2AMDA

Crystal structure of sars_cov mpro in complex with an inhibitor n9
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
309
structure length
309
Chain Sequence
PLGSSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 3C-like proteinase
publication title Design of Wide-Spectrum Inhibitors Targeting Coronavirus Main Proteases.
pubmed doi rcsb
source organism Sars coronavirus
total genus 83
structure length 309
sequence length 309
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2amdA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2amdA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2amdA02
1FQ3A 4X1RU 3SNEA 1CA8B 2A4RA 3A8DA 1X7AC 2WYGA 1A46H 1P06A 1DICA 2ZDAH 1LPKB 4X1QU 1MTUA 1EASA 1C5UA 1TNLA 3RXDA 5FBEA 1GJAB 3ZVDA 4D7FA 4RN6A 1NU7B 3EGKH 1D3DB 2BY5X 1EZUC 2RG3A 1SG8B 3CENA 3PMAB 4FUDA 4MVNA 3IWMA 8GCHG 3B23B 5C67A 5EOKA 1G3BA 2XYAA 1C5YB 1ZMJA 1O5AB 5GCHG 5DPAA 4FVDA 2GT8A 1DANH 1GJDB 5AF9H 4MPVA 4AFUA 1ZGIA 1EAWA 1EB1H 1KLJH 1EB2A 1H9HE 3TNSA 1CHOF 1TMUH 3K6ZA 1EATA 1UVTH 2ZPRA 3TPIZ 1IHSH 1G30B 2V35A 2W3IA 4HGCA 1O0DH 4YOGA 1FI8A 4AOQA 1TB6H 1OSSA 1GVZA 3K9XB 4MPWA 1ELEE 1K1PA 1XXDA 2BY9X 2QAAA 1UMAH 5DP4A 1ELCA 4Y7AA 1ESBA 3P6ZB 2VIWA 2V6NA 1AFEH 1AI8H 1L4DA 1KLTA 2BDGA 1TQ7B 3P92A 2QN5T 5FCRA 1PPZA 4Q7YA 4DJZB 2ZTZA 1A7SA 1LDTT 1TALA 1YPHC 2QXGA 2FEQH 1G2MA 3P70B 4TYDA 3UNRA 1SGNE 2W7UA 1OWEA 2F9UA 3TK6A 3WY8A 1D3TB 3LPRA 1O3GA 2GCTB 3FVFB 1LVMA 1S81A 2OC7A 1Y3XA 1GBLA 2A2XH 1T4UH 1BJVA 1XKAC 1MTNC 1H9IE 1QTFA 1LHGH 3STJA 1UTNA 4NSVA 1V2RT 4K8BA 5DO4H 1ETRH 1S0QA 3VGCB 1B5GH 2A0QB 2F3CE 1SOTA 4TPYA 9ESTA 4ISNA 3LH1A 1WAYB 2SGFE 3ZZAA 3EA9A 2JH0D 1PPHE 1TBZH 3PMJA 3ZYEA 1O2UA 1VCQA 2B0FA 1O2SA 1K1OA 4MNWA 4CH2B 4INKA 1BB0B 1O33A 1CQQA 1QL8A 1TLDA 4ZAEA 4XDEA 2HNTC 2QGRA 2ZGCA 5AFZH 3MOCA 3M36A 3SOSA 3TH2H 2SFAA 2PKSB 3KIDU 4NWLA 2W7SA 4BAOB 3NXPA 1O2GH 4MPUA 1GJ7B 2HLCA 1AVGH 1LQDB 3ZZDA 5J4SA 3HATH 4I8JA 5I46H 4I8LA 2NU4E 4X2VA 3UPEA 1W11U 4E05H 1S82A 3TJOA 3F6UH 1QB6A 2ZDNA 3ODFA 1OYTH 6GCHG 5FX5A 1PQ8A 2M5TA 2A31A 3Q76A 3F68H 2ODPA 1Y8TA 2EI7A 4M7GA 1HIAA 1A0LA 4WF8A 1BHXB 1O39A 2G5NA 3CS7A 4U2WA 1KY9A 1O2KA 2TPIZ 2WPHS 5CHAB 2GD4B 1QL9A 1BDAA 1THPB 2F9VA 2XC0A 2FDAA 1BRAA 4E7NA 1EZQA 1ZRKA 3C1KA 1N6XA 1C2EA 1PYTC 4IN1A 1CU1A 1MUEB 2BDHA 2FX4A 1EPTA 4H6SB 2FPZA 5ETXA 4A6LA 1A5HA 2FS9A 2BD2A 1KIGH 1A61H 1NFXA 1J16A 3KL6A 5EODA 4OGXA 3UFAA 4YLQH 3LT3A 4IMZA 3RM2H 1NM6A 3U8OH 3UUZA 1DWDH 3KCGH 2QIQA 3UQOA 1MZAA 1TA6A 4A1TA 4LZ4B 2QXIA 2ZI2H 2VIPA 2F9PA 1QRXA 4NZLA 3ZYDA 1ZTJA 3RXKA 1T8OA 1TPAE 1LHEH 4YESB 5GXPA 2QYIA 5C5NA 3LC5A 2GCTC 1B0EA 1GDQA 4J2YB 1ELDE 1GBJA 4E7RG 1G36A 1NZQH 6CHAB 1P12E 2WYJA 1MCVA 3U1IB 5FPTA 1HJAB 7GCHF 1LQEA 2WPKS 2FYQA 1SGEE 4OGYA 1B7XB 1A3EH 3HPTB 2UUKB 4INHA 1QJ6B 2Z6BD 2PTNA 4AGJA 1MTVA 3LOXA 3ZVBA 2AS9A 3GY3A 1P03A 2TGTA 3SUGA 1OWIA 4YM9A 3F9FA 2R2MB 4AORA 1ZTLA 1O2OA 5B6OA 2XBXA 4JMYA 1C5LH 1BBRH 2I6QA 2QC2A 1A4WH 3FP8E 2GKVE 1HAYB 1HAOH 1GBFA 2PKSC 3RXRA 4FU7A 2GVFA 1AUTC 1MZDA 1YF4A 3GDVA 1BIOA 4NG9H 1KXEA 2KAIA 5IYTA 3S69A 4UFGH 3QK1A 1FAKH 3I78A 3OX7U 3AASA 3RU4E 1HXFH 1Z6EA 2IPHA 1WQSA 5HM2A 1GHWH 1QA7A 3ZVAA 7ESTE 1SHHB 2G5VA 4BAHB 4HZHA 1VR1H 2C93B 3MU4A 5A09A 3BTME 3FP6E 2OTVA 1TABE 3RLYH 2A7JA 4SGAE 3UWIA 3V12A 2QCYA 5DGJA 1V2UT 1KXCA 5ABWA 1GDNA 2W26A 4CRBA 2BDYA 1AUJA 2HPQH 1FPHH 3A7WA 1ETSH 3JZ2B 2JH6D 4X8UH 4GHTA 1EUFA 4BTUB 1ANDA 3P8OA 1ESAA 2RA0A 1P05A 1VCWA 2A32A 1NFYA 2AFQB 1XUJA 2QA9E 1MD8A 3SJOA 1ARBA 3AAVA 1F2SE 3SGAE 4GAWA 1SGIB 4ZKRU 2C4FH 1RTFB 1KTTB 3DHKH 1LMWB 2H9EH 3RC5A 1DOJA 2ZGJA 1L1NA 1H1BA 5AHGH 3FFGA 2SGPE 2UUFB 1LVOA 1E38B 5E0GA 2GX4A 3TK5A 1V2NT 3GCHB 4I8GA 4AYYB 2OBQA 1NRRH 1SOZA 1UTPA 1FN8A 2A5IA 1HJAC 3KN2A 3UR9A 4KTCA 4BXWA 5F8XA 1IQIA 1O30A 3GY6A 3A8BA 3FAOA 4X2WA 3RXSA 3NZIA 4K2YA 4OS2A 1GI4A 1DSUA 4TPIZ 2FS8A 1BTPA 4YTAA 1GHBG 4JZEH 4X2YA 1GL0E 4A5TS 1O3LA 1HIAB 1OWKA 1NESE 1L4ZA 2ZFQH 2PUXB 1C1MA 2XTTB 1MH0A 3T27A 2G8TA 3RXPA 2Y5HA 1LPGB 1UK3A 5FHTA 1PPBH 2R0LA 3BIVH 5EPYA 2Q6GA 2ZDVH 3SI3H 1C5PA 5T6FA 4A92A 1HFDA 1EPTB 4AG2A 2GT7A 1C4U2 2AEIH 4FVBA 1P3EA 3RXJA 2A4QA 1TQ0B 3LIWA 3U1JB 1GHAF 3KF2A 3BG8A 3A80A 1FMGA 1SGDE 1PPCE 3LGTA 5JDUB 1K21H 2A1DB 2ZCHP 2ZFFH 4Y76A 2B9LA 2ULLA 4Z0KA 3BTWE 3PO1B 4D76A 2CHAB 1SLWB 2FWWA 3PTNA 2FOEA 3RDZA 4NZQA 3U98H 3O8DA 1YCPK 1C1NA 1SC8U 3LGWA 1C2HA 4ZROA 1BRUP 2OUAA 2PWXA 1W2KH 1ZHRA 4WH6A 2TIOA 2CMYA 1MAXA 4ISHH 3LGIA 7LPRA 4WVPE 3ATLA 4I8KA 4WH8A 3T28A 3DA9B 1MU6B 1QCPA 4A1VA 1NRPH 3QWCH 4GUXA 3A83A 4ZHLU 2GP9B 4OS5A 1TIOA 1JBUH 1J17T 4CRGA 1YPJH 3SJ9A 2SGQE 4ABFA 1O3BA 1IQMA 4FUBA 1AVWA 1DY9A 1ETTH 2P16A 8KME2 2VWMA 3SU4A 9LPRA 1WUNH 3RXEA 2FI4E 1AY6H 5DKMA 2O8LA 5T3HA 2OXSA 5FXLA 1GI3A 1H9LB 4ISOA 1MD7A 2BDBA 1MKWH 3QTOH 3UNSA 5FCKA 4Y8ZA 3MH5A 1V2JT 1U6QA 4YLUA 1YPEH 8LPRA 1FONA 2RDLA 4LXBH 1O3AA 1UO6A 1DT2A 2O8MA 1C2GA 2GCHG 3ATIA 2KAIB 2BLVA 2D8WA 1Z8JB 1ZYOA 1S83A 2C3SA 4K1EA 1QBOA 2R3YA 3V0XA 2BTCE 1ACBE 1GI7B 2F9OA 2BMGB 3UREA 5A0BA 3PWCA 2AMDA 1CT2E 2WPLS 2R9PA 1WOFA 3GYMA 1UHBA 1AGJA 4YT7H 2LPRA 3S9CA 1C5RA 4B75A 1FY1A 3B8JA 2BOKA 3GCNA 1VJ9U 4JCNA 5DP7A 1VITG 3TNTA 1LO6A 1MBMA 2A5KA 1N8OB 1LHCH 2R2WU 1RRKA 1XX9A 2Z3DA 1L1GA 1TNIA 5GJ4B 1UK2A 4NA9H 1ZZZA 1GMHF 3UOPA 3GICB 3MU5A 1H4WA 1TMTH 1HNEE 4ABJA 1BCUH 5LPEA 3BEIB 4UEHH 2XW9A 5CE1A 3K65B 3SJ8A 4D8NA 3BN9A 1A3BH 1C1OA 1NTPA 1GI8B 1Z7KA 3PO1C 4X1PU 2CHAC 4IC5A 5JYIA 1AHTH 1ANBA 3NKKA 2DE9A 1ELGA 4K3JA 2OP9A 1UK4A 1DE7H 1OWDA 1FAXA 2R0KA 1E35B 1OYQA 2OLGA 1D6RA 5JBBS 1BTWA 2ZCKP 2QXJA 5EQRA 1VJAU 3D62A 1P01A 3TLOA 1CHGA 1SQTA 2Q6DA 1WU1A 1IQGA 4I32A 2GDEH 1SMFE 3GOVB 3RLWH 2Z9GA 4ZMAH 3SNCA 1TOMH 4TY7A 4DG4A 8GCHF 3LGYA 1P2JA 2G00A 5GCHF 1B0FA 4RKOB 1EAXA 1RIWB 2VWNA 3BG4C 3RUOA 4B2BA 1ELAA 1O3MA 1WCZA 3O8RA 1EJMA 5GPIB 2XXLA 1GBCA 2VVUA 3H7OA 2NU0E 1NN6A 1LKBA 2H9HA 3GDUA 3STIA 1AB9B 3OYPA 2ZP0H 5C1YA 1ELTA 1ZMNA 2UWLA 4Y0ZE 1LPZB 3OY6U 2QXHA 4FUCA 2PHBA 3A8AA 3GISB 3PLPA 1WTGH 4U30A 3RU4T 4UFDH 4KELA 1D3QB 1O3JA 2Y5GA 5HM9A 3NUMA 4IBLH 4XSKU 4B74A 2V3OH 5T6GA 4XOJA 3LJOA 1G32B 1D4PB 1HAVA 1Y3VA 1ZJDA 5TCAA 2FIRH 4Y71A 2VU8E 4WMFA 1AKSA 2FOHA 5FAHA 1C1WH 1J14A 1G9IE 2BD7A 5F8ZA 2ZNKH 4Y8XA 3MO9A 2JETB 5EW2H 2DUCA 5JBCS 4SGBE 3O8CA 2WUCA 5HXFA 2BVRH 1N8OC 2WINI 1BMMH 1F0TA 3PV4A 1YM0A 4Q7XA 3SGBE 4ABAA 2J95A 4AGKA 2ZFTA 4BANB 1GJ4H 1TPPA 4VGCB 2WPJS 3RMMH 1W13U 1BTZA 3KEEA 1YLDA 4JYUH 5E0JA 3FZZA 1HGTH 5LPRA 1UTQA 3SV9A 1GHXH 3A81A 1P2QA 3BTHE 1W7GH 1W7XH 2TBSA 3SUDA 1IQNA 3E6PH 1Z1IA 3M3TA 2OQUA 2PSYA 1QQUA 2VIOA 4K8YA 1DXWA 1C1UH 4FUHA 4BAMB 3QZRA 4IW4E 2NU1E 1QY6A 2FODA 5A8XA 5L2ZH 1HUTH 3E0NB 1EX3A 3A7TA 1P10A 3A85A 4CRDA 1O2YA 2XNIA 1C2KA 1XUGA 1DVAH 4ZKNU 1T8NA 3K2UA 1ZGVA 1CA0C 1GMDG 1MKXK 2FTLE 3M5OA 2JKHA 2P8OB 3EE0B 2HWLB 2J2UA 2VIDA 6GCHF 3LH3A 3ZZ3A 3LU9B 1Q2WA 3KNXA 3TJNA 2HGTH 3TIUA 3TVJB 1C1PA 2BM2A 3HK6B 5T6DA 1SLXB 4RKJB 1DFPA 1NRSH 1QR3E 1O3PB 2FI5E 2TGPZ 3MU1A 4CHAB 1RIWC 2ZHQH 2RA3A 1UHBB 4A7IB 3MU8A 3E0PB 2BY7X 3O8BA 3SU0A 3URCA 5I25A 4DOQA 2WPMS 1AB9C 3CP7A 1TGBA 4OS4A 4ESTE 3MTYA 1GI0A 3E3TA 2OC0A 1P3CA 4NIVA 3T25A 1YPKH 3Q77A 1GHYH 4O3UA 3BTFE 3L3TA 1DSTA 4D9RA 4INLA 1BA8B 1GJ9B 1GJ6A 3DFJA 2ZHFH 4CRAA 5EQSA 2Z7FE 1P2NA 4MTBA 1CGJE 1ANCA 2HRVA 3BEUA 2WPIS 1P57B 3N7OA 4U01A 1F92A 5F03A 2F91A 2JETC 5F8TA 1O2NA 1XKBC 3PMBB 1UCYK 4AYVB 2J9NA 1C4Y2 3KQBA 3HKIB 4B76A 1GVLA 1MQ6A 5GWZA 1V2PT 2HVXA 1Y5UT 1YPLH 3R3GB 1GBMA 5GIBA 1O3CA 3GCTG 3U8RH 2H9TH 1GBTA 4VGCC 2BDIA 2XRCA 3KHVA 4THNH 8ESTE 1JWTA 1Z6JH 3Q3YA 5DK1A 1ZSKA 3QGNB 3BSQA 1O2VA 2C8WB 5C20A 3PWBA 3SO3A 1QURH 1HV7A 3ATKA 4Y8YA 3SN8A 5GDSH 1EXFA 2ZG0H 2ZHDA 1AZ8A 1S6FA 3ZZCA 4MPXA 2ZFRH 3ZV9A 5C2ZA 3ZZ4A 2B7DH 1O38A 1V6DA 1UVOA 3BTDE 3PYHA 1EP6A 1NT1A 3ZVEA 1ABJH 1BTXA 1FNIA 3SJKA 1T8LA 1SGTA 4CRCA 4IGDA 4YO9A 1YGCH 1ZPZA 1C5NH 3VGCC 5JBTA 3M3VA 1C2DA 1O2HA 1O3NA 1CT4E 3ZZ8A 3M37A 1BJUA 2Y81A 1NY22 3UNQA 2Z9IA 3QDZB 4ZHAA 1HAVB 1NS3A 4FUIA 2FO9A 1OP8A 5K0HA 1AMHA 1K1LA 4Y10E 1AKSB 3AW1A 4DT7B 1VCPA 1H8IH 4Z6AH 3T26A 4XBBA 1A2CH 4CHAC 4MLFB 2OBOA 1GBKA 1GJBB 3A7XA 1TNKA 1O32A 1UTKA 4NA8A 2FOFA 1TA2A 3M5LA 1GCDA 1Q3XA 2VVCA 1K9OE 1TYNA 1LKAA 3PB1E 1XXFA 1SHYA 1HAPH 3VXFH 3EAJA 1S6HA 4HFPB 3RXHA 1OOKB 3LJJA 1O5DH 1O2QA 1EJAA 4FUJA 4UDWH 4WWYA 1HBTH 5JB9S 3BTEE 1XUFA 3LKWA 4CH8B 2STAE 1BRBE 1EOLA 1L0ZA 4DCDA 2OINA 3PMHB 4H4FA 3T2NA 1IQLA 5EXLA 5CHAC 3MNSA 4WMDA 3A88A 2BB4A 4BNRA 3V7TA 5HGGA 1AQ7A 2FP7B 2ZU4A 2ZF0H 1O2TA 1PFXC 1O5FH 3NWUA 1FIWA 3MFJA 1GI2A 1GMCG 4CR5A 1SFQB 5EPNA 5E2PA 3SHCH 1C9TA 1GJ5H 5A2MH 3A89A 3R0FA 3RMNH 3TJUA 3LDXH 1JIRA 2BVSH 2ZHWH 1BT7A 1SFIA 1OX1A 2YNBA 1OP2A 3BTGE 3SORA 3BTQE 3L6PA 1QHRB 1QL7A 1W0ZU 1GHBF 3D49H 3LGVA 4KTUA 1JOUB 2O8UA 1UJ1A 4F4OC 1TGCA 1CGIE 2XC5A 3U69H 3SU5A 1ZPBA 1C2IA 2FOBA 1UVPA 1HJ9A 2P3UB 2BX3A 1K28D 1KXDA 2EI6A 4YT6H 1DLEA 2XBYA 6CHAC 1C5SA 2OC8A 1TBQH 4JZDH 1OKXA 1A5IA 1SL3A 4WJG2 5FBIA 2BQWB 1EZSC 1C1TA 1E34B 2P95A 1K2I1 4Q80A 3TGKE 2BY6X 5EQQA 4NIWA 4X6NA 3VB4A 3ZZ7A 4JK6A 3SUFA 3GCOA 1GBAA 3UR6A 2XCNA 2Y6TA 1G2LA 5EW1H 1TGTA 1C5XB 1AE5A 4H6TA 3T29A 1UCYE 1T31A 3E91A 1YPHE 5DP9A 1IQEA 2R3UA 3E8LA 1V2LT 3BIUH 4AB9A 4I7YH 2ZU2A 1W14U 3LC3A 4K60A 4WMEA 3EA8A 2B8OH 5EXNA 3ELAH 4BXSA 3S0NA 4O3TA 1JIMA 4HTCH 3RXFA 4DGJA 1GBEA 1V2TT 2NU2E 1RD3B 4XBCA 4X8SH 1P9UA 2AGEX 4X6OA 1O3HA 4X6PA 1TPOA 1UCYH 4AB8A 5LH8A 3OSYA 4BAQB 1YYY1 1Y3YA 2Q1JA 3IG6B 3S9BA 1AO5A 1SBWA 3RP2A 1YC0A 2PGQB 3DFLA 4ASHA 5L2YH 2QF3A 5SGAE 3NCLA 2QF0A 1E37B 1GCTB 2ANMH 2VIVA 3QN7A 3LGUA 4A1XA 1C5VA 1F0SA 3NPSA 4NIYA 1O3FA 2G55A 4OS7A 1QA0A 3SNDA 1WQVH 1C1RA 3KQDA 2GZ8A 1DY8A 5E0HA 3BV9B 4FUGA 1BZXE 1S5SA 3ATWA 4KTSA 2GCHF 1ZTKA 4JK5A 1HXEH 2XWAA 2VWLA 1UTLM 2HNTF 5TJXA 3S7HB 4CBNA 3UIRA 1KDQA 1Z8RA 4ISLA 2VH6A 2VGCB 1K1JA 4Y79A 1C2MA 3SJIA 5A0AE 1D3PB 3I77A 3RXOA 1TMBH 1F5KU 5LGOA 2F83A 3V3MA 1IQJA 3K6YA 4LZ1H 1P2OA 4ABGA 1O3IA 2CV3A 6ESTA 1P9SA 2A4OA 4X8VH 1XUKA 1YLCA 1QRZA 1FJSA 2C8XB 1VITF 1O5EH 2GDDA 3VB3A 3OTJE 4LK4A 3TU7H 3RXBA 1CVWH 1W12U 1GL1A 1HAIH 1RTLA 2V0BA 2ZGBH 2BZ6H 2H2ZA 4ZHMU 3GCHC 4E06H 3HK3B 1C1SA 3MWIU 2BOHB 4K5ZA 1BQYA 3MYWA 1ZSJA 3MH7A 2ZEBA 4WXVA 4Q2KA 2BD8A 1YP9A 1W3CA 1GVKB 1D6WA 1BTUA 1C2JA 1Y59T 3SHAH 3F9GA 1BUIA 2P59A 2WV5A 1O35A 4IN2A 2BDCA 1P09A 1GBBA 2ALVA 1PPGE 3RXGA 3RC4A 4Y6DA 2D2DA 1RTKA 4B73A 2BLQA 1AD8H 4MQAA 2CF8H 2FLRH 1MCTA 3RXUA 1HAZB 4K69A 4X6MA 4TY6A 3FZDA 3E16B 1SGCA 2ZHEH 1BMNH 4UD9H 1K1NA 1FPCH 2A45B 3BTTE 3DUXH 1V2QT 1FN6A 1TBRH 3B9FH 1EPTC 4O03A 3RXLA 4ZUHA 4I8HA 1O31A 3ZVFA 4GPGA 1ZR0A 2J38A 1GWAA 5AVDA 2V3HH 2CXVA 1IQFA 1SGFG 5C1UA 2G52A 2VIQA 4FU9A 1CGHA 1JXPA 3KQCA 4B1TA 2GZ7A 1C2LA 5C1XA 2UUYA 1O2JA 1GI6A 1O34A 2C8ZB 4GCHG 3GY2A 1QQ4A 1THSH 2THFB 1S84A 1DWCH 2OC1A 2PTCE 1DITH 1GCTC 2STBE 3PLBA 1E36B 2Z3EA 5DJ7A 4GHQA 3D23A 5L6NH 4AX9H 1F7ZA 3S7KB 4O97A 1ELVA 2PR3A 1C5QA 1WV7H 4B2CA 3SU3A 4UONA 2P94A 2C90B 1O2PA 4TWYA 4F49A 1A0JA 1EKBB 1SLVB 4NIXA 2VJ1A 1QJ7B 3A82A 4B2AA 1TNJA 1GBIA 1KTSB 1L1JA 2G4TA 3P95A 1UVSH 3MO6A 3QGJA 1XVOA 1LTOA 1GBHA 4TWWA 3M5NA 1QB1A 1ELFA 1THRH 2K7XA 2Y7XA 2ZPQA 3HGNA 4IC6A 1OPHB 4BOHA 1AFQB 3OY5U 2ZWLH 4R0IA 3RXCA 4CBOA 1O2LA 2VNTA 1GDUA 1YPMH 2CJIA 5JPMH 4WXIA 3RXAA 1S0RA 3ZZBA 1G3EA 1C1VH 2NWNA 2A2QH 1BBRK 1SB1H 1C5TA 1ZMLA 1G37A 1FUJA 1LHDH 1W8BH 3PLKA 1F0UA 2AIQA 3F9EA 2BD9A 1FY5A 2BX4A 1O3KA 1YKTA 1SVPA 5DP3A 4Y0YE 1XUHA 1IAUA 1A1RA 2FLBH 4I33A 4YOIA 2GZ9A 2EA3A 1DUEA 2AH4X 1CHOG 3U8TH 1GMDF 1NFUA 4DY7B 1WBGB 1O5GH 3TGJE 1K22H 5AFYH 1YCPH 1KDQB 1WTHD 2SGEE 1HAHH 4YZUA 3RMLH 1NROH 3RXIA 4ISIH 1TX8A 3Q3XA 2ZU3A 1O2RA 3SV2H 3ZV8A 1TRYA 4KP0A 1O5CB 3TH4H 4MNXA 1V2OT 5EGMA 2BDAA 1C4V2 4DIHH 2PKAA 1SSXA 1DUAA 4CREA 1V2KT 2ODQA 1IQHA 2FOGA 4ZKOU 1C5MD 1FZZA 4JZFH 2BLOA 1TGSZ 1ZHPA 3QO6A 4K1SA 3SGQE 5LPFA 4R8TB 1G3CA 1INCA 5DP6A 3VB7A 3M61U 4OS1A 1KXBA 1N1LA 1IQKA 1TRNA 2Z9JA 3A7YA 3ZZ5A 2XBWA 1EJNA 3SV7A 5EU8A 1ORFA 5PTPA 2BHGA 3F9HA 3UWJH 2SNWA 3SV6A 3HKJB 4J1YA 2ZTYA 2ZECA 1CE5A 1EP5A 1MTSA 2ANKH 2AGGX 2OQ5A 3BF6H 3MO3A 2PSXA 1H8DH 3E1XB 2ZFPH 1HRTH 2BQ6B 4U32A 2FOCA 2HALA 1GG6B 5C3NA 2PGBB 4KKDA 1IHTH 3MH4A 1RXPA 2ZCLP 3TITA 1TNGA 3GCTF 1AVXA 4UFFH 3IITA 4AG1A 6LPRA 1AFQC 3Q00A 1TE0A 2TRMA 2CN0H 2A7HA 4NFFA 5K7RA 1DS2E 1RS0A 2BVXH 5IDKA 1TGNA 1MBQA 1XVMA 4X0WU 1AE8H 2BD4A 4NSYA 1FY8E 2ZQ2A 3AVZA 4ABHA 3TK9A 3QLPH 2W3KA 3MNBA 1PPEE 2ZGHA 1KSNA 1ZHMA 3A7VA 4X1SU 1MQ5A 4RSPA 4BAKB 3OU0A 4I31A 3AW0A 4XE4A 4HI3A 1EZXC 1C5ZB 2YOLA 2ZZUH 2PW8H 1TAWA 4AFSA 1WYKA 2PUQH 2QY0B 4NA7A 2GTBA 1OXGA 2Y82A 1MU8B 2Q6FA 2H6MA 2B5TB 3M35A 3BTKE 2AMQA 3QX5H 4LOYH 2FTMA 2O8TA 1GBDA 1CT0E 3GYLB 2IN2A 4BTIB 1CO7E 1NRQH 1O2XA 1EAIA 2WUBA 4B71A 3A86A 1Y5BT 1GJCB 1V2WT 1IOEA 4X8TH 1O36A 5EXMA 3SUEA 4DVAU 3M7UA 2ODYB 3KQEA 1QB9A 1ID5H 4O9VA 1VZQH 2OCVB 4K1TA 1XM1A 3T62A 2XWBI 2ZIQH 4UE7H 3C27B 3URDA 1GI1A 2AGIX 1MMJN 3SNAA 3TJVA 3SQHE 1P02A 3TGIE 2P8OC 1DWEH 4AZ2B 1ZJKA 5DP8A 2Z3CA 2FOMB 3EYDA 4PROA 4QT8C 1DXPA 1BBRE 1C9PA 2F9NA 1C2FA 3ATMA 4MNYA 1BITA 1MKWK 3SZNA 2GV7A 3H5CB 1TRMA 3G01A 2J34A 3CS0A 3GY4A 1ABIH 1GI9B 3U9AH 2TGDA 5DP5A 3VXEH 1O3DA 3MH6A 4Y7BA 2J94A 4GVUA 5A8YA 2VWOA 1DDJA 1QNJA 2XC4A 3GY8A 1GG6C 2PLXA 4ZKSU 3SQEE 3RXMA 3KGPA 1GMCF 2ZDLA 2GMTB 2C8YB 1K1MA 2UWPA 3F1SB 1TWXB 2XBVA 3P8GA 4NCYA 5TCCA 1DWBH 2A5AA 3PTBA 2EEKA 4JYTA 4CRFA 1ZLRA 1GI5A 1O2ZA 7GCHG 1FY4A 1DLKB 3LONA 3ZVGA 1LHFH 2GGVB 5E8EH 3UOUA 1OWHA 2H5CA 4BTTB 7KMEH 3A87A 1SPJA 2PKAB 3I29A 4X2XA 3RU4D 5A8ZA 4NGAH 2ASUB 2D26C 1O3OA 2IJOB 2FOAA 1C1QA 2P3TB 3W95A 4MG3A 3SBKA 3H7TA 1P2MA 3EBNA 1VGCB 3BEFB 2ILNA 1QFKH 2ALPA 3EA7A 1RFNA 3D65E 2HOBA 1CSOE 1NRNH 2ZDMA 3SI4H 1KLIH 1HCGA 5FPYA 4H42U 2BYAX 3GY5A 2VH0A 5F6MA 2UWOA 1NC6A 2GV6A 2BY8X 2ZQ1A 3P8NA 4DURA 4XFQA 2G4UA 2AERH 5A0CA 1XMNB 1LVBA 2BD3A 3ENSB 1SGRE 3L33A 1T7CA 1TFXA 1E0FD 1LVYA 1MKXH 1O2IA 3HGPA 1PQ7A 3Q3KA 2HPPH 2ANWA 3FP7E 1W0YH 3JZ1B 1NU9A 3E90B 4ABEA 2ZPSA 4NFEA 5ESBA 1JRSA 3EQ0H 4ZXXH 2IOTA 5JB8S 5C5OA 1L2EA 2WV4A 4Q7ZA 4FUEA 4KGAA 2AIPA 3VB5A 1F5LA 1HDTH 3DD2H 4ABIA 3SW2B 3VPKA 1YBWA 1EOJA 4FUFA 1JMOH 1GJ8B 1C5WB 2RCEA 1SQAA 1ANEA 2H5DA 2Z94A 1SGYE 1UTJA 3FANA 4UFEH 2PV9B 1PPFE 5BRRE 2Y7ZA 4D7GA 1RGQA 3SU6A 2FX6A 5L30H 2ZGXH 1HB0B 1OWJA 1MTWA 1EAUA 2CF9H 2ZC9H 4YOJA 2FXRA 1AU8A 2ZU5A 2VVVA 1FV9A 2DE8A 3MNCA 1TX7A 3T5FH 1UTMA 1Z71A 2BXTH 1AN1E 1Y3WA 1GPZA 1Z1JA 1PJPA 2GMTC 1A0HB 1NO9H 2LIZA 3MI4A 3GY7A 3M7TA 2A7CA 1SI5H 1QRWA 1C5OH 2ZU1A 1SGQE 3P17H 3RXVA 3S9AA 1TONA 3RC6A 5J4QA 1FY3A 1N6YA 3RXTA 1HAGE 1AWHB 3MNXA 1TOCB 3M3SA 1P2KA 1XUIA 2F9BH 3A7ZA 2J4IA 2HNTE 2NU3E 3QTVH 1SQOA 3ESTA 3UQVA 4FXGH 2ESTE 1ZPCA 5HMAA 1PQ5A 3VFEA 1J15A 3W94A 1UVUH 5H4IB 2EI8A 3VB6A 2BZAA 2G51A 5EG4A 1UTOA 2VB0A 1VGCC 1T4VH 1QGFA 1AIXH 1SGFA 2QV1A 2ANYA 2BQ7B 3M5MA 4IMQA 2Y80A 4JZIA 3V13A 1P04A 2VINA 2FZZA 1O2WA 1QBNA 1CBWB 1FIZA 4GLYA 1WSSH 2H1UA 3AAUA 1AWFH 4X1NU 4NWKA 1OS8A 3EDXB 4MDSA 5BPEA 1GHAG 1BOQA 1M9UA 1V2ST 5FPSA 2O9QA 4ZXYH 2BD5A 1JRTA 4D9QA 3SV8A 1O3EA 1V2VT 1PYTD 1D9IA 1W10U 1QBVH 1SGPE 1AZZA 1GGDB 1LCYA 2JH5D 3BG4B 1BRCE 3A8CA 1P2IA 1SR5C 2G81E 3SU1A 5FX6A 2FESH 1QJ1B 2BXUH 3MMGA 1VITH 2FI3E 2YNAA 3UTUH 1ELBA 1BMAA 1K1IA 1F5RA 2XCFA 1O37A 1V3XA 1O2MA 1FLEE 5JBAS 1HAXB 4DIIH 1OP0A 3PM3A 2LNCA 4GCHF 1SLUB 3QUMP 4FU8A 2SNVA 2Z9KA 1QIXB 1J9CH 1F0RA 1S85A 1GHVH 3SU2A 1J8AA 3ZVCA 2P3FH 4AFQA 2AYWA 3A84A 1G3DA 1BMLA 1O5BB 4ABBA 2ZKSA 4JZ1A 1NPMA 1DM4B 3VEQB 1T8MA 1TPSA 3PROA 3RM0H 1YPGH 3MHWU 2ZA5A 3ITIA 1FXYA 2P93A 3M7QA 4Y11E 2ZO3H 1ZRBA 2J92A 2ZDKA 3SNBA 3TH3H 2FYRA 1HJ8A 1KXAA 2PFEA 1HLTH 5CMXH 5G4BA 2AMPA 4ZH8A 1TNHA 1GHZA 2ZFSA 2O8WA 2K1QA 3DT0H 5DG6A 2W5EA 1KYNA 3ZZ9A 3RXQA 1V2MT 1BTHH 3ZZ6A 3QZQA 4XBDA 4AFZA 2D1JA 1Y5AT 1YCPM 1ARCA 2ZTXA 1Y3UA 1T32A 1HPGA 3ODDA 1ESTA 1Z8GA 2A4GA 1P11E 2Y5FA 2FMJA 4JYVH 1KXFA 2OD3B 4MNVA 1NFWA 2I6SA 2VGCC 4IS5A 1MTNB 4WY3A 2FM2A 1CBWC 2TGAA 1GMHG 1BTYA 1TX6A 1Z8IB 2UUJB 4AN7A 3RMOH 1ZOMA 4DW2U 1CA0B 5E2OA 1DX5M 2CGAA 1RJXB 1FDPA 1P0SH 1HYLA 4OS6A 1MAYA 4ABDA 2SGAA 4CR9A 1ZSLA 3P8FA 1A5GH 2Z9LA 2EC9H 1BHXF 1P8VC 1PQAA 5ESTE 3UY9A 3MU0A 3GDSA 3NK8A 1Q31A 1DPOA 1GGDC 2BLWA 4GSOA 2SGDE 1EQ9A 5HYOA
chains in the Genus database with same CATH superfamily
1FQ3A 4X1RU 3CNRA 3SNEA 1CA8B 2A4RA 3A8DA 1X7AC 2WYGA 1A46H 1P06A 1DICA 2ZDAH 1LPKB 4X1QU 1MTUA 1EASA 5C0UA 1C5UA 1TNLA 3RXDA 5FBEA 1GJAB 3ZVDA 4D7FA 4RN6A 1NU7B 3EGKH 1D3DB 2BY5X 1EZUC 2RG3A 1SG8B 3CENA 3PMAB 4FUDA 4MVNA 3IWMA 8GCHG 3B23B 5C67A 5EOKA 1G3BA 2XYAA 1C5YB 1ZMJA 1O5AB 5GCHG 5DPAA 4FVDA 2GT8A 1DANH 1GJDB 5AF9H 4MPVA 4AFUA 1ZGIA 2M2AA 1EAWA 1EB1H 1KLJH 1EB2A 1H9HE 3TNSA 1CHOF 1TMUH 3K6ZA 1EATA 1UVTH 2ZPRA 3TPIZ 1IHSH 1G30B 2V35A 2W3IA 4HGCA 1O0DH 4YOGA 1FI8A 4AOQA 1TB6H 1OSSA 1GVZA 3K9XB 4MPWA 1ELEE 1K1PA 1XXDA 2BY9X 2QAAA 1UMAH 5DP4A 1ELCA 4Y7AA 1ESBA 3P6ZB 2VIWA 2V6NA 1AFEH 1AI8H 1L4DA 1KLTA 2BDGA 1TQ7B 3P92A 2QN5T 5FCRA 1PPZA 4Q7YA 4DJZB 2ZTZA 1A7SA 1LDTT 3H09A 1TALA 1YPHC 2QXGA 2FEQH 1G2MA 3P70B 4TSFD 4TYDA 3UNRA 1SGNE 2W7UA 1OWEA 2F9UA 3TK6A 3WY8A 1D3TB 2RDEA 3LPRA 1O3GA 2GCTB 3FVFB 1LVMA 1S81A 2OC7A 1Y3XA 1GBLA 2A2XH 1T4UH 1BJVA 1XKAC 1MTNC 1H9IE 1QTFA 1LHGH 3STJA 1UTNA 4NSVA 1V2RT 3PRDA 4K8BA 5DO4H 1ETRH 1S0QA 3VGCB 1B5GH 2A0QB 2F3CE 1SOTA 4TPYA 9ESTA 4ISNA 3LH1A 1WAYB 2SGFE 3ZZAA 3EA9A 2JH0D 1PPHE 1TBZH 3PMJA 3ZYEA 1O2UA 1VCQA 2B0FA 1O2SA 1K1OA 4MNWA 4CH2B 4INKA 1BB0B 1O33A 1CQQA 1QL8A 1TLDA 4ZAEA 4XDEA 2HNTC 2QGRA 2ZGCA 5AFZH 3MOCA 1E1QD 3M36A 3SZEA 3SOSA 3TH2H 2SFAA 2PKSB 3KIDU 4NWLA 2W7SA 4BAOB 3NXPA 1O2GH 4MPUA 1GJ7B 2HLCA 1AVGH 1LQDB 3ZZDA 5J4SA 3HATH 4I8JA 5I46H 4I8LA 2NU4E 4X2VA 2QE7D 3UPEA 2WPDD 1W11U 4E05H 1S82A 3TJOA 3F6UH 1QB6A 2ZDNA 3ODFA 1OYTH 6GCHG 5FX5A 1PQ8A 2M5TA 2A31A 3Q76A 3F68H 2ODPA 1Y8TA 2EI7A 4M7GA 1HIAA 1A0LA 4WF8A 1BHXB 1O39A 2G5NA 3CS7A 4U2WA 1KY9A 1O2KA 2TPIZ 2WPHS 5CHAB 2GD4B 1QL9A 5CDFE 1BDAA 1THPB 2F9VA 2XC0A 2FDAA 1BRAA 4E7NA 1EZQA 1ZRKA 3C1KA 1N6XA 4B6FA 1C2EA 1PYTC 4IN1A 1CU1A 1MUEB 5KECA 5T1VA 2BDHA 2FX4A 1EPTA 4H6SB 2FPZA 5ETXA 4A6LA 1A5HA 2FS9A 2BD2A 1KIGH 1A61H 1NFXA 1J16A 3KL6A 5EODA 4OGXA 3UFAA 4YLQH 3LT3A 4IMZA 3RM2H 4TT3D 1NM6A 3U8OH 4F48B 3UUZA 3UAIC 1DWDH 3KCGH 2QIQA 3UQOA 1MZAA 1TA6A 4A1TA 4LZ4B 2KCOA 2QXIA 2ZI2H 2VIPA 2F9PA 1QRXA 4NZLA 3ZYDA 1ZTJA 5F53A 3RXKA 1T8OA 1TPAE 1LHEH 4YESB 5GXPA 2QYIA 5C5NA 3LC5A 2GCTC 1B0EA 1GDQA 4J2YB 1ELDE 1GBJA 4E7RG 1G36A 1NZQH 6CHAB 1P12E 2WYJA 1MCVA 3U28C 3U1IB 5FPTA 1HJAB 7GCHF 1LQEA 2WPKS 2FYQA 1SGEE 4OGYA 1B7XB 1A3EH 3HPTB 3OEHD 2UUKB 4INHA 1QJ6B 2Z6BD 2PTNA 4AGJA 1MTVA 3LOXA 3ZVBA 2AS9A 3GY3A 1P03A 2TGTA 3SUGA 1OWIA 4YM9A 3F9FA 2R2MB 4AORA 1ZTLA 1O2OA 5B6OA 2XBXA 4JMYA 1C5LH 3OFND 1BBRH 2I6QA 2QC2A 1A4WH 3FP8E 2GKVE 1HAYB 1HAOH 1GBFA 2PKSC 3RXRA 4FU7A 2GVFA 1AUTC 1MZDA 1YF4A 3GDVA 1BIOA 4NG9H 1KXEA 2KAIA 5IYTA 3S69A 4UFGH 3QK1A 1FAKH 3I78A 3OX7U 3AASA 3RU4E 1HXFH 1Z6EA 2IPHA 1WQSA 5HM2A 1GHWH 1QA7A 3ZVAA 7ESTE 1SHHB 2G5VA 4BAHB 4HZHA 1VR1H 2C93B 3MU4A 5A09A 3BTME 3FP6E 2OTVA 1TABE 3RLYH 2A7JA 4SGAE 3UWIA 3V12A 2QCYA 5DGJA 1V2UT 1KXCA 5ABWA 1GDNA 2W26A 4CRBA 5CHBA 2BDYA 1AUJA 2HPQH 1FPHH 3A7WA 1ETSH 3JZ2B 2JH6D 4M9FA 2K8IA 4GHTA 1EUFA 4X8UH 1W0JD 4BTUB 1ANDA 3P8OA 1ESAA 2RA0A 1P05A 1VCWA 2A32A 1NFYA 2AFQB 1XUJA 2QA9E 1MD8A 3SJOA 1ARBA 3AAVA 1F2SE 3SGAE 4GAWA 1SGIB 4ZKRU 2C4FH 1RTFB 1KTTB 3DHKH 1SKYE 1LMWB 2H9EH 3RC5A 1DOJA 2ZGJA 2J5UA 1L1NA 1H1BA 5AHGH 3FFGA 2SGPE 2UUFB 1LVOA 1E38B 5E0GA 2GX4A 3TK5A 1V2NT 3GCHB 4I8GA 4AYYB 2OBQA 1NRRH 1SOZA 1UTPA 3N7DA 1FN8A 2A5IA 1HJAC 3KN2A 3UR9A 4AC9A 4KTCA 4BXWA 5F8XA 1IQIA 1O30A 3GY6A 3A8BA 3FAOA 4X2WA 3RXSA 3F2GA 3NZIA 4K2YA 4OS2A 1GI4A 1DSUA 4TPIZ 5EJLA 2FS8A 1BTPA 4YTAA 1GHBG 4JZEH 4X2YA 1GL0E 4A5TS 1O3LA 1HIAB 1OWKA 5EJZA 1NESE 1L4ZA 2ZFQH 2PUXB 1C1MA 2XTTB 3VG8A 1MH0A 3T27A 2G8TA 3RXPA 2Y5HA 1LPGB 1UK3A 5FHTA 1PPBH 2R0LA 3BIVH 5EPYA 2Q6GA 2ZDVH 3SI3H 1C5PA 5T6FA 4A92A 1HFDA 1YY3A 1EPTB 4AG2A 2GT7A 1C4U2 2AEIH 4FVBA 1P3EA 3RXJA 2A4QA 1TQ0B 3LIWA 4Q4LA 3U1JB 1GHAF 3KF2A 3BG8A 3A80A 1FMGA 1SGDE 1PPCE 3LGTA 5JDUB 1K21H 2A1DB 2ZCHP 2ZFFH 4Y76A 2B9LA 2ULLA 4Z0KA 3BTWE 3PO1B 4D76A 2CHAB 3GS9A 1SLWB 2FWWA 3PTNA 2FOEA 3RDZA 4NZQA 3U98H 3O8DA 1YCPK 1C1NA 1SC8U 3LGWA 1C2HA 4ZROA 1BRUP 2OUAA 2PWXA 1W2KH 1ZHRA 4WH6A 2TIOA 2CMYA 1MAXA 4ISHH 3LGIA 7LPRA 4WVPE 3ATLA 4I8KA 4WH8A 3T28A 3DA9B 1MU6B 1QCPA 4A1VA 1NRPH 1VKYA 3QWCH 4GUXA 3A83A 4ZHLU 2GP9B 2JJ2D 4OS5A 1TIOA 1JBUH 1J17T 4CRGA 1YPJH 3SJ9A 2SGQE 4ABFA 1O3BA 3FN8A 1IQMA 4FUBA 1AVWA 1DY9A 1ETTH 2P16A 8KME2 2VWMA 3SU4A 9LPRA 1WUNH 3RXEA 2FI4E 1AY6H 5DKMA 2XOKD 2O8LA 5T3HA 3F0OA 2OXSA 5FXLA 1GI3A 1H9LB 3FOAA 4ISOA 1MD7A 2BDBA 1MKWH 3QTOH 3UNSA 5FCKA 4Y8ZA 3MH5A 1V2JT 1U6QA 4YLUA 1YPEH 8LPRA 1FONA 2RDLA 4LXBH 1O3AA 1UO6A 1DT2A 2O8MA 1C2GA 2GCHG 3ATIA 2KAIB 2BLVA 2D8WA 1Z8JB 1ZYOA 1S83A 2C3SA 4K1EA 1QBOA 2R3YA 3V0XA 2BTCE 1ACBE 1GI7B 2F9OA 2BMGB 3UREA 5A0BA 3PWCA 2AMDA 1CT2E 3N7EA 2WPLS 2R9PA 1WOFA 2WHXA 3GYMA 1UHBA 1AGJA 4YT7H 2LPRA 3S9CA 2YMSD 1C5RA 4B75A 1FY1A 3B8JA 2BOKA 3GCNA 3KYFA 1VJ9U 2AHME 4JCNA 5DP7A 1VITG 3TNTA 3F2HA 1LO6A 1MBMA 2A5KA 1N8OB 1LHCH 2R2WU 1RRKA 1XX9A 2Z3DA 1L1GA 1TNIA 5GJ4B 1UK2A 4NA9H 1ZZZA 1GMHF 3UOPA 2W6JD 3GICB 3MU5A 1H4WA 1TMTH 1HNEE 4ABJA 1BCUH 5LPEA 3BEIB 4UEHH 2XW9A 5CE1A 3K65B 3SJ8A 4D8NA 3BN9A 3OTPA 1A3BH 1C1OA 1NTPA 1GI8B 1Z7KA 3PO1C 4X1PU 2CHAC 4IC5A 5JYIA 1AHTH 1ANBA 3NKKA 2DE9A 1ELGA 4K3JA 2OP9A 1EFRD 1UK4A 1DE7H 1OWDA 1FAXA 2R0KA 1E35B 1OYQA 2OLGA 1D6RA 5JBBS 1BTWA 2ZCKP 2QXJA 5EQRA 1VJAU 3D62A 2CK3D 1P01A 3TLOA 1CHGA 1SQTA 2Q6DA 1WU1A 1IQGA 4I32A 2GDEH 1SMFE 3GOVB 3RLWH 2Z9GA 4ZMAH 3SNCA 1TOMH 4TY7A 4DG4A 1E1RD 8GCHF 3LGYA 1P2JA 4RT0A 2G00A 5GCHF 1B0FA 4RKOB 1EAXA 1RIWB 2VWNA 3BG4C 2EQNA 3RUOA 4B2BA 1ELAA 1O3MA 1WCZA 3O8RA 1EJMA 5GPIB 2XXLA 1GBCA 2VVUA 3H7OA 2NU0E 1NN6A 1LKBA 2H9HA 3GDUA 3NRLA 3STIA 1AB9B 3OYPA 2ZP0H 5C1YA 1ELTA 1ZMNA 2UWLA 4Y0ZE 1LPZB 3OY6U 2QXHA 4FUCA 2PHBA 3A8AA 3GISB 3PLPA 1WTGH 4U30A 3RU4T 4UFDH 4KELA 1D3QB 3PV2A 1O3JA 2Y5GA 5HM9A 3NUMA 4IBLH 4XSKU 4B74A 2V3OH 5T6GA 3PV5A 4XOJA 3LJOA 1G32B 1D4PB 1HAVA 1Y3VA 1ZJDA 5TCAA 2FIRH 4Y71A 2VU8E 4WMFA 1AKSA 2FOHA 5FAHA 1C1WH 1J14A 1G9IE 2BD7A 5DSFA 5F8ZA 2ZNKH 4Y8XA 3MO9A 2JETB 5EW2H 3AK5A 2DUCA 5JBCS 4SGBE 3O8CA 2WUCA 3EE7A 5HXFA 2BVRH 1N8OC 2WINI 1BMMH 1F0TA 3PV4A 1YM0A 4Q7XA 3SGBE 4ABAA 2J95A 4AGKA 2ZFTA 4BANB 1GJ4H 1TPPA 4VGCB 2WPJS 3RMMH 5IK2D 1W13U 1BTZA 3KEEA 2KM0A 1YLDA 4JYUH 5E0JA 3FZZA 1HGTH 5LPRA 1UTQA 3SV9A 1GHXH 3A81A 1P2QA 3BTHE 1W7GH 1W7XH 2TBSA 3SUDA 1IQNA 3E6PH 1Z1IA 3M3TA 2OQUA 2PSYA 1QQUA 2VIOA 4K8YA 1DXWA 1C1UH 4FUHA 4BAMB 3QZRA 4IW4E 2NU1E 1QY6A 2FODA 5A8XA 5L2ZH 1HUTH 3E0NB 1EX3A 3A7TA 2YMSB 4XD7D 1P10A 1WDIA 3A85A 4CRDA 1O2YA 2XNIA 1C2KA 1XUGA 1DVAH 4ZKNU 1T8NA 3K2UA 1ZGVA 1CA0C 1GMDG 1MKXK 2FTLE 3M5OA 2JKHA 2P8OB 3EE0B 2EY4C 2HWLB 2J2UA 2VIDA 6GCHF 3LH3A 3ZZ3A 3LU9B 1Q2WA 3KNXA 3TJNA 2HGTH 3TIUA 3TVJB 1C1PA 2BM2A 3SYJA 3HK6B 5T6DA 1SLXB 4RKJB 1DFPA 1NRSH 1QR3E 1O3PB 2FI5E 2TGPZ 3MU1A 4CHAB 1RIWC 2ZHQH 2RA3A 1UHBB 4A7IB 3MU8A 3E0PB 2BY7X 3O8BA 3SU0A 3URCA 5I25A 4DOQA 2WPMS 1AB9C 3CP7A 1TGBA 2GJGA 4OS4A 4ESTE 3MTYA 1GI0A 3E3TA 2OC0A 1P3CA 4NIVA 3T25A 1YPKH 3Q77A 1GHYH 4O3UA 3BTFE 3L3TA 1DSTA 4D9RA 4INLA 1BA8B 1GJ9B 1GJ6A 3DFJA 2ZHFH 4CRAA 5EQSA 2Z7FE 1P2NA 4MTBA 1CGJE 1ANCA 2HRVA 3BEUA 2WPIS 1P57B 3N7OA 4U01A 1F92A 5F03A 2F91A 2JETC 5F8TA 5HIYA 1O2NA 1H8HD 1XKBC 3PMBB 1UCYK 4AYVB 2J9NA 4ACBA 1C4Y2 3KQBA 3HKIB 4B76A 1GVLA 1MQ6A 5GWZA 1V2PT 2HVXA 1Y5UT 1YPLH 3R3GB 1GBMA 5GIBA 1O3CA 3GCTG 3U8RH 2H9TH 1GBTA 4VGCC 2BDIA 2VBCA 2XRCA 3KHVA 5C0TA 4F55A 4THNH 8ESTE 1JWTA 1Z6JH 3Q3YA 5DK1A 1ZSKA 3QGNB 3BSQA 1O2VA 2C8WB 5C20A 3PWBA 3SO3A 1QURH 1HV7A 3ATKA 4Y8YA 3SN8A 5GDSH 1EXFA 2ZG0H 2F43B 2ZHDA 1AZ8A 2WZQA 1S6FA 3ZZCA 4MPXA 2ZFRH 3ZV9A 5C2ZA 3ZZ4A 2B7DH 1O38A 1V6DA 1UVOA 1UW7A 3BTDE 3PYHA 1EP6A 1NT1A 3ZVEA 1ABJH 1BTXA 1FNIA 3SJKA 1T8LA 1SGTA 2QF4A 4CRCA 4IGDA 4YO9A 1YGCH 1ZPZA 1C5NH 3VGCC 5JBTA 3M3VA 1C2DA 1O2HA 1O3NA 3F2FA 1CT4E 3ZZ8A 3M37A 1BJUA 2Y81A 4P02A 1NY22 3UNQA 2Z9IA 3QDZB 4ZHAA 1HAVB 1NS3A 4FUIA 2FO9A 5DN6D 1OP8A 5K0HA 1AMHA 1K1LA 4Y10E 1AKSB 3AW1A 4DT7B 1VCPA 1H8IH 4Z6AH 3T26A 4XBBA 1A2CH 4CHAC 4MLFB 2OBOA 1GBKA 1GJBB 3A7XA 1TNKA 1O32A 1UTKA 4NA8A 2FOFA 1TA2A 3M5LA 1GCDA 1Q3XA 2VVCA 1K9OE 1TYNA 1LKAA 3PB1E 1XXFA 1SHYA 1HAPH 3VXFH 3EAJA 1S6HA 4HFPB 3RXHA 1OOKB 3LJJA 1O5DH 1O2QA 1EJAA 4FUJA 4UDWH 4WWYA 1HBTH 5JB9S 3BTEE 1XUFA 2WSSD 3LKWA 4CH8B 2STAE 1BRBE 1EOLA 1L0ZA 2LELA 4DCDA 2OINA 3PMHB 4H4FA 2IPQX 3T2NA 1IQLA 5EXLA 5CHAC 3MNSA 4WMDA 3A88A 2BB4A 4BNRA 1W0KD 3V7TA 5HGGA 1AQ7A 2FP7B 2ZU4A 2ZF0H 1O2TA 1PFXC 1O5FH 3NWUA 1FIWA 3MFJA 1GI2A 1GMCG 4CR5A 1SFQB 5EPNA 5E2PA 3SHCH 1C9TA 1GJ5H 5A2MH 3A89A 3R0FA 3RMNH 3TJUA 3LDXH 1JIRA 2BVSH 2ZHWH 1BT7A 1SFIA 3N99A 1OX1A 2YNBA 1OP2A 3BTGE 3SORA 3BTQE 4RT1A 3L6PA 4XRNA 1QHRB 1QL7A 1W0ZU 1GHBF 3D49H 3LGVA 4KTUA 1JOUB 2O8UA 1UJ1A 4F4OC 1TGCA 4ZCNA 1CGIE 2XC5A 3U69H 2XNDD 3SU5A 1ZPBA 1SQRA 1C2IA 2FOBA 1UVPA 1HJ9A 2P3UB 2BX3A 1K28D 1KXDA 2EI6A 4YT6H 1DLEA 2XBYA 6CHAC 1C5SA 2J98A 2OC8A 1TBQH 4JZDH 1OKXA 1A5IA 1SL3A 4WJG2 5FBIA 2BQWB 1EZSC 1C1TA 1E34B 2P95A 1K2I1 4Q80A 3TGKE 2BY6X 5EQQA 4NIWA 4X6NA 3VB4A 3ZZ7A 4JK6A 3SUFA 3GCOA 1GBAA 3UR6A 2XCNA 2Y6TA 1G2LA 5EW1H 1TGTA 1C5XB 1AE5A 4H6TA 3T29A 1UCYE 1T31A 3E91A 1YPHE 5DP9A 1IQEA 2R3UA 3E8LA 1V2LT 3BIUH 4AB9A 4I7YH 2ZU2A 1W14U 3LC3A 4K60A 4WMEA 3EA8A 2B8OH 5EXNA 3ELAH 4BXSA 3S0NA 4O3TA 1JIMA 4HTCH 3RXFA 4DGJA 1GBEA 1V2TT 1FX0B 2NU2E 1RD3B 4XBCA 4X8SH 1P9UA 2AGEX 4X6OA 1O3HA 1KMHB 4X6PA 1TPOA 1UCYH 4AB8A 5LH8A 3OSYA 4BAQB 1YYY1 1Y3YA 2Q1JA 3IG6B 3S9BA 1AO5A 1SBWA 3RP2A 1YC0A 2PGQB 3DFLA 4ASHA 5L2YH 2QF3A 5SGAE 3NCLA 2QF0A 1E37B 1GCTB 2ANMH 2VIVA 3QN7A 3LGUA 4A1XA 1C5VA 1F0SA 3NPSA 4NIYA 1O3FA 2G55A 4OS7A 1QA0A 3SNDA 1WQVH 1C1RA 3KQDA 2GZ8A 1DY8A 5E0HA 3BV9B 4FUGA 1BZXE 1S5SA 3ATWA 4KTSA 2GCHF 1ZTKA 4JK5A 1HXEH 2XWAA 2VWLA 1UTLM 2HNTF 5TJXA 3S7HB 4CBNA 3UIRA 1KDQA 1Z8RA 4ISLA 3DSOA 2VH6A 2VGCB 1K1JA 4Y79A 1C2MA 3SJIA 5A0AE 1D3PB 3I77A 3RXOA 1TMBH 1F5KU 5LGOA 2F83A 3V3MA 1IQJA 3K6YA 4LZ1H 1P2OA 4ABGA 1O3IA 1H8ED 2CV3A 6ESTA 1P9SA 2A4OA 4X8VH 1XUKA 1YLCA 1QRZA 1FJSA 2C8XB 1VITF 1O5EH 2GDDA 3VB3A 3OTJE 4LK4A 3TU7H 3RXBA 1CVWH 1W12U 1GL1A 1HAIH 1RTLA 2V0BA 2ZGBH 2BZ6H 2H2ZA 4ZHMU 3GCHC 4E06H 3HK3B 1C1SA 3MWIU 2BOHB 4K5ZA 1BQYA 3MYWA 1ZSJA 3FKSD 3MH7A 2ZEBA 4WXVA 4Q2KA 2BD8A 1YP9A 1W3CA 1GVKB 1D6WA 1BTUA 1C2JA 1COWD 1Y59T 3SHAH 3F9GA 1BUIA 2P59A 2WV5A 1O35A 4IN2A 2BDCA 1P09A 1GBBA 2ALVA 1PPGE 3RXGA 3RC4A 4RI0A 2KX4A 1S6LA 4Y6DA 2D2DA 1RTKA 4B73A 4OM9A 2BLQA 1AD8H 4MQAA 2CF8H 2FLRH 1MCTA 3RXUA 1HAZB 4K69A 4X6MA 4TY6A 3FZDA 3E16B 1SGCA 2ZHEH 1BMNH 4UD9H 1K1NA 1FPCH 2A45B 3BTTE 3DUXH 1V2QT 1FN6A 1TBRH 3B9FH 4FETA 1EPTC 4O03A 3RXLA 4ZUHA 4I8HA 1O31A 3ZVFA 2OK5A 4GPGA 1ZR0A 2J38A 1GWAA 5AVDA 2V3HH 2CXVA 1IQFA 1SGFG 5C1UA 2G52A 2VIQA 4FU9A 1CGHA 1JXPA 3KQCA 3UB0A 4B1TA 2GZ7A 1C2LA 5C1XA 2UUYA 3FO8D 1O2JA 1GI6A 1O34A 2C8ZB 4GCHG 3GY2A 1QQ4A 1THSH 2THFB 1S84A 1DWCH 2OC1A 2PP6A 2PTCE 1DITH 1GCTC 2STBE 3PLBA 1E36B 3OAAD 2Z3EA 5DJ7A 3WW7A 4GHQA 3D23A 5L6NH 4AX9H 1F7ZA 3S7KB 4O97A 1ELVA 2PR3A 2J98B 1C5QA 4Z1MD 1WV7H 4B2CA 3SU3A 4UONA 2P94A 2C90B 1O2PA 4TWYA 4F49A 1MABB 1A0JA 1EKBB 1SLVB 4NIXA 2VJ1A 1QJ7B 3A82A 4B2AA 1TNJA 1GBIA 3DCLA 1KTSB 1L1JA 2G4TA 3P95A 1UVSH 3MO6A 3QGJA 1XVOA 1LTOA 1GBHA 4TWWA 3M5NA 1QB1A 1ELFA 1THRH 2K7XA 2Y7XA 2ZPQA 3HGNA 4IC6A 1OPHB 4BOHA 1AFQB 3OY5U 2ZWLH 4YXWD 4R0IA 3RXCA 4CBOA 1O2LA 2VNTA 1GDUA 1YPMH 2CJIA 5JPMH 4WXIA 3RXAA 1S0RA 3ZZBA 2F4LA 1G3EA 1C1VH 2NWNA 2A2QH 1BBRK 1SB1H 1C5TA 1ZMLA 1G37A 1FUJA 1LHDH 1W8BH 3PLKA 1F0UA 2AIQA 3F9EA 2BD9A 1FY5A 2BX4A 1O3KA 1YKTA 1SVPA 5DP3A 4Y0YE 1XUHA 1IAUA 1A1RA 2FLBH 4I33A 4YOIA 2GZ9A 2EA3A 1DUEA 2AH4X 1CHOG 5B6LA 3U8TH 1GMDF 1NFUA 4DY7B 1WBGB 1O5GH 3TGJE 1K22H 5AFYH 1YCPH 1KDQB 1WTHD 2SGEE 1HAHH 4YZUA 3RMLH 1NROH 3RXIA 4ISIH 2W6ID 1TX8A 3Q3XA 2ZU3A 1O2RA 3SV2H 3ZV8A 1TRYA 4KP0A 1O5CB 3TH4H 4MNXA 1V2OT 5EGMA 2BDAA 1C4V2 4DIHH 2PKAA 1SSXA 1DUAA 4CREA 1V2KT 2ODQA 1IQHA 1E79D 2FOGA 4ZKOU 1C5MD 1FZZA 2KCYA 4JZFH 2JIZD 2BLOA 1TGSZ 1ZHPA 3QO6A 4K1SA 3SGQE 5LPFA 4R8TB 1G3CA 1INCA 3OEED 3VB7A 5DP6A 3M61U 4OS1A 5C94A 1KXBA 1K0HA 1N1LA 1IQKA 1TRNA 2Z9JA 3A7YA 3ZZ5A 2XBWA 1EJNA 3SV7A 5EU8A 1ORFA 5PTPA 2BHGA 3F9HA 3UWJH 2SNWA 3SV6A 3HKJB 4J1YA 2ZTYA 2ZECA 1CE5A 1EP5A 1MTSA 2ANKH 2AGGX 2OQ5A 3BF6H 2L74A 3MO3A 2PSXA 3DSGA 1H8DH 3E1XB 2ZFPH 1HRTH 2BQ6B 4U32A 2FOCA 2HALA 1GG6B 5C3NA 2PGBB 4KKDA 1IHTH 3MH4A 1RXPA 2ZCLP 3TITA 1TNGA 3GCTF 1AVXA 4UFFH 3IITA 4AG1A 6LPRA 1AFQC 1YWUA 3Q00A 1TE0A 2TRMA 2CN0H 2A7HA 5KEDA 4NFFA 5K7RA 1DS2E 1RS0A 2BVXH 5IDKA 1TGNA 1MBQA 1XVMA 4X0WU 1AE8H 2BD4A 4NSYA 1FY8E 2ZQ2A 3AVZA 4ABHA 3TK9A 3QLPH 2L6OA 2W3KA 3MNBA 1PPEE 2KFWA 2ZGHA 1KSNA 1ZHMA 3A7VA 4X1SU 1MQ5A 1NBME 4RSPA 1NBMD 5KGOA 4BAKB 2QF5A 3OU0A 4I31A 3AW0A 4XE4A 4HI3A 1EZXC 1C5ZB 2YOLA 2ZZUH 2PW8H 1TAWA 4AFSA 1WYKA 2PUQH 2QY0B 4NA7A 2GTBA 1OXGA 2Y82A 1WXRA 1MU8B 2Q6FA 2H6MA 2B5TB 3M35A 3BTKE 2AMQA 3QX5H 4LOYH 2FTMA 2O8TA 1GBDA 1CT0E 3GYLB 2IN2A 4BTIB 1CO7E 1NRQH 1O2XA 1EAIA 2WUBA 4B71A 3A86A 1Y5BT 1GJCB 1V2WT 1IOEA 4X8TH 1O36A 5EXMA 3SUEA 4DVAU 3M7UA 2ODYB 3KQEA 1QB9A 1ID5H 4O9VA 1VZQH 2OCVB 4K1TA 1XM1A 2YMSC 3T62A 2XWBI 2ZIQH 4UE7H 3C27B 4ACAA 3URDA 1GI1A 2AGIX 1MMJN 3SNAA 3TJVA 3SQHE 1P02A 2JJ1D 2P8OC 3TGIE 1DWEH 4AZ2B 1ZJKA 5DP8A 2Z3CA 2FOMB 3EYDA 4DT4A 4PROA 4QT8C 1DXPA 1BBRE 1C9PA 2F9NA 1C2FA 3ATMA 4MNYA 1BITA 1MKWK 3SZNA 2GV7A 3H5CB 1TRMA 3G01A 2J34A 3CS0A 3GY4A 1ABIH 1GI9B 3U9AH 2TGDA 5DP5A 3VXEH 1O3DA 4FOUC 3MH6A 4Y7BA 2J94A 4GVUA 5A8YA 2VWOA 1DDJA 1QNJA 2XC4A 3GY8A 1GG6C 3ZIAD 2PLXA 4ZKSU 3SQEE 2KZ4A 3RXMA 3KGPA 1GMCF 5C17A 2ZDLA 2GMTB 5EIYA 2C8YB 1K1MA 2UWPA 3F1SB 1TWXB 2XBVA 3P8GA 4NCYA 5TCCA 1DWBH 2A5AA 3PTBA 2EEKA 4JYTA 5HIZA 4CRFA 1YLNA 1ZLRA 1GI5A 1O2ZA 7GCHG 1FY4A 1DLKB 3LONA 2K0QA 3ZVGA 1LHFH 2GGVB 5E8EH 3UOUA 1OWHA 2H5CA 4BTTB 7KMEH 3A87A 1SPJA 2PKAB 3I29A 4X2XA 3RU4D 5A8ZA 4NGAH 2ASUB 2D26C 1O3OA 2IJOB 2FOAA 1C1QA 2P3TB 3W95A 4MG3A 3SBKA 3H7TA 1P2MA 3EBNA 2IJD1 1VGCB 3BEFB 2ILNA 1BMFD 1QFKH 2ALPA 3EA7A 1RFNA 3D65E 2HOBA 1CSOE 1NRNH 2ZDMA 3SI4H 1KLIH 1HCGA 5FPYA 4H42U 2BYAX 3GY5A 2VH0A 5F6MA 2UWOA 1NC6A 2GV6A 2BY8X 2ZQ1A 3P8NA 4DURA 4XFQA 2G4UA 2AERH 5A0CA 2V7QD 1XMNB 1LVBA 2BD3A 5EJ1A 3ENSB 5FL7D 1SGRE 3L33A 1T7CA 1TFXA 1E0FD 1LVYA 1MKXH 1O2IA 3DSPA 3HGPA 1PQ7A 3Q3KA 2HPPH 2ANWA 3FP7E 1W0YH 3JZ1B 1NU9A 3E90B 4ABEA 2ZPSA 4NFEA 5ESBA 1JRSA 3EQ0H 4ZXXH 2IOTA 5JB8S 5C5OA 1L2EA 2WV4A 4Q7ZA 1OHHD 4FUEA 4KGAA 2AIPA 3VB5A 1F5LA 1HDTH 3DD2H 4ABIA 3SW2B 3VPKA 1YBWA 1EOJA 4FUFA 1JMOH 1GJ8B 1C5WB 2RCEA 1SQAA 1ANEA 2LP6A 2H5DA 2Z94A 1SGYE 1UTJA 3FANA 4UFEH 2PV9B 1PPFE 5BRRE 2Y7ZA 4D7GA 1RGQA 3SU6A 2FX6A 5L30H 2ZGXH 1HB0B 1OWJA 1MTWA 1EAUA 2CF9H 2ZC9H 4YOJA 2FXRA 1AU8A 2ZU5A 2VVVA 1FV9A 2DE8A 3MNCA 1TX7A 3T5FH 1UTMA 1Z71A 2BXTH 3KQ5A 4P00A 1AN1E 1Y3WA 1GPZA 1Z1JA 1PJPA 2GMTC 1A0HB 1NO9H 2KR7A 2LIZA 3MI4A 2HLDD 3GY7A 3M7TA 2A7CA 1SI5H 1QRWA 1C5OH 2ZU1A 1SGQE 3P17H 3RXVA 3S9AA 1TONA 3RC6A 5J4QA 2KCPA 1FY3A 1N6YA 3RXTA 3MQKC 2WV9A 1HAGE 1AWHB 3OE7D 3MNXA 5GNDA 1TOCB 3M3SA 3W1EA 1P2KA 1XUIA 2F9BH 3A7ZA 2J4IA 2HNTE 2NU3E 3QTVH 1SQOA 3ESTA 3UQVA 4FXGH 2ESTE 1ZPCA 3KYGA 5HMAA 1PQ5A 3VFEA 1J15A 3W94A 1UVUH 5H4IB 2EI8A 3VB6A 2BZAA 2G51A 5EG4A 1UTOA 2VB0A 1VGCC 1T4VH 1QGFA 1AIXH 1SGFA 2QV1A 2ANYA 2BQ7B 3M5MA 4IMQA 2Y80A 4JZIA 3V13A 3F3BA 1P04A 2VINA 2FZZA 1O2WA 1QBNA 3WWBA 1CBWB 1FIZA 4GLYA 1WSSH 2H1UA 3AAUA 1AWFH 4X1NU 4NWKA 1OS8A 3EDXB 4MDSA 4B6EA 5BPEA 1GHAG 1BOQA 1M9UA 1V2ST 5FPSA 2O9QA 3WWFA 4ZXYH 2BD5A 1JRTA 4D9QA 3SV8A 1O3EA 1V2VT 1PYTD 1D9IA 1W10U 4HG6A 1QBVH 1SGPE 1AZZA 1QZ8A 1GGDB 1LCYA 2JH5D 3BG4B 1BRCE 3A8CA 1P2IA 1SR5C 2G81E 3SU1A 5FX6A 2FESH 1QJ1B 2BXUH 3MMGA 1VITH 2FI3E 2YNAA 3UTUH 1ELBA 1BMAA 1K1IA 1F5RA 2XCFA 1O37A 1V3XA 1O2MA 1FLEE 5JBAS 1HAXB 4DIIH 1OP0A 3PM3A 2LNCA 2KCAA 4GCHF 1SLUB 3QUMP 4FU8A 2SNVA 2Z9KA 1QIXB 1J9CH 1F0RA 1S85A 1GHVH 3SU2A 1J8AA 3ZVCA 2JDID 2P3FH 4AFQA 4ASUD 2AYWA 3A84A 2V3MA 1G3DA 1BMLA 1O5BB 4ABBA 2ZKSA 4JZ1A 1NPMA 1DM4B 3VEQB 1T8MA 1TPSA 3PROA 3RM0H 1YPGH 3MHWU 2ZA5A 3ITIA 1FXYA 2P93A 3M7QA 4Y11E 2ZO3H 1ZRBA 2J92A 2ZDKA 3SNBA 3TH3H 2FYRA 3PRBA 1HJ8A 2HVYB 1KXAA 2PFEA 1HLTH 5CMXH 4Q63A 2AMPA 5G4BA 4ZH8A 1TNHA 1GHZA 2ZFSA 2O8WA 2K1QA 3DT0H 5DG6A 2W5EA 1KYNA 3ZZ9A 3RXQA 1V2MT 1BTHH 3ZZ6A 3QZQA 4XBDA 4AFZA 2D1JA 1Y5AT 1YCPM 1ARCA 2ZTXA 1Y3UA 2RFKC 1T32A 1HPGA 3ODDA 1ESTA 1Z8GA 2A4GA 1P11E 2Y5FA 2FMJA 4JYVH 1KXFA 2OD3B 4MNVA 1NFWA 2I6SA 2VGCC 5HKKD 4IS5A 1MTNB 4WY3A 2FM2A 1CBWC 2TGAA 1GMHG 1BTYA 1TX6A 1Z8IB 2UUJB 4I86A 2J97A 3RMOH 4AN7A 1ZOMA 4DW2U 1CA0B 5E2OA 1DX5M 2CGAA 1RJXB 1FDPA 1P0SH 1HYLA 4OS6A 1MAYA 4ABDA 2SGAA 4CR9A 1ZSLA 3P8FA 1A5GH 2Z9LA 2EC9H 1BHXF 1P8VC 1PQAA 5ESTE 3UY9A 3MU0A 3GDSA 3NK8A 1Q31A 3F0PA 1DPOA 1GGDC 2BLWA 4GSOA 2SGDE 1EQ9A 5HYOA
chains in the Genus database with same CATH topology
1FQ3A 4X1RU 3SNEA 1CA8B 2A4RA 3A8DA 1X7AC 2WYGA 1A46H 1P06A 1DICA 2ZDAH 1LPKB 4X1QU 1MTUA 1EASA 1C5UA 1TNLA 3RXDA 5FBEA 1GJAB 3ZVDA 4D7FA 4RN6A 1NU7B 3EGKH 1D3DB 2BY5X 1EZUC 2RG3A 1SG8B 3CENA 3PMAB 4FUDA 4MVNA 3IWMA 8GCHG 3B23B 5C67A 5EOKA 1G3BA 2XYAA 1C5YB 1ZMJA 1O5AB 5GCHG 5DPAA 4FVDA 2GT8A 1DANH 1GJDB 5AF9H 4MPVA 4AFUA 1ZGIA 1EAWA 1EB1H 1KLJH 1EB2A 1H9HE 3TNSA 1CHOF 1TMUH 3K6ZA 1EATA 1UVTH 2ZPRA 3TPIZ 1IHSH 1G30B 2V35A 2W3IA 4HGCA 1O0DH 4YOGA 1FI8A 4AOQA 1TB6H 1OSSA 1GVZA 3K9XB 4MPWA 1ELEE 1K1PA 1XXDA 2BY9X 2QAAA 1UMAH 5DP4A 1ELCA 4Y7AA 1ESBA 3P6ZB 2VIWA 2V6NA 1AFEH 1AI8H 1L4DA 1KLTA 2BDGA 1TQ7B 3P92A 2QN5T 5FCRA 1PPZA 4Q7YA 4DJZB 2ZTZA 1A7SA 1LDTT 1TALA 1YPHC 2QXGA 2FEQH 1G2MA 3P70B 4TYDA 3UNRA 1SGNE 2W7UA 1OWEA 2F9UA 3TK6A 3WY8A 1D3TB 3LPRA 1O3GA 2GCTB 3FVFB 1LVMA 1S81A 2OC7A 1Y3XA 1GBLA 2A2XH 1T4UH 1BJVA 1XKAC 1MTNC 1H9IE 1QTFA 1LHGH 3STJA 1UTNA 4NSVA 1V2RT 4K8BA 5DO4H 1ETRH 1S0QA 3VGCB 1B5GH 2A0QB 2F3CE 1SOTA 4TPYA 9ESTA 4ISNA 3LH1A 1WAYB 2SGFE 3ZZAA 3EA9A 2JH0D 1PPHE 1TBZH 3PMJA 3ZYEA 1O2UA 1VCQA 2B0FA 1O2SA 1K1OA 4MNWA 4CH2B 4INKA 1BB0B 1O33A 1CQQA 1QL8A 1TLDA 4ZAEA 4XDEA 2HNTC 2QGRA 2ZGCA 5AFZH 3MOCA 3M36A 3SOSA 3TH2H 2SFAA 2PKSB 3KIDU 4NWLA 2W7SA 4BAOB 3NXPA 1O2GH 4MPUA 1GJ7B 2HLCA 1AVGH 1LQDB 3ZZDA 5J4SA 3HATH 4I8JA 5I46H 4I8LA 2NU4E 4X2VA 3UPEA 1W11U 4E05H 1S82A 3TJOA 3F6UH 1QB6A 2ZDNA 3ODFA 1OYTH 6GCHG 5FX5A 1PQ8A 2M5TA 2A31A 3Q76A 3F68H 2ODPA 1Y8TA 2EI7A 4M7GA 1HIAA 1A0LA 4WF8A 1BHXB 1O39A 2G5NA 3CS7A 4U2WA 1KY9A 1O2KA 2TPIZ 2WPHS 5CHAB 2GD4B 1QL9A 1BDAA 1THPB 2F9VA 2XC0A 2FDAA 1BRAA 4E7NA 1EZQA 1ZRKA 3C1KA 1N6XA 1C2EA 1PYTC 4IN1A 1CU1A 1MUEB 2BDHA 2FX4A 1EPTA 4H6SB 2FPZA 5ETXA 4A6LA 1A5HA 2FS9A 2BD2A 1KIGH 1A61H 1NFXA 1J16A 3KL6A 5EODA 4OGXA 3UFAA 4YLQH 3LT3A 4IMZA 3RM2H 1NM6A 3U8OH 3UUZA 1DWDH 3KCGH 2QIQA 3UQOA 1MZAA 1TA6A 4A1TA 4LZ4B 2QXIA 2ZI2H 2VIPA 2F9PA 1QRXA 4NZLA 3ZYDA 1ZTJA 3RXKA 1T8OA 1TPAE 1LHEH 4YESB 5GXPA 2QYIA 5C5NA 3LC5A 2GCTC 1B0EA 1GDQA 4J2YB 1ELDE 1GBJA 4E7RG 1G36A 1NZQH 6CHAB 1P12E 2WYJA 1MCVA 3U1IB 5FPTA 1HJAB 7GCHF 1LQEA 2WPKS 2FYQA 1SGEE 4OGYA 1B7XB 1A3EH 3HPTB 2UUKB 4INHA 1QJ6B 2Z6BD 2PTNA 4AGJA 1MTVA 3LOXA 3ZVBA 2AS9A 3GY3A 1P03A 2TGTA 3SUGA 1OWIA 4YM9A 3F9FA 2R2MB 4AORA 1ZTLA 1O2OA 5B6OA 2XBXA 4JMYA 1C5LH 1BBRH 2I6QA 2QC2A 1A4WH 3FP8E 2GKVE 1HAYB 1HAOH 1GBFA 2PKSC 3RXRA 4FU7A 2GVFA 1AUTC 1MZDA 1YF4A 3GDVA 1BIOA 4NG9H 1KXEA 2KAIA 5IYTA 3S69A 4UFGH 3QK1A 1FAKH 3I78A 3OX7U 3AASA 3RU4E 1HXFH 1Z6EA 2IPHA 1WQSA 5HM2A 1GHWH 1QA7A 3ZVAA 7ESTE 1SHHB 2G5VA 4BAHB 4HZHA 1VR1H 2C93B 3MU4A 5A09A 3BTME 3FP6E 2OTVA 1TABE 3RLYH 2A7JA 4SGAE 3UWIA 3V12A 2QCYA 5DGJA 1V2UT 1KXCA 5ABWA 1GDNA 2W26A 4CRBA 2BDYA 1AUJA 2HPQH 1FPHH 3A7WA 1ETSH 3JZ2B 2JH6D 4X8UH 4GHTA 1EUFA 4BTUB 1ANDA 3P8OA 1ESAA 2RA0A 1P05A 1VCWA 2A32A 1NFYA 2AFQB 1XUJA 2QA9E 1MD8A 3SJOA 1ARBA 3AAVA 1F2SE 3SGAE 4GAWA 1SGIB 4ZKRU 2C4FH 1RTFB 1KTTB 3DHKH 1LMWB 2H9EH 3RC5A 1DOJA 2ZGJA 1L1NA 1H1BA 5AHGH 3FFGA 2SGPE 2UUFB 1LVOA 1E38B 5E0GA 2GX4A 3TK5A 1V2NT 3GCHB 4I8GA 4AYYB 2OBQA 1NRRH 1SOZA 1UTPA 1FN8A 2A5IA 1HJAC 3KN2A 3UR9A 4KTCA 4BXWA 5F8XA 1IQIA 1O30A 3GY6A 3A8BA 3FAOA 4X2WA 3RXSA 3NZIA 4K2YA 4OS2A 1GI4A 1DSUA 4TPIZ 2FS8A 1BTPA 4YTAA 1GHBG 4JZEH 4X2YA 1GL0E 4A5TS 1O3LA 1HIAB 1OWKA 1NESE 1L4ZA 2ZFQH 2PUXB 1C1MA 2XTTB 1MH0A 3T27A 2G8TA 3RXPA 2Y5HA 1LPGB 1UK3A 5FHTA 1PPBH 2R0LA 3BIVH 5EPYA 2Q6GA 2ZDVH 3SI3H 1C5PA 5T6FA 4A92A 1HFDA 1EPTB 4AG2A 2GT7A 1C4U2 2AEIH 4FVBA 1P3EA 3RXJA 2A4QA 1TQ0B 3LIWA 3U1JB 1GHAF 3KF2A 3BG8A 3A80A 1FMGA 1SGDE 1PPCE 3LGTA 5JDUB 1K21H 2A1DB 2ZCHP 2ZFFH 4Y76A 2B9LA 2ULLA 4Z0KA 3BTWE 3PO1B 4D76A 2CHAB 1SLWB 2FWWA 3PTNA 2FOEA 3RDZA 4NZQA 3U98H 3O8DA 1YCPK 1C1NA 1SC8U 3LGWA 1C2HA 4ZROA 1BRUP 2OUAA 2PWXA 1W2KH 1ZHRA 4WH6A 2TIOA 2CMYA 1MAXA 4ISHH 3LGIA 7LPRA 4WVPE 3ATLA 4I8KA 4WH8A 3T28A 3DA9B 1MU6B 1QCPA 4A1VA 1NRPH 3QWCH 4GUXA 3A83A 4ZHLU 2GP9B 4OS5A 1TIOA 1JBUH 1J17T 4CRGA 1YPJH 3SJ9A 2SGQE 4ABFA 1O3BA 1IQMA 4FUBA 1AVWA 1DY9A 1ETTH 2P16A 8KME2 2VWMA 3SU4A 9LPRA 1WUNH 3RXEA 2FI4E 1AY6H 5DKMA 2O8LA 5T3HA 2OXSA 5FXLA 1GI3A 1H9LB 4ISOA 1MD7A 2BDBA 1MKWH 3QTOH 3UNSA 5FCKA 4Y8ZA 3MH5A 1V2JT 1U6QA 4YLUA 1YPEH 8LPRA 1FONA 2RDLA 4LXBH 1O3AA 1UO6A 1DT2A 2O8MA 1C2GA 2GCHG 3ATIA 2KAIB 2BLVA 2D8WA 1Z8JB 1ZYOA 1S83A 2C3SA 4K1EA 1QBOA 2R3YA 3V0XA 2BTCE 1ACBE 1GI7B 2F9OA 2BMGB 3UREA 5A0BA 3PWCA 2AMDA 1CT2E 2WPLS 2R9PA 1WOFA 3GYMA 1UHBA 1AGJA 4YT7H 2LPRA 3S9CA 1C5RA 4B75A 1FY1A 3B8JA 2BOKA 3GCNA 1VJ9U 4JCNA 5DP7A 1VITG 3TNTA 1LO6A 1MBMA 2A5KA 1N8OB 1LHCH 2R2WU 1RRKA 1XX9A 2Z3DA 1L1GA 1TNIA 5GJ4B 1UK2A 4NA9H 1ZZZA 1GMHF 3UOPA 3GICB 3MU5A 1H4WA 1TMTH 1HNEE 4ABJA 1BCUH 5LPEA 3BEIB 4UEHH 2XW9A 5CE1A 3K65B 3SJ8A 4D8NA 3BN9A 1A3BH 1C1OA 1NTPA 1GI8B 1Z7KA 3PO1C 4X1PU 2CHAC 4IC5A 5JYIA 1AHTH 1ANBA 3NKKA 2DE9A 1ELGA 4K3JA 2OP9A 1UK4A 1DE7H 1OWDA 1FAXA 2R0KA 1E35B 1OYQA 2OLGA 1D6RA 5JBBS 1BTWA 2ZCKP 2QXJA 5EQRA 1VJAU 3D62A 1P01A 3TLOA 1CHGA 1SQTA 2Q6DA 1WU1A 1IQGA 4I32A 2GDEH 1SMFE 3GOVB 3RLWH 2Z9GA 4ZMAH 3SNCA 1TOMH 4TY7A 4DG4A 8GCHF 3LGYA 1P2JA 2G00A 5GCHF 1B0FA 4RKOB 1EAXA 1RIWB 2VWNA 3BG4C 3RUOA 4B2BA 1ELAA 1O3MA 1WCZA 3O8RA 1EJMA 5GPIB 2XXLA 1GBCA 2VVUA 3H7OA 2NU0E 1NN6A 1LKBA 2H9HA 3GDUA 3STIA 1AB9B 3OYPA 2ZP0H 5C1YA 1ELTA 1ZMNA 2UWLA 4Y0ZE 1LPZB 3OY6U 2QXHA 4FUCA 2PHBA 3A8AA 3GISB 3PLPA 1WTGH 4U30A 3RU4T 4UFDH 4KELA 1D3QB 1O3JA 2Y5GA 5HM9A 3NUMA 4IBLH 4XSKU 4B74A 2V3OH 5T6GA 4XOJA 3LJOA 1G32B 1D4PB 1HAVA 1Y3VA 1ZJDA 5TCAA 2FIRH 4Y71A 2VU8E 4WMFA 1AKSA 2FOHA 5FAHA 1C1WH 1J14A 1G9IE 2BD7A 5F8ZA 2ZNKH 4Y8XA 3MO9A 2JETB 5EW2H 2DUCA 5JBCS 4SGBE 3O8CA 2WUCA 5HXFA 2BVRH 1N8OC 2WINI 1BMMH 1F0TA 3PV4A 1YM0A 4Q7XA 3SGBE 4ABAA 2J95A 4AGKA 2ZFTA 4BANB 1GJ4H 1TPPA 4VGCB 2WPJS 3RMMH 1W13U 1BTZA 3KEEA 1YLDA 4JYUH 5E0JA 3FZZA 1HGTH 5LPRA 1UTQA 3SV9A 1GHXH 3A81A 1P2QA 3BTHE 1W7GH 1W7XH 2TBSA 3SUDA 1IQNA 3E6PH 1Z1IA 3M3TA 2OQUA 2PSYA 1QQUA 2VIOA 4K8YA 1DXWA 1C1UH 4FUHA 4BAMB 3QZRA 4IW4E 2NU1E 1QY6A 2FODA 5A8XA 5L2ZH 1HUTH 3E0NB 1EX3A 3A7TA 1P10A 3A85A 4CRDA 1O2YA 2XNIA 1C2KA 1XUGA 1DVAH 4ZKNU 1T8NA 3K2UA 1ZGVA 1CA0C 1GMDG 1MKXK 2FTLE 3M5OA 2JKHA 2P8OB 3EE0B 2HWLB 2J2UA 2VIDA 6GCHF 3LH3A 3ZZ3A 3LU9B 1Q2WA 3KNXA 3TJNA 2HGTH 3TIUA 3TVJB 1C1PA 2BM2A 3HK6B 5T6DA 1SLXB 4RKJB 1DFPA 1NRSH 1QR3E 1O3PB 2FI5E 2TGPZ 3MU1A 4CHAB 1RIWC 2ZHQH 2RA3A 1UHBB 4A7IB 3MU8A 3E0PB 2BY7X 3O8BA 3SU0A 3URCA 5I25A 4DOQA 2WPMS 1AB9C 3CP7A 1TGBA 4OS4A 4ESTE 3MTYA 1GI0A 3E3TA 2OC0A 1P3CA 4NIVA 3T25A 1YPKH 3Q77A 1GHYH 4O3UA 3BTFE 3L3TA 1DSTA 4D9RA 4INLA 1BA8B 1GJ9B 1GJ6A 3DFJA 2ZHFH 4CRAA 5EQSA 2Z7FE 1P2NA 4MTBA 1CGJE 1ANCA 2HRVA 3BEUA 2WPIS 1P57B 3N7OA 4U01A 1F92A 5F03A 2F91A 2JETC 5F8TA 1O2NA 1XKBC 3PMBB 1UCYK 4AYVB 2J9NA 1C4Y2 3KQBA 3HKIB 4B76A 1GVLA 1MQ6A 5GWZA 1V2PT 2HVXA 1Y5UT 1YPLH 3R3GB 1GBMA 5GIBA 1O3CA 3GCTG 3U8RH 2H9TH 1GBTA 4VGCC 2BDIA 2XRCA 3KHVA 4THNH 8ESTE 1JWTA 1Z6JH 3Q3YA 5DK1A 1ZSKA 3QGNB 3BSQA 1O2VA 2C8WB 5C20A 3PWBA 3SO3A 1QURH 1HV7A 3ATKA 4Y8YA 3SN8A 5GDSH 1EXFA 2ZG0H 2ZHDA 1AZ8A 1S6FA 3ZZCA 4MPXA 2ZFRH 3ZV9A 5C2ZA 3ZZ4A 2B7DH 1O38A 1V6DA 1UVOA 3BTDE 3PYHA 1EP6A 1NT1A 3ZVEA 1ABJH 1BTXA 1FNIA 3SJKA 1T8LA 1SGTA 4CRCA 4IGDA 4YO9A 1YGCH 1ZPZA 1C5NH 3VGCC 5JBTA 3M3VA 1C2DA 1O2HA 1O3NA 1CT4E 3ZZ8A 3M37A 1BJUA 2Y81A 1NY22 3UNQA 2Z9IA 3QDZB 4ZHAA 1HAVB 1NS3A 4FUIA 2FO9A 1OP8A 5K0HA 1AMHA 1K1LA 4Y10E 1AKSB 3AW1A 4DT7B 1VCPA 1H8IH 4Z6AH 3T26A 4XBBA 1A2CH 4CHAC 4MLFB 2OBOA 1GBKA 1GJBB 3A7XA 1TNKA 1O32A 1UTKA 4NA8A 2FOFA 1TA2A 3M5LA 1GCDA 1Q3XA 2VVCA 1K9OE 1TYNA 1LKAA 3PB1E 1XXFA 1SHYA 1HAPH 3VXFH 3EAJA 1S6HA 4HFPB 3RXHA 1OOKB 3LJJA 1O5DH 1O2QA 1EJAA 4FUJA 4UDWH 4WWYA 1HBTH 5JB9S 3BTEE 1XUFA 3LKWA 4CH8B 2STAE 1BRBE 1EOLA 1L0ZA 4DCDA 2OINA 3PMHB 4H4FA 3T2NA 1IQLA 5EXLA 5CHAC 3MNSA 4WMDA 3A88A 2BB4A 4BNRA 3V7TA 5HGGA 1AQ7A 2FP7B 2ZU4A 2ZF0H 1O2TA 1PFXC 1O5FH