2AMDA

Crystal structure of sars_cov mpro in complex with an inhibitor n9
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
309
structure length
309
Chain Sequence
PLGSSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Design of Wide-Spectrum Inhibitors Targeting Coronavirus Main Proteases.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 83
structure length 309
sequence length 309
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2amdA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2amdA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2amdA02
9LPRA 1RXPA 1N6YA 2PWXA 2H5CA 3LJJA 3JZ1B 5A2MH 2JH5D 3S9BA 1S6HA 1MTUA 2CF8H 4O3TA 3AW0A 1C5YB 3DFLA 3KQBA 1TGCA 1SLXB 1SGTA 5T3HA 5DKMA 3SUEA 1O2NA 2HNTC 1MBQA 1HXEH 1GVLA 2JH6D 3C27B 1SHYA 2G5VA 3O8BA 1GI5A 1BTWA 3ZV9A 3PWCA 3BG8A 2F9UA 1C5LH 3VB4A 3O8RA 5TCCA 2OBOA 2J38A 2RDLA 1P2OA 5EQSA 1GHAG 1SGCA 2ZF0H 3OSYA 1Z71A 3OX7U 4Q80A 3SUDA 3ZZAA 3GY8A 4DJZB 4ABDA 2GCHG 1SG8B 1TBQH 5DP8A 1A2CH 1GI0A 1FJSA 4UFFH 3UY9A 2VIDA 1UVTH 1WSSH 2FTMA 4YOJA 3NUMA 5EU8A 1C5ZB 3GYMA 1MU8B 2A2QH 2FOAA 2IJOB 5CHAC 4X2YA 2AMQA 4AFQA 3AW1A 2VIQA 3SU4A 1QGFA 2P3FH 2KAIA 4Y0YE 4I32A 1QRWA 2H2ZA 3GCHC 3RXKA 1GHZA 1HCGA 1NRSH 1ARCA 2GZ7A 1P12E 4ABHA 4E7RG 1HV7A 1O3GA 2IOTA 3ZZ8A 1C5OH 2OC0A 1L1JA 1V2OT 3MU1A 2VNTA 3BTTE 2VIWA 4GUXA 9ESTA 4K2YA 1DOJA 1O3NA 2C93B 2XBVA 4CR5A 1GGDB 1LHDH 2ZGCA 4XBBA 3FP6E 1BRAA 1ELDE 1OWEA 1GHXH 3V13A 1MD8A 1EASA 2NU2E 1P11E 3UUZA 1K21H 2DE9A 3M5NA 1P9UA 2ZDKA 1ZHMA 4ABGA 1N1LA 3N7OA 4LZ4B 5FXLA 4WH8A 2O8LA 2PGBB 4D9QA 3BTHE 2LNCA 1MZAA 1ANBA 2A7JA 1PPEE 1THSH 4ZHMU 1Y59T 2ZTXA 2LIZA 2NU1E 1GVKB 2GP9B 5JB8S 1MZDA 2ZFQH 4Q2KA 4IMZA 3F9HA 1Y5AT 2WUBA 1ANDA 1RRKA 1TLDA 1WCZA 5L6NH 1OPHB 2G81E 5LPRA 1DWDH 1LHFH 3TK9A 3BV9B 3D65E 1K1IA 3SU5A 1ZHPA 1KIGH 3T28A 3RXVA 4BAKB 1H9IE 2FXRA 1T4UH 4BAOB 2BD9A 1O2TA 4U2WA 1PQ5A 2G52A 5DJ7A 1AU8A 1C1OA 1O30A 2PFEA 1TRYA 3Q76A 4X1PU 1CSOE 6ESTA 1Y8TA 3TH2H 1UTQA 3V7TA 3A8DA 1EB1H 4NA9H 1UK2A 1BHXB 4A1VA 4H4FA 1IQKA 2HNTF 2THFB 1QL7A 2BD2A 5F8XA 1ARBA 2BLOA 3QGJA 2M5TA 3CENA 5A0CA 4KKDA 2LPRA 4JZFH 1RFNA 5DO4H 3RXAA 3QX5H 2BOKA 3RXQA 2NU4E 1QIXB 1GCTC 2ODYB 1SGFA 2SNWA 3RXTA 2Y7ZA 3MH7A 2B8OH 1OX1A 2C8YB 4Y8ZA 2OQ5A 1WV7H 4IC6A 1W13U 3Q3YA 3RUOA 3SV9A 4FUDA 1O2SA 1BMMH 2QXJA 1K1LA 1XUJA 5B6OA 1HJAC 4CHAC 2XWAA 1GHYH 1IQGA 2ZO3H 2UUJB 3M7UA 2STAE 1OSSA 1XKAC 5ABWA 5FBEA 2BD5A 1DSUA 1VCPA 1TX6A 2BDBA 1MKXK 1Y3UA 1K1OA 1H1BA 5FPYA 3QK1A 2BM2A 3M5OA 5T6FA 1U6QA 3L33A 4UONA 3ZZ4A 2GTBA 3UWJH 2XTTB 4H42U 2BD3A 1ZSKA 3PYHA 3RXHA 1DSTA 1FIZA 1ZSLA 1NT1A 4B2AA 4ZHLU 7LPRA 4AG2A 3VFEA 2XCNA 2ZPSA 2ZU2A 4DW2U 4YZUA 1HIAB 5JBTA 1P2IA 1TIOA 1A0JA 5FX6A 6LPRA 1IQHA 2FPZA 1PFXC 4Q7XA 1AKSA 1GI8B 3ZVDA 3BIUH 3DFJA 1O0DH 1IAUA 1P09A 1XUHA 2EA3A 2DUCA 3STJA 3UNRA 5DP9A 1DXPA 1YP9A 3EQ0H 1LCYA 1FY3A 4XBCA 1NO9H 4BANB 1BMAA 3RU4T 3VXFH 3MOCA 4YM9A 3BTQE 1FY8E 2ANMH 4XBDA 5C1UA 1ETSH 4IN2A 3T29A 3K65B 5JDUB 2XW9A 1ZYOA 4B71A 2D2DA 1O3BA 3LGWA 1XUGA 1BBRH 1LDTT 2FLRH 5A8ZA 1MBMA 2A4RA 1AB9B 1DWCH 2OQUA 5LGOA 1S81A 1ELVA 1ZMLA 1KXFA 3W94A 1THPB 4U32A 1BTYA 5HYOA 2Y81A 1ZJKA 3MU0A 2Y5FA 2FODA 1O3MA 3RXGA 1C2KA 1C2GA 4WMEA 1BT7A 3H7OA 2A45B 3E3TA 4NFFA 3ZVGA 1NPMA 1OYTH 1CQQA 5A09A 3AVZA 4K5ZA 2GMTB 4JK5A 3SV7A 1XUKA 4WMFA 1RTKA 3ENSB 1WTHD 4BXWA 1O2WA 1UTPA 5I46H 4GCHG 4K3JA 1HAIH 3RLYH 1P03A 4O97A 1C9TA 2OXSA 3K6YA 1TPOA 2JETB 1C1PA 1HAXB 1GBAA 3NZIA 3TGKE 2Z9GA 1F0RA 1O2KA 2BQ6B 5AF9H 1NRQH 2ZFFH 5A0BA 4FU8A 3F68H 1MAYA 2P3UB 1SGQE 4CBNA 2WUCA 3TJOA 1D6WA 2QV1A 2SGQE 3GCOA 3RU4D 3LGIA 2H9TH 1UCYH 2SGAA 1BRBE 1O2PA 2PSXA 1FNIA 1T7CA 8GCHG 2ASUB 3UNSA 1DDJA 4TY6A 1O35A 6GCHF 4LOYH 1V2JT 2AGGX 1GMHF 3LONA 3ATMA 3EDXB 1G36A 5EXMA 5EW1H 1SLWB 1DUEA 4X1SU 5EQRA 5I25A 3LIWA 3S7HB 3M35A 1AFQC 1HAYB 1EZUC 1AUJA 4J1YA 1GMCG 1D9IA 1FDPA 3TIUA 1O5EH 4YTAA 4OS5A 3CP7A 4ABFA 1DUAA 3KGPA 1MQ5A 2F9VA 4XFQA 4DVAU 1AE8H 1HBTH 1AUTC 1BTPA 4B2BA 2GZ8A 2NU0E 2QN5T 3A86A 3BTKE 1GBEA 2ZG0H 2QY0B 4NFEA 4O3UA 2WPKS 5EXNA 1ELAA 3PLPA 4A1TA 2P8OB 2XBXA 3M5MA 2NU3E 4MTBA 4I33A 5E2OA 2PHBA 2WPLS 1XXDA 4ISHH 1BMNH 1WTGH 1YM0A 3RXLA 1S82A 3GOVB 1S0RA 3MNSA 5AHGH 1VGCB 1ZTLA 3KCGH 3RM2H 1MCTA 5DP5A 3RP2A 1C5QA 3G01A 2FP7B 4DT7B 2CGAA 1L0ZA 3SU3A 4BAHB 3A82A 3E90B 2ZPQA 1EOJA 1JMOH 4BTIB 4ZXYH 3ZVEA 1K28D 1MAXA 1GI6A 1C2LA 1KXAA 5HGGA 1PYTC 1HAGE 5EGMA 1C1SA 3RXIA 3VPKA 5H4IB 2Q6GA 3LJOA 1C1NA 4I8HA 3RXCA 2BZ6H 1BBRK 7GCHG 4ABEA 2ZZUH 3MHWU 1F7ZA 2ALPA 4X1RU 2EI6A 1EATA 3UR6A 3M61U 2ZI2H 2RG3A 2BQWB 1WOFA 1Y5UT 1V6DA 1RIWB 2J92A 1EUFA 1FPHH 1YKTA 1C4Y2 1C4V2 1GBKA 3A8CA 3SUFA 1HAHH 2BX4A 2ANWA 3SV8A 3ATKA 4U30A 1B0FA 1XMNB 1DLEA 2B0FA 3RXFA 4X6MA 4ZMAH 1CA0C 1EJNA 1HUTH 1SGNE 4UFDH 1BUIA 1LQDB 1CT2E 1C2HA 4RKOB 4WXIA 2EEKA 1GGDC 1HJ8A 4MPVA 3TH4H 5GXPA 5K7RA 3EE0B 1CE5A 2BYAX 3RXJA 2SFAA 3RM0H 2C8WB 1TNHA 2PKAB 4WY3A 2RA3A 4I8GA 1CGHA 4IMQA 1SGYE 3T25A 2VGCB 2P93A 2CV3A 1GI9B 1KXCA 4Y71A 4K69A 4BTTB 1KXBA 1CO7E 1DXWA 1W2KH 3TU7H 2Z9LA 1Z1IA 3M7QA 2BX3A 1IQJA 4KP0A 2Z9IA 1J16A 3ZZCA 1HAVB 2AGEX 3GISB 4X1QU 1HIAA 3SJIA 1YBWA 1KDQB 2IN2A 4IN1A 1V2ST 2Q6DA 1A46H 2R3YA 3VB6A 1GL0E 4JCNA 1AWHB 2QF3A 3TITA 4ASHA 2WPHS 1KY9A 1SFIA 1EJAA 5FCKA 4MQAA 2PLXA 3ESTA 1QB1A 1DT2A 1GJ5H 3GCTG 3MNCA 4UFEH 1Q2WA 1GHVH 2BTCE 2R9PA 2ZEBA 1NN6A 6CHAB 1NESE 2PTNA 2QGRA 4NIYA 1RTLA 1ZZZA 4I8JA 3VB3A 1O2YA 1O38A 1CGIE 1C5TA 5GIBA 1P9SA 1PPZA 1NTPA 1ELFA 4OS7A 1VJAU 1A5GH 2ULLA 3T26A 4AORA 1TBZH 1O2OA 3Q77A 1AVXA 3IWMA 2CF9H 2ODPA 3HATH 2BXTH 2OC8A 2BB4A 2FESH 1GMDF 4CBOA 2ZCLP 2V0BA 1QQUA 1SPJA 3FFGA 2ZCHP 1QY6A 1TABE 3CS7A 3RU4E 5HMAA 1WQVH 2AH4X 2G4TA 3KF2A 3Q3XA 4CRFA 4X2WA 3HK6B 3LC5A 4Y7AA 4R0IA 3KN2A 2CN0H 2RCEA 3BTEE 4BOHA 2VIPA 1GBMA 1LPGB 1G2MA 1ELGA 1YPLH 2HWLB 4GVUA 4OGYA 3URDA 1W10U 1HLTH 1O5FH 3VXEH 3OU0A 2TGTA 1G30B 1EP5A 1SGEE 1ZTKA 1N6XA 1C5VA 3AASA 4NIXA 4FU7A 3SU2A 1XUFA 2FO9A 2BVRH 1Z7KA 1NFWA 1C5NH 1OOKB 1TGTA 3T27A 3LH3A 1BA8B 3RXBA 1O34A 3RMOH 4B76A 1LHGH 1O3AA 1O2VA 1QBOA 2ZQ2A 4XE4A 2A7CA 1RTFB 1EZSC 4GSOA 4Y10E 1AVWA 1SQOA 1D3DB 3ZYDA 1O3KA 1VITF 2A4GA 2PKSB 1VCWA 1O31A 1MKXH 2JKHA 1Q31A 2FX6A 4FVBA 3M5LA 1L4DA 3RC6A 1GDQA 5ETXA 3RXRA 1BBRE 1NRNH 2WYGA 1YPJH 4ABJA 1SL3A 4MNWA 3ZZ3A 1KLTA 1IHSH 1OKXA 2P3TB 3QUMP 2ZDMA 1O3HA 3E8LA 3ZVFA 5L30H 1G32B 2I6QA 2D8WA 1C1RA 2F9PA 4Y6DA 4A5TS 3LGTA 1AB9C 4ISOA 5K0HA 1VJ9U 2BY8X 3GY7A 2BDIA 1KLIH 2BD8A 1SC8U 4JZ1A 5FAHA 1QFKH 5EODA 1AZZA 3AAUA 4O03A 1O2HA 1GJ7B 1TMBH 1BHXF 1W11U 2GMTC 2XNIA 1RD3B 5E2PA 4MVNA 1BRCE 2R0KA 4X2VA 3BSQA 2Y80A 1RGQA 3PTBA 4YESB 1GJDB 3RXEA 1GG6B 2A0QB 1IOEA 2VB0A 2A31A 3U9AH 4ZKSU 1UTNA 1UCYE 1HAPH 1P02A 1ANCA 2UWOA 4SGAE 2JETC 4K1EA 2BZAA 1UMAH 2H9EH 3SO3A 2BVSH 5AFYH 3O8CA 3MO6A 1SI5H 1CHGA 2CHAC 1A3BH 4BTUB 2FYRA 3M37A 1HXFH 4NGAH 4IC5A 1CT0E 1DANH 2FOCA 1OWKA 1ZGVA 1QQ4A 1CBWB 4Z6AH 2AMDA 2P59A 1ELCA 4DCDA 1FONA 1W14U 1XXFA 3PLBA 4CRDA 1V2RT 2F3CE 3SHAH 2GGVB 2QIQA 1MKWH 4BXSA 1LVBA 2CMYA 5E0JA 2STBE 1UK3A 4KTSA 1P2QA 1FQ3A 4INKA 1E37B 5T6GA 4INHA 1F0TA 1E38B 1YCPH 2WPJS 1EP6A 1GI4A 2AFQB 2PKAA 2OLGA 4MDSA 1EKBB 2O8MA 1FLEE 3S9AA 2Y5GA 4A7IB 1HFDA 1ABIH 3A8AA 1GJAB 4M7GA 3ZZ5A 2C90B 1GVZA 1J15A 1C9PA 1E34B 1YGCH 2QCYA 1J14A 1XX9A 1ZPZA 3LGYA 5F8TA 2EI7A 3SV2H 4TWYA 3U8RH 5L2YH 1JIMA 1LKBA 1QJ7B 3B9FH 3F9GA 4X8VH 3SNBA 1QR3E 1SLVB 3UNQA 1OXGA 1HAVA 1OWHA 3VGCB 3SOSA 2A5AA 1ORFA 5GJ4B 1KDQA 1GI2A 1F2SE 1O3EA 1AE5A 1RS0A 1VGCC 5C1YA 4B1TA 2G5NA 3CS0A 1NFUA 2EI8A 5FCRA 1LQEA 7ESTE 2AMPA 2ZECA 1LPKB 3DA9B 2J9NA 5E8EH 4FUGA 1ZGIA 2BHGA 3TNTA 3S7KB 1TQ0B 2XRCA 4TYDA 1KLJH 1LPZB 3ZVAA 3PO1B 2ZU5A 1EZQA 4MPUA 1TNJA 4DG4A 3U98H 1GJ6A 2BY9X 5F03A 4ZKNU 2Y5HA 5C20A 1NFYA 4Z0KA 4BAQB 2FOEA 3BTME 1FN6A 3E6PH 1SMFE 4NWKA 1O2XA 3ODDA 5DK1A 3HKIB 1LO6A 3BN9A 4ZH8A 2OBQA 3GICB 1K1MA 1RIWC 2W26A 1OWIA 2BY5X 1V2VT 1KSNA 3VB7A 3SI3H 1NU9A 1TGSZ 3S0NA 1IQNA 1S85A 4IBLH 1GDNA 1SSXA 1QHRB 1YLDA 1P2MA 3BTGE 3RXDA 2Y6TA 4ABAA 3EA8A 1OP8A 1F5LA 1T8MA 2V3HH 3MYWA 4Y76A 1GI1A 1C1VH 3TH3H 2FS8A 1MTNB 2VWOA 3SGQE 1KXDA 4KTCA 1L1NA 1OP0A 4ZUHA 2XYAA 1P2NA 1MQ6A 4XDEA 2FOFA 3A84A 4WXVA 1GPZA 2YNAA 1LHCH 2A5IA 3PM3A 1O2RA 1PJPA 2FX4A 2GV7A 2VGCC 1S83A 3SQEE 2P95A 2ZTZA 1UO6A 1FI8A 3KNXA 3A7YA 4JMYA 3V12A 6GCHG 3FP7E 1HNEE 5A8XA 4UEHH 3A89A 1GMHG 3I29A 3F6UH 1ELTA 1ZRKA 3KQEA 1FY5A 2V3OH 4AYYB 3D49H 5FPSA 1HDTH 1EAWA 3NK8A 1EAXA 5C1XA 3SQHE 4IS5A 4K1TA 1S84A 3BEFB 3PLKA 1TYNA 1ZR0A 3RMLH 2QC2A 1MKWK 3SJ8A 2ZDNA 4ZROA 4X6NA 1C5SA 2XC0A 4GPGA 2Z9KA 1GJ8B 3S69A 4MLFB 1DITH 4WJG2 1ZJDA 1UVSH 2O9QA 3SJKA 4DOQA 1PQ7A 3TJNA 1H9HE 1YCPK 2G00A 2TBSA 1XVOA 3EA9A 1W0ZU 1GI3A 1ID5H 6CHAC 2XBWA 4GAWA 4FUFA 4CH2B 2W3KA 1HAOH 1C2DA 2BDCA 3RMNH 3BEIB 1Z8GA 2ANKH 1EQ9A 1A4WH 1BITA 1EPTB 4A92A 3UPEA 5FHTA 2C4FH 1P3CA 3KQDA 1GBFA 3QLPH 1DY9A 2ALVA 2Z3DA 3A81A 3ZV8A 2FOBA 1SLUB 3PMJA 3EA7A 1K1NA 3E0NB 3QN7A 5L2ZH 2FEQH 2A7HA 5GDSH 1SBWA 1TOCB 4K60A 8ESTE 1UJ1A 1O5BB 1B5GH 1TE0A 4X0WU 1NROH 1C2FA 2TGAA 3URCA 5PTPA 3QZRA 2GCTB 2ZU1A 4AB9A 2A1DB 1UVOA 2F9OA 2AIQA 1SOZA 4RN6A 1ZPCA 1CVWH 1G3EA 2HVXA 1RJXB 3D62A 1ACBE 4YO9A 1UTJA 1V2TT 4AX9H 5HXFA 1LTOA 1YPHE 2A4QA 2YOLA 2ZGJA 1AD8H 3MU4A 3GY6A 4AGJA 4OS4A 3LDXH 3PMBB 3MH6A 2B7DH 3SORA 3TVJB 4YOGA 4GHTA 2H6MA 1KTSB 2R2WU 1EOLA 4VGCB 1P10A 1CHOF 4NCYA 2G4UA 1ZPBA 3PROA 4Y7BA 1D4PB 1HRTH 1K1PA 4NWLA 1TGBA 1G3DA 2R3UA 2FOGA 1V2LT 3D23A 1DWBH 2FTLE 3RXPA 2VU8E 1BZXE 3H5CB 1TB6H 1O2MA 1T4VH 2OC7A 3TLOA 1TNLA 1V2QT 3P95A 4KELA 2OCVB 3ITIA 5FPTA 1BJVA 3SI4H 2ZIQH 2GVFA 5DP7A 1NZQH 1UVPA 1TRMA 4ESTE 3GDVA 3BF6H 5BPEA 1QB6A 1XUIA 3TJVA 4B75A 2PKSC 2AERH 1ZRBA 2FOHA 3U8OH 1UVUH 4UD9H 3E91A 1AQ7A 1TOMH 1TNGA 2ZU4A 3VB5A 2Q1JA 3GYLB 4WF8A 1EX3A 3RXUA 2J94A 2WPMS 3PMHB 1GBLA 3SBKA 1Z1JA 3P17H 2XCFA 3MO9A 1AO5A 4CRCA 2TRMA 1KYNA 4UE7H 1PPBH 5C2ZA 4FUEA 3LU9B 1ABJH 3A87A 4DGJA 1V2NT 2F83A 1XM1A 2ZGHA 3M3SA 1GJBB 1QNJA 3IG6B 3P92A 4MG3A 4ZXXH 3RXSA 1FZZA 5GCHF 2UUKB 4HGCA 3VEQB 2H1UA 2ODQA 1DE7H 3K9XB 1P05A 3IITA 3GCNA 2Z3CA 1GWAA 4AFUA 2AS9A 1L1GA 1K2I1 2BDGA 1P01A 2TGPZ 3V0XA 1AHTH 5LPFA 3FZZA 2BD7A 1PPGE 1GJ4H 2SNVA 2WV4A 4E06H 1ZHRA 1E0FD 2ZHDA 3A88A 4HFPB 1Z8IB 1AI8H 1WUNH 2K1QA 3UWIA 3GY2A 4JZIA 1C2JA 1GG6C 1QCPA 1CU1A 2GT8A 1EXFA 3F9EA 4NIWA 1DWEH 4CRBA 1SGIB 2GDEH 1NU7B 5C5NA 1YLCA 1O3LA 1TFXA 5G4BA 2FI4E 3HK3B 1GMDG 1W0YH 4NSVA 1LVYA 3RXMA 1LMWB 1HGTH 1BTZA 1ELEE 2VIVA 1C1WH 1DLKB 1YPEH 2UWPA 1SGPE 1Y5BT 4XSKU 1AIXH 4X6OA 2CJIA 2A2XH 3SZNA 1CBWC 1QBNA 1BIOA 3LPRA 5GWZA 2VINA 1BTHH 4TY7A 1ELBA 5EPNA 2W7SA 4F49A 2C3SA 1YYY1 1TAWA 1YF4A 2H5DA 1O39A 1G3CA 3R3GB 3NPSA 2QA9E 5BRRE 5C5OA 5SGAE 3P8NA 3RLWH 1EJMA 2O8UA 1G3BA 1P2KA 2ZFPH 1NY22 3NCLA 1PPHE 1J8AA 2IPHA 1NS3A 3I77A 4TPYA 2C8ZB 3SHCH 2A5KA 4H6SB 4PROA 1JBUH 2OD3B 4RKJB 1SFQB 3LH1A 4GLYA 1TWXB 4CREA 3EGKH 2Y82A 1FIWA 7KMEH 5JYIA 1A0HB 3E1XB 2GD4B 3ODFA 3QWCH 3A7ZA 3BTDE 4AGKA 4D76A 4J2YB 4DURA 1PYTD 4B73A 4X8UH 1VITG 5DPAA 3VGCC 1SGDE 4Q7YA 1T31A 3ELAH 4CR9A 1N8OB 4UDWH 3GDUA 1MCVA 3I78A 1IQIA 1O33A 2ZTYA 1GJ9B 2ZGBH 4D7FA 1UHBB 1B0EA 3SNAA 1ETTH 3ZZDA 2QXHA 3O8DA 2VWMA 1YPHC 3UFAA 5LH8A 3QTVH 4OS2A 4CRGA 1BRUP 1O36A 3PO1C 2GKVE 3A7XA 8LPRA 1GBHA 2ZGXH 1A1RA 3FAOA 1EPTA 2Z94A 2K7XA 1GBBA 2QYIA 3A7WA 5HM2A 2FLBH 3MMGA 2FYQA 4FUCA 4FUJA 1V2KT 3SNDA 1H8IH 1J17T 4HI3A 2FWWA 1W12U 1GHBF 3SGBE 3ZZ7A 3ZZ6A 3PTNA 1V3XA 3UTUH 1C5XB 3HGNA 2SGEE 1O5DH 1SQAA 3OY5U 3ZZBA 1X7AC 5J4SA 2FZZA 2VVVA 3R0FA 1O2LA 2B9LA 1G9IE 4TWWA 1MTNC 1P06A 1E35B 1MTSA 1BOQA 3MNBA 4JZEH 3HKJB 2PTCE 1P2JA 1GBJA 1BCUH 2BOHB 1O32A 3QGNB 2ZFRH 5T6DA 3S9CA 1HYLA 2BD4A 2AIPA 2Z3EA 4I8KA 1QRXA 3QO6A 3UQVA 5LPEA 4ISIH 1IQMA 3A85A 1A3EH 4X8TH 5JBCS 1EB2A 2Q6FA 4HZHA 2XBYA 1FAXA 2CXVA 3AAVA 1C5UA 1GBIA 1O3IA 1Y3VA 4AG1A 1GI7B 2F9BH 1FY4A 1H4WA 1O3FA 2HLCA 2O8TA 2P94A 4AN7A 1CA0B 3MFJA 3STIA 1LKAA 1SHHB 3KQCA 3SU1A 4B74A 1ANEA 2FI3E 4FUHA 3BEUA 4MPXA 4R8TB 4KGAA 1GHAF 3ATLA 2ZFSA 1PPFE 1TMTH 1OP2A 3LOXA 3MWIU 4NZQA 4WWYA 2GCHF 1D3QB 4ABIA 3SUGA 5JBBS 1TNIA 1UTKA 2ZA5A 1FAKH 2XC4A 1C5RA 1GHWH 1NC6A 2EC9H 2J4IA 1Y3YA 3DT0H 3PMAB 1ESTA 1H9LB 3TJUA 3P8GA 4D9RA 4ZAEA 1TNKA 2BQ7B 2ILNA 3EAJA 4INLA 3SU6A 2ZC9H 3MU5A 4O9VA 2ANYA 4X6PA 3RC4A 1IQFA 1JWTA 1C1MA 1S0QA 2ZDVH 4TPIZ 1EPTC 2SGFE 1CA8B 1BJUA 4K8BA 5FX5A 1E36B 4NZLA 3EYDA 1TBRH 1M9UA 4B2CA 1Z6JH 3LC3A 4FU9A 3TK6A 5C67A 2VVCA 5EOKA 5GPIB 3KL6A 4JYTA 5A8YA 1LHEH 3EBNA 1MD7A 1Z6EA 2GCTC 3UIRA 3GDSA 4MNYA 3NKKA 2WINI 2Z6BD 4AOQA 1VR1H 3LGUA 1YC0A 1ZMJA 2W3IA 4A1XA 1TA6A 2QXGA 3BG4B 1W3CA 1DS2E 4K8YA 2AYWA 2GZ9A 1AVGH 2P8OC 5HM9A 1HAZB 2J95A 4I7YH 2A32A 4H6TA 4X1NU 2G8TA 3JZ2B 4D7GA 3MI4A 1DICA 1LVMA 1SGRE 2PW8H 3FANA 4FUBA 1OYQA 1NM6A 1DY8A 4FXGH 1SR5C 4VGCC 1V2WT 2SGDE 3FVFB 2G55A 1F0SA 1SVPA 2UWLA 4IGDA 4F4OC 2VJ1A 4ZHAA 2HOBA 2OTVA 2H9HA 2ZHQH 1W8BH 1O3CA 4E05H 3U1IB 3OTJE 2TGDA 3E16B 3MU8A 1AFEH 2W7UA 1O2GH 4E7NA 1DM4B 1O2IA 4X8SH 1A5HA 3QTOH 1CT4E 1TPSA 1V2UT 1C4U2 2AGIX 1TPAE 1JXPA 2XWBI 1TA2A 1BDAA 4JZDH 2BDAA 1EAUA 3TNSA 1GDUA 1HB0B 3MO3A 1UK4A 1O37A 3SN8A 2Z7FE 2F9NA 4Y0ZE 3UREA 1O2JA 2FM2A 4DIHH 2PUQH 4LK4A 1NFXA 4LXBH 3SNEA 4UFGH 5DP6A 3LT3A 3GY3A 1FV9A 5TCAA 2VVUA 1QL9A 2TPIZ 4FUIA 1C2IA 1T8NA 3KEEA 1TPPA 2W5EA 4Q7ZA 3A7VA 4WVPE 2BY6X 3A7TA 1AGJA 3L3TA 1P8VC 1TQ7B 1LVOA 1OWJA 5CHAB 1WBGB 1QJ1B 2BY7X 2Y7XA 3MH5A 1UHBA 3U69H 3SJOA 2BLWA 2BLQA 1PQAA 3GCHB 4MPWA 1J9CH 2HGTH 1DX5M 3P6ZB 3DUXH 2B5TB 3RC5A 3M36A 1F5RA 1P3EA 3F1SB 1TMUH 3OYPA 3M3TA 3MH4A 2F91A 2WPIS 1DFPA 1KTTB 1JIRA 2D26C 3RDZA 1GBCA 3HGPA 5CMXH 3FZDA 2PSYA 1UTMA 1W7GH 2FIRH 1EAIA 8KME2 2R2MB 3RMMH 2ZDAH 2PR3A 4YLQH 4U01A 2OC1A 5AFZH 5ESBA 2PUXB 1SQTA 1BB0B 1MH0A 2NWNA 1NRPH 2ZWLH 1SB1H 5IYTA 1K22H 1B7XB 5A0AE 4QT8C 4WH6A 2I6SA 3UR9A 3SNCA 2PGQB 1QA0A 4NSYA 3Q3KA 3QDZB 4LZ1H 1ZTJA 1QTFA 2V6NA 4Y11E 5AVDA 3WY8A 3ZVBA 2UUYA 3DD2H 3F9FA 2GX4A 1WAYB 3UOPA 1CHOG 4ISLA 1Z8RA 1S6FA 4OS1A 2HALA 2CHAB 4BAMB 5JBAS 5DGJA 1T32A 2XC5A 2ZFTA 2ZHEH 1JRTA 3W95A 1A5IA 3UQOA 3B23B 1DVAH 4NIVA 5F6MA 2RA0A 1XVMA 3P70B 1UTOA 2BXUH 5EPYA 1HPGA 3MTYA 1SGFG 1YPMH 4ABBA 1FN8A 1MTVA 4OS6A 2ZHWH 2ZQ1A 2FOMB 4FVDA 2ZP0H 1FY1A 4GCHF 1MU6B 2ZHFH 1ZSJA 2QXIA 4CH8B 3GY5A 1AY6H 2HPQH 2DE8A 3A8BA 2HRVA 1N8OC 1WYKA 1AMHA 1FUJA 1Y3XA 5EW2H 4MNXA 3A80A 1GCTB 2ZKSA 2FI5E 2KAIB 4ISNA 1TALA 1C5WB 1O2ZA 5E0GA 1BTXA 1NRRH 2VIOA 4A6LA 2ZU3A 4K1SA 2D1JA 4ZKOU 4WMDA 1YPKH 3K6ZA 1D3TB 1IHTH 4IW4E 5EQQA 2HNTE 4YOIA 1GBTA 4I31A 3SV6A 1VCQA 4YLUA 1ESAA 3ZZ9A 8GCHF 2VWNA 5GCHG 1WU1A 3C1KA 1BMLA 1YCPM 3K2UA 1HJAB 4CHAB 1K9OE 1TX8A 3UOUA 5CE1A 1AWFH 1O3JA 1O2UA 2FDAA 1Z8JB 1TONA 3HPTB 1HJ9A 1TX7A 2ESTE 1K1JA 3DHKH 3E0PB 2P16A 1F92A 3KIDU 1C5PA 1ZMNA 3BTFE 1ZLRA 4THNH 3U8TH 1GMCF 5ESTE 3ZYEA 3T62A 4JK6A 5F8ZA 4BNRA 2QF0A 2FS9A 1ESBA 1GL1A 4YT6H 1THRH 1O3DA 2Z9JA 1DPOA 2A4OA 4D8NA 1P0SH 1AN1E 2C8XB 3RXOA 3LGVA 4X2XA 1C2EA 3ZVCA 1F0UA 5FBIA 2BDHA 1MTWA 4OGXA 3PV4A 3OY6U 3QZQA 1O5CB 3TPIZ 1QL8A 5IDKA 1QB9A 5TJXA 1JRSA 3NXPA 3T5FH 1ETRH 3T2NA 3BTWE 1C1TA 1MMJN 4SGBE 1O5AB 1YPGH 2BMGB 3TK5A 4JYVH 1FMGA 1EZXC 2VH0A 3KHVA 3P8OA 1OWDA 3ATWA 1FXYA 1PPCE 2G51A 3LKWA 3NWUA 4AB8A 3P8FA 1CGJE 1V2MT 2V35A 3TGJE 1V2PT 1C1UH 1C2MA 3M7TA 5EXLA 1O3OA 3M3VA 2OUAA 1WQSA 3Q00A 1A0LA 2VWLA 1GBDA 1INCA 1TGNA 3H7TA 2ZNKH 1T8OA 3FP8E 5JPMH 2UUFB 2TIOA 3MNXA 1BTUA 1C1QA 7GCHF 2QAAA 5E0HA 2HPPH 1VITH 1TRNA 1QBVH 2FMJA 3SU0A 1G37A 1SOTA 2OINA 1A61H 1UCYK 2BDYA 1QRZA 1O5GH 4NG9H 1O2QA 4AFSA 3PB1E 1S5SA 1JOUB 2J34A 5DG6A 1ZOMA 3L6PA 4GHQA 4YT7H 4NA7A 5J4QA 1MUEB 1QA7A 4AFZA 1AZ8A 4Y8XA 2JH0D 5EG4A 1BQYA 5DP3A 1UTLM 4NA8A 2SGPE 1L4ZA 4I8LA 4MNVA 1VZQH 2R0LA 1KXEA 1QJ6B 2PV9B 4XOJA 2WV5A 2AEIH 3PWBA 4AZ2B 1T8LA 2BVXH 1O3PB 1P04A 2VH6A 1W7XH 1L2EA 1G2LA 1Q3XA 3SJ9A 3BG4C 4KTUA 3V3MA 2YNBA 3GY4A 3TGIE 4DIIH 3SW2B 4CRAA 1AKSB 4DY7B 4HTCH 2J2UA 1PQ8A 1XKBC 1C5MD 2O8WA 5DP4A 3U1JB 2OP9A 2XXLA 4Y8YA 3A83A 1GJCB 2ZDLA 2ZCKP 3B8JA 1IQEA 3BIVH 1Y3WA 1GCDA 1AFQB 2GDDA 1A7SA 5C3NA 1FPCH 1GHBG 1P57B 2ZPRA 1D3PB 1IQLA 2GV6A 1F5KU 1D6RA 4RSPA 4JYUH 2WYJA 4ZKRU 4Y79A 1OS8A 1QURH 4AYVB 1H8DH 3ATIA 3GCTF 3SGAE 2GT7A 2BLVA 5JB9S
chains in the Genus database with same CATH superfamily
9LPRA 1RXPA 1N6YA 2PWXA 2H5CA 3LJJA 3JZ1B 5A2MH 2JH5D 3S9BA 1S6HA 1MTUA 2CF8H 4O3TA 3AW0A 1C5YB 3DFLA 3KQBA 1TGCA 1SLXB 1SGTA 5T3HA 5DKMA 3SUEA 1O2NA 2HNTC 1MBQA 3PRBA 1HXEH 1GVLA 4RT0A 2JH6D 3C27B 1SHYA 2G5VA 3O8BA 1GI5A 1BTWA 3ZV9A 3PWCA 1BMFD 3BG8A 2F9UA 1C5LH 3VB4A 3O8RA 5TCCA 2OBOA 2J38A 2RDLA 1P2OA 5EQSA 1GHAG 1SGCA 2ZF0H 3OSYA 1Z71A 3OX7U 4Q80A 3SUDA 3ZZAA 3GY8A 4DJZB 4ABDA 2GCHG 1SG8B 1TBQH 5DP8A 1A2CH 1GI0A 1FJSA 4UFFH 3UY9A 2VIDA 1UVTH 1WSSH 2FTMA 4YOJA 3NUMA 5EU8A 2LP6A 1C5ZB 3GYMA 1MU8B 2A2QH 2FOAA 2IJOB 5CHAC 4X2YA 2AMQA 4AFQA 3AW1A 2VIQA 3SU4A 1QGFA 2P3FH 2KAIA 4Y0YE 4I32A 1QRWA 2H2ZA 3GCHC 3RXKA 1GHZA 1HCGA 1NRSH 1ARCA 2GZ7A 1P12E 5DSFA 4ABHA 4E7RG 1HV7A 1O3GA 2IOTA 5FL7D 2XNDD 1C5OH 2OC0A 1L1JA 3ZZ8A 1V2OT 3MU1A 2VNTA 3BTTE 2VIWA 4GUXA 9ESTA 4K2YA 1DOJA 1O3NA 2C93B 2XBVA 4CR5A 5EJZA 1GGDB 1LHDH 2ZGCA 4XBBA 3FP6E 2KCOA 1BRAA 1ELDE 1OWEA 1GHXH 3V13A 1EFRD 4RT1A 1MD8A 1EASA 2NU2E 1P11E 3UUZA 1K21H 2DE9A 1SQRA 3M5NA 1P9UA 2ZDKA 1ZHMA 4ABGA 1N1LA 3N7OA 4LZ4B 5FXLA 4WH8A 3ZIAD 2O8LA 2PGBB 4D9QA 3BTHE 2LNCA 1MZAA 1ANBA 2A7JA 1PPEE 1THSH 3OTPA 4ZHMU 1Y59T 2ZTXA 2LIZA 2NU1E 1GVKB 2GP9B 5JB8S 1MZDA 2ZFQH 4Q2KA 4IMZA 3F9HA 1Y5AT 2WUBA 5KEDA 1ANDA 1RRKA 1TLDA 1WCZA 5L6NH 1OPHB 2G81E 5LPRA 1DWDH 1LHFH 3TK9A 3BV9B 3D65E 1K1IA 3SU5A 1ZHPA 1KIGH 3T28A 3RXVA 4BAKB 1H9IE 2FXRA 1T4UH 4BAOB 2BD9A 1O2TA 4U2WA 1PQ5A 2G52A 5DJ7A 1AU8A 1C1OA 1O30A 2PFEA 1TRYA 3Q76A 4X1PU 1CSOE 6ESTA 1Y8TA 3TH2H 1UTQA 3V7TA 2PP6A 1EB1H 3A8DA 4NA9H 1UK2A 1BHXB 4A1VA 4H4FA 1IQKA 2HNTF 2THFB 1QL7A 2BD2A 5F8XA 1ARBA 2BLOA 3QGJA 2M5TA 3CENA 5A0CA 4KKDA 2LPRA 4JZFH 1RFNA 5DO4H 3RXAA 3QX5H 2BOKA 3RXQA 3WWFA 2NU4E 1QIXB 1GCTC 2ODYB 4Q63A 1SGFA 2SNWA 3RXTA 2Y7ZA 3MH7A 2B8OH 1OX1A 2C8YB 4Y8ZA 2OQ5A 1WV7H 4IC6A 1W13U 3Q3YA 3RUOA 3SV9A 4FUDA 1O2SA 1BMMH 2QXJA 1K1LA 1XUJA 5B6OA 1HJAC 4CHAC 2XWAA 1GHYH 1IQGA 4ASUD 2ZO3H 2UUJB 3M7UA 2STAE 1OSSA 1XKAC 5ABWA 5FBEA 5GNDA 2BD5A 1DSUA 1VCPA 1TX6A 2BDBA 1MKXK 1Y3UA 1K1OA 1H1BA 3F2GA 5FPYA 2EQNA 3QK1A 2BM2A 3M5OA 5T6FA 1U6QA 3L33A 4UONA 3ZZ4A 2GTBA 3UWJH 2XTTB 4H42U 2BD3A 1ZSKA 3PYHA 3RXHA 1DSTA 1FIZA 1ZSLA 1NT1A 4B2AA 4ZHLU 7LPRA 4AG2A 3VFEA 2XCNA 2ZPSA 2ZU2A 4DW2U 4YZUA 1HIAB 5JBTA 1P2IA 1TIOA 1A0JA 5FX6A 6LPRA 1IQHA 2FPZA 1PFXC 4Q7XA 3UB0A 3FKSD 1AKSA 1GI8B 3ZVDA 3BIUH 3DFJA 1MABB 1O0DH 1IAUA 1P09A 1XUHA 3OFND 2EA3A 2DUCA 3STJA 3UNRA 5DP9A 1DXPA 1YP9A 3EQ0H 1LCYA 1FY3A 2K0QA 4XBCA 1NO9H 4BANB 1BMAA 3RU4T 3VXFH 3MOCA 4YM9A 3BTQE 3OEED 1FY8E 2ANMH 4XBDA 5C1UA 1ETSH 4IN2A 3T29A 3K65B 2WSSD 5JDUB 2XW9A 1ZYOA 4B71A 2D2DA 1O3BA 3LGWA 1XUGA 1BBRH 1LDTT 2FLRH 5A8ZA 1MBMA 2A4RA 1AB9B 1DWCH 2OQUA 5LGOA 1S81A 1ELVA 1ZMLA 1KXFA 3W94A 1THPB 4U32A 1BTYA 5HYOA 2Y81A 1ZJKA 3MU0A 1E1QD 2Y5FA 2FODA 1O3MA 2OK5A 3RXGA 1C2KA 1C2GA 4WMEA 1BT7A 3H7OA 2A45B 3E3TA 4NFFA 3ZVGA 1NPMA 1OYTH 1CQQA 5A09A 3AVZA 4K5ZA 2GMTB 4JK5A 3SV7A 1XUKA 4WMFA 1RTKA 3ENSB 1WTHD 4BXWA 1O2WA 1UTPA 5I46H 4GCHG 4K3JA 1HAIH 3RLYH 1P03A 4O97A 2K8IA 4FETA 1C9TA 2OXSA 3K6YA 1TPOA 2JETB 1C1PA 1HAXB 2V3MA 1GBAA 3NZIA 3TGKE 2Z9GA 1F0RA 1O2KA 2BQ6B 5AF9H 1NRQH 2ZFFH 5A0BA 4FU8A 3F68H 1MAYA 2P3UB 1SGQE 4CBNA 2WUCA 3TJOA 1D6WA 2QV1A 2SGQE 3GCOA 3RU4D 3LGIA 2H9TH 1UCYH 2SGAA 1BRBE 1O2PA 2PSXA 1FNIA 1T7CA 8GCHG 2ASUB 3UNSA 1DDJA 4TY6A 1O35A 6GCHF 4LOYH 1V2JT 3U28C 2AGGX 1GMHF 3LONA 3ATMA 3F3BA 3EDXB 1G36A 5EXMA 2YMSC 5EW1H 1SLWB 1DUEA 4X1SU 5EQRA 5I25A 3LIWA 1WDIA 3S7HB 3M35A 1AFQC 1HAYB 1EZUC 1AUJA 4J1YA 4P02A 1GMCG 1D9IA 1FDPA 3TIUA 1O5EH 4YTAA 4OS5A 3CP7A 4ABFA 1DUAA 3KGPA 1MQ5A 2F9VA 4XFQA 4DVAU 1AE8H 1HBTH 1AUTC 1BTPA 4AC9A 2GZ8A 2NU0E 2QN5T 4B2BA 3A86A 3BTKE 1GBEA 2ZG0H 2QY0B 4NFEA 4O3UA 2WPKS 3DSPA 5EXNA 1ELAA 3PLPA 4A1TA 2P8OB 2XBXA 3M5MA 2NU3E 4MTBA 4I33A 5E2OA 2PHBA 2WPLS 1XXDA 4ISHH 1BMNH 1WTGH 1YM0A 3RXLA 1S82A 3GOVB 1S0RA 3MNSA 5AHGH 1VGCB 1ZTLA 3KCGH 3RM2H 1MCTA 5DP5A 3N99A 3RP2A 1C5QA 3G01A 2FP7B 4DT7B 2CGAA 1L0ZA 3SU3A 4BAHB 3A82A 3E90B 2ZPQA 1EOJA 1JMOH 4BTIB 4ZXYH 3ZVEA 1K28D 1MAXA 1GI6A 1C2LA 1KXAA 5HGGA 1PYTC 1HAGE 5EGMA 1C1SA 3RXIA 3VPKA 5H4IB 2Q6GA 3LJOA 1C1NA 4I8HA 4ACAA 3RXCA 2BZ6H 2RFKC 1BBRK 7GCHG 1E1RD 4ABEA 2ZZUH 3MHWU 1F7ZA 2ALPA 4X1RU 2EI6A 1EATA 3UR6A 3M61U 2ZI2H 2RG3A 2BQWB 1WOFA 5HKKD 1Y5UT 1V6DA 1RIWB 2J92A 1EUFA 1FPHH 1YKTA 1C4Y2 1C4V2 1GBKA 3A8CA 3SUFA 1HAHH 2BX4A 2ANWA 3SV8A 3ATKA 4U30A 1B0FA 1XMNB 1DLEA 2B0FA 3RXFA 4X6MA 4ZMAH 1CA0C 1EJNA 4FOUC 1HUTH 1SGNE 4UFDH 1BUIA 1LQDB 1CT2E 1C2HA 4RKOB 4WXIA 2EEKA 1GGDC 1HJ8A 4MPVA 3TH4H 5GXPA 5K7RA 3EE0B 1CE5A 2BYAX 3RXJA 2SFAA 3RM0H 2C8WB 1TNHA 2PKAB 4WY3A 2RA3A 4I8GA 1CGHA 4IMQA 1SGYE 3T25A 2VGCB 2P93A 2CV3A 1GI9B 1KXCA 4Y71A 4K69A 4BTTB 1KXBA 1CO7E 1DXWA 1W2KH 3TU7H 2WV9A 2Z9LA 1Z1IA 3M7QA 2BX3A 1IQJA 4KP0A 2RDEA 2Z9IA 1J16A 3ZZCA 1HAVB 2AGEX 3GISB 1K0HA 4X1QU 1HIAA 3SJIA 1YBWA 2WHXA 1KDQB 2IN2A 4IN1A 1V2ST 2Q6DA 1A46H 2R3YA 3VB6A 1GL0E 4JCNA 1AWHB 2QF3A 3TITA 4ASHA 2WPHS 1KY9A 1SFIA 1EJAA 5FCKA 4MQAA 2PLXA 3ESTA 1QB1A 1DT2A 1GJ5H 3GCTG 3MNCA 4UFEH 1Q2WA 1GHVH 2BTCE 2R9PA 2ZEBA 1NN6A 6CHAB 1NESE 2PTNA 2QGRA 4NIYA 1RTLA 1ZZZA 4I8JA 3VB3A 1O2YA 1O38A 1CGIE 1C5TA 5GIBA 1P9SA 1PPZA 1NTPA 1ELFA 4OS7A 3DSGA 1VJAU 1A5GH 2ULLA 3T26A 4AORA 1TBZH 1O2OA 3Q77A 1AVXA 3IWMA 2CF9H 2ODPA 3HATH 2BXTH 2QF4A 2OC8A 2BB4A 2FESH 1GMDF 4CBOA 2ZCLP 2V0BA 1QQUA 1SPJA 2JJ1D 3FFGA 2ZCHP 2AHME 1QY6A 1TABE 3CS7A 3RU4E 5HMAA 1WQVH 2AH4X 2G4TA 3KF2A 3Q3XA 4CRFA 4X2WA 3HK6B 3LC5A 4Y7AA 4R0IA 3KN2A 2CN0H 2RCEA 3BTEE 4BOHA 2VIPA 1GBMA 1SKYE 1W0JD 1LPGB 1G2MA 2F4LA 1ELGA 1YPLH 2HWLB 4GVUA 4OGYA 3URDA 1W10U 1HLTH 1O5FH 3VXEH 3OU0A 2TGTA 1G30B 3W1EA 1EP5A 1SGEE 1ZTKA 1N6XA 1C5VA 3AASA 4NIXA 4FU7A 3SU2A 3PRDA 1XUFA 2FO9A 2BVRH 1Z7KA 1NFWA 1C5NH 1OOKB 1TGTA 4Q4LA 3T27A 3LH3A 3F0PA 1BA8B 3RXBA 1O34A 3RMOH 4B76A 1LHGH 1O3AA 1O2VA 1QBOA 2ZQ2A 4XE4A 2A7CA 1RTFB 1EZSC 4GSOA 4Y10E 1AVWA 1SQOA 1D3DB 3ZYDA 1O3KA 1VITF 2A4GA 2PKSB 1VCWA 1O31A 1MKXH 1OHHD 2JKHA 1Q31A 2FX6A 4FVBA 3M5LA 1E79D 1L4DA 3RC6A 3UAIC 1GDQA 5ETXA 3RXRA 1BBRE 1NRNH 2WYGA 1YPJH 4ABJA 1SL3A 4MNWA 3ZZ3A 1KLTA 3WW7A 1IHSH 2WPDD 1OKXA 2P3TB 3QUMP 2ZDMA 1O3HA 3E8LA 3ZVFA 5L30H 1G32B 2I6QA 2D8WA 1C1RA 2F9PA 4HG6A 4Y6DA 4A5TS 3LGTA 1AB9C 4ISOA 5K0HA 1VJ9U 2BY8X 3GY7A 2BDIA 4XRNA 1KLIH 2BD8A 1SC8U 4JZ1A 5FAHA 1QFKH 5EODA 1AZZA 2LELA 3AAUA 4O03A 1O2HA 1GJ7B 1TMBH 1BHXF 1W11U 2GMTC 3FO8D 2XNIA 1RD3B 5E2PA 4MVNA 1BRCE 2R0KA 4X2VA 3BSQA 2Y80A 5CDFE 1RGQA 3PTBA 4YESB 1GJDB 4TT3D 3RXEA 1GG6B 2A0QB 1IOEA 5KECA 2VB0A 2A31A 3U9AH 4ZKSU 1UTNA 1UCYE 1HAPH 1P02A 1ANCA 2UWOA 4SGAE 2M2AA 2JETC 4K1EA 4ACBA 2BZAA 1UMAH 2H9EH 3SO3A 2BVSH 5AFYH 5F53A 3O8CA 3MO6A 1SI5H 1CHGA 2CHAC 1A3BH 4BTUB 2FYRA 3M37A 1HXFH 4NGAH 3F2FA 4IC5A 1CT0E 1DANH 2FOCA 1OWKA 1ZGVA 5HIYA 1QQ4A 1CBWB 4Z6AH 1FX0B 2AMDA 2P59A 1ELCA 3GS9A 4DCDA 1FONA 3FN8A 1W14U 1XXFA 3PLBA 4CRDA 1V2RT 2F3CE 3SHAH 2GGVB 2QIQA 1MKWH 4BXSA 1LVBA 2CMYA 5E0JA 2STBE 1UK3A 4KTSA 1P2QA 1FQ3A 4INKA 1E37B 5T6GA 4INHA 1F0TA 1E38B 1YCPH 2WPJS 1EP6A 1GI4A 2AFQB 2PKAA 2OLGA 4MDSA 1EKBB 2O8MA 1FLEE 3S9AA 2Y5GA 4A7IB 3EE7A 1HFDA 1ABIH 3A8AA 1GJAB 4M7GA 3ZZ5A 2C90B 1GVZA 1J15A 1C9PA 1E34B 1YGCH 2QCYA 1J14A 1XX9A 1ZPZA 3LGYA 5F8TA 2EI7A 3SV2H 4F55A 4TWYA 3U8RH 5L2YH 1JIMA 1LKBA 1QJ7B 3B9FH 3F9GA 4X8VH 3SNBA 1QR3E 1SLVB 3UNQA 1OXGA 1HAVA 1OWHA 3VGCB 3SOSA 2A5AA 3N7EA 1ORFA 5GJ4B 1KDQA 1GI2A 1F2SE 1O3EA 1AE5A 1RS0A 1VGCC 5C1YA 4B1TA 2G5NA 3CS0A 1NFUA 2EI8A 5FCRA 1LQEA 7ESTE 2AMPA 2ZECA 1LPKB 3DA9B 2J9NA 5E8EH 4FUGA 1ZGIA 2BHGA 3TNTA 3S7KB 1TQ0B 2XRCA 4TYDA 1KLJH 1LPZB 3ZVAA 3AK5A 3PO1B 2ZU5A 1EZQA 4MPUA 1TNJA 4DG4A 3U98H 1GJ6A 2BY9X 2HVYB 5F03A 4ZKNU 2Y5HA 5C20A 1NFYA 5C17A 3PV2A 4Z0KA 4BAQB 2FOEA 3BTME 1FN6A 3E6PH 1SMFE 4NWKA 1O2XA 3ODDA 5DK1A 3HKIB 1LO6A 3BN9A 4ZH8A 2OBQA 3GICB 1K1MA 1RIWC 2W26A 1OWIA 2BY5X 1V2VT 1KSNA 3VB7A 3SI3H 1NU9A 1TGSZ 3S0NA 1IQNA 1S85A 4IBLH 1GDNA 1SSXA 1QHRB 1YLDA 1P2MA 3BTGE 5KGOA 3RXDA 2Y6TA 4ABAA 3EA8A 1OP8A 1F5LA 1T8MA 2V3HH 3MYWA 4Y76A 1GI1A 1C1VH 3TH3H 2FS8A 1MTNB 2VWOA 1YY3A 3SGQE 1KXDA 4KTCA 1L1NA 1OP0A 4ZUHA 2XYAA 1P2NA 1MQ6A 4XDEA 2KCPA 2FOFA 3A84A 4WXVA 1GPZA 2YNAA 1LHCH 2A5IA 3PM3A 3WWBA 1O2RA 1PJPA 2FX4A 2GV7A 2VGCC 1S83A 3SQEE 2P95A 2ZTZA 1UO6A 1FI8A 3KNXA 3A7YA 4JMYA 3V12A 6GCHG 3FP7E 1HNEE 5A8XA 4UEHH 3A89A 1GMHG 3I29A 3F6UH 1ELTA 1ZRKA 3KQEA 1FY5A 2V3OH 4AYYB 3D49H 5FPSA 1HDTH 3MQKC 1EAWA 3NK8A 1EAXA 5C1XA 4Z1MD 3SQHE 4IS5A 4K1TA 1S84A 3BEFB 3PLKA 1TYNA 1ZR0A 3RMLH 2QC2A 1MKWK 3SJ8A 2ZDNA 4ZROA 4X6NA 1C5SA 2XC0A 4GPGA 2Z9KA 1GJ8B 3S69A 4MLFB 1DITH 4WJG2 1ZJDA 1UVSH 2O9QA 3SJKA 4DOQA 1PQ7A 3TJNA 1H9HE 1YCPK 2G00A 2TBSA 1XVOA 3EA9A 1W0ZU 3FOAA 1GI3A 1ID5H 6CHAC 2XBWA 4GAWA 4FUFA 4CH2B 2W3KA 1HAOH 1C2DA 2BDCA 3RMNH 3BEIB 4M9FA 1Z8GA 2ANKH 1EQ9A 1A4WH 1BITA 1EPTB 4A92A 3UPEA 5FHTA 2C4FH 1P3CA 3KQDA 1GBFA 3QLPH 1DY9A 2ALVA 2Z3DA 2V7QD 3A81A 3ZV8A 2FOBA 1SLUB 3PMJA 3EA7A 1K1NA 3E0NB 3QN7A 5L2ZH 2FEQH 2A7HA 5GDSH 1SBWA 1TOCB 4K60A 8ESTE 1UJ1A 1O5BB 1B5GH 1TE0A 4X0WU 1NROH 1C2FA 2TGAA 3URCA 5PTPA 3QZRA 2GCTB 2ZU1A 4AB9A 2A1DB 1UVOA 2F9OA 2AIQA 1SOZA 4RN6A 1ZPCA 1CVWH 1G3EA 2HVXA 1RJXB 3D62A 1ACBE 4YO9A 1UTJA 1V2TT 4AX9H 5HXFA 1LTOA 1YPHE 2A4QA 3OEHD 2YOLA 2ZGJA 1AD8H 3MU4A 2KFWA 2IJD1 3GY6A 4AGJA 4OS4A 1NBMD 3LDXH 3PMBB 3MH6A 4YXWD 2B7DH 3SORA 3TVJB 4YOGA 4GHTA 2H6MA 1KTSB 2L6OA 1EOLA 2R2WU 4VGCB 1P10A 1CHOF 4NCYA 2G4UA 1ZPBA 3PROA 4Y7BA 1D4PB 1HRTH 1K1PA 4NWLA 1TGBA 1G3DA 2R3UA 2FOGA 1V2LT 3D23A 1DWBH 2FTLE 3RXPA 2VU8E 1BZXE 3H5CB 1TB6H 2J5UA 1O2MA 1T4VH 2OC7A 3TLOA 1TNLA 1V2QT 3P95A 4KELA 2OCVB 3ITIA 4P00A 1BJVA 5FPTA 3SI4H 2ZIQH 2GVFA 5DP7A 4DT4A 1NZQH 1UVPA 1TRMA 4ESTE 3GDVA 3BF6H 5BPEA 1QB6A 1XUIA 3TJVA 4B75A 2PKSC 1VKYA 2AERH 1ZRBA 2FOHA 3U8OH 1UVUH 4UD9H 3E91A 1AQ7A 1TOMH 1TNGA 2ZU4A 3VB5A 2Q1JA 3GYLB 4WF8A 1EX3A 3RXUA 2J94A 2WPMS 3VG8A 3PMHB 1GBLA 3SBKA 1Z1JA 3P17H 2XCFA 3MO9A 1AO5A 4CRCA 2TRMA 1KYNA 4UE7H 1PPBH 5C2ZA 4FUEA 3LU9B 1ABJH 3A87A 4DGJA 1V2NT 2F83A 1XM1A 2ZGHA 3M3SA 1GJBB 1QNJA 3IG6B 3P92A 4MG3A 4ZXXH 3RXSA 1FZZA 5GCHF 2KCYA 2UUKB 4HGCA 1S6LA 3VEQB 2H1UA 2ODQA 1DE7H 3K9XB 1P05A 3CNRA 3IITA 3GCNA 2Z3CA 1GWAA 4AFUA 2AS9A 1L1GA 1K2I1 2BDGA 1P01A 2TGPZ 3V0XA 1AHTH 5LPFA 3FZZA 2BD7A 1PPGE 1GJ4H 2SNVA 2WV4A 4E06H 1ZHRA 5C94A 1E0FD 2ZHDA 2IPQX 3A88A 4HFPB 1Z8IB 1AI8H 1WUNH 2K1QA 3UWIA 3N7DA 3GY2A 4JZIA 1C2JA 1GG6C 1QCPA 1CU1A 2GT8A 1EXFA 3F9EA 4NIWA 4RI0A 1DWEH 4CRBA 1SGIB 2GDEH 1NU7B 5C5NA 1YLCA 1O3LA 1TFXA 5G4BA 2FI4E 3HK3B 1GMDG 1W0YH 4NSVA 1LVYA 3RXMA 1LMWB 1HGTH 1BTZA 1ELEE 2VIVA 1C1WH 1DLKB 1YPEH 2QF5A 2UWPA 1SGPE 1Y5BT 4XSKU 1AIXH 4X6OA 2CJIA 2A2XH 3SZNA 1CBWC 1QBNA 1BIOA 3LPRA 5GWZA 2VINA 1BTHH 4TY7A 1ELBA 5EPNA 2W7SA 4F49A 2C3SA 1YYY1 1TAWA 1YF4A 1O39A 2H5DA 1G3CA 3R3GB 3NPSA 2QA9E 5BRRE 5C5OA 5SGAE 3P8NA 3RLWH 1EJMA 2O8UA 1G3BA 1P2KA 2ZFPH 1NY22 3NCLA 1PPHE 1J8AA 2IPHA 1NS3A 3I77A 4TPYA 2C8ZB 3SHCH 2A5KA 4H6SB 4PROA 1JBUH 2OD3B 4RKJB 1SFQB 3LH1A 4GLYA 1TWXB 4CREA 3EGKH 3F0OA 2Y82A 1FIWA 7KMEH 5JYIA 1A0HB 3E1XB 2GD4B 3ODFA 3QWCH 3A7ZA 3BTDE 3SYJA 4AGKA 4D76A 4J2YB 4DURA 1PYTD 4B73A 4X8UH 5B6LA 1VITG 5DPAA 3NRLA 3VGCC 1SGDE 4Q7YA 1T31A 3ELAH 4CR9A 1N8OB 4UDWH 3GDUA 1MCVA 3I78A 1IQIA 1O33A 2ZTYA 1GJ9B 2ZGBH 4D7FA 1UHBB 1B0EA 3SNAA 1ETTH 3ZZDA 2QXHA 3O8DA 2JDID 2VWMA 1YPHC 3UFAA 5LH8A 3QTVH 4OS2A 4CRGA 1BRUP 1O36A 3PO1C 2GKVE 3A7XA 8LPRA 1GBHA 2ZGXH 1A1RA 3FAOA 1EPTA 2Z94A 2K7XA 1GBBA 2QYIA 3A7WA 5HM2A 2FLBH 3MMGA 2FYQA 4FUCA 4FUJA 1V2KT 2JJ2D 3SNDA 1NBME 1H8IH 1J17T 4HI3A 2FWWA 1W12U 1GHBF 3SGBE 3ZZ7A 3ZZ6A 3PTNA 1V3XA 3UTUH 1C5XB 3HGNA 2SGEE 1O5DH 1SQAA 3OY5U 3ZZBA 1X7AC 5J4SA 2FZZA 2VVVA 3R0FA 1O2LA 2B9LA 1G9IE 4TWWA 1MTNC 4I86A 1P06A 1E35B 1MTSA 1BOQA 3MNBA 4JZEH 3HKJB 2PTCE 2EY4C 1P2JA 1GBJA 1BCUH 2BOHB 1O32A 3QGNB 2ZFRH 5T6DA 3S9CA 1HYLA 5C0TA 2BD4A 2AIPA 2Z3EA 4I8KA 1QRXA 3QO6A 3UQVA 5LPEA 4ISIH 1IQMA 3A85A 1A3EH 4X8TH 5JBCS 1EB2A 2Q6FA 4HZHA 2XBYA 1FAXA 2CXVA 3AAVA 1C5UA 1GBIA 1O3IA 1QZ8A 1Y3VA 4AG1A 1GI7B 2F9BH 1FY4A 1H4WA 1O3FA 2HLCA 2O8TA 2P94A 4AN7A 1CA0B 3MFJA 3STIA 1LKAA 2F43B 1SHHB 3KQCA 3SU1A 4B74A 1ANEA 2VBCA 2FI3E 4FUHA 3BEUA 4MPXA 4R8TB 4KGAA 1GHAF 3ATLA 2ZFSA 1PPFE 1TMTH 1OP2A 3LOXA 3MWIU 4NZQA 4WWYA 2GCHF 1D3QB 4ABIA 1COWD 3SUGA 5JBBS 1TNIA 1UTKA 2ZA5A 1FAKH 2XC4A 1C5RA 1GHWH 1NC6A 2EC9H 2J4IA 1Y3YA 3DT0H 3PMAB 1ESTA 1H9LB 3TJUA 3P8GA 4D9RA 4ZAEA 1TNKA 2BQ7B 2KCAA 2L74A 2ILNA 3EAJA 4INLA 3SU6A 2ZC9H 3DCLA 3MU5A 4O9VA 2ANYA 4X6PA 3RC4A 1IQFA 1JWTA 1KMHB 1C1MA 2J98B 1S0QA 2ZDVH 4TPIZ 1EPTC 4XD7D 2SGFE 1CA8B 1BJUA 4K8BA 5FX5A 1E36B 4NZLA 3EYDA 1TBRH 1M9UA 4B2CA 1Z6JH 3LC3A 4FU9A 3TK6A 5C67A 2WZQA 2VVCA 5EOKA 5GPIB 3SZEA 3KL6A 4JYTA 5A8YA 1LHEH 1W0KD 3EBNA 1MD7A 1Z6EA 2GCTC 3UIRA 3GDSA 4MNYA 3NKKA 2WINI 2Z6BD 4AOQA 1VR1H 2KR7A 1UW7A 3LGUA 1YC0A 1ZMJA 2W3IA 4A1XA 1TA6A 2QXGA 3BG4B 1W3CA 5EJ1A 1DS2E 4K8YA 2AYWA 2GZ9A 1AVGH 2P8OC 5HM9A 1HAZB 2J95A 4I7YH 2A32A 4H6TA 4X1NU 2G8TA 3F2HA 3JZ2B 4D7GA 3MI4A 1DICA 1LVMA 1SGRE 2PW8H 3FANA 4FUBA 1OYQA 1NM6A 1DY8A 4FXGH 1SR5C 4VGCC 1V2WT 2KX4A 2SGDE 3FVFB 2G55A 1F0SA 4TSFD 1SVPA 2UWLA 4IGDA 4F4OC 2VJ1A 4ZHAA 2HOBA 2OTVA 4ZCNA 2H9HA 2ZHQH 1W8BH 1O3CA 4E05H 3U1IB 3OTJE 2TGDA 3E16B 3MU8A 1AFEH 2W7UA 1O2GH 4E7NA 1DM4B 1O2IA 4X8SH 5DN6D 1A5HA 3QTOH 1CT4E 1TPSA 1V2UT 1C4U2 2AGIX 1TPAE 1JXPA 2XWBI 1TA2A 1BDAA 4JZDH 2BDAA 1EAUA 3TNSA 1GDUA 1HB0B 3MO3A 1UK4A 1O37A 3SN8A 2W6JD 2Z7FE 2F9NA 4Y0ZE 3UREA 1O2JA 2FM2A 4DIHH 2PUQH 4LK4A 1NFXA 4LXBH 3SNEA 4UFGH 5DP6A 3LT3A 3GY3A 1FV9A 5TCAA 2VVUA 1QL9A 2TPIZ 4FUIA 1C2IA 1T8NA 3KEEA 3OAAD 1TPPA 2W5EA 4Q7ZA 3A7VA 4WVPE 2BY6X 3A7TA 1AGJA 3L3TA 1P8VC 1TQ7B 1LVOA 1OWJA 5CHAB 1WBGB 1QJ1B 2BY7X 2Y7XA 3MH5A 1UHBA 3U69H 3SJOA 2BLWA 1H8HD 1PQAA 2BLQA 3GCHB 4MPWA 1J9CH 2HGTH 1DX5M 3P6ZB 3DUXH 2B5TB 3RC5A 3M36A 1F5RA 1P3EA 3F1SB 1TMUH 3OYPA 3M3TA 3MH4A 2F91A 2WPIS 1DFPA 1KTTB 1JIRA 2D26C 3RDZA 1GBCA 3HGPA 5CMXH 3FZDA 2PSYA 1UTMA 1W7GH 2FIRH 1EAIA 8KME2 2R2MB 3RMMH 2ZDAH 2PR3A 4YLQH 4U01A 2OC1A 5AFZH 5ESBA 2PUXB 1SQTA 1BB0B 1MH0A 2NWNA 1NRPH 2ZWLH 1SB1H 5IYTA 1K22H 1B7XB 5A0AE 4QT8C 4WH6A 2I6SA 3UR9A 3SNCA 2PGQB 1QA0A 4NSYA 3Q3KA 3QDZB 4LZ1H 1ZTJA 1QTFA 2V6NA 4Y11E 5AVDA 3WY8A 3ZVBA 2UUYA 3DD2H 3F9FA 2GX4A 1WAYB 3UOPA 1CHOG 4ISLA 1Z8RA 1S6FA 4OS1A 2HALA 2KZ4A 2CHAB 4BAMB 2GJGA 5JBAS 5DGJA 1T32A 2XC5A 2ZFTA 2ZHEH 1JRTA 3W95A 1A5IA 3UQOA 3B23B 1DVAH 4NIVA 5F6MA 2RA0A 3PV5A 1XVMA 3P70B 1UTOA 2BXUH 5EPYA 1HPGA 3MTYA 1SGFG 1YPMH 4ABBA 1FN8A 1MTVA 4OS6A 2ZHWH 2ZQ1A 2FOMB 4FVDA 4B6EA 2ZP0H 1FY1A 4GCHF 1MU6B 2ZHFH 1ZSJA 2QXIA 4CH8B 3GY5A 1AY6H 2HPQH 2DE8A 3A8BA 2HRVA 1N8OC 1WYKA 1AMHA 1FUJA 1Y3XA 5EW2H 4MNXA 3A80A 1GCTB 2ZKSA 1YWUA 2FI5E 2KAIB 4ISNA 1TALA 1C5WB 1O2ZA 5E0GA 5C0UA 1BTXA 1NRRH 2VIOA 4A6LA 2ZU3A 4K1SA 2D1JA 4ZKOU 4WMDA 1YPKH 5T1VA 3K6ZA 1D3TB 1IHTH 4IW4E 5EQQA 2HNTE 4YOIA 1GBTA 4I31A 3SV6A 1VCQA 4YLUA 3OE7D 1ESAA 3ZZ9A 8GCHF 2VWNA 5GCHG 1WU1A 3C1KA 1BMLA 2J98A 1YCPM 3K2UA 1HJAB 4CHAB 1K9OE 1TX8A 3UOUA 5CE1A 1AWFH 1YLNA 1O3JA 1O2UA 2FDAA 2KM0A 1Z8JB 1TONA 3HPTB 1HJ9A 1TX7A 2ESTE 1K1JA 3DHKH 3H09A 3E0PB 2P16A 1F92A 3KIDU 1C5PA 1ZMNA 3BTFE 1ZLRA 4THNH 3U8TH 1GMCF 5ESTE 3ZYEA 3T62A 4JK6A 5F8ZA 4BNRA 2QF0A 2FS9A 1ESBA 1GL1A 4YT6H 1THRH 1O3DA 2Z9JA 1DPOA 2A4OA 4D8NA 1P0SH 1AN1E 2C8XB 3RXOA 3LGVA 4OM9A 4X2XA 1C2EA 3ZVCA 1F0UA 5FBIA 2BDHA 1MTWA 4OGXA 3PV4A 3OY6U 3QZQA 1O5CB 3TPIZ 1QL8A 5IDKA 1QB9A 5TJXA 1JRSA 3NXPA 3T5FH 1ETRH 3T2NA 3BTWE 1C1TA 1MMJN 4SGBE 1O5AB 1YPGH 2BMGB 3TK5A 4JYVH 1FMGA 1EZXC 2VH0A 3KHVA 3P8OA 5EIYA 1OWDA 3ATWA 1FXYA 1PPCE 2G51A 2JIZD 3LKWA 3NWUA 4AB8A 3P8FA 1CGJE 1V2MT 2CK3D 2HLDD 2V35A 3TGJE 1V2PT 1C1UH 1C2MA 3M7TA 5EXLA 1O3OA 3M3VA 2OUAA 1WQSA 3Q00A 5IK2D 1A0LA 2VWLA 1GBDA 1INCA 3KYGA 1TGNA 3H7TA 2ZNKH 2YMSD 1T8OA 3FP8E 5JPMH 2UUFB 2TIOA 2QE7D 1BTUA 3MNXA 1C1QA 7GCHF 2QAAA 3KQ5A 5E0HA 2HPPH 1VITH 1TRNA 1QBVH 2FMJA 3SU0A 5EJLA 1G37A 1SOTA 2OINA 1A61H 1UCYK 2BDYA 1QRZA 4B6FA 1O5GH 3KYFA 4NG9H 1O2QA 4AFSA 3PB1E 1S5SA 1JOUB 5HIZA 2J34A 5DG6A 1ZOMA 3L6PA 4GHQA 4YT7H 4NA7A 5J4QA 1MUEB 1QA7A 4AFZA 4F48B 1AZ8A 4Y8XA 2JH0D 5EG4A 1BQYA 5CHBA 5DP3A 1UTLM 4NA8A 2SGPE 1L4ZA 4I8LA 4MNVA 1VZQH 2R0LA 1KXEA 2W6ID 1QJ6B 2PV9B 4XOJA 2WV5A 2AEIH 3PWBA 4AZ2B 1T8LA 1WXRA 2BVXH 1O3PB 1P04A 2VH6A 1H8ED 1W7XH 1L2EA 1G2LA 1Q3XA 3SJ9A 3BG4C 4KTUA 3V3MA 2YNBA 3GY4A 3TGIE 4DIIH 3SW2B 4CRAA 1AKSB 4DY7B 4HTCH 2J2UA 1PQ8A 1XKBC 1C5MD 2O8WA 2YMSB 5DP4A 3U1JB 2OP9A 2XXLA 4Y8YA 2XOKD 3A83A 1GJCB 2ZDLA 2ZCKP 3B8JA 1IQEA 3BIVH 1Y3WA 1GCDA 1AFQB 1A7SA 5C3NA 1FPCH 1GHBG 1P57B 2GDDA 2ZPRA 1D3PB 1IQLA 2GV6A 1F5KU 1D6RA 4RSPA 4JYUH 2J97A 2WYJA 3DSOA 4ZKRU 4Y79A 1OS8A 1QURH 4AYVB 1H8DH 3ATIA 3GCTF 3SGAE 2GT7A 2BLVA 5JB9S
chains in the Genus database with same CATH topology
9LPRA 1RXPA 1N6YA 2PWXA 2H5CA 3LJJA 3JZ1B 5A2MH 2JH5D 3S9BA 1S6HA 1MTUA 2CF8H 4O3TA 3AW0A 1C5YB 3DFLA 3KQBA 1TGCA 1SLXB 1SGTA 5T3HA 5DKMA 3SUEA 1O2NA 2HNTC 1MBQA 1HXEH 1GVLA 2JH6D 3C27B 1SHYA 2G5VA 3O8BA 1GI5A 1BTWA 3ZV9A 3PWCA 3BG8A 2F9UA 1C5LH 3VB4A 3O8RA 5TCCA 2OBOA 2J38A 2RDLA 1P2OA 5EQSA 1GHAG 1SGCA 2ZF0H 3OSYA 1Z71A 3OX7U 4Q80A 3SUDA 3ZZAA 3GY8A 4DJZB 4ABDA 2GCHG 1SG8B 1TBQH 5DP8A 1A2CH 1GI0A 1FJSA 4UFFH 3UY9A 2VIDA 1UVTH 1WSSH 2FTMA 4YOJA 3NUMA 5EU8A 1C5ZB 3GYMA 1MU8B 2A2QH 2FOAA 2IJOB 5CHAC 4X2YA 2AMQA 4AFQA 3AW1A 2VIQA 3SU4A 1QGFA 2P3FH 2KAIA 4Y0YE 4I32A 1QRWA 2H2ZA 3GCHC 3RXKA 1GHZA 1HCGA 1NRSH 1ARCA 2GZ7A 1P12E 4ABHA 4E7RG 1HV7A 1O3GA 2IOTA 3ZZ8A 1C5OH 2OC0A 1L1JA 1V2OT 3MU1A 2VNTA 3BTTE 2VIWA 4GUXA 9ESTA 4K2YA 1DOJA 1O3NA 2C93B 2XBVA 4CR5A 1GGDB 1LHDH 2ZGCA 4XBBA 3FP6E 1BRAA 1ELDE 1OWEA 1GHXH 3V13A 1MD8A 1EASA 2NU2E 1P11E 3UUZA 1K21H 2DE9A 3M5NA 1P9UA 2ZDKA 1ZHMA 4ABGA 1N1LA 3N7OA 4LZ4B 5FXLA 4WH8A 2O8LA 2PGBB 4D9QA 3BTHE 2LNCA 1MZAA 1ANBA 2A7JA 1PPEE 1THSH 4ZHMU 1Y59T 2ZTXA 2LIZA 2NU1E 1GVKB 2GP9B 5JB8S 1MZDA 2ZFQH 4Q2KA 4IMZA 3F9HA 1Y5AT 2WUBA 1ANDA 1RRKA 1TLDA 1WCZA 5L6NH 1OPHB 2G81E 5LPRA 1DWDH 1LHFH 3TK9A 3BV9B 3D65E 1K1IA 3SU5A 1ZHPA 1KIGH 3T28A 3RXVA 4BAKB 1H9IE 2FXRA 1T4UH 4BAOB 2BD9A 1O2TA 4U2WA 1PQ5A 2G52A 5DJ7A 1AU8A 1C1OA 1O30A 2PFEA 1TRYA 3Q76A 4X1PU 1CSOE 6ESTA 1Y8TA 3TH2H 1UTQA 3V7TA 3A8DA 1EB1H 4NA9H 1UK2A 1BHXB 4A1VA 4H4FA 1IQKA 2HNTF 2THFB 1QL7A 2BD2A 5F8XA 1ARBA 2BLOA 3QGJA 2M5TA 3CENA 5A0CA 4KKDA 2LPRA 4JZFH 1RFNA 5DO4H 3RXAA 3QX5H 2BOKA 3RXQA 2NU4E 1QIXB 1GCTC 2ODYB 1SGFA 2SNWA 3RXTA 2Y7ZA 3MH7A 2B8OH 1OX1A 2C8YB 4Y8ZA 2OQ5A 1WV7H 4IC6A 1W13U 3Q3YA 3RUOA 3SV9A 4FUDA 1O2SA 1BMMH 2QXJA 1K1LA 1XUJA 5B6OA 1HJAC 4CHAC 2XWAA 1GHYH 1IQGA 2ZO3H 2UUJB 3M7UA 2STAE 1OSSA 1XKAC 5ABWA 5FBEA 2BD5A 1DSUA 1VCPA 1TX6A 2BDBA 1MKXK 1Y3UA 1K1OA 1H1BA 5FPYA 3QK1A 2BM2A 3M5OA 5T6FA 1U6QA 3L33A 4UONA 3ZZ4A 2GTBA 3UWJH 2XTTB 4H42U 2BD3A 1ZSKA 3PYHA 3RXHA 1DSTA 1FIZA 1ZSLA 1NT1A 4B2AA 4ZHLU 7LPRA 4AG2A 3VFEA 2XCNA 2ZPSA 2ZU2A 4DW2U 4YZUA 1HIAB 5JBTA 1P2IA 1TIOA 1A0JA 5FX6A 6LPRA 1IQHA 2FPZA 1PFXC 4Q7XA 1AKSA 1GI8B 3ZVDA 3BIUH 3DFJA 1O0DH 1IAUA 1P09A 1XUHA 2EA3A 2DUCA 3STJA 3UNRA 5DP9A 1DXPA 1YP9A 3EQ0H 1LCYA 1FY3A 4XBCA 1NO9H 4BANB 1BMAA 3RU4T 3VXFH 3MOCA 4YM9A 3BTQE 1FY8E 2ANMH 4XBDA 5C1UA 1ETSH 4IN2A 3T29A 3K65B 5JDUB 2XW9A 1ZYOA 4B71A 2D2DA 1O3BA 3LGWA 1XUGA 1BBRH 1LDTT 2FLRH 5A8ZA 1MBMA 2A4RA 1AB9B 1DWCH 2OQUA 5LGOA 1S81A 1ELVA 1ZMLA 1KXFA 3W94A 1THPB 4U32A 1BTYA 5HYOA 2Y81A 1ZJKA 3MU0A 2Y5FA 2FODA 1O3MA 3RXGA 1C2KA 1C2GA 4WMEA 1BT7A 3H7OA 2A45B 3E3TA 4NFFA 3ZVGA 1NPMA 1OYTH 1CQQA 5A09A 3AVZA 4K5ZA 2GMTB 4JK5A 3SV7A 1XUKA 4WMFA 1RTKA 3ENSB 1WTHD 4BXWA 1O2WA 1UTPA 5I46H 4GCHG 4K3JA 1HAIH 3RLYH 1P03A 4O97A 1C9TA 2OXSA 3K6YA 1TPOA 2JETB 1C1PA 1HAXB 1GBAA 3NZIA 3TGKE 2Z9GA 1F0RA 1O2KA 2BQ6B 5AF9H 1NRQH 2ZFFH 5A0BA 4FU8A 3F68H 1MAYA 2P3UB 1SGQE 4CBNA 2WUCA 3TJOA 1D6WA 2QV1A 2SGQE 3GCOA 3RU4D 3LGIA 2H9TH 1UCYH 2SGAA 1BRBE 1O2PA 2PSXA 1FNIA 1T7CA 8GCHG 2ASUB 3UNSA 1DDJA 4TY6A 1O35A 6GCHF 4LOYH 1V2JT 2AGGX 1GMHF 3LONA 3ATMA 3EDXB 1G36A 5EXMA 5EW1H 1SLWB 1DUEA 4X1SU 5EQRA 5I25A 3LIWA 3S7HB 3M35A 1AFQC 1HAYB 1EZUC 1AUJA 4J1YA 1GMCG 1D9IA 1FDPA 3TIUA 1O5EH 4YTAA 4OS5A 3CP7A 4ABFA 1DUAA 3KGPA 1MQ5A 2F9VA 4XFQA 4DVAU 1AE8H 1HBTH 1AUTC 1BTPA 4B2BA 2GZ8A 2NU0E 2QN5T 3A86A 3BTKE 1GBEA 2ZG0H 2QY0B 4NFEA 4O3UA 2WPKS 5EXNA 1ELAA 3PLPA 4A1TA 2P8OB 2XBXA 3M5MA 2NU3E 4MTBA 4I33A 5E2OA 2PHBA 2WPLS 1XXDA 4ISHH 1BMNH 1WTGH 1YM0A 3RXLA 1S82A 3GOVB 1S0RA 3MNSA 5AHGH 1VGCB 1ZTLA 3KCGH 3RM2H 1MCTA 5DP5A 3RP2A 1C5QA 3G01A 2FP7B 4DT7B 2CGAA 1L0ZA 3SU3A 4BAHB 3A82A 3E90B 2ZPQA 1EOJA 1JMOH 4BTIB 4ZXYH 3ZVEA 1K28D 1MAXA 1GI6A 1C2LA 1KXAA 5HGGA 1PYTC 1HAGE 5EGMA 1C1SA 3RXIA 3VPKA 5H4IB 2Q6GA 3LJOA 1C1NA 4I8HA 3RXCA 2BZ6H 1BBRK 7GCHG 4ABEA 2ZZUH 3MHWU 1F7ZA 2ALPA 4X1RU 2EI6A 1EATA 3UR6A 3M61U 2ZI2H 2RG3A 2BQWB 1WOFA 1Y5UT 1V6DA 1RIWB 2J92A 1EUFA 1FPHH 1YKTA 1C4Y2 1C4V2 1GBKA 3A8CA 3SUFA 1HAHH 2BX4A 2ANWA 3SV8A 3ATKA 4U30A 1B0FA 1XMNB 1DLEA 2B0FA 3RXFA 4X6MA 4ZMAH 1CA0C 1EJNA 1HUTH 1SGNE 4UFDH 1BUIA 1LQDB 1CT2E 1C2HA 4RKOB 4WXIA 2EEKA 1GGDC 1HJ8A 4MPVA 3TH4H 5GXPA 5K7RA 3EE0B 1CE5A 2BYAX 3RXJA 2SFAA 3RM0H 2C8WB 1TNHA 2PKAB 4WY3A 2RA3A 4I8GA 1CGHA 4IMQA 1SGYE 3T25A 2VGCB 2P93A 2CV3A 1GI9B 1KXCA 4Y71A 4K69A 4BTTB 1KXBA 1CO7E 1DXWA 1W2KH 3TU7H 2Z9LA 1Z1IA 3M7QA 2BX3A 1IQJA 4KP0A 2Z9IA 1J16A 3ZZCA 1HAVB 2AGEX 3GISB 4X1QU 1HIAA 3SJIA 1YBWA 1KDQB 2IN2A 4IN1A 1V2ST 2Q6DA 1A46H 2R3YA 3VB6A 1GL0E 4JCNA 1AWHB 2QF3A 3TITA 4ASHA 2WPHS 1KY9A 1SFIA 1EJAA 5FCKA 4MQAA 2PLXA 3ESTA 1QB1A 1DT2A 1GJ5H 3GCTG 3MNCA 4UFEH 1Q2WA 1GHVH 2BTCE 2R9PA 2ZEBA 1NN6A 6CHAB 1NESE 2PTNA 2QGRA 4NIYA 1RTLA 1ZZZA 4I8JA 3VB3A 1O2YA 1O38A 1CGIE 1C5TA 5GIBA 1P9SA 1PPZA 1NTPA 1ELFA 4OS7A 1VJAU 1A5GH 2ULLA 3T26A 4AORA 1TBZH 1O2OA 3Q77A 1AVXA 3IWMA 2CF9H 2ODPA 3HATH 2BXTH 2OC8A 2BB4A 2FESH 1GMDF 4CBOA 2ZCLP 2V0BA 1QQUA 1SPJA 3FFGA 2ZCHP 1QY6A 1TABE 3CS7A 3RU4E 5HMAA 1WQVH 2AH4X 2G4TA 3KF2A 3Q3XA 4CRFA 4X2WA 3HK6B 3LC5A 4Y7AA 4R0IA 3KN2A 2CN0H 2RCEA 3BTEE 4BOHA 2VIPA 1GBMA 1LPGB 1G2MA 1ELGA 1YPLH 2HWLB 4GVUA 4OGYA 3URDA 1W10U 1HLTH 1O5FH 3VXEH 3OU0A 2TGTA 1G30B 1EP5A 1SGEE 1ZTKA 1N6XA 1C5VA 3AASA 4NIXA 4FU7A 3SU2A 1XUFA 2FO9A 2BVRH 1Z7KA 1NFWA 1C5NH 1OOKB 1TGTA 3T27A 3LH3A 1BA8B 3RXBA 1O34A 3RMOH 4B76A 1LHGH 1O3AA 1O2VA 1QBOA 2ZQ2A 4XE4A 2A7CA 1RTFB 1EZSC 4GSOA 4Y10E 1AVWA 1SQOA 1D3DB 3ZYDA 1O3KA 1VITF 2A4GA 2PKSB 1VCWA 1O31A 1MKXH 2JKHA 1Q31A 2FX6A 4FVBA 3M5LA 1L4DA 3RC6A 1GDQA 5ETXA 3RXRA 1BBRE 1NRNH 2WYGA 1YPJH 4ABJA 1SL3A 4MNWA 3ZZ3A 1KLTA 1IHSH 1OKXA 2P3TB 3QUMP 2ZDMA 1O3HA 3E8LA 3ZVFA 5L30H 1G32B 2I6QA 2D8WA 1C1RA 2F9PA 4Y6DA 4A5TS 3LGTA 1AB9C 4ISOA 5K0HA 1VJ9U 2BY8X 3GY7A 2BDIA 1KLIH 2BD8A 1SC8U 4JZ1A 5FAHA 1QFKH 5EODA 1AZZA 3AAUA 4O03A 1O2HA 1GJ7B 1TMBH 1BHXF 1W11U 2GMTC 2XNIA 1RD3B 5E2PA 4MVNA 1BRCE 2R0KA 4X2VA 3BSQA 2Y80A 1RGQA 3PTBA 4YESB 1GJDB 3RXEA 1GG6B 2A0QB 1IOEA 2VB0A 2A31A 3U9AH 4ZKSU 1UTNA 1UCYE 1HAPH 1P02A 1ANCA 2UWOA 4SGAE 2JETC 4K1EA 2BZAA 1UMAH 2H9EH 3SO3A 2BVSH 5AFYH 3O8CA 3MO6A 1SI5H 1CHGA 2CHAC 1A3BH 4BTUB 2FYRA 3M37A 1HXFH 4NGAH 4IC5A 1CT0E 1DANH 2FOCA 1OWKA 1ZGVA 1QQ4A 1CBWB 4Z6AH 2AMDA 2P59A 1ELCA 4DCDA 1FONA 1W14U 1XXFA 3PLBA 4CRDA 1V2RT 2F3CE 3SHAH 2GGVB 2QIQA 1MKWH 4BXSA 1LVBA 2CMYA 5E0JA 2STBE 1UK3A 4KTSA 1P2QA 1FQ3A 4INKA 1E37B 5T6GA 4INHA 1F0TA 1E38B 1YCPH 2WPJS 1EP6A 1GI4A 2AFQB 2PKAA 2OLGA 4MDSA 1EKBB 2O8MA 1FLEE 3S9AA 2Y5GA 4A7IB 1HFDA 1ABIH 3A8AA 1GJAB 4M7GA 3ZZ5A 2C90B 1GVZA 1J15A 1C9PA 1E34B 1YGCH 2QCYA 1J14A 1XX9A 1ZPZA 3LGYA 5F8TA 2EI7A 3SV2H 4TWYA 3U8RH 5L2YH 1JIMA 1LKBA 1QJ7B 3B9FH 3F9GA 4X8VH 3SNBA 1QR3E 1SLVB 3UNQA 1OXGA 1HAVA 1OWHA 3VGCB 3SOSA 2A5AA 1ORFA 5GJ4B 1KDQA 1GI2A 1F2SE 1O3EA 1AE5A 1RS0A 1VGCC 5C1YA 4B1TA 2G5NA 3CS0A 1NFUA 2EI8A 5FCRA 1LQEA 7ESTE 2AMPA 2ZECA 1LPKB 3DA9B 2J9NA 5E8EH 4FUGA 1ZGIA 2BHGA 3TNTA 3S7KB 1TQ0B 2XRCA 4TYDA 1KLJH 1LPZB 3ZVAA 3PO1B 2ZU5A 1EZQA 4MPUA 1TNJA 4DG4A 3U98H 1GJ6A 2BY9X 5F03A 4ZKNU 2Y5HA 5C20A 1NFYA 4Z0KA 4BAQB 2FOEA 3BTME 1FN6A 3E6PH 1SMFE 4NWKA 1O2XA 3ODDA 5DK1A 3HKIB 1LO6A 3BN9A 4ZH8A 2OBQA 3GICB 1K1MA 1RIWC 2W26A 1OWIA 2BY5X 1V2VT 1KSNA 3VB7A 3SI3H 1NU9A 1TGSZ 3S0NA 1IQNA 1S85A 4IBLH 1GDNA 1SSXA 1QHRB 1YLDA 1P2MA 3BTGE 3RXDA 2Y6TA 4ABAA 3EA8A 1OP8A 1F5LA 1T8MA 2V3HH 3MYWA 4Y76A 1GI1A 1C1VH 3TH3H 2FS8A 1MTNB 2VWOA 3SGQE 1KXDA 4KTCA 1L1NA 1OP0A 4ZUHA 2XYAA 1P2NA 1MQ6A 4XDEA 2FOFA 3A84A 4WXVA 1GPZA 2YNAA 1LHCH 2A5IA 3PM3A 1O2RA 1PJPA 2FX4A 2GV7A 2VGCC 1S83A 3SQEE 2P95A 2ZTZA 1UO6A 1FI8A 3KNXA 3A7YA 4JMYA 3V12A 6GCHG 3FP7E 1HNEE 5A8XA 4UEHH 3A89A 1GMHG 3I29A 3F6UH 1ELTA 1ZRKA 3KQEA 1FY5A 2V3OH 4AYYB 3D49H 5FPSA 1HDTH 1EAWA 3NK8A 1EAXA 5C1XA 3SQHE 4IS5A 4K1TA 1S84A 3BEFB 3PLKA 1TYNA