDD 5AVDA 5LPEA 2WHXA 1O3LA 2VBCA 2ZFSA 4I8GA 4I86A 4MVNA 1IQJA 1S0RA 2B0FA 2HALA 2ZEBA 4XFQA 2FS8A 4Y8XA 2QF0A 1P2IA 3OX7U 1W7XH 1YC0A 2CHAC 1IQKA 5ESTE 1O35A 1JRTA 3K9XB 1BHXB 1P2OA 1L1GA 1MTVA 4UDWH 3C27B 1C5LH 1O5AB 2BY9X 3ZZ4A 1PYTC 3LONA 2BDBA 1E79D 1H8IH 1ABIH 1GJAB 2VVCA 1C1WH 2P8OB 1O3CA 1DWEH 1PYTD 2H2ZA 2SNVA 3ENSB 4X0WU 3QUMP 2SGDE 4KTUA 3KEEA 5PTPA 4Q80A 3P8GA 3PO1B 4X2YA 1KTSB 5LH8A 1KDQA 2GCTC 4IMQA 1D4PB 1O2LA 1O5FH 1GVZA 1DXPA 4ZAEA 1SOZA 1A61H 4YLUA 1AE8H 2H6MA 3EA9A 2H1UA 5FPSA 3PRDA 1GGDB 5CHAC 3SJKA 1PPEE 1B0EA 4U30A 3CENA 4YTAA 3D65E 3S69A 3KYFA 4KELA 4BAQB 1DUAA 3U69H 1EOJA 1W12U 2Z9LA 1OP8A 1HJAB 1TGCA 1DX5M 3FAOA 1C5SA 5GDSH 3D23A 1ACBE 3B23B 2HLDD 2CF8H 1V2ST 4BTIB 1TOCB 1YPMH 2AH4X 2VNTA 1FPCH 1FY4A 1C5PA 1GJ8B 2K0QA 3LH1A 2Y82A 2QA9E 2BY7X 2FYQA 3SUGA 1L1NA 3BG4C 5JBBS 1OOKB 3PB1E 4CRDA 2JDID 1TAWA 1OWEA 1H9IE 1ZSKA 2ZA5A 2LPRA 3OEED 4ZHMU 1LMWB 3MQKC 1QURH 1YM0A 4YT6H 4IMZA 3F0PA 2FM2A 2VH6A 1YCPK 5TJXA 2QGRA 5JDUB 1O5CB 1NFUA 3ODDA 1NS3A 5C5NA 1D3QB 2XOKD 3GY3A 3R3GB 4XSKU 3MNXA 4ASUD 1O2UA 3BSQA 3U8OH 2FS9A 1HAIH 1DUEA 1SPJA 4TPIZ 2PKSB 2V0BA 1E38B 3NZIA 4K1EA 1ELCA 1EJMA 1W0JD 3RXUA 1HAOH 1D9IA 1Z8GA 4Q7ZA 1EFRD 5GJ4B 1C4Y2 4WXVA 3ZZAA 1W8BH 4BNRA 4HGCA 4Z1MD 4YXWD 2FOMB 3A81A 3SJ8A 2PTCE 1E0FD 3LC3A 1QB6A 5EJZA 2PUQH 1QL8A 4FVDA 2YNAA 1PPHE 4NZLA 4CR9A 3LIWA 1XUKA 2VIWA 1WCZA 1V2VT 5CDFE 1BA8B 3T29A 3UIRA 1ZGIA 3RMNH 1XKBC 1EJNA 2IOTA 5AFYH 2BOHB 2EI7A 5I25A 2WYJA 2Z9KA 3RU4T 1CO7E 3AW1A 4JYVH 1ZSLA 1QBOA 2Y81A 4B6EA 5C67A 1S85A 1G3EA 4DIHH 1FI8A 2C3SA 2NU4E 3PROA 2ZPQA 2Z3DA 1TNJA 4B75A 3GS9A 5J4SA 2BQ6B 1UK3A 4OS4A 3RXCA 1C5QA 2J98B 4FOUC 1EZSC 1T8NA 1C1UH 2KCYA 3SQEE 2SGPE 1AI8H 1W2KH 1P3EA 3SI3H 3PWBA 2OQUA 4WH8A 5FL7D 4TY7A 2XC5A 1GHZA 4X2XA 2F9VA 2RCEA 4B76A 4ZKOU 2W7UA 1IQMA 1MZDA 2STAE 1P8VC 4MNYA 2W6JD 2FOFA 2HRVA 1BBRH 1O2TA 3CNRA 1GWAA 3SZNA 3LGYA 3RXKA 2ZU1A 3CP7A 2ODQA 3VGCC 2OINA 2P3UB 4X8SH 3E16B 2BXUH 1ELGA 1A3BH 5HM9A 3SUEA 3UWIA 4BAKB 1NC6A 5A8ZA 4JZ1A 2FESH 1H9HE 1QL7A 5EW1H 1GJ4H 1FY3A 1SQOA 1DDJA 2QF4A 1EPTB 3HK6B 3S9BA 4F49A 3GY8A 4AOQA 1HFDA 4X6NA 2WV9A 3N7OA 1CGHA 4TSFD 5EG4A 1YBWA 2V6NA 4MNVA 3V13A 4FUFA 4GPGA 2K1QA 4NIWA 4LZ4B 3SORA 1S6HA 4NA8A 3TGKE 3HPTB 1C1RA 4ZCNA 1AWHB 4I8KA 3BTKE 3KGPA 4ABGA 1A7SA 1KXEA 2AEIH 3UREA 1O31A 1PQ7A 1UTPA 3UY9A 4AX9H 4D76A 2PSXA 1A46H 4XDEA 2A32A 3UQOA 1UVTH 1XX9A 3SBKA 2G55A 1CGIE 3BTTE 1XUGA 2AFQB 1OS8A 1AQ7A 4Y11E 1V2MT 3D49H 3PTNA 4A92A 4GVUA 2PP6A 1GI7B 4ISHH 1QA0A 4B2CA 1C2FA 2C93B 3P8NA 1QHRB 2ANKH 1EX3A 5FPYA 1NM6A 1AZ8A 1VZQH 1C1TA 2FEQH 3M35A 1D3DB 4A1TA 1K1LA 1C2EA 1OP2A 2ZGCA 1P57B 6CHAC 5E2OA 2WV5A 4AYYB 5DGJA 2C90B 1LPZB 3U28C 1TWXB 1FN6A 2PGQB 4X2VA 4CHAC 1O2HA 1DWBH 2WPJS 3G01A 4I8HA 1OYTH 1BZXE 2ASUB 2ZDKA 3TH4H 4B6FA 2XWBI 1HAXB 3GYLB 1TPPA 1W0YH 1Y59T 3ATWA 2BQWB 2R3UA 5GPIB 1B5GH 4U01A 2F83A 4B2BA 4FUIA 5DP3A 3GDUA 2QYIA 3SI4H 3Q00A 4NFFA 1F0UA 2JH5D 3ZVDA 3DCLA 2HPQH 3P8FA 1FIZA 2A4OA 3QLPH 1WTHD 1YCPM 2CN0H 3KN2A 1UTJA 3RDZA 3ZV8A 2ZECA 2Z6BD 1H8ED 2XWAA 2O9QA 2WPIS 3BTGE 1MCTA 4ESTE 3SYJA 2UUKB 1O2KA 5J4QA 1SLVB 3SV6A 4IC5A 4GSOA 5EU8A 1T8MA 2ZFPH 1S0QA 1OX1A 4H6TA 3MH7A 1GBBA 1DANH 1RRKA 1SGNE 1EKBB 4YZUA 4K1SA 1HJ9A 3TK6A 3TVJB 3F1SB 3A8DA 3FN8A 2GJGA 4XOJA 4VGCB 1JWTA 3SNCA 1UTNA 3GISB 4YOGA 1DLEA 2ZGXH 2A7JA 3RXDA 4MG3A 1AU8A 2WPLS 3AVZA 4LK4A 3SZEA 2XYAA 1V2QT 1UK4A 1BTHH 3MU5A 1F0SA 3PWCA 2CJIA 3RM2H 3NK8A 4D9RA 2JIZD 3O8CA 2JJ2D 1W14U 2R2MB 5DJ7A 2WUCA 5EQRA 8ESTE 3F9HA 3H7TA 4WMDA 1TMTH 1AFQB 4A1XA 1YP9A 1V2JT 2OC7A 3A7YA 2FX4A 3M7QA 2WINI 2ZQ1A 3A7TA 4O03A 2Y7XA 3U1IB 4ZKRU 1VCQA 3PLKA 3TJNA 1MQ6A 1TABE 2VWMA 3KF2A 4Q7YA 1NFWA 3BIVH 1ANBA 1GBLA 2OBOA 1KIGH 2HLCA 2D8WA 3OYPA 5HM2A 8GCHF 2GKVE 2W7SA 1SGQE 4K2YA 4A6LA 1XVOA 1V3XA 4PROA 4NIXA 1H8HD 5F8XA 1V2NT 1C5NH 2A4GA 2D1JA 2G51A 4JYUH 2IPHA 1QIXB 2XC4A 1O3PB 2AMPA 1GBHA 1C1PA 1DLKB 1HRTH 1BHXF 1T4UH 2ANWA 3SGAE 4CRAA 3F2HA 2UWPA 4BAOB 2BD7A 1E1QD 1GDNA 3PLBA 1TNIA 1TGTA 1C9TA 3GCTF 1HDTH 1ZRKA 1T8OA 3KNXA 1F7ZA 1HAVA 1WUNH 2UUJB 1SGDE 1GHYH 5A8YA 1NU7B 1OWHA 2F43B 3LGVA 3T25A 2ODPA 2FI4E 5FAHA 1K1PA 4I8LA 2XNDD 1J14A 4ISLA 2GZ7A 1N8OB 3DHKH 1CGJE 1ZJDA 4DJZB 1TX7A 1CT0E 3SUDA 1P2QA 1X7AC 1O3DA 3QZRA 5C1YA 1AD8H 3QK1A 2WV4A 4BAMB 4E7NA 5EQQA 4YT7H 3QX5H 1WXRA 1E36B 1IQLA 4U32A 3SJIA 1YY3A 4AZ2B 8GCHG 2BDCA 4AFQA 3HK3B 1ZLRA 3LT3A 1XMNB 4NFEA 4TWWA 1CSOE 3BTME 4NSYA 1GL0E 2G8TA 1C2HA 1QJ7B 1HAGE 1GG6C 5DP8A 4IS5A 1CBWC 4RKOB 3P8OA 1DITH 1TYNA 5FCKA 3OY5U 1AUTC 2ESTE 4O9VA 4OGYA 1LQEA 2FI3E 3S7HB 3GCTG 3SV2H 3K6YA 1Y3WA 3I78A 2ZNKH 3S9CA 2GP9B 1IAUA 3ZVEA 1QRZA 1GBKA 1GHBF 1ESAA 2ZGHA 1LHDH 3BEUA 3FZZA 4BANB 1FONA 2A0QB 4MPXA 2OP9A 2BLWA 5GIBA 5JPMH 2FX6A 3U98H 3A82A 3RXMA 3TH3H 2HNTE 1P0SH 2CF9H 1V2LT 4HZHA 1QB1A 4E06H 4A7IB 1VJ9U 2PV9B 5GCHF 2WZQA 4XBDA 1DE7H 1DSUA 2ANMH 1HIAB 1TRNA 4ZXYH 4UE7H 2YOLA 1O2YA 4RSPA 1BRUP 1QJ6B 4AG2A 3LPRA 1COWD 3WWBA 1BRBE 4MTBA 3U9AH 5K7RA 5C20A 2ZIQH 1C5TA 4JZDH 4JK6A 1K0HA 1CE5A 1AB9B 3P17H 3BV9B 1P11E 1MTWA 1TRMA 1DPOA 1LO6A 1Z8IB 2V3HH 1P06A 1HAHH 2ZG0H 3SO3A 4NZQA 2B7DH 2FTMA 1ZHMA 1ARBA 4FUCA 5T6GA 1BB0B 1EAIA 2TGAA 1ELVA 4AGJA 1EZXC 4UEHH 2BDHA 4MNWA 2TPIZ 2O8WA 2RDEA 2J4IA 1GHBG 1VITF 1IHSH 4JK5A 3A88A 3GY2A 1O2IA 1Q3XA 4AN7A 4YM9A 2F4LA 2BDGA 4U2WA 4OS5A 1XUJA 1DWDH 3EE0B 2Z3CA 1L4DA 2VWOA 1PQ5A 2PUXB 1J9CH 2OC0A 1YLDA 3KL6A 4I33A 2FLRH 4BTTB 4J2YB 1RTKA 4UFGH 2GMTB 3M3SA 2GVFA 2ZDLA 4YESB 1IHTH 3VB4A 1GCTB 1V6DA 3HGNA 3O8DA 1TA2A 3MO9A 3UTUH 1AHTH 1YPKH 1C5UA 3SGBE 1O5EH 3PLPA 1TNLA 3WW7A 2BZ6H 2OQ5A 1NRRH 1U6QA 1OWIA 1UTLM 2SFAA 3TH2H 2UUFB 1ANDA 1SQRA 1UO6A 3AW0A 3QDZB 3RC6A 4B74A 1BTWA 1K21H 2B8OH 3ATMA 2ZO3H 1EB1H 1GI3A 3FANA 1BBRK 1C4U2 1O2VA 1L2EA 2GDDA 4MPVA 2JETC 1VITG 5C0UA 2BHGA 1HXEH 4AFSA 2Q6GA 1FAXA 1O2QA 1UTKA 2AERH 1Z1JA 4GCHF 5EXNA 2O8LA 1EPTA 1GMCF 2I6SA 3BTWE 3ZVCA 1AIXH 5BRRE 2AIQA 5K0HA 3FOAA 2FTLE 2AHME 3E8LA 2GX4A 2A5KA 1DY8A 3QWCH 1YPEH 5EOKA 3VB6A 1UHBB 1C9PA 3A7XA 3M36A 3SQHE 2Z94A 4IN1A 2R9PA 3R0FA 4F55A 1D6RA 1C5ZB 1GBAA 3A83A 2BZAA 1P03A 1KXCA 3NWUA 1G32B 3PV5A 2V3OH 1Y5BT 4ABEA 2OC8A 4NIYA 3L6PA 4Y7BA 3N7DA 3ZVAA 2H9TH 2HGTH 3F2FA 3DD2H 2QC2A 1KMHB 4DCDA 2ZU2A 3QZQA 1ETTH 2NU1E 4JZEH 1L4ZA 1P01A 3PM3A 3ZZ3A 3CS0A 1Y5AT 4AFUA 1SBWA 3U1JB 1YPJH 3GDSA 2VGCB 1SLWB 2J5UA 1EQ9A 2F9PA 1LTOA 3F6UH 1MU8B 2P3TB 2NU2E 1TIOA 1WU1A 5LGOA 3ZYEA 3L33A 1HCGA 4GCHG 1VITH 4A1VA 2QV1A 3TK5A 4CRFA 2NU0E 1GMCG 1FIWA 1PJPA 5H4IB 3ZZ7A 3V0XA 3ZZBA 1BTYA 1SQTA 2LP6A 1A0LA 1OWKA 1TPAE 4ZKNU 1BMNH 2J95A 1K22H 3A7WA 1O2OA 1HB0B 1HLTH 3T62A 2XNIA 4NGAH 1MAYA 3RXRA 1XUFA 4JZFH 1Y8TA 3VB3A 3DSOA 4CBNA 1IQFA 2Z3EA 1NU9A 2CHAB 1RGQA 3P92A 1ETRH 2R0LA 2OUAA 1SKYE 2KAIB 1SFIA 3RXEA 1FUJA 1FN8A 2F9NA 1NRQH 2AGEX 2GV7A 5JBTA 4ZH8A 5C2ZA 3VXFH 1O5GH 5DPAA 5E8EH 5HIYA 5T6FA 1SGYE 1UTQA 3FP7E 1YLCA 5JBCS 5A8XA 2PR3A 1N1LA 1OPHB 3ITIA 1ANEA 1EB2A 2GZ9A 4Q4LA 2GCTB 1RD3B 4X2WA 4Q63A 1GCDA 1OKXA 3TNSA 5FBEA 3MWIU 2FXRA 1GBTA 1ZTKA 3SJ9A 3W94A 3RXQA 5CHAB 4QT8C 2ODYB 3TPIZ 4DURA 1BBRE 2BVRH 1HAZB 2LNCA 2BXTH 4X6MA 2XCFA 4O3TA 4FUJA 2Z9JA 3CS7A 5HGGA 3VB7A 1V2TT 1WAYB 2DE8A 4KKDA 3UNRA 1QRWA 1ESBA 1VGCC 4P02A 1O0DH 3FKSD 1V2WT 3DT0H 2VU8E 1O2ZA 1GVLA 4TWYA 1F92A 1THSH 3I77A 3RXAA 1MZAA 1AVXA 1Z1IA 3T28A 3SW2B 3EAJA 3STJA 2ZTZA 3BG4B 2Y5HA 3EGKH 1O2JA 3MNCA 1T4VH 1GJBB 2B9LA 3MOCA 2PKAA 3UB0A 2BD8A 4Y8YA 3SGQE 2FO9A 2ZQ2A 1O2GH 5TCAA 1O3EA 4K1TA 2BVXH 2GCHF 3ELAH 3FO8D 5EXMA 4X8TH 3SV7A 3JZ2B 4NA7A 3URCA 2BD9A 2ZPRA 2BX4A 1Y3UA 2P95A 4X8VH 1LHFH 1KLTA 2J2UA 3A84A 3KIDU 1KDQB 1DSTA 1Z7KA 4TY6A 2BOKA 1K1MA 1K1IA 1AKSA 1KY9A 1KXBA 1CA8B 1C1QA 1S5SA 1YGCH 2J97A 2HVYB 1DY9A 1P9UA 1BCUH 3AAVA 3B8JA 2ZFRH 1G3DA 3MFJA 2GV6A 2M2AA 3ZZ6A 1OSSA 1G30B 1V2OT 3OTJE 3SHCH 4WJG2 5DP4A 1ZMLA 3S9AA 4GUXA 1P2MA 3H7OA 1NPMA 1TNGA 4D7GA 1GBDA 2EA3A 4ZROA 1BRCE 2VWLA 2XTTB 3A7VA 5L30H 1D3PB 3RXVA 3STIA 1ZSJA 1NN6A 1SGEE 3ZV9A 1EXFA 1ZRBA 1OWDA 3PV4A 2A31A 1UVSH 4IGDA 3UR9A 4Y7AA 1ID5H 4K8YA 5EW2H 2GCHG 4XBCA 1MTUA 1QFKH 3UWJH 3ZZDA 1P05A 2HPPH 1AMHA 1B0FA 2QXJA 4MNXA 1BIOA 1C2KA 2FOGA 2FOAA 1UCYH 1SGTA 1H8DH 3SU2A 1MMJN 2EQNA 4Y0ZE 3RC5A 5A0BA 2H5CA 1RS0A 3BG8A 4Y71A 1FY5A 2BDIA 3RMOH 5JB9S 3GCOA 3RU4E 2TRMA 1SG8B 2O8UA 4X1QU 3VGCB 1GBFA 1GDUA 2M5TA 4BTUB 3ATLA 5HMAA 2KM0A 5EPNA 1ZPCA 2GD4B 3RU4D 1OHHD 1QA7A 2WPKS 4Y76A 2ALPA 2HWLB 2J9NA 1Q31A 2R0KA 1INCA 2EEKA 4K5ZA 1ESTA 3TNTA 3GY4A 3DUXH 1QL9A 2RDLA 3F2GA 2ZHEH 4KTCA 4CRCA 3VFEA 4Q7XA 2FZZA 1O5BB 1LQDB 3HKJB 2FDAA 5A0AE 2KR7A 4Y6DA 5F6MA 3KQEA 1XKAC 1BOQA 3RXJA 7GCHF 1O3MA 1MTNC 1MD7A 1HXFH 2QIQA 3PRBA 3M37A 2TGTA 2Z9GA 1AO5A 2IN2A 4JMYA 1Y3XA 5F8TA 1DVAH 1K1OA 7KMEH
chains in the Genus database with same CATH topology
2YOLA 2A4GA 4WF8A 2M2AA 3M5LA 1DXWA 4DT4A 4R8TB 2KCOA 2KCPA 4B71A 2IJOB 1N1LA 1COWD 3WWBA 3F2HA 2KCYA 3OE7D 4Q4LA 5DSFA 3FOAA 4B6FA 2AHME 3OEHD 4Q63A 4WH8A 1NBME 1E1QD 5FL7D 1DY8A 2CK3D 2YMSB 5GPIB 2OK5A 3N7EA 2HLDD 2V7QD 4U01A 1BT7A 3LKWA 2F9VA 4B76A 4F55A 3RC4A 1JXPA 2OC1A 2W6JD 3E90B 3EYDA 3M5MA 3OFND 5HKKD 3KNXA 2K0QA 3DCLA 3SU6A 4WH6A 2WSSD 1NBMD 2F43B 5IK2D 2F9UA 3SUGA 3PV5A 3AK5A 2OC8A 3GS9A 2OINA 3L6PA 3N7DA 2XCFA 2JDID 5IDKA 2QF5A 2XNDD 3F2FA 3SV8A 3OEED 3KN2A 3SUEA 1KMHB 3SU3A 1MABB 1FX0B 3ZIAD 3O8BA 1H8ED 2K8IA 4TT3D 3F0PA 3SUDA 3M5OA 4FETA 4XD7D 2FM2A 2QF4A 3OAAD 3SYJA 3NRLA 3FKSD 3SU0A 2LELA 1A1RA 3U1JB 3SV6A 2F4LA 3H09A 4I32A 2WPDD 3SU2A 3W1EA 1NS3A 2QE7D 2J5UA 3SV9A 2WV9A 2WHXA 4TSFD 2VBCA 2KCAA 5T1VA 3RC5A 2XOKD 5EQQA 5ESBA 1WXRA 4OM9A 4NWKA 1E1RD 2OC0A 3F0OA 4ASUD 2K1QA 3LOXA 4I33A 3FN8A 2O8MA 4ZCNA 1W0JD 3VG8A 5B6LA 3WWFA 1EFRD 4A1VA 5DN6D 5GJ4B 5EPYA 2GVFA 2QV1A 2KM0A 3SU1A 5EPNA 3O8RA 2A4RA 3PV2A 3SU4A 4Z1MD 2GGVB 3SZEA 5H4IB 2FOMB 4YXWD 3P8OA 4B73A 1OHHD 2KFWA 3O8DA 3LONA 3UB0A 3OTPA 3SU5A 1E79D 2L6OA 2FP7B 1BMFD 2JIZD 5C17A 2JJ2D 3N99A 3O8CA 1CU1A 2P59A 1S6LA 2XNIA 3F3BA 5EQRA 3FO8D 3WW7A 4A1XA 5F53A 1W0KD 3KEEA 4K8BA 3SV7A 4A92A 3F2GA 5GNDA 2OC7A 5CDFE 5ETXA 2OBQA 4KTCA 3DSOA 2W6ID 4TYDA 3P8NA 2XCNA 5FPYA 1RGQA 1DXPA 2A4QA 2KR7A 2KZ4A 2YMSC 3RC6A 4B74A 4M9FA 1SKYE 5CHBA 5EQSA 3U1IB 3SUFA 3KF2A 4I31A 4A1TA 3M5NA 3DSPA 4B6EA 2OBOA 2YMSD 4RI0A 3PRBA 5FPSA 5C0UA 5C0TA 3PRDA 4NWLA 3OYPA 5FPTA 4JMYA 2IJD1 1W3CA 1RTLA 4B75A 2WZQA 1DY9A 2JJ1D 1H8HD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KCO A;  2KCY A;  2KCP A; 
#chains in the Genus database with same CATH topology
 1H9L B;  1K28 D;  2G00 A;  3M5L A;  5G4B A;  3P95 A;  3MI4 A;  1WBG B;  2BQ7 B;  1ZYO A;  9EST A;  1GJ9 B;  4Y79 A;  1CA0 C;  5C1X A;  2CK3 D;  2EI8 A;  1DS2 E;  3OY6 U;  1O2R A;  3QTV H;  1A5I A;  3PTB A;  1DFP A;  1DM4 B;  3LU9 B;  2RFK C;  3TGI E;  1BTX A;  2JH6 D;  1PPB H;  3Q3K A;  2STB E;  1ZTL A;  2BTC E;  2ZKS A;  1G2L A;  1NFY A;  3EYD A;  5HKK D;  4LZ1 H;  6CHA B;  1ELE E;  1RFN A;  3QGN B;  1C4V 2;  2WSS D;  2YNB A;  4FUD A;  4X6P A;  1MU6 B;  3BTQ E;  3AK5 A;  1TGN A;  2ZDA H;  3GY7 A;  4FVB A;  3SU3 A;  1QR3 E;  4Y10 E;  4CHA B;  3D62 A;  1JOU B;  1O2W A;  5CE1 A;  4RT1 A;  4H6S B;  1P2J A;  1BML A;  1QRX A;  1BDA A;  1KYN A;  1SFQ B;  2LEL A;  5DP7 A;  1AY6 H;  2W5E A;  1CQQ A;  2BVS H;  2FPZ A;  3EA8 A;  7GCH G;  3SV9 A;  2DUC A;  5FX5 A;  4MQA A;  1SGF A;  3T26 A;  2ZF0 H;  4NSV A;  3RXL A;  2WPM S;  3Q3X A;  3A8C A;  1EUF A;  3KQC A;  4NCY A;  4AG1 A;  1RIW C;  3LDX H;  4CRG A;  1WV7 H;  2G81 E;  3MNB A;  4Q2K A;  3TIT A;  3DA9 B;  3SU1 A;  1DWC H;  1BJV A;  1ZGV A;  3GCH C;  1TGS Z;  2FP7 B;  3PMA B;  1NT1 A;  2ZCK P;  1LVY A;  1F0R A;  1HJ8 A;  2ZU3 A;  3Q76 A;  1SC8 U;  1EP5 A;  1B7X B;  1K1N A;  1SGC A;  3TK9 A;  1SGF G;  1UHB A;  1TQ0 B;  4IBL H;  2TBS A;  6GCH F;  2KZ4 A;  2YMS C;  1J17 T;  2GTB A;  3T2N A;  1G2M A;  1UVP A;  1YPG H;  1C1N A;  1LPG B;  1N6X A;  5DP5 A;  1O5D H;  2YMS D;  1YF4 A;  3EA7 A;  3GOV B;  5FPT A;  1BMM H;  1AWF H;  2BDA A;  1RTL A;  2SGA A;  3U8T H;  2H9H A;  3F9F A;  3HGP A;  2ZTY A;  2PHB A;  2ZPS A;  3MH4 A;  3QN7 A;  5DG6 A;  1TON A;  4FUE A;  5E0G A;  2D2D A;  1QNJ A;  3OE7 D;  1HAP H;  1TNH A;  2BB4 A;  4P00 A;  1GBE A;  3LGW A;  2BY5 X;  2EY4 C;  1HBT H;  2VWN A;  1XVM A;  8LPR A;  1GHA F;  1F0T A;  3LH3 A;  1MKW H;  1V2K T;  2FMJ A;  4ABB A;  3M5M A;  2EI6 A;  1SR5 C;  4WH6 A;  1O3I A;  5IK2 D;  1FXY A;  1GBC A;  5DK1 A;  1Z8J B;  5IDK A;  2O8T A;  3OSY A;  4ZHA A;  1MAB B;  2BYA X;  1SLU B;  2AYW A;  1AZZ A;  2AIP A;  2Q6D A;  4HG6 A;  2XRC A;  2CXV A;  3NRL A;  6GCH G;  5JB8 S;  1PFX C;  3OU0 A;  4I32 A;  1TBR H;  3PMJ A;  3W1E A;  4GHT A;  2P8O C;  5T1V A;  2AGI X;  1O2M A;  2ZP0 H;  1ZJK A;  1ELF A;  4D8N A;  1KTT B;  3PO1 C;  2BDY A;  1YPH C;  3ODF A;  2JKH A;  4DVA U;  1HNE E;  2I6Q A;  1JMO H;  2BX3 A;  1GMD F;  4SGB E;  2C8X B;  2KAI A;  1O37 A;  1MBQ A;  4E7R G;  5EPY A;  5DP9 A;  2PGB B;  2PFE A;  1ZMJ A;  4RKJ B;  1O2P A;  1TBQ H;  1SLX B;  1GBJ A;  1W10 U;  2V3M A;  2BD3 A;  1GGD C;  3OTP A;  2P93 A;  1SVP A;  2BLQ A;  4CBO A;  1TLD A;  2SGF E;  4WMF A;  5F03 A;  1IQE A;  4E05 H;  3A85 A;  2WUB A;  2J94 A;  4FXG H;  3MU8 A;  1C1S A;  5C17 A;  2XBX A;  1GHA G;  5EJ1 A;  2P3F H;  2VIP A;  1TRY A;  2QXI A;  3MMG A;  5GCH G;  2ZCL P;  4WME A;  4OS1 A;  1HJA C;  2ANY A;  2VJ1 A;  2XCN A;  1C2D A;  4DII H;  4M7G A;  1WSS H;  1MBM A;  1GG6 B;  1G3C A;  2W3K A;  1CBW B;  1OXG A;  4HFP B;  3BTD E;  3E6P H;  4THN H;  2J92 A;  4ZKS U;  3L3T A;  1ANC A;  2J98 A;  2Y80 A;  1J15 A;  1SOT A;  1WQV H;  2TGD A;  3BTF E;  1M9U A;  1GI1 A;  1Y3V A;  3UAI C;  3GY6 A;  1HYL A;  2RA3 A;  1NTP A;  5E0J A;  3GIC B;  2AGG X;  4ASH A;  5HIZ A;  2C4F H;  2ALV A;  2BD4 A;  2FOD A;  1NY2 2;  4AYV B;  1NBM E;  1GMD G;  1LVB A;  1OP0 A;  1O3K A;  2OK5 A;  3VPK A;  1GDQ A;  3KQB A;  1BT7 A;  4OS6 A;  1GI8 B;  2VIV A;  4X1P U;  1TA6 A;  3SJO A;  3RC4 A;  1S83 A;  2OC1 A;  1THP B;  1YWU A;  4I8J A;  5FXL A;  3SU6 A;  1H4W A;  1NBM D;  2PKS C;  1FY1 A;  1P2K A;  3MU1 A;  2ZHD A;  1P04 A;  1MKX H;  1HAV B;  2FOH A;  1BJU A;  3O8B A;  4LOY H;  3RLY H;  3M3V A;  1C2G A;  2BLO A;  4TT3 D;  1PQ8 A;  4YOJ A;  3BEI B;  3BIU H;  3QGJ A;  1SHH B;  4UFE H;  1FMG A;  2R2W U;  4NG9 H;  4ABA A;  1WQS A;  1MH0 A;  1C5Y B;  1YKT A;  2GT8 A;  3FP8 E;  3MHW U;  1QGF A;  2L74 A;  1BTU A;  2XC0 A;  2ZGB H;  8KME 2;  2XBW A;  3WWF A;  4KP0 A;  1ZZZ A;  1C1O A;  5DN6 D;  2ZFT A;  3KQ5 A;  1A3E H;  3O8R A;  5C3N A;  2ZHW H;  4CH8 B;  1DIC A;  1WTG H;  2VH0 A;  3MU4 A;  1PPZ A;  4B73 A;  1NRN H;  1HPG A;  2KFW A;  2L6O A;  2UUY A;  4AOR A;  2AS9 A;  3ZVG A;  1MD8 A;  1BMF D;  2G5V A;  1KXD A;  1GJ7 B;  1S82 A;  4NIV A;  1GI4 A;  2P59 A;  1S6L A;  1O36 A;  1NRO H;  1TNK A;  4GHQ A;  3FFG A;  1GPZ A;  4K8B A;  1TPO A;  3SHA H;  4IN2 A;  4JCN A;  1P3C A;  1FAK H;  2BM2 A;  2QAA A;  4UFD H;  1O3B A;  5FCR A;  4JYT A;  2A4Q A;  4ISO A;  3WY8 A;  3FP6 E;  2FOC A;  1QB9 A;  4DGJ A;  3QO6 A;  4I31 A;  1NFX A;  5A09 A;  3DSP A;  2VIQ A;  2BY6 X;  4KTS A;  4NWL A;  4R0I A;  1JIR A;  1CT4 E;  3DFJ A;  1AE5 A;  1MUE B;  1C5M D;  2RA0 A;  3KYG A;  1W0Z U;  3URD A;  3MU0 A;  4WF8 A;  1DXW A;  1FLE E;  5IYT A;  3RLW H;  1JBU H;  4B71 A;  4AFZ A;  4MPW A;  4UON A;  1UCY K;  3SND A;  2FI5 E;  3A8B A;  4K60 A;  1KLI H;  1EPT C;  2OTV A;  4CRE A;  1ZHP A;  6EST A;  3N7E A;  2ULL A;  1PQA A;  1PPG E;  1LHG H;  2JET B;  3TGJ E;  2BLV A;  1O2X A;  2Y5G A;  1LHC H;  3ATK A;  4J1Y A;  1E37 B;  3S7K B;  1O30 A;  4H4F A;  4I7Y H;  2DE9 A;  1A0H B;  1TX6 A;  1THR H;  3ZIA D;  1UTO A;  1ABJ H;  3P6Z B;  3LGT A;  1HGT H;  4FET A;  3RXH A;  2A7H A;  1V2U T;  1QQ4 A;  1FNI A;  1TAL A;  2FLB H;  1T7C A;  1KLJ H;  2FIR H;  2BD5 A;  4X1N U;  4INH A;  3S0N A;  2A45 B;  2B5T B;  5ESB A;  3F0O A;  1UMA H;  1GI2 A;  1L0Z A;  4Y8Z A;  1TMB H;  1D3T B;  1ZOM A;  2JH0 D;  3Q77 A;  1VCW A;  2TIO A;  2WYG A;  3RUO A;  1Z6J H;  5GWZ A;  1LVM A;  1SGP E;  2A5A A;  4GLY A;  1UTM A;  3SU4 A;  1ETS H;  2PWX A;  5HYO A;  3V7T A;  1EZU C;  3SU5 A;  1ORF A;  1C5X B;  2TGP Z;  1RXP A;  1BMA A;  1C2J A;  1O3N A;  1C5W B;  3N99 A;  1GHX H;  1C5V A;  2OD3 B;  1IQH A;  3B9F H;  2Z7F E;  3M3T A;  4FUG A;  1GVK B;  3HAT H;  5ETX A;  5L2Z H;  1XXF A;  2AMQ A;  3UOP A;  4AGK A;  2CGA A;  1SGR E;  2Q1J A;  2FOE A;  1RTF B;  1G3B A;  3RXO A;  1PPC E;  2ZFF H;  1MCV A;  1F5K U;  1KXA A;  3VB5 A;  5SGA E;  4ABD A;  5FHT A;  3SNA A;  5EXL A;  4RI0 A;  3RXI A;  2IJD 1;  2UWL A;  2ZFQ H;  1TPS A;  1VCP A;  2QXH A;  1UW7 A;  2C8Z B;  2JJ1 D;  1UVO A;  2GDE H;  2ZZU H;  1SHY A;  1VR1 H;  4DG4 A;  3PYH A;  2EC9 H;  3RML H;  1P2N A;  1EAS A;  4MLF B;  4XRN A;  1CT2 E;  4YOI A;  3EST A;  1V2P T;  2AMD A;  2RG3 A;  3RP2 A;  2V7Q D;  1VJA U;  1O39 A;  1XUH A;  2W26 A;  3ZZ8 A;  1O32 A;  2G5N A;  1AVW A;  1EJA A;  3GY5 A;  1AUJ A;  1JXP A;  4D9Q A;  3RM0 H;  1SI5 H;  2ILN A;  3NXP A;  4MPU A;  1O3O A;  4Z6A H;  3AAU A;  1BIT A;  3K2U A;  1CHO F;  1T32 A;  2Q6F A;  2QF5 A;  4VGC C;  4ZXX H;  4H42 U;  1FX0 B;  3T27 A;  1S81 A;  2SGE E;  2KX4 A;  2VIN A;  1E35 B;  3ZYD A;  1G37 A;  2BD2 A;  4XD7 D;  5E2P A;  5KED A;  1Z6E A;  1O3A A;  1YLN A;  2OCV B;  3OAA D;  2FWW A;  5LPF A;  3SU0 A;  4D7F A;  5ABW A;  4B2A A;  1UCY E;  1J8A A;  2QE7 D;  3I29 A;  1EOL A;  1YYY 1;  4OM9 A;  1AFQ C;  2Z9I A;  3M61 U;  3LOX A;  4BXS A;  1NRS H;  5TCC A;  3RXF A;  1KSN A;  1IOE A;  4FU7 A;  5T3H A;  2A2Q H;  1S6F A;  2ZDN A;  3RXS A;  1FDP A;  4DW2 U;  3ZZ9 A;  3TU7 H;  1A2C H;  1VGC B;  1P02 A;  3UFA A;  4O3U A;  1Z71 A;  3K6Z A;  4ZUH A;  1PPF E;  1BQY A;  1QBN A;  3TJO A;  2A2X H;  1CHG A;  2ZTX A;  1WOF A;  1YCP H;  3E91 A;  4XBB A;  1SMF E;  1GI0 A;  1UJ1 A;  4INL A;  5EOD A;  1SSX A;  1F5L A;  1Y5U T;  3ATI A;  1MTS A;  2VVU A;  5C5O A;  1A4W H;  2CMY A;  1TGB A;  3KHV A;  1GI5 A;  1CHO G;  5I46 H;  1MKW K;  4ACA A;  3DFL A;  1LHE H;  2G52 A;  5F8Z A;  2PW8 H;  4HTC H;  1OYQ A;  4OS2 A;  2ZHF H;  1TE0 A;  5C1U A;  1HIA A;  1EAT A;  2VB0 A;  3F9E A;  3P70 B;  1A5H A;  1UVU H;  4K3J A;  2GT7 A;  1P09 A;  2NWN A;  1G9I E;  3A7Z A;  3T5F H;  1UK2 A;  2F91 A;  2J38 A;  3MTY A;  4ABH A;  5LPR A;  1SB1 H;  3KQD A;  1ZPB A;  2PLX A;  3IIT A;  3SN8 A;  3QTO H;  2F9O A;  4DT4 A;  5L6N H;  1N8O C;  2KCO A;  5AF9 H;  4O97 A;  3K65 B;  5KGO A;  6LPR A;  1TX8 A;  3RXT A;  3M7U A;  1AN1 E;  3BEF B;  1A0J A;  2ZU5 A;  2PSY A;  1P9S A;  1TBZ H;  4MDS A;  2GZ8 A;  1EZQ A;  1GJC B;  1G36 A;  3RMM H;  5JYI A;  5HXF A;  1O3H A;  4CR5 A;  1QBV H;  2ZU4 A;  1XXD A;  4FU8 A;  3TJV A;  2F9U A;  4YLQ H;  2A5I A;  2WPH S;  5BPE A;  1TFX A;  3SV8 A;  2XBY A;  3Q3Y A;  1ZMN A;  3MO3 A;  5FBI A;  3VEQ B;  2K8I A;  3A86 A;  3PMB B;  4HI3 A;  3M5O A;  1W7G H;  1W13 U;  3LGI A;  1BTZ A;  1SGI B;  2QXG A;  1F5R A;  1A1R A;  1LVO A;  5KEC A;  3H09 A;  2ZGJ A;  4K69 A;  2ZI2 H;  3UNQ A;  3BN9 A;  1DT2 A;  3SNE A;  2P16 A;  7LPR A;  2UWO A;  4FUB A;  2NU3 E;  4X1R U;  1E1R D;  3M7T A;  2QY0 B;  3NUM A;  4ABI A;  3IWM A;  1EAU A;  1C2L A;  1O38 A;  1O2N A;  1V2R T;  4KGA A;  4F48 B;  5T6D A;  2F9B H;  2XW9 A;  2O8M A;  3NKK A;  1A5G H;  3VG8 A;  5B6L A;  1E34 B;  1YPL H;  1IQN A;  1Y3Y A;  3PV2 A;  2A7C A;  1QQU A;  1GJ6 A;  1QZ8 A;  2Y5F A;  1S84 A;  1RJX B;  4ABF A;  1O3F A;  4AB9 A;  1EAX A;  2Y6T A;  1HUT H;  2F3C E;  1GBM A;  2HNT F;  9LPR A;  3IG6 B;  3NCL A;  2PKA B;  2BMG B;  2OXS A;  4JZI A;  1C2M A;  3ZZC A;  4XE4 A;  3UPE A;  3EQ0 H;  1QJ1 B;  2XXL A;  3A89 A;  5FX6 A;  5GND A;  1GMH F;  4BAH B;  3C1K A;  3JZ1 B;  2THF B;  1GHW H;  1O2S A;  4SGA E;  2P94 A;  1FPH H;  4AB8 A;  3A80 A;  1N6Y A;  4X1S U;  3HKI B;  2ZWL H;  4CH2 B;  3TIU A;  1MQ5 A;  1SL3 A;  5CHB A;  1AB9 C;  4IW4 E;  1WYK A;  2ZCH P;  3SUF A;  4WVP E;  4ACB A;  1OWJ A;  1GJD B;  2XBV A;  3M5N A;  1JIM A;  4INK A;  3UOU A;  2W3I A;  5C0T A;  1MKX K;  3F9G A;  1IQG A;  2VIO A;  1XM1 A;  2QF3 A;  3VXE H;  1AKS B;  1C5R A;  2H9E H;  1QTF A;  1WDI A;  3AAS A;  2CV3 A;  4R8T B;  1Q2W A;  1AFE H;  1GI9 B;  1F2S E;  1K1J A;  4UFF H;  3RXB A;  3GDV A;  3PMH B;  3TLO A;  3RXG A;  5CMX H;  2QCY A;  3UUZ A;  3UNS A;  1J16 A;  4FU9 A;  2VID A;  3LKW A;  2D26 C;  3UQV A;  1MTN B;  4ISN A;  2PTN A;  3MO6 A;  1ELB A;  3GYM A;  1XUI A;  1ELT A;  4A5T S;  1GI6 A;  3OFN D;  4WXI A;  3SNB A;  3FVF B;  1GL1 A;  3KCG H;  4FUH A;  2V35 A;  4YO9 A;  4LXB H;  2GMT C;  1HV7 A;  3LGU A;  1K2I 1;  1FZZ A;  3NPS A;  1ZHR A;  3FZD A;  2FOB A;  1GMH G;  1CA0 B;  1GCT C;  4TPY A;  1LKB A;  1ELD E;  4BXW A;  1ZPZ A;  3LJJ A;  4CRB A;  2Y7Z A;  1T8L A;  2ZDM A;  2KCA A;  5L2Y H;  1FJS A;  1MAX A;  2HVX A;  1C2I A;  2C8W B;  3EE7 A;  1IQI A;  4NWK A;  3A8A A;  3BTH E;  1BUI A;  1O34 A;  1VKY A;  5DP6 A;  1L1J A;  4DOQ A;  3E0N B;  2BY8 X;  3A87 A;  3V3M A;  2A4R A;  1AVG H;  2GGV B;  1DOJ A;  1ZTJ A;  1LDT T;  3LJO A;  1TQ7 B;  1C1M A;  1FV9 A;  3BF6 H;  3MH6 A;  4X6O A;  1GJ5 H;  1K9O E;  1TB6 H;  2HNT C;  2H5D A;  1YPH E;  1CU1 A;  1QY6 A;  1Z8R A;  3F3B A;  3U8R H;  2G4T A;  5F53 A;  2SGQ E;  5B6O A;  1LKA A;  1W0K D;  4NA9 H;  2OBQ A;  5A0C A;  1O3G A;  2W6I D;  4TYD A;  3MNS A;  3E1X B;  2C8Y B;  4OS7 A;  4Z0K A;  4BOH A;  1QCP A;  1BRA A;  1RIW B;  1H1B A;  5JBA S;  1FQ3 A;  2ZHQ H;  4M9F A;  1KXF A;  4ABJ A;  5AHG H;  1NRP H;  1NZQ H;  5EQS A;  1TMU H;  4WWY A;  3EDX B;  1TOM H;  4Y0Y E;  5DO4 H;  4AC9 A;  4RN6 A;  4WY3 A;  1O3J A;  4X8U H;  3F68 H;  1CVW H;  5GXP A;  3GCH B;  1HAY B;  1W3C A;  3GCN A;  2FYR A;  1GBI A;  1C1V H;  2OLG A;  4ISI H;  2VVV A;  4B1T A;  2KCP A;  3RXP A;  3TJU A;  3ZVF A;  2IJO B;  3LC5 A;  4OGX A;  1P10 A;  2HOB A;  5DSF A;  2G4U A;  1D6W A;  3OEH D;  3MYW A;  3DSG A;  4ZHL U;  2YMS B;  5EGM A;  2A1D B;  1LPK B;  2VGC C;  3BTE E;  1SQA A;  2QN5 T;  4ZMA H;  1EP6 A;  1JRS A;  5EJL A;  1O33 A;  1W11 U;  3E0P B;  3E90 B;  3UR6 A;  2SNW A;  1LCY A;  5AFZ H;  4F4O C;  2ZC9 H;  3V12 A;  1ZR0 A;  4UD9 H;  1GHV H;  2R3Y A;  3ZZ5 A;  3H5C B;  4GAW A;  2J34 A;  3MH5 A;  4IC6 A;  4DY7 B;  1C5O H;  1ELA A;  5EIY A;  1NO9 H;  2ZDV H;  1NES E;  1BTP A;  1FY8 E;  4RT0 A;  2IPQ X;  3ZVB A;  1AGJ A;  1T31 A;  3W95 A;  4DT7 B;  5A2M H;  5C94 A;  5E0H A;  1ARC A;  5DKM A;  7EST E;  3E3T A;  1EAW A;  1P12 E;  3SOS A;  2WPD D;  5AVD A;  5LPE A;  2WHX A;  1O3L A;  2VBC A;  2ZFS A;  4I8G A;  4I86 A;  4MVN A;  1IQJ A;  1S0R A;  2B0F A;  2HAL A;  2ZEB A;  4XFQ A;  2FS8 A;  4Y8X A;  2QF0 A;  1P2I A;  3OX7 U;  1W7X H;  1YC0 A;  2CHA C;  1IQK A;  5EST E;  1O35 A;  1JRT A;  3K9X B;  1BHX B;  1P2O A;  1L1G A;  1MTV A;  4UDW H;  3C27 B;  1C5L H;  1O5A B;  2BY9 X;  3ZZ4 A;  1PYT C;  3LON A;  2BDB A;  1E79 D;  1H8I H;  1ABI H;  1GJA B;  2VVC A;  1C1W H;  2P8O B;  1O3C A;  1DWE H;  1PYT D;  2H2Z A;  2SNV A;  3ENS B;  4X0W U;  3QUM P;  2SGD E;  4KTU A;  3KEE A;  5PTP A;  4Q80 A;  3P8G A;  3PO1 B;  4X2Y A;  1KTS B;  5LH8 A;  1KDQ A;  2GCT C;  4IMQ A;  1D4P B;  1O2L A;  1O5F H;  1GVZ A;  1DXP A;  4ZAE A;  1SOZ A;  1A61 H;  4YLU A;  1AE8 H;  2H6M A;  3EA9 A;  2H1U A;  5FPS A;  3PRD A;  1GGD B;  5CHA C;  3SJK A;  1PPE E;  1B0E A;  4U30 A;  3CEN A;  4YTA A;  3D65 E;  3S69 A;  3KYF A;  4KEL A;  4BAQ B;  1DUA A;  3U69 H;  1EOJ A;  1W12 U;  2Z9L A;  1OP8 A;  1HJA B;  1TGC A;  1DX5 M;  3FAO A;  1C5S A;  5GDS H;  3D23 A;  1ACB E;  3B23 B;  2HLD D;  2CF8 H;  1V2S T;  4BTI B;  1TOC B;  1YPM H;  2AH4 X;  2VNT A;  1FPC H;  1FY4 A;  1C5P A;  1GJ8 B;  2K0Q A;  3LH1 A;  2Y82 A;  2QA9 E;  2BY7 X;  2FYQ A;  3SUG A;  1L1N A;  3BG4 C;  5JBB S;  1OOK B;  3PB1 E;  4CRD A;  2JDI D;  1TAW A;  1OWE A;  1H9I E;  1ZSK A;  2ZA5 A;  2LPR A;  3OEE D;  4ZHM U;  1LMW B;  3MQK C;  1QUR H;  1YM0 A;  4YT6 H;  4IMZ A;  3F0P A;  2FM2 A;  2VH6 A;  1YCP K;  5TJX A;  2QGR A;  5JDU B;  1O5C B;  1NFU A;  3ODD A;  1NS3 A;  5C5N A;  1D3Q B;  2XOK D;  3GY3 A;  3R3G B;  4XSK U;  3MNX A;  4ASU D;  1O2U A;  3BSQ A;  3U8O H;  2FS9 A;  1HAI H;  1DUE A;  1SPJ A;  4TPI Z;  2PKS B;  2V0B A;  1E38 B;  3NZI A;  4K1E A;  1ELC A;  1EJM A;  1W0J D;  3RXU A;  1HAO H;  1D9I A;  1Z8G A;  4Q7Z A;  1EFR D;  5GJ4 B;  1C4Y 2;  4WXV A;  3ZZA A;  1W8B H;  4BNR A;  4HGC A;  4Z1M D;  4YXW D;  2FOM B;  3A81 A;  3SJ8 A;  2PTC E;  1E0F D;  3LC3 A;  1QB6 A;  5EJZ A;  2PUQ H;  1QL8 A;  4FVD A;  2YNA A;  1PPH E;  4NZL A;  4CR9 A;  3LIW A;  1XUK A;  2VIW A;  1WCZ A;  1V2V T;  5CDF E;  1BA8 B;  3T29 A;  3UIR A;  1ZGI A;  3RMN H;  1XKB C;  1EJN A;  2IOT A;  5AFY H;  2BOH B;  2EI7 A;  5I25 A;  2WYJ A;  2Z9K A;  3RU4 T;  1CO7 E;  3AW1 A;  4JYV H;  1ZSL A;  1QBO A;  2Y81 A;  4B6E A;  5C67 A;  1S85 A;  1G3E A;  4DIH H;  1FI8 A;  2C3S A;  2NU4 E;  3PRO A;  2ZPQ A;  2Z3D A;  1TNJ A;  4B75 A;  3GS9 A;  5J4S A;  2BQ6 B;  1UK3 A;  4OS4 A;  3RXC A;  1C5Q A;  2J98 B;  4FOU C;  1EZS C;  1T8N A;  1C1U H;  2KCY A;  3SQE E;  2SGP E;  1AI8 H;  1W2K H;  1P3E A;  3SI3 H;  3PWB A;  2OQU A;  4WH8 A;  5FL7 D;  4TY7 A;  2XC5 A;  1GHZ A;  4X2X A;  2F9V A;  2RCE A;  4B76 A;  4ZKO U;  2W7U A;  1IQM A;  1MZD A;  2STA E;  1P8V C;  4MNY A;  2W6J D;  2FOF A;  2HRV A;  1BBR H;  1O2T A;  3CNR A;  1GWA A;  3SZN A;  3LGY A;  3RXK A;  2ZU1 A;  3CP7 A;  2ODQ A;  3VGC C;  2OIN A;  2P3U B;  4X8S H;  3E16 B;  2BXU H;  1ELG A;  1A3B H;  5HM9 A;  3SUE A;  3UWI A;  4BAK B;  1NC6 A;  5A8Z A;  4JZ1 A;  2FES H;  1H9H E;  1QL7 A;  5EW1 H;  1GJ4 H;  1FY3 A;  1SQO A;  1DDJ A;  2QF4 A;  1EPT B;  3HK6 B;  3S9B A;  4F49 A;  3GY8 A;  4AOQ A;  1HFD A;  4X6N A;  2WV9 A;  3N7O A;  1CGH A;  4TSF D;  5EG4 A;  1YBW A;  2V6N A;  4MNV A;  3V13 A;  4FUF A;  4GPG A;  2K1Q A;  4NIW A;  4LZ4 B;  3SOR A;  1S6H A;  4NA8 A;  3TGK E;  3HPT B;  1C1R A;  4ZCN A;  1AWH B;  4I8K A;  3BTK E;  3KGP A;  4ABG A;  1A7S A;  1KXE A;  2AEI H;  3URE A;  1O31 A;  1PQ7 A;  1UTP A;  3UY9 A;  4AX9 H;  4D76 A;  2PSX A;  1A46 H;  4XDE A;  2A32 A;  3UQO A;  1UVT H;  1XX9 A;  3SBK A;  2G55 A;  1CGI E;  3BTT E;  1XUG A;  2AFQ B;  1OS8 A;  1AQ7 A;  4Y11 E;  1V2M T;  3D49 H;  3PTN A;  4A92 A;  4GVU A;  2PP6 A;  1GI7 B;  4ISH H;  1QA0 A;  4B2C A;  1C2F A;  2C93 B;  3P8N A;  1QHR B;  2ANK H;  1EX3 A;  5FPY A;  1NM6 A;  1AZ8 A;  1VZQ H;  1C1T A;  2FEQ H;  3M35 A;  1D3D B;  4A1T A;  1K1L A;  1C2E A;  1OP2 A;  2ZGC A;  1P57 B;  6CHA C;  5E2O A;  2WV5 A;  4AYY B;  5DGJ A;  2C90 B;  1LPZ B;  3U28 C;  1TWX B;  1FN6 A;  2PGQ B;  4X2V A;  4CHA C;  1O2H A;  1DWB H;  2WPJ S;  3G01 A;  4I8H A;  1OYT H;  1BZX E;  2ASU B;  2ZDK A;  3TH4 H;  4B6F A;  2XWB I;  1HAX B;  3GYL B;  1TPP A;  1W0Y H;  1Y59 T;  3ATW A;  2BQW B;  2R3U A;  5GPI B;  1B5G H;  4U01 A;  2F83 A;  4B2B A;  4FUI A;  5DP3 A;  3GDU A;  2QYI A;  3SI4 H;  3Q00 A;  4NFF A;  1F0U A;  2JH5 D;  3ZVD A;  3DCL A;  2HPQ H;  3P8F A;  1FIZ A;  2A4O A;  3QLP H;  1WTH D;  1YCP M;  2CN0 H;  3KN2 A;  1UTJ A;  3RDZ A;  3ZV8 A;  2ZEC A;  2Z6B D;  1H8E D;  2XWA A;  2O9Q A;  2WPI S;  3BTG E;  1MCT A;  4EST E;  3SYJ A;  2UUK B;  1O2K A;  5J4Q A;  1SLV B;  3SV6 A;  4IC5 A;  4GSO A;  5EU8 A;  1T8M A;  2ZFP H;  1S0Q A;  1OX1 A;  4H6T A;  3MH7 A;  1GBB A;  1DAN H;  1RRK A;  1SGN E;  1EKB B;  4YZU A;  4K1S A;  1HJ9 A;  3TK6 A;  3TVJ B;  3F1S B;  3A8D A;  3FN8 A;  2GJG A;  4XOJ A;  4VGC B;  1JWT A;  3SNC A;  1UTN A;  3GIS B;  4YOG A;  1DLE A;  2ZGX H;  2A7J A;  3RXD A;  4MG3 A;  1AU8 A;  2WPL S;  3AVZ A;  4LK4 A;  3SZE A;  2XYA A;  1V2Q T;  1UK4 A;  1BTH H;  3MU5 A;  1F0S A;  3PWC A;  2CJI A;  3RM2 H;  3NK8 A;  4D9R A;  2JIZ D;  3O8C A;  2JJ2 D;  1W14 U;  2R2M B;  5DJ7 A;  2WUC A;  5EQR A;  8EST E;  3F9H A;  3H7T A;  4WMD A;  1TMT H;  1AFQ B;  4A1X A;  1YP9 A;  1V2J T;  2OC7 A;  3A7Y A;  2FX4 A;  3M7Q A;  2WIN I;  2ZQ1 A;  3A7T A;  4O03 A;  2Y7X A;  3U1I B;  4ZKR U;  1VCQ A;  3PLK A;  3TJN A;  1MQ6 A;  1TAB E;  2VWM A;  3KF2 A;  4Q7Y A;  1NFW A;  3BIV H;  1ANB A;  1GBL A;  2OBO A;  1KIG H;  2HLC A;  2D8W A;  3OYP A;  5HM2 A;  8GCH F;  2GKV E;  2W7S A;  1SGQ E;  4K2Y A;  4A6L A;  1XVO A;  1V3X A;  4PRO A;  4NIX A;  1H8H D;  5F8X A;  1V2N T;  1C5N H;  2A4G A;  2D1J A;  2G51 A;  4JYU H;  2IPH A;  1QIX B;  2XC4 A;  1O3P B;  2AMP A;  1GBH A;  1C1P A;  1DLK B;  1HRT H;  1BHX F;  1T4U H;  2ANW A;  3SGA E;  4CRA A;  3F2H A;  2UWP A;  4BAO B;  2BD7 A;  1E1Q D;  1GDN A;  3PLB A;  1TNI A;  1TGT A;  1C9T A;  3GCT F;  1HDT H;  1ZRK A;  1T8O A;  3KNX A;  1F7Z A;  1HAV A;  1WUN H;  2UUJ B;  1SGD E;  1GHY H;  5A8Y A;  1NU7 B;  1OWH A;  2F43 B;  3LGV A;  3T25 A;  2ODP A;  2FI4 E;  5FAH A;  1K1P A;  4I8L A;  2XND D;  1J14 A;  4ISL A;  2GZ7 A;  1N8O B;  3DHK H;  1CGJ E;  1ZJD A;  4DJZ B;  1TX7 A;  1CT0 E;  3SUD A;  1P2Q A;  1X7A C;  1O3D A;  3QZR A;  5C1Y A;  1AD8 H;  3QK1 A;  2WV4 A;  4BAM B;  4E7N A;  5EQQ A;  4YT7 H;  3QX5 H;  1WXR A;  1E36 B;  1IQL A;  4U32 A;  3SJI A;  1YY3 A;  4AZ2 B;  8GCH G;  2BDC A;  4AFQ A;  3HK3 B;  1ZLR A;  3LT3 A;  1XMN B;  4NFE A;  4TWW A;  1CSO E;  3BTM E;  4NSY A;  1GL0 E;  2G8T A;  1C2H A;  1QJ7 B;  1HAG E;  1GG6 C;  5DP8 A;  4IS5 A;  1CBW C;  4RKO B;  3P8O A;  1DIT H;  1TYN A;  5FCK A;  3OY5 U;  1AUT C;  2EST E;  4O9V A;  4OGY A;  1LQE A;  2FI3 E;  3S7H B;  3GCT G;  3SV2 H;  3K6Y A;  1Y3W A;  3I78 A;  2ZNK H;  3S9C A;  2GP9 B;  1IAU A;  3ZVE A;  1QRZ A;  1GBK A;  1GHB F;  1ESA A;  2ZGH A;  1LHD H;  3BEU A;  3FZZ A;  4BAN B;  1FON A;  2A0Q B;  4MPX A;  2OP9 A;  2BLW A;  5GIB A;  5JPM H;  2FX6 A;  3U98 H;  3A82 A;  3RXM A;  3TH3 H;  2HNT E;  1P0S H;  2CF9 H;  1V2L T;  4HZH A;  1QB1 A;  4E06 H;  4A7I B;  1VJ9 U;  2PV9 B;  5GCH F;  2WZQ A;  4XBD A;  1DE7 H;  1DSU A;  2ANM H;  1HIA B;  1TRN A;  4ZXY H;  4UE7 H;  2YOL A;  1O2Y A;  4RSP A;  1BRU P;  1QJ6 B;  4AG2 A;  3LPR A;  1COW D;  3WWB A;  1BRB E;  4MTB A;  3U9A H;  5K7R A;  5C20 A;  2ZIQ H;  1C5T A;  4JZD H;  4JK6 A;  1K0H A;  1CE5 A;  1AB9 B;  3P17 H;  3BV9 B;  1P11 E;  1MTW A;  1TRM A;  1DPO A;  1LO6 A;  1Z8I B;  2V3H H;  1P06 A;  1HAH H;  2ZG0 H;  3SO3 A;  4NZQ A;  2B7D H;  2FTM A;  1ZHM A;  1ARB A;  4FUC A;  5T6G A;  1BB0 B;  1EAI A;  2TGA A;  1ELV A;  4AGJ A;  1EZX C;  4UEH H;  2BDH A;  4MNW A;  2TPI Z;  2O8W A;  2RDE A;  2J4I A;  1GHB G;  1VIT F;  1IHS H;  4JK5 A;  3A88 A;  3GY2 A;  1O2I A;  1Q3X A;  4AN7 A;  4YM9 A;  2F4L A;  2BDG A;  4U2W A;  4OS5 A;  1XUJ A;  1DWD H;  3EE0 B;  2Z3C A;  1L4D A;  2VWO A;  1PQ5 A;  2PUX B;  1J9C H;  2OC0 A;  1YLD A;  3KL6 A;  4I33 A;  2FLR H;  4BTT B;  4J2Y B;  1RTK A;  4UFG H;  2GMT B;  3M3S A;  2GVF A;  2ZDL A;  4YES B;  1IHT H;  3VB4 A;  1GCT B;  1V6D A;  3HGN A;  3O8D A;  1TA2 A;  3MO9 A;  3UTU H;  1AHT H;  1YPK H;  1C5U A;  3SGB E;  1O5E H;  3PLP A;  1TNL A;  3WW7 A;  2BZ6 H;  2OQ5 A;  1NRR H;  1U6Q A;  1OWI A;  1UTL M;  2SFA A;  3TH2 H;  2UUF B;  1AND A;  1SQR A;  1UO6 A;  3AW0 A;  3QDZ B;  3RC6 A;  4B74 A;  1BTW A;  1K21 H;  2B8O H;  3ATM A;  2ZO3 H;  1EB1 H;  1GI3 A;  3FAN A;  1BBR K;  1C4U 2;  1O2V A;  1L2E A;  2GDD A;  4MPV A;  2JET C;  1VIT G;  5C0U A;  2BHG A;  1HXE H;  4AFS A;  2Q6G A;  1FAX A;  1O2Q A;  1UTK A;  2AER H;  1Z1J A;  4GCH F;  5EXN A;  2O8L A;  1EPT A;  1GMC F;  2I6S A;  3BTW E;  3ZVC A;  1AIX H;  5BRR E;  2AIQ A;  5K0H A;  3FOA A;  2FTL E;  2AHM E;  3E8L A;  2GX4 A;  2A5K A;  1DY8 A;  3QWC H;  1YPE H;  5EOK A;  3VB6 A;  1UHB B;  1C9P A;  3A7X A;  3M36 A;  3SQH E;  2Z94 A;  4IN1 A;  2R9P A;  3R0F A;  4F55 A;  1D6R A;  1C5Z B;  1GBA A;  3A83 A;  2BZA A;  1P03 A;  1KXC A;  3NWU A;  1G32 B;  3PV5 A;  2V3O H;  1Y5B T;  4ABE A;  2OC8 A;  4NIY A;  3L6P A;  4Y7B A;  3N7D A;  3ZVA A;  2H9T H;  2HGT H;  3F2F A;  3DD2 H;  2QC2 A;  1KMH B;  4DCD A;  2ZU2 A;  3QZQ A;  1ETT H;  2NU1 E;  4JZE H;  1L4Z A;  1P01 A;  3PM3 A;  3ZZ3 A;  3CS0 A;  1Y5A T;  4AFU A;  1SBW A;  3U1J B;  1YPJ H;  3GDS A;  2VGC B;  1SLW B;  2J5U A;  1EQ9 A;  2F9P A;  1LTO A;  3F6U H;  1MU8 B;  2P3T B;  2NU2 E;  1TIO A;  1WU1 A;  5LGO A;  3ZYE A;  3L33 A;  1HCG A;  4GCH G;  1VIT H;  4A1V A;  2QV1 A;  3TK5 A;  4CRF A;  2NU0 E;  1GMC G;  1FIW A;  1PJP A;  5H4I B;  3ZZ7 A;  3V0X A;  3ZZB A;  1BTY A;  1SQT A;  2LP6 A;  1A0L A;  1OWK A;  1TPA E;  4ZKN U;  1BMN H;  2J95 A;  1K22 H;  3A7W A;  1O2O A;  1HB0 B;  1HLT H;  3T62 A;  2XNI A;  4NGA H;  1MAY A;  3RXR A;  1XUF A;  4JZF H;  1Y8T A;  3VB3 A;  3DSO A;  4CBN A;  1IQF A;  2Z3E A;  1NU9 A;  2CHA B;  1RGQ A;  3P92 A;  1ETR H;  2R0L A;  2OUA A;  1SKY E;  2KAI B;  1SFI A;  3RXE A;  1FUJ A;  1FN8 A;  2F9N A;  1NRQ H;  2AGE X;  2GV7 A;  5JBT A;  4ZH8 A;  5C2Z A;  3VXF H;  1O5G H;  5DPA A;  5E8E H;  5HIY A;  5T6F A;  1SGY E;  1UTQ A;  3FP7 E;  1YLC A;  5JBC S;  5A8X A;  2PR3 A;  1N1L A;  1OPH B;  3ITI A;  1ANE A;  1EB2 A;  2GZ9 A;  4Q4L A;  2GCT B;  1RD3 B;  4X2W A;  4Q63 A;  1GCD A;  1OKX A;  3TNS A;  5FBE A;  3MWI U;  2FXR A;  1GBT A;  1ZTK A;  3SJ9 A;  3W94 A;  3RXQ A;  5CHA B;  4QT8 C;  2ODY B;  3TPI Z;  4DUR A;  1BBR E;  2BVR H;  1HAZ B;  2LNC A;  2BXT H;  4X6M A;  2XCF A;  4O3T A;  4FUJ A;  2Z9J A;  3CS7 A;  5HGG A;  3VB7 A;  1V2T T;  1WAY B;  2DE8 A;  4KKD A;  3UNR A;  1QRW A;  1ESB A;  1VGC C;  4P02 A;  1O0D H;  3FKS D;  1V2W T;  3DT0 H;  2VU8 E;  1O2Z A;  1GVL A;  4TWY A;  1F92 A;  1THS H;  3I77 A;  3RXA A;  1MZA A;  1AVX A;  1Z1I A;  3T28 A;  3SW2 B;  3EAJ A;  3STJ A;  2ZTZ A;  3BG4 B;  2Y5H A;  3EGK H;  1O2J A;  3MNC A;  1T4V H;  1GJB B;  2B9L A;  3MOC A;  2PKA A;  3UB0 A;  2BD8 A;  4Y8Y A;  3SGQ E;  2FO9 A;  2ZQ2 A;  1O2G H;  5TCA A;  1O3E A;  4K1T A;  2BVX H;  2GCH F;  3ELA H;  3FO8 D;  5EXM A;  4X8T H;  3SV7 A;  3JZ2 B;  4NA7 A;  3URC A;  2BD9 A;  2ZPR A;  2BX4 A;  1Y3U A;  2P95 A;  4X8V H;  1LHF H;  1KLT A;  2J2U A;  3A84 A;  3KID U;  1KDQ B;  1DST A;  1Z7K A;  4TY6 A;  2BOK A;  1K1M A;  1K1I A;  1AKS A;  1KY9 A;  1KXB A;  1CA8 B;  1C1Q A;  1S5S A;  1YGC H;  2J97 A;  2HVY B;  1DY9 A;  1P9U A;  1BCU H;  3AAV A;  3B8J A;  2ZFR H;  1G3D A;  3MFJ A;  2GV6 A;  2M2A A;  3ZZ6 A;  1OSS A;  1G30 B;  1V2O T;  3OTJ E;  3SHC H;  4WJG 2;  5DP4 A;  1ZML A;  3S9A A;  4GUX A;  1P2M A;  3H7O A;  1NPM A;  1TNG A;  4D7G A;  1GBD A;  2EA3 A;  4ZRO A;  1BRC E;  2VWL A;  2XTT B;  3A7V A;  5L30 H;  1D3P B;  3RXV A;  3STI A;  1ZSJ A;  1NN6 A;  1SGE E;  3ZV9 A;  1EXF A;  1ZRB A;  1OWD A;  3PV4 A;  2A31 A;  1UVS H;  4IGD A;  3UR9 A;  4Y7A A;  1ID5 H;  4K8Y A;  5EW2 H;  2GCH G;  4XBC A;  1MTU A;  1QFK H;  3UWJ H;  3ZZD A;  1P05 A;  2HPP H;  1AMH A;  1B0F A;  2QXJ A;  4MNX A;  1BIO A;  1C2K A;  2FOG A;  2FOA A;  1UCY H;  1SGT A;  1H8D H;  3SU2 A;  1MMJ N;  2EQN A;  4Y0Z E;  3RC5 A;  5A0B A;  2H5C A;  1RS0 A;  3BG8 A;  4Y71 A;  1FY5 A;  2BDI A;  3RMO H;  5JB9 S;  3GCO A;  3RU4 E;  2TRM A;  1SG8 B;  2O8U A;  4X1Q U;  3VGC B;  1GBF A;  1GDU A;  2M5T A;  4BTU B;  3ATL A;  5HMA A;  2KM0 A;  5EPN A;  1ZPC A;  2GD4 B;  3RU4 D;  1OHH D;  1QA7 A;  2WPK S;  4Y76 A;  2ALP A;  2HWL B;  2J9N A;  1Q31 A;  2R0K A;  1INC A;  2EEK A;  4K5Z A;  1EST A;  3TNT A;  3GY4 A;  3DUX H;  1QL9 A;  2RDL A;  3F2G A;  2ZHE H;  4KTC A;  4CRC A;  3VFE A;  4Q7X A;  2FZZ A;  1O5B B;  1LQD B;  3HKJ B;  2FDA A;  5A0A E;  2KR7 A;  4Y6D A;  5F6M A;  3KQE A;  1XKA C;  1BOQ A;  3RXJ A;  7GCH F;  1O3M A;  1MTN C;  1MD7 A;  1HXF H;  2QIQ A;  3PRB A;  3M37 A;  2TGT A;  2Z9G A;  1AO5 A;  2IN2 A;  4JMY A;  1Y3X A;  5F8T A;  1DVA H;  1K1O A;  7KME H; 
#chains in the Genus database with same CATH homology
 2YOL A;  2A4G A;  4WF8 A;  2M2A A;  3M5L A;  1DXW A;  4DT4 A;  4R8T B;  2KCO A;  2KCP A;  4B71 A;  2IJO B;  1N1L A;  1COW D;  3WWB A;  3F2H A;  2KCY A;  3OE7 D;  4Q4L A;  5DSF A;  3FOA A;  4B6F A;  2AHM E;  3OEH D;  4Q63 A;  4WH8 A;  1NBM E;  1E1Q D;  5FL7 D;  1DY8 A;  2CK3 D;  2YMS B;  5GPI B;  2OK5 A;  3N7E A;  2HLD D;  2V7Q D;  4U01 A;  1BT7 A;  3LKW A;  2F9V A;  4B76 A;  4F55 A;  3RC4 A;  1JXP A;  2OC1 A;  2W6J D;  3E90 B;  3EYD A;  3M5M A;  3OFN D;  5HKK D;  3KNX A;  2K0Q A;  3DCL A;  3SU6 A;  4WH6 A;  2WSS D;  1NBM D;  2F43 B;  5IK2 D;  2F9U A;  3SUG A;  3PV5 A;  3AK5 A;  2OC8 A;  3GS9 A;  2OIN A;  3L6P A;  3N7D A;  2XCF A;  2JDI D;  5IDK A;  2QF5 A;  2XND D;  3F2F A;  3SV8 A;  3OEE D;  3KN2 A;  3SUE A;  1KMH B;  3SU3 A;  1MAB B;  1FX0 B;  3ZIA D;  3O8B A;  1H8E D;  2K8I A;  4TT3 D;  3F0P A;  3SUD A;  3M5O A;  4FET A;  4XD7 D;  2FM2 A;  2QF4 A;  3OAA D;  3SYJ A;  3NRL A;  3FKS D;  3SU0 A;  2LEL A;  1A1R A;  3U1J B;  3SV6 A;  2F4L A;  3H09 A;  4I32 A;  2WPD D;  3SU2 A;  3W1E A;  1NS3 A;  2QE7 D;  2J5U A;  3SV9 A;  2WV9 A;  2WHX A;  4TSF D;  2VBC A;  2KCA A;  5T1V A;  3RC5 A;  2XOK D;  5EQQ A;  5ESB A;  1WXR A;  4OM9 A;  4NWK A;  1E1R D;  2OC0 A;  3F0O A;  4ASU D;  2K1Q A;  3LOX A;  4I33 A;  3FN8 A;  2O8M A;  4ZCN A;  1W0J D;  3VG8 A;  5B6L A;  3WWF A;  1EFR D;  4A1V A;  5DN6 D;  5GJ4 B;  5EPY A;  2GVF A;  2QV1 A;  2KM0 A;  3SU1 A;  5EPN A;  3O8R A;  2A4R A;  3PV2 A;  3SU4 A;  4Z1M D;  2GGV B;  3SZE A;  5H4I B;  2FOM B;  4YXW D;  3P8O A;  4B73 A;  1OHH D;  2KFW A;  3O8D A;  3LON A;  3UB0 A;  3OTP A;  3SU5 A;  1E79 D;  2L6O A;  2FP7 B;  1BMF D;  2JIZ D;  5C17 A;  2JJ2 D;  3N99 A;  3O8C A;  1CU1 A;  2P59 A;  1S6L A;  2XNI A;  3F3B A;  5EQR A;  3FO8 D;  3WW7 A;  4A1X A;  5F53 A;  1W0K D;  3KEE A;  4K8B A;  3SV7 A;  4A92 A;  3F2G A;  5GND A;  2OC7 A;  5CDF E;  5ETX A;  2OBQ A;  4KTC A;  3DSO A;  2W6I D;  4TYD A;  3P8N A;  2XCN A;  5FPY A;  1RGQ A;  1DXP A;  2A4Q A;  2KR7 A;  2KZ4 A;  2YMS C;  3RC6 A;  4B74 A;  4M9F A;  1SKY E;  5CHB A;  5EQS A;  3U1I B;  3SUF A;  3KF2 A;  4I31 A;  4A1T A;  3M5N A;  3DSP A;  4B6E A;  2OBO A;  2YMS D;  4RI0 A;  3PRB A;  5FPS A;  5C0U A;  5C0T A;  3PRD A;  4NWL A;  3OYP A;  5FPT A;  4JMY A;  2IJD 1;  1W3C A;  1RTL A;  4B75 A;  2WZQ A;  1DY9 A;  2JJ1 D;  1H8H D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...