4HI3A

Crystal structure of dimeric r298a mutant of sars coronavirus main protease
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
300
structure length
300
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVAQC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Mechanism for controlling the monomer-dimer conversion of SARS coronavirus main protease.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 82
structure length 300
sequence length 300
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2012-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 4hi3A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4hi3A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4hi3A02
3RXFA 4D9RA 1TALA 4FUEA 1V2TT 3A88A 1L2EA 2JH6D 3ZZ6A 1F0UA 4ABEA 3SGBE 5AF9H 1EOJA 2FESH 1BRBE 3A7VA 4HGCA 4XE4A 1GL1A 2EEKA 4B73A 2F9BH 4JMYA 6GCHG 3IITA 1O2OA 2GZ8A 1LO6A 3SI4H 1C5WB 4ZXXH 1LTOA 1PQ8A 3ZVFA 4B75A 3QLPH 4OS4A 2ZNKH 1IQIA 4FUIA 7LPRA 2Y80A 2AIQA 5E0HA 3D65E 1C5QA 1V2PT 4E06H 1D6RA 1GHBF 5JBTA 1XKAC 1MTUA 2BOKA 3L6PA 5F03A 2A31A 1UVSH 1SGFA 2BLQA 4CRAA 2UWLA 3F9FA 1O5CB 1FNIA 2FS9A 1GJ5H 1DANH 2WPLS 1FMGA 4FUJA 2Z3EA 2P3TB 2BY7X 1GI8B 1L0ZA 5HGGA 3VEQB 3UOUA 1OOKB 1YLDA 2BD7A 3M5MA 3ZV8A 3P70B 3MO9A 4ABDA 2OTVA 3LPRA 4NA7A 1OYTH 1DY8A 1UVUH 3NPSA 3ZZAA 1WCZA 2FTLE 2P3UB 1E37B 3GY5A 4GAWA 1A7SA 2IOTA 4YOJA 2ZWLH 1GJDB 2FXRA 1HAZB 1MAYA 2TGAA 4XBDA 3ATKA 3UWIA 1LVMA 4TY7A 2IPHA 4MNXA 1YP9A 3GCOA 3ODFA 1GG6C 2W3IA 2AEIH 3A7WA 2ZFQH 1W12U 1EAXA 2Q6GA 1GJCB 1W2KH 2FOFA 4ZXYH 2QY0B 5EXNA 3SOSA 2PFEA 2BHGA 1O2MA 1O2YA 2OQUA 1UTKA 3MI4A 1GHAF 3HATH 3A83A 1UTMA 1YM0A 2F9UA 2Y7XA 3TNTA 4DGJA 2ZTXA 2AGEX 1QJ1B 5T6GA 2OC1A 4XBCA 2CF8H 2R0KA 3RXIA 1GHYH 3MNSA 3NWUA 2K1QA 3ZYDA 3MNBA 5A8ZA 4CRBA 8GCHF 1O31A 1WBGB 1A5IA 1MU8B 1AHTH 1BHXB 4UFFH 2HNTC 3TJUA 4XDEA 1GBJA 1OWIA 3P6ZB 2J34A 3T28A 2BX3A 1SGRE 2Z9IA 1KXAA 3GY2A 1K22H 1A3BH 3JZ1B 1O39A 1OWEA 3RLWH 1O2UA 1DWEH 1FY5A 2ZCLP 3QO6A 2JH0D 1H1BA 5GIBA 2AFQB 2FX6A 3OU0A 4IS5A 1UCYK 1AI8H 1NPMA 3QUMP 5EW2H 2XYAA 3U1JB 1QJ6B 1SGNE 3RXCA 2P95A 5F6MA 2V3HH 1TOCB 3ATWA 3LIWA 2D1JA 1EPTA 3BTGE 2SNWA 1DPOA 1MBQA 4ESTE 4Y11E 1CQQA 1O33A 2O8UA 5AVDA 5CE1A 2ILNA 3LU9B 1D3DB 1UK3A 1BTHH 1O2ZA 1QL9A 1FJSA 1F5LA 4YESB 4AYYB 2BB4A 1DUAA 2TIOA 4X6PA 1AMHA 4GCHG 3S7HB 5DP7A 3Q00A 2FM2A 5FCRA 1ID5H 3EDXB 5K7RA 2PLXA 4BXWA 2A5KA 3RXMA 1P11E 1O3LA 2Z9KA 2Y5HA 3AW0A 1C1SA 1EZSC 4SGAE 1E0FD 2ZP0H 2LIZA 3ATLA 1E38B 3MWIU 3RXEA 1BIOA 4JYUH 3LGIA 1C5YB 4Y71A 1HAYB 1Q31A 5FHTA 3TU7H 3Q77A 3SU4A 1BRAA 3ZYEA 1G2LA 2WPMS 3LC5A 1H4WA 3A7XA 4NWKA 1Z71A 4J2YB 2H9TH 2PV9B 3QZQA 1BRCE 4TPIZ 2BLOA 1TPPA 1OP0A 5CHAB 1GCDA 4ABAA 2W5EA 1P05A 1FONA 1YBWA 2STAE 2OC7A 3P95A 2Y82A 3SU3A 4BAQB 3ATMA 1T31A 1NRPH 1FIWA 1RIWB 5EG4A 2FOBA 4HZHA 4YT6H 4B2AA 1SGFG 3S9BA 2GCTB 3CENA 3KF2A 4UONA 1SQTA 1QURH 1CA0B 4AFUA 1ZMNA 1WQSA 1F2SE 2ULLA 5DJ7A 1EJAA 1AUTC 1FDPA 1AZ8A 1EPTB 2ZHDA 3MMGA 1HJ8A 4H6SB 5F8ZA 1V2RT 3EAJA 2ZECA 2C90B 4Y79A 1Z8GA 1PPBH 1LHFH 3TIUA 4I8HA 2ZC9H 4UFEH 1V2OT 1PPCE 5T6DA 1OS8A 1S5SA 3F1SB 3H7OA 3N7OA 3MU0A 2Z3CA 3BG4C 2M5TA 1GMCG 1S84A 4D8NA 1EXFA 3RP2A 1V2QT 2H6MA 2GV7A 4ZROA 1O36A 5F8XA 3RMNH 4ZUHA 1CHOF 1YKTA 4X8SH 3O8DA 3T26A 5AHGH 1C2HA 4OS7A 1MCVA 1MMJN 5DK1A 1G3EA 4R8TB 3E16B 2LNCA 3EGKH 5C1XA 1A61H 1O3FA 1VJAU 1AE8H 1IQNA 4FU8A 5ESBA 3VGCB 3DUXH 1O0DH 2QXIA 4X6NA 1BMAA 3KGPA 3DFJA 1GJBB 3K65B 2VU8E 4B71A 2GZ9A 3RXUA 4BAOB 1QBNA 3IWMA 5JYIA 3UNSA 1HAVA 2FZZA 1VZQH 2SGPE 3ZZ7A 5GCHF 1BCUH 3GY4A 2LPRA 2F9VA 3P92A 1O3GA 1O5AB 4X8TH 5TCAA 3VB6A 4FXGH 3MFJA 2O8WA 4H42U 1ZHMA 4IC6A 1CU1A 3RXBA 1LPKB 5E2PA 4RSPA 2VJ1A 1ZPZA 2HALA 1QFKH 4AFZA 1IQHA 1CA0C 3LONA 2GDEH 3EE0B 1P2MA 2BLVA 1QBVH 1C5LH 2AMPA 2F3CE 1AU8A 2ZU1A 4MTBA 1FN8A 2ZFFH 2RA3A 1EPTC 1SHYA 4NIVA 1LVBA 4KGAA 3EA9A 1KXBA 1CE5A 1FLEE 1NFUA 1K1OA 2CGAA 2VGCB 1CT0E 1O37A 4NSYA 5HXFA 1BMLA 2GD4B 1V3XA 2GCHF 2OQ5A 2WPKS 1QB1A 5E2OA 2D2DA 1F0RA 3SW2B 3AAUA 2NU2E 1J14A 1CA8B 4MG3A 5GJ4B 4WMDA 1ANEA 1DXWA 1OWDA 1GMDF 3RU4T 4U2WA 3GCNA 1C2EA 1TIOA 3SGQE 3D49H 3R3GB 7GCHF 4WY3A 1BTXA 1PPZA 5A8XA 2PHBA 1C1RA 3GDSA 5GDSH 2RG3A 2G55A 1C2DA 1GGDB 1KTSB 4WF8A 2WINI 1G2MA 1O2TA 4XBBA 2A4GA 1DUEA 2R3YA 4NZQA 3PMAB 8ESTE 5LPFA 4Q7YA 1FXYA 1O2PA 3TJOA 1FIZA 2ODPA 1GDNA 1K1IA 1YYY1 9ESTA 1MZAA 3QZRA 5L2YH 4X1QU 1HDTH 1MKXH 2H2ZA 1AFEH 3FANA 1VJ9U 1Z1JA 3RU4E 1GHWH 4OS1A 1C5VA 1F7ZA 2PGBB 1CGHA 3PMBB 4ZKOU 4KELA 2Z9GA 3PWCA 1GJ8B 1RGQA 2A5IA 1QTFA 1INCA 1G37A 4I8LA 2VIOA 3GYMA 1ZRBA 4NIWA 1UTLM 1TMUH 5C67A 1AWFH 4CHAB 2ZQ1A 3MH4A 4F4OC 2RA0A 4FVBA 3KHVA 1S81A 2JETB 1B5GH 1FUJA 3BTHE 2TRMA 1MKXK 1NT1A 3VB3A 4IMQA 1C5XB 3C1KA 3PLPA 5HM2A 1D4PB 1XUFA 4NSVA 1MZDA 1KTTB 1W8BH 4TYDA 1L1JA 2ZEBA 4UEHH 4GUXA 2Z6BD 3D62A 5C1YA 3E90B 1EZXC 4Y7AA 3BF6H 1P2JA 1TBQH 1AB9B 4WVPE 3BG8A 2BY6X 2QYIA 3GICB 3BTME 2BD8A 1SGQE 1H9IE 1O3HA 5JB8S 2EI8A 1NZQH 4H4FA 1W3CA 2CV3A 3W94A 2ZPSA 4B2BA 5IDKA 1QRWA 2VGCC 4K60A 4YO9A 1ELVA 1TRYA 2XXLA 3QGNB 1MUEB 3SQHE 1XXFA 1ELTA 2GV6A 4ASHA 3MO6A 1L4DA 1ZPCA 5A09A 1O2LA 1OSSA 1SHHB 4MDSA 2BDYA 2J2UA 3ZZCA 3S9CA 1Y5BT 2BD5A 1P03A 4YOIA 3TK6A 2WV5A 1TMBH 4B76A 1GBKA 1BRUP 2OBOA 1V2VT 1WV7H 4X1PU 2ANMH 3OY5U 1MQ5A 1T8NA 1N6XA 1QA0A 3SJOA 3UPEA 1QB6A 5E0JA 1VR1H 1ZHRA 4ZHAA 3MU1A 4HFPB 1TGNA 1LVYA 3KQDA 4B2CA 1DE7H 1XUKA 2D26C 1TPOA 1XMNB 1MKWH 1O3IA 4ZAEA 1BUIA 1ANCA 2TGPZ 3M37A 3SNCA 1GMHG 1JRTA 1TGTA 2BDAA 4K1TA 1P2OA 2QN5T 4VGCB 1GI2A 1GJ9B 2ZZUH 3TK9A 2XBWA 1Y8TA 3EQ0H 1CSOE 3LGYA 4Q80A 5A2MH 1P10A 4CRDA 1SGDE 1G3BA 4ZKSU 1IQLA 1GI0A 1SGCA 3SJ8A 1BBRE 2HVXA 1O2NA 4J1YA 4MLFB 4ZMAH 2JETC 1GBTA 3MU5A 1EP5A 4Y7BA 1MKWK 3FP8E 4ZH8A 1W13U 3NXPA 1DLEA 3QTOH 1FAKH 4A7IB 4A1XA 2B0FA 2OC0A 2H9EH 2C8WB 5LH8A 4BAMB 2ZKSA 1ZYOA 1LHEH 2FDAA 3F6UH 3ZVDA 1RXPA 1AB9C 1W7XH 3Q3YA 1C5RA 3ZVAA 4K8YA 4JK5A 3RM0H 1O30A 3SU6A 1NRSH 1UHBA 3VXEH 1O38A 1K21H 1DM4B 1DWBH 1S83A 2PR3A 5C5OA 3LH1A 5EPNA 3S0NA 4MNVA 1TRMA 1SFIA 5I46H 2BDBA 3Q76A 1O3KA 2G4TA 3I78A 1SGYE 1Y3UA 1T8OA 1XUHA 2ZDNA 4D9QA 2AGGX 3TK5A 1GL0E 1KXEA 2A45B 1DDJA 3KEEA 1RFNA 1AO5A 1D3PB 1MAXA 1O2JA 1UO6A 3RXKA 2H5DA 2QA9E 1BMNH 1SLWB 3RC6A 3WY8A 1C2KA 2ALVA 2R9PA 1TQ0B 4O3UA 1V2UT 1V2ST 1Q2WA 1P12E 4CBNA 1O3NA 4BNRA 2K7XA 1A46H 3L3TA 3BIUH 2GMTB 5EQRA 2PUQH 1ESTA 1A0LA 1TPAE 2XC4A 1HAOH 3ZZ9A 2EA3A 1AKSB 3TPIZ 1P2IA 1UTQA 1Z8JB 1ORFA 1H8DH 3MU8A 4KTUA 4VGCC 2AH4X 1EQ9A 5C3NA 1ARCA 2NWNA 1C5NH 4F49A 3UFAA 3ZZ3A 1BB0B 2UUFB 3OY6U 1AVXA 3E91A 1QGFA 1YPEH 2HNTF 3RXAA 1P01A 3PTBA 1WQVH 5EQSA 3UREA 4Y76A 1DWDH 3M7QA 1AFQC 2VB0A 4JK6A 3MYWA 1UMAH 1YPHE 2FOEA 1HIAA 2BD4A 3A84A 1A5GH 1O3CA 2PW8H 1C1WH 5BPEA 3NK8A 4B74A 2SGFE 2BMGB 1XXDA 1EAIA 1HBTH 1DXPA 1S6HA 1NRNH 2ZU5A 1IQGA 1HYLA 1RS0A 2G51A 3BIVH 3HK6B 1O2VA 3OSYA 1WUNH 5FXLA 4DY7B 4BXSA 1ZTLA 1Y5UT 3VXFH 5C2ZA 4IW4E 1YCPM 4NCYA 3RMMH 1TNJA 1KSNA 5DP5A 2RDLA 1O2KA 3ATIA 1V2WT 2BDGA 1C1QA 1EKBB 2A2XH 2R3UA 1ZGVA 4M7GA 1MD7A 1SGPE 2TGDA 4CR5A 2ZPRA 4ISNA 3AW1A 1C1OA 1ELDE 2TGTA 1D3QB 1WTHD 1UCYH 4PROA 3A7YA 1C1PA 2VIQA 1GHBG 1C5MD 2AMQA 1W14U 1O3OA 4BOHA 3A80A 1KLIH 5EQQA 3A7TA 1KDQA 3ZV9A 1AUJA 1LKAA 1QR3E 2SGEE 2A5AA 3P8NA 5JBAS 1TONA 1YLCA 1VITF 1VCWA 1EAUA 1N1LA 3CS0A 1TE0A 1QRXA 1PYTC 3MO3A 3EA7A 2GMTC 2C8YB 1O3EA 3NZIA 1GDUA 1N6YA 2O9QA 2ZF0H 2Z3DA 3ZZDA 1O2IA 1EZUC 2TPIZ 3GDVA 1AWHB 1ELEE 1C2LA 1DICA 1O3MA 1EX3A 2BYAX 2W7SA 4U32A 1AVWA 5L2ZH 4WMEA 4JYTA 2FX4A 1SI5H 3M61U 3FAOA 1PYTD 3RXDA 3T27A 2KAIA 1BHXF 2GZ7A 2OCVB 3M5LA 3SV8A 3BG4B 2CMYA 3ELAH 1DX5M 1GJ7B 1RTKA 1GBAA 5LGOA 1CO7E 2ZGCA 1LQDB 3P17H 5C5NA 2F9PA 1EOLA 2GKVE 4JZEH 1QL7A 2C4FH 1FZZA 4TWYA 3S7KB 3M3SA 4X6MA 4A6LA 4XOJA 1BTUA 5HYOA 1ESBA 1GHAG 1TRNA 1WU1A 4UDWH 1AQ7A 1LHGH 1YCPH 2PTNA 3RM2H 4CBOA 1PPEE 2VVUA 4X1NU 5I25A 2P8OB 1KLTA 2PUXB 2NU0E 3EBNA 1E34B 3FZDA 1NRRH 1HAPH 1MTWA 5FX5A 8GCHG 3BTFE 4NFFA 2ZGHA 2XW9A 1ZSJA 4FUHA 4NIYA 4X2VA 1IOEA 3QN7A 1HCGA 1Z6JH 1C2JA 3MH7A 1YCPK 2PWXA 2EI7A 1NY22 1P04A 3NKKA 3U1IB 3RDZA 1V6DA 3V0XA 1EZQA 2BOHB 1GBBA 1Z8IB 2J95A 1OXGA 3SORA 3SI3H 3F68H 4ABFA 1TNKA 3ZZ8A 3RLYH 1EJMA 3SN8A 4MPXA 4IC5A 4DVAU 1A4WH 2IN2A 2O8LA 2ZPQA 2R0LA 5SGAE 1QBOA 1DOJA 2Q1JA 1P02A 2STBE 3TLOA 3KIDU 1VCQA 3RXGA 2G8TA 2ZCKP 1SQOA 1SB1H 3GY6A 4OGXA 4OS5A 2KAIB 4NZLA 1RRKA 3E8LA 3TH4H 1HJAC 3TH2H 1MH0A 4OGYA 1GPZA 1TOMH 5HM9A 4DURA 1X7AC 1BZXE 4O03A 1GWAA 3TGKE 2XTTB 2BXTH 1SQAA 1XVOA 2Q6FA 4U30A 1ANDA 3TGJE 1GI4A 1HAGE 1SG8B 1L4ZA 5DGJA 3HPTB 3PMJA 4FUGA 4JZFH 4YT7H 4AGJA 2BY8X 1EASA 1ZLRA 2EI6A 3STIA 1IQFA 2XNIA 2CN0H 2VINA 2SGQE 1LHCH 2VIDA 3M3VA 1C4V2 1CGIE 4GLYA 1NC6A 3GYLB 1QQ4A 3LGTA 4X8UH 3M36A 1C2GA 4X1SU 5T3HA 1NM6A 2J9NA 4BANB 1YC0A 4IBLH 2OBQA 1O3JA 2BQ6B 5EXLA 4ABGA 2P8OC 2NU4E 1U6QA 2FOCA 2OXSA 1TPSA 1SMFE 1K1MA 1C5UA 2OC8A 2OINA 2ZHFH 3FFGA 3QX5H 5DKMA 1P57B 4OS2A 5AFZH 1B0FA 6ESTA 5L30H 1P2KA 1JOUB 2ZTZA 1D9IA 4MPUA 1GI3A 3CP7A 1QNJA 2A7JA 3KQCA 2FS8A 1GBLA 4Q2KA 3RMLH 1ACBE 1SLVB 2ZFPH 4D76A 4ZHMU 4FUBA 4FU9A 4DIHH 4I8GA 1EB1H 3BEIB 2A7HA 4DG4A 3A7ZA 2YOLA 1SR5C 2A2QH 1S82A 1C5TA 1ZRKA 4INHA 1B7XB 2XBXA 3JZ2B 2FTMA 5JBCS 1BITA 3Q3KA 2BLWA 1SLUB 1KLJH 5ESTE 2PGQB 1O3PB 1O2RA 2CXVA 1ETTH 3V12A 1AN1E 1A0HB 4X2YA 3RXLA 1HJ9A 2CHAC 4NG9H 1YPLH 3UR6A 3SNBA 1FY8E 1QY6A 1E36B 1O3AA 4LXBH 2GTBA 1ELFA 2ZGBH 1A3EH 4E05H 1XUIA 1EP6A 3PYHA 1PPHE 2Y5GA 2QC2A 4JCNA 1YPMH 1TX7A 3F9HA 4X2WA 3TGIE 1ZZZA 4BAHB 2QF3A 2O8MA 1GI1A 3AASA 4UFDH 3UNRA 3I29A 3C27B 2PKSB 1FY3A 1GBMA 2HWLB 2IJOB 6LPRA 1HNEE 3LJJA 4UD9H 3TJVA 2HNTE 2QIQA 2ZHEH 1SFQB 3RXSA 3A85A 1P2QA 1NFXA 1LMWB 4I33A 3RC4A 1C5ZB 4NIXA 2G4UA 2WPIS 3URDA 1JBUH 1TNIA 2A4RA 1ZTKA 5FX6A 2QV1A 3U69H 1RJXB 2BDIA 1VGCB 2QGRA 3KL6A 1O2QA 2HGTH 1NROH 2FOHA 2PSXA 1MTVA 1FPHH 4Z0KA 1CBWB 1YF4A 1GVZA 1P2NA 5IYTA 4K2YA 5GCHG 5A0CA 1ESAA 1F5KU 2UWOA 3LC3A 1FN6A 1UVOA 4KTCA 1HAVB 1NFWA 3GY8A 1KIGH 5BRRE 4DIIH 3ZVGA 2F9NA 1TYNA 3LGUA 5EOKA 2G00A 3H7TA 3SZNA 1T8MA 3QK1A 5HMAA 3LKWA 4RKOB 1BBRH 4JZ1A 3TITA 4ISHH 1HGTH 3KQBA 1LPGB 2VWMA 2RCEA 4CRCA 1MD8A 4MNWA 1SSXA 2YNBA 4I8JA 2W3KA 5K0HA 5EPYA 2GCHG 1V2NT 1HV7A 1IQJA 1P0SH 5B6OA 2ODQA 2WV4A 4ABIA 1DLKB 1EATA 5JPMH 4X2XA 1K1PA 3VB4A 3E0NB 1AGJA 1HAXB 1DSTA 1EJNA 1TLDA 3PB1E 1O5FH 1BBRK 2G52A 2J38A 5FPSA 3SU0A 2ZDLA 7GCHG 3EYDA 4WH8A 3SJKA 4MNYA 1YPGH 1OP8A 1Y3VA 2ZGJA 1P06A 1OYQA 4NGAH 2PKSC 3HGNA 3GCTF 3PROA 2OUAA 1OP2A 1Y59T 1BMMH 2H9HA 1TAWA 4O9VA 2V3OH 5GXPA 5T6FA 2ANYA 2GGVB 2GX4A 4AZ2B 3F9EA 1AE5A 1ARBA 1BTZA 1AZZA 2J94A 3G01A 4YZUA 5ABWA 1TX6A 1DFPA 1ZGIA 1N8OB 5CMXH 1K1JA 3GOVB 2FEQH 1VGCC 1C9PA 3S69A 3TJNA 1JMOH 2DE8A 3SNAA 2Z9LA 1SGIB 3A89A 2XWAA 3SUEA 4WMFA 2NU1E 1CBWC 1C4Y2 4XSKU 2UUYA 4Y8ZA 1XKBC 4NA8A 1OWHA 4DJZB 1P9UA 1O5EH 3MOCA 4IMZA 1O5BB 2BTCE 3FVFB 4B1TA 4CH8B 2P94A 1T8LA 4AFSA 1HFDA 1TNLA 2A32A 6GCHF 2VWNA 1NTPA 3RXRA 3FP6E 1GJ6A 3BTWE 2UWPA 3QTVH 4AB9A 1C1TA 1ELCA 1PQ5A 4Y0ZE 1AFQB 2BVSH 2ZCHP 1G30B 3ZVEA 3UUZA 3U8TH 1ZSLA 1Z6EA 5FBIA 3T62A 3RXQA 1F5RA 5DO4H 4D7GA 3B8JA 3SV2H 5PTPA 5AFYH 2BDCA 4GHTA 1LKBA 4IN2A 1S85A 4QT8C 1IQEA 1ANBA 2BQWB 1O5GH 3M5OA 4ZKNU 2WUBA 3T25A 3K6YA 4R0IA 1PFXC 3BV9B 1NN6A 2J4IA 2ZDKA 3EA8A 3UNQA 3UQVA 1XVMA 1SOZA 2QXHA 3OTJE 1Y3WA 3ZVCA 3FZZA 1M9UA 1PQAA 3L33A 1ZHPA 3SGAE 4X6OA 5E8EH 3V3MA 4Y6DA 2ALPA 3TH3H 1BT7A 3PM3A 5FBEA 2FO9A 3LOXA 4BTUB 2QXGA 2FLRH 1AVGH 1G9IE 3DT0H 2SFAA 9LPRA 5GPIB 4FU7A 1O34A 2BD3A 3MNXA 2FYQA 1WYKA 2BY9X 3RC5A 3KQEA 3LDXH 1BOQA 3M7UA 2FOGA 1P9SA 4THNH 4KTSA 1MTNC 1J9CH 1J8AA 1N8OC 4CR9A 4CRFA 1LHDH 4WXVA 2ZG0H 1GDQA 1XUGA 3PV4A 4D7FA 1IHSH 1K1NA 2DE9A 3CS7A 1DWCH 2YNAA 1B0EA 4CREA 3ZZ4A 3SU5A 1G32B 3ZZBA 1UK4A 4ISOA 4O3TA 5H4IB 1OX1A 3E6PH 4NWLA 2ZU2A 1TQ7B 3QWCH 4WXIA 1PJPA 1ABJH 4UE7H 1FI8A 2ZTYA 1NS3A 1FPCH 1UK2A 1SC8U 1GBHA 3SV6A 1TBRH 4GSOA 2A4OA 3MTYA 2XWBI 2B8OH 4ISIH 4Y8XA 2NU3E 2F9OA 3K9XB 1GBDA 2SGDE 3SJIA 3NUMA 1MQ6A 1TB6H 3NCLA 2GT8A 1OKXA 3V7TA 3KCGH 4WWYA 3PLKA 1C2FA 2WUCA 2BXUH 1T4UH 1UHBB 4DOQA 1A1RA 4INLA 1NU7B 3ESTA 1G3CA 5EODA 2VIVA 4LK4A 2WYJA 4K1EA 4K5ZA 3HK3B 4DCDA 4HI3A 2Z9JA 2ASUB 1L1NA 2Z7FE 1P3EA 1BDAA 4JZDH 1TA2A 2VH6A 4GCHF 5DG6A 4E7NA 1DS2E 2VWOA 2P3FH 1GCTB 1Z1IA 1TGCA 3UWJH 3UR9A 1BQYA 3DD2H 1V2JT 1RD3B 1KYNA 1L1GA 1K1LA 2AS9A 1WOFA 2AIPA 1ETRH 3U8RH 3ENSB 2F91A 3SO3A 2HRVA 3BTDE 4AFQA 3M5NA 4SGBE 2B5TB 1BTPA 1H9LB 1NRQH 1YPKH 2CF9H 2J92A 1JXPA 1UTJA 1GI9B 2FOMB 2HPPH 2P16A 2XBVA 2AERH 2ZO3H 3U9AH 3BTEE 3URCA 5TJXA 5EU8A 4AG1A 1IAUA 2BDHA 3STJA 5C20A 1NU9A 4TWWA 1EAWA 1HJAB 2FI4E 1NESE 1H8IH 4Y0YE 3OX7U 8KME2 1ZJKA 2SNVA 2GT7A 2DUCA 4FUCA 1OPHB 2G5VA 1HIAB 1UTOA 4X8VH 3GY3A 3Q3XA 1PPFE 2XBYA 1A5HA 4TY6A 2AGIX 2Y81A 3UQOA 1BJVA 4YTAA 1P09A 1LVOA 4INKA 4NA9H 4WH6A 3SU2A 4A5TS 2D8WA 3A8DA 4I32A 1Y5AT 1S0QA 3PTNA 4BTIB 3A81A 1WTGH 1JRSA 1KY9A 1HXEH 1XX9A 1C1MA 3RU4D 3SV7A 3K6ZA 1T4VH 1A0JA 3VPKA 2SGAA 4JYVH 1SLXB 1O2HA 3M3TA 1O2GH 1GMCF 1CGJE 1O35A 1Y3YA 4A1TA 1GCTC 4O97A 2I6SA 4AB8A 1VITG 1YPJH 3S9AA 1KDQB 3B9FH 5A0AE 1QCPA 5JDUB 1GJAB 2HOBA 5LPRA 3V13A 1CHGA 4AX9H 2VNTA 4YLQH 5DP3A 1SPJA 2G81E 1UTPA 1C5SA 3SUFA 1GVLA 1ZTJA 1FY4A 2A1DB 1UCYE 1O3BA 3SHCH 3SJ9A 1LQEA 1C9TA 2ZU4A 1DITH 2FP7B 2FWWA 3A8BA 3MH6A 1O32A 4K8BA 2Y5FA 4I7YH 4RKJB 1GI5A 3A8CA 2G5NA 2R2WU 2CHAB 1TBZH 4I31A 3U8OH 1FV9A 2BX4A 4AG2A 4KKDA 4UFGH 3UY9A 2ZHWH 2ZU3A 2V6NA 2ODYB 1RTFB 2V35A 2BVXH 4X0WU 5DP9A 2BD9A 2OD3B 1XM1A 1C1VH 1DVAH 3D23A 1C5OH 2GVFA 1J15A 1ELBA 3DA9B 1AD8H 4XFQA 1DY9A 2A0QB 3BEFB 1HUTH 4U01A 1ZJDA 1GBCA 1QL8A 1F0TA 1CT2E 3IG6B 5ETXA 1JIRA 2QAAA 1TGSZ 3E3TA 1GHZA 1C2IA 1QA7A 2ZFTA 3SU1A 1C1NA 5DPAA 4DT7B 1V2LT 1THPB 2QF0A 1C4U2 1DT2A 1W0YH 3RUOA 4K3JA 3LGWA 3R0FA 1O2WA 1RTLA 2H5CA 3SUGA 1TGBA 1VCPA 3A87A 3U98H 4Q7XA 1ZR0A 4GPGA 4ZKRU 4AORA 1IHTH 1G3DA 2THFB 4FUFA 4ZHLU 3OYPA 1HB0B 1IQMA 1WAYB 2F83A 1TWXB 2C93B 1D3TB 4LZ1H 5L6NH 3SBKA 3BTKE 1HXFH 1W7GH 2XRCA 3RXOA 1C2MA 5DP6A 1QIXB 1QJ7B 1EB2A 4A92A 1W11U 2WYGA 4GVUA 4LZ4B 2ZQ2A 1V2KT 2ZDAH 5A0BA 3LJOA 1THSH 1W0ZU 2XCFA 3PWBA 3P8OA 1O3DA 4AYVB 4ABJA 1S6FA 1F0SA 1GBFA 3P8GA 1Q3XA 4KP0A 2VH0A 1TNGA 1ZMLA 3TVJB 5GWZA 4IGDA 5FPTA 1EUFA 2H1UA 2EC9H 5A8YA 4FVDA 2FIRH 3VB5A 1F92A 5CHAC 2GDDA 2P93A 1KXDA 3MU4A 2ZDVH 1AY6H 1GHXH 1RIWC 4A1VA 3SQEE 1ABIH 1LPZB 2Y6TA 3LGVA 1KXFA 1C5PA 2P59A 4CH2B 4BTTB 2QCYA 1VITH 6CHAB 2C3SA 7ESTE 5C1UA 3BTQE 2GCTC 4ISLA 3O8BA 5JB9S 2ZHQH 1SVPA 1CVWH 2ANWA 1MBMA 2VVCA 3QGJA 2VIPA 2WPHS 2Z94A 3UIRA 1P8VC 4YM9A 2XC5A 3PMHB 5FAHA 1OWKA 1H9HE 2ZDMA 3LT3A 4HTCH 3RXHA 1K2I1 2ZIQH 1CHOG 2BVRH 3GCHB 1J17T 5EW1H 3E0PB 2QXJA 1HLTH 2AYWA 2TBSA 1MU6B 2BQ7B 3BTTE 4LOYH 5J4QA 2I6QA 2Y7ZA 1Z8RA 2BZ6H 3F9GA 4NFEA 2O8TA 4JZIA 1BTWA 1GVKB 3T29A 2C8XB 3AAVA 1HAIH 4AGKA 4K1SA 4MPVA 2JH5D 4I8KA 4IN1A 3BSQA 1TABE 1ZSKA 4WJG2 1ETSH 4MPWA 3MH5A 1UJ1A 1FAXA 4AOQA 1YPHC 3ODDA 3PO1B 1A2CH 2ZI2H 1ZPBA 1K9OE 3W95A 3GY7A 3RXPA 2C8ZB 2UUKB 5LPEA 1V2MT 1P3CA 3M35A 3VFEA 4FUDA 1T32A 5FCKA 1SBWA 2PTCE 2ZFSA 3VGCC 5DP8A 3HKIB 2W26A 2GP9B 4TPYA 4CRGA 2V0BA 3VB7A 3MHWU 1BA8B 1UVTH 3KN2A 3UTUH 2FI3E 1TX8A 4K69A 3BN9A 7KMEH 3UOPA 4ABBA 3P8FA 3RXVA 3AVZA 1TNHA 1GMHF 3T5FH 4E7RG 1KXCA 1C1UH 3GDUA 3ITIA 3K2UA 3FP7E 1GHVH 2ZA5A 1GBIA 1UTNA 2WPJS 1D6WA 3A86A 1ELAA 1ELGA 2PKAA 6CHAC 3TNSA 3O8RA 1GMDG 3ZVBA 3M7TA 4H6TA 1DSUA 1AIXH 1OWJA 2ANKH 1E35B 2Q6DA 1NFYA 5E0GA 4DW2U 1HPGA 2VWLA 2BY5X 3RMOH 1J16A 1QB9A 1BTYA 1GBEA 1FY1A 4RN6A 3SV9A 3SNDA 1IQKA 3BEUA 2BD2A 4MQAA 3GCHC 2FLBH 1HAHH 1GI6A 1G36A 2CJIA 1PQ7A 2HLCA 5F8TA 2OLGA 3SHAH 1SGTA 1TA6A 1TMTH 3RXTA 3GISB 4X1RU 3HKJB 2AMDA 3H5CB 1MTNB 2XC0A 4GHQA 1Y3XA 2BM2A 2W7UA 1YGCH 1HRTH 1O2XA 1SOTA 1O2SA 1ZOMA 5EXMA 2JKHA 2ZGXH 1SL3A 3I77A 5J4SA 4Y10E 3QDZB 1W10U 3PO1C 1GGDC 5FPYA 3O8CA 2FOAA 3DFLA 2A4QA 1JWTA 2ESTE 1ZMJA 2UUJB 3PLBA 2A7CA 1MTSA 1S0RA 2PSYA 3RXJA 1NO9H 1LCYA 3A82A 1QHRB 1TFXA 1O5DH 3B23B 2FMJA 4YLUA 4ABHA 4MVNA 4Z6AH 3E1XB 2VIWA 3T2NA 2FPZA 1CT4E 1FQ3A 1GI7B 2ZFRH 1QQUA 2HPQH 1SGEE 4YOGA 1GJ4H 1PPGE 1AKSA 2FYRA 2B7DH 2OP9A 5TCCA 5EGMA 3SUDA 3DHKH 5G4BA 1JIMA 1THRH 3ZZ5A 4AN7A 4CHAC 1XUJA 3LH3A 2B9LA 4Y8YA 2PKAB 1WSSH 4BAKB 2BZAA 1BJUA 2VVVA 1MCTA 3SNEA 8LPRA 3HGPA 2XCNA 2R2MB 1Z7KA 1QRZA 3GCTG 3KNXA 1UVPA 5DP4A 1GG6B 3A8AA 1K28D 4OS6A 5JBBS 2FODA 4Q7ZA 2FI5E 1T7CA 3MNCA 1LDTT
chains in the Genus database with same CATH superfamily
3RXFA 4D9RA 1TALA 4FUEA 1V2TT 3A88A 1L2EA 2JH6D 3ZZ6A 1F0UA 4ABEA 3SGBE 5AF9H 1EOJA 2FESH 1BRBE 3A7VA 4HGCA 3DCLA 4XE4A 1GL1A 5EJZA 2EEKA 4B73A 2F9BH 4JMYA 6GCHG 3IITA 1O2OA 2GZ8A 1LO6A 3SI4H 1C5WB 4ZXXH 1LTOA 1PQ8A 3ZVFA 4B75A 3QLPH 4OS4A 5DN6D 2ZNKH 1IQIA 4FUIA 7LPRA 2Y80A 2AIQA 5E0HA 3D65E 1C5QA 1V2PT 4E06H 1D6RA 1GHBF 5JBTA 1XKAC 1MTUA 2BOKA 3L6PA 5F03A 2A31A 1UVSH 1SGFA 2BLQA 4CRAA 5EJLA 2UWLA 3F9FA 1O5CB 1FNIA 2FS9A 1GJ5H 1DANH 2WPLS 1FMGA 4FUJA 2Z3EA 2P3TB 2BY7X 1GI8B 1L0ZA 5HGGA 3VEQB 3UOUA 3OEHD 1OOKB 1YLDA 2BD7A 3M5MA 3ZV8A 3P70B 3MO9A 4ABDA 2OTVA 3LPRA 4NA7A 1OYTH 1DY8A 1UVUH 5EIYA 3NPSA 3ZZAA 1WCZA 2FTLE 2P3UB 1E37B 3GY5A 4GAWA 1A7SA 2IOTA 4YOJA 2ZWLH 1GJDB 2FXRA 1HAZB 1MAYA 2TGAA 4XBDA 3ATKA 3UWIA 1LVMA 3DSGA 4TY7A 2IPHA 4MNXA 1YP9A 3GCOA 3ODFA 1GG6C 2W3IA 2AEIH 3A7WA 2ZFQH 1W12U 1EAXA 2Q6GA 1GJCB 1W2KH 2FOFA 1NBME 4ZXYH 2QY0B 5EXNA 3SOSA 2PFEA 1E79D 2BHGA 1O2MA 1O2YA 2OQUA 1UTKA 3VG8A 3MI4A 1GHAF 2LP6A 3HATH 3A83A 1UTMA 1YM0A 2F9UA 2Y7XA 3TNTA 4DGJA 2ZTXA 2AGEX 1QJ1B 5T6GA 2OC1A 4XBCA 2CF8H 2R0KA 3RXIA 1GHYH 3MNSA 3NWUA 3NRLA 2K1QA 3ZYDA 3MNBA 5A8ZA 4CRBA 8GCHF 1O31A 1WBGB 1A5IA 1MU8B 1AHTH 1BHXB 4UFFH 2HNTC 3TJUA 4XDEA 1GBJA 1OWIA 3OAAD 2J34A 3P6ZB 3T28A 2BX3A 1SGRE 2Z9IA 1KXAA 3GY2A 1K22H 1A3BH 3JZ1B 1O39A 1OWEA 3RLWH 1O2UA 1DWEH 1FY5A 2ZCLP 3QO6A 2JH0D 1H1BA 3PV5A 5GIBA 2AFQB 2FX6A 3OU0A 4IS5A 1UCYK 1AI8H 1NPMA 3QUMP 5EW2H 2XYAA 3U1JB 1QJ6B 1SGNE 3RXCA 2P95A 5F6MA 2WPDD 2V3HH 1TOCB 3ATWA 3LIWA 2D1JA 1EPTA 3BTGE 2SNWA 1DPOA 1MBQA 4ESTE 4Y11E 1CQQA 1O33A 2O8UA 5AVDA 5CE1A 2ILNA 3LU9B 1D3DB 1UK3A 1BTHH 1O2ZA 1QL9A 1FJSA 1F5LA 4YESB 4AYYB 2BB4A 1DUAA 2TIOA 4X6PA 1AMHA 4GCHG 5DSFA 5DP7A 3Q00A 2FM2A 5FCRA 3S7HB 1ID5H 3EDXB 5K7RA 2PLXA 4BXWA 2A5KA 3RXMA 1P11E 1O3LA 2Z9KA 2Y5HA 3AW0A 1C1SA 1EZSC 4SGAE 1E0FD 2ZP0H 2LIZA 3ATLA 1E38B 3MWIU 3RXEA 1BIOA 4JYUH 3LGIA 1C5YB 3PV2A 4Y71A 1HAYB 4DT4A 1Q31A 5FHTA 3TU7H 3Q77A 3SU4A 1BRAA 1H8HD 3ZYEA 1G2LA 2WPMS 3LC5A 1H4WA 2GJGA 3A7XA 4NWKA 1Z71A 4J2YB 2H9TH 2PV9B 3QZQA 1BRCE 4TPIZ 2BLOA 1TPPA 2LELA 1OP0A 5CHAB 4I86A 1GCDA 4ABAA 2W5EA 1P05A 1FONA 3OTPA 1YBWA 2STAE 2OC7A 3P95A 2Y82A 3SU3A 4BAQB 3OEED 3ATMA 1T31A 1NRPH 1FIWA 1RIWB 5EG4A 1KMHB 2FOBA 4HZHA 4YT6H 4B2AA 1SGFG 3S9BA 5EJ1A 2GCTB 3CENA 3KF2A 4UONA 1SQTA 1QURH 1CA0B 4AFUA 1ZMNA 1WQSA 1F2SE 2ULLA 5DJ7A 1EJAA 1AUTC 3DSPA 1FDPA 1AZ8A 1EPTB 2ZHDA 3MMGA 1HJ8A 4H6SB 5F8ZA 1V2RT 3EAJA 2ZECA 2C90B 4Y79A 1Z8GA 1PPBH 1LHFH 3TIUA 4I8HA 2ZC9H 4UFEH 1V2OT 1PPCE 3F2HA 5T6DA 1OS8A 1S5SA 3F1SB 3H7OA 3N7OA 3MU0A 2Z3CA 3BG4C 2M5TA 1GMCG 1S84A 4D8NA 1EXFA 3RP2A 1V2QT 2H6MA 2GV7A 4ZROA 5KECA 1O36A 5F8XA 3RMNH 4ZUHA 1CHOF 1YKTA 4X8SH 3O8DA 3T26A 5AHGH 1C2HA 4OS7A 1MCVA 1MMJN 5DK1A 1G3EA 4R8TB 3E16B 2LNCA 3EGKH 1YWUA 5C1XA 1A61H 1O3FA 1VJAU 1AE8H 1IQNA 4FU8A 5ESBA 3VGCB 3DUXH 1O0DH 2QXIA 4X6NA 1BMAA 3KGPA 3DFJA 1GJBB 3K65B 2VU8E 4B71A 2GZ9A 3RXUA 4BAOB 1QBNA 3ZIAD 3IWMA 5JYIA 3UNSA 1HAVA 2FZZA 2RDEA 1VZQH 2SGPE 3ZZ7A 5GCHF 1BCUH 3GY4A 2LPRA 2F9VA 3P92A 1O3GA 1O5AB 4X8TH 5TCAA 3VB6A 4FXGH 3MFJA 2O8WA 4H42U 1ZHMA 4IC6A 1CU1A 3RXBA 1LPKB 5E2PA 4RSPA 2VJ1A 1ZPZA 2F4LA 1QFKH 2HALA 4AFZA 1IQHA 2J97A 1CA0C 3LONA 2GDEH 3EE0B 1P2MA 2BLVA 1QBVH 1C5LH 2AMPA 2F3CE 1AU8A 2ZU1A 4MTBA 1FN8A 2ZFFH 2RA3A 1EPTC 1SHYA 4NIVA 1LVBA 4KGAA 3EA9A 1KXBA 1CE5A 1FLEE 1NFUA 1K1OA 2CGAA 2VGCB 1CT0E 1O37A 4NSYA 5HXFA 1BMLA 2GD4B 1V3XA 2GCHF 2OQ5A 2WPKS 1QB1A 5E2OA 2D2DA 1F0RA 3SW2B 3AAUA 2NU2E 1J14A 1CA8B 4MG3A 5GJ4B 4WMDA 1ANEA 1DXWA 1OWDA 1GMDF 2VBCA 3RU4T 4U2WA 3GCNA 1C2EA 1TIOA 3SGQE 3D49H 3R3GB 4ASUD 7GCHF 4WY3A 1BTXA 1PPZA 5A8XA 2PHBA 1C1RA 3GDSA 5GDSH 2RG3A 2G55A 1C2DA 1GGDB 1KTSB 4WF8A 2WINI 1G2MA 1O2TA 4XBBA 2A4GA 1DUEA 2R3YA 4NZQA 3PMAB 8ESTE 5LPFA 4Q7YA 1FXYA 1BMFD 1O2PA 3TJOA 1FIZA 2ODPA 1GDNA 1K1IA 1YYY1 9ESTA 1MZAA 3QZRA 5L2YH 4X1QU 1HDTH 1MKXH 2H2ZA 1AFEH 3FANA 1VJ9U 1Z1JA 3RU4E 1GHWH 4OS1A 1C5VA 1F7ZA 2PGBB 1CGHA 3PMBB 1EFRD 4ZKOU 4KELA 2Z9GA 3PWCA 1GJ8B 1RGQA 2A5IA 1QTFA 1INCA 1G37A 4I8LA 3F0OA 2VIOA 3GYMA 1ZRBA 2KR7A 4NIWA 1UTLM 1TMUH 5C67A 1AWFH 4CHAB 2ZQ1A 3MH4A 4F4OC 2RA0A 4FVBA 3KHVA 1S81A 2JETB 1B5GH 1FUJA 3BTHE 2TRMA 1MKXK 1NT1A 3VB3A 4IMQA 1C5XB 3C1KA 3PLPA 5HM2A 1D4PB 1XUFA 4NSVA 1MZDA 1KTTB 1W8BH 4TYDA 1L1JA 2ZEBA 4UEHH 4GUXA 2Z6BD 3D62A 5C1YA 3E90B 1EZXC 4Y7AA 3BF6H 1P2JA 1TBQH 1AB9B 4WVPE 1NBMD 3BG8A 2BY6X 2QYIA 3GICB 3BTME 2BD8A 1SGQE 1H9IE 1O3HA 5JB8S 2EI8A 1NZQH 4H4FA 1W3CA 2CV3A 5CDFE 3W94A 2ZPSA 4B2BA 5IDKA 1QRWA 2VGCC 4K60A 4YO9A 1ELVA 1TRYA 2XXLA 3QGNB 1MUEB 3SQHE 1XXFA 1ELTA 2GV6A 4ASHA 3MO6A 1L4DA 1ZPCA 5A09A 1O2LA 1OSSA 1SHHB 4MDSA 2BDYA 2J2UA 3ZZCA 3S9CA 1Y5BT 2BD5A 1P03A 4YOIA 3TK6A 2WV5A 1TMBH 4B76A 1GBKA 1BRUP 2OBOA 1V2VT 1WV7H 4X1PU 2ANMH 4P02A 3OY5U 1MQ5A 1T8NA 1N6XA 1QA0A 3SJOA 3UPEA 1QB6A 5E0JA 1VR1H 1ZHRA 4ZHAA 3MU1A 4HFPB 1TGNA 1LVYA 3KQDA 4B2CA 1DE7H 1XUKA 2D26C 1TPOA 1XMNB 1MKWH 1O3IA 4ZAEA 1BUIA 1YY3A 1ANCA 2TGPZ 3M37A 3SNCA 1GMHG 1JRTA 1TGTA 2BDAA 4K1TA 1P2OA 2QN5T 2WHXA 4VGCB 1GI2A 1GJ9B 2ZZUH 3TK9A 2XBWA 1Y8TA 3EQ0H 1CSOE 3LGYA 4Q80A 5A2MH 1P10A 2K0QA 4CRDA 1SGDE 1G3BA 4ZKSU 1IQLA 1GI0A 1SGCA 3SJ8A 1BBRE 2HVXA 2CK3D 5C17A 1O2NA 4J1YA 4MLFB 4ZMAH 2JETC 1GBTA 3MU5A 1EP5A 4Y7BA 1MKWK 3FP8E 4ZH8A 1W13U 3NXPA 1DLEA 3QTOH 1H8ED 1FAKH 3UAIC 4A7IB 4A1XA 2B0FA 2OC0A 2H9EH 2C8WB 5LH8A 4BAMB 2ZKSA 1ZYOA 1LHEH 2FDAA 3F6UH 3ZVDA 1RXPA 1AB9C 1W7XH 3Q3YA 5KEDA 1C5RA 3ZVAA 4K8YA 4JK5A 3RM0H 1O30A 3SU6A 1NRSH 1UHBA 3VXEH 1O38A 1K21H 1DM4B 1DWBH 1S83A 2PR3A 5C5OA 3LH1A 5EPNA 3S0NA 4MNVA 1TRMA 1SFIA 5I46H 2BDBA 3Q76A 1O3KA 2G4TA 3I78A 1SGYE 1Y3UA 1T8OA 1XUHA 2ZDNA 4D9QA 2AGGX 3TK5A 4RT0A 1GL0E 2EY4C 1KXEA 2A45B 1DDJA 3KEEA 1RFNA 1AO5A 1D3PB 1MAXA 1O2JA 1UO6A 3RXKA 4FOUC 2H5DA 2QA9E 1BMNH 1SLWB 2HVYB 3RC6A 3WY8A 1C2KA 2ALVA 2R9PA 1TQ0B 4O3UA 1V2UT 1V2ST 1Q2WA 1P12E 4CBNA 1O3NA 4TSFD 4BNRA 2K7XA 1A46H 3CNRA 3L3TA 3BIUH 2GMTB 5EQRA 3WWBA 2PUQH 1ESTA 1A0LA 1TPAE 2XC4A 1HAOH 3ZZ9A 2EA3A 1AKSB 3TPIZ 1P2IA 1UTQA 1Z8JB 1ORFA 1H8DH 3MU8A 4KTUA 4VGCC 2AH4X 1EQ9A 2HLDD 1VKYA 5C3NA 4ACAA 1ARCA 2NWNA 1SKYE 1C5NH 4F49A 3UFAA 3ZZ3A 1BB0B 2UUFB 3OY6U 1AVXA 3E91A 1QGFA 1YPEH 2HNTF 3RXAA 1P01A 3PTBA 1WQVH 5EQSA 3UREA 4Y76A 1DWDH 3KQ5A 3M7QA 1AFQC 2VB0A 4JK6A 3MYWA 1UMAH 5C0UA 1YPHE 2FOEA 1HIAA 2BD4A 3A84A 1A5GH 1O3CA 2PW8H 1C1WH 5BPEA 3NK8A 4B74A 2SGFE 2BMGB 1XXDA 1EAIA 1HBTH 1DXPA 1S6HA 1NRNH 2ZU5A 1IQGA 1HYLA 1RS0A 2G51A 3BIVH 4Q63A 3HK6B 1O2VA 3OSYA 1WUNH 5FXLA 4DY7B 4BXSA 1ZTLA 1Y5UT 3VXFH 5C2ZA 4IW4E 1YCPM 4NCYA 3RMMH 1TNJA 1KSNA 5DP5A 2RDLA 4B6EA 1O2KA 3ATIA 1V2WT 2BDGA 1C1QA 1EKBB 2A2XH 2R3UA 1ZGVA 4FETA 4M7GA 1MD7A 1SGPE 2TGDA 4CR5A 2ZPRA 4ISNA 3AW1A 1C1OA 1ELDE 2TGTA 4XD7D 1D3QB 1WTHD 1UCYH 4PROA 3A7YA 1C1PA 2VIQA 1GHBG 1C5MD 2AMQA 1W14U 3GS9A 1O3OA 4BOHA 3A80A 1KLIH 5EQQA 3A7TA 1KDQA 3ZV9A 1AUJA 1LKAA 1QR3E 2SGEE 2A5AA 3P8NA 5JBAS 1TONA 1YLCA 1VITF 1VCWA 1EAUA 1N1LA 3CS0A 1TE0A 1QRXA 1PYTC 3MO3A 3EA7A 2GMTC 2C8YB 1O3EA 3NZIA 1GDUA 1N6YA 3SYJA 2O9QA 2ZF0H 2Z3DA 3ZZDA 1O2IA 1EZUC 2TPIZ 3GDVA 1AWHB 1ELEE 1C2LA 1DICA 1O3MA 1EX3A 2BYAX 2JIZD 2W7SA 4U32A 1AVWA 5L2ZH 4WMEA 4JYTA 2FX4A 1SI5H 3M61U 3FAOA 1PYTD 3RXDA 3T27A 2KAIA 1BHXF 2GZ7A 2OCVB 3M5LA 3SV8A 3BG4B 2CMYA 3ELAH 1DX5M 1GJ7B 1RTKA 1GBAA 5LGOA 1CO7E 2ZGCA 1LQDB 3P17H 5C5NA 2F9PA 1EOLA 2GKVE 4JZEH 1QL7A 2C4FH 1W0KD 1FZZA 4TWYA 3S7KB 3M3SA 4X6MA 4A6LA 4XOJA 1BTUA 5HYOA 1ESBA 1GHAG 1TRNA 1WU1A 4UDWH 1AQ7A 1LHGH 1YCPH 2PTNA 3RM2H 4CBOA 1PPEE 2VVUA 4X1NU 5I25A 2P8OB 1KLTA 2PUXB 2NU0E 3EBNA 1E34B 3FZDA 1NRRH 1HAPH 1MTWA 5FX5A 8GCHG 3BTFE 2KFWA 4NFFA 2ZGHA 2XW9A 1ZSJA 4FUHA 4NIYA 4X2VA 1IOEA 1YLNA 3QN7A 1HCGA 1Z6JH 1C2JA 3MH7A 1YCPK 2PWXA 2EI7A 3SZEA 1NY22 1P04A 3NKKA 3U1IB 3RDZA 1V6DA 3V0XA 3H09A 1EZQA 2BOHB 1GBBA 1Z8IB 2J95A 1OXGA 3SORA 3SI3H 3F68H 4ABFA 1TNKA 3ZZ8A 3RLYH 2L6OA 1EJMA 3SN8A 4MPXA 4IC5A 4DVAU 1A4WH 2IN2A 2O8LA 2ZPQA 2R0LA 5SGAE 1QBOA 1WXRA 1DOJA 2Q1JA 1P02A 2STBE 3TLOA 3KIDU 1VCQA 3RXGA 2G8TA 2ZCKP 1SQOA 1SB1H 3GY6A 4OGXA 4OS5A 2F43B 4OM9A 2KAIB 4NZLA 1RRKA 3E8LA 3TH4H 1HJAC 3TH2H 1MH0A 4OGYA 1GPZA 1TOMH 3FOAA 5HM9A 4DURA 1X7AC 1BZXE 4O03A 1GWAA 3TGKE 2XTTB 2BXTH 1MABB 1SQAA 2Q6FA 1XVOA 4U30A 1ANDA 3TGJE 1GI4A 1HAGE 1SG8B 1L4ZA 5DGJA 3HPTB 3PMJA 4FUGA 2V7QD 4JZFH 4YT7H 4AGJA 2BY8X 1EASA 1ZLRA 2EI6A 3STIA 1IQFA 2XNIA 2CN0H 2VINA 2SGQE 1LHCH 2VIDA 3M3VA 1C4V2 1CGIE 4GLYA 1NC6A 3GYLB 1QQ4A 3LGTA 4X8UH 3M36A 1C2GA 4X1SU 5T3HA 1NM6A 2J9NA 4BANB 1YC0A 4IBLH 2OBQA 1O3JA 2BQ6B 5EXLA 4ABGA 2P8OC 2NU4E 1U6QA 2FOCA 2OXSA 1TPSA 3DSOA 2JJ1D 2WV9A 1SMFE 1K1MA 1C5UA 2OC8A 2OINA 2ZHFH 3FFGA 3QX5H 5DKMA 1P57B 4OS2A 5AFZH 1B0FA 6ESTA 5L30H 1P2KA 1JOUB 2ZTZA 1D9IA 4MPUA 1GI3A 3CP7A 1QNJA 2A7JA 3KQCA 4XRNA 2FS8A 1GBLA 4Q2KA 3RMLH 1ACBE 1SLVB 2ZFPH 3F3BA 4ZHMU 4FUBA 4FU9A 4D76A 4DIHH 4I8GA 3KYFA 2K8IA 1EB1H 3BEIB 2A7HA 4DG4A 3A7ZA 2YOLA 1SR5C 2A2QH 1S82A 1C5TA 1ZRKA 4INHA 1B7XB 2XBXA 3AK5A 3JZ2B 2FTMA 5JBCS 1BITA 3Q3KA 2BLWA 1SLUB 1KLJH 5ESTE 2PGQB 1O3PB 1O2RA 2CXVA 1ETTH 3V12A 1AN1E 1A0HB 4X2YA 3RXLA 1HJ9A 2CHAC 4NG9H 1YPLH 3UR6A 3SNBA 1FY8E 1QY6A 1E36B 1O3AA 4LXBH 2GTBA 2JJ2D 1ELFA 2ZGBH 1A3EH 4E05H 1XUIA 1EP6A 3PYHA 1PPHE 2Y5GA 2QC2A 4JCNA 1YPMH 1TX7A 3F9HA 4X2WA 3TGIE 1ZZZA 4BAHB 2QF3A 2O8MA 1GI1A 3AASA 4UFDH 3UNRA 3I29A 3C27B 2PKSB 2YMSD 1FY3A 1GBMA 2HWLB 2IJOB 6LPRA 1HNEE 3LJJA 4UD9H 4YXWD 3TJVA 2HNTE 2QIQA 2ZHEH 5FL7D 1SFQB 3RXSA 3A85A 1P2QA 1NFXA 1LMWB 4I33A 1FX0B 3RC4A 3FKSD 5CHBA 1C5ZB 4NIXA 2G4UA 2WPIS 3URDA 1JBUH 1TNIA 2A4RA 1ZTKA 5FX6A 2QV1A 3U69H 1RJXB 2BDIA 1VGCB 2QGRA 3KL6A 1O2QA 2HGTH 1NROH 3EE7A 2FOHA 2PSXA 1MTVA 1FPHH 4Z0KA 1CBWB 1YF4A 1GVZA 1P2NA 5C0TA 5IK2D 5IYTA 4K2YA 5GCHG 5A0CA 1ESAA 1F5KU 2UWOA 3FO8D 3LC3A 1FN6A 1UVOA 4B6FA 4KTCA 1HAVB 1NFWA 5KGOA 3GY8A 1KIGH 5BRRE 4DIIH 3ZVGA 2W6JD 2F9NA 1TYNA 3LGUA 5EOKA 2G00A 3H7TA 3SZNA 1UW7A 1T8MA 3QK1A 5HMAA 3LKWA 3OFND 1BBRH 4RKOB 4JZ1A 2QE7D 3TITA 4ISHH 2OK5A 1HGTH 3F2FA 3KQBA 1LPGB 2VWMA 2RCEA 4CRCA 1MD8A 4MNWA 1SSXA 2YNBA 4HG6A 2W3KA 4I8JA 5EPYA 5K0HA 2GCHG 1V2NT 1HV7A 1IQJA 1P0SH 5B6OA 2ODQA 2WV4A 4ABIA 1DLKB 1EATA 5JPMH 4X2XA 1K1PA 3VB4A 3E0NB 1AGJA 1HAXB 1DSTA 1EJNA 3OE7D 1TLDA 5B6LA 3PB1E 1O5FH 1BBRK 2G52A 2J38A 4RI0A 5FPSA 3SU0A 2ZDLA 7GCHG 3EYDA 4WH8A 3SJKA 4MNYA 1YPGH 1OP8A 1Y3VA 2ZGJA 1P06A 1OYQA 4NGAH 2PKSC 3HGNA 3GCTF 3PROA 2OUAA 3W1EA 1OP2A 1Y59T 1BMMH 2H9HA 1TAWA 4O9VA 2V3OH 5GXPA 5HIYA 5T6FA 2ANYA 2GGVB 2GX4A 4AZ2B 1E1RD 3F9EA 1AE5A 1ARBA 1BTZA 1AZZA 2J94A 3G01A 4YZUA 5ABWA 1TX6A 1DFPA 1ZGIA 2RFKC 1N8OB 5CMXH 1K1JA 3GOVB 2FEQH 1VGCC 1C9PA 3S69A 3TJNA 1JMOH 2DE8A 3SNAA 2Z9LA 1SGIB 3A89A 2XWAA 3SUEA 4WMFA 2NU1E 1CBWC 1C4Y2 4XSKU 2UUYA 4Y8ZA 1XKBC 4NA8A 1OWHA 4DJZB 1P9UA 1O5EH 3MOCA 4IMZA 1O5BB 2BTCE 3FVFB 4B1TA 4CH8B 2P94A 1T8LA 4AFSA 1HFDA 1TNLA 2A32A 6GCHF 2VWNA 1NTPA 4P00A 3RXRA 3FP6E 1GJ6A 3BTWE 2UWPA 3QTVH 4AB9A 4ZCNA 1C1TA 1ELCA 1PQ5A 4Y0ZE 1AFQB 2BVSH 2ZCHP 1G30B 3ZVEA 3UUZA 3U8TH 1ZSLA 1Z6EA 5FBIA 3T62A 1K0HA 3RXQA 1F5RA 5DO4H 4D7GA 3B8JA 3SV2H 5PTPA 5AFYH 2BDCA 4GHTA 1LKBA 2KX4A 4IN2A 1S85A 4QT8C 1IQEA 1ANBA 2BQWB 1O5GH 3M5OA 4ZKNU 2WUBA 3T25A 3K6YA 4R0IA 1PFXC 2XOKD 3BV9B 1NN6A 2J4IA 2ZDKA 3EA8A 3UNQA 3UQVA 2AHME 1XVMA 1SOZA 2QXHA 3OTJE 1Y3WA 3ZVCA 3FZZA 1M9UA 1PQAA 3L33A 1ZHPA 3SGAE 4X6OA 5E8EH 3V3MA 4Y6DA 2ALPA 3TH3H 1BT7A 3PM3A 5FBEA 2FO9A 3LOXA 4BTUB 2QXGA 2FLRH 1AVGH 1G9IE 3DT0H 2SFAA 3N7EA 9LPRA 5GPIB 4FU7A 1O34A 2BD3A 3MNXA 2FYQA 1WYKA 2BY9X 3RC5A 3KQEA 3LDXH 1BOQA 3M7UA 2FOGA 1P9SA 4THNH 4KTSA 1MTNC 1J9CH 1J8AA 1N8OC 4CR9A 4CRFA 1LHDH 4RT1A 4WXVA 2ZG0H 1GDQA 1XUGA 3PV4A 4D7FA 1IHSH 1K1NA 2DE9A 3CS7A 1DWCH 2YNAA 1B0EA 4CREA 3ZZ4A 3SU5A 1G32B 3ZZBA 1UK4A 4ISOA 4O3TA 5H4IB 1OX1A 3E6PH 4NWLA 2ZU2A 1TQ7B 3QWCH 4WXIA 1PJPA 1ABJH 4UE7H 1FI8A 2ZTYA 1NS3A 1FPCH 1UK2A 1SC8U 1GBHA 3SV6A 1TBRH 4GSOA 2A4OA 3MTYA 2XWBI 2B8OH 4ISIH 4Y8XA 2NU3E 2F9OA 3K9XB 1GBDA 2SGDE 3SJIA 3NUMA 1MQ6A 1TB6H 3NCLA 2GT8A 1OKXA 3V7TA 3F2GA 3KCGH 4WWYA 3PLKA 4TT3D 1C2FA 2WUCA 2BXUH 1T4UH 1UHBB 4DOQA 1A1RA 4INLA 1NU7B 3ESTA 1G3CA 5EODA 2VIVA 4LK4A 2WYJA 4K1EA 4K5ZA 3HK3B 4DCDA 4HI3A 2Z9JA 2ASUB 1L1NA 2M2AA 2Z7FE 1P3EA 1BDAA 4JZDH 1TA2A 2VH6A 4GCHF 5DG6A 4E7NA 1DS2E 2VWOA 2P3FH 1GCTB 1Z1IA 1TGCA 3UWJH 3UR9A 1BQYA 3DD2H 1V2JT 1RD3B 1KYNA 1L1GA 1K1LA 2AS9A 1WOFA 2AIPA 1ETRH 3U8RH 3ENSB 2F91A 3SO3A 2HRVA 3BTDE 4AFQA 3M5NA 1W0JD 4SGBE 3MQKC 2B5TB 1BTPA 1H9LB 1NRQH 1YPKH 2CF9H 2J92A 1JXPA 1UTJA 2JDID 1GI9B 2FOMB 2HPPH 2P16A 2XBVA 2AERH 2ZO3H 3U9AH 3KYGA 3BTEE 3URCA 5TJXA 5EU8A 4AG1A 1IAUA 4M9FA 2BDHA 3N7DA 3STJA 1E1QD 5C20A 1NU9A 4TWWA 1EAWA 1HJAB 2FI4E 1NESE 1H8IH 4Y0YE 2WZQA 3OX7U 8KME2 1ZJKA 2SNVA 2GT7A 2DUCA 4FUCA 1OPHB 2G5VA 1HIAB 1UTOA 4X8VH 3PRDA 3GY3A 3Q3XA 1PPFE 2XBYA 2KCOA 1A5HA 4TY6A 2AGIX 2Y81A 3UQOA 1BJVA 4YTAA 1P09A 1LVOA 1SQRA 4INKA 4NA9H 4WH6A 3SU2A 4A5TS 2D8WA 3A8DA 4I32A 1Y5AT 1S0QA 3PTNA 4BTIB 2KCPA 3A81A 1WTGH 1JRSA 1KY9A 1HXEH 1XX9A 1C1MA 3RU4D 3SV7A 3K6ZA 4F48B 1T4VH 1A0JA 3N99A 3VPKA 2SGAA 4JYVH 1SLXB 1O2HA 3M3TA 1O2GH 1GMCF 1CGJE 1O35A 2QF4A 1Y3YA 4A1TA 1GCTC 4O97A 2I6SA 4AB8A 1VITG 1YPJH 3S9AA 1KDQB 3B9FH 5A0AE 1QCPA 5JDUB 1GJAB 2HOBA 2V3MA 3V13A 1CHGA 2L74A 2VNTA 4YLQH 5DP3A 4ACBA 4AX9H 5LPRA 1SPJA 2G81E 1UTPA 1C5SA 3SUFA 1GVLA 1ZTJA 1FY4A 2A1DB 1UCYE 1O3BA 3SHCH 3SJ9A 1LQEA 1C9TA 2ZU4A 1DITH 2FP7B 2FWWA 3A8BA 3MH6A 1O32A 4K8BA 2Y5FA 4I7YH 4RKJB 1GI5A 3A8CA 2G5NA 2R2WU 2CHAB 1TBZH 4I31A 3U8OH 2YMSB 1FV9A 2BX4A 4AG2A 2KM0A 4KKDA 4UFGH 3UY9A 2ZHWH 2ZU3A 2V6NA 2ODYB 1RTFB 2V35A 2BVXH 4X0WU 2J98A 2BD9A 5C94A 5DP9A 2OD3B 1XM1A 1C1VH 1DVAH 3D23A 1C5OH 2GVFA 1J15A 2J5UA 1ELBA 3DA9B 1AD8H 4XFQA 1DY9A 2A0QB 3BEFB 1HUTH 4U01A 1ZJDA 1GBCA 2IJD1 1QL8A 1F0TA 1CT2E 3IG6B 5ETXA 4Q4LA 1JIRA 2QAAA 1TGSZ 3E3TA 1GHZA 1C2IA 1QA7A 2ZFTA 3SU1A 1C1NA 5DPAA 4DT7B 1V2LT 1THPB 2QF0A 3PRBA 1C4U2 1DT2A 1W0YH 3RUOA 4K3JA 3LGWA 2IPQX 3R0FA 1O2WA 1RTLA 2H5CA 3SUGA 1TGBA 1VCPA 3A87A 3U98H 4Q7XA 1ZR0A 4GPGA 4ZKRU 1COWD 4AORA 1IHTH 1G3DA 2THFB 4FUFA 4ZHLU 3OYPA 1HB0B 1IQMA 1WAYB 2F83A 1TWXB 2C93B 1D3TB 4LZ1H 5L6NH 3SBKA 3BTKE 1HXFH 1W7GH 2XRCA 3RXOA 1C2MA 5DP6A 1QIXB 1QJ7B 1EB2A 4A92A 1W11U 2WYGA 4GVUA 4LZ4B 2ZQ2A 1V2KT 2ZDAH 5A0BA 3LJOA 1THSH 1W0ZU 2XCFA 3FN8A 3PWBA 3P8OA 1O3DA 4AYVB 4ABJA 1S6FA 1F0SA 1GBFA 3P8GA 1Q3XA 4KP0A 2VH0A 3F0PA 1TNGA 2KCYA 1ZMLA 3TVJB 5GWZA 4IGDA 5FPTA 1EUFA 2H1UA 2EC9H 5A8YA 4FVDA 2FIRH 3VB5A 1F92A 5CHAC 2GDDA 2P93A 4Z1MD 1KXDA 2EQNA 3MU4A 2ZDVH 2YMSC 2WSSD 1AY6H 1GHXH 1RIWC 2J98B 3SQEE 4A1VA 1ABIH 1LPZB 2Y6TA 3LGVA 1KXFA 1C5PA 2P59A 4CH2B 4BTTB 2QCYA 1VITH 6CHAB 2C3SA 7ESTE 5C1UA 3BTQE 2GCTC 4ISLA 3O8BA 5JB9S 2ZHQH 1SVPA 1CVWH 2ANWA 2KCAA 1MBMA 2VVCA 3QGJA 2VIPA 2WPHS 2Z94A 3UIRA 1P8VC 4YM9A 2XC5A 3PMHB 5FAHA 1OWKA 1H9HE 2ZDMA 3LT3A 4HTCH 3RXHA 1K2I1 2ZIQH 1CHOG 2BVRH 3GCHB 1J17T 3WWFA 5EW1H 3E0PB 2QXJA 3WW7A 1HLTH 2AYWA 2TBSA 1MU6B 2BQ7B 3BTTE 4LOYH 5J4QA 2I6QA 2Y7ZA 1Z8RA 2BZ6H 3F9GA 4NFEA 2O8TA 4JZIA 5HKKD 1BTWA 1GVKB 3T29A 2C8XB 3AAVA 1HAIH 4AGKA 4K1SA 4MPVA 2JH5D 4I8KA 4IN1A 3BSQA 1TABE 1ZSKA 4WJG2 1ETSH 4MPWA 3MH5A 1UJ1A 1FAXA 4AOQA 1YPHC 3ODDA 3PO1B 1A2CH 2ZI2H 1ZPBA 1K9OE 3W95A 3GY7A 3RXPA 2C8ZB 2UUKB 5LPEA 1V2MT 1P3CA 3M35A 3VFEA 4FUDA 2XNDD 1T32A 5FCKA 1SBWA 2PTCE 2ZFSA 3VGCC 5DP8A 3HKIB 2W26A 2GP9B 4TPYA 4CRGA 2V0BA 3VB7A 1OHHD 3MHWU 1BA8B 1UVTH 3KN2A 3UTUH 2FI3E 1TX8A 4K69A 3BN9A 7KMEH 3UOPA 4ABBA 3P8FA 3RXVA 3AVZA 1TNHA 1GMHF 3T5FH 4E7RG 1KXCA 1C1UH 3GDUA 3ITIA 3K2UA 3FP7E 1GHVH 2ZA5A 1GBIA 1UTNA 2WPJS 1D6WA 3A86A 1ELAA 1ELGA 2PKAA 6CHAC 3TNSA 3O8RA 1GMDG 2QF5A 3ZVBA 3M7TA 4H6TA 1DSUA 1AIXH 1OWJA 2ANKH 1E35B 3U28C 2Q6DA 1NFYA 5E0GA 4DW2U 1HPGA 2VWLA 2BY5X 3RMOH 1J16A 1QB9A 5HIZA 1BTYA 1GBEA 1FY1A 4RN6A 1WDIA 3SV9A 4F55A 3SNDA 1IQKA 3BEUA 2BD2A 4MQAA 3GCHC 2FLBH 2PP6A 1HAHH 5T1VA 1GI6A 1G36A 2CJIA 1PQ7A 2HLCA 5F8TA 2OLGA 3SHAH 1SGTA 1TA6A 1TMTH 3RXTA 3GISB 4X1RU 3HKJB 2AMDA 3H5CB 1MTNB 2XC0A 4GHQA 1Y3XA 2BM2A 2W7UA 5GNDA 1YGCH 1HRTH 1O2XA 1SOTA 1O2SA 1ZOMA 5EXMA 2JKHA 2ZGXH 1SL3A 3I77A 5J4SA 2KZ4A 4Y10E 3QDZB 1W10U 3PO1C 3UB0A 1GGDC 5FPYA 3O8CA 2FOAA 2W6ID 3DFLA 2A4QA 1JWTA 2ESTE 1ZMJA 2UUJB 3PLBA 2A7CA 1MTSA 1S0RA 2PSYA 3RXJA 1NO9H 1LCYA 3A82A 1QHRB 1TFXA 1O5DH 3B23B 2FMJA 4YLUA 4ABHA 4MVNA 4Z6AH 3E1XB 2VIWA 3T2NA 2FPZA 1CT4E 1FQ3A 1GI7B 2ZFRH 1QQUA 2HPQH 1SGEE 4YOGA 1GJ4H 1PPGE 1AKSA 2FYRA 2B7DH 2OP9A 5TCCA 5EGMA 1S6LA 3SUDA 3DHKH 5G4BA 1JIMA 1THRH 3ZZ5A 4AN7A 4CHAC 1XUJA 3LH3A 2B9LA 4Y8YA 1QZ8A 2PKAB 1WSSH 4BAKB 2BZAA 1BJUA 2VVVA 1MCTA 3SNEA 8LPRA 3HGPA 2XCNA 2R2MB 1Z7KA 1QRZA 3GCTG 3KNXA 4AC9A 1UVPA 5DP4A 1GG6B 3A8AA 5F53A 1K28D 4OS6A 5JBBS 2FODA 4Q7ZA 2FI5E 1T7CA 3MNCA 1LDTT
chains in the Genus database with same CATH topology
3RXFA 4D9RA 1TALA 4FUEA 1V2TT 3A88A 1L2EA 2JH6D 3ZZ6A 1F0UA 4ABEA 3SGBE 5AF9H 1EOJA 2FESH 1BRBE 3A7VA 4HGCA 4XE4A 1GL1A 2EEKA 4B73A 2F9BH 4JMYA 6GCHG 3IITA 1O2OA 2GZ8A 1LO6A 3SI4H 1C5WB 4ZXXH 1LTOA 1PQ8A 3ZVFA 4B75A 3QLPH 4OS4A 2ZNKH 1IQIA 4FUIA 7LPRA 2Y80A 2AIQA 5E0HA 3D65E 1C5QA 1V2PT 4E06H 1D6RA 1GHBF 5JBTA 1XKAC 1MTUA 2BOKA 3L6PA 5F03A 2A31A 1UVSH 1SGFA 2BLQA 4CRAA 2UWLA 3F9FA 1O5CB 1FNIA 2FS9A 1GJ5H 1DANH 2WPLS 1FMGA 4FUJA 2Z3EA 2P3TB 2BY7X 1GI8B 1L0ZA 5HGGA 3VEQB 3UOUA 1OOKB 1YLDA 2BD7A 3M5MA 3ZV8A 3P70B 3MO9A 4ABDA 2OTVA 3LPRA 4NA7A 1OYTH 1DY8A 1UVUH 3NPSA 3ZZAA 1WCZA 2FTLE 2P3UB 1E37B 3GY5A 4GAWA 1A7SA 2IOTA 4YOJA 2ZWLH 1GJDB 2FXRA 1HAZB 1MAYA 2TGAA 4XBDA 3ATKA 3UWIA 1LVMA 4TY7A 2IPHA 4MNXA 1YP9A 3GCOA 3ODFA 1GG6C 2W3IA 2AEIH 3A7WA 2ZFQH 1W12U 1EAXA 2Q6GA 1GJCB 1W2KH 2FOFA 4ZXYH 2QY0B 5EXNA 3SOSA 2PFEA 2BHGA 1O2MA 1O2YA 2OQUA 1UTKA 3MI4A 1GHAF 3HATH 3A83A 1UTMA 1YM0A 2F9UA 2Y7XA 3TNTA 4DGJA 2ZTXA 2AGEX 1QJ1B 5T6GA 2OC1A 4XBCA 2CF8H 2R0KA 3RXIA 1GHYH 3MNSA 3NWUA 2K1QA 3ZYDA 3MNBA 5A8ZA 4CRBA 8GCHF 1O31A 1WBGB 1A5IA 1MU8B 1AHTH 1BHXB 4UFFH 2HNTC 3TJUA 4XDEA 1GBJA 1OWIA 3P6ZB 2J34A 3T28A 2BX3A 1SGRE 2Z9IA 1KXAA 3GY2A 1K22H 1A3BH 3JZ1B 1O39A 1OWEA 3RLWH 1O2UA 1DWEH 1FY5A 2ZCLP 3QO6A 2JH0D 1H1BA 5GIBA 2AFQB 2FX6A 3OU0A 4IS5A 1UCYK 1AI8H 1NPMA 3QUMP 5EW2H 2XYAA 3U1JB 1QJ6B 1SGNE 3RXCA 2P95A 5F6MA 2V3HH 1TOCB 3ATWA 3LIWA 2D1JA 1EPTA 3BTGE 2SNWA 1DPOA 1MBQA 4ESTE 4Y11E 1CQQA 1O33A 2O8UA 5AVDA 5CE1A 2ILNA 3LU9B 1D3DB 1UK3A 1BTHH 1O2ZA 1QL9A 1FJSA 1F5LA 4YESB 4AYYB 2BB4A 1DUAA 2TIOA 4X6PA 1AMHA 4GCHG 3S7HB 5DP7A 3Q00A 2FM2A 5FCRA 1ID5H 3EDXB 5K7RA 2PLXA 4BXWA 2A5KA 3RXMA 1P11E 1O3LA 2Z9KA 2Y5HA 3AW0A 1C1SA 1EZSC 4SGAE 1E0FD 2ZP0H 2LIZA 3ATLA 1E38B 3MWIU 3RXEA 1BIOA 4JYUH 3LGIA 1C5YB 4Y71A 1HAYB 1Q31A 5FHTA 3TU7H 3Q77A 3SU4A 1BRAA 3ZYEA 1G2LA 2WPMS 3LC5A 1H4WA 3A7XA 4NWKA 1Z71A 4J2YB 2H9TH 2PV9B 3QZQA 1BRCE 4TPIZ 2BLOA 1TPPA 1OP0A 5CHAB 1GCDA 4ABAA 2W5EA 1P05A 1FONA 1YBWA 2STAE 2OC7A 3P95A 2Y82A 3SU3A 4BAQB 3ATMA 1T31A 1NRPH 1FIWA 1RIWB 5EG4A 2FOBA 4HZHA 4YT6H 4B2AA 1SGFG 3S9BA 2GCTB 3CENA 3KF2A 4UONA 1SQTA 1QURH 1CA0B 4AFUA 1ZMNA 1WQSA 1F2SE 2ULLA 5DJ7A 1EJAA 1AUTC 1FDPA 1AZ8A 1EPTB 2ZHDA 3MMGA 1HJ8A 4H6SB 5F8ZA 1V2RT 3EAJA 2ZECA 2C90B 4Y79A 1Z8GA 1PPBH 1LHFH 3TIUA 4I8HA 2ZC9H 4UFEH 1V2OT 1PPCE 5T6DA 1OS8A 1S5SA 3F1SB 3H7OA 3N7OA 3MU0A 2Z3CA 3BG4C 2M5TA 1GMCG 1S84A 4D8NA 1EXFA 3RP2A 1V2QT 2H6MA 2GV7A 4ZROA 1O36A 5F8XA 3RMNH 4ZUHA 1CHOF 1YKTA 4X8SH 3O8DA 3T26A 5AHGH 1C2HA 4OS7A 1MCVA 1MMJN 5DK1A 1G3EA 4R8TB 3E16B 2LNCA 3EGKH 5C1XA 1A61H 1O3FA 1VJAU 1AE8H 1IQNA 4FU8A 5ESBA 3VGCB 3DUXH 1O0DH 2QXIA 4X6NA 1BMAA 3KGPA 3DFJA 1GJBB 3K65B 2VU8E 4B71A 2GZ9A 3RXUA 4BAOB 1QBNA 3IWMA 5JYIA 3UNSA 1HAVA 2FZZA 1VZQH 2SGPE 3ZZ7A 5GCHF 1BCUH 3GY4A 2LPRA 2F9VA 3P92A 1O3GA 1O5AB 4X8TH 5TCAA 3VB6A 4FXGH 3MFJA 2O8WA 4H42U 1ZHMA 4IC6A 1CU1A 3RXBA 1LPKB 5E2PA 4RSPA 2VJ1A 1ZPZA 2HALA 1QFKH 4AFZA 1IQHA 1CA0C 3LONA 2GDEH 3EE0B 1P2MA 2BLVA 1QBVH 1C5LH 2AMPA 2F3CE 1AU8A 2ZU1A 4MTBA 1FN8A 2ZFFH 2RA3A 1EPTC 1SHYA 4NIVA 1LVBA 4KGAA 3EA9A 1KXBA 1CE5A 1FLEE 1NFUA 1K1OA 2CGAA 2VGCB 1CT0E 1O37A 4NSYA 5HXFA 1BMLA 2GD4B 1V3XA 2GCHF 2OQ5A 2WPKS 1QB1A 5E2OA 2D2DA 1F0RA 3SW2B 3AAUA 2NU2E 1J14A 1CA8B 4MG3A 5GJ4B 4WMDA 1ANEA 1DXWA 1OWDA 1GMDF 3RU4T 4U2WA 3GCNA 1C2EA 1TIOA 3SGQE 3D49H 3R3GB 7GCHF 4WY3A 1BTXA 1PPZA 5A8XA 2PHBA 1C1RA 3GDSA 5GDSH 2RG3A 2G55A 1C2DA 1GGDB 1KTSB 4WF8A 2WINI 1G2MA 1O2TA 4XBBA 2A4GA 1DUEA 2R3YA 4NZQA 3PMAB 8ESTE 5LPFA 4Q7YA 1FXYA 1O2PA 3TJOA 1FIZA 2ODPA 1GDNA 1K1IA 1YYY1 9ESTA 1MZAA 3QZRA 5L2YH 4X1QU 1HDTH 1MKXH 2H2ZA 1AFEH 3FANA 1VJ9U 1Z1JA 3RU4E 1GHWH 4OS1A 1C5VA 1F7ZA 2PGBB 1CGHA 3PMBB 4ZKOU 4KELA 2Z9GA 3PWCA 1GJ8B 1RGQA 2A5IA 1QTFA 1INCA 1G37A 4I8LA 2VIOA 3GYMA 1ZRBA 4NIWA 1UTLM 1TMUH 5C67A 1AWFH 4CHAB 2ZQ1A 3MH4A 4F4OC 2RA0A 4FVBA 3KHVA 1S81A 2JETB 1B5GH 1FUJA 3BTHE 2TRMA 1MKXK 1NT1A 3VB3A 4IMQA 1C5XB 3C1KA 3PLPA 5HM2A 1D4PB 1XUFA 4NSVA 1MZDA 1KTTB 1W8BH 4TYDA 1L1JA 2ZEBA 4UEHH 4GUXA 2Z6BD 3D62A 5C1YA 3E90B 1EZXC 4Y7AA 3BF6H 1P2JA 1TBQH 1AB9B 4WVPE 3BG8A 2BY6X 2QYIA 3GICB 3BTME 2BD8A 1SGQE 1H9IE 1O3HA 5JB8S 2EI8A 1NZQH 4H4FA 1W3CA 2CV3A 3W94A 2ZPSA 4B2BA 5IDKA 1QRWA 2VGCC 4K60A 4YO9A 1ELVA 1TRYA 2XXLA 3QGNB 1MUEB 3SQHE 1XXFA 1ELTA 2GV6A 4ASHA 3MO6A 1L4DA 1ZPCA 5A09A 1O2LA 1OSSA 1SHHB 4MDSA 2BDYA 2J2UA 3ZZCA 3S9CA 1Y5BT 2BD5A 1P03A 4YOIA 3TK6A 2WV5A 1TMBH 4B76A 1GBKA 1BRUP 2OBOA 1V2VT 1WV7H 4X1PU 2ANMH 3OY5U 1MQ5A 1T8NA 1N6XA 1QA0A 3SJOA 3UPEA 1QB6A 5E0JA 1VR1H 1ZHRA 4ZHAA 3MU1A 4HFPB 1TGNA 1LVYA 3KQDA 4B2CA 1DE7H 1XUKA 2D26C 1TPOA 1XMNB 1MKWH 1O3IA 4ZAEA 1BUIA 1ANCA 2TGPZ 3M37A 3SNCA 1GMHG 1JRTA 1TGTA 2BDAA 4K1TA 1P2OA 2QN5T 4VGCB 1GI2A 1GJ9B 2ZZUH 3TK9A 2XBWA 1Y8TA 3EQ0H 1CSOE 3LGYA 4Q80A 5A2MH 1P10A 4CRDA 1SGDE 1G3BA 4ZKSU 1IQLA 1GI0A 1SGCA 3SJ8A 1BBRE 2HVXA 1O2NA 4J1YA 4MLFB 4ZMAH 2JETC 1GBTA 3MU5A 1EP5A 4Y7BA 1MKWK 3FP8E 4ZH8A 1W13U 3NXPA 1DLEA 3QTOH 1FAKH 4A7IB 4A1XA 2B0FA 2OC0A 2H9EH 2C8WB 5LH8A 4BAMB 2ZKSA 1ZYOA 1LHEH 2FDAA 3F6UH 3ZVDA 1RXPA 1AB9C 1W7XH 3Q3YA 1C5RA 3ZVAA 4K8YA 4JK5A 3RM0H 1O30A 3SU6A 1NRSH 1UHBA 3VXEH 1O38A 1K21H 1DM4B 1DWBH 1S83A 2PR3A 5C5OA 3LH1A 5EPNA 3S0NA 4MNVA 1TRMA 1SFIA 5I46H 2BDBA 3Q76A 1O3KA 2G4TA 3I78A 1SGYE 1Y3UA 1T8OA 1XUHA 2ZDNA 4D9QA 2AGGX 3TK5A 1GL0E 1KXEA 2A45B 1DDJA 3KEEA 1RFNA 1AO5A 1D3PB 1MAXA 1O2JA 1UO6A 3RXKA 2H5DA 2QA9E 1BMNH 1SLWB 3RC6A 3WY8A 1C2KA 2ALVA 2R9PA 1TQ0B 4O3UA 1V2UT 1V2ST 1Q2WA 1P12E 4CBNA 1O3NA 4BNRA 2K7XA 1A46H 3L3TA 3BIUH 2GMTB 5EQRA 2PUQH 1ESTA 1A0LA 1TPAE 2XC4A 1HAOH 3ZZ9A 2EA3A 1AKSB 3TPIZ 1P2IA 1UTQA 1Z8JB 1ORFA 1H8DH 3MU8A 4KTUA 4VGCC 2AH4X 1EQ9A 5C3NA 1ARCA 2NWNA 1C5NH 4F49A 3UFAA 3ZZ3A 1BB0B 2UUFB 3OY6U 1AVXA 3E91A 1QGFA 1YPEH 2HNTF 3RXAA 1P01A 3PTBA 1WQVH 5EQSA 3UREA 4Y76A 1DWDH 3M7QA 1AFQC 2VB0A 4JK6A 3MYWA 1UMAH 1YPHE 2FOEA 1HIAA 2BD4A 3A84A 1A5GH 1O3CA 2PW8H 1C1WH 5BPEA 3NK8A 4B74A 2SGFE 2BMGB 1XXDA 1EAIA 1HBTH 1DXPA 1S6HA 1NRNH 2ZU5A 1IQGA 1HYLA 1RS0A 2G51A 3BIVH 3HK6B 1O2VA 3OSYA 1WUNH 5FXLA 4DY7B 4BXSA 1ZTLA 1Y5UT 3VXFH 5C2ZA 4IW4E 1YCPM 4NCYA 3RMMH 1TNJA 1KSNA 5DP5A 2RDLA 1O2KA 3ATIA 1V2WT 2BDGA 1C1QA 1EKBB 2A2XH 2R3UA 1ZGVA 4M7GA 1MD7A 1SGPE 2TGDA 4CR5A 2ZPRA 4ISNA 3AW1A 1C1OA 1ELDE 2TGTA 1D3QB 1WTHD 1UCYH 4PROA 3A7YA 1C1PA 2VIQA 1GHBG 1C5MD 2AMQA 1W14U 1O3OA 4BOHA 3A80A 1KLIH 5EQQA 3A7TA 1KDQA 3ZV9A 1AUJA 1LKAA 1QR3E 2SGEE 2A5AA 3P8NA 5JBAS 1TONA 1YLCA 1VITF 1VCWA 1EAUA 1N1LA 3CS0A 1TE0A 1QRXA 1PYTC 3MO3A 3EA7A 2GMTC 2C8YB 1O3EA 3NZIA 1GDUA 1N6YA 2O9QA 2ZF0H 2Z3DA 3ZZDA 1O2IA 1EZUC 2TPIZ 3GDVA 1AWHB 1ELEE 1C2LA 1DICA 1O3MA 1EX3A 2BYAX 2W7SA 4U32A 1AVWA 5L2ZH 4WMEA 4JYTA 2FX4A 1SI5H 3M61U 3FAOA 1PYTD 3RXDA 3T27A 2KAIA 1BHXF 2GZ7A 2OCVB 3M5LA 3SV8A 3BG4B 2CMYA 3ELAH 1DX5M 1GJ7B 1RTKA 1GBAA 5LGOA 1CO7E 2ZGCA 1LQDB 3P17H 5C5NA 2F9PA 1EOLA 2GKVE 4JZEH 1QL7A 2C4FH 1FZZA 4TWYA 3S7KB 3M3SA 4X6MA 4A6LA 4XOJA 1BTUA 5HYOA 1ESBA 1GHAG 1TRNA 1WU1A 4UDWH 1AQ7A 1LHGH 1YCPH 2PTNA 3RM2H 4CBOA 1PPEE 2VVUA 4X1NU 5I25A 2P8OB 1KLTA 2PUXB 2NU0E 3EBNA 1E34B 3FZDA 1NRRH 1HAPH 1MTWA 5FX5A 8GCHG 3BTFE 4NFFA 2ZGHA 2XW9A 1ZSJA 4FUHA 4NIYA 4X2VA 1IOEA 3QN7A 1HCGA 1Z6JH 1C2JA 3MH7A 1YCPK 2PWXA 2EI7A 1NY22 1P04A 3NKKA 3U1IB 3RDZA 1V6DA 3V0XA 1EZQA 2BOHB 1GBBA 1Z8IB 2J95A 1OXGA 3SORA 3SI3H 3F68H 4ABFA 1TNKA 3ZZ8A 3RLYH 1EJMA 3SN8A 4MPXA 4IC5A 4DVAU 1A4WH 2IN2A 2O8LA 2ZPQA 2R0LA 5SGAE 1QBOA 1DOJA 2Q1JA 1P02A 2STBE 3TLOA 3KIDU 1VCQA 3RXGA 2G8TA 2ZCKP 1SQOA 1SB1H 3GY6A 4OGXA 4OS5A 2KAIB 4NZLA 1RRKA 3E8LA 3TH4H 1HJAC 3TH2H 1MH0A 4OGYA 1GPZA 1TOMH 5HM9A 4DURA 1X7AC 1BZXE 4O03A 1GWAA 3TGKE 2XTTB 2BXTH 1SQAA 1XVOA 2Q6FA 4U30A 1ANDA 3TGJE 1GI4A 1HAGE 1SG8B 1L4ZA 5DGJA 3HPTB 3PMJA 4FUGA 4JZFH 4YT7H 4AGJA 2BY8X 1EASA 1ZLRA 2EI6A 3STIA 1IQFA 2XNIA 2CN0H 2VINA 2SGQE 1LHCH 2VIDA