2AMDA

Crystal structure of sars_cov mpro in complex with an inhibitor n9
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
309
structure length
309
Chain Sequence
b'PLGSSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Design of Wide-Spectrum Inhibitors Targeting Coronavirus Main Proteases.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 83
structure length 309
sequence length 309
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2amdA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2amdA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2amdA02
2EC9H 1ZZZA 3RC4A 5T6GA 1AB9C 1IHTH 2BD2A 2ZDVH 3PLBA 1ETRH 1YYY1 8KME2 1CT2E 1TOMH 2EA3A 1IQIA 4Z0KA 2XC4A 1Y59T 1PQ5A 2Y80A 3MHWU 3SUDA 1T32A 3LJJA 3P17H 4MNYA 2XBXA 1EJNA 4DT7B 1VZQH 5EXMA 1P0SH 4Y8YA 1O34A 2NU0E 1UTPA 2XWBI 2CHAC 1KDQB 1P2MA 1AO5A 2XBVA 3RXHA 2C8YB 1UVSH 3BTQE 3LGUA 2UWPA 3OX7U 1AB9B 4TY6A 4MTBA 5LH8A 2SGAA 4U01A 1XUHA 1GMHF 2FODA 1YPLH 5BRRE 1GJ6A 4OS4A 4NIYA 3T2NA 1AKSA 3QDZB 1D3QB 1DY9A 4Y0ZE 2JH0D 1OWDA 3ZVDA 3GCOA 3TNTA 1HJAC 2ZU1A 5A8ZA 5PTPA 1GG6B 1T8NA 1OP2A 1O3PB 3UQOA 1FAXA 2Z9GA 1NRSH 4B71A 3GCTG 1OWHA 1MU8B 4UEHH 1C2KA 5LPEA 4F49A 2ZZUH 5EGMA 5GIBA 1RJXB 1WBGB 1QGFA 5DP7A 3FFGA 3RLWH 1XX9A 2HLCA 3M7QA 3QGNB 2FWWA 4X6PA 3F9EA 1KLIH 3UQVA 2WPMS 1BUIA 3A83A 2GGVB 1GI9B 3SU4A 4XE4A 2WUBA 2H9TH 1UK3A 1YLCA 2AGEX 1DWBH 1O3AA 1A1RA 1HJAB 2ZGBH 2ALVA 4X1SU 3S7KB 1ANDA 4I32A 4AYVB 2A4QA 1MQ6A 5J4QA 3AW0A 1THPB 3SU0A 1CVWH 2QCYA 3LC5A 4MNVA 3RXDA 1BMNH 5C1XA 2VVUA 1FLEE 4CBNA 3E1XB 2BVXH 2VIOA 3CENA 4MNWA 3RU4T 4ZH8A 4K8YA 1AFEH 1AY6H 3U1IB 1O2TA 5DG6A 1GHYH 3RXKA 4OS5A 2G51A 1NO9H 1OYQA 1BTXA 1PPEE 1AGJA 3SU3A 5AVDA 2ZDMA 1UHBB 1UK4A 1JMOH 4K1EA 1F5LA 3F1SB 4NFFA 1ELGA 1RTFB 1HXFH 5CMXH 4DG4A 4CH8B 1UVTH 3WY8A 1GI0A 3A8BA 3PWCA 4PROA 1TWXB 4ABEA 3SNCA 5GXPA 2ZDKA 3ZVEA 3MNXA 4K2YA 1YLDA 1O2NA 2F3CE 3RM0H 1D4PB 1T4UH 1XUJA 3RM2H 2Z3EA 1IQMA 4KGAA 2UUKB 2ZO3H 5A0CA 1JXPA 3OU0A 2VIQA 2ZP0H 1YPMH 1GI6A 1QRXA 2TRMA 1HAXB 3P8OA 2RCEA 2NWNA 3PTNA 1QA0A 3ZZ6A 1Z71A 1B0FA 4AFUA 3GCHC 3SNBA 2AEIH 2B8OH 2WPHS 3K2UA 1TMTH 2ZGJA 2O8LA 3BG4B 2GMTC 1P9SA 1GBIA 1AZ8A 3A8AA 1ID5H 1SGEE 3ZVFA 1O2KA 1BRUP 1CT0E 2R0LA 3EA8A 3PO1B 1GVZA 2ESTE 3RXSA 3PM3A 4GCHF 1ZGVA 3A85A 1OXGA 1GHBF 1H9IE 2BXUH 3T62A 4I31A 2VIDA 4ZROA 1F7ZA 3BTME 3MFJA 3MH5A 3SGQE 3RXCA 1LKAA 3C27B 3MU8A 3JZ2B 2ULLA 1W0YH 2C8WB 3RUOA 2P3UB 5T6DA 4MNXA 2BY5X 2G5VA 5EQRA 1O2HA 1XKBC 2EI8A 4AGJA 2IOTA 4BXWA 1GL0E 1EOJA 4UFFH 1WCZA 3RXEA 2PGBB 1G3DA 1A3BH 2XC5A 2GD4B 1HAHH 3HGPA 3MO6A 1OWJA 2W26A 1JRSA 2D1JA 2GT8A 4Q7XA 2FI4E 4B75A 4CR5A 2WPJS 1O2PA 1SFQB 3KF2A 4X6OA 1Z6JH 2G4TA 4X2VA 1P12E 1FY4A 1ZOMA 3FVFB 3U8OH 4ASHA 2VB0A 1A61H 3RMLH 2NU4E 1F2SE 4I8JA 1UTQA 4WVPE 1TBRH 4B74A 3B8JA 5EPYA 3RLYH 1CQQA 3Q77A 4H6SB 3P6ZB 4ZXXH 3GISB 4FVBA 1PYTD 4JK5A 1C5NH 1GI1A 4E06H 1ELTA 4IC5A 1K22H 1SSXA 4IBLH 3VB3A 3UOUA 1C5QA 2B5TB 2WV4A 2G5NA 1CGHA 3GCTF 2IPHA 1FIZA 1TRNA 1LVBA 1G3EA 2ZFRH 2H1UA 1Z1IA 1DOJA 1ZSJA 2VNTA 1HBTH 3GY7A 3AVZA 1DT2A 1P2QA 4Y10E 1DFPA 1OYTH 2VWMA 3RXMA 2F9BH 1P2NA 3ZZ5A 1VITG 1CU1A 1ORFA 2Z7FE 4X1QU 5AFYH 1BOQA 2AFQB 5TJXA 1ZRBA 4K8BA 1NRQH 3BEFB 2C8ZB 1OS8A 2B7DH 3RC6A 4XBCA 1INCA 1B0EA 1C1VH 3GY5A 2BQ7B 5HGGA 4YTAA 1ZSLA 1TGBA 3NCLA 4X6MA 1E34B 2ZHEH 3D62A 1ZLRA 3GYLB 1ZR0A 1CBWC 2AIPA 3SHAH 4FU7A 1A5IA 4KTCA 5TCCA 2GV6A 4X8VH 3BN9A 1T4VH 3BTGE 1KXCA 3TK9A 3GDSA 4X2XA 3T28A 2OBQA 4BTUB 1P03A 1ZPZA 3SGAE 3V12A 3SU1A 1QA7A 3MU0A 1AQ7A 1YPJH 2QXJA 4I8HA 2V3OH 1W0ZU 1C5PA 1GJAB 3M3TA 2ZF0H 1O5DH 1XUGA 1WUNH 4IW4E 2AS9A 4H6TA 4K1SA 4E05H 1G30B 4NGAH 1MCVA 1TNGA 2CN0H 1TX8A 3S7HB 2A5IA 1CBWB 5DP8A 4VGCC 2ZU4A 5C5OA 3UR9A 2H6MA 1GJ4H 1G2LA 2A5AA 4ZUHA 2I6QA 1SPJA 1HB0B 1K1NA 2A31A 3MNBA 2NU1E 4AB8A 3ZVGA 1OPHB 4INLA 3SU2A 3PMBB 2BY9X 2GCTC 3M35A 3Q76A 5A09A 4CRAA 3RXIA 2KAIA 3SJKA 4FUBA 2BXTH 3QTVH 1EXFA 1O5BB 3MH7A 1H8IH 2V6NA 2G8TA 2PUXB 4OS1A 1VCQA 3EGKH 2F91A 1MU6B 2FLBH 1MTSA 1O3MA 1PPFE 3VGCC 1KIGH 1XXDA 5LPRA 2ZA5A 1O39A 3GY6A 3SJ8A 1HAIH 5K7RA 1UTOA 2OC7A 3A8CA 3BTFE 4D9QA 1IOEA 3HPTB 1W12U 2H5DA 4B2BA 2UWLA 1SMFE 2P8OC 2PTCE 4UFDH 5F8TA 3UIRA 1HAVB 1NESE 1OKXA 1AFQC 4BANB 1GI4A 2GCTB 1WQSA 1ZGIA 2GDDA 3VXFH 4MPVA 3SV6A 2BLQA 1IAUA 4JMYA 1JIRA 2AERH 5HYOA 1NS3A 4DGJA 5CE1A 2V0BA 4NSVA 1A3EH 5FX5A 1UVPA 4YLUA 3O8DA 3NPSA 2FS9A 3URDA 2LPRA 1QURH 2H9HA 2FO9A 2ZU3A 1D3DB 4UFGH 1TX7A 4I8KA 1MKWH 1TNLA 2TBSA 1QTFA 1ZTKA 2P8OB 3HATH 3CS0A 1C2HA 2SFAA 2A32A 1EP6A 5C67A 1IQKA 1OX1A 3MH4A 1FMGA 4B2CA 1V6DA 3E90B 2WYJA 3SN8A 1QNJA 5FBEA 1P06A 5A8XA 1J16A 3RMOH 1SGTA 2WV5A 5DP5A 5JBCS 1AWFH 3SW2B 5SGAE 3ZYDA 2HNTC 3RXQA 1ZPCA 1GJDB 1EQ9A 3K6ZA 3TU7H 1QHRB 3K9XB 4INKA 1S5SA 1JIMA 4KTSA 2GKVE 3MO9A 1VITF 4X1PU 4OS2A 6LPRA 1Z6EA 3SUGA 4A1VA 5HXFA 3A84A 2XCFA 5L2YH 2HPPH 2J34A 1WAYB 5H4IB 2WPLS 2XWAA 1S82A 1P57B 4FUGA 3ATMA 2BY7X 4DIIH 1C5MD 2UWOA 4D76A 1F0UA 3ODFA 1C5OH 1GMCG 3E6PH 4NWKA 2FTMA 3SBKA 2FIRH 1PPCE 1EPTC 1BIOA 3STIA 4AB9A 4INHA 4O97A 3LT3A 4IGDA 2STBE 1EOLA 1LHEH 1QL8A 2V3HH 4Y7BA 1O5GH 1H8DH 4O9VA 2BTCE 3TJUA 4TPIZ 1O3OA 1V2VT 1EZXC 1K1JA 1G37A 1QJ7B 1C5UA 3RXBA 1ZPBA 2HWLB 2AMDA 1GMDF 1NRRH 3LKWA 1TIOA 1XUFA 1FI8A 2GX4A 1BBRE 3M7UA 4H4FA 3SUEA 3FP6E 1T31A 3GYMA 5DP6A 4RKJB 3U98H 2PKSC 2OUAA 1NC6A 1EPTB 2IN2A 1QRZA 5FCKA 2GDEH 2BMGB 4JK6A 2BOHB 5EPNA 3A86A 3MTYA 4Q7ZA 2RDLA 5DJ7A 2XW9A 1C2EA 4D7FA 2SGDE 2W5EA 3ZZ4A 1GJ8B 1DLKB 1CO7E 2RG3A 4KELA 5BPEA 2BM2A 2ZNKH 4BAMB 4TY7A 2CGAA 3TLOA 4FUIA 2PKSB 2XNIA 1SHHB 2PSYA 3BTDE 1C5YB 1BTWA 5L6NH 2JH5D 5HM9A 1BDAA 1A7SA 1C9PA 1FDPA 2GZ8A 3LH3A 1HRTH 5F8ZA 3A80A 1C2GA 2V35A 4NIWA 4ZHLU 4LZ1H 2CJIA 2PUQH 2TPIZ 1OWEA 3E0PB 2ZFSA 2SGQE 3RU4E 4WY3A 1AIXH 4FUJA 1L1JA 4A92A 1DWDH 2ANKH 4BTTB 1GG6C 1MD7A 5LPFA 1QCPA 3A7YA 1AE5A 1O30A 2ZPSA 3NKKA 2BHGA 3ATKA 5GCHG 3M61U 1S81A 2OLGA 4ZHAA 4I8GA 2BLVA 1O38A 3LIWA 1DITH 1OOKB 4B1TA 3MMGA 3TH4H 4AGKA 1BJUA 2HVXA 1MUEB 1C2FA 1W8BH 2K1QA 1PQAA 2P3FH 1EAXA 4IC6A 3M37A 2Y7ZA 2OCVB 2ZGHA 1S85A 2FOGA 1EAIA 1V2WT 2M5TA 3S9AA 1O31A 4OS7A 4AG1A 1O2SA 1GGDC 3HK3B 1O3GA 3P8GA 3STJA 4YM9A 3LGIA 1NM6A 4BTIB 3P70B 4IMQA 5F8XA 1TONA 2OP9A 5EG4A 2SGFE 4JZDH 1BMMH 3SJ9A 1KY9A 3KIDU 3AASA 3FANA 1FY3A 1O0DH 2BX3A 4GLYA 1GDNA 1ELBA 1ZHRA 2P94A 5DP9A 5FAHA 1SGPE 3S69A 2NU2E 3GY4A 2QV1A 3PV4A 4Q2KA 1MKXH 1NROH 1QIXB 1UCYE 4JZEH 1O2QA 3OY5U 3PLKA 1EKBB 3DD2H 4WMDA 1Z8GA 1ELEE 2EEKA 2XBYA 3NUMA 1MTUA 3P92A 4GAWA 3ATWA 3F9GA 4CBOA 4DJZB 2FX4A 1O2MA 3MU5A 3DFJA 3BTKE 7ESTE 3KL6A 1GGDB 1SR5C 2Y82A 1UHBA 3TGKE 1SLWB 1LCYA 1SLXB 2OQUA 1MKXK 1FPCH 4LZ4B 4ZHMU 3M5LA 1CHGA 2BZAA 3JZ1B 3SV7A 2TGAA 1DY8A 4XDEA 1AKSB 1PQ7A 1GMCF 1TGSZ 4HFPB 3TK5A 3TGJE 1C1UH 3KQCA 3A82A 1MAXA 2Y81A 4WH6A 3RXPA 1KXDA 2OTVA 2G4UA 3RXLA 1NTPA 1V2OT 2J95A 2Z9JA 1MTWA 5TCAA 2HPQH 2A2XH 2QA9E 3Q3XA 4K3JA 7KMEH 1YC0A 1E0FD 2PW8H 1O3FA 4AN7A 3P95A 3BG4C 1ARBA 2BYAX 1UTNA 3RU4D 2HNTE 5IDKA 2GV7A 4MPXA 3ZV8A 3H5CB 1QQUA 2ZTZA 3PO1C 4THNH 1UK2A 1QJ1B 1YPHC 1F0RA 2HNTF 3E3TA 5EW2H 5FPSA 1TRYA 4CRCA 2VIWA 1FV9A 4DURA 5ETXA 3LC3A 1XKAC 4AZ2B 2J92A 3B9FH 1NPMA 1GI8B 3T26A 4CH2B 1TQ7B 6GCHF 4TPYA 2D8WA 1DDJA 1QR3E 1BRAA 1BRBE 4UE7H 5FCRA 1BJVA 1P2IA 1BZXE 1E37B 4ABGA 5I46H 1CE5A 7LPRA 1GI2A 1FONA 4CR9A 1HNEE 2W3IA 5C20A 1K1PA 1TMUH 3LOXA 1LO6A 2Y5FA 4NZQA 2OQ5A 1AU8A 4DIHH 2VWLA 4B2AA 1P3EA 2CF8H 1EZQA 1O3CA 4ZXYH 1KTSB 4FUHA 4WH8A 1KXBA 2FLRH 3UUZA 2ZFPH 1LPGB 1T8OA 1UMAH 2FOMB 4WJG2 1Q31A 1SC8U 3ZZ3A 3SOSA 2BD4A 2O8TA 8ESTE 3KNXA 4BXSA 2ZKSA 1FNIA 1GBCA 3BTHE 1C1NA 1RS0A 4ABIA 1C5WB 2A1DB 5EU8A 1VCWA 1GJ7B 4O3UA 2BDAA 2G52A 4NIXA 2ILNA 1SOZA 3EA7A 5GCHF 1WU1A 3ZV9A 2YNBA 2ANYA 2BY8X 5CHAC 1GBDA 4LOYH 4ZAEA 1G3BA 1FJSA 2BOKA 2FEQH 2QXHA 4X2WA 4NFEA 5GPIB 3A7VA 2OXSA 1V2LT 2FOAA 2Y7XA 2ZU5A 1SGFG 3ZZAA 1DXWA 1O2WA 3Q00A 4ABHA 2D2DA 1N6XA 1QBVH 2TGDA 1FQ3A 1O32A 1ABIH 1J15A 2ANWA 2ZDLA 1VJAU 4BAQB 1ESBA 1Y5AT 3BTTE 1P01A 1F5KU 1K2I1 1NU7B 3BV9B 3GY3A 2PSXA 1BMAA 4D8NA 1EB2A 1K28D 1C2DA 1GBKA 1GBHA 2F9OA 1W13U 4I8LA 5JBTA 3PMHB 2A7HA 3VB7A 1GJ9B 3FAOA 5JB9S 3TITA 1O33A 3EDXB 1VCPA 1GVKB 5EXNA 1GBJA 5CHAB 5E2PA 1S0QA 1A0LA 1D6RA 2GP9B 1B5GH 1VGCC 3SNAA 1OP8A 8LPRA 4CRFA 3E91A 2R3YA 4NA9H 2WUCA 1GI5A 1JBUH 3VB6A 1AVGH 2OINA 1V2TT 3E0NB 4CHAC 4Z6AH 1W11U 2J9NA 2ODPA 3BTWE 1V2MT 2TGPZ 3FZDA 1QY6A 3H7OA 1FY5A 1O2RA 3PB1E 4KTUA 1QL9A 1J9CH 3V0XA 5C1UA 1SG8B 4JYVH 1TNKA 4IN1A 4TYDA 1SGDE 1AUTC 1GWAA 2WINI 3SI4H 1SVPA 4X1NU 5HMAA 1HUTH 3EBNA 1F0SA 4ISHH 1VGCB 2Z3CA 2FM2A 1HPGA 2Z94A 5AFZH 1O2XA 1SGCA 1BTUA 1BHXB 5EQSA 1Y5UT 1A0HB 1L0ZA 3IITA 5ESBA 1LPKB 4ISLA 2ZFTA 2ZHFH 3DUXH 4GUXA 5GDSH 2ZHDA 4K1TA 3PLPA 4CHAB 2BD9A 1F0TA 1GJBB 4JZ1A 1HXEH 3MU4A 2FTLE 1W10U 1Q3XA 1K9OE 4TWYA 1ELAA 1LHFH 3BEIB 1SL3A 1ANBA 3I78A 1YF4A 2GZ9A 2Q1JA 1TBQH 1AMHA 1OSSA 2JH6D 1BA8B 4DY7B 1TA6A 9LPRA 3TJOA 4ZKNU 2ZDNA 3HKIB 1O3LA 2G00A 3SV2H 5EOKA 5FBIA 1D9IA 2FX6A 1ZMLA 3RMNH 3QZRA 3T5FH 1UO6A 3V3MA 1AVXA 4F4OC 2WPIS 5E0GA 5GWZA 5AF9H 1Z8JB 4ZKSU 1YPGH 1O2YA 3M5MA 4J2YB 3M36A 1A0JA 1LVYA 4X2YA 3QUMP 1MTNB 3IWMA 1SLUB 3UNRA 2ZECA 3SO3A 2A4OA 3F9HA 1V2KT 1PPZA 1IHSH 1ZSKA 1LQEA 3KQDA 4K69A 2EI6A 2XRCA 1D3TB 1W3CA 3DA9B 5JB8S 1TB6H 1PFXC 1UTJA 4Y6DA 5EXLA 1DE7H 4FXGH 1TGTA 1TPSA 3ESTA 2J94A 1TYNA 3M5NA 3R0FA 1E35B 3VPKA 1G32B 2ZI2H 2ODYB 1P04A 1P09A 1KLTA 1O3IA 3A7XA 1YKTA 1J14A 3RXOA 3L33A 5K0HA 2QC2A 2QIQA 2Z9KA 1YPHE 2LNCA 3UFAA 1G2MA 1TBZH 1K1IA 2BY6X 1AI8H 1UTKA 1EP5A 5L2ZH 2ZTYA 1ETTH 2DE9A 3NWUA 1TFXA 2D26C 1YPKH 4X6NA 3TPIZ 1O5FH 2FYRA 3AAUA 3I77A 4IN2A 1LVOA 1SGIB 1DANH 2I6SA 2B0FA 3KQEA 1CT4E 2FOCA 4B76A 4CRBA 1NN6A 1VR1H 2KAIB 4WWYA 3RXGA 1O36A 3FZZA 1Y8TA 1JOUB 3MOCA 4KKDA 1GBTA 3A8DA 2P3TB 1NFUA 4GHTA 4JYTA 3GCNA 4BAHB 4R0IA 1NFWA 2F9VA 2ASUB 4R8TB 4NSYA 3TVJB 1GCDA 1MAYA 2ZWLH 3T27A 2VWOA 5A8YA 1HGTH 4NWLA 2H2ZA 1D6WA 4FVDA 1GBFA 3A7WA 1OWIA 1SFIA 1KLJH 1SGNE 1CA8B 3M5OA 1GJ5H 1P2JA 1NT1A 1TPAE 1DXPA 1C1WH 1HIAB 1G36A 3TH3H 2PKAB 1J8AA 3LGWA 2ZTXA 3Q3KA 1GHVH 1O3BA 1T8MA 4DVAU 1YP9A 2PR3A 1H4WA 1S6HA 3C1KA 4ISNA 1H9LB 5C5NA 1GBMA 5JYIA 1GHAG 3TIUA 2RA3A 1IQFA 2ZGCA 1OWKA 3RXAA 4DCDA 4Y71A 2VWNA 2QXIA 1HLTH 3EYDA 1W7XH 1Z8IB 5DGJA 1KSNA 3OY6U 4Y76A 4CRDA 2FOEA 2VGCC 4U32A 3O8CA 1GPZA 2B9LA 4WMFA 2R2WU 3BIVH 1XVOA 4FU9A 4YLQH 1EPTA 4K5ZA 1SHYA 1QRWA 3CS7A 2F83A 2PLXA 4OGXA 1QB9A 4H42U 1E36B 3PMJA 4XSKU 4HGCA 4UFEH 1W2KH 1WYKA 1HYLA 5E8EH 2FP7B 2HRVA 4JZFH 3OYPA 4GHQA 1T7CA 4IMZA 4MDSA 1WOFA 3VB5A 3A7ZA 1UVOA 2O8MA 1BTZA 3AW1A 4Q7YA 1TGNA 1L4ZA 4XFQA 3P8NA 1S83A 2QY0B 1IQGA 2VGCB 1GCTB 4Q80A 1O3KA 4BAKB 2RA0A 1ZTLA 1FPHH 2ZG0H 3QO6A 1XVMA 3MWIU 3S9BA 2FMJA 2FESH 1QL7A 1FIWA 5T6FA 2VIVA 2STAE 1AWHB 2A4RA 1ABJH 1RFNA 1C2JA 2PFEA 5L30H 3SI3H 2A2QH 1O5EH 2ZQ2A 4K60A 1HFDA 2SNWA 2QAAA 2XYAA 4SGBE 6CHAB 4NZLA 2R0KA 1W7GH 1BMLA 3KGPA 5FPYA 4OGYA 1P9UA 1KDQA 5DK1A 5LGOA 2UUYA 3TGIE 4U30A 5EW1H 2FOBA 2YOLA 1WTHD 1EJMA 1HAYB 4FUCA 1C2IA 1J17T 1TLDA 3SU5A 1K1MA 1ELCA 2ZPRA 2R3UA 3AAVA 1GHBG 5C3NA 1ESTA 4JYUH 1CA0B 4NG9H 2R2MB 1GHXH 2A7CA 1DLEA 3KCGH 2P95A 1ELVA 2AMPA 1UVUH 1TPPA 4A5TS 1FY1A 3HGNA 1LHGH 1C9TA 1C5ZB 1BRCE 3NK8A 3SQEE 3GDVA 2YNAA 1CHOG 3A7TA 1HCGA 1BBRH 2AIQA 1UTLM 1EASA 5DP4A 2BVSH 2OC0A 5AHGH 2HGTH 1V2JT 4JZIA 1TPOA 2OBOA 1EATA 1H9HE 4KP0A 2ZCHP 1L1GA 3A88A 3GOVB 3QZQA 5T3HA 3S9CA 1X7AC 3LU9B 1XUIA 5E0JA 1DUEA 3SJIA 1BQYA 1V2RT 1RD3B 3KHVA 2BLOA 1EZSC 1GHWH 4WXVA 3F9FA 1BBRK 4BNRA 1DSUA 1JWTA 2THFB 1DPOA 1HJ8A 4X1RU 1CGIE 1ZTJA 4RSPA 4OS6A 4ABBA 3ZYEA 4ESTE 4D7GA 3PWBA 1MZDA 2FOFA 4U2WA 2P16A 4Y79A 3ZVBA 3FP8E 3F6UH 4LK4A 1C5VA 1ZJDA 2ZQ1A 4YZUA 3ZZ7A 4MLFB 1EZUC 5JDUB 1AVWA 1HV7A 5F03A 3QTOH 3G01A 1BT7A 4DW2U 2GZ7A 1T8LA 1PQ8A 3CP7A 1WTGH 1A5GH 3KEEA 3QN7A 1SGYE 3U9AH 3RXVA 3M3SA 1EAUA 1GHAF 1SBWA 1V2ST 1GBAA 2CHAB 1ZMNA 3F68H 1EUFA 3RMMH 3SZNA 1F5RA 2ZCLP 2QN5T 2FYQA 1FN6A 1V2NT 1E38B 1TABE 3I29A 4QT8C 1PJPA 4AX9H 1PPHE 1GBBA 1TNJA 3RC5A 5FX6A 1HAGE 1O2UA 1SGRE 1WSSH 1LQDB 1NRNH 2BQWB 4FUFA 2Z9IA 5ABWA 1TALA 3SUFA 5E2OA 1SI5H 3EAJA 4UD9H 5G4BA 4HTCH 3R3GB 3M3VA 4AYYB 4UDWH 5HM2A 1QQ4A 2Q6GA 1LTOA 3QK1A 1Y3WA 2TIOA 2W7SA 2GT7A 1RRKA 3MO3A 3GY2A 1FZZA 3PYHA 1Y3XA 2FZZA 3UNSA 3N7OA 3RXJA 2G55A 1S6FA 3ZZBA 3KN2A 3TH2H 2C93B 5F6MA 4BOHA 1KXEA 3ODDA 4E7NA 1NU9A 3T25A 4AFZA 1GL1A 3ITIA 2ZHWH 3KQBA 3GY8A 2CMYA 4AOQA 1RIWC 2ZIQH 3MU1A 3LDXH 4YOIA 2P93A 4CREA 4UONA 1TNIA 3L3TA 4MQAA 1ACBE 1C4U2 2O8WA 2J2UA 1C5TA 1O2ZA 2J4IA 1TNHA 1UCYH 2PWXA 1O5CB 1SQTA 1P3CA 3TJVA 1HAPH 1M9UA 2QGRA 3RP2A 4AG2A 1GBLA 1SGFA 2HOBA 2DE8A 3O8BA 1FAKH 1HAZB 3ZZDA 1GDQA 5DPAA 1SGQE 4GVUA 5JBAS 2QXGA 1G9IE 1UCYK 3BEUA 3S0NA 1K1LA 1IQNA 3RXRA 4Y11E 1RIWB 3DFLA 2F9UA 1TX6A 1TRMA 3EQ0H 4O3TA 3LONA 2WYGA 2J38A 1L1NA 3ZZCA 1F92A 1XUKA 3TK6A 1N8OC 2PV9B 1DS2E 1V3XA 2IJOB 4ZKRU 4B73A 5DO4H 4XOJA 1Y3VA 1D3PB 1EX3A 2R9PA 1DX5M 1BTYA 1FXYA 1NFYA 4X0WU 1LKBA 1TA2A 1C4V2 5FPTA 2ODQA 4Y0YE 3GCHB 1CHOF 2OC1A 2JETC 2PTNA 2VVVA 4WXIA 3ZZ9A 2Y6TA 1C5LH 1S0RA 2FPZA 1MBQA 2BX4A 1HJ9A 2GMTB 4IS5A 1V2PT 1VJ9U 2SGEE 1EAWA 1GJCB 1NY22 3NXPA 2BDIA 2Z6BD 4I7YH 4Y8XA 4LXBH 2H9EH 1N8OB 2CXVA 2BQ6B 1LVMA 1NFXA 3T29A 4E7RG 1IQLA 3K65B 1P02A 1ZMJA 3K6YA 3Q3YA 4A1TA 3VEQB 1SQAA 2XXLA 3PTBA 1ANEA 1MD8A 3MI4A 1DWEH 1C1SA 3E8LA 1BCUH 1XMNB 2OC8A 2JETB 4ABDA 1KXAA 1YGCH 3D49H 3MYWA 4O03A 3U1JB 1ANCA 2G81E 1MBMA 2F9NA 3LGVA 4J1YA 1YBWA 3ELAH 3FP7E 1GHZA 1FN8A 2FI3E 8GCHG 4XBDA 2FS8A 5EQQA 2ZGXH 4WMEA 3M7TA 4RN6A 4X8TH 3LPRA 5FXLA 1HAOH 3ENSB 1KXFA 2LIZA 1C4Y2 2DUCA 1O3NA 2VVCA 4SGAE 1P05A 1Q2WA 7GCHG 5JBBS 3H7TA 1P11E 1P2OA 3BIUH 3URCA 1NZQH 1O2VA 3GICB 3ZZ8A 1V2QT 3HKJB 1QJ6B 5JPMH 1AE8H 1QB6A 1C5XB 1LPZB 2GTBA 3RXUA 3VFEA 2Z9LA 1LHCH 3ZVCA 1ZRKA 2CV3A 2HALA 1FY8E 1GDUA 3LH1A 1ELFA 1LMWB 1MTNC 4FUDA 3EE0B 1O35A 2ZFQH 2GCHG 2C3SA 2F9PA 1MQ5A 2ZFFH 1TAWA 1AHTH 2BB4A 2FOHA 3BTEE 1O2LA 1C2LA 2A5KA 4ABFA 3SGBE 1O3HA 2VH0A 1ETSH 2Q6FA 4A7IB 3MNCA 1IQHA 1GMDG 1TQ0B 5IYTA 4JCNA 1O2GH 3RXFA 2O8UA 1O3EA 1MZAA 1KYNA 4Y8ZA 1EJAA 2P59A 3E16B 2BD3A 1QBNA 1TOCB 2ZCKP 1DUAA 3V7TA 5A0AE 1G3CA 5FHTA 1HAVA 1O37A 2XTTB 1RTLA 3A89A 2CF9H 4BAOB 5E0HA 3UOPA 4ABJA 4MVNA 3SQHE 2BD8A 3L6PA 4MPWA 3UPEA 4AFSA 2FI5E 1ARCA 1Y3YA 1Z1JA 4ABAA 2BDGA 3W94A 4HI3A 4AORA 3IG6B 1C1QA 3UY9A 1HDTH 1O3JA 1AD8H 1S84A 2XC0A 1C5SA 2JKHA 1O2IA 1SB1H 3LGTA 1GI7B 3RDZA 1WV7H 3QLPH 1NRPH 1XM1A 2Y5GA 1CSOE 2BD5A 3SV8A 3UWIA 2A0QB 1K21H 2AYWA 2Y5HA 4YOJA 2FXRA 1UTMA 2QF3A 2VH6A 3UR6A 3U69H 3U8TH 2ZHQH 4VGCB 1DSTA 1P10A 2NU3E 1QFKH 3BSQA 1RXPA 3OSYA 3ZVAA 4X8SH 4TWWA 1DM4B 4FU8A 4GPGA 5DKMA 2ANMH 3QX5H 2ZDAH 3GDUA 1O2OA 1A2CH 2VINA 1V2UT 2O9QA 1YPEH 4A1XA 1W14U 1HIAA 5C2ZA 3U8RH 2PKAA 4A6LA 1C1TA 1AZZA 5ESTE 1BTPA 1O2JA 3TJNA 3PMAB 3SNEA 4NCYA 1C1OA 1THSH 1TGCA 4GSOA 4MG3A 2ZU2A 1GBEA 1QBOA 1MH0A 4XBBA 1K1OA 1PPBH 2BDBA 2Q6DA 2WPKS 2A4GA 4ZMAH 2VJ1A 1N6YA 1PPGE 3PROA 4FUEA 1SQOA 2BDCA 3VGCB 5A2MH 4ISOA 3SJOA 3MH6A 1GMHG 1ELDE 4HZHA 3BF6H 1CGJE 1L2EA 6ESTA 3UTUH 3RXTA 1ZYOA 1ZHPA 4YT6H 5EODA 3SU6A 1AFQB 2ZEBA 4M7GA 4CRGA 1PYTC 1ZJKA 4X8UH 3SHCH 1A46H 1C1PA 2ALPA 8GCHF 2AMQA 1LHDH 5DP3A 3UNQA 3SV9A 1A5HA 2AGIX 2XCNA 5A0BA 1IQJA 4D9RA 1MKWK 1MTVA 3A81A 2UUFB 2A45B 2QF0A 1BB0B 3SORA 3D65E 3A87A 1DWCH 1GCTC 3BG8A 1A4WH 7GCHF 1U6QA 3DT0H 1P2KA 4YESB 3EA9A 3P8FA 1UJ1A 2W3KA 4MPUA 1DICA 3SNDA 1IQEA 1C2MA 1DVAH 4AFQA 1KTTB 1MCTA 1JRTA 1ZHMA 2BDYA 3LGYA 5B6OA 2VIPA 2PGQB 5C1YA 3V13A 2UUJB 2PHBA 4NA8A 3W95A 2TGTA 4NIVA 1SLVB 3LJOA 5GJ4B 1C1MA 1P8VC 1YCPH 2XBWA 1O3DA 3QGJA 2GCHF 3OTJE 1FUJA 2AGGX 1YM0A 9ESTA 3QWCH 1RGQA 1H1BA 2ZPQA 3VB4A 3O8RA 2H5CA 6CHAC 2BD7A 2OD3B 1C1RA 1BHXF 1MMJN 1RTKA 4NA7A 1ESAA 1B7XB 1AN1E 1YCPK 1THRH 3NZIA 3ATIA 1Z7KA 5J4SA 2AH4X 4ISIH 3VXEH 1VITH 1XXFA 3TNSA 1CA0C 2W7UA 1SOTA 1EB1H 1N1LA 2SNVA 3ATLA 2BLWA 2GVFA 2C90B 2C8XB 4WF8A 1GI3A 1C5RA 6GCHG 1GVLA 3MNSA 1Z8RA 1YCPM 4ZKOU 2C4FH 4Y7AA 1OP0A 3UWJH 4I33A 2K7XA 1BITA 2ZC9H 3D23A 1WQVH 5I25A 3B23B 3DHKH 2VU8E 1QB1A 4YOGA 4DOQA 2BDHA 1AUJA 1L4DA 2QYIA 3HK6B 1TE0A 2A7JA 1O5AB 2FDAA 1Y5BT 1LDTT 2Z3DA 1BTHH 2BZ6H 2EI7A 4RKOB 3UREA 2BVRH 4YT7H 4GCHG 4YO9A 1TMBH 2SGPE 1Y3UA
chains in the Genus database with same CATH superfamily
2EC9H 1ZZZA 3RC4A 5T6GA 1AB9C 1IHTH 2BD2A 2ZDVH 3PLBA 1ETRH 1YYY1 2XOKD 3DSOA 8KME2 1CT2E 1TOMH 2EA3A 1IQIA 4Z0KA 2XC4A 1Y59T 1PQ5A 2Y80A 3MHWU 4RT0A 3SUDA 1T32A 3LJJA 3P17H 4MNYA 2XBXA 1EJNA 4DT7B 1VZQH 5EXMA 1P0SH 4Y8YA 1O34A 2NU0E 1UTPA 2XWBI 2CHAC 5B6LA 1KDQB 1P2MA 1AO5A 2XBVA 3RXHA 2C8YB 1UVSH 3BTQE 3LGUA 2UWPA 3OX7U 1AB9B 4TY6A 4MTBA 5LH8A 2SGAA 4U01A 1XUHA 1GMHF 2IPQX 2FODA 1YPLH 5BRRE 1GJ6A 4OS4A 4NIYA 3T2NA 1AKSA 3QDZB 1D3QB 1DY9A 4Y0ZE 2JH0D 1OWDA 3ZVDA 3GCOA 3TNTA 1HJAC 2ZU1A 5A8ZA 5PTPA 1GG6B 1T8NA 1OP2A 1O3PB 3UQOA 1FAXA 4M9FA 2Z9GA 1NRSH 4B71A 3GCTG 1OWHA 1MU8B 4UEHH 1C2KA 5LPEA 4F49A 2ZZUH 1OHHD 2QE7D 5EGMA 2L74A 1RJXB 1WBGB 5GIBA 1QGFA 5DP7A 4B6FA 3FFGA 3RLWH 1XX9A 2HLCA 3M7QA 3QGNB 2FWWA 4X6PA 3F9EA 1KLIH 3UQVA 2WPMS 1BUIA 3OEHD 3A83A 2GGVB 1GI9B 3SU4A 4XE4A 2WUBA 2H9TH 1UK3A 1YLCA 2AGEX 2HVYB 1DWBH 1O3AA 2J5UA 1A1RA 1HJAB 2ZGBH 2ALVA 4X1SU 3S7KB 1ANDA 4I32A 4AYVB 2A4QA 1MQ6A 5J4QA 3AW0A 1THPB 3SU0A 1CVWH 2QCYA 3LC5A 4P02A 4MNVA 3RXDA 1BMNH 5C1XA 2VVUA 1FLEE 4CBNA 3E1XB 2BVXH 2VIOA 3CENA 4MNWA 3RU4T 4ZH8A 4K8YA 1AFEH 1AY6H 3U1IB 1O2TA 5DG6A 1GHYH 3RXKA 4OS5A 2G51A 1NO9H 1OYQA 1BTXA 1PPEE 1AGJA 3SU3A 5AVDA 2ZDMA 1UHBB 1UK4A 5CDFE 1JMOH 4K1EA 1F5LA 3F1SB 4NFFA 1ELGA 1RTFB 1HXFH 5CMXH 4DG4A 4CH8B 1UVTH 3WY8A 1GI0A 3A8BA 3PWCA 4PROA 1TWXB 4ABEA 3SNCA 5GXPA 2ZDKA 3ZVEA 3MNXA 4K2YA 1YLDA 1O2NA 2F3CE 3RM0H 1D4PB 1T4UH 1XUJA 3RM2H 2Z3EA 1IQMA 4KGAA 2UUKB 2ZO3H 5A0CA 1JXPA 3OU0A 2VIQA 2ZP0H 1YPMH 1GI6A 1QRXA 2TRMA 4XD7D 1HAXB 3P8OA 2RCEA 2QF4A 2NWNA 3PTNA 1QA0A 3ZZ6A 1Z71A 1B0FA 4AFUA 3GCHC 2LELA 3SNBA 2AEIH 2B8OH 2WPHS 3K2UA 1TMTH 2ZGJA 2O8LA 3BG4B 2GMTC 1P9SA 1GBIA 1AZ8A 3A8AA 1ID5H 1SGEE 3ZVFA 1O2KA 1BRUP 1CT0E 2R0LA 3EA8A 3PO1B 1E79D 1GVZA 1YLNA 2ESTE 3PM3A 4GCHF 3RXSA 2AHME 1ZGVA 3A85A 1OXGA 2KM0A 1GHBF 1H9IE 2BXUH 3T62A 4I31A 2VIDA 4ZROA 1F7ZA 2KZ4A 2WSSD 3BTME 3MFJA 3MH5A 2KCPA 3SGQE 3RXCA 1LKAA 3C27B 3MU8A 3JZ2B 2ULLA 1W0YH 2C8WB 3RUOA 2P3UB 5T6DA 4MNXA 2BY5X 2G5VA 5EQRA 1O2HA 1XKBC 2EI8A 4AGJA 2IOTA 4BXWA 1GL0E 5EJZA 5C0UA 1EOJA 4UFFH 1WCZA 3RXEA 2PGBB 1G3DA 1A3BH 2XC5A 2GD4B 1HAHH 3HGPA 3MO6A 1OWJA 2W26A 1JRSA 2D1JA 2GT8A 4Q7XA 2FI4E 4B75A 4CR5A 2WPJS 1O2PA 1SFQB 3KF2A 4X6OA 1Z6JH 2G4TA 4X2VA 1P12E 1FY4A 1ZOMA 3FVFB 3U8OH 4ASHA 2VB0A 1A61H 3RMLH 2NU4E 1F2SE 4I8JA 1UTQA 4WVPE 1TBRH 4B74A 2J98B 2F4LA 4YXWD 3B8JA 5EPYA 3RLYH 1CQQA 3Q77A 4H6SB 3P6ZB 4ZXXH 3GISB 4FVBA 1PYTD 4JK5A 1C5NH 1GI1A 4E06H 2JIZD 1ELTA 4IC5A 1K22H 1SSXA 4IBLH 5C94A 3VB3A 3UOUA 2WHXA 1C5QA 2B5TB 2WV4A 2G5NA 1CGHA 3GCTF 2IPHA 1FIZA 1TRNA 1LVBA 1G3EA 2ZFRH 2H1UA 1Z1IA 1DOJA 1ZSJA 2VNTA 1HBTH 3GY7A 3AVZA 1DT2A 1P2QA 4Y10E 1DFPA 1OYTH 4B6EA 2VWMA 3RXMA 2F9BH 1P2NA 3ZZ5A 1VITG 1CU1A 1ORFA 2Z7FE 4X1QU 5AFYH 1BOQA 2AFQB 5TJXA 1ZRBA 4K8BA 1NRQH 3BEFB 2C8ZB 1OS8A 2B7DH 3RC6A 2VBCA 4XBCA 1INCA 1B0EA 1C1VH 3GY5A 2BQ7B 5F53A 5HGGA 4YTAA 1ZSLA 3CNRA 1TGBA 3NCLA 4X6MA 5T1VA 1E34B 2ZHEH 3D62A 2HLDD 1ZLRA 3GYLB 1ZR0A 1CBWC 2AIPA 3SHAH 4FU7A 1A5IA 4KTCA 5TCCA 2GV6A 4X8VH 3BN9A 1T4VH 2EY4C 3BTGE 1KXCA 3TK9A 3GDSA 4X2XA 3T28A 2OBQA 4BTUB 1P03A 1ZPZA 3SGAE 3V12A 3SU1A 1QA7A 3MU0A 1AQ7A 1YPJH 2QXJA 4I8HA 2V3OH 1W0ZU 5HIZA 1C5PA 1GJAB 3M3TA 2ZF0H 1O5DH 3DSGA 1XUGA 1WUNH 4IW4E 2AS9A 4H6TA 4K1SA 4E05H 1G30B 4NGAH 1MCVA 3N99A 2KR7A 2YMSB 1TNGA 2CN0H 1TX8A 3S7HB 2A5IA 1CBWB 3WWFA 5DP8A 4VGCC 2ZU4A 5C5OA 3UR9A 1EFRD 2H6MA 1GJ4H 1G2LA 2A5AA 4ZUHA 2I6QA 1SPJA 2KCAA 1HB0B 1K1NA 2A31A 3MNBA 2NU1E 4AB8A 3OTPA 3ZVGA 1OPHB 4INLA 3SU2A 1FX0B 3PMBB 2BY9X 2GCTC 3M35A 3Q76A 5A09A 4CRAA 3RXIA 2KAIA 3SJKA 4FUBA 2BXTH 3QTVH 1EXFA 1O5BB 3MH7A 1H8IH 2V6NA 2G8TA 2PUXB 4OS1A 3UAIC 2JJ2D 2WV9A 1VCQA 3EGKH 2F91A 1MU6B 2FLBH 1MTSA 1O3MA 1PPFE 3VGCC 1KIGH 1XXDA 5LPRA 2ZA5A 1O39A 3GY6A 3SJ8A 1HAIH 5K7RA 1UTOA 2OC7A 3A8CA 3BTFE 3N7EA 4D9QA 1IOEA 3HPTB 1W12U 2H5DA 2K0QA 3NRLA 4B2BA 2UWLA 1SMFE 2P8OC 2PTCE 4UFDH 5F8TA 3UIRA 1HAVB 1NESE 1OKXA 1AFQC 4BANB 1GI4A 2GCTB 1WQSA 1ZGIA 2GDDA 5KECA 3VXFH 4MPVA 3SV6A 2BLQA 1IAUA 4JMYA 1JIRA 2AERH 5HYOA 1NS3A 2JJ1D 4DGJA 5CE1A 2V0BA 4NSVA 1A3EH 1MABB 5FX5A 1UVPA 4YLUA 3O8DA 3NPSA 2FS9A 3URDA 2LPRA 1QURH 2H9HA 2FO9A 2ZU3A 3AK5A 1D3DB 4UFGH 5C0TA 1TX7A 4I8KA 1MKWH 1TNLA 2TBSA 1QTFA 1ZTKA 2P8OB 3F0PA 3HATH 3CS0A 1C2HA 2SFAA 2A32A 1EP6A 5C67A 1IQKA 1OX1A 3MH4A 1FMGA 4B2CA 1V6DA 3E90B 2WYJA 3SN8A 1QNJA 5FBEA 1P06A 5A8XA 1J16A 3RMOH 1SGTA 2WV5A 5DP5A 5JBCS 1AWFH 3SW2B 5SGAE 3ZYDA 2HNTC 3RXQA 1ZPCA 1GJDB 1EQ9A 3K6ZA 3TU7H 1QHRB 3K9XB 4INKA 1S5SA 1JIMA 4KTSA 3KQ5A 2GKVE 3MO9A 1VITF 4X1PU 4OS2A 6LPRA 1Z6EA 3SUGA 4A1VA 5HXFA 3A84A 2XCFA 5L2YH 2HPPH 2J34A 1WAYB 5H4IB 2WPLS 2XWAA 1S82A 1P57B 4FUGA 3ATMA 2BY7X 4DIIH 1C5MD 2UWOA 3DCLA 4D76A 1F0UA 3ODFA 1C5OH 1GMCG 3E6PH 4NWKA 2FTMA 3SBKA 2FIRH 1PPCE 1EPTC 2L6OA 1BIOA 3STIA 4AB9A 4INHA 4O97A 3LT3A 4IGDA 2STBE 1EOLA 1LHEH 1QL8A 2V3HH 4Y7BA 1O5GH 1H8DH 4O9VA 2BTCE 3TJUA 4TPIZ 1O3OA 1V2VT 1EZXC 1K1JA 1G37A 1QJ7B 1C5UA 3RXBA 1ZPBA 2HWLB 2AMDA 1GMDF 1NRRH 3LKWA 1TIOA 1XUFA 1FI8A 2GX4A 1BBRE 3M7UA 4H4FA 3SUEA 3FP6E 1T31A 3GYMA 5DP6A 3PV5A 4RKJB 3U98H 2PKSC 2OUAA 1NC6A 1EPTB 2IN2A 1QRZA 5FCKA 4RI0A 2GDEH 2BMGB 4JK6A 1S6LA 2BOHB 5EPNA 3A86A 3MTYA 4Q7ZA 2RDLA 3SYJA 5DJ7A 2XW9A 1C2EA 4D7FA 2SGDE 2W5EA 3ZZ4A 1GJ8B 1DLKB 1CO7E 2RG3A 4KELA 5BPEA 2BM2A 2ZNKH 4BAMB 4TY7A 2CGAA 3TLOA 4FUIA 2PKSB 2XNIA 1SHHB 2PSYA 3BTDE 1C5YB 1BTWA 5L6NH 2JH5D 2M2AA 5HM9A 1BDAA 1A7SA 1C9PA 1FDPA 2GZ8A 3LH3A 1HRTH 5F8ZA 3A80A 1C2GA 2V35A 4NIWA 4ZHLU 4LZ1H 2CJIA 2PUQH 2TPIZ 1OWEA 3E0PB 2ZFSA 2SGQE 3RU4E 4WY3A 1AIXH 4FUJA 1H8ED 1L1JA 1K0HA 4A92A 1DWDH 2ANKH 4BTTB 1GG6C 5GNDA 4ZCNA 1MD7A 5LPFA 1QCPA 3A7YA 1AE5A 1O30A 2ZPSA 3NKKA 2BHGA 3ATKA 5GCHG 3M61U 1S81A 2OLGA 4ZHAA 4I8GA 2BLVA 1O38A 3LIWA 1DITH 1OOKB 4B1TA 3MMGA 3TH4H 4AGKA 5C17A 1BJUA 2HVXA 1MUEB 1C2FA 1W8BH 2K1QA 1PQAA 2P3FH 1EAXA 4IC6A 3M37A 2Y7ZA 2OCVB 2KX4A 1S85A 2FOGA 1EAIA 2ZGHA 1V2WT 1W0JD 1H8HD 2M5TA 3S9AA 1O31A 4OS7A 4AG1A 1O2SA 1GGDC 3HK3B 3F2GA 1O3GA 3P8GA 3STJA 4YM9A 3LGIA 1NM6A 4BTIB 3P70B 4IMQA 5F8XA 1TONA 2OP9A 5EG4A 2SGFE 4JZDH 5HKKD 1BMMH 3SJ9A 1KY9A 3KIDU 3AASA 3FANA 2V7QD 1FY3A 1O0DH 2BX3A 4GLYA 1GDNA 1ELBA 1ZHRA 2P94A 5DP9A 5FAHA 1SGPE 3S69A 2NU2E 3GY4A 2QV1A 3PV4A 4Q2KA 1MKXH 4RT1A 1NROH 1QIXB 1UCYE 4JZEH 1O2QA 3OY5U 3PLKA 1EKBB 3DD2H 4WMDA 1Z8GA 1ELEE 2EEKA 2XBYA 3NUMA 1MTUA 3P92A 4GAWA 4ACAA 3ATWA 3F9GA 4CBOA 4DJZB 2FX4A 1O2MA 3MU5A 3DFJA 3BTKE 7ESTE 2OK5A 3KL6A 1GGDB 1SR5C 2Y82A 1UHBA 3TGKE 1SLWB 1LCYA 1SLXB 2OQUA 1MKXK 1FPCH 4LZ4B 4ZHMU 3M5LA 1CHGA 2BZAA 3JZ1B 3SV7A 2TGAA 1DY8A 4XDEA 1AKSB 4ACBA 1PQ7A 1GMCF 1TGSZ 4HFPB 3TK5A 3FOAA 3TGJE 1C1UH 3KQCA 5FL7D 3A82A 1MAXA 2Y81A 4WH6A 3RXPA 1KXDA 2OTVA 2G4UA 3RXLA 1NTPA 4HG6A 1V2OT 2J95A 2Z9JA 1MTWA 5DSFA 5TCAA 5EIYA 2HPQH 2A2XH 2QA9E 3Q3XA 4K3JA 7KMEH 1YC0A 1E0FD 2PW8H 1O3FA 4AN7A 3P95A 3BG4C 1ARBA 2BYAX 1UTNA 3RU4D 2HNTE 4Q4LA 5IDKA 2GV7A 4MPXA 3ZV8A 3H5CB 1QQUA 2ZTZA 3PO1C 4THNH 1UK2A 1QJ1B 1YPHC 1F0RA 2HNTF 3E3TA 5EW2H 5FPSA 1TRYA 4CRCA 2VIWA 1FV9A 4DURA 5ETXA 3LC3A 1XKAC 4AZ2B 2J92A 3B9FH 3UB0A 3FO8D 1NPMA 1GI8B 3T26A 4CH2B 1TQ7B 6GCHF 4TPYA 2XNDD 2D8WA 1DDJA 1QR3E 1BRAA 1BRBE 4UE7H 5FCRA 1BJVA 1P2IA 1BZXE 1E37B 4ABGA 5I46H 1CE5A 3FN8A 7LPRA 1GI2A 1SQRA 1FONA 4CR9A 1HNEE 2W3IA 5C20A 1K1PA 1TMUH 3LOXA 1LO6A 2Y5FA 4NZQA 2OQ5A 1AU8A 4DIHH 2VWLA 4B2AA 1P3EA 2CF8H 1EZQA 2V3MA 1O3CA 4ZXYH 1KTSB 4FUHA 4WH8A 1KXBA 2FLRH 3UUZA 2ZFPH 1LPGB 1T8OA 1UMAH 2FOMB 4WJG2 1Q31A 1SC8U 3ZZ3A 3SOSA 2BD4A 2O8TA 8ESTE 3KNXA 4BXSA 2ZKSA 1FNIA 1GBCA 3BTHE 1C1NA 1RS0A 4ABIA 1C5WB 2A1DB 5EU8A 2J98A 1VCWA 1GJ7B 4O3UA 2BDAA 2G52A 4NIXA 2ILNA 1SOZA 3EA7A 5GCHF 1WU1A 4FOUC 3ZV9A 2RFKC 2YNBA 2ANYA 2BY8X 5CHAC 1GBDA 4LOYH 4ZAEA 1G3BA 1FJSA 2BOKA 2FEQH 2QXHA 4X2WA 4NFEA 5GPIB 3A7VA 2OXSA 1V2LT 2FOAA 2Y7XA 2ZU5A 1SGFG 3ZZAA 1DXWA 1O2WA 3Q00A 4ABHA 3KYFA 2D2DA 1N6XA 1QBVH 2TGDA 1FQ3A 1O32A 1ABIH 1J15A 2ANWA 2ZDLA 1VJAU 4BAQB 1ESBA 1Y5AT 3BTTE 1P01A 1F5KU 1K2I1 1NU7B 3BV9B 3GY3A 3OFND 2PSXA 1BMAA 4D8NA 1EB2A 1K28D 1C2DA 1GBKA 1GBHA 2F9OA 1W13U 4I8LA 5JBTA 3PMHB 2A7HA 3VB7A 1GJ9B 3FAOA 5JB9S 3TITA 1O33A 3EDXB 5CHBA 1VCPA 1GVKB 5EXNA 1GBJA 5CHAB 5E2PA 1S0QA 1A0LA 1D6RA 2GP9B 1B5GH 1VGCC 3SNAA 1OP8A 2RDEA 8LPRA 4OM9A 4CRFA 3E91A 2R3YA 4NA9H 2WUCA 1GI5A 1JBUH 3VB6A 1AVGH 2OINA 1V2TT 3E0NB 4CHAC 4Z6AH 1W11U 2J9NA 2ODPA 3BTWE 1V2MT 2TGPZ 3FZDA 1QY6A 3H7OA 1FY5A 1O2RA 3PB1E 4KTUA 1QL9A 1J9CH 3V0XA 5C1UA 2YMSC 1SG8B 4JYVH 1TNKA 4IN1A 4TYDA 1SGDE 1AUTC 1GWAA 2WINI 3SI4H 1SVPA 4X1NU 5HMAA 1HUTH 3EBNA 2WPDD 4DT4A 1F0SA 4ISHH 1VGCB 2Z3CA 2FM2A 1HPGA 2Z94A 5AFZH 1O2XA 1SGCA 1BTUA 1BHXB 5EQSA 1Y5UT 1A0HB 1L0ZA 3IITA 5ESBA 1LPKB 3N7DA 4ISLA 2ZFTA 2ZHFH 3DUXH 3PV2A 4GUXA 5GDSH 2ZHDA 4K1TA 3PLPA 4CHAB 2BD9A 1F0TA 1GJBB 4JZ1A 1HXEH 3MU4A 5EJLA 2FTLE 1W10U 1Q3XA 1K9OE 4TWYA 1ELAA 1LHFH 3BEIB 1SL3A 1ANBA 3I78A 1YF4A 2GZ9A 2Q1JA 1TBQH 1AMHA 1OSSA 2JH6D 1BA8B 3F0OA 4DY7B 1TA6A 9LPRA 3TJOA 4ZKNU 2ZDNA 3HKIB 1O3LA 2G00A 3SV2H 5EOKA 5FBIA 1D9IA 2FX6A 1ZMLA 3RMNH 3QZRA 3T5FH 1UO6A 3V3MA 1AVXA 2LP6A 4F4OC 2WPIS 5E0GA 5GWZA 5AF9H 1Z8JB 4ZKSU 1YPGH 1O2YA 3M5MA 4J2YB 3M36A 1A0JA 1LVYA 4X2YA 3QUMP 1MTNB 3IWMA 1SLUB 3UNRA 2ZECA 3SO3A 2A4OA 3F9HA 1V2KT 1PPZA 1IHSH 1ZSKA 1LQEA 3KQDA 4K69A 2EI6A 2XRCA 1D3TB 1W3CA 3DA9B 5JB8S 1TB6H 3OE7D 1PFXC 1UTJA 4Y6DA 5EXLA 1DE7H 4FXGH 1TGTA 1TPSA 3ESTA 2J94A 1TYNA 3M5NA 3R0FA 1E35B 3VPKA 1G32B 2ZI2H 2ODYB 1P04A 1P09A 1KLTA 1O3IA 3A7XA 1YKTA 1J14A 3RXOA 3L33A 5K0HA 2QC2A 2QIQA 2Z9KA 1YPHE 2LNCA 4XRNA 3UFAA 1G2MA 1TBZH 1K1IA 2BY6X 1AI8H 1UTKA 1EP5A 5L2ZH 2ZTYA 1ETTH 2DE9A 3NWUA 1TFXA 2D26C 1YPKH 4X6NA 3TPIZ 1O5FH 2FYRA 3AAUA 3I77A 4IN2A 1LVOA 3DSPA 1SGIB 1DANH 4Q63A 2I6SA 2B0FA 3KQEA 1CT4E 2FOCA 4B76A 4CRBA 1NN6A 1VR1H 2KAIB 4WWYA 3RXGA 1O36A 3FZZA 1Y8TA 1JOUB 3MOCA 4KKDA 1GBTA 3A8DA 2KCOA 2P3TB 1NFUA 4GHTA 4JYTA 3GCNA 4BAHB 4R0IA 1NFWA 2F9VA 2ASUB 4R8TB 4NSYA 3TVJB 3OEED 1GCDA 1MAYA 2ZWLH 3T27A 2VWOA 5A8YA 1HGTH 4NWLA 2H2ZA 1D6WA 3WWBA 4FVDA 1GBFA 3A7WA 4ASUD 1OWIA 1SFIA 1KLJH 1SGNE 1CA8B 3M5OA 1GJ5H 1P2JA 1NT1A 1TPAE 1DXPA 1C1WH 1HIAB 1G36A 3TH3H 2PKAB 2KCYA 1J8AA 3LGWA 2ZTXA 3Q3KA 1GHVH 1O3BA 1T8MA 4DVAU 1YP9A 2PR3A 1H4WA 1S6HA 3C1KA 4ISNA 1H9LB 5C5NA 1GBMA 5JYIA 1GHAG 3TIUA 2RA3A 1IQFA 2ZGCA 1OWKA 3RXAA 4DCDA 4Y71A 2VWNA 2QXIA 1HLTH 3EYDA 1W7XH 1Z8IB 5DGJA 1KSNA 3OY6U 4Y76A 4CRDA 2FOEA 2VGCC 4U32A 3O8CA 1GPZA 5KGOA 2B9LA 4WMFA 2R2WU 3BIVH 1XVOA 4FU9A 4YLQH 1EPTA 4K5ZA 1SHYA 1QRWA 3CS7A 2F83A 2PLXA 4OGXA 1QB9A 4H42U 1E36B 3PMJA 4XSKU 4HGCA 4UFEH 1W2KH 1WYKA 1HYLA 5E8EH 2FP7B 2HRVA 2CK3D 4JZFH 2GJGA 3F2FA 3OYPA 4GHQA 1T7CA 4IMZA 4MDSA 1WOFA 3VB5A 3A7ZA 1UVOA 2O8MA 1BTZA 3AW1A 4Q7YA 1TGNA 1L4ZA 4XFQA 3P8NA 1S83A 2QY0B 1IQGA 3WW7A 2VGCB 1GCTB 4Q80A 1O3KA 2JDID 4BAKB 2RA0A 1ZTLA 1FPHH 2ZG0H 3QO6A 1XVMA 3MWIU 3S9BA 2FMJA 2FESH 1BMFD 1QL7A 4F48B 1FIWA 5T6FA 2VIVA 4P00A 2STAE 1AWHB 1VKYA 2A4RA 1ABJH 1RFNA 1C2JA 2PFEA 5L30H 3SI3H 2A2QH 1O5EH 2ZQ2A 4K60A 1HFDA 2SNWA 2QAAA 2XYAA 3KYGA 4SGBE 6CHAB 4NZLA 2R0KA 1W7GH 1BMLA 3KGPA 5FPYA 4OGYA 1P9UA 1KDQA 5DK1A 5LGOA 2UUYA 3TGIE 4U30A 5EW1H 2FOBA 2YOLA 1WTHD 1EJMA 1HAYB 4FUCA 1C2IA 1J17T 1TLDA 3SU5A 1K1MA 1ELCA 2ZPRA 2IJD1 2R3UA 3AAVA 1GHBG 5C3NA 1ESTA 4JYUH 1CA0B 4NG9H 2R2MB 1GHXH 2A7CA 1DLEA 3KCGH 2P95A 1ELVA 2AMPA 1UVUH 1TPPA 4A5TS 1FY1A 3HGNA 1LHGH 1C9TA 1C5ZB 1BRCE 3NK8A 3SQEE 3GDVA 2YNAA 1CHOG 3A7TA 1HCGA 1BBRH 2AIQA 1UTLM 1EASA 5DP4A 2BVSH 2OC0A 5AHGH 2HGTH 1V2JT 4JZIA 1TPOA 2OBOA 1EATA 1H9HE 4KP0A 2ZCHP 1L1GA 3A88A 3GOVB 3QZQA 5T3HA 3S9CA 1X7AC 2K8IA 3LU9B 1XUIA 5E0JA 1DUEA 3SJIA 1BQYA 1V2RT 1RD3B 3KHVA 2BLOA 1EZSC 1GHWH 4WXVA 3F9FA 1BBRK 4BNRA 1DSUA 1JWTA 2THFB 1DPOA 1HJ8A 4X1RU 1CGIE 1ZTJA 4RSPA 4OS6A 4ABBA 3ZYEA 4ESTE 4Z1MD 4D7GA 3PWBA 1MZDA 2FOFA 4U2WA 2P16A 4Y79A 3ZVBA 3FP8E 3F6UH 4LK4A 1C5VA 1ZJDA 2ZQ1A 4YZUA 3ZZ7A 4MLFB 1EZUC 3ZIAD 2EQNA 5JDUB 1AVWA 1HV7A 5F03A 3QTOH 3G01A 1BT7A 4DW2U 2GZ7A 1T8LA 1PQ8A 3CP7A 1WTGH 1A5GH 3KEEA 3QN7A 1SGYE 3U9AH 3RXVA 3M3SA 1EAUA 1GHAF 1SBWA 1V2ST 1GBAA 2CHAB 1ZMNA 4AC9A 3F68H 1EUFA 3RMMH 3SZNA 1F5RA 2ZCLP 2QN5T 2FYQA 1FN6A 1V2NT 2YMSD 3U28C 1E38B 1TABE 3I29A 4QT8C 1PJPA 4AX9H 1PPHE 1GBBA 1WXRA 1TNJA 3RC5A 5FX6A 1HAGE 1O2UA 1SGRE 1WSSH 1LQDB 1NRNH 2BQWB 4FUFA 2Z9IA 5ABWA 1TALA 3SUFA 1E1QD 5E2OA 1SI5H 3EAJA 4UD9H 5G4BA 4HTCH 3R3GB 3M3VA 4AYYB 4UDWH 5HM2A 5DN6D 1QQ4A 2Q6GA 1LTOA 3QK1A 1Y3WA 2TIOA 2W7SA 2GT7A 1RRKA 3MO3A 3GY2A 1FZZA 3PYHA 1Y3XA 2FZZA 3UNSA 3N7OA 3RXJA 2G55A 1S6FA 2J97A 3ZZBA 3KN2A 3TH2H 2C93B 5F6MA 4BOHA 1KXEA 3ODDA 4E7NA 1NU9A 3T25A 4FETA 4AFZA 1GL1A 3ITIA 2ZHWH 3KQBA 3GY8A 3W1EA 2CMYA 4AOQA 1RIWC 2ZIQH 3MU1A 3LDXH 4YOIA 2P93A 1WDIA 4CREA 4UONA 1TNIA 1W0KD 3L3TA 4MQAA 1ACBE 1C4U2 2O8WA 2J2UA 1C5TA 1O2ZA 2J4IA 1TNHA 1UCYH 2PWXA 1O5CB 1SQTA 1P3CA 3TJVA 1HAPH 1M9UA 3PRDA 2QGRA 3RP2A 4AG2A 1GBLA 1SGFA 2HOBA 2DE8A 3O8BA 1FAKH 1HAZB 3ZZDA 5EJ1A 1GDQA 5DPAA 1SGQE 4GVUA 5JBAS 2QXGA 1G9IE 1UCYK 3BEUA 3S0NA 1E1RD 1K1LA 1IQNA 4I86A 3RXRA 4Y11E 1RIWB 3DFLA 2F9UA 1TX6A 1TRMA 3OAAD 3EQ0H 4O3TA 3LONA 2WYGA 3PRBA 2J38A 1L1NA 3ZZCA 1F92A 1XUKA 3TK6A 1N8OC 2PV9B 2WZQA 1DS2E 1V3XA 2IJOB 5KEDA 4ZKRU 4B73A 5DO4H 4XOJA 1Y3VA 1D3PB 1EX3A 2R9PA 1DX5M 1BTYA 1FXYA 1NFYA 4X0WU 1LKBA 1TA2A 3EE7A 1C4V2 3F2HA 5FPTA 2ODQA 4Y0YE 3GCHB 1CHOF 2OC1A 2JETC 2PTNA 1SKYE 2VVVA 4WXIA 3ZZ9A 2Y6TA 1C5LH 1S0RA 2FPZA 1MBQA 2BX4A 1HJ9A 2GMTB 4IS5A 1V2PT 1VJ9U 2SGEE 1EAWA 1GJCB 1NY22 3NXPA 2BDIA 2Z6BD 4I7YH 4Y8XA 4LXBH 2H9EH 1N8OB 2CXVA 2BQ6B 1LVMA 1NFXA 3T29A 4E7RG 1IQLA 3K65B 1P02A 1ZMJA 3K6YA 3Q3YA 4TSFD 4A1TA 3VEQB 1SQAA 2XXLA 3PTBA 1ANEA 2PP6A 1MD8A 3MI4A 1DWEH 1C1SA 3E8LA 1BCUH 1XMNB 2OC8A 2JETB 4ABDA 1KXAA 1YY3A 1YGCH 3D49H 3MYWA 4O03A 3U1JB 1ANCA 2G81E 1MBMA 2F9NA 3LGVA 4J1YA 1YBWA 3ELAH 3FP7E 1GHZA 1FN8A 2FI3E 8GCHG 4XBDA 2FS8A 5EQQA 2ZGXH 2W6ID 4WMEA 3M7TA 4RN6A 4X8TH 3LPRA 5FXLA 1HAOH 3ENSB 1KXFA 2LIZA 1QZ8A 1KMHB 1C4Y2 2DUCA 1O3NA 2VVCA 4SGAE 1P05A 1Q2WA 7GCHG 5JBBS 3H7TA 1P11E 1P2OA 3BIUH 3URCA 1NZQH 1O2VA 3GICB 2QF5A 3ZZ8A 1V2QT 3HKJB 1QJ6B 5JPMH 1AE8H 1QB6A 1UW7A 1C5XB 1LPZB 2GTBA 3RXUA 3VFEA 2Z9LA 1LHCH 3ZVCA 1ZRKA 2CV3A 2HALA 1FY8E 1GDUA 3LH1A 1ELFA 1LMWB 1MTNC 4FUDA 3EE0B 1O35A 2ZFQH 5HIYA 2GCHG 2C3SA 2F9PA 1MQ5A 2ZFFH 1TAWA 1AHTH 2BB4A 2FOHA 3BTEE 1O2LA 1C2LA 2A5KA 4ABFA 3SGBE 1O3HA 2VH0A 1ETSH 2Q6FA 4A7IB 3MNCA 1IQHA 1YWUA 1GMDG 1TQ0B 5IYTA 4JCNA 1O2GH 3RXFA 2O8UA 1O3EA 1MZAA 1KYNA 4Y8ZA 1EJAA 2P59A 3E16B 2BD3A 1QBNA 1TOCB 2ZCKP 1DUAA 3V7TA 5A0AE 1G3CA 5FHTA 2F43B 3GS9A 1HAVA 1O37A 2XTTB 1RTLA 2KFWA 3A89A 2CF9H 4BAOB 5E0HA 3UOPA 4ABJA 4MVNA 3SQHE 2BD8A 3L6PA 4MPWA 3UPEA 4AFSA 2FI5E 1ARCA 1Y3YA 1Z1JA 4ABAA 2BDGA 2W6JD 4HI3A 3W94A 4AORA 3IG6B 1C1QA 3UY9A 1HDTH 1O3JA 1AD8H 1S84A 2XC0A 1C5SA 2JKHA 1O2IA 1SB1H 3LGTA 1GI7B 1NBME 3RDZA 1WV7H 3QLPH 1NRPH 1XM1A 2Y5GA 1CSOE 2BD5A 3SV8A 3UWIA 2A0QB 1K21H 2AYWA 2Y5HA 5IK2D 3VG8A 4YOJA 2FXRA 1UTMA 2QF3A 2VH6A 3UR6A 3U69H 3U8TH 2ZHQH 4VGCB 1DSTA 1P10A 2NU3E 1QFKH 3BSQA 1RXPA 3OSYA 3ZVAA 4X8SH 4TWWA 1DM4B 4FU8A 4GPGA 5DKMA 2ANMH 3QX5H 2ZDAH 3GDUA 1O2OA 1A2CH 2VINA 1V2UT 2O9QA 1YPEH 4A1XA 1W14U 1HIAA 5C2ZA 3U8RH 2PKAA 4A6LA 1C1TA 1AZZA 5ESTE 1BTPA 1O2JA 3TJNA 3PMAB 3SNEA 4NCYA 1C1OA 1THSH 1TGCA 4GSOA 4MG3A 2ZU2A 1GBEA 1QBOA 1MH0A 4XBBA 1K1OA 1PPBH 2BDBA 2Q6DA 2WPKS 2A4GA 4ZMAH 2VJ1A 1N6YA 1PPGE 3PROA 4FUEA 1SQOA 2BDCA 3VGCB 5A2MH 4ISOA 3SJOA 3MH6A 1GMHG 1ELDE 4HZHA 3BF6H 1CGJE 1L2EA 6ESTA 3UTUH 3RXTA 1ZYOA 1ZHPA 4YT6H 5EODA 3SU6A 1AFQB 2ZEBA 4M7GA 4CRGA 1PYTC 1ZJKA 4X8UH 3SHCH 1A46H 1C1PA 2ALPA 8GCHF 2AMQA 4TT3D 1LHDH 5DP3A 3UNQA 3SV9A 1A5HA 2AGIX 2XCNA 5A0BA 1IQJA 4D9RA 1MKWK 1MTVA 3A81A 2UUFB 2A45B 2QF0A 1BB0B 3SORA 3D65E 3A87A 1DWCH 1GCTC 3BG8A 1A4WH 7GCHF 1U6QA 3DT0H 1P2KA 4YESB 3EA9A 3P8FA 1UJ1A 2W3KA 4MPUA 3MQKC 1DICA 3SNDA 1IQEA 1C2MA 1DVAH 4AFQA 1KTTB 1MCTA 1JRTA 1ZHMA 2BDYA 3LGYA 5B6OA 2VIPA 2PGQB 5C1YA 3V13A 2UUJB 3FKSD 3SZEA 2PHBA 1NBMD 4NA8A 3W95A 2TGTA 4NIVA 1SLVB 3LJOA 5GJ4B 3F3BA 1C1MA 1P8VC 1YCPH 2XBWA 1O3DA 3QGJA 2GCHF 3OTJE 1FUJA 2AGGX 1YM0A 9ESTA 3QWCH 1RGQA 1H1BA 2ZPQA 3VB4A 3O8RA 2H5CA 6CHAC 2BD7A 2OD3B 1C1RA 1BHXF 1MMJN 1RTKA 4NA7A 1ESAA 1B7XB 1AN1E 1YCPK 1THRH 3NZIA 4F55A 3ATIA 1Z7KA 5J4SA 2AH4X 4ISIH 3VXEH 1VITH 1XXFA 3TNSA 1CA0C 2W7UA 1SOTA 1EB1H 1N1LA 3H09A 2SNVA 3ATLA 2BLWA 2GVFA 2C90B 2C8XB 4WF8A 1GI3A 1C5RA 6GCHG 1GVLA 3MNSA 1Z8RA 1YCPM 4ZKOU 2C4FH 4Y7AA 1OP0A 3UWJH 4I33A 2K7XA 1BITA 2ZC9H 3D23A 1WQVH 5I25A 3B23B 3DHKH 2VU8E 1QB1A 4YOGA 4DOQA 2BDHA 1AUJA 1L4DA 2QYIA 3HK6B 1TE0A 2A7JA 1O5AB 2FDAA 1Y5BT 1LDTT 2Z3DA 1BTHH 2BZ6H 2EI7A 4RKOB 3UREA 2BVRH 4YT7H 1COWD 4GCHG 4YO9A 1TMBH 2SGPE 1Y3UA
chains in the Genus database with same CATH topology
2EC9H 1ZZZA 3RC4A 5T6GA 1AB9C 1IHTH 2BD2A 2ZDVH 3PLBA 1ETRH 1YYY1 8KME2 1CT2E 1TOMH 2EA3A 1IQIA 4Z0KA 2XC4A 1Y59T 1PQ5A 2Y80A 3MHWU 3SUDA 1T32A 3LJJA 3P17H 4MNYA 2XBXA 1EJNA 4DT7B 1VZQH 5EXMA 1P0SH 4Y8YA 1O34A 2NU0E 1UTPA 2XWBI 2CHAC 1KDQB 1P2MA 1AO5A 2XBVA 3RXHA 2C8YB 1UVSH 3BTQE 3LGUA 2UWPA 3OX7U 1AB9B 4TY6A 4MTBA 5LH8A 2SGAA 4U01A 1XUHA 1GMHF 2FODA 1YPLH 5BRRE 1GJ6A 4OS4A 4NIYA 3T2NA 1AKSA 3QDZB 1D3QB 1DY9A 4Y0ZE 2JH0D 1OWDA 3ZVDA 3GCOA 3TNTA 1HJAC 2ZU1A 5A8ZA 5PTPA 1GG6B 1T8NA 1OP2A 1O3PB 3UQOA 1FAXA 2Z9GA 1NRSH 4B71A 3GCTG 1OWHA 1MU8B 4UEHH 1C2KA 5LPEA 4F49A 2ZZUH 5EGMA 5GIBA 1RJXB 1WBGB 1QGFA 5DP7A 3FFGA 3RLWH 1XX9A 2HLCA 3M7QA 3QGNB 2FWWA 4X6PA 3F9EA 1KLIH 3UQVA 2WPMS 1BUIA 3A83A 2GGVB 1GI9B 3SU4A 4XE4A 2WUBA 2H9TH 1UK3A 1YLCA 2AGEX 1DWBH 1O3AA 1A1RA 1HJAB 2ZGBH 2ALVA 4X1SU 3S7KB 1ANDA 4I32A 4AYVB 2A4QA 1MQ6A 5J4QA 3AW0A 1THPB 3SU0A 1CVWH 2QCYA 3LC5A 4MNVA 3RXDA 1BMNH 5C1XA 2VVUA 1FLEE 4CBNA 3E1XB 2BVXH 2VIOA 3CENA 4MNWA 3RU4T 4ZH8A 4K8YA 1AFEH 1AY6H 3U1IB 1O2TA 5DG6A 1GHYH 3RXKA 4OS5A 2G51A 1NO9H 1OYQA 1BTXA 1PPEE 1AGJA 3SU3A 5AVDA 2ZDMA 1UHBB 1UK4A 1JMOH 4K1EA 1F5LA 3F1SB 4NFFA 1ELGA 1RTFB 1HXFH 5CMXH 4DG4A 4CH8B 1UVTH 3WY8A 1GI0A 3A8BA 3PWCA 4PROA 1TWXB 4ABEA 3SNCA 5GXPA 2ZDKA 3ZVEA 3MNXA 4K2YA 1YLDA 1O2NA 2F3CE 3RM0H 1D4PB 1T4UH 1XUJA 3RM2H 2Z3EA 1IQMA 4KGAA 2UUKB 2ZO3H 5A0CA 1JXPA 3OU0A 2VIQA 2ZP0H 1YPMH 1GI6A 1QRXA 2TRMA 1HAXB 3P8OA 2RCEA 2NWNA 3PTNA 1QA0A 3ZZ6A 1Z71A 1B0FA 4AFUA 3GCHC 3SNBA 2AEIH 2B8OH 2WPHS 3K2UA 1TMTH 2ZGJA 2O8LA 3BG4B 2GMTC 1P9SA 1GBIA 1AZ8A 3A8AA 1ID5H 1SGEE 3ZVFA 1O2KA 1BRUP 1CT0E 2R0LA 3EA8A 3PO1B 1GVZA 2ESTE 3RXSA 3PM3A 4GCHF 1ZGVA 3A85A 1OXGA 1GHBF 1H9IE 2BXUH 3T62A 4I31A 2VIDA 4ZROA 1F7ZA 3BTME 3MFJA 3MH5A 3SGQE 3RXCA 1LKAA 3C27B 3MU8A 3JZ2B 2ULLA 1W0YH 2C8WB 3RUOA 2P3UB 5T6DA 4MNXA 2BY5X 2G5VA 5EQRA 1O2HA 1XKBC 2EI8A 4AGJA 2IOTA 4BXWA 1GL0E 1EOJA 4UFFH 1WCZA 3RXEA 2PGBB 1G3DA 1A3BH 2XC5A 2GD4B 1HAHH 3HGPA 3MO6A 1OWJA 2W26A 1JRSA 2D1JA 2GT8A 4Q7XA 2FI4E 4B75A 4CR5A 2WPJS 1O2PA 1SFQB 3KF2A 4X6OA 1Z6JH 2G4TA 4X2VA 1P12E 1FY4A 1ZOMA 3FVFB 3U8OH 4ASHA 2VB0A 1A61H 3RMLH 2NU4E 1F2SE 4I8JA 1UTQA 4WVPE 1TBRH 4B74A 3B8JA 5EPYA 3RLYH 1CQQA 3Q77A 4H6SB 3P6ZB 4ZXXH 3GISB 4FVBA 1PYTD 4JK5A 1C5NH 1GI1A 4E06H 1ELTA 4IC5A 1K22H 1SSXA 4IBLH 3VB3A 3UOUA 1C5QA 2B5TB 2WV4A 2G5NA 1CGHA 3GCTF 2IPHA 1FIZA 1TRNA 1LVBA 1G3EA 2ZFRH 2H1UA 1Z1IA 1DOJA 1ZSJA 2VNTA 1HBTH 3GY7A 3AVZA 1DT2A 1P2QA 4Y10E 1DFPA 1OYTH 2VWMA 3RXMA 2F9BH 1P2NA 3ZZ5A 1VITG 1CU1A 1ORFA 2Z7FE 4X1QU 5AFYH 1BOQA 2AFQB 5TJXA 1ZRBA 4K8BA 1NRQH 3BEFB 2C8ZB 1OS8A 2B7DH 3RC6A 4XBCA 1INCA 1B0EA 1C1VH 3GY5A 2BQ7B 5HGGA 4YTAA 1ZSLA 1TGBA 3NCLA 4X6MA 1E34B 2ZHEH 3D62A 1ZLRA 3GYLB 1ZR0A 1CBWC 2AIPA 3SHAH 4FU7A 1A5IA 4KTCA 5TCCA 2GV6A 4X8VH 3BN9A 1T4VH 3BTGE 1KXCA 3TK9A 3GDSA 4X2XA 3T28A 2OBQA 4BTUB 1P03A 1ZPZA 3SGAE 3V12A 3SU1A 1QA7A 3MU0A 1AQ7A 1YPJH 2QXJA 4I8HA 2V3OH 1W0ZU 1C5PA 1GJAB 3M3TA 2ZF0H 1O5DH 1XUGA 1WUNH 4IW4E 2AS9A 4H6TA 4K1SA 4E05H 1G30B 4NGAH 1MCVA 1TNGA 2CN0H 1TX8A 3S7HB 2A5IA 1CBWB 5DP8A 4VGCC 2ZU4A 5C5OA 3UR9A 2H6MA 1GJ4H 1G2LA 2A5AA 4ZUHA 2I6QA 1SPJA 1HB0B 1K1NA 2A31A 3MNBA 2NU1E 4AB8A 3ZVGA 1OPHB 4INLA 3SU2A 3PMBB 2BY9X 2GCTC 3M35A 3Q76A 5A09A 4CRAA 3RXIA 2KAIA 3SJKA 4FUBA 2BXTH 3QTVH 1EXFA 1O5BB 3MH7A 1H8IH 2V6NA 2G8TA 2PUXB 4OS1A 1VCQA 3EGKH 2F91A 1MU6B 2FLBH 1MTSA 1O3MA 1PPFE 3VGCC 1KIGH 1XXDA 5LPRA 2ZA5A 1O39A 3GY6A 3SJ8A 1HAIH 5K7RA 1UTOA 2OC7A 3A8CA 3BTFE 4D9QA 1IOEA 3HPTB 1W12U 2H5DA 4B2BA 2UWLA 1SMFE 2P8OC 2PTCE 4UFDH 5F8TA 3UIRA 1HAVB 1NESE 1OKXA 1AFQC 4BANB 1GI4A 2GCTB 1WQSA 1ZGIA 2GDDA 3VXFH 4MPVA 3SV6A 2BLQA 1IAUA 4JMYA 1JIRA 2AERH 5HYOA 1NS3A 4DGJA 5CE1A 2V0BA 4NSVA 1A3EH 5FX5A 1UVPA 4YLUA 3O8DA 3NPSA 2FS9A 3URDA 2LPRA 1QURH 2H9HA 2FO9A 2ZU3A 1D3DB 4UFGH 1TX7A 4I8KA 1MKWH 1TNLA 2TBSA 1QTFA 1ZTKA 2P8OB 3HATH 3CS0A 1C2HA 2SFAA 2A32A 1EP6A 5C67A 1IQKA 1OX1A 3MH4A 1FMGA 4B2CA 1V6DA 3E90B 2WYJA 3SN8A 1QNJA 5FBEA 1P06A 5A8XA 1J16A 3RMOH 1SGTA 2WV5A 5DP5A 5JBCS 1AWFH 3SW2B 5SGAE 3ZYDA 2HNTC 3RXQA 1ZPCA 1GJDB 1EQ9A 3K6ZA 3TU7H 1QHRB 3K9XB 4INKA 1S5SA 1JIMA 4KTSA 2GKVE 3MO9A 1VITF 4X1PU 4OS2A 6LPRA 1Z6EA 3SUGA 4A1VA 5HXFA 3A84A 2XCFA 5L2YH 2HPPH 2J34A 1WAYB 5H4IB 2WPLS 2XWAA 1S82A 1P57B 4FUGA 3ATMA 2BY7X 4DIIH 1C5MD 2UWOA 4D76A 1F0UA 3ODFA 1C5OH 1GMCG 3E6PH 4NWKA 2FTMA 3SBKA 2FIRH 1PPCE 1EPTC 1BIOA 3STIA 4AB9A 4INHA 4O97A 3LT3A 4IGDA 2STBE 1EOLA 1LHEH 1QL8A 2V3HH 4Y7BA 1O5GH 1H8DH 4O9VA 2BTCE 3TJUA 4TPIZ 1O3OA 1V2VT 1EZXC 1K1JA 1G37A 1QJ7B 1C5UA 3RXBA 1ZPBA 2HWLB 2AMDA 1GMDF 1NRRH 3LKWA 1TIOA 1XUFA 1FI8A 2GX4A 1BBRE 3M7UA 4H4FA 3SUEA 3FP6E 1T31A 3GYMA 5DP6A 4RKJB 3U98H 2PKSC 2OUAA 1NC6A 1EPTB 2IN2A 1QRZA 5FCKA 2GDEH 2BMGB 4JK6A 2BOHB 5EPNA 3A86A 3MTYA 4Q7ZA 2RDLA 5DJ7A 2XW9A 1C2EA 4D7FA 2SGDE 2W5EA 3ZZ4A 1GJ8B 1DLKB 1CO7E 2RG3A 4KELA 5BPEA 2BM2A 2ZNKH 4BAMB 4TY7A 2CGAA 3TLOA 4FUIA 2PKSB 2XNIA 1SHHB 2PSYA 3BTDE 1C5YB 1BTWA 5L6NH 2JH5D 5HM9A 1BDAA 1A7SA 1C9PA 1FDPA 2GZ8A 3LH3A 1HRTH 5F8ZA 3A80A 1C2GA 2V35A 4NIWA 4ZHLU 4LZ1H 2CJIA 2PUQH 2TPIZ 1OWEA 3E0PB 2ZFSA 2SGQE 3RU4E 4WY3A 1AIXH 4FUJA 1L1JA 4A92A 1DWDH 2ANKH 4BTTB 1GG6C 1MD7A 5LPFA 1QCPA 3A7YA 1AE5A 1O30A 2ZPSA 3NKKA 2BHGA 3ATKA 5GCHG 3M61U 1S81A 2OLGA 4ZHAA 4I8GA 2BLVA 1O38A 3LIWA 1DITH 1OOKB 4B1TA 3MMGA 3TH4H 4AGKA 1BJUA 2HVXA 1MUEB 1C2FA 1W8BH 2K1QA 1PQAA 2P3FH 1EAXA 4IC6A 3M37A 2Y7ZA 2OCVB 2ZGHA 1S85A 2FOGA 1EAIA 1V2WT 2M5TA 3S9AA 1O31A 4OS7A 4AG1A 1O2SA 1GGDC 3HK3B 1O3GA 3P8GA 3STJA 4YM9A 3LGIA 1NM6A 4BTIB 3P70B 4IMQA 5F8XA 1TONA 2OP9A 5EG4A 2SGFE 4JZDH 1BMMH 3SJ9A 1KY9A 3KIDU 3AASA 3FANA 1FY3A 1O0DH 2BX3A 4GLYA 1GDNA 1ELBA 1ZHRA 2P94A 5DP9A 5FAHA 1SGPE 3S69A 2NU2E 3GY4A 2QV1A 3PV4A 4Q2KA 1MKXH 1NROH 1QIXB 1UCYE 4JZEH 1O2QA 3OY5U 3PLKA 1EKBB 3DD2H 4WMDA 1Z8GA 1ELEE 2EEKA 2XBYA 3NUMA 1MTUA 3P92A 4GAWA 3ATWA 3F9GA 4CBOA 4DJZB 2FX4A 1O2MA 3MU5A 3DFJA 3BTKE 7ESTE 3KL6A 1GGDB 1SR5C 2Y82A 1UHBA 3TGKE 1SLWB 1LCYA 1SLXB 2OQUA 1MKXK 1FPCH 4LZ4B 4ZHMU 3M5LA 1CHGA 2BZAA 3JZ1B 3SV7A 2TGAA 1DY8A 4XDEA 1AKSB 1PQ7A 1GMCF 1TGSZ 4HFPB 3TK5A 3TGJE 1C1UH 3KQCA 3A82A 1MAXA 2Y81A 4WH6A 3RXPA 1KXDA 2OTVA 2G4UA 3RXLA 1NTPA 1V2OT 2J95A 2Z9JA 1MTWA 5TCAA 2HPQH 2A2XH 2QA9E 3Q3XA 4K3JA 7KMEH 1YC0A 1E0FD 2PW8H 1O3FA 4AN7A 3P95A 3BG4C 1ARBA 2BYAX 1UTNA 3RU4D 2HNTE 5IDKA 2GV7A 4MPXA 3ZV8A 3H5CB 1QQUA 2ZTZA 3PO1C 4THNH 1UK2A 1QJ1B 1YPHC 1F0RA 2HNTF 3E3TA 5EW2H 5FPSA 1TRYA 4CRCA 2VIWA 1FV9A 4DURA 5ETXA 3LC3A 1XKAC 4AZ2B 2J92A 3B9FH 1NPMA 1GI8B 3T26A 4CH2B 1TQ7B 6GCHF 4TPYA 2D8WA 1DDJA 1QR3E 1BRAA 1BRBE 4UE7H 5FCRA 1BJVA 1P2IA 1BZXE 1E37B 4ABGA 5I46H 1CE5A 7LPRA 1GI2A 1FONA 4CR9A 1HNEE 2W3IA 5C20A 1K1PA 1TMUH 3LOXA 1LO6A 2Y5FA 4NZQA 2OQ5A 1AU8A 4DIHH 2VWLA 4B2AA 1P3EA 2CF8H 1EZQA 1O3CA 4ZXYH 1KTSB 4FUHA 4WH8A 1KXBA 2FLRH 3UUZA 2ZFPH 1LPGB 1T8OA 1UMAH 2FOMB 4WJG2 1Q31A 1SC8U 3ZZ3A 3SOSA 2BD4A 2O8TA 8ESTE 3KNXA 4BXSA 2ZKSA 1FNIA 1GBCA 3BTHE 1C1NA 1RS0A 4ABIA 1C5WB 2A1DB 5EU8A 1VCWA 1GJ7B 4O3UA 2BDAA 2G52A 4NIXA 2ILNA 1SOZA 3EA7A 5GCHF 1WU1A 3ZV9A 2YNBA 2ANYA 2BY8X 5CHAC 1GBDA 4LOYH 4ZAEA 1G3BA 1FJSA 2BOKA 2FEQH 2QXHA 4X2WA 4NFEA 5GPIB 3A7VA 2OXSA 1V2LT 2FOAA 2Y7XA 2ZU5A 1SGFG 3ZZAA 1DXWA 1O2WA 3Q00A 4ABHA 2D2DA 1N6XA 1QBVH 2TGDA 1FQ3A 1O32A 1ABIH 1J15A 2ANWA 2ZDLA 1VJAU 4BAQB 1ESBA 1Y5AT 3BTTE 1P01A 1F5KU 1K2I1 1NU7B 3BV9B 3GY3A 2PSXA 1BMAA 4D8NA 1EB2A 1K28D 1C2DA 1GBKA 1GBHA 2F9OA 1W13U 4I8LA 5JBTA 3PMHB 2A7HA 3VB7A 1GJ9B 3FAOA 5JB9S 3TITA 1O33A 3EDXB 1VCPA 1GVKB 5EXNA 1GBJA 5CHAB 5E2PA 1S0QA 1A0LA 1D6RA 2GP9B 1B5GH 1VGCC 3SNAA 1OP8A 8LPRA 4CRFA 3E91A 2R3YA 4NA9H 2WUCA 1GI5A 1JBUH 3VB6A 1AVGH 2OINA 1V2TT 3E0NB 4CHAC 4Z6AH 1W11U 2J9NA 2ODPA 3BTWE 1V2MT 2TGPZ 3FZDA 1QY6A 3H7OA 1FY5A 1O2RA 3PB1E 4KTUA 1QL9A 1J9CH 3V0XA 5C1UA 1SG8B 4JYVH 1TNKA 4IN1A 4TYDA 1SGDE 1AUTC 1GWAA 2WINI 3SI4H