4HI3A

Crystal structure of dimeric r298a mutant of sars coronavirus main protease
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
300
structure length
300
Chain Sequence
b'SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVAQC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Mechanism for controlling the monomer-dimer conversion of SARS coronavirus main protease.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 82
structure length 300
sequence length 300
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2012-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 4hi3A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4hi3A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4hi3A02
1GWAA 3OY6U 4YOGA 4X1NU 2RA3A 3A7XA 2PKAA 5ABWA 1TWXB 3STIA 1ZSKA 1PQAA 5E0JA 1MH0A 4SGBE 2K1QA 1INCA 1E0FD 1HUTH 3MOCA 4KELA 4F4OC 1S84A 3KEEA 1QRWA 3AASA 4JZIA 1DY8A 3TPIZ 3BG4C 4NIVA 1SLVB 3RLWH 4X8SH 1C5ZB 3SU5A 1O3GA 1QL8A 2UWPA 4A92A 1C5NH 2Z3CA 3KIDU 2VWNA 5F03A 2AMDA 1V2ST 2J95A 1TNIA 3OTJE 1WV7H 1AVXA 5LH8A 5TCCA 1F92A 1TGSZ 5H4IB 1S82A 1EJNA 1XX9A 1LQEA 4OGYA 1LMWB 2BYAX 1P06A 1SGIB 4YT7H 2ZU5A 3RXIA 1DT2A 4B2BA 1W14U 1O2LA 4Y6DA 4UDWH 1BRCE 2HVXA 4OS5A 3UY9A 1E38B 1KXFA 1O2PA 4XOJA 1A3BH 1QA0A 2FX4A 2O8UA 4A1TA 4LK4A 4FUGA 5A09A 3BIUH 1ZYOA 2FI4E 3LC3A 1UCYK 1V3XA 1N8OC 4D8NA 5GXPA 2UUJB 4MNWA 3U9AH 4BXSA 4VGCC 2EI6A 1QTFA 3P8NA 3Q3YA 3QK1A 3GCOA 3E1XB 1NS3A 1CA8B 3F9HA 1AUJA 1MZDA 2BY7X 3A86A 5DP4A 1ZHPA 1GJ8B 1RXPA 4TWYA 4WF8A 1SGRE 1AI8H 4NCYA 1NZQH 1ZRKA 3F6UH 1UTJA 4ESTE 1NT1A 2GZ9A 4IC6A 2ALPA 2VJ1A 4WMEA 1IQNA 1UJ1A 4NWLA 2ZDVH 1TGNA 3LC5A 4F49A 1CQQA 1ANCA 1TALA 1YPHC 2Z9JA 3RXEA 2FTLE 2J9NA 3A82A 5C67A 1NRRH 2LIZA 4ZROA 3TIUA 2BY6X 3RXBA 5G4BA 2ZHWH 5AFZH 3HK3B 1C1VH 4K1EA 1GBBA 3BTWE 1THPB 1O34A 3SUGA 1UCYH 1J15A 1EJAA 3UIRA 1K21H 1TRNA 6GCHF 4BAOB 1P2IA 2BOHB 3M5NA 1TYNA 1TMTH 2ZFSA 3RP2A 3UOUA 1YPHE 4J2YB 1OWHA 1MQ6A 5A8ZA 3AW0A 1AB9C 1ELFA 4I33A 2HRVA 4Y76A 1GHYH 3ZZCA 4FUFA 1Y5AT 3Q3KA 2A4QA 2GCTC 2BD7A 1P12E 4SGAE 1AFQB 3BV9B 1SG8B 1GJ4H 5LPEA 2NWNA 1ORFA 1P10A 1A0JA 4INKA 1TONA 3RU4T 5GWZA 4OS4A 4I32A 1O3HA 3SBKA 2C8WB 1HAGE 4FUIA 5DK1A 3RXMA 2WYJA 2ZU2A 3ZYDA 2BVXH 4RSPA 3TVJB 2Y80A 3BTHE 1NM6A 2V3HH 2AERH 3P70B 2XC0A 4BNRA 2TGAA 1SLUB 1IQIA 1K22H 4ISNA 1O5GH 1SGNE 1QR3E 1T32A 4B73A 1GCTC 1P9SA 5E2OA 1AIXH 3EE0B 2SNWA 3ATIA 1KSNA 3M37A 3VB3A 1TGCA 1WAYB 4ISLA 1FN6A 3UFAA 1PPFE 1O2NA 1J16A 3UNQA 1V2LT 4U01A 5E2PA 2OBOA 1AGJA 4Q2KA 1FV9A 3RXOA 2R3YA 1O33A 1HXEH 4YLUA 1SHHB 1VITF 2R9PA 3DUXH 4E7NA 3RXPA 4KGAA 2VB0A 1H8IH 1HAVB 3SV6A 1DE7H 1WBGB 1MTSA 4Y11E 2O8MA 3LPRA 3GCTF 1QHRB 1O2SA 5HMAA 5JDUB 4RN6A 1GJCB 3SJ8A 2ZTYA 1YPJH 2Q1JA 1ACBE 2A2XH 2BDBA 2GCHF 2ZPRA 2D1JA 3G01A 4HGCA 1C1TA 4TWWA 3QO6A 1G30B 3HK6B 1BMNH 2ZTXA 1BTZA 4WWYA 4YT6H 2GDDA 2Y82A 1Y5BT 4ISIH 1LDTT 3TNSA 1CU1A 4GCHF 4MPXA 4DIIH 1C2LA 1D3TB 1O2RA 3M7UA 3M7TA 3VXEH 3OSYA 1P01A 1EASA 1P3EA 5C1YA 4CR5A 4X8TH 1XUKA 2BDAA 1GBDA 4ABGA 1QL7A 1TAWA 4D7FA 1EZSC 1BCUH 5T6FA 2FLBH 2QV1A 1G36A 1IAUA 3P8OA 3V0XA 3SOSA 3HATH 3SV8A 2QA9E 3E90B 1ELDE 7LPRA 2IOTA 3GCHC 1W13U 1N8OB 4CR9A 3TGKE 2XBWA 1MQ5A 2RG3A 1UVSH 2NU2E 2ALVA 3I29A 3RMNH 4BTIB 3UREA 4VGCB 3FP6E 4DCDA 4ABEA 1HAVA 2ZECA 2ZIQH 1GHBF 1BBRE 3QZQA 2FLRH 2HWLB 2BB4A 4Z6AH 1SOTA 3M5LA 1MKXH 1HJ9A 3SU6A 2GP9B 1BA8B 1T8MA 4AFSA 1IQFA 1K1NA 1Z6EA 3A85A 3CENA 3LGYA 4E06H 2YNBA 2PHBA 1FI8A 1J14A 1X7AC 1RTLA 4MLFB 3SUDA 4UE7H 4DT7B 4IW4E 1D3DB 1GMHG 2HPPH 1C1UH 3ATKA 3C1KA 1GI8B 1UTOA 2OD3B 2AGIX 1YF4A 3EYDA 3MO9A 8GCHG 1O3JA 3SGBE 3OU0A 1UTLM 2FWWA 2H5DA 1C2FA 3KQEA 4A7IB 1SGFG 2GTBA 1AZ8A 3TH3H 5DG6A 8KME2 2BQWB 3A7ZA 2IN2A 3BTFE 4I7YH 1TOCB 1QQ4A 1GJ6A 1HDTH 4Q7YA 2A4OA 4MNXA 5AVDA 1J9CH 4IS5A 3GY5A 3MNBA 2HNTF 1ZGIA 1O3PB 1GJBB 3R3GB 2OQ5A 1C5VA 2FYRA 1C1MA 1AB9B 2Y7ZA 3UWIA 3ELAH 3QN7A 2XCFA 5DGJA 3SW2B 2H5CA 4JZDH 1QY6A 4QT8C 3PMHB 1H1BA 1VCWA 3UR9A 2R0LA 1GBTA 2GCTB 3PB1E 1EZQA 8ESTE 1O0DH 1ZHMA 4ZH8A 1KXAA 2ODYB 1QJ6B 2CGAA 3S7HB 1RRKA 3RMLH 4JCNA 4JYUH 5F8XA 3M61U 1NRQH 3A80A 3ENSB 2ZI2H 4GVUA 3RXJA 1SB1H 3GY6A 1GI4A 4CBNA 1BBRK 2Z9IA 3ITIA 1S6FA 2A7CA 1MKWK 5B6OA 2TGTA 1O5FH 5DKMA 2Y5GA 1Y59T 3P95A 3HKJB 2UWLA 4FUHA 4TY6A 1GCTB 3OY5U 2FPZA 1YCPK 2RCEA 3UQVA 5FCKA 1W7XH 1A2CH 3Q77A 1C2EA 1FXYA 2ZA5A 2J2UA 2VIWA 4A1XA 2OUAA 1F0SA 3KGPA 3EA8A 2W3KA 2QN5T 1P02A 1CGIE 1BHXB 1BMMH 1OPHB 4HZHA 3SORA 1G3CA 2UUKB 2GKVE 1GCDA 1LHEH 3SGAE 2BTCE 1ZLRA 3SJOA 4YOJA 4ZHAA 4X1QU 1HXFH 1UVOA 1OP2A 2A5AA 2B7DH 4X6MA 3LGVA 1Q2WA 5EGMA 2G5NA 3EDXB 2FP7B 4YM9A 5EQSA 1HAXB 1BZXE 2VIOA 1SGDE 2SGDE 4O3TA 2FO9A 1BBRH 1MTVA 4DVAU 1EAUA 5JYIA 3TGJE 1CSOE 1TOMH 3E0PB 1YYY1 3ZVBA 1GHAF 3H7OA 1BB0B 3GYMA 5EQRA 1ESBA 5AHGH 1C1NA 5IDKA 1O2YA 2G00A 1SFIA 2Y5FA 1LVOA 1DY9A 2FYQA 2SGQE 1DSUA 1P9UA 4IN2A 3BTEE 2JH5D 2VH0A 2FODA 2Z7FE 1EATA 3UQOA 2ZHEH 1GBHA 5I46H 2Q6GA 3SJKA 1QQUA 1DS2E 2SNVA 5DP8A 1MAXA 2BDYA 3M5MA 1ZMLA 1F5KU 2J34A 4D9QA 1O31A 1A0HB 1A0LA 4B76A 3IITA 3PV4A 3GCHB 1OYTH 1TMBH 3PWCA 2F9UA 3C27B 3UWJH 5JBTA 2FDAA 5FBEA 2OC0A 2BZ6H 3P92A 3RXAA 3M3VA 4DGJA 1MBQA 3FZZA 2PUXB 3TJOA 5TCAA 1V2WT 4TPYA 1QCPA 3MNCA 3SV9A 3QUMP 1GMCF 2ZKSA 1XUIA 1MUEB 2Z9KA 1PYTC 1P09A 4FUDA 3RUOA 2W7SA 2QXIA 5BPEA 1C2IA 1G3EA 3PTNA 5DO4H 1P2NA 3PTBA 1QA7A 3RXLA 3ZYEA 5JBAS 1GJ9B 1IQLA 5DP7A 3UNRA 1JRTA 1DPOA 3KQDA 3E91A 2ODPA 1P05A 2NU0E 4Y7BA 4GSOA 1YLCA 3KL6A 1ABIH 4NSVA 2I6SA 3BN9A 2QXJA 1LKAA 3PMAB 4X8UH 4ZKSU 1WTGH 4AOQA 2GD4B 2VVVA 2DE8A 3T29A 1O2IA 1V2VT 1ZJKA 3MNXA 2OP9A 2W26A 2ZFFH 1C5PA 1F0RA 3DT0H 2ZCLP 2OINA 1SVPA 3SU1A 2G4UA 1CHOF 2P3TB 3MYWA 1MTNC 3BTTE 2A1DB 3RC6A 3SHCH 1VCPA 1FZZA 1GDQA 1NFXA 2V3OH 1LO6A 3GOVB 2ZCKP 5C20A 4CHAC 1OP0A 1EKBB 1FUJA 4X6PA 1HAZB 1GI0A 4K60A 1Y3YA 1BMLA 1GBJA 1ABJH 1B7XB 1A46H 1Y3VA 1HB0B 3RU4D 2GMTC 1DLEA 5EU8A 4FU7A 3LOXA 3QWCH 2NU4E 1ESAA 4B71A 2VH6A 1EPTC 4K1SA 2G55A 5AFYH 1RD3B 2BDIA 4X1SU 1XVOA 4MPWA 3KNXA 1G2MA 3LIWA 2FS8A 2PWXA 1GGDC 3GDSA 1P11E 3LGIA 2AYWA 4OS1A 1JWTA 1UTQA 1ZTKA 4J1YA 1ZZZA 3TJUA 1J8AA 4TYDA 1AE8H 1O2JA 1XUJA 2GZ7A 6GCHG 4FUEA 1KTTB 1QB9A 2FOFA 2PTNA 1EOLA 1FJSA 1GJ7B 1ZPBA 1GI1A 4ZXXH 1AY6H 1QIXB 2ANKH 2C93B 1W12U 1T4VH 4NZQA 2GDEH 5HGGA 1L4ZA 1BDAA 4ZXYH 3LGUA 2QAAA 3ATMA 3PM3A 1O2GH 1O2ZA 1Z1JA 2CJIA 3PMJA 4NSYA 2WPJS 2VVUA 3GICB 4U30A 3RLYH 1KXCA 2TGPZ 4DJZB 1HIAB 2DUCA 2TBSA 3QGJA 4LOYH 4JZEH 2WPKS 1CA0C 3MU4A 1TGTA 4Y8ZA 1K1OA 3P8FA 2QXHA 3RXGA 4X0WU 4LZ4B 4ABHA 4U32A 1M9UA 4GHQA 1SGCA 4CRBA 3EA7A 1FY4A 1SR5C 4Y8XA 1FY8E 1BQYA 3TITA 1HJAC 2PW8H 4WVPE 4MNVA 1VZQH 4AB9A 2TGDA 1MU8B 3LJJA 1B5GH 5FXLA 1FQ3A 1P8VC 2OLGA 1C4U2 2QF3A 4Q7ZA 1RFNA 1ID5H 3MHWU 4E05H 5BRRE 4DOQA 1MCVA 1QJ7B 2JKHA 2PLXA 4DG4A 1YPEH 4AGJA 4DW2U 2GT8A 2FOCA 1OP8A 1QBNA 5ESBA 1GI6A 1FN8A 3SNBA 1LPKB 2FIRH 5T6GA 2W7UA 1DUAA 3UTUH 2D2DA 4K1TA 1O3NA 4INHA 1J17T 1H4WA 4AX9H 5SGAE 2HALA 1VITG 1FMGA 2AGGX 1ELCA 1XUHA 2P59A 3FVFB 3AVZA 1PYTD 1D6WA 1LTOA 2QIQA 1CHGA 4BAKB 2WPLS 4B2CA 3MO6A 4BXWA 3GCTG 1UVPA 2BD3A 2Z3EA 1KLIH 2UUYA 1ELBA 1AO5A 1TIOA 3KQBA 1C4V2 2BY5X 3EBNA 2H1UA 3NKKA 9LPRA 1HIAA 3A7VA 1GDNA 2PGQB 3B23B 5EPNA 1HAOH 2ANYA 4BTTB 2A5KA 2GCHG 3TH4H 3WY8A 2G51A 3ZVAA 3DHKH 4PROA 3SJIA 1P3CA 1SPJA 1OXGA 1V2PT 2Y81A 2BY8X 1O3DA 2EI8A 2OC1A 1MTWA 4GCHG 1F7ZA 3CP7A 3SV2H 3H7TA 3PMBB 3VEQB 4KP0A 3JZ2B 5FPYA 4K8BA 1P2OA 2JH6D 3KHVA 2B9LA 3RXFA 3HPTB 3T2NA 3ZZ4A 4H4FA 1EP5A 4LXBH 1RJXB 1T4UH 3VFEA 2V6NA 4A5TS 2AMQA 5EXNA 1FONA 1FY1A 2J92A 3TK6A 3Q76A 4OS6A 3PO1C 4R8TB 4CRAA 3BIVH 4UFFH 2F3CE 5A8XA 1LKBA 5FBIA 3W95A 1SLWB 1ETRH 2A31A 4CH8B 4ZKOU 3QLPH 1QRXA 1S0RA 2DE9A 4WH6A 1G3BA 3RM0H 4HI3A 2XTTB 1MTNB 2CXVA 3QTVH 2BLOA 3RM2H 2KAIB 2H6MA 2PFEA 1DICA 1THSH 4CHAB 3FFGA 2BVSH 3E6PH 1ZOMA 3LH1A 1ZPZA 5GDSH 3V13A 2WPHS 1C2HA 1KIGH 3SU0A 3MWIU 4ASHA 3ZZ7A 1IOEA 5DP6A 4JZFH 4TY7A 3ZZ6A 4MVNA 5E8EH 3T62A 4I8HA 1GJDB 2BDHA 2GMTB 4Y7AA 1EB1H 1HYLA 1EPTB 3T5FH 4NIYA 2O8LA 3Q00A 1ZMNA 1G32B 3BEIB 3SJ9A 2FOEA 1WQSA 3ZZ5A 1GGDB 2C3SA 4CRCA 1SBWA 1ZSLA 2P8OC 2ILNA 2VNTA 1D4PB 2PV9B 3UNSA 4ABAA 3PROA 3GY8A 5HYOA 2ZU4A 1ZHRA 3L6PA 4DURA 1T7CA 3NXPA 3M3TA 1P57B 1IQMA 3V12A 3TU7H 2XCNA 2WV5A 1ELVA 3V3MA 2A32A 4K5ZA 2Z94A 1Z8GA 1EAWA 2WUCA 3LONA 1NFWA 4IBLH 3L3TA 4MQAA 5LPFA 1S85A 3QGNB 4FU8A 1GG6C 5F8TA 2KAIA 3RXTA 3GDVA 2XWBI 3VB7A 1O36A 2ODQA 3B8JA 4IN1A 3SU2A 4NIWA 1YC0A 2FI5E 2ZGXH 1G3DA 4OGXA 2RDLA 3MH5A 1TX7A 2TRMA 4MPVA 2W5EA 3UUZA 1WSSH 2ZDMA 1GVKB 3H5CB 2FMJA 1Z6JH 2B5TB 1LPGB 1O2KA 1G37A 2GGVB 1CA0B 5DP5A 1QBOA 2BQ6B 1Y8TA 1CBWC 3E3TA 1ELAA 4WMDA 4KKDA 2FOGA 1E34B 1DWEH 7GCHG 1QBVH 1T8LA 1NESE 1K1JA 2VIQA 4X2YA 4D9RA 1HAIH 1SQTA 3LH3A 5DPAA 4Y10E 1HJAB 2SGPE 1KLTA 2EA3A 2QYIA 3SU3A 2F9VA 2AMPA 1O5CB 2A4RA 2XXLA 4RKOB 1GL0E 2EC9H 1EXFA 4RKJB 4BANB 1DITH 1V2OT 3R0FA 1TRYA 1GBEA 4GUXA 4K69A 4O9VA 5C2ZA 2PGBB 1UVTH 2F9BH 3FANA 1Y5UT 1ETTH 5E0HA 1PJPA 1GI7B 1TFXA 2FS9A 3OX7U 3T28A 1EQ9A 3ZVCA 1GL1A 5JB8S 3BTDE 1EP6A 2Z9GA 1H9LB 3EQ0H 3CS7A 3K2UA 1S81A 4MDSA 1NROH 1LHFH 2TIOA 2XNIA 3FP8E 1JOUB 2AS9A 1O3IA 3MI4A 2ULLA 3F9GA 2OCVB 2P16A 4ZHLU 1GHWH 1GDUA 1TA6A 1SMFE 3ZZBA 4B2AA 1O3AA 4KTCA 2J94A 2C8ZB 4ZMAH 1OWJA 3LU9B 4AFZA 1F5RA 3RXVA 4X8VH 5FPTA 1THRH 1PPHE 1PFXC 3SUEA 1NU9A 2AIPA 1C5TA 1FDPA 4ZKNU 2HPQH 2UUFB 6ESTA 1EAIA 4X2VA 5CMXH 2VGCC 1D3QB 1HNEE 1JIMA 1LCYA 1VR1H 1V2MT 1GHXH 1QNJA 1IHSH 4FVDA 3SGQE 4UONA 3FAOA 3VB5A 3NUMA 1ZJDA 3M35A 1RS0A 1DDJA 4XBCA 3PO1B 2LNCA 1IQHA 3MTYA 5GIBA 1CT4E 3S9AA 1GI2A 4WJG2 2C8XB 7ESTE 1K9OE 5EPYA 3ZV8A 3P17H 4INLA 4A6LA 4K8YA 2ZFRH 1NFYA 2RA0A 4CREA 2ZU3A 3BG8A 1O3BA 1A5HA 2O8TA 2ZO3H 2D26C 1NO9H 3MH4A 1L4DA 2K7XA 1MTUA 1JXPA 4UFGH 4I8JA 2CF8H 1GMDF 1VCQA 2H9HA 3ZVEA 3I78A 4GHTA 1O32A 1XUFA 3VGCB 3N7OA 2TPIZ 1RIWC 1G9IE 1AU8A 3SU4A 2GT7A 4B75A 1C5SA 1C2JA 4JMYA 4NFEA 4X1RU 4Q7XA 1P04A 3TJNA 1AKSB 4XFQA 1IQJA 4CBOA 1UTMA 5GCHG 1A4WH 3MU1A 2P8OB 4X2XA 1BTUA 1S6HA 1U6QA 3KN2A 1MKWH 4CRDA 1Z8JB 5L6NH 1C1OA 2ZWLH 2IPHA 1CT2E 4AGKA 5A0AE 5F6MA 2F83A 1ARCA 1CHOG 5JPMH 1YCPH 3K6ZA 4TPIZ 1NY22 4NG9H 1YBWA 4AG1A 1H9HE 4HFPB 2PKSC 2G8TA 1BMAA 2FOAA 2Y7XA 3ZZ9A 2XBXA 1BOQA 3ZVFA 2AGEX 4D76A 1HCGA 1KTSB 4Q80A 1GG6B 1Q3XA 1FAXA 5ESTE 1XKBC 2FI3E 3MH6A 1LVMA 1P2JA 3PLPA 5DP3A 1O2VA 2XBVA 4FXGH 2C90B 1F0UA 4WY3A 4NWKA 1L1GA 3RXRA 1XXFA 2JETC 2IJOB 1WUNH 2HGTH 3RXCA 1TQ0B 1EAXA 1QURH 2CHAC 1TNGA 1E36B 4UFEH 1BT7A 1CBWB 4XE4A 1BUIA 1SOZA 1AKSA 4M7GA 4I8LA 1O39A 1TX8A 5E0GA 5F8ZA 2PKAB 3MMGA 1DANH 4CRFA 1WQVH 1RTKA 2H2ZA 1KXEA 2G52A 2XC5A 1HPGA 2FOMB 1W8BH 1C9TA 4BAMB 2HNTC 2SGAA 5L2YH 2VU8E 1ZGVA 2PTCE 3RC4A 2AIQA 2EI7A 4ABFA 1Q31A 1SQOA 5EQQA 1PQ8A 2XW9A 1L1NA 1C2DA 5DJ7A 2WINI 1KXDA 4JYVH 3ZZ8A 1V2JT 5FX6A 4AFQA 1TBZH 1N6XA 2FZZA 1Y3WA 1O5EH 1T8NA 4UEHH 1ETSH 2SGEE 1S5SA 3LDXH 5A0BA 3VXFH 2HNTE 2ZC9H 4THNH 1O2OA 1V2TT 4AN7A 1O2TA 1NTPA 4K2YA 2ZHQH 5L30H 5EG4A 3BTGE 2FX6A 4YTAA 4NA7A 3ATLA 1Z1IA 3RMOH 3MH7A 3LKWA 4D7GA 1ELGA 3L33A 1BTWA 5C1XA 1YCPM 3K9XB 1CT0E 5C1UA 1VITH 1NC6A 2WYGA 5FAHA 4BAHB 3SNDA 2BZAA 1LHDH 2NU1E 2ZQ2A 2R0KA 3RDZA 1QB6A 1C1WH 1PQ7A 2PSYA 2VGCB 5C3NA 1D9IA 1K1LA 3A8AA 3D23A 1MBMA 1L0ZA 2VWOA 4AYYB 2ZDAH 1BHXF 3PLBA 3A84A 3GCNA 4X2WA 5CHAC 2WPMS 1ZMJA 3ZVGA 4AG2A 1BJVA 3U1JB 2XBYA 1TLDA 1UK2A 1W3CA 4XBBA 1DOJA 4H42U 2H9TH 2OBQA 1SHYA 1GBLA 3GY7A 1C5LH 1HJ8A 1C1RA 2ZZUH 4MTBA 1TQ7B 2VWLA 2SGFE 4FUJA 1EZXC 1C5OH 3E8LA 3GYLB 3K65B 1DWCH 2F9PA 2FTMA 2A7JA 4AZ2B 3O8CA 1AQ7A 6CHAC 4K3JA 1C5RA 4O03A 1O2XA 3LJOA 3O8BA 3UOPA 3ZZAA 1YM0A 1VGCC 4KTUA 3D65E 3NK8A 4Y0YE 2B8OH 1Y3UA 1EB2A 3TK9A 1BTHH 2P93A 2J4IA 4GLYA 1IQGA 1W2KH 1IQEA 4ABIA 1GI5A 1RIWB 2AFQB 1UTPA 2H9EH 4IC5A 1IQKA 4JZ1A 1AE5A 4ISHH 3AW1A 1XKAC 3MFJA 3A7WA 3FP7E 2BXTH 3SQEE 4XDEA 4GPGA 1OS8A 1LHCH 2EEKA 1GI3A 2ZF0H 3SO3A 4AORA 1ARBA 3NWUA 1GBFA 4WXIA 2ZP0H 3SUFA 3SHAH 1DWDH 3RMMH 5FHTA 1O3EA 1SQAA 5TJXA 2JH0D 2C8YB 1L2EA 2PKSB 1Z8IB 1GBMA 1JIRA 4CH2B 4DIHH 2D8WA 3QX5H 5FPSA 4ZUHA 2Q6DA 1ZSJA 3F9FA 2J38A 1SGEE 1V2KT 1C2GA 2ZGBH 2QC2A 3BTQE 1SSXA 1C1QA 1XXDA 2FEQH 4B74A 1FIWA 1RTFB 2ZDLA 2ASUB 1H9IE 2ZG0H 2ZEBA 3D62A 1DVAH 1F5LA 2WPIS 2CV3A 1K1MA 2BX3A 1E35B 4AYVB 1W7GH 2JETB 3IG6B 3IWMA 4H6TA 1OYQA 1AVGH 5PTPA 1OWKA 4GAWA 1NRNH 2ZDKA 1VJAU 3ESTA 2CHAB 3VB6A 3GY3A 3B9FH 4Y8YA 3F68H 2ANWA 1TPOA 1A61H 1TNJA 2CN0H 5HM9A 1WCZA 1TABE 2Z9LA 2A5IA 1TGBA 2OC7A 1O38A 1OSSA 1C5WB 1HFDA 2STBE 3SN8A 1IHTH 2CMYA 2ZFTA 3BSQA 1YLDA 3LGTA 1O30A 2A7HA 4Z0KA 5K7RA 3JZ1B 2BVRH 1DXWA 1NFUA 3TGIE 2A45B 1AN1E 3M36A 5EW2H 2OTVA 1GBAA 1WTHD 3ODFA 2PR3A 2UWOA 2NU3E 1GBKA 1DUEA 4O97A 1TPAE 3UR6A 1C9PA 1HBTH 1HAHH 1GHBG 1JRSA 4ZHMU 2BOKA 3DFLA 2V35A 1O3KA 1BTPA 2LPRA 2I6QA 4I8GA 1PPGE 1ZRBA 1OOKB 2ZFPH 1KLJH 1C2KA 1K1IA 2CF9H 1KDQB 5LGOA 3PWBA 3E0NB 1ZTLA 1JMOH 3UPEA 5GJ4B 1V2RT 3VGCC 1O3FA 1SGTA 1TE0A 1FNIA 3BEFB 1MAYA 3A87A 3A81A 5T3HA 3MU5A 1EX3A 3P8GA 1TPSA 2XC4A 1SGQE 2V0BA 4U2WA 2ZPQA 4UD9H 3NCLA 4OS2A 1K1PA 1KXBA 4ABJA 4YLQH 3O8DA 2VIDA 1AD8H 1TBRH 1NN6A 3O8RA 1UO6A 2STAE 1C2MA 1DLKB 5A8YA 1HGTH 3MNSA 3VPKA 1C5YB 2Y5HA 3I77A 2ZFQH 3BG4B 1MKXK 4R0IA 2BD9A 4WXVA 5CHAB 4H6SB 3BF6H 3QTOH 1L1JA 2C4FH 4O3UA 1TRMA 3GDUA 3FZDA 2GZ8A 1C5XB 3PYHA 3TNTA 2BD4A 4BOHA 3ATWA 1W0ZU 2P94A 3TH2H 1HAYB 1P2MA 1FLEE 1QJ1B 2OXSA 1F2SE 2BLVA 4IGDA 2BLWA 4MNYA 2F91A 4Y71A 4AFUA 2GVFA 1TX6A 1TNHA 5K0HA 3RXQA 5J4SA 1P2KA 3CS0A 3STJA 3URCA 6CHAB 3RXKA 1XM1A 3BTME 1LQDB 3SI4H 1KDQA 4BTUB 1K28D 4JYTA 3U1IB 1VGCB 1TPPA 2BX4A 2G81E 2GV7A 1LVYA 1S83A 1TNLA 1UHBB 1EPTA 2XRCA 2Z6BD 3TJVA 1CVWH 1MMJN 2F9OA 2A4GA 1KYNA 3AAUA 4NA9H 1ZR0A 2R2WU 3KCGH 1C1SA 3A88A 1O5BB 5EXMA 1P0SH 3W94A 4B1TA 1QL9A 1YPGH 1UK4A 2ZHFH 1YPKH 2PUQH 2P95A 1O2MA 1GJ5H 1XUGA 3PLKA 1MU6B 4WMFA 3MU8A 3A8DA 1YPLH 1BIOA 1LPZB 1SGFA 1UMAH 6LPRA 1G2LA 5A0CA 3SNCA 1ELTA 2YNAA 1BTXA 1XMNB 1DWBH 1GBCA 2G4TA 3LT3A 1B0FA 3OYPA 3HKIB 3S69A 5C5NA 3U8RH 2SFAA 1D3PB 3F9EA 3A7TA 4ABDA 1V2QT 2FOBA 2O9QA 1AWHB 1A3EH 1P2QA 2FM2A 1AVWA 3U8TH 1GMDG 1O3LA 1W10U 3HGPA 2ZNKH 1PPCE 1BRBE 1O5AB 1HRTH 4YESB 1YGCH 1OKXA 4MPUA 2W3IA 1F0TA 2ZHDA 1BITA 3D49H 2Q6FA 1LHGH 2BDCA 1ANBA 3E16B 1UHBA 1QRZA 1O2WA 3A7YA 1ANEA 1GHAG 1MZAA 2ESTE 3HGNA 1PPEE 3SI3H 4ABBA 3NPSA 1QGFA 3RXSA 2VIVA 4Y0ZE 2VINA 1WU1A 5FCRA 2ZTZA 1O2HA 3A8CA 3DA9B 1DSTA 3RXUA 5DP9A 5JB9S 4ISOA 3SQHE 2BQ7B 1YP9A 1C5MD 8LPRA 3S9CA 3K6YA 1XVMA 1GPZA 4FU9A 2FESH 3S7KB 3ZV9A 3ODDA 5EW1H 2BDGA 5AF9H 4E7RG 1GHZA 3MU0A 1NU7B 3M7QA 1V2NT 2QF0A 1HLTH 4Y79A 2VWMA 1BRAA 2QCYA 1PQ5A 2R3UA 2THFB 1HAPH 1SFQB 1O37A 4FUBA 1Y3XA 5A2MH 1TNKA 1RGQA 1T8OA 2VIPA 1FAKH 1YPMH 3QDZB 5T6DA 3EA9A 2BD2A 2F9NA 7GCHF 7KMEH 5HM2A 4OS7A 3S9BA 1GMCG 1BJUA 2A0QB 1O3MA 1NPMA 3Q3XA 4NFFA 1MD8A 2ZDNA 2WV4A 3GY4A 3MO3A 1AMHA 1FIZA 1PPZA 1SC8U 4AB8A 2OC8A 4LZ1H 1AWFH 1C5QA 2ZPSA 1ESTA 3A8BA 1GMHF 1GJAB 1ANDA 2ZGHA 3GY2A 1QB1A 4ZAEA 3A83A 8GCHF 2M5TA 4DY7B 1UK3A 3M3SA 3RU4E 5EXLA 1ZPCA 1S0QA 4A1VA 4X1PU 2QXGA 3RXHA 4FUCA 1N1LA 3RC5A 2O8WA 2ZGJA 1SLXB 5C5OA 4NA8A 1TMUH 1EOJA 4NIXA 1GBIA 5LPRA 3BTKE 1SGPE 1Z7KA 3LGWA 1QFKH 1EJMA 1AHTH 3EGKH 1JBUH 1FY5A 1V2UT 4HTCH 3T26A 2VVCA 1YKTA 4KTSA 1AFEH 2B0FA 2BD5A 3U69H 4JK5A 4XSKU 5CE1A 1DXPA 2ANMH 1GHVH 1WYKA 2XYAA 1SGYE 1TB6H 2BLQA 3SZNA 4I31A 4BAQB 2ZGCA 3KQCA 1WOFA 2QGRA 1H8DH 1TBQH 2YOLA 4IMQA 3T27A 4YOIA 4NGAH 1GVLA 9ESTA 4YZUA 3VB4A 1ZTJA 2Z3DA 1B0EA 3NZIA 4NZLA 1O3CA 3T25A 2GV6A 1BRUP 1NRPH 1DFPA 1D6RA 2AH4X 1UVUH 3M5OA 1MCTA 4WH8A 3ZVDA 3ZZ3A 1EUFA 2P3UB 3U8OH 2BY9X 1A1RA 1A7SA 1C4Y2 1UTKA 4I8KA 1Z71A 2PSXA 1A5GH 2BMGB 4IMZA 4X6OA 3EAJA 1W0YH 1OWEA 3TLOA 3DFJA 1OWIA 1O5DH 4ZKRU 3URDA 2FXRA 2BD8A 2AEIH 3TK5A 3ZZDA 5J4QA 5JBCS 5L2ZH 1PPBH 2BXUH 2HLCA 5FX5A 1LVBA 5HXFA 1ELEE 3DD2H 1AFQC 1DX5M 1OX1A 1GVZA 2P3FH 3SNEA 2R2MB 1AUTC 2BM2A 1FPCH 1NRSH 1W11U 3SNAA 5ETXA 1FPHH 1O35A 1Z8RA 4MG3A 1KY9A 3A89A 1O2UA 5JBBS 2FOHA 2Y6TA 3BEUA 3QZRA 1C5UA 3GISB 5EODA 1E37B 2QY0B 2GX4A 1K2I1 1BTYA 1P03A 1OWDA 4JK6A 1A5IA 1N6YA 1AZZA 1UCYE 3F1SB 1V6DA 2ZU1A 5GPIB 2G5VA 3SV7A 4UFDH 3RXDA 2ZCHP 1SI5H 1CE5A 2ZQ1A 1EZUC 3P6ZB 1CGJE 5GCHF 4X6NA 5EOKA 1VJ9U 1O2QA 2OQUA 1DM4B 2XWAA 1CO7E 4CRGA 4YO9A 2HOBA 1O3OA 1SL3A 3S0NA 1UTNA 2A2QH 1HV7A 3AAVA 1TA2A 4FVBA 3U98H 2BHGA 5I25A 1GI9B 1FY3A 4XBDA 1CGHA 1T31A 1MD7A 3V7TA 3KF2A 5IYTA 2WUBA 1C1PA
chains in the Genus database with same CATH superfamily
1GWAA 3OY6U 4YOGA 4X1NU 2RA3A 3A7XA 4Q4LA 2PKAA 5ABWA 1TWXB 3STIA 1ZSKA 1PQAA 5E0JA 4TT3D 1MH0A 4SGBE 5DN6D 2K1QA 1INCA 1E0FD 1HUTH 3MOCA 4KELA 4F4OC 1S84A 3KEEA 1QRWA 3AASA 4JZIA 1DY8A 3TPIZ 3BG4C 4NIVA 1SLVB 3RLWH 4X8SH 3UB0A 1C5ZB 3SU5A 1O3GA 1QL8A 2UWPA 4A92A 1C5NH 2Z3CA 3KIDU 2VWNA 5F03A 2AMDA 1V2ST 2J95A 1TNIA 1K0HA 3OTJE 1WV7H 1AVXA 5LH8A 5TCCA 1F92A 1TGSZ 5H4IB 1S82A 1EJNA 1XX9A 1LQEA 4OGYA 1LMWB 2BYAX 1P06A 1SGIB 4YT7H 2ZU5A 3RXIA 1DT2A 4B2BA 1W14U 1O2LA 4Y6DA 4UDWH 2YMSD 1YLNA 1BRCE 2HVXA 4OS5A 3UY9A 1E38B 1KXFA 1O2PA 4XOJA 1A3BH 1QA0A 2FX4A 2O8UA 4A1TA 4LK4A 4FUGA 5A09A 3BIUH 1ZYOA 4P00A 2FI4E 3LC3A 1UCYK 1V3XA 1N8OC 4D8NA 2QE7D 3PV2A 5F53A 5GXPA 2UUJB 4MNWA 3U9AH 4BXSA 4VGCC 2EI6A 1E1QD 1QTFA 1SKYE 3P8NA 3Q3YA 3QK1A 3GCOA 3E1XB 1NS3A 1CA8B 3F9HA 1AUJA 1MZDA 2BY7X 4FETA 3A86A 5DP4A 1ZHPA 1GJ8B 1RXPA 4TWYA 4WF8A 1SGRE 1AI8H 4NCYA 1NZQH 1COWD 1ZRKA 3F6UH 1UTJA 4ESTE 1NT1A 2GZ9A 4IC6A 2ALPA 2VJ1A 4WMEA 1IQNA 1UJ1A 4NWLA 2ZDVH 1TGNA 3LC5A 4F49A 1CQQA 1ANCA 1TALA 3F0OA 1YPHC 2Z9JA 3RXEA 2FTLE 2J9NA 3A82A 5C67A 1NRRH 2LIZA 4ZROA 3TIUA 2BY6X 3RXBA 5G4BA 2ZHWH 5AFZH 5B6LA 3HK3B 1C1VH 4K1EA 1GBBA 3BTWE 1THPB 1O34A 3SUGA 1UCYH 1J15A 1EJAA 3UIRA 1K21H 1TRNA 6GCHF 4BAOB 1P2IA 2BOHB 3M5NA 1TYNA 1TMTH 2ZFSA 3RP2A 3UOUA 1YPHE 4J2YB 1OWHA 1MQ6A 2V3MA 2VBCA 5A8ZA 3AW0A 1AB9C 1ELFA 4I33A 2HRVA 4Y76A 1GHYH 3ZZCA 4FUFA 1Y5AT 3Q3KA 3PRBA 2A4QA 2GCTC 2BD7A 1P12E 4SGAE 1AFQB 3BV9B 1SG8B 1GJ4H 5LPEA 4YXWD 4F55A 2NWNA 1ORFA 1P10A 1A0JA 4INKA 1TONA 3RU4T 5GWZA 4OS4A 4I32A 1O3HA 3SBKA 2C8WB 1HAGE 4FUIA 5DK1A 3RXMA 2WYJA 2ZU2A 1E1RD 3ZYDA 2BVXH 2JIZD 4RSPA 3TVJB 2Y80A 3ZIAD 3BTHE 1NM6A 2V3HH 2AERH 3P70B 2XC0A 4BNRA 2TGAA 1SLUB 1IQIA 1K22H 4ISNA 1O5GH 1SGNE 1QR3E 3DSPA 1T32A 4B73A 1GCTC 1NBME 1P9SA 5E2OA 2WV9A 1AIXH 3EE0B 2SNWA 3ATIA 1KSNA 3M37A 3VB3A 1TGCA 2WZQA 1WAYB 4ISLA 1FN6A 3UFAA 1PPFE 1O2NA 1J16A 3UNQA 1V2LT 4U01A 5E2PA 2OBOA 1AGJA 4ACBA 4Q2KA 4TSFD 1FV9A 3RXOA 2HVYB 2R3YA 1O33A 1HXEH 4YLUA 1SHHB 1VITF 2R9PA 3DUXH 4E7NA 3RXPA 4KGAA 2VB0A 1H8IH 1HAVB 3SV6A 1DE7H 1WBGB 1MTSA 4Y11E 2O8MA 3LPRA 3GCTF 1QHRB 1O2SA 5HMAA 5JDUB 4RN6A 1GJCB 3SJ8A 2ZTYA 3DCLA 1YPJH 2EY4C 2Q1JA 1ACBE 2A2XH 2BDBA 2GCHF 2ZPRA 2D1JA 3G01A 4HGCA 1C1TA 4TWWA 3QO6A 1G30B 3HK6B 1BMNH 2ZTXA 1BTZA 4WWYA 4YT6H 2GDDA 2Y82A 1Y5BT 4ISIH 1LDTT 1WXRA 3TNSA 1CU1A 4GCHF 4MPXA 4DIIH 1C2LA 1D3TB 1O2RA 3M7UA 3M7TA 3VXEH 3OSYA 1P01A 1EASA 1P3EA 5C1YA 4CR5A 4X8TH 1XUKA 2BDAA 1GBDA 4ABGA 1QL7A 1TAWA 4D7FA 1EZSC 1BCUH 5T6FA 2FLBH 2QV1A 1G36A 1IAUA 3P8OA 3V0XA 3SOSA 3HATH 3SV8A 2QA9E 3E90B 5C0UA 1ELDE 7LPRA 2IOTA 3F2GA 3GCHC 1W13U 1N8OB 4CR9A 3TGKE 2XBWA 1MQ5A 2RG3A 1UVSH 2NU2E 2ALVA 3I29A 3RMNH 4BTIB 3UREA 4VGCB 3FP6E 4DCDA 4ABEA 1HAVA 2ZECA 2ZIQH 1GHBF 1BBRE 3QZQA 2FLRH 2HWLB 2BB4A 4Z6AH 5GNDA 1SOTA 3M5LA 1MKXH 1HJ9A 3SU6A 2GP9B 1BA8B 1T8MA 4AFSA 1IQFA 1K1NA 1Z6EA 3A85A 3CENA 3LGYA 3DSOA 4E06H 2YNBA 2PHBA 1FI8A 1J14A 1X7AC 1RTLA 4MLFB 3SUDA 4UE7H 4DT7B 2F4LA 4IW4E 3F2FA 1D3DB 1GMHG 2HPPH 1C1UH 3ATKA 3C1KA 1GI8B 1UTOA 2OD3B 2AGIX 1YF4A 3EYDA 3MO9A 8GCHG 1O3JA 3SGBE 3OU0A 1UTLM 2FWWA 2H5DA 1C2FA 3KQEA 4A7IB 1SGFG 2GTBA 1AZ8A 3TH3H 5DG6A 8KME2 2BQWB 3A7ZA 2IN2A 3BTFE 4I7YH 1TOCB 1QQ4A 4RI0A 1GJ6A 1HDTH 4Q7YA 2A4OA 4MNXA 5AVDA 1J9CH 4IS5A 3GY5A 3MNBA 2HNTF 1ZGIA 1NBMD 1O3PB 2J5UA 3FOAA 1GJBB 3R3GB 2OQ5A 1C5VA 4B6EA 2FYRA 1C1MA 1AB9B 2Y7ZA 3UWIA 3ELAH 3QN7A 2XCFA 5DGJA 3SW2B 4HG6A 2H5CA 4JZDH 1QY6A 4QT8C 4ZCNA 3PMHB 1H1BA 1VCWA 3UR9A 2R0LA 1GBTA 2GCTB 3PB1E 2QF4A 1EZQA 8ESTE 1O0DH 1ZHMA 4ZH8A 1KXAA 2ODYB 1QJ6B 2CGAA 3S7HB 1RRKA 3RMLH 2GJGA 4JCNA 4JYUH 5F8XA 3M61U 1NRQH 3A80A 3ENSB 2ZI2H 4GVUA 3RXJA 1SB1H 3KYFA 3GY6A 1GI4A 4CBNA 1BBRK 2Z9IA 3ITIA 1S6FA 2A7CA 1MKWK 5B6OA 2TGTA 1O5FH 5DKMA 2Y5GA 1Y59T 3P95A 4AC9A 3HKJB 2UWLA 4FUHA 4TY6A 1GCTB 2K8IA 3OY5U 2FPZA 1YCPK 2RCEA 3UQVA 5FCKA 1W7XH 1A2CH 3Q77A 1C2EA 1FXYA 2ZA5A 2J2UA 2VIWA 4A1XA 2OUAA 1F0SA 3KGPA 3EA8A 2W3KA 2QN5T 1P02A 1CGIE 1BHXB 1BMMH 1OPHB 4HZHA 3SORA 1EFRD 1G3CA 1SQRA 2UUKB 2GKVE 1GCDA 1LHEH 3SGAE 2BTCE 1ZLRA 3SJOA 4YOJA 4ZHAA 4X1QU 1HXFH 1UVOA 1OP2A 2A5AA 2B7DH 4X6MA 3LGVA 1Q2WA 5EGMA 2G5NA 3EDXB 2FP7B 4YM9A 5EQSA 1HAXB 1BZXE 2VIOA 1SGDE 2SGDE 4O3TA 2FO9A 1BBRH 1MTVA 4DVAU 1EAUA 5JYIA 3TGJE 1CSOE 1TOMH 3E0PB 1YYY1 3ZVBA 5CDFE 1GHAF 3H7OA 1BB0B 3GYMA 5EQRA 3H09A 1ESBA 5AHGH 1C1NA 5IDKA 1O2YA 2G00A 1SFIA 2Y5FA 1LVOA 1DY9A 2FYQA 2SGQE 1DSUA 1P9UA 4IN2A 3BTEE 2JH5D 2VH0A 2FODA 2Z7FE 1EATA 3UQOA 2ZHEH 1GBHA 5I46H 2Q6GA 3SZEA 3SJKA 1QQUA 1DS2E 2SNVA 5DP8A 1YWUA 3OEHD 1MAXA 2BDYA 3M5MA 1ZMLA 1F5KU 2J34A 4D9QA 1O31A 1A0HB 1A0LA 4B76A 3IITA 3PV4A 3GCHB 1OYTH 1TMBH 3PWCA 2F9UA 3C27B 3UWJH 5JBTA 2FDAA 5FBEA 2OC0A 2BZ6H 3P92A 3RXAA 3M3VA 4DGJA 2KCPA 1MBQA 3FZZA 2PUXB 3TJOA 3UAIC 5TCAA 1V2WT 4TPYA 1QCPA 3MNCA 3SV9A 3QUMP 1GMCF 2ZKSA 1XUIA 1MUEB 2Z9KA 1PYTC 1P09A 4FUDA 2KR7A 3RUOA 2W7SA 2QXIA 5BPEA 1C2IA 1G3EA 3PTNA 5DO4H 1P2NA 3PTBA 1QA7A 3RXLA 3ZYEA 5JBAS 1GJ9B 1IQLA 5DP7A 3UNRA 1JRTA 1DPOA 3KQDA 3E91A 2ODPA 1P05A 2WPDD 2NU0E 4Y7BA 4GSOA 1YLCA 3SYJA 3KL6A 1ABIH 3OEED 4NSVA 2I6SA 3BN9A 2QXJA 1LKAA 3PMAB 4X8UH 4ZKSU 1WTGH 4AOQA 2GD4B 2VVVA 2DE8A 2XOKD 1O2IA 3T29A 1V2VT 1ZJKA 3MNXA 2OP9A 2W26A 2ZFFH 1C5PA 1F0RA 3DT0H 2ZCLP 2OINA 1SVPA 3SU1A 2G4UA 1CHOF 2P3TB 3MYWA 1MTNC 3BTTE 2A1DB 3RC6A 3SHCH 1VCPA 1FZZA 5FL7D 1GDQA 1NFXA 2V3OH 1LO6A 3GOVB 2ZCKP 5C20A 4CHAC 1OP0A 1EKBB 1FUJA 4X6PA 1HAZB 1GI0A 4K60A 1Y3YA 1BMLA 1GBJA 1ABJH 1B7XB 1A46H 1Y3VA 1HB0B 3RU4D 2GMTC 1YY3A 1DLEA 5EU8A 4FU7A 3LOXA 3QWCH 2NU4E 1ESAA 4B71A 2VH6A 1EPTC 4K1SA 2G55A 5AFYH 1RD3B 2BDIA 4X1SU 1XVOA 4MPWA 3KNXA 1G2MA 3LIWA 2FS8A 2PWXA 1GGDC 3GDSA 1P11E 3LGIA 2AYWA 4OS1A 1JWTA 1UTQA 1ZTKA 4J1YA 2JJ1D 1ZZZA 3TJUA 1J8AA 4TYDA 1AE8H 1O2JA 1XUJA 2GZ7A 6GCHG 4FUEA 1KTTB 1QB9A 2FOFA 2PTNA 1EOLA 1FJSA 1GJ7B 1ZPBA 1GI1A 4ZXXH 3FO8D 1AY6H 1QIXB 2ANKH 2C93B 1W12U 1T4VH 4NZQA 2GDEH 5HGGA 1L4ZA 1BDAA 4ZXYH 3LGUA 2QAAA 3ATMA 3PM3A 1O2GH 1O2ZA 1Z1JA 2CJIA 3KYGA 3PMJA 4NSYA 2WPJS 3WW7A 2VVUA 3GICB 4U30A 3RLYH 1KXCA 2HLDD 2TGPZ 3PRDA 4DJZB 1HIAB 2DUCA 2TBSA 3QGJA 4LOYH 4JZEH 2WPKS 1CA0C 3MU4A 1TGTA 4Y8ZA 1K1OA 3P8FA 2QXHA 3RXGA 4X0WU 3VG8A 4LZ4B 4ABHA 3FN8A 4U32A 1M9UA 4GHQA 1SGCA 4CRBA 3EA7A 1FY4A 1SR5C 4Y8XA 1FY8E 1BQYA 3TITA 1HJAC 2PW8H 4WVPE 4MNVA 1VZQH 4AB9A 2TGDA 1MU8B 3LJJA 1B5GH 5FXLA 1FQ3A 1P8VC 5C0TA 2OLGA 1C4U2 2QF3A 4Q7ZA 1RFNA 1ID5H 3MHWU 4E05H 5BRRE 4DOQA 1MCVA 2WHXA 1QJ7B 2JKHA 2PLXA 4DG4A 1YPEH 4AGJA 4DW2U 2GT8A 2FOCA 5EJLA 1OP8A 1QBNA 5ESBA 1GI6A 1FN8A 3SNBA 1LPKB 2FIRH 5T6GA 2W7UA 1DUAA 3UTUH 2D2DA 4K1TA 1O3NA 4INHA 1J17T 1H4WA 4AX9H 5SGAE 2HALA 1VITG 1FMGA 2AGGX 1ELCA 1XUHA 2P59A 3FVFB 3AVZA 1PYTD 2QF5A 1D6WA 1LTOA 2QIQA 1CHGA 4BAKB 2WPLS 4B2CA 3MO6A 4BXWA 3GCTG 1W0KD 1UVPA 2BD3A 2Z3EA 1KLIH 2UUYA 1ELBA 1AO5A 1TIOA 3KQBA 1C4V2 2BY5X 3EBNA 2H1UA 4Q63A 3NKKA 9LPRA 1HIAA 3A7VA 1GDNA 2PGQB 3B23B 3CNRA 5EPNA 1HAOH 2ANYA 4BTTB 2A5KA 2GCHG 3TH4H 3WY8A 4M9FA 2G51A 3ZVAA 3DHKH 4PROA 3SJIA 1P3CA 1SPJA 1OXGA 1V2PT 2Y81A 4ASUD 2BY8X 1O3DA 2EI8A 2OC1A 1MTWA 4GCHG 1F7ZA 3CP7A 3SV2H 3H7TA 3PMBB 3VEQB 4KP0A 3JZ2B 5FPYA 4K8BA 1P2OA 2JH6D 3KHVA 2B9LA 1MABB 3RXFA 3HPTB 3T2NA 3ZZ4A 4H4FA 1EP5A 4LXBH 1RJXB 1T4UH 3VFEA 2V6NA 4A5TS 2AMQA 5EXNA 1FONA 1FY1A 2J92A 3TK6A 3Q76A 4OS6A 3PO1C 2J98B 4R8TB 4CRAA 4XD7D 3BIVH 4UFFH 2F3CE 5A8XA 1LKBA 5FBIA 3W95A 1SLWB 1ETRH 2A31A 4CH8B 4ZKOU 3QLPH 1QRXA 1S0RA 2DE9A 4WH6A 1G3BA 3RM0H 4HI3A 2XTTB 1MTNB 2CXVA 3QTVH 2BLOA 3RM2H 2KAIB 2H6MA 2PFEA 1DICA 1THSH 4CHAB 3FFGA 2BVSH 4RT1A 3E6PH 1ZOMA 3LH1A 1ZPZA 5GDSH 3V13A 2WPHS 1C2HA 1KIGH 3SU0A 3MWIU 4ASHA 3ZZ7A 1IOEA 5DP6A 4JZFH 4TY7A 3ZZ6A 4MVNA 5E8EH 3T62A 4I8HA 1GJDB 2BDHA 2GMTB 4Y7AA 1EB1H 1S6LA 1HYLA 1EPTB 3T5FH 4NIYA 2O8LA 3Q00A 1ZMNA 1G32B 3BEIB 3SJ9A 2FOEA 1WQSA 3ZZ5A 1GGDB 2C3SA 4CRCA 1SBWA 1ZSLA 2P8OC 2ILNA 2VNTA 1D4PB 2PV9B 3UNSA 4ABAA 3PROA 3GY8A 5HYOA 2ZU4A 1ZHRA 3L6PA 4DURA 1T7CA 3NXPA 3M3TA 1P57B 1IQMA 3V12A 2KX4A 3TU7H 2XCNA 2WV5A 1ELVA 3V3MA 2A32A 2J98A 4K5ZA 2Z94A 1Z8GA 1EAWA 2WUCA 2RFKC 3LONA 1NFWA 4IBLH 3L3TA 3GS9A 4MQAA 5LPFA 1S85A 3QGNB 4FU8A 1GG6C 5F8TA 3OE7D 2KAIA 3RXTA 4P02A 3GDVA 2XWBI 3VB7A 1O36A 2ODQA 3B8JA 4IN1A 3SU2A 4NIWA 1YC0A 2FI5E 2ZGXH 1G3DA 4OGXA 2RDLA 3MH5A 1TX7A 2TRMA 4MPVA 2PP6A 2W5EA 3UUZA 3F0PA 1WSSH 2ZDMA 1GVKB 3H5CB 2FMJA 1Z6JH 2B5TB 1LPGB 1O2KA 1G37A 2GGVB 1CA0B 5DP5A 1QBOA 2BQ6B 1Y8TA 1CBWC 3E3TA 1ELAA 4WMDA 4KKDA 2FOGA 1E34B 1DWEH 7GCHG 1QBVH 1T8LA 1NESE 1K1JA 2VIQA 4X2YA 4D9RA 5EJ1A 1HAIH 1SQTA 3LH3A 5DPAA 4Y10E 1HJAB 2SGPE 1KLTA 2EA3A 2QYIA 3SU3A 2F9VA 2AMPA 1O5CB 2A4RA 2XXLA 4RKOB 1GL0E 2EC9H 1EXFA 4RKJB 4BANB 1DITH 1V2OT 3R0FA 1TRYA 1GBEA 4GUXA 4K69A 4O9VA 5C2ZA 2PGBB 1W0JD 1UVTH 2F9BH 3FANA 1Y5UT 1ETTH 5E0HA 1PJPA 1GI7B 1TFXA 2FS9A 3OX7U 3T28A 1EQ9A 3ZVCA 1GL1A 5JB8S 2RDEA 3BTDE 1EP6A 2Z9GA 1H9LB 3EQ0H 3CS7A 3K2UA 1S81A 4MDSA 1NROH 1LHFH 1H8HD 2TIOA 2XNIA 3FP8E 1JOUB 2AS9A 1O3IA 3MI4A 2ULLA 3F9GA 2OCVB 2P16A 3AK5A 4ZHLU 3WWBA 1GHWH 1GDUA 1TA6A 1SMFE 3ZZBA 4B2AA 1O3AA 4KTCA 2J94A 2C8ZB 4ZMAH 1OWJA 3WWFA 3LU9B 4AFZA 1F5RA 1QZ8A 3RXVA 4X8VH 5FPTA 1THRH 1PPHE 1PFXC 3SUEA 1NU9A 2AIPA 1C5TA 1FDPA 4ZKNU 2HPQH 2UUFB 6ESTA 1EAIA 4X2VA 5CMXH 2VGCC 1D3QB 1HNEE 1JIMA 1LCYA 1VR1H 1V2MT 1GHXH 3OAAD 1QNJA 1IHSH 4FVDA 3SGQE 4UONA 3FAOA 3VB5A 3NUMA 1ZJDA 3M35A 1RS0A 1DDJA 4XBCA 3PO1B 2LNCA 1IQHA 2K0QA 3MTYA 5GIBA 1CT4E 3S9AA 1GI2A 4WJG2 2AHME 2C8XB 7ESTE 1K9OE 5EPYA 3ZV8A 3P17H 4INLA 4A6LA 4K8YA 2ZFRH 1NFYA 2RA0A 4CREA 2ZU3A 3BG8A 1O3BA 1A5HA 2KCAA 2O8TA 2ZO3H 2D26C 1NO9H 3MH4A 1L4DA 2K7XA 1UW7A 1MTUA 1JXPA 4UFGH 4I8JA 2IJD1 2CF8H 1GMDF 1VKYA 1VCQA 2H9HA 5DSFA 3ZVEA 3I78A 4GHTA 1O32A 1XUFA 3VGCB 3N7OA 2TPIZ 1RIWC 1G9IE 1AU8A 3SU4A 2GT7A 4B75A 1C5SA 1C2JA 4JMYA 4NFEA 4X1RU 4Q7XA 1P04A 3TJNA 1AKSB 4XFQA 1IQJA 2YMSC 4CBOA 1UTMA 5GCHG 1A4WH 3MU1A 2P8OB 4X2XA 1BTUA 1S6HA 1U6QA 3KN2A 1MKWH 4CRDA 1Z8JB 5L6NH 1C1OA 2ZWLH 2IPHA 1CT2E 4AGKA 5A0AE 5F6MA 2L6OA 2F83A 1ARCA 1CHOG 5JPMH 1YCPH 3K6ZA 4TPIZ 1NY22 4NG9H 1YBWA 1KMHB 4AG1A 1H9HE 4HFPB 2PKSC 2G8TA 1BMAA 2FOAA 2Y7XA 2V7QD 3ZZ9A 2XBXA 1BOQA 3ZVFA 2AGEX 4D76A 1HCGA 1KTSB 4Q80A 1GG6B 1Q3XA 1FAXA 2XNDD 1XKBC 5ESTE 2FI3E 3MH6A 1LVMA 1P2JA 3PLPA 5DP3A 1O2VA 2XBVA 4FXGH 2C90B 1F0UA 4WY3A 4NWKA 1L1GA 3RXRA 1XXFA 2JETC 2IJOB 1WUNH 2HGTH 3RXCA 1TQ0B 5HIZA 1EAXA 2L74A 2KCYA 1QURH 2CHAC 1TNGA 1E36B 4UFEH 1BT7A 1CBWB 4XE4A 1BUIA 1SOZA 1AKSA 4M7GA 4I8LA 1O39A 1TX8A 5E0GA 5F8ZA 2PKAB 3MMGA 1DANH 4CRFA 1WQVH 1RTKA 2H2ZA 1KXEA 3EE7A 2G52A 4FOUC 2XC5A 1HPGA 2FOMB 1W8BH 1C9TA 4BAMB 2F43B 2HNTC 2SGAA 3U28C 2VU8E 5L2YH 1ZGVA 2PTCE 3RC4A 2AIQA 2EI7A 4ABFA 1Q31A 1SQOA 5EQQA 1PQ8A 2XW9A 1L1NA 1C2DA 5DJ7A 2WINI 1KXDA 4JYVH 3ZZ8A 1V2JT 5FX6A 4AFQA 1TBZH 1N6XA 2FZZA 1Y3WA 5KEDA 1O5EH 1T8NA 4UEHH 1ETSH 2SGEE 1S5SA 3LDXH 5A0BA 3VXFH 2HNTE 2ZC9H 4THNH 1O2OA 1V2TT 4AN7A 1O2TA 1NTPA 4K2YA 2ZHQH 5L30H 5EG4A 3BTGE 2FX6A 4YTAA 4DT4A 4NA7A 3ATLA 1Z1IA 3RMOH 3MH7A 3LKWA 4D7GA 1ELGA 3L33A 1BTWA 5C1XA 1YCPM 3K9XB 1CT0E 5C1UA 1VITH 1NC6A 2WYGA 5FAHA 4BAHB 3SNDA 2BZAA 1LHDH 2NU1E 2ZQ2A 2R0KA 3RDZA 1QB6A 1C1WH 1PQ7A 2PSYA 2VGCB 5C3NA 1D9IA 1K1LA 3A8AA 3D23A 1MBMA 1L0ZA 2VWOA 4AYYB 2ZDAH 1BHXF 5HKKD 3PLBA 3A84A 3GCNA 4X2WA 5CHAC 2WPMS 1ZMJA 3ZVGA 4AG2A 1BJVA 3U1JB 2XBYA 1TLDA 1UK2A 1W3CA 4XBBA 1DOJA 4H42U 2H9TH 2OBQA 3F2HA 1SHYA 1GBLA 3GY7A 1C5LH 1HJ8A 1C1RA 2ZZUH 4MTBA 1TQ7B 2VWLA 3N7DA 2SGFE 4FUJA 1EZXC 1C5OH 3E8LA 3GYLB 3K65B 1DWCH 2F9PA 2FTMA 2A7JA 4AZ2B 3O8CA 1AQ7A 6CHAC 2LELA 4K3JA 1C5RA 4O03A 1O2XA 3LJOA 3O8BA 3UOPA 3ZZAA 1YM0A 1VGCC 4KTUA 3D65E 3NK8A 4Y0YE 2B8OH 1Y3UA 3W1EA 1EB2A 3TK9A 1BTHH 2P93A 2J4IA 4GLYA 1IQGA 1W2KH 1IQEA 2CK3D 4ABIA 1GI5A 1RIWB 2AFQB 1UTPA 2KFWA 2H9EH 4IC5A 1IQKA 4JZ1A 4XRNA 1AE5A 2YMSB 4ISHH 3AW1A 1XKAC 3MFJA 3A7WA 3FP7E 2BXTH 3SQEE 4XDEA 5CHBA 4GPGA 1OS8A 1LHCH 2EEKA 1GI3A 5EJZA 2ZF0H 3SO3A 4AORA 5C94A 1ARBA 3NWUA 1GBFA 4WXIA 2ZP0H 3SUFA 3SHAH 1DWDH 3OFND 3RMMH 5FHTA 1O3EA 1SQAA 5TJXA 2JH0D 2C8YB 1L2EA 2PKSB 1Z8IB 1GBMA 1JIRA 4CH2B 4DIHH 2D8WA 3QX5H 5FPSA 4ZUHA 2Q6DA 1ZSJA 3F9FA 2J38A 1SGEE 1V2KT 1C2GA 2ZGBH 2QC2A 3BTQE 1SSXA 1C1QA 1XXDA 2FEQH 4B74A 1FIWA 1RTFB 2ZDLA 2ASUB 1H9IE 2ZG0H 2ZEBA 3D62A 1DVAH 1F5LA 2WPIS 2CV3A 1K1MA 2BX3A 1E35B 4AYVB 1W7GH 2JETB 3IG6B 3IWMA 4H6TA 1OYQA 1AVGH 5IK2D 5PTPA 1WDIA 1OWKA 4GAWA 1NRNH 2ZDKA 1VJAU 3ESTA 2CHAB 3VB6A 3GY3A 3B9FH 4Y8YA 3F68H 2ANWA 1TPOA 1A61H 1TNJA 2CN0H 5HM9A 1WCZA 1TABE 2Z9LA 2A5IA 1TGBA 2OC7A 1O38A 1OSSA 1C5WB 1HFDA 2STBE 3SN8A 1IHTH 2CMYA 2ZFTA 3BSQA 1YLDA 3LGTA 1O30A 2A7HA 4Z0KA 5K7RA 3JZ1B 2BVRH 1DXWA 1NFUA 3TGIE 2A45B 1AN1E 3M36A 5EW2H 2OTVA 1GBAA 3F3BA 1WTHD 3ODFA 2PR3A 2UWOA 2NU3E 1GBKA 1DUEA 2LP6A 4O97A 1TPAE 3UR6A 1C9PA 1HBTH 1HAHH 1GHBG 1JRSA 1FX0B 4ZHMU 2BOKA 3DFLA 2V35A 1O3KA 1BTPA 2LPRA 4ACAA 2I6QA 4I8GA 1PPGE 1ZRBA 1OOKB 2ZFPH 1KLJH 1C2KA 1K1IA 2CF9H 1KDQB 5LGOA 3PWBA 3E0NB 1ZTLA 1JMOH 3NRLA 5GJ4B 3UPEA 1V2RT 3VGCC 1O3FA 1SGTA 1TE0A 1FNIA 3BEFB 1MAYA 3A87A 3A81A 5T3HA 3MU5A 1EX3A 3OTPA 3P8GA 1TPSA 2XC4A 1SGQE 2V0BA 4U2WA 2ZPQA 4UD9H 3NCLA 4OS2A 1K1PA 1KXBA 4ABJA 4YLQH 3O8DA 2VIDA 1AD8H 1TBRH 1NN6A 3O8RA 1UO6A 2STAE 1C2MA 1DLKB 5A8YA 1HGTH 3MNSA 3VPKA 1C5YB 2Y5HA 3I77A 4OM9A 2ZFQH 3BG4B 1MKXK 4R0IA 2BD9A 4WXVA 5CHAB 4H6SB 3BF6H 3QTOH 1L1JA 2C4FH 4O3UA 5C17A 1TRMA 3GDUA 3FZDA 2GZ8A 1C5XB 3PYHA 3TNTA 2BD4A 4BOHA 3ATWA 1W0ZU 2P94A 3TH2H 1HAYB 1P2MA 1FLEE 1QJ1B 2KM0A 1F2SE 2BLVA 2OXSA 2BLWA 4IGDA 4MNYA 2F91A 4Y71A 4AFUA 2GVFA 1TX6A 1TNHA 5K0HA 3RXQA 5J4SA 1P2KA 3CS0A 3STJA 3URCA 6CHAB 3RXKA 1XM1A 3BTME 1LQDB 3SI4H 1KDQA 4BTUB 1K28D 4JYTA 3U1IB 1VGCB 1TPPA 2BX4A 2G81E 2GV7A 1LVYA 1S83A 1TNLA 1UHBB 1EPTA 2XRCA 2Z6BD 3TJVA 1CVWH 1MMJN 2F9OA 2A4GA 1KYNA 2JDID 3AAUA 4NA9H 1ZR0A 2R2WU 3KCGH 1C1SA 3A88A 1O5BB 5EXMA 1P0SH 3W94A 4B1TA 1QL9A 1YPGH 1UK4A 2ZHFH 1YPKH 2PUQH 2P95A 1O2MA 1GJ5H 1XUGA 3PLKA 1MU6B 4WMFA 3MU8A 3A8DA 1YPLH 1BIOA 1LPZB 1SGFA 2IPQX 2JJ2D 1UMAH 6LPRA 1G2LA 5A0CA 3SNCA 1ELTA 2YNAA 1BTXA 1XMNB 1DWBH 1GBCA 2G4TA 3LT3A 1B0FA 1BMFD 3OYPA 3HKIB 3S69A 5C5NA 3U8RH 2SFAA 1D3PB 3F9EA 3A7TA 4ABDA 1V2QT 2FOBA 2O9QA 1AWHB 1A3EH 1P2QA 2FM2A 1AVWA 3U8TH 1GMDG 1O3LA 1W10U 3HGPA 3FKSD 2ZNKH 1PPCE 1BRBE 1O5AB 1HRTH 4YESB 1YGCH 1OKXA 4MPUA 2W3IA 1F0TA 3DSGA 2ZHDA 1BITA 3D49H 2Q6FA 1LHGH 2BDCA 1ANBA 3E16B 1UHBA 1QRZA 1O2WA 3A7YA 1ANEA 1GHAG 1MZAA 2ESTE 3HGNA 1PPEE 3SI3H 4ABBA 3NPSA 1QGFA 3RXSA 2VIVA 4Y0ZE 2VINA 4B6FA 1WU1A 5FCRA 2ZTZA 1O2HA 3A8CA 3DA9B 1DSTA 2EQNA 3RXUA 5DP9A 5JB9S 4ISOA 3SQHE 2BQ7B 1YP9A 1C5MD 8LPRA 3S9CA 3K6YA 1XVMA 1GPZA 4FU9A 2FESH 3S7KB 3ZV9A 3ODDA 5EW1H 2BDGA 5AF9H 4E7RG 1GHZA 3MU0A 1NU7B 3M7QA 1V2NT 2QF0A 1HLTH 4Y79A 2VWMA 1BRAA 2QCYA 1PQ5A 2R3UA 2THFB 1HAPH 1SFQB 1O37A 4FUBA 1Y3XA 5A2MH 1TNKA 1RGQA 1T8OA 2VIPA 1FAKH 1YPMH 3QDZB 5T6DA 3EA9A 2BD2A 2F9NA 7GCHF 7KMEH 5HM2A 4OS7A 1E79D 3S9BA 1GMCG 1BJUA 2A0QB 1O3MA 1NPMA 3Q3XA 4NFFA 1MD8A 2ZDNA 2WV4A 3GY4A 3MO3A 1AMHA 1FIZA 1PPZA 1SC8U 4AB8A 2OC8A 4LZ1H 1AWFH 1C5QA 2ZPSA 3N7EA 1ESTA 3A8BA 1GMHF 1GJAB 5EIYA 1ANDA 2ZGHA 3GY2A 1QB1A 4ZAEA 3A83A 8GCHF 2M5TA 4DY7B 1UK3A 3M3SA 3RU4E 5EXLA 1ZPCA 1S0QA 4A1VA 4X1PU 2QXGA 3RXHA 4FUCA 1N1LA 3RC5A 2O8WA 2ZGJA 1SLXB 5C5OA 4NA8A 1TMUH 1EOJA 4NIXA 1GBIA 5LPRA 3BTKE 1SGPE 1Z7KA 3LGWA 1QFKH 2OK5A 1EJMA 1AHTH 3EGKH 1JBUH 1FY5A 1V2UT 4HTCH 3T26A 2VVCA 3PV5A 1YKTA 4KTSA 1AFEH 2B0FA 3MQKC 2BD5A 3U69H 4JK5A 4XSKU 5CE1A 1DXPA 5HIYA 2ANMH 1GHVH 1WYKA 2KZ4A 2XYAA 1SGYE 1TB6H 2BLQA 3SZNA 4I31A 4BAQB 2ZGCA 3KQCA 1WOFA 2KCOA 2QGRA 1H8DH 1TBQH 2YOLA 4IMQA 3T27A 4YOIA 4NGAH 1GVLA 9ESTA 4YZUA 3VB4A 1ZTJA 2Z3DA 1B0EA 3NZIA 4NZLA 1O3CA 3T25A 2GV6A 1BRUP 1NRPH 1DFPA 1D6RA 2AH4X 1UVUH 3N99A 3M5OA 1MCTA 5KECA 4WH8A 3ZVDA 3ZZ3A 1EUFA 2P3UB 2W6ID 3U8OH 2BY9X 1A1RA 1A7SA 1C4Y2 1UTKA 2M2AA 4I8KA 1Z71A 2PSXA 1A5GH 2BMGB 4IMZA 4X6OA 3EAJA 1W0YH 1OWEA 3TLOA 3DFJA 1OWIA 1O5DH 4ZKRU 3URDA 2FXRA 2BD8A 2AEIH 3TK5A 3ZZDA 5J4QA 1OHHD 5KGOA 5JBCS 5L2ZH 1PPBH 2BXUH 2HLCA 5FX5A 1LVBA 5HXFA 1ELEE 3DD2H 1AFQC 1DX5M 1OX1A 1GVZA 2J97A 2P3FH 2WSSD 3SNEA 4RT0A 2R2MB 1AUTC 2BM2A 1FPCH 1NRSH 1W11U 5T1VA 3SNAA 5ETXA 1FPHH 1O35A 1Z8RA 4MG3A 1KY9A 3A89A 1O2UA 5JBBS 2FOHA 2Y6TA 3BEUA 3QZRA 1C5UA 3GISB 5EODA 1E37B 2QY0B 2GX4A 1K2I1 1BTYA 1P03A 1OWDA 4JK6A 1H8ED 1A5IA 1N6YA 1AZZA 1UCYE 3F1SB 1V6DA 2ZU1A 5GPIB 2G5VA 3KQ5A 4UFDH 3RXDA 3SV7A 4F48B 2ZCHP 1SI5H 1CE5A 2ZQ1A 1EZUC 3P6ZB 1CGJE 5GCHF 4X6NA 5EOKA 1VJ9U 2W6JD 1O2QA 2OQUA 1DM4B 2XWAA 1CO7E 4CRGA 4YO9A 2HOBA 1O3OA 1SL3A 3S0NA 1UTNA 2A2QH 1HV7A 3AAVA 1TA2A 4FVBA 3U98H 2BHGA 5I25A 1GI9B 1FY3A 4XBDA 4Z1MD 1CGHA 1T31A 1MD7A 3V7TA 3KF2A 5IYTA 2WUBA 1C1PA 4I86A
chains in the Genus database with same CATH topology
1GWAA 3OY6U 4YOGA 4X1NU 2RA3A 3A7XA 2PKAA 5ABWA 1TWXB 3STIA 1ZSKA 1PQAA 5E0JA 1MH0A 4SGBE 2K1QA 1INCA 1E0FD 1HUTH 3MOCA 4KELA 4F4OC 1S84A 3KEEA 1QRWA 3AASA 4JZIA 1DY8A 3TPIZ 3BG4C 4NIVA 1SLVB 3RLWH 4X8SH 1C5ZB 3SU5A 1O3GA 1QL8A 2UWPA 4A92A 1C5NH 2Z3CA 3KIDU 2VWNA 5F03A 2AMDA 1V2ST 2J95A 1TNIA 3OTJE 1WV7H 1AVXA 5LH8A 5TCCA 1F92A 1TGSZ 5H4IB 1S82A 1EJNA 1XX9A 1LQEA 4OGYA 1LMWB 2BYAX 1P06A 1SGIB 4YT7H 2ZU5A 3RXIA 1DT2A 4B2BA 1W14U 1O2LA 4Y6DA 4UDWH 1BRCE 2HVXA 4OS5A 3UY9A 1E38B 1KXFA 1O2PA 4XOJA 1A3BH 1QA0A 2FX4A 2O8UA 4A1TA 4LK4A 4FUGA 5A09A 3BIUH 1ZYOA 2FI4E 3LC3A 1UCYK 1V3XA 1N8OC 4D8NA 5GXPA 2UUJB 4MNWA 3U9AH 4BXSA 4VGCC 2EI6A 1QTFA 3P8NA 3Q3YA 3QK1A 3GCOA 3E1XB 1NS3A 1CA8B 3F9HA 1AUJA 1MZDA 2BY7X 3A86A 5DP4A 1ZHPA 1GJ8B 1RXPA 4TWYA 4WF8A 1SGRE 1AI8H 4NCYA 1NZQH 1ZRKA 3F6UH 1UTJA 4ESTE 1NT1A 2GZ9A 4IC6A 2ALPA 2VJ1A 4WMEA 1IQNA 1UJ1A 4NWLA 2ZDVH 1TGNA 3LC5A 4F49A 1CQQA 1ANCA 1TALA 1YPHC 2Z9JA 3RXEA 2FTLE 2J9NA 3A82A 5C67A 1NRRH 2LIZA 4ZROA 3TIUA 2BY6X 3RXBA 5G4BA 2ZHWH 5AFZH 3HK3B 1C1VH 4K1EA 1GBBA 3BTWE 1THPB 1O34A 3SUGA 1UCYH 1J15A 1EJAA 3UIRA 1K21H 1TRNA 6GCHF 4BAOB 1P2IA 2BOHB 3M5NA 1TYNA 1TMTH 2ZFSA 3RP2A 3UOUA 1YPHE 4J2YB 1OWHA 1MQ6A 5A8ZA 3AW0A 1AB9C 1ELFA 4I33A 2HRVA 4Y76A 1GHYH 3ZZCA 4FUFA 1Y5AT 3Q3KA 2A4QA 2GCTC 2BD7A 1P12E 4SGAE 1AFQB 3BV9B 1SG8B 1GJ4H 5LPEA 2NWNA 1ORFA 1P10A 1A0JA 4INKA 1TONA 3RU4T 5GWZA 4OS4A 4I32A 1O3HA 3SBKA 2C8WB 1HAGE 4FUIA 5DK1A 3RXMA 2WYJA 2ZU2A 3ZYDA 2BVXH 4RSPA 3TVJB 2Y80A 3BTHE 1NM6A 2V3HH 2AERH 3P70B 2XC0A 4BNRA 2TGAA 1SLUB 1IQIA 1K22H 4ISNA 1O5GH 1SGNE 1QR3E 1T32A 4B73A 1GCTC 1P9SA 5E2OA 1AIXH 3EE0B 2SNWA 3ATIA 1KSNA 3M37A 3VB3A 1TGCA 1WAYB 4ISLA 1FN6A 3UFAA 1PPFE 1O2NA 1J16A 3UNQA 1V2LT 4U01A 5E2PA 2OBOA 1AGJA 4Q2KA 1FV9A 3RXOA 2R3YA 1O33A 1HXEH 4YLUA 1SHHB 1VITF 2R9PA 3DUXH 4E7NA 3RXPA 4KGAA 2VB0A 1H8IH 1HAVB 3SV6A 1DE7H 1WBGB 1MTSA 4Y11E 2O8MA 3LPRA 3GCTF 1QHRB 1O2SA 5HMAA 5JDUB 4RN6A 1GJCB 3SJ8A 2ZTYA 1YPJH 2Q1JA 1ACBE 2A2XH 2BDBA 2GCHF 2ZPRA 2D1JA 3G01A 4HGCA 1C1TA 4TWWA 3QO6A 1G30B 3HK6B 1BMNH 2ZTXA 1BTZA 4WWYA 4YT6H 2GDDA 2Y82A 1Y5BT 4ISIH 1LDTT 3TNSA 1CU1A 4GCHF 4MPXA 4DIIH 1C2LA 1D3TB 1O2RA 3M7UA 3M7TA 3VXEH 3OSYA 1P01A 1EASA 1P3EA 5C1YA 4CR5A 4X8TH 1XUKA 2BDAA 1GBDA 4ABGA 1QL7A 1TAWA 4D7FA 1EZSC 1BCUH 5T6FA 2FLBH 2QV1A 1G36A 1IAUA 3P8OA 3V0XA 3SOSA 3HATH 3SV8A 2QA9E 3E90B 1ELDE 7LPRA 2IOTA 3GCHC 1W13U 1N8OB 4CR9A 3TGKE 2XBWA 1MQ5A 2RG3A 1UVSH 2NU2E 2ALVA 3I29A 3RMNH 4BTIB 3UREA 4VGCB 3FP6E 4DCDA 4ABEA 1HAVA 2ZECA 2ZIQH 1GHBF 1BBRE 3QZQA 2FLRH 2HWLB 2BB4A 4Z6AH 1SOTA 3M5LA 1MKXH 1HJ9A 3SU6A 2GP9B 1BA8B 1T8MA 4AFSA 1IQFA 1K1NA 1Z6EA 3A85A 3CENA 3LGYA 4E06H 2YNBA 2PHBA 1FI8A 1J14A 1X7AC 1RTLA 4MLFB 3SUDA 4UE7H 4DT7B 4IW4E 1D3DB 1GMHG 2HPPH 1C1UH 3ATKA 3C1KA 1GI8B 1UTOA 2OD3B 2AGIX 1YF4A 3EYDA 3MO9A 8GCHG 1O3JA 3SGBE 3OU0A 1UTLM 2FWWA 2H5DA 1C2FA 3KQEA 4A7IB 1SGFG 2GTBA 1AZ8A 3TH3H 5DG6A 8KME2 2BQWB 3A7ZA 2IN2A 3BTFE 4I7YH 1TOCB 1QQ4A 1GJ6A 1HDTH 4Q7YA 2A4OA 4MNXA 5AVDA 1J9CH 4IS5A 3GY5A 3MNBA 2HNTF 1ZGIA 1O3PB 1GJBB 3R3GB 2OQ5A 1C5VA 2FYRA 1C1MA 1AB9B 2Y7ZA 3UWIA 3ELAH 3QN7A 2XCFA 5DGJA 3SW2B 2H5CA 4JZDH 1QY6A 4QT8C 3PMHB 1H1BA 1VCWA 3UR9A 2R0LA 1GBTA 2GCTB 3PB1E 1EZQA 8ESTE 1O0DH 1ZHMA 4ZH8A 1KXAA 2ODYB 1QJ6B 2CGAA 3S7HB 1RRKA 3RMLH 4JCNA 4JYUH 5F8XA 3M61U 1NRQH 3A80A 3ENSB 2ZI2H 4GVUA 3RXJA 1SB1H 3GY6A 1GI4A 4CBNA 1BBRK 2Z9IA 3ITIA 1S6FA 2A7CA 1MKWK 5B6OA 2TGTA 1O5FH 5DKMA 2Y5GA 1Y59T 3P95A 3HKJB 2UWLA 4FUHA 4TY6A 1GCTB 3OY5U 2FPZA 1YCPK 2RCEA 3UQVA 5FCKA 1W7XH 1A2CH 3Q77A 1C2EA 1FXYA 2ZA5A 2J2UA 2VIWA 4A1XA 2OUAA 1F0SA 3KGPA 3EA8A 2W3KA 2QN5T 1P02A 1CGIE 1BHXB 1BMMH 1OPHB 4HZHA 3SORA 1G3CA 2UUKB 2GKVE 1GCDA 1LHEH 3SGAE 2BTCE 1ZLRA 3SJOA 4YOJA 4ZHAA 4X1QU 1HXFH 1UVOA 1OP2A 2A5AA 2B7DH 4X6MA 3LGVA 1Q2WA 5EGMA 2G5NA 3EDXB 2FP7B 4YM9A 5EQSA 1HAXB 1BZXE 2VIOA 1SGDE 2SGDE 4O3TA 2FO9A 1BBRH 1MTVA 4DVAU 1EAUA 5JYIA 3TGJE 1CSOE 1TOMH 3E0PB 1YYY1 3ZVBA 1GHAF 3H7OA 1BB0B 3GYMA 5EQRA 1ESBA 5AHGH 1C1NA 5IDKA 1O2YA 2G00A 1SFIA 2Y5FA 1LVOA 1DY9A 2FYQA 2SGQE 1DSUA 1P9UA 4IN2A 3BTEE 2JH5D 2VH0A 2FODA 2Z7FE 1EATA 3UQOA 2ZHEH 1GBHA 5I46H 2Q6GA 3SJKA 1QQUA 1DS2E 2SNVA 5DP8A 1MAXA 2BDYA 3M5MA 1ZMLA 1F5KU 2J34A 4D9QA 1O31A 1A0HB 1A0LA 4B76A 3IITA 3PV4A 3GCHB 1OYTH 1TMBH 3PWCA 2F9UA 3C27B 3UWJH 5JBTA 2FDAA 5FBEA 2OC0A 2BZ6H 3P92A 3RXAA 3M3VA 4DGJA 1MBQA 3FZZA 2PUXB 3TJOA 5TCAA 1V2WT 4TPYA 1QCPA 3MNCA 3SV9A 3QUMP 1GMCF 2ZKSA 1XUIA 1MUEB 2Z9KA 1PYTC 1P09A 4FUDA 3RUOA 2W7SA 2QXIA 5BPEA 1C2IA 1G3EA 3PTNA 5DO4H 1P2NA 3PTBA 1QA7A 3RXLA 3ZYEA 5JBAS 1GJ9B 1IQLA 5DP7A 3UNRA 1JRTA 1DPOA 3KQDA 3E91A 2ODPA 1P05A 2NU0E 4Y7BA 4GSOA 1YLCA 3KL6A 1ABIH 4NSVA 2I6SA 3BN9A 2QXJA 1LKAA 3PMAB 4X8UH 4ZKSU 1WTGH 4AOQA 2GD4B 2VVVA 2DE8A 3T29A 1O2IA 1V2VT 1ZJKA 3MNXA 2OP9A 2W26A 2ZFFH 1C5PA 1F0RA 3DT0H 2ZCLP 2OINA 1SVPA 3SU1A 2G4UA 1CHOF 2P3TB 3MYWA 1MTNC 3BTTE 2A1DB 3RC6A 3SHCH 1VCPA 1FZZA 1GDQA 1NFXA 2V3OH 1LO6A 3GOVB 2ZCKP 5C20A 4CHAC 1OP0A 1EKBB 1FUJA 4X6PA 1HAZB 1GI0A 4K60A 1Y3YA 1BMLA 1GBJA 1ABJH 1B7XB 1A46H 1Y3VA 1HB0B 3RU4D 2GMTC 1DLEA 5EU8A 4FU7A 3LOXA 3QWCH 2NU4E 1ESAA 4B71A 2VH6A 1EPTC 4K1SA 2G55A 5AFYH 1RD3B 2BDIA 4X1SU 1XVOA 4MPWA 3KNXA 1G2MA 3LIWA 2FS8A 2PWXA 1GGDC 3GDSA 1P11E 3LGIA 2AYWA 4OS1A 1JWTA 1UTQA 1ZTKA 4J1YA 1ZZZA 3TJUA 1J8AA 4TYDA 1AE8H 1O2JA 1XUJA 2GZ7A 6GCHG 4FUEA 1KTTB 1QB9A 2FOFA 2PTNA 1EOLA 1FJSA 1GJ7B 1ZPBA 1GI1A 4ZXXH 1AY6H 1QIXB 2ANKH 2C93B 1W12U 1T4VH 4NZQA 2GDEH 5HGGA 1L4ZA 1BDAA 4ZXYH 3LGUA 2QAAA 3ATMA 3PM3A 1O2GH 1O2ZA 1Z1JA 2CJIA 3PMJA 4NSYA 2WPJS 2VVUA 3GICB 4U30A 3RLYH 1KXCA 2TGPZ 4DJZB 1HIAB 2DUCA 2TBSA 3QGJA 4LOYH 4JZEH 2WPKS 1CA0C 3MU4A 1TGTA 4Y8ZA 1K1OA 3P8FA 2QXHA 3RXGA 4X0WU 4LZ4B 4ABHA 4U32A 1M9UA 4GHQA 1SGCA 4CRBA 3EA7A 1FY4A 1SR5C 4Y8XA 1FY8E 1BQYA 3TITA 1HJAC 2PW8H 4WVPE 4MNVA 1VZQH 4AB9A 2TGDA 1MU8B 3LJJA 1B5GH 5FXLA 1FQ3A 1P8VC 2OLGA 1C4U2 2QF3A 4Q7ZA 1RFNA 1ID5H 3MHWU 4E05H 5BRRE 4DOQA 1MCVA 1QJ7B 2JKHA 2PLXA 4DG4A 1YPEH 4AGJA 4DW2U 2GT8A 2FOCA 1OP8A 1QBNA 5ESBA 1GI6A 1FN8A 3SNBA 1LPKB 2FIRH 5T6GA 2W7UA 1DUAA 3UTUH 2D2DA 4K1TA 1O3NA 4INHA 1J17T 1H4WA 4AX9H 5SGAE 2HALA 1VITG 1FMGA 2AGGX 1ELCA 1XUHA 2P59A 3FVFB 3AVZA 1PYTD 1D6WA 1LTOA 2QIQA 1CHGA 4BAKB 2WPLS 4B2CA 3MO6A 4BXWA 3GCTG 1UVPA 2BD3A 2Z3EA 1KLIH 2UUYA 1ELBA 1AO5A 1TIOA 3KQBA 1C4V2 2BY5X 3EBNA 2H1UA 3NKKA 9LPRA 1HIAA 3A7VA 1GDNA 2PGQB 3B23B 5EPNA 1HAOH 2ANYA 4BTTB 2A5KA 2GCHG 3TH4H 3WY8A 2G51A 3ZVAA 3DHKH 4PROA 3SJIA 1P3CA 1SPJA 1OXGA 1V2PT 2Y81A 2BY8X 1O3DA 2EI8A 2OC1A 1MTWA 4GCHG 1F7ZA 3CP7A 3SV2H 3H7TA 3PMBB 3VEQB 4KP0A 3JZ2B 5FPYA 4K8BA 1P2OA 2JH6D 3KHVA 2B9LA 3RXFA 3HPTB 3T2NA 3ZZ4A 4H4FA 1EP5A 4LXBH 1RJXB 1T4UH 3VFEA 2V6NA 4A5TS 2AMQA 5EXNA 1FONA 1FY1A 2J92A 3TK6A 3Q76A 4OS6A 3PO1C 4R8TB 4CRAA 3BIVH 4UFFH 2F3CE 5A8XA 1LKBA 5FBIA 3W95A 1SLWB 1ETRH 2A31A 4CH8B 4ZKOU 3QLPH 1QRXA 1S0RA 2DE9A 4WH6A 1G3BA 3RM0H 4HI3A 2XTTB 1MTNB 2CXVA 3QTVH 2BLOA 3RM2H 2KAIB 2H6MA 2PFEA 1DICA 1THSH 4CHAB 3FFGA 2BVSH 3E6PH 1ZOMA 3LH1A 1ZPZA 5GDSH 3V13A 2WPHS 1C2HA 1KIGH 3SU0A 3MWIU 4ASHA 3ZZ7A 1IOEA 5DP6A 4JZFH 4TY7A 3ZZ6A 4MVNA 5E8EH 3T62A 4I8HA 1GJDB 2BDHA 2GMTB 4Y7AA 1EB1H 1HYLA 1EPTB 3T5FH 4NIYA 2O8LA 3Q00A 1ZMNA 1G32B 3BEIB 3SJ9A 2FOEA 1WQSA 3ZZ5A 1GGDB 2C3SA 4CRCA 1SBWA 1ZSLA 2P8OC 2ILNA 2VNTA 1D4PB 2PV9B 3UNSA 4ABAA 3PROA 3GY8A 5HYOA 2ZU4A 1ZHRA 3L6PA 4DURA 1T7CA 3NXPA 3M3TA 1P57B 1IQMA 3V12A 3TU7H 2XCNA 2WV5A 1ELVA 3V3MA 2A32A 4K5ZA 2Z94A 1Z8GA 1EAWA 2WUCA 3LONA 1NFWA 4IBLH 3L3TA 4MQAA 5LPFA 1S85A 3QGNB 4FU8A 1GG6C 5F8TA 2KAIA 3RXTA 3GDVA 2XWBI 3VB7A 1O36A 2ODQA 3B8JA 4IN1A 3SU2A 4NIWA 1YC0A 2FI5E 2ZGXH 1G3DA 4OGXA 2RDLA 3MH5A 1TX7A 2TRMA 4MPVA 2W5EA 3UUZA 1WSSH 2ZDMA 1GVKB 3H5CB 2FMJA 1Z6JH 2B5TB 1LPGB 1O2KA 1G37A 2GGVB 1CA0B 5DP5A 1QBOA 2BQ6B 1Y8TA 1CBWC 3E3TA 1ELAA 4WMDA 4KKDA 2FOGA 1E34B 1DWEH