2AMDA

Crystal structure of sars_cov mpro in complex with an inhibitor n9
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
309
structure length
309
Chain Sequence
PLGSSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Design of Wide-Spectrum Inhibitors Targeting Coronavirus Main Proteases.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 83
structure length 309
sequence length 309
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2amdA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2amdA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2amdA02
3SU3A 1GMHG 3LJOA 1MKXH 1SLXB 2RA0A 4TPIZ 1OSSA 2ZIQH 2Z9GA 1EZUC 3A80A 1TAWA 2OC7A 5FHTA 3PO1C 1BTZA 1MQ6A 2VH0A 3P70B 4FUJA 1BBRH 4FUHA 4DIIH 3UQOA 5DGJA 1OWKA 1MCTA 1TGNA 1W0YH 3LGYA 5C20A 1DXPA 3VEQB 1TPAE 1CHGA 2GDEH 4FU9A 5DKMA 2FO9A 2A4QA 4Y8ZA 3A8CA 3PB1E 1O2JA 1KXBA 2J4IA 4RKJB 3A8DA 4MNWA 1C9TA 2BTCE 5F8ZA 5J4QA 1EX3A 1ZPCA 4I31A 1E38B 2BHGA 1ABJH 1SFIA 4A1TA 3RXFA 5EODA 1P10A 2ZFQH 4ZXYH 3DT0H 1ETRH 1GHWH 3SV2H 3TK6A 4X8UH 2K7XA 3VGCC 1OYTH 5GDSH 1IQNA 4BTUB 1D3QB 2AMDA 2A32A 2C4FH 2RG3A 1KXFA 4TWYA 1BMMH 1IQGA 3UWJH 1SGQE 1WBGB 3CP7A 2BX3A 2VWNA 1V2VT 2ZTZA 4KP0A 5JBBS 2H5DA 1W7GH 2HALA 6CHAC 1P3CA 3BTEE 4I7YH 2BDGA 2FEQH 3GCNA 2FWWA 5F6MA 3MNBA 4MPVA 4JK6A 3BSQA 3P95A 1AVWA 3RXJA 1M9UA 1FY3A 3D65E 1LHDH 1LHFH 1IQIA 1MBMA 3EAJA 2QA9E 1CVWH 5TJXA 3TGKE 4Y10E 1GHBG 4Y76A 1DUAA 3GCHB 1EPTA 4H6SB 1QTFA 1ZMLA 4OGXA 3BTHE 2PKAA 1MTVA 2GKVE 1O5AB 1C5WB 1WU1A 1GGDC 2G51A 5FPSA 1OKXA 1DWCH 1W11U 3DFJA 3GY3A 2GCHG 4U32A 4MTBA 2HPPH 3ATLA 2D1JA 2XC0A 3Q3XA 1P8VC 1AY6H 2TIOA 1ESBA 4I8KA 5E8EH 3SNDA 3AVZA 2BX4A 1IHTH 4ZH8A 1C1SA 4NG9H 1F0SA 4JZDH 3S7HB 2B9LA 5FAHA 1GJAB 1TABE 1O3EA 2QV1A 2ZC9H 4UEHH 1GBAA 1PJPA 3SV9A 3PMHB 1SMFE 5EXLA 1EPTB 2FOMB 3MI4A 1HRTH 1C5PA 2RCEA 1AFQB 1O34A 2PKAB 1H8DH 4Q2KA 5LPEA 3FVFB 5FBEA 5FX6A 1V2WT 1YPHE 2C8YB 2FTMA 3RLWH 4FU7A 3RXQA 3K2UA 1KY9A 2GV7A 2W7SA 1GMHF 1SBWA 2QN5T 2JH5D 1D3TB 1TX6A 3BN9A 3U8RH 3G01A 2XYAA 2W3IA 1C4V2 5EQRA 4YZUA 2ZFRH 4LXBH 3RXAA 1TGTA 5DP3A 1DANH 5CHAB 3E90B 5DP6A 1GBCA 1T31A 1VR1H 3E8LA 2ZDVH 1A5IA 3T28A 3A88A 1P9UA 4BANB 3MMGA 3OYPA 1GJCB 1C1VH 1O2TA 4HGCA 3AW1A 4A92A 1UMAH 2PWXA 2A45B 4I8HA 1H9HE 4CR5A 5JBAS 2TBSA 1QB1A 3BG4B 1CA0C 4FU8A 1HAYB 3BG8A 3ZVGA 1GHVH 3LC3A 3UNSA 4DT7B 2ANKH 1DOJA 3PLBA 2Y5GA 3HK6B 2Z3EA 2F9NA 3PTNA 2GMTC 2G8TA 2THFB 2V3OH 1E35B 4JYVH 1T4UH 1O2KA 1O3GA 4IN1A 1WTGH 4AFSA 1L1JA 2ZWLH 1RD3B 4WWYA 1INCA 1TPSA 1HFDA 1EUFA 1O5BB 1IHSH 2NU3E 1AN1E 1FIWA 1H8IH 1QJ7B 3QGJA 2FOBA 2FZZA 3RM0H 1TRNA 3ZZ3A 1OP2A 2BDYA 5FXLA 1ID5H 2BMGB 1KDQA 2WPHS 3SUFA 4AYYB 1Z1IA 3QO6A 2ZCHP 4O3TA 5A0BA 2STBE 4WMDA 1SGFA 1HAOH 1GHBF 2PSXA 4ABGA 2P8OB 3KQCA 4MPWA 1C2LA 4DY7B 1KXEA 5A2MH 2A5AA 1NO9H 1TBQH 1ETTH 3PWBA 1D6RA 1XUKA 1XKBC 3UPEA 3KIDU 1BT7A 4JZ1A 4D9QA 3S7KB 1ZHMA 3NWUA 1NROH 4TY6A 1GJ5H 2ANMH 4ZKSU 3RXLA 3SNEA 2GCHF 3OY6U 3TJVA 5HXFA 3UR6A 4FUIA 4GPGA 1SG8B 3TK5A 1L1NA 2ZQ2A 2F9BH 2ILNA 5ETXA 2VVVA 1HBTH 1JWTA 1H1BA 2P3TB 1KDQB 4FUFA 2HNTE 1S85A 2GX4A 4ISHH 5FX5A 4NWKA 4BXWA 3SW2B 4IMZA 1ZPBA 5TCCA 1T4VH 2D8WA 3Q76A 3S9BA 4CRFA 4YOJA 1UK4A 1C2IA 1NZQH 1P06A 5HM9A 1GBKA 1QRZA 3DFLA 2ZO3H 4VGCB 3R0FA 1D3PB 3M7TA 4AFZA 2BDBA 4AFQA 1SHHB 1O2YA 3O8DA 3MU0A 1WV7H 7LPRA 1CBWC 1XUJA 3ATIA 2FLRH 4Y7BA 1KTTB 1C5TA 4NIYA 4ISLA 1BQYA 3SU2A 1C5QA 2PGBB 4ISNA 5I46H 3T5FH 3MOCA 4JZEH 4NIWA 4GSOA 1DT2A 3RXCA 1XXFA 4Y71A 1TBZH 2UWPA 3U8TH 1PPCE 1W3CA 1ZTJA 4MG3A 1GI9B 4J2YB 3D49H 3UOPA 1THSH 1UTJA 1S6FA 1C1OA 4INKA 1UCYK 1QIXB 2ZF0H 3C1KA 2WPJS 3TJUA 3A7VA 3RUOA 2BLOA 3NXPA 1O2XA 2V0BA 1LQDB 4GCHG 3QZQA 2V3HH 3S9AA 1AKSA 4OS7A 5JBTA 1VCPA 1WCZA 1GBDA 1O2PA 2CJIA 2A5IA 3KQDA 2Z9IA 3LJJA 2D2DA 1AO5A 2BDAA 2QYIA 3UIRA 1CO7E 5K0HA 5DP5A 5JDUB 1SHYA 1A1RA 1O2QA 2ZNKH 1O2WA 3NKKA 2AIPA 5L2ZH 1V2NT 5F8TA 1TMUH 4CHAB 3SU4A 1O2VA 2HLCA 4B76A 4THNH 5EW2H 5A8ZA 2NU4E 3SV8A 2VVCA 1L1GA 4AGJA 3E0PB 1A3BH 1SPJA 4CRCA 1VCWA 2WPMS 2PHBA 3QZRA 1MAYA 1DITH 1D6WA 1T8OA 2BY7X 3LOXA 1EJAA 1HB0B 3E0NB 1QA0A 3TU7H 4FUBA 2PUQH 3SJIA 1AKSB 1ZMNA 2R9PA 1XVMA 2ZKSA 4E06H 1MKWH 4ABFA 4INLA 2FX6A 5EGMA 3LGVA 2VIVA 4NZLA 1TNLA 2ANWA 1EQ9A 1K9OE 3P92A 1P3EA 2O9QA 1YPJH 1C5ZB 2BY5X 2XTTB 3SNCA 1HJAB 1K1LA 1O2MA 3T27A 1HJ8A 1S83A 1GVZA 3S0NA 1UTQA 1MMJN 4NIVA 1O2IA 2BLVA 2GCTC 1YPEH 1ETSH 1MTNB 2SGQE 9LPRA 1QL7A 3BTGE 3KL6A 3FP6E 2BD9A 1ANEA 1JXPA 5FPYA 3MNSA 1ZYOA 3LU9B 1DVAH 4HZHA 1SSXA 2CF9H 1JRTA 1W8BH 4MDSA 3U69H 2OCVB 1JMOH 2Q1JA 3SGQE 2HGTH 4BTIB 3SN8A 4ISIH 6ESTA 3UREA 1QB6A 1UTPA 2QXIA 1V2PT 2UUKB 3WY8A 2LIZA 1PPEE 2ODQA 3SJ9A 5J4SA 3UUZA 5A8XA 1KLTA 1TBRH 4ZHAA 5BPEA 4OS1A 4BTTB 2ODYB 1VCQA 2BD7A 1GHZA 1G3CA 2ZHQH 4CR9A 3T62A 5EPNA 1ELVA 1LHGH 1GBTA 3T25A 1SL3A 1NFWA 3ZYEA 3MYWA 1GI0A 2UUFB 3GY5A 2WV4A 3GY8A 1RIWB 2TGPZ 3QTOH 4H6TA 1ZSKA 3LDXH 4NA8A 1FDPA 2Z9LA 1AVXA 1CE5A 3A85A 2Y82A 3TLOA 3M3TA 1HJ9A 4NSYA 5DG6A 2JH0D 1TONA 3EQ0H 4FVDA 5T6DA 4KTUA 1KTSB 3STIA 2QXHA 2QXGA 4Z0KA 5FPTA 4ZROA 3F9FA 2HVXA 4K1SA 2ZZUH 2JETC 1EP5A 1BTWA 2GZ7A 3RXEA 4GCHF 2NWNA 1SGRE 2ZU1A 3TPIZ 4LK4A 1UK2A 1IQHA 3DA9B 1O3DA 2ULLA 1FIZA 1YLDA 1FUJA 3KEEA 1K1OA 4AFUA 2FI3E 1CSOE 4XFQA 5JB9S 2QAAA 4O3UA 1V2JT 1S5SA 2QCYA 1ELCA 3HATH 2VU8E 3B23B 1BRCE 1PPZA 5DJ7A 3TH3H 4YOGA 1C5OH 1PQ5A 1ANBA 2VIDA 2OINA 1FPHH 1O5EH 2HNTC 2C93B 3T29A 1MCVA 1V2TT 1SGCA 1X7AC 1HAPH 3SBKA 2WUBA 1V2UT 4K2YA 1YCPK 2CGAA 1DLEA 2VINA 4XOJA 2ZHDA 4IS5A 4UONA 1C1MA 4XBCA 4AOQA 2OP9A 3LH3A 1FAXA 1P0SH 1DFPA 3LIWA 4DCDA 1UK3A 1NRQH 1VGCC 4GAWA 1DWBH 1GBJA 1GI7B 4Y11E 1GCTC 1YPMH 5AF9H 2BDHA 3E3TA 2ZU3A 3A87A 1CT0E 2H9EH 1ZGIA 2ODPA 1MD8A 3MU4A 2Q6DA 3BTTE 1JIRA 1O36A 4ZXXH 3W95A 4AX9H 1BHXF 2WPKS 1C5YB 2Y80A 2J2UA 1FMGA 2FYRA 2PV9B 2VGCB 1HYLA 2FMJA 2SNWA 1N6YA 5BRRE 3A82A 2SGPE 3U1JB 3MWIU 1A2CH 3PTBA 3QK1A 3VXFH 5C5NA 8LPRA 1C5XB 1SGNE 6GCHG 2ZP0H 2BD3A 1RGQA 2O8LA 4M7GA 3RXTA 3SQHE 1J9CH 1D9IA 3EBNA 3V3MA 3P8FA 3LPRA 1GG6C 1NS3A 1Y5UT 1H9IE 1SGIB 1EP6A 4FUDA 2HRVA 3R3GB 1KXAA 4UD9H 3SI3H 1EAUA 4ZUHA 3VB7A 2F9UA 3ZZAA 1C2FA 3ENSB 1AWHB 1EZQA 2J92A 2R3UA 4Y0ZE 5G4BA 1GI3A 4O97A 1BB0B 4FVBA 2CHAC 3RXIA 1XM1A 2AMPA 4D7GA 3HPTB 2YNBA 4Q7ZA 4BXSA 3Q3YA 3HK3B 1QBVH 3AAUA 1OP8A 1C5RA 1C2DA 3LGTA 1D3DB 3ZV8A 1HDTH 1YYY1 4OS6A 2FOGA 3AAVA 1O5DH 1CT4E 1VZQH 2IJOB 4XDEA 2G4UA 1MZDA 5EXNA 3FP7E 4Y7AA 1UVPA 1ESTA 4BAHB 3VGCB 5DK1A 4IC5A 3QN7A 2H1UA 1GBEA 3LGIA 1LCYA 1O2GH 3IWMA 1FQ3A 1GJ6A 2ALPA 3MH7A 3GYMA 3KF2A 3SUGA 1BOQA 1J14A 1FZZA 1RFNA 2H6MA 3TIUA 1YPKH 2A7CA 2A4OA 6CHAB 1XX9A 1O3CA 4GLYA 2A4RA 2Z3CA 4E05H 1ABIH 1XUFA 5F8XA 5FCRA 3UFAA 1LKBA 3EGKH 1QL8A 1EAXA 4NA9H 4OS5A 3SU0A 4YO9A 3URCA 2W26A 3ITIA 1C2MA 3PV4A 5GWZA 1EPTC 2GGVB 4ABIA 5C1XA 1N6XA 1A4WH 3OU0A 4DOQA 1O3OA 2TRMA 1G37A 2BQ6B 2XW9A 1VJ9U 3BEUA 1TE0A 5ABWA 4WH8A 2FOAA 4PROA 1ZPZA 1GGDB 2J34A 3EE0B 1TB6H 1GBMA 2OBOA 4B74A 5L2YH 5JBCS 4MQAA 5C67A 1MU6B 1SOTA 1ZRBA 4KGAA 3U98H 1QQ4A 4X2WA 3SQEE 3SJ8A 1N1LA 3L3TA 2Z3DA 1WSSH 1LHEH 2H9TH 5A0CA 2Z7FE 4WVPE 5LH8A 1UTLM 3TH2H 2VWOA 1Y59T 1UCYE 1BJVA 1SQAA 2AERH 2XC5A 3TJNA 1P2IA 2VIPA 4MLFB 1PQAA 1UVOA 1DSTA 2B8OH 2BY6X 3I29A 1ORFA 2A2XH 3BG4C 4E7NA 1TA2A 3GY2A 3MU1A 2GZ9A 5CMXH 6GCHF 3GCTG 2PR3A 1Y3YA 4I8JA 4CRGA 1THPB 2TGDA 1QCPA 3I77A 3I78A 1P2OA 1TWXB 4X6PA 1ELDE 5DP4A 2RA3A 2BOHB 3LGUA 1GBIA 1VITH 1IAUA 1Z6JH 1SFQB 5HM2A 7KMEH 2R2WU 3SUDA 1RJXB 1GCDA 1C2EA 2WPIS 5DP8A 5LPRA 1UJ1A 2XBVA 2ZFTA 1FAKH 1Z1JA 2HNTF 1FLEE 1ZTKA 4K8BA 3SJOA 3SHAH 3FP8E 2V6NA 1NY22 2FYQA 5HGGA 1LPZB 3UTUH 1TX8A 1BCUH 3TVJB 2O8WA 5DP7A 2A7HA 4YLUA 1O3PB 4GHTA 2XBYA 1F0TA 3V7TA 1L0ZA 4U01A 1KYNA 1QRWA 1BUIA 1CA0B 1A0LA 1FNIA 1LHCH 2VH6A 1ZLRA 1CT2E 1S82A 4X8VH 1SR5C 5C1YA 1GHXH 4Y8XA 1AUTC 2ZGCA 1F0UA 1HAIH 3MNCA 2GMTB 4ZKNU 2CN0H 3E6PH 5I25A 3VB6A 1NT1A 3RXVA 1XKAC 3UY9A 3VB4A 1GI5A 1ZR0A 1EOJA 3P6ZB 3MO9A 1P04A 1NM6A 1WOFA 4WY3A 2GV6A 4WJG2 4U30A 1F5RA 1AE8H 1WUNH 1F5LA 1TOMH 1ZRKA 3O8BA 4CRBA 3URDA 5EXMA 2FOHA 1AE5A 1K1IA 4I8GA 2WINI 1QNJA 1GPZA 1Z71A 1XUHA 4B2BA 3Q3KA 2PW8H 2D26C 1J17T 1LPKB 5A09A 1O2OA 3AASA 1TNJA 1J8AA 1NPMA 1O3KA 2CMYA 3EA9A 1ELFA 2C8XB 4VGCC 1U6QA 4ZMAH 2UWLA 3KQBA 1A46H 2A31A 3M35A 1O32A 4OGYA 1NTPA 2DUCA 2PTCE 2GVFA 1Y3XA 1Z8IB 1F5KU 5ESTE 3O8RA 2J38A 1BA8B 3V13A 3ZVAA 4AG1A 1XUGA 3DHKH 1QURH 1OWHA 2ZGXH 1GI8B 2LNCA 5ESBA 4ZHLU 1GL0E 3T2NA 4IGDA 3OSYA 2OLGA 1GBBA 1HGTH 3ZZ8A 3QDZB 1TMTH 3QX5H 4FUGA 1P57B 1TGBA 5JB8S 1BITA 1CA8B 7ESTE 2A0QB 2YOLA 1AZZA 2O8MA 3KHVA 2Y6TA 1CGHA 1AMHA 2G52A 4F4OC 3RU4D 3ODFA 4X1PU 2ZHFH 1LVBA 4XBDA 5FCKA 3P17H 1UCYH 1AUJA 4X2YA 2Y7XA 5FBIA 3M5OA 2EEKA 3RMNH 4AORA 4X0WU 1ANDA 1DPOA 1O30A 2OC0A 1A61H 2A1DB 1SLVB 1TGSZ 3EDXB 4OS2A 2FDAA 3RXHA 4DGJA 2AFQB 3GCTF 2WYGA 1CBWB 3HGNA 2P59A 9ESTA 1PQ8A 1F2SE 2NU1E 4WMFA 3ZYDA 4UFEH 1AFEH 2PKSC 2BY8X 4Y0YE 1P2JA 1HIAA 1E34B 1L2EA 4DIHH 1C5VA 1W14U 2P16A 4ZKRU 2VIWA 2OBQA 4GUXA 2O8TA 5PTPA 2AS9A 3RU4T 2ZDMA 2Q6FA 3GISB 1IQKA 1N8OC 1O3FA 1TFXA 3N7OA 2ZHEH 2B5TB 3DD2H 2HPQH 1QFKH 1HAVA 3PWCA 1SGFG 1LPGB 3KGPA 4XBBA 2HWLB 5EOKA 3F6UH 1NRSH 1NFUA 3NCLA 4QT8C 4INHA 1NN6A 5T6GA 3SU1A 4B73A 1E0FD 1GJ8B 2G81E 1K1PA 4JYTA 4KTCA 2Y5HA 1ZMJA 1AB9C 4I8LA 3LT3A 3UWIA 1HJAC 4F49A 2DE8A 1FY5A 1O38A 1VITG 3A7WA 1EAWA 3H7TA 1G36A 1HIAB 2ZDLA 1K28D 2IN2A 3H7OA 3M7QA 1YPHC 1IQFA 2R2MB 3LH1A 1PYTC 3BTWE 2SFAA 3S69A 1P2KA 1UHBA 1Y8TA 1LVOA 1DS2E 1VJAU 3FZZA 1V6DA 1GJ7B 4ABEA 4TYDA 2XXLA 1G30B 4B71A 5IDKA 4ZKOU 1DY9A 1P02A 4MNYA 1SI5H 1HAVB 1C1TA 4BAOB 3BV9B 2TGTA 2XNIA 1GBLA 3K65B 5E0GA 4K3JA 2AEIH 5LPFA 5L6NH 5EPYA 4CREA 3PLPA 3GDUA 4SGBE 3IG6B 1TIOA 5AVDA 2EC9H 1GHAG 2OC8A 1B7XB 4CBNA 1P09A 2VWMA 3FAOA 1V2ST 1ZOMA 1CQQA 2CV3A 3SGBE 4J1YA 1QHRB 4IN2A 1BRAA 1F7ZA 3NPSA 3VFEA 1QRXA 1RIWC 1RXPA 2BZ6H 2GCTB 5HYOA 1UHBB 3M3SA 1P11E 2OQUA 1O2NA 1TNGA 2ZGBH 1GJDB 4LZ1H 3V0XA 4RKOB 2SGEE 1C2GA 1MTSA 1W12U 2P95A 3BEFB 1BDAA 4ZHMU 2M5TA 2JKHA 5AHGH 4K8YA 3BIUH 1C4U2 1RTKA 3S9CA 1JRSA 3BTQE 3ATKA 2BVXH 2BB4A 2JH6D 2W3KA 2EA3A 2ZPQA 2GP9B 2F9VA 4AB8A 1GI2A 8KME2 4BAMB 1UTKA 1HV7A 1HCGA 4CH2B 2XBXA 2ZPSA 2GT8A 3CENA 1F92A 1OXGA 2XCNA 3K6YA 1B0FA 1GVKB 3PM3A 3SNAA 1DICA 2SGAA 1O3AA 4D8NA 4Y79A 4IW4E 1GMDG 2Z9KA 1WQSA 5A8YA 1O5FH 3MU8A 1DDJA 1QR3E 3HKJB 1GDUA 5E2PA 1MTUA 1P2QA 2FOCA 3M3VA 3B8JA 1K2I1 1FV9A 2BVRH 3BF6H 4NGAH 2JETB 2ZPRA 4X1NU 2C8ZB 2FM2A 1B0EA 3M5LA 1OPHB 1GHYH 3RDZA 3STJA 3GY7A 4RSPA 5B6OA 2UWOA 5E0JA 2ZTXA 2GTBA 4Y6DA 1EASA 1ACBE 3E1XB 3UQVA 1TQ0B 2ALVA 1YCPH 1C5LH 3U8OH 2F3CE 1C2KA 1P01A 1TALA 2FPZA 3K6ZA 4D9RA 1TMBH 1GI6A 3KQEA 3M37A 1NRRH 4K60A 1Y5AT 1BTXA 2BLQA 3EYDA 2QXJA 1VITF 1GL1A 1MZAA 2EI6A 2BQWB 4JZIA 5TCAA 1RRKA 5SGAE 2BD4A 3KNXA 1KIGH 4FUCA 2FOFA 1KLJH 2IOTA 3MU5A 2GZ8A 2Z9JA 5EW1H 2UUJB 3GICB 3RC5A 1SC8U 1XVOA 3GY4A 1EZXC 1BRBE 2BDIA 2ZI2H 4Q80A 1P2MA 5T6FA 1DUEA 2XC4A 3RXGA 3VXEH 4AB9A 1Y5BT 3ZVDA 1PPFE 1XXDA 2P3FH 1HAXB 1FI8A 1E37B 4BAKB 3QTVH 4KELA 1TLDA 2RDLA 4SGAE 1VGCB 2SNVA 1GHAF 1OP0A 2ZGHA 2R0KA 1O3LA 3A84A 1FN6A 3RXPA 1GI4A 1G3DA 1O35A 1C2HA 1JBUH 3ZZ4A 1GCTB 2VNTA 1O2HA 2BOKA 3NUMA 2AIQA 1GJ4H 4DG4A 1MTWA 1C1UH 1MKXK 1O39A 1SGEE 1ZSLA 3ATWA 4ISOA 3ZZ7A 3O8CA 3RXMA 1TNIA 1BBRK 3ZZCA 3ZZ5A 2Q6GA 4TY7A 1SQOA 3T26A 3AW0A 1SLWB 3PO1B 3A7YA 4GVUA 1H4WA 4Q7YA 1IQJA 3LONA 5JPMH 1ELBA 2BZAA 3RMOH 2O8UA 2VB0A 1AGJA 2BY9X 1V2MT 1NESE 1NFYA 1BRUP 1TNHA 1HLTH 1TQ7B 1BMLA 5GIBA 1FXYA 3Q77A 3ZZDA 4H4FA 4YESB 3A89A 3GCHC 1GI1A 2VVUA 1GG6B 3ZVBA 2OXSA 1LVMA 2FI5E 1OWIA 3MTYA 3M5NA 4AN7A 1XUIA 4O03A 3OTJE 1GMDF 3SZNA 3SHCH 3NZIA 4A6LA 1MUEB 2AH4X 2XBWA 1G32B 1GJBB 1UVUH 1ARCA 3M7UA 2AMQA 4R0IA 1P2NA 1EB1H 1V2OT 2BXUH 1Q3XA 1CU1A 2CHAB 1RTFB 1UO6A 2P94A 5AFZH 3TNSA 4UDWH 5EU8A 4X8TH 1S0QA 3RU4E 2Y5FA 2NU2E 4ASHA 5C1UA 4HI3A 3RXUA 1TPOA 4K5ZA 4UFGH 2I6SA 2F9PA 1RTLA 2Z6BD 3RLYH 3VPKA 1Y3VA 1DM4B 1HAGE 1O3NA 1OYQA 3GDSA 2ZDKA 2G5NA 3HKIB 2QC2A 2VIQA 3ODDA 2GT7A 3MH5A 2SGDE 1G3BA 1AFQC 2FESH 3IITA 2P3UB 3MO6A 1BTHH 1G2LA 2WV5A 1WAYB 1YKTA 4ZAEA 3CS7A 3B9FH 1EATA 2BYAX 1YBWA 1A0JA 2Y81A 1EAIA 1S84A 5E0HA 4X2XA 5DPAA 4WMEA 3UR9A 3LGWA 5EQQA 4YOIA 3TITA 1C5SA 1C9PA 1MQ5A 1YF4A 1ARBA 1THRH 3ATMA 1G9IE 1MAXA 4ABDA 2TGAA 1IOEA 1Z6EA 1PPGE 4D76A 5CHAC 2A5KA 1O2RA 3RM2H 1OWEA 4BOHA 4X2VA 1YP9A 2UUYA 2FTLE 1O3JA 2TPIZ 3GY6A 1TRYA 1SLUB 2ZU2A 1K1MA 2W5EA 1Q31A 4ABBA 3NK8A 4UE7H 4BAQB 1UTNA 1J16A 4CRDA 3A7ZA 2WPLS 1G3EA 2OD3B 3PLKA 4A1XA 3OY5U 2GDDA 3A83A 1C5UA 1OX1A 1QGFA 1A5GH 2ZFSA 4X1QU 4A7IB 1KLIH 3VB3A 2AGGX 4NWLA 2ZTYA 1BMNH 2ZGJA 1A7SA 2FIRH 1LKAA 2G4TA 2ZEBA 3U1IB 3ESTA 4XSKU 5EQSA 1C5NH 1CGIE 4Z6AH 1GWAA 1W2KH 3QWCH 2BD2A 1SGPE 2K1QA 1S81A 4OS4A 1SQTA 4LZ4B 2C90B 1T8MA 3MNXA 3KCGH 2PUXB 1ZTLA 4NZQA 2QY0B 1MU8B 1O3HA 1OOKB 3SJKA 2OQ5A 1AWFH 3MHWU 1SVPA 4FXGH 1BTUA 1UVTH 2P8OC 1GJ9B 3A86A 3F9EA 3PMBB 2VWLA 1DX5M 1AZ8A 1LMWB 1KSNA 4K1TA 3L33A 3MO3A 1FY8E 1OS8A 2ZDNA 1W10U 1ZJDA 1GDQA 4LOYH 5JYIA 5K7RA 1AQ7A 2BDCA 6LPRA 5L30H 3FZDA 2ANYA 1PQ7A 2BQ7B 2FX4A 1UTMA 3JZ2B 1AIXH 3RXSA 2EI8A 4X6NA 1S0RA 2ZHWH 3UNRA 1SB1H 1EOLA 1K1JA 2ZU5A 1SOZA 3P8NA 2A2QH 1NU9A 1CGJE 2YNAA 1XMNB 1FY4A 1T32A 1EB2A 1IQLA 2A7JA 3TNTA 1W0ZU 3A8BA 3LC5A 1AHTH 5DP9A 4WXVA 3CS0A 1EKBB 1FN8A 3H5CB 3TJOA 1LVYA 4CH8B 3RXDA 1G2MA 2PFEA 1PPHE 3SUEA 1PFXC 1YLCA 3F1SB 1O2UA 3BTDE 3ZVEA 1AD8H 1GBHA 4CBOA 4Y8YA 1Z8JB 2ZCKP 1ZGVA 1L4ZA 5GCHG 4JCNA 1BZXE 1MBQA 3TGJE 4JZFH 1ELAA 3ZZ9A 1CHOG 3BTME 2R0LA 3SV7A 1QL9A 3ZZBA 2FI4E 4DURA 1O2ZA 2OUAA 2WYJA 2BD5A 1LDTT 1DE7H 1DWEH 2KAIA 8GCHG 2W7UA 1YPLH 3RMMH 4R8TB 1TGCA 5EG4A 1YGCH 2Y7ZA 2R3YA 2FS8A 1V2RT 4I33A 4YTAA 1YC0A 1GVLA 3RXKA 1EJMA 2ESTE 3P8GA 1A5HA 1V2KT 2G55A 3PROA 1HAZB 1HNEE 1UTOA 1WQVH 4MNXA 2A4GA 3E91A 2C8WB 3F9GA 1O31A 4ABAA 1SGDE 2FS9A 3SOSA 4CHAC 1W7XH 1O3MA 3GOVB 4UFDH 1HPGA 1TX7A 4NA7A 2ZU4A 1QQUA 4NIXA 4AZ2B 2FXRA 1ELGA 1ZSJA 1O5GH 2CXVA 1H9LB 1O37A 3MH4A 1NC6A 1ZZZA 4ESTE 3MH6A 1GBFA 4JK5A 4X1SU 1FJSA 3A8AA 2WUCA 1JOUB 2PSYA 1UVSH 1BHXB 1NFXA 2KAIB 3DUXH 1IQMA 2ASUB 5E2OA 1TOCB 1ZJKA 3BTKE 1Z7KA 4DVAU 1BJUA 3TH4H 2FP7B 4DJZB 2LPRA 1EJNA 3EA8A 2F83A 1HXEH 2GD4B 1TPPA 2QGRA 4X6MA 1J15A 1QB9A 1IQEA 1Q2WA 2STAE 1YPGH 4RN6A 1P12E 3RC6A 1PYTD 1WTHD 3M36A 2IPHA 4ABHA 2QF0A 2PKSB 2P93A 1NRPH 1L4DA 1QBOA 2ZCLP 1GDNA 5F03A 4XE4A 4X1RU 1RS0A 4AG2A 2J95A 3QLPH 2G5VA 2ZA5A 2BVSH 1O2SA 5CE1A 1MTNC 2J94A 4CRAA 7GCHG 4IC6A 3PYHA 1N8OB 4Q7XA 4E7RG 1AVGH 4YT6H 1QJ6B 1K21H 4MPXA 1NU7B 5HMAA 4B2AA 4UFFH 2G00A 3UOUA 3TGIE 3C27B 5C3NA 1MKWK 1GMCG 5T3HA 1DWDH 3D23A 1QY6A 1Z8GA 4WH6A 3RXOA 1P05A 2F9OA 2FLBH 4B2CA 5DO4H 3TK9A 2Z94A 4K1EA 2DE9A 4BNRA 2V35A 1SGYE 3GCOA 1ANCA 1AB9B 2NU0E 4X8SH 3SO3A 1LQEA 1BTPA 1QA7A 3F68H 1O5CB 4NSVA 1Z8RA 2QIQA 1ZHPA 1FPCH 3SNBA 1C1QA 1SGTA 2XCFA 3MFJA 3ZZ6A 4B1TA 1O2LA 1C1NA 1MH0A 1TRMA 2BD8A 2CF8H 1DSUA 1V2QT 5A0AE 2SGFE 3VB5A 1EXFA 4YT7H 3PMJA 4IMQA 1C4Y2 4A5TS 4AGKA 5GCHF 4D7FA 1V2LT 3E16B 3RC4A 1BBRE 3ZVCA 3UNQA 3QUMP 1V3XA 2FOEA 1DLKB 1CHOF 1KXDA 1ELEE 3M61U 1T8LA 5C5OA 1JIMA 3FANA 1C1RA 4YLQH 1NRNH 4HFPB 3KN2A 1O0DH 8GCHF 4U2WA 1F0RA 2EI7A 3A7TA 3L6PA 5AFYH 3W94A 4NFFA 4HTCH 2FODA 4WXIA 3LKWA 4FUEA 4A1VA 3EA7A 2ZFPH 1OWDA 4H42U 1S6HA 4DW2U 4TWWA 3M5MA 2F91A 1E36B 1PPBH 2BXTH 2BLWA 1C1PA 2PTNA 3QGNB 2ZDAH 1YCPM 4MVNA 1TA6A 3SU6A 4B75A 4IBLH 4JYUH 3RXRA 3FFGA 1C5MD 4TPYA 1AU8A 1HUTH 1EZSC 2PLXA 1ELTA 2B7DH 3RXBA 1TYNA 2H5CA 2XWAA 3A7XA 1WYKA 2ZECA 1DXWA 5H4IB 4NCYA 1AI8H 8ESTE 2C3SA 1B5GH 1O33A 1T8NA 5IYTA 1FONA 4JMYA 4MNVA 3RP2A 4MPUA 2ZFFH 2AGIX 4X6OA 3F9HA 1QBNA 3V12A 1TNKA 1W13U 1K1NA 3A81A 3SORA 2B0FA 3BTFE 3HGPA 4KKDA 1P03A 2AGEX 5C2ZA 1A0HB 1LTOA 2QF3A 2VIOA 1Y3WA 1P9SA 1LO6A 1BMAA 4O9VA 4GHQA 2OC1A 1FY1A 1DY8A 4K69A 4I32A 1D4PB 1BIOA 2HOBA 3OX7U 1ZHRA 2H9HA 2OTVA 5GXPA 5LGOA 2BM2A 1OWJA 2PGQB 3SV6A 2ZG0H 3Q00A 3SI4H 7GCHF 1O3BA 3BIVH 4YM9A 1YM0A 1QJ1B 1C1WH 3GDVA 1HAHH 2VJ1A 2XRCA 3BEIB 1BTYA 2XWBI 1K22H 4AYVB 3SGAE 1GMCF 1MD7A 1KXCA 2ZQ1A 4WF8A 3RMLH 2AYWA 2VGCC 1C2JA 4NFEA 3ELAH 2I6QA 1T7CA 3P8OA 1Y3UA 4ABJA 2H2ZA 1ESAA 3JZ1B 3PMAB 4KTSA 1A3EH 2J9NA 3ZV9A 5GPIB 3ZVFA 3GYLB 3U9AH 3K9XB 5GJ4B 3SU5A 1O3IA 3D62A 1HXFH
chains in the Genus database with same CATH superfamily
3SU3A 1GMHG 3LJOA 1MKXH 1YLNA 1SLXB 2RA0A 1VKYA 4TPIZ 1OSSA 2ZIQH 2Z9GA 1EZUC 3A80A 1TAWA 2OC7A 5FHTA 3PO1C 1BTZA 1MQ6A 2VH0A 3P70B 4FUJA 1BBRH 4FUHA 4DIIH 2CK3D 5DGJA 3UQOA 1OWKA 1MCTA 2KM0A 1TGNA 1W0YH 3LGYA 5C20A 1DXPA 3VEQB 1TPAE 1CHGA 2GDEH 4FU9A 5DKMA 2FO9A 2A4QA 4Y8ZA 3A8CA 3PB1E 1O2JA 1KXBA 2J4IA 4RKJB 3A8DA 4MNWA 1C9TA 2BTCE 5F8ZA 5J4QA 1EX3A 1ZPCA 4I31A 1W0JD 1E38B 3KYFA 2BHGA 1ABJH 1SFIA 4A1TA 3RXFA 5EODA 1P10A 2ZFQH 4ZXYH 3DT0H 1ETRH 1GHWH 3SV2H 3TK6A 4X8UH 2K7XA 3VGCC 1OYTH 5GDSH 5T1VA 1IQNA 4BTUB 1D3QB 2AMDA 4ACBA 2QE7D 2A32A 2C4FH 2RG3A 1KXFA 4TWYA 1BMMH 1IQGA 3UWJH 1SGQE 1WBGB 3CP7A 2BX3A 2VWNA 1V2VT 2ZTZA 4KP0A 5JBBS 2H5DA 1W7GH 2HALA 6CHAC 1P3CA 3BTEE 4I7YH 2BDGA 2FEQH 3GCNA 2FWWA 5F6MA 3N7EA 1EFRD 3MNBA 4JK6A 3BSQA 3P95A 2GJGA 4MPVA 1AVWA 3RXJA 1M9UA 1FY3A 3D65E 1LHDH 1LHFH 1IQIA 1MBMA 3EAJA 2QA9E 1CVWH 5TJXA 3TGKE 4Y10E 1GHBG 3GS9A 4Y76A 1DUAA 3GCHB 1EPTA 4H6SB 1QTFA 1ZMLA 4OGXA 3BTHE 2PKAA 1MTVA 2GKVE 1O5AB 1C5WB 1WU1A 1GGDC 2WZQA 2G51A 5FPSA 1OKXA 1DWCH 3DCLA 1W11U 3DFJA 3GY3A 2GCHG 4U32A 4MTBA 2HPPH 3ATLA 2D1JA 1UW7A 2XC0A 3Q3XA 1P8VC 1AY6H 2TIOA 1ESBA 2RFKC 4I8KA 5F53A 2EY4C 5E8EH 3SNDA 3AVZA 2BX4A 1IHTH 4ZH8A 1C1SA 4NG9H 1F0SA 4JZDH 3S7HB 2B9LA 5FAHA 5HKKD 1GJAB 1TABE 1O3EA 2QV1A 2ZC9H 4UEHH 3WW7A 1GBAA 1PJPA 3SV9A 3PMHB 1SMFE 5EXLA 1EPTB 2FOMB 3MI4A 1HRTH 1C5PA 2RCEA 2EQNA 1AFQB 1O34A 2PKAB 1H8DH 4Q2KA 5LPEA 3FVFB 5FBEA 5FX6A 1V2WT 1YPHE 2C8YB 2FTMA 3RLWH 4B6EA 2IJD1 3KQ5A 4FU7A 3RXQA 3K2UA 1KY9A 2GV7A 4RI0A 2W7SA 1GMHF 1SBWA 2QN5T 2JH5D 1D3TB 1TX6A 3BN9A 2RDEA 3U8RH 3G01A 2XYAA 2W3IA 1C4V2 5EQRA 4YZUA 2ZFRH 4LXBH 3RXAA 1TGTA 5DP3A 1DANH 5CHAB 3E90B 5DP6A 1GBCA 1T31A 1VR1H 3E8LA 2ZDVH 1A5IA 2K8IA 3T28A 3A88A 1P9UA 4BANB 3MMGA 3OYPA 1GJCB 1C1VH 1O2TA 4HGCA 3AW1A 4A92A 1UMAH 2PWXA 2A45B 4I8HA 1H9HE 4CR5A 5JBAS 2TBSA 1QB1A 3BG4B 1CA0C 4FU8A 1HAYB 3BG8A 3ZVGA 1GHVH 3LC3A 3UNSA 4DT7B 2ANKH 1DOJA 3PLBA 2Y5GA 3HK6B 2Z3EA 4XRNA 3EE7A 2F9NA 3PTNA 2GMTC 2G8TA 2THFB 2V3OH 1E35B 4JYVH 1T4UH 1O2KA 1O3GA 4IN1A 1WTGH 4AFSA 1L1JA 2ZWLH 1RD3B 4WWYA 1INCA 1TPSA 1HFDA 1EUFA 1O5BB 1IHSH 2NU3E 1AN1E 1FIWA 1H8IH 1QJ7B 4TT3D 3QGJA 1YWUA 2F4LA 2FOBA 2FZZA 3RM0H 1TRNA 3ZZ3A 1OP2A 2BDYA 5FXLA 1ID5H 2BMGB 1KDQA 2WPHS 3SUFA 4AYYB 1Z1IA 3QO6A 2YMSC 2ZCHP 4O3TA 5A0BA 2STBE 4WMDA 1SGFA 1HAOH 1GHBF 2PSXA 4ABGA 2P8OB 3KQCA 4MPWA 1C2LA 4DY7B 1KXEA 5A2MH 2A5AA 1NO9H 1TBQH 1ETTH 3PWBA 1D6RA 1XUKA 1XKBC 3UPEA 3KIDU 1BT7A 1E1RD 2KCYA 4JZ1A 4D9QA 3S7KB 1ZHMA 3NWUA 1NROH 4TY6A 1GJ5H 2ANMH 4ZKSU 3RXLA 3SNEA 2GCHF 3OY6U 3TJVA 5HXFA 3UR6A 4FUIA 4GPGA 1SG8B 3TK5A 3AK5A 1L1NA 2KCOA 2ZQ2A 2F9BH 2ILNA 5KEDA 5ETXA 2VVVA 1HBTH 1JWTA 1H1BA 2P3TB 3WWFA 1KDQB 4FUFA 2HNTE 1S85A 2GX4A 4ISHH 5FX5A 4NWKA 4BXWA 2L6OA 5DSFA 3SW2B 4IMZA 1ZPBA 5TCCA 1T4VH 2D8WA 3Q76A 3S9BA 4CRFA 4YOJA 1UK4A 1C2IA 1NZQH 1P06A 5HM9A 1GBKA 1QRZA 3DFLA 2ZO3H 4VGCB 3R0FA 1D3PB 3M7TA 4AFZA 5EIYA 2BDBA 4AFQA 1SHHB 1O2YA 3O8DA 3MU0A 1WV7H 7LPRA 1CBWC 1XUJA 3ATIA 2FLRH 4Y7BA 1KTTB 1C5TA 4NIYA 4ISLA 1BQYA 3SU2A 1C5QA 2PGBB 4ISNA 5I46H 3T5FH 3MOCA 4JZEH 4NIWA 4GSOA 1DT2A 3RXCA 1XXFA 4Y71A 1TBZH 2UWPA 3U8TH 1PPCE 1W3CA 1ZTJA 4MG3A 1GI9B 4J2YB 3D49H 3UOPA 1THSH 1UTJA 1S6FA 1C1OA 4INKA 1UCYK 1QIXB 2V3MA 2ZF0H 2WPJS 3C1KA 3TJUA 3A7VA 3RUOA 2BLOA 3NXPA 1O2XA 2V0BA 1LQDB 4GCHG 3QZQA 2V3HH 3S9AA 1AKSA 4OS7A 5JBTA 1VCPA 1WCZA 1NBME 1GBDA 1O2PA 2CJIA 2A5IA 3KQDA 2Z9IA 3LJJA 2D2DA 1AO5A 2BDAA 2QYIA 3UIRA 1CO7E 5K0HA 5DP5A 5JDUB 1SHYA 1A1RA 1O2QA 2ZNKH 1O2WA 3NKKA 2AIPA 3F0OA 2OK5A 5L2ZH 1V2NT 5F8TA 1TMUH 4CHAB 3SU4A 1O2VA 2HLCA 4B76A 4THNH 4Z1MD 5A8ZA 5C17A 5EW2H 3MQKC 2NU4E 3SV8A 2VVCA 1L1GA 4AGJA 3E0PB 1A3BH 1SPJA 4CRCA 1VCWA 2WPMS 2PHBA 3QZRA 1MAYA 1DITH 1D6WA 3N99A 1T8OA 2BY7X 3LOXA 1EJAA 1HB0B 3E0NB 1QA0A 3TU7H 4FUBA 2PUQH 3SJIA 1AKSB 1ZMNA 2R9PA 1XVMA 2ZKSA 4E06H 1MKWH 4ABFA 4INLA 3WWBA 2FX6A 5EGMA 3LGVA 2VIVA 4NZLA 1TNLA 2ANWA 1EQ9A 1K9OE 3P92A 1P3EA 2O9QA 1YPJH 1C5ZB 2BY5X 2XTTB 3SNCA 1HJAB 1K1LA 1O2MA 3T27A 1HJ8A 1S83A 4ACAA 1GVZA 3S0NA 1UTQA 1MMJN 4NIVA 1O2IA 2BLVA 2GCTC 1YPEH 1ETSH 1MTNB 1KMHB 2SGQE 1QL7A 3BTGE 9LPRA 3KL6A 3FP6E 2BD9A 4B6FA 2IPQX 1ANEA 1JXPA 5FPYA 3MNSA 1ZYOA 1S6LA 3LU9B 1DVAH 4HZHA 1SSXA 2CF9H 1JRTA 1W8BH 3H09A 4MDSA 2JJ2D 3U69H 2OCVB 1JMOH 2Q1JA 3SGQE 2HGTH 4BTIB 3SN8A 4ISIH 5C0TA 6ESTA 1WXRA 3UREA 1QB6A 1UTPA 2QXIA 1V2PT 2UUKB 3WY8A 2LIZA 1PPEE 2ODQA 3SJ9A 5J4SA 3UUZA 5A8XA 3FKSD 1KLTA 1TBRH 4ZHAA 5BPEA 4OS1A 4BTTB 2ODYB 1OHHD 1VCQA 2BD7A 1GHZA 1G3CA 2ZHQH 4CR9A 3T62A 5EPNA 1ELVA 1LHGH 1GBTA 3T25A 1SL3A 1NFWA 3ZYEA 3MYWA 1GI0A 2UUFB 3GY5A 2WV4A 4RT1A 3GY8A 1RIWB 2TGPZ 3QTOH 4H6TA 1ZSKA 3LDXH 4NA8A 1FDPA 2Z9LA 1AVXA 1CE5A 3A85A 2Y82A 3TLOA 3M3TA 1HJ9A 4NSYA 5DG6A 2JH0D 1TONA 3EQ0H 4FVDA 5T6DA 4KTUA 1KTSB 3STIA 2QXHA 2QXGA 4Z0KA 5FPTA 4ZROA 3F9FA 2HVXA 4K1SA 2ZZUH 2JETC 1EP5A 1BTWA 2GZ7A 3RXEA 4GCHF 2NWNA 1SGRE 2ZU1A 3TPIZ 5KGOA 2KCAA 4LK4A 1UK2A 1IQHA 3DA9B 1O3DA 2ULLA 1FIZA 1YLDA 1FUJA 3KEEA 1K1OA 4AFUA 2FI3E 1CSOE 4XFQA 5JB9S 2QAAA 4O3UA 1V2JT 1S5SA 2QCYA 1ELCA 3HATH 2QF5A 2VU8E 3B23B 1BRCE 1PPZA 2J97A 5DJ7A 3TH3H 4YOGA 1C5OH 1PQ5A 1ANBA 2VIDA 2OINA 1FPHH 1O5EH 2HNTC 2C93B 3T29A 1MCVA 1V2TT 1SGCA 1X7AC 1HAPH 3SBKA 2WUBA 1V2UT 4K2YA 3SYJA 1YCPK 2CGAA 1DLEA 2VINA 4XOJA 2ZHDA 4IS5A 4UONA 1C1MA 4XBCA 4AOQA 2OP9A 3LH3A 1FAXA 1P0SH 1DFPA 3LIWA 4DCDA 1UK3A 1NRQH 2XOKD 1VGCC 4GAWA 1DWBH 1GBJA 1GI7B 4Y11E 1GCTC 4YXWD 1YPMH 5AF9H 2BDHA 3E3TA 2ZU3A 3FOAA 3A87A 1CT0E 2H9EH 1ZGIA 2ODPA 1MD8A 3MU4A 2Q6DA 3DSGA 3BTTE 1JIRA 1O36A 4ZXXH 3W95A 4AX9H 1BHXF 2WPKS 1C5YB 2Y80A 2J2UA 1FMGA 2FYRA 3ZIAD 2PV9B 2VGCB 1HYLA 2FMJA 2SNWA 1N6YA 5BRRE 3A82A 3PRBA 2SGPE 3U1JB 3MWIU 1A2CH 3PTBA 3QK1A 3VXFH 5C5NA 8LPRA 5HIZA 1C5XB 1SGNE 6GCHG 2ZP0H 2BD3A 1RGQA 2O8LA 4M7GA 3RXTA 1H8HD 3SQHE 1J9CH 1D9IA 3EBNA 3V3MA 3P8FA 3LPRA 1GG6C 4Q63A 1NS3A 1Y5UT 1H9IE 1SGIB 1EP6A 4FUDA 2HRVA 3R3GB 1KXAA 4UD9H 3SI3H 1EAUA 4ZUHA 3VB7A 2F9UA 3ZZAA 1C2FA 3ENSB 1AWHB 1EZQA 2J92A 2R3UA 3PRDA 4Y0ZE 1GI3A 5G4BA 4O97A 1BB0B 4FVBA 2CHAC 3RXIA 1XM1A 2AMPA 4D7GA 3HPTB 2YNBA 4Q7ZA 4BXSA 3Q3YA 3HK3B 1QBVH 3AAUA 1OP8A 1C5RA 1C2DA 3LGTA 3OAAD 1D3DB 3ZV8A 1HDTH 1YYY1 4OS6A 2FOGA 3AAVA 1O5DH 1CT4E 1VZQH 2IJOB 4XDEA 2G4UA 1MZDA 5EXNA 3FP7E 4Y7AA 1UVPA 1ESTA 4BAHB 3VGCB 5DK1A 4IC5A 3QN7A 2H1UA 1GBEA 3LGIA 1LCYA 1O2GH 3IWMA 1FQ3A 1GJ6A 2ALPA 3MH7A 3GYMA 3KF2A 3SUGA 3OFND 1BOQA 1J14A 1FZZA 1RFNA 1YPKH 3TIUA 2A7CA 2H6MA 1W0KD 2A4OA 5GNDA 6CHAB 1XX9A 1O3CA 4GLYA 2A4RA 2Z3CA 4E05H 1ABIH 5HIYA 1XUFA 5F8XA 5FCRA 3UFAA 1LKBA 3EGKH 1QL8A 1EAXA 4NA9H 4OS5A 3SU0A 4YO9A 3URCA 2W26A 3ITIA 1C2MA 3PV4A 5GWZA 1EPTC 2GGVB 4ABIA 5C1XA 1N6XA 1A4WH 3OU0A 4DOQA 1O3OA 2TRMA 1G37A 2BQ6B 2XW9A 1VJ9U 3BEUA 1TE0A 2LP6A 5ABWA 4WH8A 2FOAA 4PROA 1ZPZA 1GGDB 2J34A 3EE0B 1TB6H 1GBMA 2OBOA 4B74A 5L2YH 5EJLA 5JBCS 4MQAA 5C67A 1MU6B 1SOTA 1ZRBA 4KGAA 3U98H 1QQ4A 4X2WA 3SQEE 3SJ8A 1N1LA 3L3TA 2Z3DA 1WSSH 1LHEH 2H9TH 3CNRA 5A0CA 2Z7FE 4WVPE 5LH8A 1UTLM 2J98A 3TH2H 2V7QD 2VWOA 1Y59T 1UCYE 1BJVA 1SQAA 2AERH 2XC5A 3TJNA 1P2IA 2VIPA 4MLFB 1PQAA 1UVOA 1DSTA 2B8OH 2BY6X 3I29A 1ORFA 2W6JD 2A2XH 3BG4C 4E7NA 1TA2A 3GY2A 3MU1A 1YY3A 2GZ9A 5CMXH 6GCHF 3GCTG 2PR3A 1Y3YA 4I8JA 4CRGA 1THPB 2TGDA 1QCPA 3I77A 3I78A 1P2OA 1TWXB 4X6PA 1ELDE 5DP4A 2RA3A 2BOHB 3LGUA 1GBIA 1VITH 1IAUA 1Z6JH 1SFQB 5HM2A 7KMEH 2R2WU 3SUDA 3F2GA 3F0PA 1RJXB 1GCDA 1C2EA 2WPIS 5DP8A 5LPRA 1UJ1A 2XBVA 2ZFTA 1FAKH 1Z1JA 2HNTF 2J98B 1FLEE 1ZTKA 4K8BA 3SJOA 3SHAH 2HLDD 3FP8E 2V6NA 2YMSD 1NY22 2FYQA 2KCPA 5HGGA 1LPZB 3UTUH 1TX8A 1BCUH 3TVJB 2O8WA 5DP7A 2A7HA 4YLUA 1O3PB 4GHTA 2XBYA 1F0TA 3V7TA 1L0ZA 4U01A 1KYNA 1QRWA 1BUIA 1CA0B 2F43B 1A0LA 1FNIA 1LHCH 2VH6A 1ZLRA 1CT2E 1S82A 4X8VH 1SR5C 5C1YA 1GHXH 4Y8XA 1AUTC 2ZGCA 1F0UA 1HAIH 3MNCA 2GMTB 4ZKNU 2CN0H 3E6PH 5I25A 3VB6A 1NT1A 3RXVA 1XKAC 3UY9A 3VB4A 1GI5A 1ZR0A 1EOJA 3P6ZB 3MO9A 1P04A 1NM6A 1WOFA 4WY3A 2GV6A 4WJG2 4U30A 1F5RA 1AE8H 1H8ED 1WUNH 1F5LA 1TOMH 1ZRKA 3O8BA 4CRBA 3URDA 5EXMA 2FOHA 1AE5A 1K1IA 4I8GA 2WINI 1QNJA 1GPZA 1Z71A 2XNDD 1XUHA 4B2BA 3Q3KA 2PW8H 2D26C 1J17T 1COWD 1LPKB 5A09A 1O2OA 3FN8A 3AASA 1TNJA 1J8AA 2YMSB 1NPMA 1O3KA 2CMYA 4P02A 3EA9A 4DT4A 1ELFA 2C8XB 2W6ID 4VGCC 1U6QA 4ZMAH 2UWLA 3KQBA 1A46H 2A31A 3M35A 1O32A 4OGYA 1NTPA 2DUCA 2PTCE 2GVFA 1Y3XA 1Z8IB 1F5KU 5ESTE 3VG8A 3O8RA 2J38A 1BA8B 3V13A 3ZVAA 4AG1A 1XUGA 3DHKH 1QURH 1OWHA 2ZGXH 1GI8B 2LNCA 5ESBA 4ZHLU 1GL0E 3T2NA 4IGDA 3OSYA 2OLGA 1GBBA 1HGTH 3ZZ8A 3QDZB 1TMTH 3QX5H 4FUGA 1P57B 1TGBA 5JB8S 1BITA 1CA8B 7ESTE 2A0QB 2YOLA 4FOUC 1AZZA 2O8MA 3KHVA 2Y6TA 1CGHA 1AMHA 2G52A 4F4OC 3RU4D 3ODFA 4X1PU 2ZHFH 1LVBA 4XBDA 5FCKA 3P17H 1UCYH 1AUJA 4X2YA 2Y7XA 5FBIA 3M5OA 2EEKA 3RMNH 4AORA 4X0WU 1ANDA 1DPOA 1O30A 2OC0A 1A61H 2A1DB 1SLVB 1TGSZ 3EDXB 4OS2A 2FDAA 3RXHA 4DGJA 2AFQB 3GCTF 2WYGA 1CBWB 3HGNA 2P59A 9ESTA 1PQ8A 1F2SE 2NU1E 4WMFA 3ZYDA 4UFEH 1AFEH 2PKSC 2BY8X 4Y0YE 1P2JA 1HIAA 1E34B 1L2EA 4ZCNA 4DIHH 1C5VA 1W14U 2P16A 4ZKRU 2VIWA 2OBQA 4GUXA 2O8TA 5PTPA 2AS9A 3RU4T 2ZDMA 2Q6FA 3GISB 1IQKA 1N8OC 1O3FA 1TFXA 3N7OA 2ZHEH 2B5TB 3DD2H 2HPQH 5C94A 1QFKH 1HAVA 3PWCA 1SGFG 1LPGB 3KGPA 4XBBA 2HWLB 5EOKA 3F6UH 1NRSH 1NFUA 3NCLA 4QT8C 4INHA 1NN6A 5T6GA 3SU1A 4B73A 1E0FD 1GJ8B 2G81E 1K1PA 4JYTA 4KTCA 2Y5HA 1ZMJA 1AB9C 4I8LA 3LT3A 3UWIA 1HJAC 4F49A 2DE8A 1FY5A 1O38A 1VITG 3A7WA 1EAWA 3H7TA 1G36A 1HIAB 2ZDLA 1K28D 2IN2A 3H7OA 3M7QA 1YPHC 1IQFA 2R2MB 3LH1A 1PYTC 3BTWE 2SFAA 3S69A 1P2KA 1UHBA 1Y8TA 1LVOA 1DS2E 1VJAU 3FZZA 1V6DA 1GJ7B 4ABEA 4TYDA 2XXLA 1G30B 4B71A 5IDKA 4ZKOU 1DY9A 1P02A 4MNYA 1SI5H 1HAVB 1C1TA 4BAOB 3BV9B 3OTPA 2TGTA 2XNIA 1GBLA 3K65B 5E0GA 4K3JA 2AEIH 5LPFA 5L6NH 5EPYA 4CREA 3PLPA 3GDUA 4SGBE 3IG6B 1TIOA 5AVDA 2EC9H 4XD7D 1GHAG 2OC8A 1B7XB 4CBNA 2PP6A 1P09A 2L74A 2VWMA 3FAOA 1V2ST 1ZOMA 1CQQA 2CV3A 3SGBE 4J1YA 1QHRB 4IN2A 4F55A 1BRAA 1F7ZA 3NPSA 3VFEA 1QRXA 1RIWC 1RXPA 2BZ6H 5KECA 2GCTB 5HYOA 1UHBB 3M3SA 1P11E 2OQUA 1O2NA 1TNGA 2ZGBH 1GJDB 4LZ1H 3V0XA 4RKOB 2SGEE 1C2GA 1MTSA 1W12U 2P95A 3BEFB 1WDIA 1BDAA 4ZHMU 2M5TA 2JKHA 5AHGH 4K8YA 3BIUH 1C4U2 1RTKA 3S9CA 1JRSA 3BTQE 3ATKA 2BVXH 2BB4A 2JH6D 2W3KA 2EA3A 2ZPQA 2GP9B 2F9VA 4AB8A 1GI2A 8KME2 4BAMB 1UTKA 1HV7A 1HCGA 3OEHD 4CH2B 2XBXA 2ZPSA 2GT8A 3CENA 1F92A 1OXGA 2XCNA 3K6YA 2JDID 1B0FA 1GVKB 3PM3A 3SNAA 1DICA 2SGAA 1O3AA 4D8NA 4Y79A 4IW4E 1GMDG 2Z9KA 1WQSA 2WPDD 5A8YA 1O5FH 4OM9A 3MU8A 1DDJA 1QR3E 3HKJB 1GDUA 2WV9A 5E2PA 1MTUA 1P2QA 2FOCA 3M3VA 3B8JA 1K2I1 1FV9A 2BVRH 3BF6H 4NGAH 2JETB 2ZPRA 4X1NU 2C8ZB 2FM2A 1B0EA 3M5LA 1OPHB 1GHYH 3RDZA 3STJA 3GY7A 4RSPA 5B6OA 2UWOA 5E0JA 2ZTXA 2GTBA 4Y6DA 1EASA 1ACBE 3E1XB 3UQVA 1TQ0B 2ALVA 1YCPH 1C5LH 3U8OH 2F3CE 1C2KA 1P01A 1TALA 2FPZA 3K6ZA 4D9RA 1TMBH 1GI6A 3KQEA 3M37A 1NRRH 4K60A 1Y5AT 1BTXA 2BLQA 3EYDA 2QXJA 1VITF 1GL1A 1MZAA 2EI6A 2BQWB 4JZIA 5TCAA 1RRKA 5SGAE 2BD4A 3KNXA 5DN6D 1KIGH 4FUCA 2FOFA 1KLJH 2IOTA 3MU5A 2GZ8A 2Z9JA 5EW1H 2UUJB 3GICB 2JJ1D 3RC5A 1SC8U 1XVOA 3GY4A 1EZXC 1BRBE 2BDIA 2ZI2H 4Q80A 1P2MA 5T6FA 1DUEA 3PV5A 2XC4A 3RXGA 3VXEH 4AB9A 1Y5BT 3ZVDA 1PPFE 1XXDA 2P3FH 1HAXB 1FI8A 1E37B 3W1EA 4BAKB 3QTVH 4KELA 1TLDA 2RDLA 4SGAE 1VGCB 2SNVA 1GHAF 1OP0A 2ZGHA 2R0KA 1O3LA 3A84A 1FN6A 3RXPA 1GI4A 1G3DA 1O35A 1C2HA 1JBUH 3ZZ4A 1GCTB 2VNTA 1O2HA 2BOKA 3NUMA 2AIQA 1GJ4H 4DG4A 1MTWA 1C1UH 1SQRA 1MKXK 1O39A 1SGEE 1ZSLA 3ATWA 4ISOA 3ZZ7A 3O8CA 3RXMA 1TNIA 1BBRK 3ZZCA 3ZZ5A 2Q6GA 4TY7A 3N7DA 1SQOA 3T26A 3AW0A 1SLWB 3PO1B 3A7YA 4GVUA 2AHME 1H4WA 4Q7YA 1IQJA 5EJ1A 3LONA 5JPMH 1ELBA 2BZAA 3RMOH 2O8UA 2VB0A 1AGJA 2BY9X 1V2MT 1NESE 1E79D 1NFYA 1BRUP 1TNHA 1HLTH 1TQ7B 1BMLA 5GIBA 1FXYA 3Q77A 3ZZDA 4H4FA 4YESB 3A89A 3GCHC 1GI1A 2VVUA 1GG6B 3ZVBA 2OXSA 1LVMA 2FI5E 1OWIA 3MTYA 3M5NA 4AN7A 1XUIA 4O03A 3OTJE 1GMDF 3SZNA 3SHCH 3NZIA 4A6LA 1MUEB 2AH4X 2XBWA 1G32B 1GJBB 3NRLA 1UVUH 1ARCA 3M7UA 2AMQA 4R0IA 1P2NA 4FETA 1EB1H 1V2OT 2BXUH 1Q3XA 1CU1A 2CHAB 1RTFB 1UO6A 2P94A 5AFZH 3TNSA 4UDWH 5EU8A 4X8TH 1S0QA 3RU4E 2Y5FA 2NU2E 4ASHA 5C1UA 3F2HA 4HI3A 3RXUA 2HVYB 1TPOA 4K5ZA 4UFGH 2I6SA 2F9PA 1RTLA 2Z6BD 3RLYH 3VPKA 1Y3VA 1DM4B 1HAGE 1O3NA 1OYQA 3GDSA 3F2FA 2ZDKA 5FL7D 2G5NA 3HKIB 2QC2A 2VIQA 3ODDA 2GT7A 3MH5A 3FO8D 2SGDE 1G3BA 1AFQC 2FESH 3IITA 2P3UB 3MO6A 3F3BA 1BTHH 1G2LA 2WV5A 1WAYB 1YKTA 4ZAEA 3CS7A 3B9FH 1EATA 2BYAX 1YBWA 1A0JA 2Y81A 1EAIA 3UAIC 1S84A 5E0HA 4X2XA 5DPAA 4WMEA 3UR9A 3LGWA 5EQQA 4YOIA 3TITA 4HG6A 1C5SA 1C9PA 1MQ5A 1YF4A 1ARBA 1THRH 3ATMA 1G9IE 1MAXA 4ABDA 2TGAA 1IOEA 1Z6EA 1PPGE 4D76A 5CHAC 2A5KA 1O2RA 3RM2H 1OWEA 4BOHA 4X2VA 1YP9A 2UUYA 2FTLE 1O3JA 2TPIZ 3GY6A 1TRYA 1SLUB 2ZU2A 1K1MA 2KZ4A 2W5EA 1Q31A 4ABBA 3NK8A 4UE7H 4BAQB 1UTNA 1J16A 4CRDA 3A7ZA 2WPLS 1G3EA 2OD3B 3PLKA 4A1XA 3OY5U 2GDDA 2QF4A 3A83A 1C5UA 1OX1A 1QGFA 1A5GH 2ZFSA 2LELA 4X1QU 1KLIH 2K0QA 3VB3A 4A7IB 2AGGX 4NWLA 1K0HA 2ZTYA 1BMNH 2ZGJA 1A7SA 2FIRH 1LKAA 2G4TA 2KFWA 2ZEBA 3U1IB 3ESTA 4XSKU 5EQSA 1C5NH 1MABB 4P00A 1CGIE 4Z6AH 1GWAA 1W2KH 3QWCH 2BD2A 1SGPE 2K1QA 1S81A 4OS4A 1SQTA 4LZ4B 2C90B 1T8MA 3MNXA 3KCGH 2PUXB 1ZTLA 4NZQA 2QY0B 1MU8B 1O3HA 1OOKB 3SJKA 2OQ5A 1AWFH 2J5UA 3MHWU 1SVPA 4FXGH 1BTUA 1UVTH 2P8OC 1GJ9B 3A86A 2JIZD 3F9EA 3PMBB 2VWLA 1DX5M 1AZ8A 1LMWB 1KSNA 4K1TA 3L33A 3MO3A 1FY8E 3UB0A 1OS8A 2ZDNA 1W10U 1ZJDA 1GDQA 4LOYH 5JYIA 5K7RA 1AQ7A 2WSSD 2BDCA 6LPRA 5L30H 3FZDA 2ANYA 1PQ7A 2BQ7B 2FX4A 1UTMA 3JZ2B 1AIXH 3RXSA 2EI8A 5CHBA 4X6NA 1S0RA 2ZHWH 3UNRA 1SB1H 1EOLA 1K1JA 2ZU5A 1SOZA 3P8NA 2A2QH 1NU9A 1CGJE 2YNAA 1XMNB 1FY4A 1T32A 1EB2A 1IQLA 2A7JA 3TNTA 1W0ZU 3A8BA 3LC5A 1AHTH 5DP9A 4WXVA 3CS0A 1EKBB 1FN8A 3H5CB 3TJOA 1LVYA 4CH8B 3RXDA 1G2MA 2PFEA 1PPHE 3SUEA 1PFXC 1YLCA 3F1SB 1O2UA 3BTDE 3ZVEA 1AD8H 1GBHA 4CBOA 4Y8YA 1Z8JB 2ZCKP 1ZGVA 1L4ZA 5GCHG 4JCNA 1BZXE 1MBQA 3TGJE 4JZFH 1ELAA 3ZZ9A 1CHOG 3BTME 2R0LA 3SV7A 1QL9A 3ZZBA 2FI4E 4DURA 1O2ZA 2OUAA 2WYJA 2BD5A 1LDTT 1DE7H 1DWEH 2KAIA 8GCHG 2W7UA 1YPLH 3RMMH 4R8TB 1TGCA 5EG4A 1YGCH 2Y7ZA 2R3YA 2FS8A 1V2RT 4I33A 4YTAA 1YC0A 1GVLA 2KR7A 1EJMA 3RXKA 4TSFD 2ESTE 3P8GA 1A5HA 5C0UA 1V2KT 2G55A 3PROA 1HAZB 1HNEE 1UTOA 1WQVH 4MNXA 2A4GA 3E91A 2C8WB 3F9GA 1O31A 4ABAA 1SGDE 2FS9A 3SOSA 4CHAC 1W7XH 1O3MA 3GOVB 4UFDH 1HPGA 1TX7A 4NA7A 4ASUD 4M9FA 2ZU4A 1QQUA 2M2AA 4NIXA 4AZ2B 2FXRA 1ELGA 1ZSJA 1O5GH 2CXVA 1H9LB 1O37A 3MH4A 1NC6A 1ZZZA 4ESTE 3MH6A 1GBFA 4JK5A 4X1SU 1FJSA 3A8AA 2WUCA 1JOUB 2PSYA 1UVSH 3PV2A 1BHXB 1NFXA 2KAIB 3DUXH 1IQMA 2ASUB 5EJZA 5E2OA 1TOCB 1ZJKA 3BTKE 1Z7KA 4DVAU 1BJUA 3TH4H 2FP7B 4DJZB 2LPRA 1EJNA 3EA8A 2F83A 1HXEH 1TPPA 2GD4B 2QGRA 4X6MA 1SKYE 1J15A 1QB9A 1IQEA 1Q2WA 2STAE 1YPGH 4RN6A 1P12E 3RC6A 1PYTD 1WTHD 3M36A 2IPHA 4ABHA 2QF0A 2PKSB 2P93A 1NRPH 1L4DA 1QBOA 2ZCLP 1GDNA 1QZ8A 5F03A 4XE4A 4X1RU 1RS0A 4AG2A 2J95A 3QLPH 1BMFD 2G5VA 2ZA5A 2BVSH 1O2SA 4AC9A 5CE1A 1MTNC 2J94A 4CRAA 7GCHG 4IC6A 5CDFE 3PYHA 1N8OB 4Q7XA 4E7RG 4F48B 1AVGH 4YT6H 1QJ6B 1K21H 4MPXA 1NU7B 5B6LA 5HMAA 4B2AA 4UFFH 2G00A 3UOUA 3TGIE 3C27B 5C3NA 1MKWK 1GMCG 5T3HA 1DWDH 3D23A 1QY6A 1Z8GA 4WH6A 3RXOA 1P05A 2F9OA 2FLBH 2VBCA 4B2CA 5DO4H 3TK9A 2Z94A 4K1EA 2DE9A 4BNRA 2V35A 1SGYE 3GCOA 1ANCA 1AB9B 2NU0E 4X8SH 3SO3A 1LQEA 1BTPA 1QA7A 3F68H 1O5CB 4NSVA 1Z8RA 2QIQA 1ZHPA 1FPCH 3SNBA 1C1QA 1SGTA 2XCFA 3MFJA 3ZZ6A 4B1TA 1O2LA 1C1NA 1MH0A 1TRMA 2BD8A 2CF8H 1DSUA 1V2QT 5A0AE 2SGFE 3VB5A 1EXFA 4YT7H 3PMJA 4IMQA 1C4Y2 4A5TS 4AGKA 5GCHF 4D7FA 1V2LT 3E16B 3OEED 3RC4A 1BBRE 3ZVCA 3UNQA 3QUMP 4I86A 1V3XA 2FOEA 1DLKB 1CHOF 1KXDA 1ELEE 3M61U 1T8LA 5C5OA 1JIMA 3FANA 1C1RA 4YLQH 1NRNH 4HFPB 3KN2A 1O0DH 8GCHF 4U2WA 1F0RA 2EI7A 3A7TA 3L6PA 5AFYH 3W94A 4NFFA 4HTCH 2FODA 4WXIA 3LKWA 4FUEA 4A1VA 3EA7A 2ZFPH 1OWDA 4H42U 1S6HA 4DW2U 4TWWA 3SZEA 3M5MA 2F91A 1E36B 1PPBH 2BXTH 2BLWA 1C1PA 2PTNA 3QGNB 2ZDAH 1YCPM 4MVNA 1TA6A 3SU6A 4B75A 4IBLH 4JYUH 3RXRA 3FFGA 1C5MD 4TPYA 1AU8A 1HUTH 1EZSC 2PLXA 1ELTA 2B7DH 3RXBA 1TYNA 2H5CA 2XWAA 3A7XA 1FX0B 1WYKA 2ZECA 1DXWA 5H4IB 4NCYA 1AI8H 8ESTE 2C3SA 1B5GH 1O33A 1T8NA 5IYTA 1FONA 4JMYA 4MNVA 3RP2A 4MPUA 2ZFFH 2AGIX 4X6OA 3F9HA 3KYGA 3OE7D 1QBNA 3V12A 1TNKA 1W13U 1K1NA 3A81A 3SORA 2B0FA 3BTFE 3HGPA 4KKDA 1P03A 2AGEX 5C2ZA 1A0HB 1LTOA 4Q4LA 2QF3A 2VIOA 1Y3WA 1P9SA 1LO6A 2WHXA 1BMAA 4O9VA 4GHQA 2OC1A 1FY1A 1DY8A 4K69A 4I32A 1D4PB 1BIOA 2HOBA 3OX7U 1ZHRA 2H9HA 2OTVA 5GXPA 5LGOA 2BM2A 5IK2D 1OWJA 2PGQB 3SV6A 2ZG0H 3Q00A 3SI4H 7GCHF 1O3BA 3BIVH 3DSPA 4YM9A 1YM0A 1QJ1B 1C1WH 3GDVA 1HAHH 2VJ1A 2XRCA 3BEIB 1BTYA 2XWBI 1K22H 4AYVB 3SGAE 1GMCF 1MD7A 1KXCA 2ZQ1A 4WF8A 3RMLH 1NBMD 2AYWA 4RT0A 2VGCC 1C2JA 4NFEA 3ELAH 2I6QA 1T7CA 3P8OA 1Y3UA 4ABJA 2H2ZA 1ESAA 3JZ1B 3PMAB 4KTSA 1A3EH 1E1QD 2J9NA 3ZV9A 5GPIB 3ZVFA 3GYLB 2KX4A 3U9AH 3K9XB 3U28C 3DSOA 5GJ4B 3SU5A 1O3IA 3D62A 1HXFH
chains in the Genus database with same CATH topology
3SU3A 1GMHG 3LJOA 1MKXH 1SLXB 2RA0A 4TPIZ 1OSSA 2ZIQH 2Z9GA 1EZUC 3A80A 1TAWA 2OC7A 5FHTA 3PO1C 1BTZA 1MQ6A 2VH0A 3P70B 4FUJA 1BBRH 4FUHA 4DIIH 3UQOA 5DGJA 1OWKA 1MCTA 1TGNA 1W0YH 3LGYA 5C20A 1DXPA 3VEQB 1TPAE 1CHGA 2GDEH 4FU9A 5DKMA 2FO9A 2A4QA 4Y8ZA 3A8CA 3PB1E 1O2JA 1KXBA 2J4IA 4RKJB 3A8DA 4MNWA 1C9TA 2BTCE 5F8ZA 5J4QA 1EX3A 1ZPCA 4I31A 1E38B 2BHGA 1ABJH 1SFIA 4A1TA 3RXFA 5EODA 1P10A 2ZFQH 4ZXYH 3DT0H 1ETRH 1GHWH 3SV2H 3TK6A 4X8UH 2K7XA 3VGCC 1OYTH 5GDSH 1IQNA 4BTUB 1D3QB 2AMDA 2A32A 2C4FH 2RG3A 1KXFA 4TWYA 1BMMH 1IQGA 3UWJH 1SGQE 1WBGB 3CP7A 2BX3A 2VWNA 1V2VT 2ZTZA 4KP0A 5JBBS 2H5DA 1W7GH 2HALA 6CHAC 1P3CA 3BTEE 4I7YH 2BDGA 2FEQH 3GCNA 2FWWA 5F6MA 3MNBA 4MPVA 4JK6A 3BSQA 3P95A 1AVWA 3RXJA 1M9UA 1FY3A 3D65E 1LHDH 1LHFH 1IQIA 1MBMA 3EAJA 2QA9E 1CVWH 5TJXA 3TGKE 4Y10E 1GHBG 4Y76A 1DUAA 3GCHB 1EPTA 4H6SB 1QTFA 1ZMLA 4OGXA 3BTHE 2PKAA 1MTVA 2GKVE 1O5AB 1C5WB 1WU1A 1GGDC 2G51A 5FPSA 1OKXA 1DWCH 1W11U 3DFJA 3GY3A 2GCHG 4U32A 4MTBA 2HPPH 3ATLA 2D1JA 2XC0A 3Q3XA 1P8VC 1AY6H 2TIOA 1ESBA 4I8KA 5E8EH 3SNDA 3AVZA 2BX4A 1IHTH 4ZH8A 1C1SA 4NG9H 1F0SA 4JZDH 3S7HB 2B9LA 5FAHA 1GJAB 1TABE 1O3EA 2QV1A 2ZC9H 4UEHH 1GBAA 1PJPA 3SV9A 3PMHB 1SMFE 5EXLA 1EPTB 2FOMB 3MI4A 1HRTH 1C5PA 2RCEA 1AFQB 1O34A 2PKAB 1H8DH 4Q2KA 5LPEA 3FVFB 5FBEA 5FX6A 1V2WT 1YPHE 2C8YB 2FTMA 3RLWH 4FU7A 3RXQA 3K2UA 1KY9A 2GV7A 2W7SA 1GMHF 1SBWA 2QN5T 2JH5D 1D3TB 1TX6A 3BN9A 3U8RH 3G01A 2XYAA 2W3IA 1C4V2 5EQRA 4YZUA 2ZFRH 4LXBH 3RXAA 1TGTA 5DP3A 1DANH 5CHAB 3E90B 5DP6A 1GBCA 1T31A 1VR1H 3E8LA 2ZDVH 1A5IA 3T28A 3A88A 1P9UA 4BANB 3MMGA 3OYPA 1GJCB 1C1VH 1O2TA 4HGCA 3AW1A 4A92A 1UMAH 2PWXA 2A45B 4I8HA 1H9HE 4CR5A 5JBAS 2TBSA 1QB1A 3BG4B 1CA0C 4FU8A 1HAYB 3BG8A 3ZVGA 1GHVH 3LC3A 3UNSA 4DT7B 2ANKH 1DOJA 3PLBA 2Y5GA 3HK6B 2Z3EA 2F9NA 3PTNA 2GMTC 2G8TA 2THFB 2V3OH 1E35B 4JYVH 1T4UH 1O2KA 1O3GA 4IN1A 1WTGH 4AFSA 1L1JA 2ZWLH 1RD3B 4WWYA 1INCA 1TPSA 1HFDA 1EUFA 1O5BB 1IHSH 2NU3E 1AN1E 1FIWA 1H8IH 1QJ7B 3QGJA 2FOBA 2FZZA 3RM0H 1TRNA 3ZZ3A 1OP2A 2BDYA 5FXLA 1ID5H 2BMGB 1KDQA 2WPHS 3SUFA 4AYYB 1Z1IA 3QO6A 2ZCHP 4O3TA 5A0BA 2STBE 4WMDA 1SGFA 1HAOH 1GHBF 2PSXA 4ABGA 2P8OB 3KQCA 4MPWA 1C2LA 4DY7B 1KXEA 5A2MH 2A5AA 1NO9H 1TBQH 1ETTH 3PWBA 1D6RA 1XUKA 1XKBC 3UPEA 3KIDU 1BT7A 4JZ1A 4D9QA 3S7KB 1ZHMA 3NWUA 1NROH 4TY6A 1GJ5H 2ANMH 4ZKSU 3RXLA 3SNEA 2GCHF 3OY6U 3TJVA 5HXFA 3UR6A 4FUIA 4GPGA 1SG8B 3TK5A 1L1NA 2ZQ2A 2F9BH 2ILNA 5ETXA 2VVVA 1HBTH 1JWTA 1H1BA 2P3TB 1KDQB 4FUFA 2HNTE 1S85A 2GX4A 4ISHH 5FX5A 4NWKA 4BXWA 3SW2B 4IMZA 1ZPBA 5TCCA 1T4VH 2D8WA 3Q76A 3S9BA 4CRFA 4YOJA 1UK4A 1C2IA 1NZQH 1P06A 5HM9A 1GBKA 1QRZA 3DFLA 2ZO3H 4VGCB 3R0FA 1D3PB 3M7TA 4AFZA 2BDBA 4AFQA 1SHHB 1O2YA 3O8DA 3MU0A 1WV7H 7LPRA 1CBWC 1XUJA 3ATIA 2FLRH 4Y7BA 1KTTB 1C5TA 4NIYA 4ISLA 1BQYA 3SU2A 1C5QA 2PGBB 4ISNA 5I46H 3T5FH 3MOCA 4JZEH 4NIWA 4GSOA 1DT2A 3RXCA 1XXFA 4Y71A 1TBZH 2UWPA 3U8TH 1PPCE 1W3CA 1ZTJA 4MG3A 1GI9B 4J2YB 3D49H 3UOPA 1THSH 1UTJA 1S6FA 1C1OA 4INKA 1UCYK 1QIXB 2ZF0H 3C1KA 2WPJS 3TJUA 3A7VA 3RUOA 2BLOA 3NXPA 1O2XA 2V0BA 1LQDB 4GCHG 3QZQA 2V3HH 3S9AA 1AKSA 4OS7A 5JBTA 1VCPA 1WCZA 1GBDA 1O2PA 2CJIA 2A5IA 3KQDA 2Z9IA 3LJJA 2D2DA 1AO5A 2BDAA 2QYIA 3UIRA 1CO7E 5K0HA 5DP5A 5JDUB 1SHYA 1A1RA 1O2QA 2ZNKH 1O2WA 3NKKA 2AIPA 5L2ZH 1V2NT 5F8TA 1TMUH 4CHAB 3SU4A 1O2VA 2HLCA 4B76A 4THNH 5EW2H 5A8ZA 2NU4E 3SV8A 2VVCA 1L1GA 4AGJA 3E0PB 1A3BH 1SPJA 4CRCA 1VCWA 2WPMS 2PHBA 3QZRA 1MAYA 1DITH 1D6WA 1T8OA 2BY7X 3LOXA 1EJAA 1HB0B 3E0NB 1QA0A 3TU7H 4FUBA 2PUQH 3SJIA 1AKSB 1ZMNA 2R9PA 1XVMA 2ZKSA 4E06H 1MKWH 4ABFA 4INLA 2FX6A 5EGMA 3LGVA 2VIVA 4NZLA 1TNLA 2ANWA 1EQ9A 1K9OE 3P92A 1P3EA 2O9QA 1YPJH 1C5ZB 2BY5X 2XTTB 3SNCA 1HJAB 1K1LA 1O2MA 3T27A 1HJ8A 1S83A 1GVZA 3S0NA 1UTQA 1MMJN 4NIVA 1O2IA 2BLVA 2GCTC 1YPEH 1ETSH 1MTNB 2SGQE 9LPRA 1QL7A 3BTGE 3KL6A 3FP6E 2BD9A 1ANEA 1JXPA 5FPYA 3MNSA 1ZYOA 3LU9B 1DVAH 4HZHA 1SSXA 2CF9H 1JRTA 1W8BH 4MDSA 3U69H 2OCVB 1JMOH 2Q1JA 3SGQE 2HGTH 4BTIB 3SN8A 4ISIH 6ESTA 3UREA 1QB6A 1UTPA 2QXIA 1V2PT 2UUKB 3WY8A 2LIZA 1PPEE 2ODQA 3SJ9A 5J4SA 3UUZA 5A8XA 1KLTA 1TBRH 4ZHAA 5BPEA 4OS1A 4BTTB 2ODYB 1VCQA 2BD7A 1GHZA 1G3CA 2ZHQH 4CR9A 3T62A 5EPNA 1ELVA 1LHGH 1GBTA 3T25A 1SL3A 1NFWA 3ZYEA 3MYWA 1GI0A 2UUFB 3GY5A 2WV4A 3GY8A 1RIWB 2TGPZ 3QTOH 4H6TA 1ZSKA 3LDXH 4NA8A 1FDPA 2Z9LA 1AVXA 1CE5A 3A85A 2Y82A 3TLOA 3M3TA 1HJ9A 4NSYA 5DG6A 2JH0D 1TONA 3EQ0H 4FVDA 5T6DA 4KTUA 1KTSB 3STIA 2QXHA 2QXGA 4Z0KA 5FPTA 4ZROA 3F9FA 2HVXA 4K1SA 2ZZUH 2JETC 1EP5A 1BTWA 2GZ7A 3RXEA 4GCHF 2NWNA 1SGRE 2ZU1A 3TPIZ 4LK4A 1UK2A 1IQHA 3DA9B 1O3DA 2ULLA 1FIZA 1YLDA 1FUJA 3KEEA 1K1OA 4AFUA 2FI3E 1CSOE 4XFQA 5JB9S 2QAAA 4O3UA 1V2JT 1S5SA 2QCYA 1ELCA 3HATH 2VU8E 3B23B 1BRCE 1PPZA 5DJ7A 3TH3H 4YOGA 1C5OH 1PQ5A 1ANBA 2VIDA 2OINA 1FPHH 1O5EH 2HNTC 2C93B 3T29A 1MCVA 1V2TT 1SGCA 1X7AC 1HAPH 3SBKA 2WUBA 1V2UT 4K2YA 1YCPK 2CGAA 1DLEA 2VINA 4XOJA 2ZHDA 4IS5A 4UONA 1C1MA 4XBCA 4AOQA 2OP9A 3LH3A 1FAXA 1P0SH 1DFPA 3LIWA 4DCDA 1UK3A 1NRQH 1VGCC 4GAWA 1DWBH 1GBJA 1GI7B 4Y11E 1GCTC 1YPMH 5AF9H 2BDHA 3E3TA 2ZU3A 3A87A 1CT0E 2H9EH 1ZGIA 2ODPA 1MD8A 3MU4A 2Q6DA 3BTTE 1JIRA 1O36A 4ZXXH 3W95A 4AX9H 1BHXF 2WPKS 1C5YB 2Y80A 2J2UA 1FMGA 2FYRA 2PV9B 2VGCB 1HYLA 2FMJA 2SNWA 1N6YA 5BRRE 3A82A 2SGPE 3U1JB 3MWIU 1A2CH 3PTBA 3QK1A 3VXFH 5C5NA 8LPRA 1C5XB 1SGNE 6GCHG 2ZP0H 2BD3A 1RGQA 2O8LA 4M7GA 3RXTA 3SQHE 1J9CH 1D9IA 3EBNA 3V3MA 3P8FA 3LPRA 1GG6C 1NS3A 1Y5UT 1H9IE 1SGIB 1EP6A 4FUDA 2HRVA 3R3GB 1KXAA 4UD9H 3SI3H 1EAUA 4ZUHA 3VB7A 2F9UA 3ZZAA 1C2FA 3ENSB 1AWHB 1EZQA 2J92A 2R3UA 4Y0ZE 5G4BA 1GI3A 4O97A 1BB0B 4FVBA 2CHAC 3RXIA 1XM1A 2AMPA 4D7GA 3HPTB 2YNBA 4Q7ZA 4BXSA 3Q3YA 3HK3B 1QBVH 3AAUA 1OP8A 1C5RA 1C2DA 3LGTA 1D3DB 3ZV8A 1HDTH 1YYY1 4OS6A 2FOGA 3AAVA 1O5DH 1CT4E 1VZQH 2IJOB 4XDEA 2G4UA 1MZDA 5EXNA 3FP7E 4Y7AA 1UVPA 1ESTA 4BAHB 3VGCB 5DK1A 4IC5A 3QN7A 2H1UA 1GBEA 3LGIA 1LCYA 1O2GH 3IWMA 1FQ3A 1GJ6A 2ALPA 3MH7A 3GYMA 3KF2A 3SUGA 1BOQA 1J14A 1FZZA 1RFNA 2H6MA 3TIUA 1YPKH 2A7CA 2A4OA 6CHAB 1XX9A 1O3CA 4GLYA 2A4RA 2Z3CA 4E05H 1ABIH 1XUFA 5F8XA 5FCRA 3UFAA 1LKBA 3EGKH 1QL8A 1EAXA 4NA9H 4OS5A 3SU0A 4YO9A 3URCA 2W26A 3ITIA 1C2MA 3PV4A 5GWZA 1EPTC 2GGVB 4ABIA 5C1XA 1N6XA 1A4WH 3OU0A 4DOQA 1O3OA 2TRMA 1G37A 2BQ6B 2XW9A 1VJ9U 3BEUA 1TE0A 5ABWA 4WH8A 2FOAA 4PROA 1ZPZA 1GGDB 2J34A 3EE0B 1TB6H 1GBMA 2OBOA 4B74A 5L2YH 5JBCS 4MQAA 5C67A 1MU6B 1SOTA 1ZRBA 4KGAA 3U98H 1QQ4A 4X2WA 3SQEE 3SJ8A 1N1LA 3L3TA 2Z3DA 1WSSH 1LHEH 2H9TH 5A0CA 2Z7FE 4WVPE 5LH8A 1UTLM 3TH2H 2VWOA 1Y59T 1UCYE 1BJVA 1SQAA 2AERH 2XC5A 3TJNA 1P2IA 2VIPA 4MLFB 1PQAA 1UVOA 1DSTA 2B8OH 2BY6X 3I29A 1ORFA 2A2XH 3BG4C 4E7NA 1TA2A 3GY2A 3MU1A 2GZ9A 5CMXH 6GCHF 3GCTG 2PR3A 1Y3YA 4I8JA 4CRGA 1THPB 2TGDA 1QCPA 3I77A 3I78A 1P2OA 1TWXB 4X6PA 1ELDE 5DP4A 2RA3A 2BOHB 3LGUA 1GBIA 1VITH 1IAUA 1Z6JH 1SFQB 5HM2A 7KMEH 2R2WU 3SUDA 1RJXB 1GCDA 1C2EA 2WPIS 5DP8A 5LPRA 1UJ1A 2XBVA 2ZFTA 1FAKH 1Z1JA 2HNTF 1FLEE 1ZTKA 4K8BA 3SJOA 3SHAH 3FP8E 2V6NA 1NY22 2FYQA 5HGGA 1LPZB 3UTUH 1TX8A 1BCUH 3TVJB 2O8WA 5DP7A 2A7HA 4YLUA 1O3PB 4GHTA 2XBYA 1F0TA 3V7TA 1L0ZA 4U01A 1KYNA 1QRWA 1BUIA 1CA0B 1A0LA 1FNIA 1LHCH 2VH6A 1ZLRA 1CT2E 1S82A 4X8VH 1SR5C 5C1YA 1GHXH 4Y8XA 1AUTC 2ZGCA 1F0UA 1HAIH 3MNCA 2GMTB 4ZKNU 2CN0H 3E6PH 5I25A 3VB6A 1NT1A 3RXVA 1XKAC 3UY9A 3VB4A 1GI5A 1ZR0A 1EOJA 3P6ZB 3MO9A 1P04A 1NM6A 1WOFA 4WY3A 2GV6A 4WJG2 4U30A 1F5RA 1AE8H 1WUNH 1F5LA 1TOMH 1ZRKA 3O8BA 4CRBA 3URDA 5EXMA 2FOHA 1AE5A 1K1IA 4I8GA 2WINI 1QNJA 1GPZA 1Z71A 1XUHA 4B2BA 3Q3KA 2PW8H 2D26C 1J17T 1LPKB 5A09A 1O2OA 3AASA 1TNJA 1J8AA 1NPMA 1O3KA 2CMYA 3EA9A 1ELFA 2C8XB 4VGCC 1U6QA 4ZMAH 2UWLA 3KQBA 1A46H 2A31A 3M35A 1O32A 4OGYA 1NTPA 2DUCA 2PTCE 2GVFA 1Y3XA 1Z8IB 1F5KU 5ESTE 3O8RA 2J38A 1BA8B 3V13A 3ZVAA 4AG1A 1XUGA 3DHKH 1QURH 1OWHA 2ZGXH 1GI8B 2LNCA 5ESBA 4ZHLU 1GL0E 3T2NA 4IGDA 3OSYA 2OLGA 1GBBA 1HGTH 3ZZ8A 3QDZB 1TMTH 3QX5H 4FUGA 1P57B 1TGBA 5JB8S