4HI3A

Crystal structure of dimeric r298a mutant of sars coronavirus main protease
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
300
structure length
300
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVAQC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 3C-like proteinase
publication title Mechanism for controlling the monomer-dimer conversion of SARS coronavirus main protease.
pubmed doi rcsb
source organism Sars coronavirus
total genus 82
structure length 300
sequence length 300
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2012-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 4hi3A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4hi3A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4hi3A02
1W0YH 3MH4A 2VVUA 1GMDF 3V3MA 5GJ4B 3FFGA 1DLKB 1GCDA 1MKXK 2ZCHP 1HAOH 2Z3CA 1TMTH 2D8WA 1GI0A 1C1TA 4MNXA 1O2LA 1A0JA 2ZGCA 1UTKA 1UTQA 2P3UB 1HXFH 3PWBA 2NU0E 2GV7A 1IQMA 3HATH 1V2VT 1NT1A 1TGTA 1J9CH 1W3CA 2VH6A 3A8CA 1KXCA 1N6XA 4NIXA 2Z94A 2FO9A 2P16A 1TQ7B 2GVFA 3ZVFA 1H9LB 3PTBA 1YPLH 4E7NA 1FNIA 1YPGH 1WQVH 2WPMS 4AX9H 1J15A 1JXPA 3A7XA 3KQEA 2RA3A 1DSUA 1H4WA 1W14U 3QTOH 4GSOA 3SO3A 1ANDA 1ANEA 1TPSA 2F9UA 4K8YA 3O8RA 2B7DH 1P09A 1YLDA 3BTTE 2WYGA 2C90B 5T6DA 4O3TA 3MU4A 2BHGA 3SV7A 1G3BA 4CRCA 4AGKA 1UO6A 1GCTC 3RMOH 2A4OA 4ZKSU 1GHVH 5E0HA 2GCHF 2ZDKA 4OS5A 3BTME 1AI8H 3DUXH 1L0ZA 3A7YA 4THNH 3SQHE 4WH8A 3U8OH 3N7OA 4AYVB 1C2MA 2C8ZB 1O2SA 1BOQA 1HIAB 1TRNA 3A7ZA 5DK1A 2GTBA 1ELDE 1MH0A 1Z6EA 1XUFA 2PGQB 2JETC 3EYDA 3P6ZB 2P3FH 3PLBA 1OWIA 1EATA 2ZDNA 4RN6A 3GDSA 4NIYA 1Z71A 3SV2H 4UE7H 2PKSB 1GHYH 5E2PA 1MMJN 2G5NA 2VIQA 1D6RA 9ESTA 4NFEA 3I78A 1W12U 5A0BA 3GY6A 1SGDE 1FMGA 5F8XA 1NRPH 2A1DB 1W7XH 1OX1A 3SU5A 1A0HB 3SNDA 3OU0A 1P2OA 3RDZA 1RGQA 1O5BB 4A7IB 3TJNA 2BD4A 2GDDA 1HDTH 4UFDH 1EXFA 1DITH 2VNTA 5GDSH 2ZEBA 2PGBB 2TRMA 1PFXC 4U2WA 3RXAA 1RTKA 5LPFA 2A2XH 1LQEA 3VB5A 3JZ2B 3NK8A 1WCZA 3VB4A 4GUXA 1O37A 1Y5UT 3U69H 3UREA 1E37B 2W7UA 4FUIA 3PV4A 1LHFH 5AF9H 4E06H 3SNEA 1P03A 2FTMA 1YPJH 4DY7B 2Q6FA 5L6NH 3M3SA 1GJCB 2C4FH 3A7VA 1EP5A 1TNGA 1O3FA 2VJ1A 2BTCE 5JB9S 2AMQA 3OY5U 1IQHA 1HFDA 1NFWA 3ZVBA 1W7GH 1THSH 2BD9A 2CN0H 2GX4A 4LZ4B 2PSYA 1SGEE 4ABEA 2FWWA 4KELA 2WV4A 2V6NA 1V6DA 3LGTA 3TVJB 2FS9A 3TJVA 2HNTC 2HNTE 2ANMH 1BUIA 4NSVA 3RXQA 1P3CA 1TOCB 2ZTXA 1TALA 1O3LA 4X2XA 1GI7B 1AN1E 1BQYA 5EW2H 1MTSA 1PPFE 3RC6A 1GG6B 4WXIA 1O3CA 5A2MH 1CT2E 1NC6A 1YKTA 1QQUA 1CHOF 2H9EH 3GOVB 4MTBA 3O8CA 1P2NA 1NM6A 4IMQA 4IBLH 1LVYA 1CA0C 3ZVGA 4AB8A 1FV9A 1Y3YA 2YNBA 1O2OA 3A7WA 4K3JA 3UUZA 2H2ZA 5AFZH 1LKAA 2BDYA 1PPHE 1A1RA 2UUJB 1O3OA 3O8BA 5A0AE 3ITIA 2VWMA 4JZIA 3RC5A 3T27A 2OQUA 4BTTB 1P57B 1TNIA 1O30A 1GI6A 3DA9B 2V0BA 4FUGA 3PLPA 1MBMA 2SGQE 2ESTE 3M5OA 1FI8A 1FN8A 3UOUA 4AFZA 5LGOA 1EPTB 2QAAA 2DUCA 1MUEB 4K2YA 1RTFB 1O39A 1QJ7B 2BX4A 4B75A 5EQRA 3BTGE 2SFAA 3RC4A 4I31A 1CVWH 1OP8A 3GY3A 2ZFRH 1SQAA 1Y3UA 1JIMA 1C5NH 4A5TS 3ZZAA 1HCGA 3AVZA 1O3IA 3FP6E 3IWMA 1GBJA 1V3XA 2F9NA 1FIWA 2J38A 4ABFA 2VGCC 4BXSA 4MDSA 2P94A 2AMDA 1TRMA 1P8VC 2WV5A 4FUDA 3HPTB 1SBWA 4TPIZ 4TWWA 1BMMH 1XUIA 3LH1A 1UTMA 4CR5A 4R0IA 1S0RA 3VB3A 2J4IA 1DY8A 1GMCF 4Y79A 2NU1E 1Z1IA 2UWOA 3RXSA 2BQ6B 2ZC9H 1D6WA 4NA7A 3RMMH 1DUAA 3PTNA 4NGAH 1O2HA 1EB1H 2GP9B 1ETRH 3A84A 2AFQB 4UONA 3O8DA 1O3GA 1HGTH 4GPGA 1RD3B 4JZFH 2QYIA 5ESBA 2XWBI 2JH6D 4X1QU 1V2UT 4LOYH 5H4IB 1TOMH 4BAHB 1CBWC 2R2WU 3KGPA 3RLYH 3RM2H 1C5TA 4BAQB 2WUBA 1MD7A 1K2I1 1O5DH 2ZECA 2FP7B 2G51A 3C1KA 6CHAC 5JBCS 1NRRH 3FAOA 3ZZ3A 1SGTA 5FPSA 1GJ5H 1UVOA 2BZ6H 4MG3A 4JCNA 1AWFH 3KQCA 8KME2 1CA8B 2FOGA 4D7GA 1B5GH 2ZFQH 1G36A 1XUJA 1WAYB 4UFFH 5EXLA 1O2NA 4D8NA 1VITG 3M7QA 1P12E 3MO6A 4KKDA 2J95A 1BB0B 4FUCA 4I8GA 2F3CE 2ZF0H 1MCTA 4K8BA 1GL1A 2R3UA 1BDAA 4OGYA 1KLIH 4UD9H 4YZUA 2Y5FA 5JBAS 2ZU5A 1DLEA 3SN8A 1MBQA 2VIOA 3SU1A 1QQ4A 4OS4A 2PHBA 4ZHLU 2J94A 3QGNB 3SUEA 4HGCA 4BAMB 1TNJA 4OS6A 2BOKA 1C5YB 1C5ZB 3UR9A 2TGTA 2ZGHA 1SMFE 4X1PU 1V2PT 1O2WA 4MLFB 3GYMA 2ZU3A 2CGAA 4YESB 2OD3B 4ZKOU 1ELCA 1TFXA 5FCRA 2JH0D 3BSQA 2ZWLH 1OWHA 2BXTH 4X6NA 1TGNA 2FTLE 1OS8A 4E7RG 1TABE 5E0GA 2NU3E 8LPRA 1ZJKA 3U9AH 3P8OA 3ZVDA 5EQSA 2XCNA 1EASA 1NROH 3ZV8A 4BANB 2A31A 1ESAA 1O3EA 2XWAA 2Y5HA 8GCHF 5DP4A 1YCPH 1BMNH 2Y82A 4IC5A 4MNWA 3STJA 1HJAB 3LJOA 1P01A 4INKA 3M5MA 5L2YH 2GDEH 1GBCA 2SGPE 3SGQE 2H6MA 2CHAC 4BNRA 3A7TA 2KAIA 1ZYOA 5C5OA 3LONA 1O3JA 2UUKB 5C1YA 2ASUB 3TK9A 1BJUA 3SUFA 2ALVA 2BXUH 4I8HA 3B8JA 2GZ7A 2WPIS 1EAIA 1QL7A 3UPEA 5GCHF 2OC8A 4Y10E 2QGRA 3OX7U 1NU9A 4CHAC 1UCYE 4MQAA 3LPRA 4Y7AA 5EQQA 1HAXB 2FOHA 2NWNA 4YOJA 1FY8E 3I29A 2VU8E 3SU6A 4I32A 1DFPA 1A7SA 1W0ZU 3T29A 1QCPA 4WJG2 1OKXA 5EPNA 3P8NA 1SSXA 4FXGH 5C3NA 2W5EA 1E36B 4YTAA 1NY22 2FDAA 5T6FA 3TJUA 2WUCA 2BD8A 3SV6A 1LKBA 2O8MA 1L1NA 1MTUA 2WPLS 4X8VH 2QXJA 4NA9H 3UIRA 3A80A 2GCTB 2F9VA 1TX8A 1IQJA 3HK3B 4X6PA 3BTQE 2IN2A 1F5KU 4CRFA 1XUKA 4AFUA 1GPZA 1O5FH 1D3PB 1WTHD 1AU8A 4IN1A 5EXMA 1HBTH 5EGMA 1TBQH 1TNLA 4IC6A 1DWCH 1UMAH 2OC1A 1ACBE 1FPHH 2PR3A 4VGCB 1E35B 1P2QA 2W26A 1T31A 2OC7A 1PYTD 3PROA 7GCHF 4H6SB 2ZG0H 1HYLA 3NWUA 1J8AA 2RCEA 4I8LA 4MNYA 2VIWA 1S85A 1LHGH 3RXTA 1G3CA 3H7TA 2BD3A 3BTHE 1CT0E 1F0SA 1SGFG 1HAZB 4A1XA 1C9PA 3LH3A 2ZDAH 4A6LA 1ZZZA 1UK3A 1ZPCA 5C20A 3RXDA 3P92A 3Q00A 1IOEA 1XVOA 4X6OA 3GY5A 1LO6A 1ZSJA 3GISB 1DT2A 3F1SB 1FUJA 2FLBH 3AAUA 1WV7H 1ESBA 2AEIH 1FY3A 1H9HE 4ISHH 4X0WU 2QA9E 4JYTA 4HZHA 2PWXA 5HGGA 4X1RU 2VINA 4NIWA 2WYJA 5F8TA 1VGCB 1ETSH 3AW1A 3A89A 2QIQA 2IJOB 1PPEE 1UK2A 1NRQH 3TJOA 1MAXA 2B9LA 3ZVAA 2A0QB 2OCVB 2BD2A 2BY6X 2BVRH 1AWHB 1IQIA 1KXBA 1TIOA 2BMGB 1BBRH 1OPHB 2BOHB 4MPXA 1CO7E 1SOZA 1C2HA 1ZOMA 2OP9A 5CHAC 4AN7A 2PKAA 4X2VA 3RXHA 1PQAA 1SC8U 3NKKA 1TPPA 2THFB 3VGCC 2ZKSA 2PUXB 1TWXB 1AUTC 1DWBH 1GHAG 2B5TB 1OYTH 1GMDG 2ODQA 4D9QA 1T8NA 7LPRA 1GJBB 7ESTE 2DE9A 1C2JA 2BY9X 3A87A 4ABBA 3OTJE 3MO9A 5FBIA 1BBRE 2CXVA 1XVMA 4WY3A 1CU1A 1O5EH 2FS8A 1O2XA 1H8IH 1SL3A 2OXSA 1JOUB 3T2NA 3MNXA 3BTDE 1V2ST 3RXUA 5FAHA 7KMEH 1TX7A 5DP6A 5DKMA 3EE0B 3A8BA 1BHXF 3KQDA 4Y71A 1S0QA 2DE8A 1MD8A 3KF2A 4BXWA 5ETXA 1AVWA 1C4V2 4DGJA 1IAUA 4Y76A 2VVCA 2JKHA 3L33A 4BTIB 2ZPRA 3MU5A 5EPYA 1A4WH 1LHCH 1AQ7A 1JRTA 5TCAA 1C2LA 2ZA5A 3RXMA 1O34A 3OY6U 3TK5A 3SU4A 4TY7A 2AGEX 2A5AA 2PV9B 3RXIA 3R0FA 3S69A 3FVFB 4BTUB 1FN6A 2OLGA 2QV1A 4Q7ZA 1ELBA 1GBKA 1ZTLA 2ODPA 1VCPA 1ARCA 5FBEA 3F9EA 3LGIA 1GBLA 3SU2A 3E0NB 1U6QA 1BT7A 1OYQA 1ZR0A 2ZFFH 2ZGXH 1KXFA 2GCHG 5IDKA 1NRSH 1KDQA 2ZDMA 4DJZB 1C1RA 2XYAA 4K1TA 3ZYDA 1N8OB 1O3BA 2QF3A 1XM1A 1NN6A 3ZZ6A 2BDIA 2AGGX 5DPAA 1P06A 3DHKH 2BDHA 2HVXA 1TNHA 1MTNB 1TE0A 1IQEA 2QXGA 1GDUA 1AE5A 1CE5A 1SGCA 2ZCKP 4ZXYH 1DICA 1QBNA 2Q1JA 4KTSA 4FU9A 1HAHH 1GG6C 1JBUH 1LVBA 1A3EH 1SR5C 1RIWB 4JZDH 5GIBA 2GV6A 1KY9A 4MNVA 1OSSA 4ISOA 3M3TA 4O97A 1TNKA 2KAIB 4WXVA 2VWLA 2V3OH 1P05A 1ZMNA 4B74A 3TNTA 2A4RA 3MOCA 1C2DA 4LK4A 3M61U 1O33A 4I8JA 3URDA 1P9UA 3BIVH 3RXCA 2LIZA 3B9FH 3TK6A 1SFIA 2AERH 4GCHF 2F9BH 2G8TA 2FEQH 4TY6A 1EKBB 3AW0A 4NCYA 4Y0ZE 3QGJA 2HRVA 3BTEE 2P8OB 3ZZ5A 1ZJDA 1ZSKA 1S81A 1KTSB 4ZUHA 2ZFPH 3PLKA 3SJ9A 3HK6B 3STIA 1AFEH 2Y5GA 1OWDA 2A4GA 3RXJA 2QF0A 2FOBA 1HB0B 3UY9A 1O5GH 1EPTC 4SGBE 1O2TA 4UDWH 2FYQA 4XBDA 3M5NA 1IQFA 1C5VA 1G2MA 1GVLA 1D4PB 1SVPA 1F0RA 2BDAA 2BLQA 2OBOA 2ZGJA 1QL8A 1A5HA 2A32A 1CHGA 4FUJA 3SV9A 3A88A 1P2KA 1DWDH 2GT8A 1BRBE 1WSSH 2ZPSA 3GY2A 3OSYA 2FI4E 2ZTZA 1GMHG 2QC2A 4NZLA 4MVNA 1DPOA 4F49A 3P8FA 2WINI 5TJXA 3SI4H 3Q3YA 5F03A 4DOQA 1K1IA 1ELAA 4J2YB 1YM0A 1EZXC 2AYWA 2HWLB 3V0XA 1F5LA 5DP8A 3SI3H 2R2MB 4NG9H 3LGYA 5B6OA 2Y80A 4ESTE 1Z8JB 1DXWA 2HALA 3UR6A 4DW2U 2FODA 2GGVB 3E16B 1P2JA 1O35A 1MTVA 1TGCA 2STBE 3TGJE 4B2BA 1EB2A 1TA6A 1SPJA 3LIWA 1JWTA 3KEEA 3PMHB 4D9RA 1BMLA 2ILNA 1CHOG 5E2OA 4WF8A 4B71A 1UTNA 2C3SA 3RUOA 2PLXA 3MYWA 5AFYH 1PYTC 3SGBE 5JB8S 1SOTA 1Q3XA 2BLWA 2O8UA 1EQ9A 3TH4H 3S0NA 3LT3A 3IITA 4E05H 4MPWA 3ZZBA 1ARBA 4ISNA 1ELEE 1GJAB 2QY0B 3ELAH 5HM9A 3AASA 1A2CH 3A83A 1YC0A 2SGDE 4CRDA 1GBHA 4R8TB 1YPMH 4INHA 3SNAA 2P95A 4JK6A 2ZU4A 3LDXH 1QRWA 5I25A 3VXFH 1O5AB 5BRRE 1UTJA 1O3HA 5DP3A 3MHWU 1INCA 4K60A 1V2WT 2Z9LA 2Z9IA 4X8TH 1XMNB 1YCPM 1BTYA 1C4Y2 1FXYA 4B2AA 1L4ZA 2HGTH 1EAWA 2EI7A 3TH2H 4X1SU 3D62A 2XRCA 2Z3EA 2IOTA 1T8MA 2W7SA 2FI3E 5HM2A 3VPKA 2J92A 1ETTH 3P17H 1VR1H 1FZZA 3LGVA 3EBNA 1T7CA 5DP7A 2XTTB 3GY8A 3SJOA 1TA2A 2ZDVH 4I8KA 3ENSB 1ABIH 2PKAB 2I6QA 1AMHA 1FY4A 1GMCG 2GT7A 4HI3A 1FJSA 1SHHB 2ZHWH 1M9UA 4NWKA 3M36A 1GGDB 1C5OH 1NZQH 2OBQA 3S9AA 3PO1B 2G52A 1LTOA 3MTYA 1T4VH 1FIZA 5EODA 1BTZA 3MFJA 2M5TA 4KTCA 5J4QA 4O9VA 1NO9H 2BDCA 1SLUB 2B0FA 1DE7H 3QO6A 1KLTA 1O2YA 1DM4B 1V2TT 2O9QA 3NZIA 4XBBA 1EJMA 1QA7A 5FX5A 2BLVA 3AAVA 2R3YA 3GY4A 1AFQC 3ESTA 3QK1A 5C1XA 2WPJS 3RXFA 2UWPA 8ESTE 4YOGA 2SNWA 1QB6A 5L30H 2F9OA 1TYNA 1D3TB 1C9TA 2K1QA 1ELTA 1SQOA 5BPEA 2OTVA 1FLEE 3S7HB 1YLCA 3TGIE 1KTTB 1NFXA 1C1WH 1TAWA 1ZHRA 4ABHA 2Y7XA 4CR9A 2STAE 3ZVCA 3GCHB 1AVXA 3MH5A 1ZRBA 2JH5D 1P02A 5PTPA 5SGAE 1E34B 2XCFA 4LZ1H 2VGCB 3V13A 1H9IE 1MCVA 1OP2A 1W10U 1A5GH 3VB7A 1Y59T 3DD2H 3K6ZA 1A46H 4CRBA 1MKWH 4U30A 5DGJA 1CSOE 1F0TA 1BTXA 2OUAA 1C1UH 3I77A 4FUHA 2PUQH 5C2ZA 4CREA 4DT7B 2ULLA 3ZZ7A 2QN5T 1O2ZA 3CS7A 1C2IA 1O2PA 1KDQB 1K1OA 2D1JA 1D9IA 1WU1A 4INLA 4Q7XA 1O2UA 3BF6H 1DX5M 2G55A 1GHBF 2XXLA 5DP5A 4B1TA 3LC5A 1A61H 1GI5A 3TH3H 1UCYH 1RS0A 1BHXB 3VEQB 1NRNH 3NCLA 5EOKA 1O2VA 3B23B 4RKJB 4UFGH 1S82A 1X7AC 1XXDA 3JZ1B 1Q2WA 1SGQE 9LPRA 8GCHG 2P3TB 3S7KB 4GAWA 1AZ8A 6CHAB 1O2JA 3RXLA 3L3TA 3RXRA 5JDUB 3SGAE 4Y8YA 2Q6GA 4GHTA 2VIDA 3IG6B 4Y8XA 2FIRH 1O0DH 4K1SA 2FI5E 3UNRA 1GDNA 1BA8B 5EW1H 3S9CA 1Z1JA 1O3PB 1WBGB 1SGRE 4BAKB 2P93A 1EAXA 1C4U2 4K5ZA 3UNSA 5JBBS 1TRYA 3H5CB 5C1UA 4B73A 3SNCA 3ZV9A 5GXPA 1SLWB 3E1XB 1DANH 2FOAA 2FOCA 5GCHG 1C5XB 4AB9A 4I7YH 4NZQA 4Q2KA 1GVKB 1PQ7A 1AE8H 4X2YA 1MKXH 1ORFA 2C8XB 3TLOA 3U1IB 4YT7H 4ZMAH 2FX6A 3EA7A 3A85A 4ISLA 2ZQ1A 4K1EA 3QLPH 4OS2A 4H6TA 3RU4D 1O38A 3P8GA 3BN9A 2A2QH 2F83A 2GMTB 5TCCA 1O3NA 5AVDA 1C5LH 1ZMLA 1ZMJA 2BY5X 3E8LA 3MU1A 3S9BA 1FPCH 1GWAA 1GJDB 4ZKRU 1CGIE 1GBMA 4TYDA 1LMWB 3SJIA 5A09A 3DFLA 1EZQA 1VGCC 1O3MA 1L1GA 5K7RA 1SI5H 2XC0A 5HYOA 1EUFA 2FPZA 5I46H 3RXEA 4CBOA 3BEFB 3QWCH 1SQTA 2RDLA 1Y3XA 3CENA 1DOJA 1G37A 2R0LA 1S6HA 2H5CA 3SHAH 1C2KA 4Y0YE 3BG4B 5A8YA 3K9XB 1GBAA 1DWEH 3QZQA 1UTOA 5IYTA 2CF8H 1FY5A 1EOLA 4OS1A 3GCTG 1KLJH 2A7CA 3MU0A 1WOFA 2HNTF 3MI4A 3SOSA 2HPQH 4CRAA 1KYNA 1HAYB 1A3BH 1GJ4H 3ATLA 1GHWH 1ABJH 4LXBH 1IQLA 1SLVB 1QRZA 6GCHF 3M5LA 2AIPA 1C2FA 2J2UA 3FZZA 3TGKE 5F8ZA 3ZZDA 5JBTA 1ESTA 2ZNKH 7GCHG 1TGBA 1YF4A 1MU8B 2FYRA 4KGAA 1OWKA 1SG8B 3URCA 4O3UA 4AG1A 4CHAB 5F6MA 4ZAEA 1BTHH 3EQ0H 1J14A 3M37A 4WMFA 1XUHA 3R3GB 1FAKH 2Z6BD 1EX3A 4ZXXH 1HLTH 2LPRA 3SV8A 3QX5H 2F91A 2A7JA 4XBCA 2HPPH 2CMYA 1K9OE 1YCPK 1V2LT 2ZFTA 1CT4E 3E3TA 4ABGA 3QUMP 1UCYK 2BY7X 1JRSA 1YGCH 1AHTH 1VITH 4BOHA 5JYIA 1JIRA 1C1SA 3ZZ9A 2PW8H 4H4FA 3MH6A 2QCYA 4UFEH 5FPTA 2FLRH 3RXVA 3Q3XA 4RSPA 1G30B 2ZDLA 1GBDA 3EGKH 3SUDA 2GKVE 2BDGA 1QJ1B 1PPCE 3GYLB 4SGAE 1B0FA 3QTVH 1P11E 2ZHDA 1NTPA 1QL9A 1MAYA 2J34A 3ZZ4A 2VVVA 4JYVH 4DG4A 2PKSC 1VJ9U 1O32A 3Q77A 1C1QA 1P2MA 1N8OC 3KQBA 4GVUA 2BQ7B 3KCGH 3UFAA 2XBWA 3Q76A 1TLDA 1GL0E 1ZHMA 3SZNA 3U98H 1PJPA 1MTNC 1IQNA 1L2EA 3QN7A 4NA8A 1XUGA 1QY6A 1KXDA 2V3HH 1KXEA 4NWLA 1SGNE 2B8OH 1MQ6A 2Z3DA 1V2NT 2WPKS 4Y8ZA 1RIWC 2BY8X 2TGAA 2HOBA 1GJ9B 1C1PA 4ABIA 4X1NU 4Y6DA 4YM9A 1MU6B 1BZXE 5DO4H 1TPAE 1SHYA 4DURA 3GDVA 3MWIU 5DJ7A 3F68H 1QB9A 5E8EH 1P2IA 2FX4A 3T5FH 1AY6H 2A45B 2SNVA 1HAIH 2O8WA 1GI9B 2UWLA 3MNCA 1UHBA 3FANA 4ZHAA 1Z6JH 1OOKB 1Z7KA 3LGWA 4B2CA 1QJ6B 2P8OC 1Y5BT 2ZU1A 1C2EA 2FMJA 1ZTKA 2VH0A 3CP7A 3UWIA 4JK5A 1CGJE 1LPKB 1ZPZA 4Q7YA 1RTLA 1FQ3A 3A82A 1L4DA 3TIUA 2UUFB 1AIXH 1GI8B 2FM2A 1H8DH 4QT8C 4AGJA 2ZQ2A 1ELVA 1OWEA 2BM2A 1W11U 3LU9B 3UQVA 4FVBA 3KHVA 4CH8B 1C2GA 1AB9B 1NFYA 2BD5A 2PSXA 2BVSH 1BRCE 1AO5A 2NU4E 5CHAB 2TBSA 4WWYA 1W2KH 4XDEA 1TPOA 2AH4X 1AZZA 4J1YA 4JYUH 4DVAU 1TONA 3VGCB 2YOLA 1DS2E 5G4BA 1J16A 1TGSZ 3GY7A 1SGIB 2AMPA 1O36A 1O2GH 2CJIA 3ODDA 3QDZB 1ZRKA 3M3VA 1YP9A 1J17T 1GDQA 1GVZA 3PMBB 4ASHA 4XFQA 3L6PA 2TGPZ 2W3KA 1C1NA 1BRAA 3C27B 3F9FA 2G4UA 2D26C 1GI1A 1RXPA 1LVOA 4GLYA 2XBVA 3VFEA 1OWJA 1PPBH 4GHQA 3SNBA 1BBRK 4FU8A 2A4QA 3D23A 3V12A 3H7OA 2ZFSA 1KIGH 1YPHC 3BIUH 4RKOB 1C5PA 1YPHE 1K22H 2H9TH 4GCHG 4D7FA 2ANKH 1GJ7B 1GCTB 4X2WA 1PPZA 4K69A 1PQ5A 2OQ5A 1Z8IB 4AORA 2UUYA 2ZHEH 1T8OA 3EA9A 4AFSA 5DP9A 1SGPE 2ZO3H 1DVAH 1AD8H 1QA0A 4ABJA 2D2DA 2W3IA 2FESH 2JETB 3ZYEA 5C67A 1BTPA 1LQDB 2EA3A 1GMHF 2XNIA 3FZDA 3RU4E 4D76A 2H1UA 1FAXA 3ODFA 4M7GA 1O2QA 1F92A 2VB0A 2G81E 1C5SA 1V2MT 5FPYA 1XKAC 4IS5A 1IQGA 5C5NA 1D3QB 2EI8A 1Y8TA 2Y81A 2ZHQH 1THRH 1S6FA 4AYYB 3RXKA 1ANCA 1QR3E 4Z0KA 4NIVA 1QGFA 1MTWA 4Q80A 2VIVA 4I33A 2P59A 1TMBH 1IHTH 1MZDA 2ALPA 2RG3A 1QRXA 3RMNH 2ZP0H 1CGHA 3UQOA 1A5IA 3A81A 2J9NA 1GGDC 3SQEE 4KP0A 1Z8RA 1HAGE 1O31A 2ZGBH 4ABAA 3U1JB 4ZROA 2QXHA 3PO1C 5FCKA 1S5SA 3MNSA 1AKSA 1O3DA 3HKIB 3NUMA 1HXEH 2R0KA 2ANWA 2QXIA 1IHSH 1Q31A 2VIPA 2ZCLP 1G2LA 1G3EA 2FOEA 1V2KT 2H9HA 3SJKA 1DSTA 3BEIB 3LC3A 4Y7BA 1JMOH 4Z6AH 1VCWA 1OXGA 1F2SE 3ZZCA 4ABDA 1NS3A 5DG6A 1MQ5A 4XE4A 1DXPA 3P70B 1ANBA 1UVPA 1N1LA 1ELGA 1LPGB 4KTUA 2RA0A 2FXRA 3GICB 1QURH 1O2KA 5CE1A 3GCHC 4JZEH 5ABWA 1HAVA 1WYKA 5T6GA 2I6SA 2G00A 2BVXH 2XC5A 1T4UH 3SORA 2ZI2H 5GPIB 2TIOA 1ZSLA 2LNCA 3OYPA 1T32A 4AG2A 4A1TA 2Q6DA 4IW4E 5GWZA 1HJ8A 1K1JA 1C1OA 1VZQH 1BTUA 1P0SH 1WTGH 1O3AA 3UOPA 1QFKH 3CS0A 3T26A 5A0CA 4IGDA 1CA0B 1LPZB 2O8TA 2BLOA 5HXFA 5LH8A 3LGUA 3T25A 4FU7A 2O8LA 3BTWE 4X8UH 3UTUH 3UNQA 1HJAC 1O2RA 2CF9H 1UTPA 2Y6TA 2Z9KA 1G32B 3TNSA 1T8LA 4ISIH 1FY1A 1FDPA 3PMJA 1L1JA 1C5RA 3TU7H 1HAPH 1VITF 1GJ6A 1UVSH 1Y3WA 6LPRA 1DUEA 1RRKA 1G3DA 1NU7B 1TBRH 2XBYA 4OS7A 4CRGA 1C5MD 3MMGA 5HMAA 1EZSC 1RJXB 3U8TH 2CV3A 2SGEE 5T3HA 1P3EA 3D65E 1GHXH 1ZPBA 1E38B 2AGIX 2WPHS 1V2RT 3MH7A 4F4OC 1SLXB 3RXPA 3TITA 1GBIA 1P04A 3F6UH 1K28D 1THPB 1GI4A 2BYAX 2C8WB 2YNAA 1UHBB 2H5DA 1ZGIA 1IQKA 5A8ZA 3NPSA 3WY8A 1V2JT 2G4TA 2Z9GA 1LHEH 4CBNA 4MPVA 1MZAA 3SUGA 2XC4A 2A5KA 3SU0A 1NESE 2ZTYA 1XXFA 1BIOA 3FP7E 1G9IE 1GBFA 1TB6H 2ODYB 1K1LA 3LKWA 3BTFE 3BEUA 3E6PH 2ZIQH 2Z9JA 3PMAB 1EAUA 2GMTC 2ZZUH 1N6YA 2GCTC 1SGYE 3M7TA 2PTCE 4AOQA 2AIQA 3KIDU 2TPIZ 3F9HA 1HIAA 1RFNA 1V2QT 1QTFA 4XSKU 4TWYA 4JMYA 2GZ8A 2G5VA 3RU4T 3GDUA 1D3DB 3U8RH 1CQQA 4IMZA 3ATWA 2IPHA 1BRUP 2ZHFH 3D49H 4NFFA 3SBKA 3HGNA 3F9GA 4UEHH 1Y3VA 4X6MA 3T28A 1WQSA 3BTKE 1A0LA 4X8SH 2BB4A 1LCYA 2FZZA 1CBWB 4DCDA 1P9SA 1GHBG 3HKJB 4YLQH 1K21H 3DT0H 3BG4C 1QBVH 5FHTA 1B7XB 2PFEA 3W94A 3T62A 4NSYA 3ATIA 1K1MA 1QHRB 1O2MA 2ANYA 1BITA 4VGCC 4AZ2B 1DY9A 1HPGA 2A7HA 3K2UA 1ID5H 1E0FD 1H1BA 4XOJA 3DFJA 3HGPA 2SGFE 6ESTA 3K65B 4FUFA 4DIHH 2VWOA 4DIIH 1BMAA 1UK4A 2F9PA 1AFQB 3BV9B 1C5WB 2K7XA 2ZPQA 1AUJA 4JZ1A 1EP6A 1HRTH 5EXNA 1KSNA 3PM3A 2GD4B 1ZLRA 2BDBA 3RMLH 1C1VH 1KXAA 3UWJH 5ESTE 5EU8A 3LJJA 3W95A 1UVTH 5CMXH 4IN2A 4Y11E 1GI2A 1ZTJA 3MU8A 4U01A 1O2IA 2BQWB 1UTLM 1DDJA 4ZKNU 3VXEH 1QBOA 1EZUC 1HJ9A 2XBXA 4FUBA 5LPEA 1AGJA 4WMDA 2FOMB 2HLCA 1TX6A 3BG8A 1S83A 2BD7A 1QNJA 4U32A 4BAOB 3VB6A 1GBEA 1P10A 3V7TA 1Z8GA 2OINA 3A8AA 5K0HA 1V2OT 4PROA 4YOIA 4ZHMU 1EJNA 3RXGA 1HV7A 3E90B 4A92A 3KL6A 5FXLA 1YYY1 3A8DA 2EI6A 1OP0A 5LPRA 1GBTA 2Y7ZA 2R9PA 1QIXB 3RP2A 1LDTT 1O5CB 2NU2E 3P95A 4FUEA 1K1NA 1YBWA 1UJ1A 1GBBA 1NPMA 3SW2B 4B76A 2BX3A 2GZ9A 1ELFA 2FOFA 1EOJA 5J4SA 2Z7FE 2CHAB 3GCTF 1C5UA 1C5QA 3ZVEA 2EC9H 1F0UA 3SJ8A 2C93B 1ZHPA 1QB1A 1PPGE 1LVMA 3SU3A 1TMUH 1UVUH 2A5IA 2TGDA 3PYHA 1VJAU 2ZU2A 3ATKA 3GCNA 3KN2A 1MKWK 1ZGVA 4WMEA 4FVDA 1WUNH 1HUTH 3EAJA 6GCHG 3QZRA 4MPUA 3RLWH 1HNEE 1AKSB 1W8BH 1BCUH 1EJAA 4AFQA 1TBZH 1VCQA 3M35A 2VWNA 2V35A 5E0JA 1BJVA 4YLUA 1YPKH 3GCOA 3M7UA 4WH6A 5L2ZH 2OC0A 1W13U 2C8YB 1SFQB 3FP8E 3TPIZ 1F5RA 4YO9A 1EPTA 5AHGH 1PQ8A 3E91A 3KNXA 1FONA 1GI3A 4TPYA 3ZZ8A 1S84A 3PWCA 1XX9A 2AS9A 3EDXB 2XW9A 1F7ZA 1GHZA 1SB1H 3G01A 3PB1E 1YPEH 5JPMH 4CH2B 3LOXA 4H42U 3EA8A 5EG4A 2SGAA 4HFPB 3Q3KA 1GJ8B 3RXBA 3SHCH 1HAVB 3NXPA 1C1MA 4HTCH 4WVPE 1AVGH 4YT6H 4ZH8A 5A8XA 3ATMA 4OGXA 3RXOA 2PTNA 1LHDH 2EEKA 4O03A 3A86A 4A1VA 1K1PA 1BTWA 1B0EA 1SGFA 1Y5AT 1NFUA 1XKBC 2BZAA 1O3KA 3K6YA 3RM0H 3MO3A 1AB9C 1TQ0B 3MNBA 5FX6A 3E0PB 1GHAF
chains in the Genus database with same CATH superfamily
1W0YH 4ZCNA 3MH4A 2VVUA 1GMDF 3V3MA 5GJ4B 3FFGA 1DLKB 1GCDA 1MKXK 2ZCHP 1HAOH 2Z3CA 1TMTH 2D8WA 4RT0A 1GI0A 1C1TA 4MNXA 1O2LA 4RI0A 1A0JA 2ZGCA 1UTKA 1UTQA 2HLDD 2P3UB 1HXFH 3PWBA 2NU0E 2GV7A 1IQMA 3HATH 1V2VT 1NT1A 1TGTA 1J9CH 1W3CA 3CNRA 2VH6A 3A8CA 1KXCA 1N6XA 4NIXA 2Z94A 2FO9A 2P16A 1TQ7B 4I86A 2GVFA 3ZVFA 4DT4A 1H9LB 3PTBA 1YPLH 4E7NA 1FNIA 1YPGH 1WQVH 2WPMS 4AX9H 1J15A 1JXPA 3A7XA 3KQEA 2RA3A 1DSUA 1H4WA 1W14U 3QTOH 4GSOA 3SO3A 1ANDA 3KQ5A 1ANEA 1TPSA 2F9UA 4K8YA 3O8RA 2B7DH 1P09A 1YLDA 1EFRD 2WYGA 3BTTE 2C90B 5T6DA 4O3TA 3MU4A 2BHGA 3SV7A 1G3BA 4CRCA 4AGKA 1UO6A 1GCTC 3RMOH 2A4OA 4ZKSU 1GHVH 5E0HA 2GCHF 2ZDKA 2V3MA 4OS5A 3BTME 1AI8H 3DUXH 1L0ZA 3A7YA 3EE7A 4THNH 3SQHE 4WH8A 3U8OH 3N7OA 3F2FA 4AYVB 1C2MA 2C8ZB 1O2SA 1BOQA 3WWFA 1HIAB 1TRNA 3A7ZA 5DK1A 2GTBA 1ELDE 1MH0A 1Z6EA 1XUFA 2PGQB 3DSOA 2JETC 3EYDA 3H09A 3P6ZB 2P3FH 2J98A 3PLBA 1OWIA 1EATA 2ZDNA 4RN6A 3GDSA 4NIYA 1Z71A 3SV2H 4UE7H 2PKSB 1GHYH 5E2PA 1MMJN 2WHXA 2G5NA 2VIQA 1D6RA 9ESTA 4NFEA 3I78A 1W12U 5A0BA 3GY6A 1SGDE 1FMGA 5F8XA 1NRPH 2A1DB 1W7XH 1OX1A 3SU5A 1A0HB 3SNDA 3OU0A 1P2OA 3RDZA 1RGQA 1O5BB 4A7IB 3TJNA 2BD4A 2GDDA 1HDTH 4UFDH 1EXFA 1DITH 2VNTA 5GDSH 2ZEBA 2PGBB 1NBME 1PFXC 2F43B 2TRMA 4U2WA 3RXAA 1RTKA 5LPFA 2A2XH 1LQEA 3DSPA 3VB5A 3JZ2B 3NK8A 1WCZA 3VB4A 4GUXA 1O37A 1Y5UT 3U69H 3UREA 1E37B 2W7UA 4FUIA 3PV4A 1LHFH 5AF9H 4E06H 2KX4A 3SNEA 1P03A 2FTMA 1YPJH 4DY7B 2Q6FA 5L6NH 3N99A 3KYFA 3M3SA 1GJCB 2C4FH 2M2AA 3A7VA 1EP5A 1TNGA 1O3FA 2VJ1A 2BTCE 2WV9A 2AHME 5JB9S 2AMQA 3OY5U 1IQHA 1HFDA 1NFWA 1H8HD 1W0JD 3ZVBA 1W7GH 1THSH 2BD9A 2CN0H 2GX4A 3PRDA 2PSYA 5C0UA 3OTPA 4LZ4B 1SGEE 4ABEA 2FWWA 4KELA 2WV4A 2V6NA 1V6DA 3LGTA 3TVJB 2FS9A 3TJVA 2HNTC 2HNTE 2ANMH 1BUIA 4NSVA 3RXQA 2EQNA 1P3CA 1TOCB 2ZTXA 1TALA 1O3LA 4X2XA 1GI7B 3F0OA 1AN1E 1BQYA 5EW2H 1MTSA 1PPFE 5HKKD 3RC6A 1GG6B 4WXIA 1O3CA 5A2MH 1CT2E 2IJD1 1NC6A 1YKTA 1QQUA 1CHOF 2H9EH 3GOVB 4MTBA 3O8CA 1P2NA 1NM6A 4IMQA 4IBLH 1LVYA 1CA0C 3ZVGA 1COWD 4AB8A 1FV9A 1Y3YA 2YNBA 1O2OA 3A7WA 4K3JA 3UUZA 4XD7D 2H2ZA 5AFZH 1LKAA 2BDYA 1PPHE 1A1RA 2UUJB 1O3OA 3O8BA 5A0AE 3ITIA 2VWMA 4JZIA 3RC5A 3T27A 2OQUA 4BTTB 1P57B 1TNIA 1O30A 1GI6A 3DA9B 2V0BA 4FUGA 3OEED 3PLPA 1MBMA 2SGQE 2ESTE 2JJ2D 1FI8A 1FN8A 3M5OA 3UOUA 4AFZA 5LGOA 1EPTB 2QAAA 2DUCA 1MUEB 4K2YA 1RTFB 1E1RD 1O39A 1QJ7B 2BX4A 4B75A 5EQRA 3BTGE 2SFAA 3RC4A 4I31A 1CVWH 1OP8A 3GY3A 2ZFRH 1SQAA 1Y3UA 1JIMA 1C5NH 4A5TS 3ZZAA 1HCGA 3AVZA 1O3IA 3FP6E 3IWMA 1GBJA 1V3XA 2F9NA 1FIWA 2J38A 4ABFA 2VGCC 4BXSA 4MDSA 3PV2A 2P94A 2AMDA 1TRMA 1P8VC 2WV5A 4FUDA 3HPTB 1SBWA 4TPIZ 4TWWA 1BMMH 1XUIA 3LH1A 1UTMA 4CR5A 4R0IA 1S0RA 2XOKD 3VB3A 2J4IA 1DY8A 1GMCF 4Y79A 2NU1E 1Z1IA 2UWOA 3RXSA 2BQ6B 2ZC9H 1D6WA 4NA7A 3RMMH 1DUAA 3PTNA 4NGAH 1O2HA 1EB1H 2GP9B 1ETRH 3A84A 2AFQB 4UONA 3O8DA 1O3GA 1HGTH 4GPGA 1RD3B 4JZFH 2QYIA 5ESBA 2XWBI 2JH6D 4X1QU 1V2UT 4LOYH 5H4IB 1TOMH 4BAHB 1CBWC 2R2WU 3KGPA 3RLYH 3RM2H 1C5TA 4BAQB 2WUBA 1MD7A 5DSFA 1K2I1 1O5DH 2ZECA 2FP7B 2G51A 3C1KA 6CHAC 5JBCS 1NRRH 3FAOA 3ZZ3A 1SGTA 5FPSA 1GJ5H 1UVOA 2BZ6H 4MG3A 4Q63A 4JCNA 1AWFH 5EIYA 3KQCA 8KME2 1CA8B 2FOGA 4D7GA 1B5GH 2ZFQH 1G36A 1XUJA 4P02A 1WAYB 4UFFH 5EXLA 1O2NA 4D8NA 1VITG 3M7QA 1P12E 3MO6A 4KKDA 2J95A 1BB0B 4FUCA 4I8GA 2F3CE 2ZF0H 1MCTA 4K8BA 1GL1A 2R3UA 1BDAA 4OGYA 1KLIH 3PRBA 4UD9H 4YZUA 2Y5FA 5JBAS 2ZU5A 3FO8D 1DLEA 3SN8A 1MBQA 2VIOA 3SU1A 1SQRA 1QQ4A 4OS4A 2PHBA 4ZHLU 2J94A 3QGNB 3SUEA 4HGCA 4BAMB 4B6EA 1TNJA 4OS6A 2BOKA 1C5YB 1C5ZB 3UR9A 2TGTA 2ZGHA 3SZEA 1SMFE 4X1PU 1V2PT 5F53A 1O2WA 4MLFB 3GYMA 2ZU3A 2CGAA 4YESB 2OD3B 4ZKOU 1ELCA 1TFXA 5FCRA 2JH0D 3BSQA 2ZWLH 1OWHA 2BXTH 4X6NA 1TGNA 2FTLE 1OS8A 4E7RG 1TABE 5E0GA 2NU3E 8LPRA 1ZJKA 3U9AH 1NBMD 3P8OA 3ZVDA 5EQSA 2XCNA 1EASA 1NROH 3ZV8A 4BANB 2A31A 1ESAA 1O3EA 2XWAA 2Y5HA 8GCHF 5DP4A 1YCPH 3DCLA 1BMNH 2Y82A 4IC5A 4MNWA 3STJA 1HJAB 3LJOA 1P01A 4INKA 3M5MA 5L2YH 2GDEH 1GBCA 2SGPE 3SGQE 2H6MA 2CHAC 4BNRA 1E79D 3A7TA 2KAIA 1ZYOA 5C5OA 3LONA 1O3JA 2UUKB 5C1YA 2ASUB 3TK9A 1BJUA 3SUFA 2ALVA 2BXUH 4I8HA 3B8JA 2GZ7A 2WPIS 1EAIA 1QL7A 3UPEA 5GCHF 2OC8A 4Y10E 2QGRA 3OX7U 1NU9A 4CHAC 1UCYE 4MQAA 3LPRA 4Y7AA 5EQQA 1HAXB 2FOHA 2NWNA 4YOJA 1FY8E 3I29A 2VU8E 3SU6A 4I32A 1DFPA 1A7SA 1W0ZU 3T29A 1QCPA 4WJG2 1OKXA 5EPNA 3P8NA 1SSXA 4FXGH 5C3NA 2QF4A 2W5EA 1E36B 4YTAA 4ASUD 1NY22 2FDAA 5T6FA 3TJUA 2WUCA 2BD8A 3SV6A 1LKBA 2O8MA 1L1NA 1MTUA 2WPLS 4X8VH 2QXJA 4NA9H 3UIRA 3A80A 2GCTB 2F9VA 1TX8A 1IQJA 3HK3B 4X6PA 3DSGA 3BTQE 2IN2A 1F5KU 4CRFA 1XUKA 4AFUA 1GPZA 1K0HA 1O5FH 1D3PB 1WTHD 1AU8A 4IN1A 5EXMA 1HBTH 5EGMA 3N7DA 1TBQH 1TNLA 4IC6A 1DWCH 1UMAH 2OC1A 1ACBE 1FPHH 4ACBA 2PR3A 4VGCB 1E35B 1P2QA 2W26A 1T31A 2OC7A 1PYTD 3PROA 7GCHF 4H6SB 2ZG0H 1HYLA 3NWUA 1J8AA 2RCEA 4I8LA 4MNYA 2VIWA 4AC9A 1S85A 1LHGH 3RXTA 1G3CA 3H7TA 2BD3A 1YWUA 3BTHE 1CT0E 1F0SA 1SGFG 1HAZB 4A1XA 1C9PA 3LH3A 2ZDAH 4A6LA 1ZZZA 1UK3A 1ZPCA 5C20A 3RXDA 3P92A 3Q00A 1IOEA 1XVOA 4X6OA 3GY5A 1LO6A 1ZSJA 3GISB 1DT2A 3F1SB 1FUJA 2FLBH 3AAUA 1WV7H 1ESBA 2AEIH 1FY3A 1H9HE 4ISHH 4X0WU 2QA9E 4JYTA 4HZHA 2PWXA 5HGGA 4X1RU 2VINA 4NIWA 2WYJA 5F8TA 1VGCB 1ETSH 3AW1A 2JDID 3A89A 2QIQA 2IJOB 1PPEE 1UK2A 1NRQH 3TJOA 1MAXA 2B9LA 3ZVAA 2A0QB 2OCVB 2BD2A 2BY6X 2BVRH 1AWHB 1IQIA 1KXBA 1TIOA 2BMGB 3PV5A 1BBRH 1BMFD 1OPHB 2BOHB 4MPXA 1CO7E 1SOZA 1C2HA 1ZOMA 2OP9A 5CHAC 4AN7A 2PKAA 3AK5A 4X2VA 3RXHA 1PQAA 1SC8U 4Q4LA 3NKKA 1TPPA 2THFB 3VGCC 2W6ID 2ZKSA 2PUXB 1TWXB 1AUTC 1DWBH 1GHAG 2B5TB 1OYTH 1GMDG 2ODQA 4D9QA 1T8NA 7LPRA 1GJBB 7ESTE 2DE9A 1C2JA 2BY9X 3A87A 5KECA 2V7QD 4ABBA 3OTJE 3MO9A 5FBIA 1BBRE 2YMSB 2CXVA 1XVMA 4WY3A 1CU1A 1O5EH 2FS8A 1O2XA 1H8IH 4OM9A 1SL3A 2OXSA 1JOUB 3T2NA 3MNXA 1VKYA 3BTDE 1V2ST 3RXUA 5FAHA 7KMEH 1TX7A 5DP6A 5DKMA 3EE0B 3A8BA 1BHXF 3KQDA 4Y71A 1S0QA 3F2HA 3OEHD 2DE8A 1MD8A 3KF2A 4BXWA 5ETXA 1AVWA 1C4V2 4DGJA 1IAUA 4Y76A 2VVCA 2JKHA 3L33A 4BTIB 2ZPRA 3MU5A 5EPYA 1A4WH 1LHCH 1AQ7A 1JRTA 2WZQA 4RT1A 5TCAA 1C2LA 3WWBA 2ZA5A 3RXMA 1O34A 3OY6U 3TK5A 3SU4A 4TY7A 2AGEX 2A5AA 2PV9B 3RXIA 3R0FA 3S69A 3FVFB 4BTUB 1FN6A 2OLGA 5C17A 2QV1A 4Q7ZA 1ELBA 1GBKA 1ZTLA 2ODPA 1VCPA 1ARCA 5FBEA 3F9EA 3LGIA 1GBLA 3SU2A 5KEDA 3E0NB 1U6QA 1BT7A 1OYQA 1ZR0A 2F4LA 2ZFFH 2ZGXH 1KXFA 2GCHG 1S6LA 5IDKA 1NRSH 1KDQA 2ZDMA 4DJZB 3FN8A 1C1RA 2XYAA 4K1TA 3ZYDA 1N8OB 1O3BA 2QF3A 1XM1A 1NN6A 3ZZ6A 2BDIA 2AGGX 5DPAA 1P06A 3DHKH 2BDHA 2HVXA 1TNHA 1MTNB 1TE0A 1IQEA 2QXGA 1GDUA 1AE5A 1CE5A 1SGCA 2ZCKP 4ZXYH 1DICA 1QBNA 2Q1JA 4KTSA 4FU9A 1HAHH 1GG6C 1JBUH 1LVBA 1A3EH 1SR5C 1RIWB 4JZDH 5GIBA 2GV6A 1KY9A 4MNVA 1OSSA 4ISOA 3M3TA 4O97A 1TNKA 2KAIB 4WXVA 2VWLA 2V3OH 1P05A 1ZMNA 4B74A 3TNTA 2A4RA 4XRNA 3MOCA 1C2DA 4LK4A 3M61U 1O33A 4I8JA 3URDA 1P9UA 3BIVH 3RXCA 2LIZA 5CDFE 3B9FH 3TK6A 1SFIA 2AERH 2L6OA 1E1QD 4GCHF 2F9BH 2G8TA 2FEQH 4TY6A 1EKBB 3OE7D 3AW0A 4NCYA 4Y0ZE 3QGJA 2HRVA 3BTEE 2P8OB 3ZZ5A 1ZJDA 1ZSKA 1S81A 4M9FA 1KTSB 4ZUHA 2ZFPH 3PLKA 3SJ9A 3HK6B 3STIA 1AFEH 2Y5GA 5C94A 1OWDA 2A4GA 3RXJA 2QF0A 2FOBA 1HB0B 3UY9A 1O5GH 1EPTC 4SGBE 1O2TA 4UDWH 2FYQA 4XBDA 3M5NA 1IQFA 1C5VA 1G2MA 1GVLA 1D4PB 1SVPA 1F0RA 2BDAA 2BLQA 2OBOA 2ZGJA 1QL8A 1A5HA 2A32A 1CHGA 4FUJA 3SV9A 3A88A 1P2KA 1DWDH 2GT8A 1BRBE 1WSSH 1YY3A 2ZPSA 3GY2A 3OSYA 2FI4E 2ZTZA 1GMHG 2QC2A 4NZLA 4MVNA 1DPOA 3GS9A 4F49A 3P8FA 2WINI 5TJXA 3SI4H 3Q3YA 5F03A 4DOQA 1K1IA 1ELAA 4J2YB 1YM0A 1EZXC 2AYWA 2HWLB 3V0XA 1F5LA 5DP8A 3SI3H 2R2MB 4NG9H 5B6LA 3LGYA 5B6OA 2Y80A 4ESTE 1Z8JB 1DXWA 4TT3D 2HALA 3UR6A 1OHHD 4DW2U 2FODA 2GGVB 3E16B 3W1EA 2KM0A 2QE7D 1P2JA 1O35A 1MTVA 1TGCA 2STBE 3TGJE 4B2BA 1EB2A 1TA6A 1SPJA 3LIWA 1JWTA 3KEEA 2JJ1D 3PMHB 4D9RA 1BMLA 2ILNA 1CHOG 5E2OA 4WF8A 2YMSD 4B71A 1UTNA 2C3SA 3RUOA 2PLXA 3MYWA 5AFYH 1PYTC 3SGBE 5JB8S 1SOTA 1Q3XA 2BLWA 2O8UA 1EQ9A 3TH4H 3S0NA 3LT3A 3IITA 4E05H 4MPWA 3ZZBA 1ARBA 4ISNA 1ELEE 1GJAB 2QY0B 3ELAH 5HM9A 3AASA 1A2CH 3A83A 1YC0A 2SGDE 4CRDA 1GBHA 4R8TB 2EY4C 1YPMH 4INHA 3SNAA 2P95A 4JK6A 2ZU4A 3LDXH 1QRWA 5I25A 3VXFH 1O5AB 5BRRE 1UTJA 1O3HA 5DP3A 3MHWU 1INCA 3N7EA 4K60A 1V2WT 2Z9LA 2Z9IA 4X8TH 1XMNB 1YCPM 1BTYA 1C4Y2 1FXYA 4B2AA 1L4ZA 2HGTH 1EAWA 2EI7A 3TH2H 4X1SU 3D62A 2XRCA 2Z3EA 2IOTA 1T8MA 2W7SA 2FI3E 5HM2A 3VPKA 2J92A 1ETTH 3P17H 1VR1H 1FZZA 3LGVA 3EBNA 1T7CA 5DP7A 2XTTB 3GY8A 3SJOA 1TA2A 2ZDVH 4I8KA 3ENSB 1ABIH 2PKAB 2I6QA 1AMHA 1FY4A 2KCOA 1GMCG 2GT7A 4HI3A 1FJSA 1SHHB 2ZHWH 1M9UA 4NWKA 3M36A 1GGDB 1C5OH 1NZQH 2OBQA 3S9AA 3PO1B 2G52A 1LTOA 3MTYA 1T4VH 1FIZA 5EODA 4ACAA 1BTZA 3MFJA 2M5TA 4KTCA 5J4QA 4O9VA 1NO9H 2BDCA 1SLUB 2B0FA 1DE7H 2CK3D 3QO6A 1KLTA 1O2YA 1DM4B 1V2TT 2O9QA 3NZIA 4XBBA 4B6FA 1EJMA 1QA7A 5FX5A 2BLVA 2RDEA 3AAVA 2R3YA 3GY4A 1AFQC 3ESTA 3QK1A 5C1XA 2WPJS 3RXFA 2UWPA 8ESTE 4YOGA 2SNWA 1QB6A 5L30H 2F9OA 1TYNA 2KZ4A 1D3TB 1C9TA 2K1QA 1ELTA 1SQOA 5BPEA 2OTVA 1FLEE 3S7HB 1YLCA 3TGIE 1KTTB 1NFXA 1C1WH 1TAWA 1ZHRA 4ABHA 2Y7XA 4CR9A 2STAE 3ZVCA 3GCHB 1AVXA 3MH5A 1ZRBA 2JH5D 1P02A 5PTPA 5SGAE 1E34B 2XCFA 4LZ1H 2VGCB 3V13A 1H9IE 1MCVA 1OP2A 1W10U 1A5GH 3VB7A 1Y59T 3DD2H 3K6ZA 1A46H 4CRBA 1MKWH 4U30A 5DGJA 1CSOE 1F0TA 1BTXA 2OUAA 1C1UH 3I77A 4FUHA 2PUQH 5C2ZA 4CREA 4DT7B 2ULLA 3ZZ7A 2J98B 2QN5T 1O2ZA 3CS7A 1C2IA 1O2PA 1KDQB 1K1OA 2D1JA 1D9IA 1WU1A 4INLA 3WW7A 4Q7XA 1O2UA 3BF6H 1DX5M 2G55A 1GHBF 2XXLA 5DP5A 4B1TA 3LC5A 1A61H 1GI5A 3F2GA 3TH3H 1UCYH 1RS0A 1BHXB 3VEQB 1NRNH 3NCLA 2PP6A 5EOKA 1O2VA 3B23B 4RKJB 4UFGH 1S82A 1X7AC 1XXDA 3JZ1B 1Q2WA 1SGQE 9LPRA 8GCHG 3VG8A 2P3TB 3S7KB 4GAWA 1AZ8A 6CHAB 1O2JA 3RXLA 3L3TA 3RXRA 5CHBA 5JDUB 3SGAE 4Y8YA 2Q6GA 4GHTA 2VIDA 3IG6B 4Y8XA 2FIRH 1O0DH 4K1SA 2FI5E 3UNRA 1GDNA 1BA8B 5EW1H 3S9CA 1Z1JA 1O3PB 1WBGB 1SGRE 4BAKB 2P93A 1EAXA 1C4U2 4K5ZA 5EJ1A 3UNSA 5JBBS 1TRYA 3H5CB 5C1UA 4B73A 3SNCA 3ZV9A 5GXPA 1SLWB 3E1XB 1DANH 2FOAA 2FOCA 5GCHG 1C5XB 4AB9A 4I7YH 4NZQA 4Q2KA 1GVKB 1PQ7A 1AE8H 4X2YA 1MKXH 1ORFA 2C8XB 3TLOA 3U1IB 4YT7H 4ZMAH 2FX6A 3EA7A 3A85A 4ISLA 2ZQ1A 4K1EA 3QLPH 4OS2A 4H6TA 5KGOA 3RU4D 1O38A 3P8GA 3BN9A 2A2QH 2F83A 2GMTB 5TCCA 3UB0A 1O3NA 5AVDA 1C5LH 1ZMLA 4F55A 2QF5A 1ZMJA 2BY5X 3E8LA 3MU1A 3S9BA 1FPCH 1GWAA 1GJDB 4ZKRU 1CGIE 1GBMA 4TYDA 1LMWB 3SJIA 5A09A 3DFLA 1EZQA 1VGCC 1O3MA 1L1GA 5K7RA 1SI5H 2XC0A 4P00A 5HYOA 1EUFA 2FPZA 5I46H 3RXEA 4CBOA 3BEFB 3QWCH 1SQTA 2RDLA 1Y3XA 3CENA 1DOJA 1G37A 2R0LA 1S6HA 2H5CA 3SHAH 1C2KA 4Y0YE 3BG4B 3OAAD 5A8YA 3K9XB 1GBAA 1DWEH 3QZQA 1UTOA 5IYTA 2CF8H 1FY5A 1EOLA 4OS1A 3GCTG 1KLJH 2A7CA 3MU0A 1WOFA 1FX0B 2HNTF 3MI4A 2HPQH 3SOSA 4CRAA 5IK2D 1KYNA 1HAYB 1A3BH 1GJ4H 3ATLA 1GHWH 1ABJH 4LXBH 1IQLA 1SLVB 1QRZA 6GCHF 3M5LA 2AIPA 1C2FA 2J2UA 3FZZA 3TGKE 5F8ZA 3ZZDA 2L74A 5JBTA 1ESTA 2ZNKH 7GCHG 3U28C 1TGBA 1YF4A 1MU8B 2FYRA 4KGAA 1OWKA 1SG8B 3URCA 4O3UA 4AG1A 2YMSC 4CHAB 5F6MA 4ZAEA 1BTHH 3EQ0H 1J14A 3M37A 4WMFA 1XUHA 3R3GB 1FAKH 2Z6BD 1EX3A 4ZXXH 1HLTH 4HG6A 2LPRA 3SV8A 3QX5H 2F91A 2A7JA 4XBCA 3MQKC 2HPPH 2CMYA 1K9OE 1YCPK 1V2LT 2ZFTA 1CT4E 3E3TA 4ABGA 3QUMP 1UCYK 2BY7X 1JRSA 2RFKC 1YGCH 4FETA 1AHTH 1VITH 4BOHA 5JYIA 1WXRA 1JIRA 1C1SA 3ZZ9A 2PW8H 4H4FA 3MH6A 2QCYA 4UFEH 5FPTA 2FLRH 3RXVA 3Q3XA 4RSPA 1G30B 2ZDLA 1GBDA 3EGKH 3SUDA 2GKVE 2BDGA 1QJ1B 2WSSD 1PPCE 3GYLB 4SGAE 1B0FA 3QTVH 1P11E 2ZHDA 1NTPA 1QL9A 1MAYA 2J34A 3ZZ4A 2VVVA 4JYVH 3FOAA 4DG4A 3KYGA 2PKSC 1VJ9U 1O32A 3Q77A 1C1QA 1P2MA 1N8OC 3KQBA 4GVUA 2BQ7B 3KCGH 3UFAA 2XBWA 2VBCA 3Q76A 1TLDA 1GL0E 1ZHMA 3SZNA 3U98H 1PJPA 1MTNC 1IQNA 1L2EA 3QN7A 4NA8A 1XUGA 1QY6A 1KXDA 2V3HH 1KXEA 4NWLA 1SGNE 2B8OH 1MQ6A 2JIZD 2Z3DA 1V2NT 2WPKS 4Y8ZA 1RIWC 2BY8X 2TGAA 2HOBA 1GJ9B 5HIYA 1C1PA 4ABIA 4X1NU 4Y6DA 4YM9A 5GNDA 1MU6B 1BZXE 5DO4H 2K8IA 1TPAE 1SHYA 4DURA 3GDVA 3MWIU 5DJ7A 3F68H 1QB9A 4Z1MD 5E8EH 1P2IA 2FX4A 3T5FH 1AY6H 2A45B 2SNVA 2LELA 1HAIH 2O8WA 1GI9B 2UWLA 3MNCA 1UHBA 3FANA 4ZHAA 1Z6JH 1OOKB 1Z7KA 2KR7A 3LGWA 4B2CA 1QJ6B 3UAIC 2P8OC 1Y5BT 2ZU1A 1C2EA 2FMJA 1ZTKA 2VH0A 3CP7A 3UWIA 4JK5A 1CGJE 1LPKB 1ZPZA 4Q7YA 1RTLA 1FQ3A 3A82A 1L4DA 3TIUA 2UUFB 1AIXH 1GI8B 2FM2A 1H8DH 4QT8C 4AGJA 2ZQ2A 1ELVA 1OWEA 2BM2A 1W11U 3LU9B 3UQVA 4FVBA 3KHVA 4CH8B 5DN6D 2GJGA 1C2GA 1AB9B 1NFYA 2W6JD 2BD5A 2PSXA 5T1VA 2BVSH 1BRCE 1AO5A 2NU4E 5CHAB 2TBSA 4WWYA 1W2KH 4XDEA 1TPOA 2AH4X 1AZZA 3F0PA 4J1YA 2KFWA 4JYUH 4DVAU 1TONA 3VGCB 2YOLA 1DS2E 5G4BA 1J16A 1TGSZ 3GY7A 1SGIB 2AMPA 1O36A 1O2GH 2CJIA 3ODDA 3QDZB 1ZRKA 3M3VA 1YP9A 4TSFD 1W0KD 1J17T 1GDQA 1GVZA 3PMBB 4ASHA 4XFQA 3L6PA 2TGPZ 2W3KA 1C1NA 1BRAA 3C27B 3F9FA 2G4UA 2D26C 1GI1A 4YXWD 1RXPA 1LVOA 1WDIA 4GLYA 2XBVA 3VFEA 1OWJA 2J97A 5C0TA 1PPBH 4GHQA 3SNBA 2KCPA 1BBRK 4FU8A 2A4QA 2WPDD 3D23A 3V12A 3H7OA 2ZFSA 1KIGH 1YPHC 3BIUH 4RKOB 1C5PA 1YPHE 1K22H 2H9TH 4GCHG 4D7FA 2ANKH 1GJ7B 1GCTB 4X2WA 1PPZA 4K69A 1PQ5A 2OQ5A 1Z8IB 4AORA 2UUYA 2ZHEH 1T8OA 3EA9A 4AFSA 5DP9A 1SGPE 2ZO3H 1DVAH 1AD8H 1QA0A 4ABJA 2D2DA 2W3IA 2FESH 2JETB 3ZYEA 5C67A 1BTPA 1LQDB 2EA3A 3SYJA 1GMHF 2XNIA 3FZDA 3RU4E 1QZ8A 4D76A 2H1UA 1FAXA 1KMHB 3ODFA 4M7GA 1O2QA 1F92A 2VB0A 2G81E 1C5SA 1V2MT 5FPYA 1XKAC 4IS5A 1IQGA 5C5NA 1D3QB 2EI8A 1Y8TA 2Y81A 2ZHQH 1THRH 1S6FA 4AYYB 3RXKA 1ANCA 1QR3E 4Z0KA 4NIVA 1QGFA 1MTWA 4Q80A 3ZIAD 2VIVA 4I33A 2P59A 4FOUC 1TMBH 2XNDD 1IHTH 1MZDA 2ALPA 2RG3A 1QRXA 3RMNH 2ZP0H 1CGHA 3UQOA 1A5IA 3A81A 2J9NA 1GGDC 3SQEE 3FKSD 4KP0A 1Z8RA 1HAGE 1O31A 2ZGBH 4ABAA 3U1JB 1H8ED 4ZROA 2QXHA 3PO1C 3OFND 5FCKA 1S5SA 3MNSA 1AKSA 1O3DA 3HKIB 3NUMA 1HXEH 2R0KA 2ANWA 2QXIA 1IHSH 1Q31A 2VIPA 2ZCLP 1G2LA 1G3EA 3NRLA 2FOEA 1V2KT 2H9HA 3SJKA 1DSTA 3BEIB 3LC3A 4Y7BA 1JMOH 4Z6AH 1VCWA 1OXGA 1F2SE 3ZZCA 4ABDA 1NS3A 5DG6A 1MQ5A 4XE4A 1DXPA 3P70B 1ANBA 1UVPA 1N1LA 1ELGA 1LPGB 4KTUA 2RA0A 2FXRA 3GICB 1QURH 1O2KA 5CE1A 3GCHC 4JZEH 5ABWA 1HAVA 1WYKA 5T6GA 2I6SA 2G00A 2LP6A 2BVXH 2XC5A 1T4UH 3SORA 2ZI2H 5GPIB 2TIOA 4F48B 1ZSLA 2LNCA 3OYPA 1T32A 4AG2A 4A1TA 2Q6DA 4IW4E 5GWZA 1HJ8A 1K1JA 1C1OA 1VZQH 2KCAA 1BTUA 1P0SH 1WTGH 1O3AA 3UOPA 1QFKH 3CS0A 3T26A 5A0CA 4IGDA 1CA0B 1LPZB 2O8TA 2BLOA 5HXFA 5LH8A 3LGUA 3T25A 4FU7A 2O8LA 3BTWE 4X8UH 3UTUH 3UNQA 1HJAC 1O2RA 2CF9H 1UTPA 2Y6TA 2Z9KA 1G32B 3TNSA 1T8LA 4ISIH 1FY1A 1FDPA 3PMJA 1MABB 1L1JA 1C5RA 3TU7H 1HAPH 1VITF 1GJ6A 1UVSH 1Y3WA 6LPRA 1DUEA 1RRKA 1G3DA 1NU7B 1TBRH 2XBYA 4OS7A 4CRGA 1C5MD 3MMGA 5HMAA 1EZSC 1RJXB 3U8TH 5EJZA 2CV3A 2SGEE 5T3HA 1P3EA 3D65E 1GHXH 1ZPBA 1E38B 2AGIX 2WPHS 1V2RT 3MH7A 4F4OC 1SLXB 3RXPA 3TITA 1GBIA 1P04A 3F6UH 1K28D 1THPB 1GI4A 2BYAX 2C8WB 2YNAA 1UHBB 2H5DA 1ZGIA 1IQKA 5A8ZA 3NPSA 3WY8A 1V2JT 2G4TA 2Z9GA 1LHEH 4CBNA 4MPVA 1MZAA 3SUGA 2XC4A 2A5KA 3SU0A 1NESE 2ZTYA 1XXFA 1BIOA 3FP7E 1G9IE 1GBFA 1TB6H 2ODYB 1K1LA 3LKWA 3BTFE 3BEUA 3E6PH 2ZIQH 2Z9JA 3PMAB 1EAUA 2GMTC 2ZZUH 5FL7D 1N6YA 2GCTC 1SGYE 3M7TA 2PTCE 4AOQA 2AIQA 3KIDU 2TPIZ 3F9HA 1HIAA 1RFNA 1V2QT 1QTFA 4XSKU 4TWYA 4JMYA 2GZ8A 2G5VA 3RU4T 3GDUA 1D3DB 3U8RH 1CQQA 4IMZA 3ATWA 2IPHA 1BRUP 2ZHFH 3D49H 4NFFA 3SBKA 3HGNA 3F9GA 4UEHH 1Y3VA 4X6MA 3T28A 1WQSA 3BTKE 1A0LA 4X8SH 2BB4A 2OK5A 1LCYA 2FZZA 1CBWB 4DCDA 1P9SA 1GHBG 3HKJB 4YLQH 1K21H 3DT0H 3BG4C 1QBVH 5FHTA 1B7XB 2PFEA 3W94A 2HVYB 3T62A 4NSYA 3ATIA 1K1MA 1QHRB 1O2MA 2ANYA 1BITA 4VGCC 4AZ2B 1DY9A 1HPGA 2A7HA 3K2UA 1ID5H 1E0FD 1H1BA 4XOJA 3DFJA 2J5UA 3HGPA 2SGFE 6ESTA 3K65B 4FUFA 4DIHH 2VWOA 4DIIH 1BMAA 1UK4A 2F9PA 1AFQB 3BV9B 1C5WB 2K7XA 2ZPQA 1AUJA 4JZ1A 1EP6A 1HRTH 5EXNA 1KSNA 3PM3A 2GD4B 1ZLRA 2BDBA 3RMLH 1C1VH 1KXAA 3UWJH 5ESTE 5EU8A 3LJJA 3W95A 1UVTH 5CMXH 4IN2A 4Y11E 1GI2A 1ZTJA 3MU8A 4U01A 1O2IA 2BQWB 1UTLM 1DDJA 4ZKNU 3VXEH 1QBOA 1EZUC 1HJ9A 2XBXA 4FUBA 5LPEA 1AGJA 4WMDA 2FOMB 2HLCA 1TX6A 3BG8A 1S83A 2BD7A 1QNJA 4U32A 4BAOB 3VB6A 1GBEA 1P10A 3V7TA 1Z8GA 2OINA 3A8AA 5K0HA 2K0QA 1V2OT 4PROA 1SKYE 4YOIA 4ZHMU 1EJNA 3RXGA 1HV7A 3E90B 4A92A 3KL6A 5FXLA 1YYY1 3A8DA 2EI6A 1OP0A 5LPRA 1GBTA 2Y7ZA 2R9PA 1QIXB 3RP2A 1LDTT 1O5CB 2NU2E 3P95A 4FUEA 1K1NA 1YBWA 1UJ1A 1GBBA 1NPMA 3SW2B 4B76A 2BX3A 2GZ9A 1ELFA 2FOFA 1EOJA 5J4SA 2Z7FE 2CHAB 3GCTF 1C5UA 1C5QA 3ZVEA 2EC9H 1F0UA 1YLNA 3SJ8A 2C93B 1ZHPA 1QB1A 1PPGE 1LVMA 3SU3A 1TMUH 1UVUH 2A5IA 2TGDA 3PYHA 1VJAU 2ZU2A 1UW7A 3ATKA 3F3BA 3GCNA 3KN2A 1MKWK 1ZGVA 4WMEA 4FVDA 1WUNH 1HUTH 3EAJA 6GCHG 3QZRA 4MPUA 3RLWH 1HNEE 1AKSB 1W8BH 1BCUH 1EJAA 4AFQA 1TBZH 1VCQA 3M35A 2VWNA 2V35A 5E0JA 1BJVA 4YLUA 1YPKH 3GCOA 3M7UA 4WH6A 2IPQX 5EJLA 5HIZA 5L2ZH 2OC0A 1W13U 2C8YB 1SFQB 3FP8E 3TPIZ 1F5RA 4YO9A 1EPTA 5AHGH 1PQ8A 3E91A 3KNXA 1FONA 1GI3A 4TPYA 3ZZ8A 1S84A 3PWCA 1XX9A 2AS9A 3EDXB 2XW9A 2KCYA 1F7ZA 1GHZA 1SB1H 3G01A 3PB1E 1YPEH 5JPMH 4CH2B 3LOXA 4H42U 3EA8A 5EG4A 2SGAA 4HFPB 3Q3KA 1GJ8B 3RXBA 3SHCH 1HAVB 3NXPA 1C1MA 4HTCH 4WVPE 1AVGH 4YT6H 4ZH8A 5A8XA 3ATMA 4OGXA 3RXOA 2PTNA 1LHDH 2EEKA 4O03A 3A86A 4A1VA 1K1PA 1BTWA 1B0EA 1SGFA 1Y5AT 1NFUA 1XKBC 2BZAA 1O3KA 3K6YA 3RM0H 3MO3A 1AB9C 1TQ0B 3MNBA 5FX6A 3E0PB 1GHAF
chains in the Genus database with same CATH topology
1W0YH 3MH4A 2VVUA 1GMDF 3V3MA 5GJ4B 3FFGA 1DLKB 1GCDA 1MKXK 2ZCHP 1HAOH 2Z3CA 1TMTH 2D8WA 1GI0A 1C1TA 4MNXA 1O2LA 1A0JA 2ZGCA 1UTKA 1UTQA 2P3UB 1HXFH 3PWBA 2NU0E 2GV7A 1IQMA 3HATH 1V2VT 1NT1A 1TGTA 1J9CH 1W3CA 2VH6A 3A8CA 1KXCA 1N6XA 4NIXA 2Z94A 2FO9A 2P16A 1TQ7B 2GVFA 3ZVFA 1H9LB 3PTBA 1YPLH 4E7NA 1FNIA 1YPGH 1WQVH 2WPMS 4AX9H 1J15A 1JXPA 3A7XA 3KQEA 2RA3A 1DSUA 1H4WA 1W14U 3QTOH 4GSOA 3SO3A 1ANDA 1ANEA 1TPSA 2F9UA 4K8YA 3O8RA 2B7DH 1P09A 1YLDA 3BTTE 2WYGA 2C90B 5T6DA 4O3TA 3MU4A 2BHGA 3SV7A 1G3BA 4CRCA 4AGKA 1UO6A 1GCTC 3RMOH 2A4OA 4ZKSU 1GHVH 5E0HA 2GCHF 2ZDKA 4OS5A 3BTME 1AI8H 3DUXH 1L0ZA 3A7YA 4THNH 3SQHE 4WH8A 3U8OH 3N7OA 4AYVB 1C2MA 2C8ZB 1O2SA 1BOQA 1HIAB 1TRNA 3A7ZA 5DK1A 2GTBA 1ELDE 1MH0A 1Z6EA 1XUFA 2PGQB 2JETC 3EYDA 3P6ZB 2P3FH 3PLBA 1OWIA 1EATA 2ZDNA 4RN6A 3GDSA 4NIYA 1Z71A 3SV2H 4UE7H 2PKSB 1GHYH 5E2PA 1MMJN 2G5NA 2VIQA 1D6RA 9ESTA 4NFEA 3I78A 1W12U 5A0BA 3GY6A 1SGDE 1FMGA 5F8XA 1NRPH 2A1DB 1W7XH 1OX1A 3SU5A 1A0HB 3SNDA 3OU0A 1P2OA 3RDZA 1RGQA 1O5BB 4A7IB 3TJNA 2BD4A 2GDDA 1HDTH 4UFDH 1EXFA 1DITH 2VNTA 5GDSH 2ZEBA 2PGBB 2TRMA 1PFXC 4U2WA 3RXAA 1RTKA 5LPFA 2A2XH 1LQEA 3VB5A 3JZ2B 3NK8A 1WCZA 3VB4A 4GUXA 1O37A 1Y5UT 3U69H 3UREA 1E37B 2W7UA 4FUIA 3PV4A 1LHFH 5AF9H 4E06H 3SNEA 1P03A 2FTMA 1YPJH 4DY7B 2Q6FA 5L6NH 3M3SA 1GJCB 2C4FH 3A7VA 1EP5A 1TNGA 1O3FA 2VJ1A 2BTCE 5JB9S 2AMQA 3OY5U 1IQHA 1HFDA 1NFWA 3ZVBA 1W7GH 1THSH 2BD9A 2CN0H 2GX4A 4LZ4B 2PSYA 1SGEE 4ABEA 2FWWA 4KELA 2WV4A 2V6NA 1V6DA 3LGTA 3TVJB 2FS9A 3TJVA 2HNTC 2HNTE 2ANMH 1BUIA 4NSVA 3RXQA 1P3CA 1TOCB 2ZTXA 1TALA 1O3LA 4X2XA 1GI7B 1AN1E 1BQYA 5EW2H 1MTSA 1PPFE 3RC6A 1GG6B 4WXIA 1O3CA 5A2MH 1CT2E 1NC6A 1YKTA 1QQUA 1CHOF 2H9EH 3GOVB 4MTBA 3O8CA 1P2NA 1NM6A 4IMQA 4IBLH 1LVYA 1CA0C 3ZVGA 4AB8A 1FV9A 1Y3YA 2YNBA 1O2OA 3A7WA 4K3JA 3UUZA 2H2ZA 5AFZH 1LKAA 2BDYA 1PPHE 1A1RA 2UUJB 1O3OA 3O8BA 5A0AE 3ITIA 2VWMA 4JZIA 3RC5A 3T27A 2OQUA 4BTTB 1P57B 1TNIA 1O30A 1GI6A 3DA9B 2V0BA 4FUGA 3PLPA 1MBMA 2SGQE 2ESTE 3M5OA 1FI8A 1FN8A 3UOUA 4AFZA 5LGOA 1EPTB 2QAAA 2DUCA 1MUEB 4K2YA 1RTFB 1O39A 1QJ7B 2BX4A 4B75A 5EQRA 3BTGE 2SFAA 3RC4A 4I31A 1CVWH 1OP8A 3GY3A 2ZFRH 1SQAA 1Y3UA 1JIMA 1C5NH 4A5TS 3ZZAA 1HCGA 3AVZA 1O3IA 3FP6E 3IWMA 1GBJA 1V3XA 2F9NA 1FIWA 2J38A 4ABFA 2VGCC 4BXSA 4MDSA 2P94A 2AMDA 1TRMA 1P8VC 2WV5A 4FUDA 3HPTB 1SBWA 4TPIZ 4TWWA 1BMMH 1XUIA 3LH1A 1UTMA 4CR5A 4R0IA 1S0RA 3VB3A 2J4IA 1DY8A 1GMCF 4Y79A 2NU1E 1Z1IA 2UWOA 3RXSA 2BQ6B 2ZC9H 1D6WA 4NA7A 3RMMH 1DUAA 3PTNA 4NGAH 1O2HA 1EB1H 2GP9B 1ETRH 3A84A 2AFQB 4UONA 3O8DA 1O3GA 1HGTH 4GPGA 1RD3B 4JZFH 2QYIA 5ESBA 2XWBI 2JH6D 4X1QU 1V2UT 4LOYH 5H4IB 1TOMH 4BAHB 1CBWC 2R2WU 3KGPA 3RLYH 3RM2H 1C5TA 4BAQB 2WUBA 1MD7A 1K2I1 1O5DH 2ZECA 2FP7B 2G51A 3C1KA 6CHAC 5JBCS 1NRRH 3FAOA 3ZZ3A 1SGTA 5FPSA 1GJ5H 1UVOA 2BZ6H 4MG3A 4JCNA 1AWFH 3KQCA 8KME2 1CA8B 2FOGA 4D7GA 1B5GH 2ZFQH 1G36A 1XUJA 1WAYB 4UFFH 5EXLA 1O2NA 4D8NA 1VITG 3M7QA 1P12E 3MO6A 4KKDA 2J95A 1BB0B 4FUCA 4I8GA 2F3CE 2ZF0H 1MCTA 4K8BA 1GL1A 2R3UA 1BDAA 4OGYA 1KLIH 4UD9H 4YZUA 2Y5FA 5JBAS 2ZU5A 1DLEA 3SN8A 1MBQA 2VIOA 3SU1A 1QQ4A 4OS4A 2PHBA 4ZHLU 2J94A 3QGNB 3SUEA 4HGCA 4BAMB 1TNJA 4OS6A 2BOKA 1C5YB 1C5ZB 3UR9A 2TGTA 2ZGHA 1SMFE 4X1PU 1V2PT 1O2WA 4MLFB 3GYMA 2ZU3A 2CGAA 4YESB 2OD3B 4ZKOU 1ELCA 1TFXA 5FCRA 2JH0D 3BSQA 2ZWLH 1OWHA 2BXTH 4X6NA 1TGNA 2FTLE 1OS8A 4E7RG 1TABE 5E0GA 2NU3E 8LPRA 1ZJKA 3U9AH 3P8OA 3ZVDA 5EQSA 2XCNA 1EASA 1NROH 3ZV8A 4BANB 2A31A 1ESAA 1O3EA 2XWAA 2Y5HA 8GCHF 5DP4A 1YCPH 1BMNH 2Y82A 4IC5A 4MNWA 3STJA 1HJAB 3LJOA 1P01A 4INKA 3M5MA 5L2YH 2GDEH 1GBCA 2SGPE 3SGQE 2H6MA 2CHAC 4BNRA 3A7TA 2KAIA 1ZYOA 5C5OA 3LONA 1O3JA 2UUKB 5C1YA 2ASUB 3TK9A 1BJUA 3SUFA 2ALVA 2BXUH 4I8HA 3B8JA 2GZ7A 2WPIS 1EAIA 1QL7A 3UPEA 5GCHF 2OC8A 4Y10E 2QGRA 3OX7U 1NU9A 4CHAC 1UCYE 4MQAA 3LPRA 4Y7AA 5EQQA 1HAXB 2FOHA 2NWNA 4YOJA 1FY8E 3I29A 2VU8E 3SU6A 4I32A 1DFPA 1A7SA 1W0ZU 3T29A 1QCPA 4WJG2 1OKXA 5EPNA 3P8NA 1SSXA 4FXGH 5C3NA 2W5EA 1E36B 4YTAA 1NY22 2FDAA 5T6FA 3TJUA 2WUCA 2BD8A 3SV6A 1LKBA 2O8MA 1L1NA 1MTUA 2WPLS 4X8VH 2QXJA 4NA9H 3UIRA 3A80A 2GCTB 2F9VA 1TX8A 1IQJA 3HK3B 4X6PA 3BTQE 2IN2A 1F5KU 4CRFA 1XUKA 4AFUA 1GPZA 1O5FH 1D3PB 1WTHD 1AU8A 4IN1A 5EXMA 1HBTH 5EGMA 1TBQH 1TNLA 4IC6A 1DWCH 1UMAH 2OC1A 1ACBE 1FPHH 2PR3A 4VGCB 1E35B 1P2QA 2W26A 1T31A 2OC7A 1PYTD 3PROA 7GCHF 4H6SB 2ZG0H 1HYLA 3NWUA 1J8AA 2RCEA 4I8LA 4MNYA 2VIWA 1S85A 1LHGH 3RXTA 1G3CA 3H7TA 2BD3A 3BTHE 1CT0E 1F0SA 1SGFG 1HAZB 4A1XA 1C9PA 3LH3A 2ZDAH 4A6LA 1ZZZA 1UK3A 1ZPCA 5C20A 3RXDA 3P92A 3Q00A 1IOEA 1XVOA 4X6OA 3GY5A 1LO6A 1ZSJA 3GISB 1DT2A 3F1SB 1FUJA 2FLBH 3AAUA 1WV7H 1ESBA 2AEIH 1FY3A 1H9HE 4ISHH 4X0WU 2QA9E 4JYTA 4HZHA 2PWXA 5HGGA 4X1RU 2VINA 4NIWA 2WYJA 5F8TA 1VGCB 1ETSH 3AW1A 3A89A 2QIQA 2IJOB 1PPEE 1UK2A 1NRQH 3TJOA 1MAXA 2B9LA 3ZVAA 2A0QB 2OCVB 2BD2A 2BY6X 2BVRH 1AWHB 1IQIA 1KXBA 1TIOA 2BMGB 1BBRH 1OPHB 2BOHB 4MPXA 1CO7E 1SOZA 1C2HA 1ZOMA 2OP9A 5CHAC 4AN7A 2PKAA 4X2VA 3RXHA 1PQAA 1SC8U 3NKKA 1TPPA 2THFB 3VGCC 2ZKSA 2PUXB 1TWXB 1AUTC 1DWBH 1GHAG 2B5TB 1OYTH 1GMDG 2ODQA 4D9QA 1T8NA 7LPRA 1GJBB 7ESTE 2DE9A 1C2JA 2BY9X 3A87A 4ABBA 3OTJE 3MO9A 5FBIA 1BBRE 2CXVA 1XVMA 4WY3A 1CU1A 1O5EH 2FS8A 1O2XA 1H8IH 1SL3A 2OXSA 1JOUB 3T2NA 3MNXA 3BTDE 1V2ST 3RXUA 5FAHA 7KMEH 1TX7A 5DP6A 5DKMA 3EE0B 3A8BA 1BHXF 3KQDA 4Y71A 1S0QA 2DE8A 1MD8A 3KF2A 4BXWA 5ETXA 1AVWA 1C4V2 4DGJA 1IAUA 4Y76A 2VVCA 2JKHA 3L33A 4BTIB 2ZPRA 3MU5A 5EPYA 1A4WH 1LHCH 1AQ7A 1JRTA 5TCAA 1C2LA 2ZA5A 3RXMA 1O34A 3OY6U 3TK5A 3SU4A 4TY7A 2AGEX 2A5AA 2PV9B 3RXIA 3R0FA 3S69A 3FVFB 4BTUB 1FN6A 2OLGA 2QV1A 4Q7ZA 1ELBA 1GBKA 1ZTLA 2ODPA 1VCPA 1ARCA 5FBEA 3F9EA 3LGIA 1GBLA 3SU2A 3E0NB 1U6QA 1BT7A 1OYQA 1ZR0A 2ZFFH 2ZGXH 1KXFA 2GCHG 5IDKA 1NRSH 1KDQA 2ZDMA 4DJZB 1C1RA 2XYAA 4K1TA 3ZYDA 1N8OB 1O3BA 2QF3A 1XM1A 1NN6A 3ZZ6A 2BDIA 2AGGX 5DPAA 1P06A 3DHKH 2BDHA 2HVXA 1TNHA 1MTNB 1TE0A 1IQEA 2QXGA 1GDUA 1AE5A 1CE5A 1SGCA 2ZCKP 4ZXYH 1DICA 1QBNA 2Q1JA 4KTSA 4FU9A 1HAHH 1GG6C 1JBUH 1LVBA 1A3EH 1SR5C 1RIWB 4JZDH 5GIBA 2GV6A 1KY9A 4MNVA 1OSSA 4ISOA 3M3TA 4O97A 1TNKA 2KAIB 4WXVA 2VWLA 2V3OH 1P05A 1ZMNA 4B74A 3TNTA 2A4RA 3MOCA 1C2DA 4LK4A 3M61U 1O33A 4I8JA 3URDA 1P9UA 3BIVH 3RXCA 2LIZA 3B9FH 3TK6A 1SFIA 2AERH 4GCHF 2F9BH 2G8TA 2FEQH 4TY6A 1EKBB 3AW0A 4NCYA 4Y0ZE 3QGJA 2HRVA 3BTEE 2P8OB 3ZZ5A 1ZJDA 1ZSKA 1S81A 1KTSB 4ZUHA 2ZFPH 3PLKA 3SJ9A 3HK6B 3STIA 1AFEH 2Y5GA 1OWDA 2A4GA 3RXJA 2QF0A 2FOBA 1HB0B 3UY9A 1O5GH 1EPTC 4SGBE 1O2TA 4UDWH 2FYQA 4XBDA 3M5NA 1IQFA 1C5VA 1G2MA 1GVLA 1D4PB 1SVPA 1F0RA 2BDAA 2BLQA 2OBOA 2ZGJA 1QL8A 1A5HA 2A32A 1CHGA 4FUJA 3SV9A 3A88A 1P2KA 1DWDH 2GT8A 1BRBE 1WSSH 2ZPSA 3GY2A 3OSYA 2FI4E 2ZTZA 1GMHG 2QC2A 4NZLA 4MVNA 1DPOA 4F49A 3P8FA 2WINI 5TJXA 3SI4H 3Q3YA 5F03A 4DOQA 1K1IA 1ELAA 4J2YB 1YM0A 1EZXC 2AYWA 2HWLB 3V0XA 1F5LA 5DP8A 3SI3H 2R2MB 4NG9H 3LGYA 5B6OA 2Y80A 4ESTE 1Z8JB 1DXWA 2HALA 3UR6A 4DW2U 2FODA 2GGVB 3E16B 1P2JA 1O35A 1MTVA 1TGCA 2STBE 3TGJE 4B2BA 1EB2A 1TA6A 1SPJA 3LIWA 1JWTA 3KEEA 3PMHB 4D9RA 1BMLA 2ILNA 1CHOG 5E2OA 4WF8A 4B71A 1UTNA 2C3SA 3RUOA 2PLXA 3MYWA 5AFYH 1PYTC 3SGBE 5JB8S 1SOTA 1Q3XA 2BLWA 2O8UA 1EQ9A 3TH4H 3S0NA 3LT3A 3IITA 4E05H 4MPWA 3ZZBA 1ARBA 4ISNA 1ELEE 1GJAB 2QY0B 3ELAH 5HM9A 3AASA 1A2CH 3A83A 1YC0A 2SGDE 4CRDA 1GBHA 4R8TB 1YPMH 4INHA 3SNAA 2P95A 4JK6A 2ZU4A 3LDXH 1QRWA 5I25A 3VXFH 1O5AB 5BRRE 1UTJA 1O3HA 5DP3A 3MHWU 1INCA 4K60A 1V2WT 2Z9LA 2Z9IA 4X8TH 1XMNB 1YCPM 1BTYA 1C4Y2 1FXYA 4B2AA 1L4ZA 2HGTH 1EAWA 2EI7A 3TH2H 4X1SU 3D62A 2XRCA 2Z3EA 2IOTA 1T8MA 2W7SA 2FI3E 5HM2A 3VPKA 2J92A 1ETTH 3P17H 1VR1H 1FZZA 3LGVA 3EBNA 1T7CA 5DP7A 2XTTB 3GY8A 3SJOA 1TA2A 2ZDVH 4I8KA 3ENSB 1ABIH 2PKAB 2I6QA 1AMHA 1FY4A 1GMCG 2GT7A 4HI3A 1FJSA 1SHHB 2ZHWH 1M9UA 4NWKA 3M36A 1GGDB 1C5OH 1NZQH 2OBQA 3S9AA 3PO1B 2G52A 1LTOA 3MTYA 1T4VH 1FIZA 5EODA 1BTZA 3MFJA 2M5TA 4KTCA 5J4QA 4O9VA 1NO9H 2BDCA 1SLUB 2B0FA 1DE7H 3QO6A 1KLTA