1ELDE

Structural analysis of the active site of porcine pancreatic elastase based on the x-ray crystal structures of complexes with trifluoroacetyl-dipeptide-anilide inhibitors
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ELASTASE
publication title Structural analysis of the active site of porcine pancreatic elastase based on the X-ray crystal structures of complexes with trifluoroacetyl-dipeptide-anilide inhibitors.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Hydrolase/hydrolase inhibitor
total genus 59
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1994-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1eldE02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1eldE01
3RXCA 1O5BB 1EPTA 3LDXH 1CA8B 1GBKA 2AH4X 2A4OA 4XFQA 2JH0D 4X6NA 1IQJA 1S81A 4WJG2 5A0AE 3UPEA 2J2UA 4GPGA 4NGAH 1C5XB 5LH8A 1CQQA 3P6ZB 1A1RA 1MKXH 2SGEE 5E0JA 2PUXB 4NCYA 4ABGA 1D6RA 1TGSZ 5GCHF 2OC1A 1O31A 1TMTH 5HMAA 1KSNA 3SNEA 5HGGA 3ZYEA 3E0NB 4YLQH 3RLWH 4ABAA 1S85A 5LGOA 1NRRH 1VZQH 3PV4A 1KXEA 5BRRE 3T27A 4KTUA 3FVFB 1CSOE 4K8YA 1A3BH 3GCHC 1UVPA 1K1NA 1C5NH 1CT0E 1V2VT 1T7CA 1ZMLA 4CBOA 1GBIA 1DOJA 5GPIB 2O8UA 1HIAA 3R3GB 4D9RA 4CH2B 3A87A 3QN7A 2BVSH 3SV6A 8GCHF 1V2QT 1HJAB 1FI8A 1TQ7B 4YT7H 2AGEX 1GBCA 1XVMA 1OWKA 3ZZ6A 1WUNH 2YOLA 2PSXA 1O3PB 3LGWA 1MKWK 1B5GH 2IN2A 3M7QA 1SGEE 4BNRA 1GJ4H 4NG9H 1FPCH 1SGPE 4AGKA 2OXSA 3U1JB 1Z1JA 3E6PH 2VVVA 3M61U 2DUCA 3PWCA 3C27B 2ZQ2A 3ZZ8A 3MTYA 1D3PB 1RGQA 1ETSH 2ZI2H 2P95A 4UDWH 1TBQH 1VITF 1UK2A 1P03A 1P06A 4ZKNU 1NU9A 3EA9A 3LU9B 2ZC9H 1NU7B 1BRBE 4I8KA 3SU4A 1SGTA 2GV6A 2ZNKH 4YT6H 1K2I1 3TK6A 1Y5BT 2IPHA 1TQ0B 1ZTJA 1DLKB 4A7IB 3QLPH 1JIRA 1O5FH 4RN6A 1MAYA 3FP8E 8LPRA 1EZQA 4CRAA 1D6WA 3SGQE 3SZNA 2CF8H 3P95A 1SGDE 2ZECA 2GCTC 2UUJB 3RC6A 2GZ8A 2XBVA 1HJ8A 1T8OA 2O9QA 3I29A 4XBCA 4ZXXH 3SJIA 4WWYA 1ZSKA 1KIGH 4Q7XA 2ANKH 6LPRA 1E37B 5HYOA 3SGAE 1HLTH 3A84A 1IQKA 1ZOMA 4I8HA 1YPKH 1BTHH 1O3KA 5J4SA 4MNWA 3V7TA 1Z8GA 1GMHF 1N8OB 3SU3A 1SMFE 2OUAA 1O2UA 3JZ1B 1LVMA 3SUEA 1G3EA 4D7GA 1EX3A 1AGJA 3SN8A 4CRBA 3MH7A 3VPKA 1DS2E 1EQ9A 1OSSA 2A45B 3QGJA 3P17H 2A4GA 1CGJE 1QTFA 2CN0H 5L30H 1RIWC 2BXUH 7ESTE 1G36A 3TK9A 1XUIA 4IBLH 3SJKA 1GDNA 2TPIZ 1VITH 1TA6A 3OTJE 2YNAA 1PQ7A 2VIWA 2VGCC 5LPRA 3NWUA 4FUCA 3RXRA 3MFJA 1MZAA 1OXGA 5ETXA 1NZQH 3A83A 5B6OA 4YOIA 1O3IA 1ZR0A 2G4TA 1YLDA 2BY8X 1ELVA 4Y8ZA 3D23A 1GG6C 2GVFA 2O8LA 1KXAA 2STAE 1UHBB 5AHGH 2ODPA 1SOZA 1HBTH 1JXPA 3D49H 5A2MH 2ZP0H 1C4Y2 4Q80A 4DURA 3N7OA 2PR3A 3QK1A 1GJ6A 2ZQ1A 1FIZA 4FUJA 3QUMP 1O2WA 4NSYA 1C2KA 2HNTF 2IJOB 4FUGA 1AUJA 1CVWH 1YBWA 4WH6A 3MNCA 3RC5A 3A89A 1BBRK 1NFXA 2UUKB 3RLYH 4UEHH 3RM2H 1O3GA 1NN6A 1QB1A 4AOQA 3M36A 1H8IH 1PPFE 4O97A 2VIVA 2D26C 1GWAA 7KMEH 2R2WU 1GHVH 1BRUP 5AF9H 2A7CA 3HATH 1S82A 4O03A 5FHTA 3ENSB 1P09A 1ARBA 2A5IA 1QJ1B 1DANH 3NPSA 3KQBA 1C1SA 1W2KH 1A0JA 5DP5A 1BOQA 1EAWA 1GBFA 3MO3A 1IQMA 2BTCE 4Y6DA 1W12U 1TNJA 5JBBS 1OYQA 2EI7A 1EPTB 3RXPA 2AMPA 2BDAA 2SGAA 2Z94A 4CRCA 2VVCA 2ZDVH 3VB7A 1BMNH 1V2OT 1C2FA 3TH3H 3KQDA 4DVAU 1UTQA 3LOXA 5DP8A 4Q7YA 1L1GA 4I8LA 1WU1A 4TYDA 3RMMH 3UNRA 2VWNA 4TPIZ 4ISHH 2C8ZB 4GSOA 2PGQB 1G3CA 1QY6A 1OWIA 1A4WH 4NIXA 1T8MA 4I8JA 1OPHB 5DP3A 2GDEH 1HDTH 1A5HA 1QL8A 3SU5A 1TNLA 2BM2A 3A8AA 1O37A 2BHGA 1BTXA 4OS2A 1GVZA 2UWOA 5T6FA 4TWYA 2SGPE 1FY1A 1HIAB 1C2LA 2ZU4A 2M5TA 3ZZ4A 1H9IE 2FTLE 4FUEA 4GCHG 1WV7H 1J9CH 1LVOA 2FOGA 4ABIA 3PLPA 1BTZA 2AIPA 1OWEA 3F9GA 2OP9A 2XXLA 3S9AA 3SV7A 5JBTA 3UOPA 2PV9B 1O3JA 1PPGE 3DHKH 3SO3A 1C2HA 1G3BA 4MDSA 3RXOA 2ALVA 3BTWE 2OCVB 1T32A 1HFDA 4SGAE 3SU6A 4A5TS 1VCQA 2GTBA 1YPHC 2BOKA 1AVGH 4D8NA 4B76A 1U6QA 2ZU1A 3TPIZ 2Z9GA 1JRTA 3LGVA 2FESH 1AN1E 1GHAG 3TJVA 4QT8C 3MNXA 4TY7A 4IC5A 3P8OA 1XXDA 1Z8JB 3RP2A 5A0CA 3MH6A 5JDUB 4MQAA 4F4OC 1O35A 1W0YH 1MAXA 1AKSA 5C5OA 3A82A 3TJNA 1C1VH 1QFKH 3GYMA 2RDLA 1IQHA 1MTNC 1HAVB 1ACBE 4X8VH 3MWIU 1YYY1 4UFDH 1JOUB 1TX7A 3F9FA 5ESTE 5AFZH 3P92A 2IOTA 4VGCB 2FP7B 4NA7A 1TPPA 5EXLA 1GVKB 3LONA 2FMJA 3ZZAA 1O3CA 4ASHA 4NFFA 3CENA 3E0PB 1ELBA 1O5EH 1LQDB 4DW2U 1K22H 1GCTC 5DKMA 1QB6A 1O3OA 4GHQA 3ZZBA 3AAVA 5FPSA 5FBEA 1GHZA 3A8CA 5I46H 1W0ZU 4BAMB 1INCA 4XBDA 2GV7A 1EATA 4MPXA 1F5KU 3BIUH 3S9BA 4IW4E 2GZ7A 3K65B 1C5TA 5EQQA 4AFUA 1AE8H 1JWTA 1YC0A 1HAHH 1YP9A 2ZCLP 4NA8A 3E91A 4YOJA 4HFPB 1UVUH 1GDQA 3RDZA 1AMHA 2PTNA 4BTTB 3LC5A 3GDVA 3A7YA 1RTKA 1GHAF 3URCA 1QL7A 5T6DA 1NC6A 1AIXH 1L0ZA 1TNIA 2VH0A 2ZHDA 3ITIA 4INHA 3A7WA 1DWCH 3V12A 3D65E 1T4VH 2FODA 2WYJA 4MNYA 4K69A 1C2MA 1GHXH 1ELAA 4LK4A 1ZHPA 2V0BA 3OX7U 3ZVEA 5A8YA 4I32A 3L3TA 3A8BA 4HTCH 3ZZDA 2PKSC 4XSKU 1C2DA 1O39A 4FVDA 4UFFH 3K2UA 4WMEA 3BEIB 3U69H 1V2MT 1V2NT 1G37A 3F9EA 1UTOA 5TJXA 2SNWA 1TA2A 1FONA 2JH5D 1N1LA 2ZFRH 4FVBA 3U8OH 5A0BA 5GWZA 3S69A 2F9NA 1UMAH 4CHAB 3QZRA 1IQNA 2XC5A 4CBNA 3MNBA 2FYQA 1GHWH 1XKBC 3DT0H 3T26A 3TVJB 3PO1B 1RTFB 3Q3YA 3MU8A 1WOFA 1EAIA 3A7TA 1C2EA 4H42U 3UR6A 2WUCA 1F0RA 5DGJA 4Y7AA 1BJVA 3EA7A 1LPZB 5CMXH 1PFXC 4JZFH 4NZQA 4DCDA 3NK8A 1RXPA 2P59A 2DE8A 2OC0A 1AVWA 2EEKA 4A92A 1P05A 4ABJA 4H6TA 1GGDC 1NTPA 3Q77A 2JH6D 1EPTC 1TOCB 1GI6A 5L2ZH 1LKAA 3KNXA 1HAPH 1O2ZA 3FAOA 1HAOH 4TY6A 4Y0YE 2Y81A 4K2YA 2ANWA 2ASUB 3HGPA 4U32A 1BZXE 2VJ1A 2VGCB 1CU1A 1O3FA 2XC4A 3UOUA 1QBOA 1VCWA 9ESTA 2D1JA 3ZVFA 5F8TA 4K5ZA 3VXFH 1MKXK 2HWLB 1Z7KA 1QHRB 3GCOA 4ISLA 3BTKE 5HM2A 1AD8H 5GCHG 2H2ZA 1O0DH 3ZZ3A 4DY7B 3GY2A 3ZVDA 1AFQC 2WV4A 1BIOA 1QJ6B 2EI8A 3EQ0H 1Y3WA 3Q3KA 3TGIE 2C4FH 3BF6H 4UFEH 3P8GA 1W13U 1Y3VA 4FUDA 3RU4T 3UTUH 1AUTC 4U2WA 1AQ7A 3AVZA 2QF0A 1GI2A 1J8AA 2O8WA 1FN8A 2CXVA 1BTYA 3MHWU 1TPAE 1YLCA 1QJ7B 3L6PA 2R3UA 1O3LA 1G2MA 8GCHG 2FOHA 3O8CA 2XC0A 2BLWA 2ZPQA 2BY9X 1SGYE 5JPMH 1XUKA 4I8GA 4IN1A 1P2IA 5EQSA 4X1NU 5EGMA 5TCCA 1PPEE 3RMOH 1UVSH 1SG8B 1L1JA 3A85A 2ULLA 1O5AB 1V2TT 5E2PA 1VITG 2VINA 3BG4C 1IHTH 2FTMA 3SV9A 1TNKA 2ZPSA 3TLOA 2NWNA 1BMLA 3KN2A 4X2WA 1TRYA 1AKSB 1P2NA 1DFPA 1Y3YA 2J94A 2JKHA 3T2NA 3BTEE 3UREA 2OQ5A 3V13A 3EYDA 5JB8S 2BD3A 4B1TA 5EXMA 1BTPA 5GIBA 4Y11E 1GL0E 1HAXB 4NIWA 2ZU5A 1XKAC 1NY22 2O8MA 4VGCC 5DP7A 3AAUA 5DP9A 3SNBA 2Y5GA 3A7VA 3BV9B 5CHAB 4A1VA 3UR9A 1V2KT 2FO9A 3SV2H 6GCHF 4RSPA 3F68H 2NU4E 1SGRE 1WTHD 6ESTA 1UK4A 1AI8H 3TH4H 3GCNA 4AGJA 1A61H 2QA9E 2VB0A 1HPGA 1XX9A 3K6ZA 2BXTH 1WYKA 3KEEA 5EODA 2ZU3A 5JBCS 1EAXA 1L2EA 3LH3A 3ZV9A 4O9VA 3F9HA 3KL6A 4U30A 1A2CH 3BTHE 4B74A 1ZTLA 3GCTF 4ZHLU 4AFZA 4H4FA 1GMCF 2OQUA 1KLJH 3LPRA 2CHAB 1GMHG 1O2SA 2WUBA 4FXGH 1D3QB 1YCPH 4NIYA 4XE4A 1O2QA 5DPAA 1Z8IB 1DX5M 1G2LA 1YKTA 1OWJA 2BDGA 2NU2E 1D3DB 1HAYB 4IC6A 4JK6A 2ZEBA 1AE5A 1QGFA 3LGYA 3STIA 5K7RA 1MTWA 1MTVA 3VEQB 2GKVE 2UWPA 1LHEH 4AG1A 1UJ1A 2GP9B 1HB0B 3TNSA 2XRCA 3S7KB 5A8XA 3FFGA 3MU0A 1VGCB 3UNSA 1EXFA 5FPTA 3RC4A 3TNTA 1GBBA 1MTNB 4ZKRU 4CHAC 3ZZ7A 1FQ3A 1GBJA 3PMHB 3V0XA 1N6YA 3PO1C 3QTOH 1FXYA 1PPBH 2Z9IA 4CRFA 5HM9A 1GJCB 2PWXA 4OGYA 1C5QA 4MG3A 1ABJH 5L2YH 4Z0KA 1G3DA 2QV1A 2BB4A 5DO4H 4NIVA 5F8XA 4Q2KA 1V2LT 2A7HA 2CGAA 2TRMA 1GJ5H 4TWWA 3RM0H 1SL3A 1QQUA 2F9PA 1EJMA 2THFB 1TNGA 1NS3A 3D62A 1PQ8A 1DY8A 3OSYA 1TPOA 4K3JA 1BUIA 1ZZZA 1GCTB 2F9VA 1ZJDA 2ZDKA 3SHAH 2H6MA 1SOTA 4Z6AH 4RKJB 1CHGA 1RRKA 4OS6A 1UCYE 1G30B 3RXHA 1H8DH 3SNDA 1SGNE 2B5TB 1OX1A 5C1UA 1TLDA 3LKWA 4ISIH 3EGKH 3KHVA 2ZF0H 1WBGB 1BDAA 2TGPZ 1EJNA 1DSTA 1YGCH 1BB0B 2BDCA 1KDQA 1T8NA 1C5UA 3A80A 1DY9A 2V3HH 1EB2A 1FLEE 3GY6A 2ZHWH 3TGKE 2EA3A 3FZZA 4DGJA 2WPMS 1OWDA 1GBTA 1KXFA 1C1MA 4WMFA 4YZUA 1ETRH 3B9FH 2A2XH 1C9TA 5I25A 2ZWLH 2SGFE 1T8LA 1ELGA 3QGNB 1MMJN 1EUFA 1HAGE 4WH8A 1QL9A 1M9UA 4JZDH 4X8UH 4YTAA 2PKSB 1GBDA 2FX4A 1SLUB 3IG6B 4A6LA 1XXFA 1QURH 4I31A 2F3CE 3HK6B 1A0LA 2ZG0H 1H9LB 1SLXB 2XW9A 1UTNA 7LPRA 1ZYOA 2ZIQH 1H9HE 1YM0A 8ESTE 4MPVA 1A46H 3SNCA 4E05H 5TCAA 2YNBA 3FP7E 1VJ9U 3PTBA 3RXFA 1JBUH 2Y6TA 1ZLRA 3WY8A 2K1QA 3RXIA 1C2JA 2FI3E 2H9HA 1SHHB 1LHFH 1FV9A 5J4QA 1XUHA 1F5RA 3GICB 1D3TB 2BZAA 1ANEA 1ZTKA 3QTVH 4DIHH 3Q00A 3BG8A 5FBIA 2SFAA 1D9IA 2ZGBH 4WF8A 1TMUH 2GCHF 1Q2WA 4Y7BA 1THRH 4JZIA 2AERH 3I78A 3A7XA 2AGGX 2J4IA 3RXDA 1GGDB 1K1OA 1WAYB 1LHGH 1QA7A 2OBQA 3AASA 2ZCHP 1NFUA 2QXIA 2W7SA 1RTLA 1T31A 1BHXB 4B73A 8KME2 1PPHE 1F92A 3OY5U 5E8EH 2H1UA 3SORA 4BAQB 2B8OH 1Q31A 1MCVA 3FP6E 2VIOA 1CA0C 1KXCA 1TIOA 3QZQA 3RU4D 2J9NA 2PLXA 2WINI 3QWCH 3M5MA 3UQVA 1A0HB 1ANDA 2HNTC 5CHAC 1IHSH 2I6SA 2XWBI 2A4QA 2ZFFH 1O2PA 2NU3E 1AFQB 1O2LA 1Z8RA 2OC7A 1C5ZB 2BD4A 1O2TA 1XM1A 3SI4H 2SNVA 3UUZA 2TGAA 1OS8A 2W7UA 7GCHG 5E0GA 4MVNA 1HUTH 2XWAA 3HGNA 1ZJKA 5LPEA 2QXHA 1V2PT 2BLOA 2CJIA 2WPKS 3DFJA 1OP0A 5G4BA 1IQIA 3MU4A 4O3UA 1ZSJA 1BQYA 3OYPA 1K1JA 1BBRH 2ZGXH 1GI5A 3EDXB 2QF3A 4Y10E 2CHAC 1O2HA 2Y82A 4GUXA 1FY4A 2WPIS 2HLCA 1V2RT 3TH2H 2HALA 4KTCA 4DOQA 4IGDA 1MQ5A 1O3MA 2P93A 5IDKA 1UTLM 3S9CA 5K0HA 1CGHA 1XUGA 2G51A 2BD2A 4FUIA 3MI4A 3ODFA 3SI3H 4X8SH 2BD8A 1P12E 3W95A 3NXPA 4CR5A 2BD5A 3T29A 2BDHA 5DP6A 5EQRA 1AWHB 1NESE 2FOCA 2OBOA 3BG4B 4BTUB 1D4PB 1O5DH 1O2NA 1ZPBA 4K8BA 1VGCC 1EAUA 2BX4A 5EPNA 3PLBA 5C2ZA 1QIXB 1GCDA 2Z9JA 1F5LA 2WPLS 1DPOA 1DDJA 4E7NA 3BN9A 1O2JA 2F9OA 3RXTA 1ESAA 5L6NH 2OTVA 1GBEA 1O2GH 2ODQA 4X6MA 2J34A 7GCHF 2ZGJA 2ZTZA 4AFSA 3ZV8A 2ZKSA 3M5NA 5DP4A 2W26A 3DUXH 1O36A 1SSXA 4X1RU 1ORFA 1EZUC 2Y5FA 1YF4A 1P04A 1AFEH 3HKIB 4Y0ZE 3E16B 4AZ2B 2Z3DA 2AEIH 3T25A 2Z7FE 1GI8B 1QRXA 2VIPA 4X6OA 1LDTT 1TGCA 2A4RA 1F7ZA 2Q6DA 1P8VC 1UCYK 1GBHA 1GBMA 5A09A 4K1EA 4ZUHA 1DUAA 1F0UA 4MNXA 1DICA 3K6YA 4NFEA 1SR5C 2ZGHA 4IN2A 2QY0B 3ZVCA 2A5AA 1KDQB 4K1SA 1DWDH 3H7OA 1OKXA 5FCKA 1UTPA 1O2MA 4TPYA 4AORA 2W3KA 1DWBH 1C5WB 1QB9A 4M7GA 1PQAA 1G32B 1GMDF 2BVXH 1C5SA 4YO9A 1P2KA 1RD3B 1SB1H 2VVUA 1O38A 1C2IA 1N6XA 2F9BH 2QXJA 2TGDA 1O2XA 1GI4A 5ABWA 3ZVBA 3Q76A 1XUFA 1B7XB 2FOMB 3EA8A 2ZGCA 4FUBA 4X1QU 2QYIA 2AFQB 2ZCKP 3TJUA 2PTCE 2BVRH 2Q6FA 2HPPH 1NFWA 1S5SA 1MTSA 1FN6A 2A0QB 2BLQA 3URDA 1IQFA 1JIMA 1MQ6A 1NM6A 1C4V2 1UTJA 3RXQA 1V3XA 5A8ZA 3TJOA 3PYHA 4NSVA 2WV5A 3LGTA 1FPHH 3BTFE 3E90B 2GT7A 4B2BA 1C4U2 1C1RA 1TOMH 3IITA 3S7HB 4UFGH 1SLWB 3UIRA 5F8ZA 1ZMNA 2OLGA 1K1PA 2V3OH 2G8TA 3BSQA 6CHAB 2AS9A 1W8BH 1KXBA 1Z6JH 1P3CA 2QGRA 3MU1A 5EG4A 4X1PU 4ZHMU 1ESTA 2P8OC 5IYTA 1V6DA 1TAWA 1O30A 1NT1A 1F0SA 1LQEA 3VB5A 2G55A 1BJUA 1AB9B 1FAXA 1YCPM 1IQGA 2KAIA 5FXLA 3SW2B 4U01A 4Y8YA 1ZHMA 1TRMA 3EE0B 4D9QA 2C8YB 1TMBH 2FS8A 2ESTE 2FWWA 2QC2A 4ZH8A 2OINA 2FXRA 1O5GH 2ZU2A 3M3SA 1EOLA 1PYTD 3BEUA 4ISOA 1K1LA 2CMYA 1TNHA 2F91A 3B8JA 2FEQH 1O3AA 3F1SB 2SGDE 1TBZH 1ZMJA 1O3HA 2PSYA 1O2YA 1QQ4A 1ELCA 2PKAA 2ZHQH 1QR3E 5C5NA 1P2QA 1GVLA 4THNH 2A1DB 3MMGA 3S0NA 1HJ9A 1K28D 3LGIA 4Q7ZA 1G9IE 3ZYDA 1CHOF 2A2QH 2RA0A 2ZTYA 1P57B 3MU5A 1FJSA 1V2WT 3F6UH 3NKKA 4MNVA 1QCPA 1K1IA 3TU7H 2PFEA 2XBWA 1DUEA 2ZHFH 3KF2A 2J92A 1Y59T 5FAHA 1OP2A 1C5MD 6GCHG 3STJA 4AG2A 3PB1E 4ZKOU 3QX5H 1J14A 4ESTE 3BTQE 1P2JA 2B0FA 2ZFTA 1FIWA 1VCPA 3VFEA 3GY5A 1E35B 4B2AA 3V3MA 1YPJH 1LKBA 1BTUA 1TPSA 4BXSA 4B75A 4CH8B 1TONA 2G5NA 3KIDU 4LXBH 4GAWA 4ABEA 2RG3A 1K9OE 4AB9A 4Y76A 4R0IA 4X2XA 3GCTG 1DXPA 2HRVA 1RS0A 1GMCG 1SQOA 1KYNA 2Y7ZA 3M3VA 5CE1A 4D76A 4BAHB 2R3YA 4AN7A 3HK3B 3O8RA 1GHBG 1ZRKA 4AYVB 1YPEH 2P16A 4XOJA 1YPHE 5FCRA 1LPGB 4OGXA 1RJXB 4DIIH 1LTOA 4YOGA 2Z9LA 2D8WA 1O2KA 3M35A 1FAKH 1ID5H 3E8LA 1ELEE 1MD8A 2BDBA 4CRDA 1CA0B 2ZDMA 3MH5A 3O8DA 2RA3A 2NU1E 1MU8B 3A88A 4X0WU 1W7XH 2R0KA 1SHYA 1E34B 1S6FA 3E1XB 1ARCA 1SI5H 1NO9H 1TGNA 3M5OA 5DJ7A 2AMDA 1Z71A 2AGIX 3L33A 3RXMA 1B0EA 4MPWA 5LPFA 2ZO3H 3SJOA 1W3CA 3SNAA 3SU2A 4IMQA 3MO6A 2AMQA 4E06H 1ANCA 1FMGA 4X1SU 3ZZ5A 3VGCC 4KGAA 1T4UH 2R2MB 3UNQA 1EASA 2QAAA 2G4UA 1NFYA 2B9LA 1LHCH 3UWJH 1TALA 3NCLA 1ABIH 3TGJE 2BMGB 1O2RA 1IAUA 3ATKA 1SGQE 4BAOB 1O2VA 4OS1A 4JZ1A 3KQCA 3M7TA 4I7YH 2XCNA 2BY6X 4ZXYH 2UUYA 1CT2E 1GHBF 4FUFA 2HOBA 1P2MA 2ANMH 1PYTC 1QBNA 2PW8H 3FZDA 1TX8A 4BAKB 9LPRA 3SGBE 1DE7H 1GJBB 1C1OA 2P3FH 4D7FA 4ZROA 2FM2A 2BQ6B 3ATIA 1SPJA 2ZZUH 1DITH 1K1MA 4MTBA 2ALPA 2EI6A 1H4WA 1W14U 3DD2H 1O3DA 1FY5A 5C1YA 3C1KA 2ZTXA 1BTWA 5E0HA 1P01A 1P9SA 3PMBB 1ELDE 2FYRA 3A7ZA 2VIQA 1YPMH 2G5VA 2JETC 4JMYA 1FNIA 2H9TH 3ELAH 3RXVA 2CF9H 2UUFB 5T3HA 1DSUA 4WY3A 1Z1IA 3ZVAA 3ESTA 3RU4E 2P3TB 4GHTA 5GDSH 1GI9B 2FS9A 1FY3A 1SC8U 1OYTH 2C8XB 4UD9H 1GJ8B 2UWLA 1ANBA 4MLFB 1EZXC 3M5LA 2XBXA 1HAVA 4NZLA 6CHAC 2TBSA 2Y5HA 1KTTB 3GY7A 1GL1A 4FU8A 3UFAA 1EB1H 4J1YA 2FX6A 2LNCA 1C5OH 1EKBB 1NRQH 1Q3XA 3SUFA 4DG4A 3ATMA 1ELTA 1TBRH 1O33A 5HXFA 1P02A 1O2OA 3H7TA 2A32A 2BY5X 1O34A 2CV3A 1GI3A 1C1TA 1GI7B 2AYWA 1BRAA 2GX4A 4XBBA 4YESB 2RCEA 1E38B 1AB9C 1Y3UA 3W94A 5C20A 5EW2H 4GVUA 1MKWH 2KAIB 1CGIE 1E0FD 3PROA 4OS4A 1ETTH 2Z3CA 1DWEH 1J17T 1LO6A 3P8NA 2ILNA 1C5VA 2GCHG 4JK5A 3KQEA 1IQEA 2XCFA 3ZVGA 2BYAX 1X7AC 2V35A 1MBMA 1SBWA 1O3EA 2C3SA 1SFIA 3AW1A 2ZFQH 1P11E 2GGVB 1TGTA 3I77A 5FX5A 3U8TH 3U98H 1TB6H 1CBWC 1HV7A 2STBE 1J16A 3GISB 2A5KA 3A86A 3MYWA 1E36B 2GZ9A 2BD9A 2BLVA 4H6SB 3GY3A 1L4ZA 5GXPA 4IS5A 5EW1H 1GJDB 1TX6A 2PKAB 1YPLH 3U8RH 1NRSH 1GJ9B 4XDEA 1EP6A 1SGIB 1MZDA 2W5EA 3P70B 3A81A 3LC3A 3LGUA 2H5DA 4HI3A 2Q6GA 1MU6B 2A7JA 5DG6A 2GD4B 3LJJA 2FLRH 2GT8A 2H5CA 1W11U 1QA0A 2BDIA 3VB4A 5PTPA 4KKDA 1Z6EA 4BOHA 1NROH 1DT2A 1KLTA 4DT7B 2Y7XA 2F83A 1Y5AT 4B71A 1IOEA 1HAIH 2WPJS 3MO9A 5H4IB 2H9EH 3G01A 3RXGA 2FPZA 4INLA 2FDAA 1C5LH 2B7DH 2QIQA 3CS0A 3P8FA 1V2JT 3B23B 1HYLA 1QBVH 2VWLA 3AW0A 3SUGA 3RXBA 1KXDA 2P8OB 1THPB 1O3BA 3TIUA 1A7SA 4LZ4B 2J38A 2DE9A 1P9UA 3DFLA 1FY8E 3LT3A 1OWHA 1OOKB 1W10U 2FOBA 1SGFA 4JYTA 3GY8A 2VWOA 5JBAS 1CO7E 4YM9A 2BX3A 2EC9H 3K9XB 4K60A 1ZPCA 4E7RG 3TITA 1NRPH 1QRZA 4Y79A 3SQEE 1AWFH 1TYNA 1A3EH 3RMNH 5DK1A 5F03A 1DVAH 1DXWA 1MCTA 1KTSB 1TWXB 3MH4A 3Q3XA 2ZA5A 2W3IA 3RXUA 3ZZCA 1JRSA 1UVTH 4AFQA 1P0SH 1C2GA 1TFXA 5E2OA 2GDDA 2XBYA 3UQOA 2GMTB 1HAZB 2Z9KA 3NUMA 5AFYH 2OC8A 4ABBA 1SLVB 2Y80A 4HZHA 3BTGE 1DLEA 1MD7A 2ZFSA 1QNJA 1HGTH 3MNSA 4FU9A 2FZZA 1HXFH 3PMAB 2Z3EA 1WQVH 1RFNA 1ZGIA 4ISNA 1P2OA 1Y5UT 1UTMA 4AB8A 2ODYB 3OY6U 4JYUH 1C9PA 4OS5A 1VJAU 2SGQE 4JZEH 1C5RA 3ODDA 1HJAC 3LJOA 1CE5A 4F49A 3EAJA 1EOJA 4WVPE 2C90B 4ABDA 1TRNA 2I6QA 3CP7A 5JYIA 3DA9B 2VU8E 1JMOH 4ZMAH 1GPZA 4AX9H 3SUDA 1KY9A 4PROA 1XVOA 3GYLB 1FDPA 3VB3A 4NA9H 1HCGA 3BTME 3RXEA 4ZHAA 4NWLA 3T28A 1XMNB 1AVXA 4MPUA 1MUEB 1TGBA 2TGTA 4BXWA 2NU0E 3LH1A 1EZSC 1EJAA 1GMDG 1ZPZA 4UE7H 4BTIB 4J2YB 3SU1A 2C93B 3O8BA 4ZKSU 5JB9S 1A5IA 3ZZ9A 2BQ7B 5T6GA 3QO6A 1GJAB 4K1TA 3RXJA 1MH0A 2O8TA 1DM4B 3SV8A 1BRCE 3KCGH 1HNEE 1S0RA 4HGCA 1LHDH 1TE0A 1AY6H 1UO6A 2BOHB 2AIQA 4KTSA 1C1NA 4ABFA 3BTTE 3BEFB 1O5CB 2LPRA 3E3TA 4A1TA 2PGBB 1PPZA 4GCHF 2HGTH 3VGCB 2OD3B 2TIOA 2HPQH 1S6HA 3GCHB 4GLYA 3GDSA 1LCYA 4B2CA 1WTGH 4R8TB 5C67A 1QRWA 3T5FH 2QXGA 2G00A 1SVPA 2F9UA 4ZAEA 4WMDA 3ATLA 3VB6A 1N8OC 1MBQA 2PHBA 3SOSA 4O3TA 5C3NA 1L4DA 4X2YA 1ZHRA 4LOYH 3LIWA 1C5PA 2FOFA 3M37A 2Z6BD 3A8DA 1GI0A 3TK5A 3UWIA 1NRNH 3PM3A 1C1QA 2BZ6H 1ELFA 5EU8A 1MTUA 2WPHS 1YPGH 2ZHEH 3RMLH 5FPYA 1P10A 2ZDAH 2ZPRA 3U9AH 3VXEH 5EXNA 1V2ST 2FOAA 4RKOB 2XNIA 3CS7A 3M7UA 1LPKB 2PUQH 1BHXF 1WCZA 4INKA 2JETB 2FLBH 1UVOA 5EPYA 2XYAA 3SQHE 4IMZA 4FUHA 1GBAA 2FI4E 4I33A 3HKJB 2G52A 5SGAE 4JYVH 1EP5A 2WYGA 4X8TH 3SJ9A 1GJ7B 1SQAA 2QCYA 1CHOG 2C8WB 3SBKA 3PLKA 5AVDA 3OU0A 1BA8B 1O32A 3BTDE 1HXEH 1O2IA 3MOCA 2GCTB 3SU0A 1B0FA 1KLIH 1ZSLA 1IQLA 4KP0A 2VNTA 2BY7X 1S83A 2BDYA 1GBLA 1WQSA 4Y8XA 1PQ5A 3RXAA 1UCYH 5GJ4B 1ZGVA 2QN5T 3GY4A 2ANYA 3ATWA 4X2VA 3PWBA 5BPEA 1XUJA 2VIDA 1BMMH 3SJ8A 4ABHA 1F2SE 1CT4E 5F6MA 3U1IB 3JZ2B 2G81E 1C1PA 1A5GH 3NZIA 1PJPA 1V2UT 1THSH 1AO5A 1ESBA 1Y3XA 3UY9A 1WSSH 3RUOA 1LVBA 2FI5E 1ZRBA 2R9PA 2P94A 1HRTH 1CBWB 2Q1JA 3GDUA 4Y71A 4UONA 3HPTB 1AZ8A 1FUJA 2HVXA 1OP8A 4CR9A 1AZZA 4CRGA 1LMWB 1RIWB 1L1NA 1UK3A 4YLUA 4A1XA 3QDZB 3KGPA 2GMTC 1AHTH 3M3TA 1AU8A 5ESBA 3IWMA 3RXKA 4BANB 1K21H 1SGCA 1S0QA 4KELA 1P3EA 4DJZB 3BIVH 4OS7A 4AYYB 2D2DA 1BT7A 3PMJA 4WXVA 1SQTA 5EOKA 1FZZA 4LZ1H 1GG6B 2BQWB 2V6NA 2ZDLA 2HNTE 1C1UH 1UTKA 2J95A 1C1WH 1UHBA 4NWKA 4CREA 5FX6A 2ZDNA 1BMAA 1GHYH 4X6PA 4SGBE 1J15A 1NPMA 2ZFPH 2P3UB 1LVYA 3GOVB 4JCNA 1BITA 3R0FA 3T62A 2BD7A 1H1BA 1BBRE 2FIRH 2VWMA 3RXLA 2XTTB 2VH6A 1SFQB 4WXIA 5C1XA 3PTNA 1S84A 1F0TA 1Y8TA 2A31A 1PPCE 3FANA 1YCPK 1O3NA 4FU7A 3SHCH 3H5CB 1GDUA 1BCUH 1VR1H 2R0LA 1GI1A 1TABE 1C5YB 1W7GH 2FOEA 3RXSA 1SGFG
chains in the Genus database with same CATH superfamily
3RXCA 1O5BB 1EPTA 2L6OA 3LDXH 1CA8B 1GBKA 2AH4X 4ZCNA 2A4OA 4XFQA 2LELA 2JH0D 3OE7D 4X6NA 1IQJA 1S81A 4WJG2 5A0AE 3UPEA 2J2UA 4GPGA 4NGAH 1C5XB 5LH8A 1CQQA 3P6ZB 1A1RA 1MKXH 2SGEE 5E0JA 2PUXB 4NCYA 4ABGA 1D6RA 1TGSZ 5GCHF 2OC1A 1O31A 1TMTH 5HMAA 1KSNA 3SNEA 5HGGA 3ZYEA 3E0NB 4YLQH 3RLWH 2KX4A 1S85A 4ABAA 5LGOA 1NRRH 1VZQH 3PV4A 1KXEA 5BRRE 3T27A 4KTUA 3FVFB 1CSOE 4K8YA 1A3BH 3GCHC 1UVPA 1K1NA 1C5NH 1CT0E 1V2VT 1T7CA 1ZMLA 4CBOA 1GBIA 1DOJA 3FOAA 5GPIB 2O8UA 1HIAA 3R3GB 4D9RA 4CH2B 3A87A 3FN8A 2PP6A 3QN7A 2BVSH 3SV6A 5EJZA 1V2QT 8GCHF 1HJAB 1FI8A 1TQ7B 4YT7H 2AGEX 1GBCA 1XVMA 1OWKA 3ZZ6A 1WUNH 2YOLA 2PSXA 1O3PB 3LGWA 1MKWK 1B5GH 2IN2A 3M7QA 1SGEE 4BNRA 3SYJA 1GJ4H 4NG9H 1FPCH 1SGPE 4AGKA 2OXSA 3U1JB 1Z1JA 3E6PH 2VVVA 3M61U 2DUCA 3PWCA 3C27B 2ZQ2A 3ZZ8A 3MTYA 1D3PB 1RGQA 1ETSH 2ZI2H 2P95A 4UDWH 1TBQH 1VITF 1UK2A 1P03A 1P06A 3OAAD 4ZKNU 3MQKC 1NU9A 3EA9A 3LU9B 2ZC9H 1NU7B 1BRBE 4I8KA 3SU4A 1SGTA 2GV6A 2WV9A 2ZNKH 4YT6H 1K2I1 3TK6A 1Y5BT 2IPHA 1TQ0B 1ZTJA 1DLKB 4TT3D 4A7IB 3QLPH 1JIRA 1O5FH 4RN6A 2XOKD 1MAYA 3FP8E 8LPRA 1H8ED 1EZQA 4CRAA 1D6WA 3SGQE 3SZNA 2CF8H 3P95A 1SGDE 2ZECA 1W0KD 2GCTC 2UUJB 3RC6A 2GZ8A 2XBVA 1HJ8A 1T8OA 2O9QA 3I29A 4XBCA 4ZXXH 3SJIA 2YMSC 1ZSKA 4WWYA 1KIGH 4Q7XA 2ANKH 6LPRA 5KEDA 1E37B 5HYOA 3SGAE 1VKYA 2WSSD 1HLTH 3A84A 1IQKA 1ZOMA 4I8HA 1YPKH 1BTHH 1O3KA 5J4SA 4MNWA 3V7TA 1Z8GA 1GMHF 1N8OB 3SU3A 1SMFE 2OUAA 1O2UA 3JZ1B 1LVMA 3SUEA 1G3EA 4D7GA 1EX3A 1AGJA 1NBME 3SN8A 4CRBA 3MH7A 3VPKA 1DS2E 1EQ9A 1OSSA 2A45B 3QGJA 3P17H 2A4GA 1W0JD 1CGJE 1QTFA 2CN0H 5L30H 1RIWC 2BXUH 7ESTE 1G36A 3KYFA 3TK9A 1XUIA 3WWFA 4IBLH 3SJKA 1GDNA 2TPIZ 1VITH 1TA6A 3OTJE 2YNAA 1PQ7A 2VIWA 2VGCC 5LPRA 2AHME 3NWUA 4FUCA 3RXRA 3MFJA 1MZAA 1OXGA 5ETXA 1NZQH 3A83A 5B6OA 4YOIA 1O3IA 1ZR0A 2G4TA 1YLDA 2BY8X 1ELVA 4Y8ZA 3D23A 1GG6C 2GVFA 2O8LA 1KXAA 2STAE 1UHBB 5AHGH 2ODPA 1SOZA 1HBTH 1JXPA 3D49H 5A2MH 2ZP0H 1C4Y2 4Q80A 4DURA 3N7OA 2PR3A 3QK1A 1GJ6A 2ZQ1A 1FIZA 4FUJA 3QUMP 1O2WA 4NSYA 1C2KA 2HNTF 2IJOB 4FUGA 1AUJA 1CVWH 1YBWA 4WH6A 3MNCA 3RC5A 3A89A 1BBRK 1NFXA 2UUKB 3RLYH 4UEHH 3RM2H 1O3GA 1NN6A 1QB1A 4AOQA 3M36A 1H8IH 1PPFE 4O97A 2VIVA 2D26C 1GWAA 7KMEH 2R2WU 1GHVH 1BRUP 2JJ1D 4DT4A 5AF9H 2A7CA 3HATH 1S82A 4O03A 5FHTA 3ENSB 1P09A 1ARBA 2A5IA 1QJ1B 1DANH 3NPSA 5C17A 3KQBA 1C1SA 1W2KH 1A0JA 5DP5A 1BOQA 1EAWA 1GBFA 3MO3A 1IQMA 2BTCE 4Y6DA 1W12U 1TNJA 5JBBS 1OYQA 2EI7A 1EPTB 3RXPA 2AMPA 2BDAA 2SGAA 2Z94A 4CRCA 4FOUC 2VVCA 2ZDVH 3VB7A 1BMNH 1V2OT 1C2FA 3GS9A 3TH3H 3KQDA 4DVAU 1UTQA 3LOXA 5DP8A 4Q7YA 1L1GA 2KM0A 4I8LA 1WU1A 4TYDA 3RMMH 3UNRA 2VWNA 4TPIZ 4ISHH 2C8ZB 4GSOA 2PGQB 1G3CA 3H09A 1QY6A 1OWIA 1A4WH 4OM9A 4NIXA 1T8MA 4I8JA 1OPHB 5DP3A 2GDEH 1HDTH 1A5HA 1QL8A 3SU5A 1TNLA 2BM2A 3A8AA 1O37A 2BHGA 1BTXA 4OS2A 1GVZA 2UWOA 5T6FA 4TWYA 2SGPE 1FY1A 1HIAB 1C2LA 2ZU4A 2M5TA 2LP6A 3ZZ4A 1H9IE 2FTLE 4FUEA 4GCHG 1WDIA 4XRNA 1WV7H 1J9CH 1LVOA 2FOGA 4ABIA 2GJGA 3PLPA 1BTZA 2AIPA 2W6ID 1OWEA 1WXRA 3F9GA 2OP9A 2XXLA 3F2HA 3S9AA 3SV7A 5JBTA 3UOPA 2PV9B 1O3JA 1PPGE 3DHKH 3SO3A 1K0HA 1C2HA 1G3BA 4MDSA 3RXOA 2ALVA 3BTWE 2OCVB 1T32A 1HFDA 4SGAE 3SU6A 4A5TS 1VCQA 2GTBA 1YPHC 2BOKA 1AVGH 4D8NA 4B76A 1U6QA 2ZU1A 3TPIZ 2Z9GA 1JRTA 3LGVA 2FESH 1AN1E 1GHAG 3TJVA 4QT8C 3MNXA 4TY7A 4IC5A 3P8OA 1XXDA 1Z8JB 3RP2A 5A0CA 3MH6A 5JDUB 2QF5A 4MQAA 4F4OC 1O35A 1W0YH 1MAXA 1AKSA 5C5OA 5CDFE 3A82A 3TJNA 1C1VH 1QFKH 3GYMA 2RDLA 1IQHA 1MTNC 1HAVB 1ACBE 4X8VH 3MWIU 1YYY1 4UFDH 1JOUB 1TX7A 3F9FA 5ESTE 5AFZH 3P92A 2IOTA 4VGCB 2FP7B 4NA7A 1TPPA 5EXLA 1GVKB 3LONA 1YY3A 2FMJA 3ZZAA 4B6FA 1O3CA 4ASHA 4NFFA 3CENA 3E0PB 1ELBA 1O5EH 1LQDB 4DW2U 1K22H 1GCTC 5DKMA 1QB6A 1O3OA 4GHQA 3ZZBA 3AAVA 5FPSA 5FBEA 1GHZA 3A8CA 5I46H 1W0ZU 4BAMB 1INCA 4XBDA 2GV7A 1EATA 4MPXA 1F5KU 3BIUH 3S9BA 4IW4E 2GZ7A 3K65B 1C5TA 4Q63A 5EQQA 4AFUA 1AE8H 4P00A 1JWTA 1YC0A 1HAHH 4M9FA 1YP9A 2ZCLP 4NA8A 3E91A 4YOJA 4HFPB 1UVUH 1GDQA 3RDZA 1AMHA 2PTNA 4BTTB 3LC5A 3GDVA 3A7YA 1RTKA 1GHAF 3URCA 1QL7A 5T6DA 1NC6A 1AIXH 1L0ZA 1TNIA 2VH0A 2ZHDA 3ITIA 4INHA 3A7WA 1DWCH 3V12A 3D65E 1T4VH 2FODA 2WYJA 4MNYA 4K69A 1C2MA 1GHXH 1ELAA 4LK4A 1ZHPA 2V0BA 3OX7U 3ZVEA 5A8YA 4I32A 3L3TA 3A8BA 4HTCH 3ZZDA 2PKSC 4XSKU 3EE7A 1C2DA 1O39A 4FVDA 4UFFH 3K2UA 4WMEA 3BEIB 3U69H 1V2MT 1V2NT 1G37A 1MABB 3F9EA 1UTOA 5TJXA 2SNWA 1TA2A 1FONA 2JH5D 1N1LA 2ZFRH 4FVBA 3U8OH 5A0BA 5GWZA 3S69A 2F9NA 1UMAH 4CHAB 3QZRA 1IQNA 2XC5A 4CBNA 3MNBA 2FYQA 1GHWH 1XKBC 3DT0H 3T26A 3TVJB 3PO1B 1RTFB 3Q3YA 3MU8A 1WOFA 1EAIA 3A7TA 1C2EA 4H42U 3PV5A 3UR6A 2WUCA 1F0RA 5DGJA 4Y7AA 1BJVA 3EA7A 1LPZB 5CMXH 1PFXC 4JZFH 4NZQA 4DCDA 5DSFA 3NK8A 1RXPA 2P59A 2DE8A 2OC0A 1AVWA 2EEKA 4A92A 1P05A 4ABJA 4H6TA 1GGDC 1NTPA 3Q77A 2JH6D 1EPTC 1TOCB 1GI6A 5L2ZH 1LKAA 3KNXA 1HAPH 1O2ZA 3FAOA 5HKKD 1HAOH 4TY6A 4Y0YE 2Y81A 4K2YA 2J98A 2ANWA 2ASUB 3HGPA 4U32A 1BZXE 2VJ1A 2VGCB 1CU1A 1O3FA 2XC4A 3UOUA 1QBOA 5EJLA 1VCWA 9ESTA 2D1JA 4I86A 3ZVFA 5F8TA 4K5ZA 3VXFH 3WWBA 1MKXK 2HWLB 1Z7KA 1QHRB 3GCOA 4ISLA 3BTKE 5HM2A 1AD8H 5GCHG 2H2ZA 1O0DH 3ZZ3A 4DY7B 3GY2A 3ZVDA 1BMFD 1AFQC 2WV4A 1BIOA 1QJ6B 2EI8A 3EQ0H 1Y3WA 3Q3KA 3TGIE 2C4FH 3BF6H 4UFEH 3P8GA 1W13U 3VG8A 1Y3VA 4FUDA 2F43B 3RU4T 3UTUH 2WZQA 1AUTC 4U2WA 1AQ7A 3AVZA 2QF0A 1GI2A 1J8AA 2O8WA 1FN8A 1OHHD 2CXVA 1BTYA 3MHWU 1TPAE 1YLCA 1QJ7B 3L6PA 2R3UA 1O3LA 1G2MA 8GCHG 2FOHA 3UB0A 3O8CA 2XC0A 2BLWA 2ZPQA 2BY9X 1SGYE 5JPMH 3DSPA 1XUKA 4I8GA 4IN1A 1P2IA 3W1EA 5EQSA 4X1NU 5EGMA 5TCCA 1PPEE 3RMOH 1UVSH 1SG8B 1L1JA 3A85A 2ULLA 1O5AB 1V2TT 5E2PA 1VITG 2VINA 3BG4C 1IHTH 2FTMA 3SV9A 1TNKA 2ZPSA 3TLOA 2NWNA 1BMLA 3KN2A 4X2WA 1TRYA 1AKSB 2IPQX 1P2NA 1DFPA 1Y3YA 2J94A 2JKHA 3T2NA 3BTEE 3UREA 2OQ5A 3V13A 3EYDA 5JB8S 2BD3A 4B1TA 5EXMA 1BTPA 5GIBA 4Y11E 1GL0E 1HAXB 4NIWA 2ZU5A 1XKAC 1NY22 2O8MA 4VGCC 5DP7A 3AAUA 1E1RD 5DP9A 3SNBA 2Y5GA 2V7QD 3A7VA 3BV9B 5CHAB 4A1VA 3UR9A 1V2KT 2FO9A 3SV2H 6GCHF 4RSPA 3F68H 2NU4E 1SGRE 1WTHD 6ESTA 1UK4A 3DCLA 1AI8H 5C94A 3TH4H 3GCNA 2WPDD 4AGJA 1A61H 2QA9E 2VB0A 1HPGA 1XX9A 3K6ZA 2BXTH 3UAIC 1WYKA 3KEEA 5EODA 3F0OA 2ZU3A 5JBCS 1EAXA 1L2EA 3LH3A 3ZV9A 4O9VA 3F9HA 3KL6A 4U30A 1A2CH 3BTHE 4B74A 1ZTLA 3GCTF 4ZHLU 4AFZA 4H4FA 1GMCF 2OQUA 1KLJH 3LPRA 2CHAB 1GMHG 3ZIAD 1O2SA 2WUBA 4FXGH 2RFKC 1D3QB 1YCPH 4NIYA 4XE4A 1O2QA 5DPAA 1Z8IB 1DX5M 1G2LA 1YKTA 1OWJA 2BDGA 2NU2E 1D3DB 1HAYB 4IC6A 4JK6A 2ZEBA 1AE5A 1QGFA 3LGYA 3STIA 5K7RA 1MTWA 1SKYE 1MTVA 3VEQB 2GKVE 2UWPA 1LHEH 4AG1A 1UJ1A 2GP9B 1HB0B 3TNSA 2XRCA 3S7KB 5A8XA 3FFGA 3MU0A 1VGCB 3UNSA 1EXFA 5FPTA 3RC4A 3KQ5A 3TNTA 1GBBA 2KCYA 1MTNB 4ZKRU 4CHAC 3ZZ7A 1FQ3A 1GBJA 3PMHB 3V0XA 3OEHD 1N6YA 3PO1C 3QTOH 1FXYA 1PPBH 2Z9IA 2JIZD 4CRFA 5HM9A 1GJCB 2PWXA 4OGYA 1C5QA 4MG3A 1ABJH 5L2YH 4Z0KA 1G3DA 2QV1A 2BB4A 5DO4H 4NIVA 5F8XA 4Q2KA 1V2LT 2A7HA 2CGAA 2TRMA 1GJ5H 4TWWA 3RM0H 1SL3A 1QQUA 2F9PA 1EJMA 2THFB 1TNGA 4RT1A 1NS3A 3D62A 1PQ8A 1DY8A 3OSYA 1TPOA 4K3JA 1BUIA 1ZZZA 1GCTB 2F9VA 1ZJDA 2ZDKA 3SHAH 2H6MA 1SOTA 4Z6AH 4RKJB 1CHGA 1RRKA 4OS6A 1UCYE 1G30B 3RXHA 1H8DH 5F53A 1SGNE 3SNDA 2B5TB 1OX1A 5C1UA 1TLDA 3LKWA 4ISIH 3EGKH 3KHVA 2ZF0H 1WBGB 1BDAA 2J98B 2TGPZ 1EJNA 1DSTA 1YGCH 1BB0B 2BDCA 1KDQA 1T8NA 1C5UA 3A80A 1DY9A 2V3HH 1EB2A 1FLEE 3GY6A 5GNDA 2ZHWH 3TGKE 2EA3A 3FZZA 4DGJA 2WPMS 1OWDA 1GBTA 1KXFA 1C1MA 4WMFA 4YZUA 1ETRH 2EQNA 3B9FH 2A2XH 1C9TA 5I25A 2ZWLH 2SGFE 1T8LA 1ELGA 3QGNB 1QZ8A 1MMJN 1EUFA 1HAGE 4WH8A 1QL9A 1M9UA 4JZDH 4X8UH 4YTAA 2PKSB 1GBDA 2FX4A 1SLUB 3IG6B 4A6LA 1XXFA 1QURH 4I31A 2F3CE 3HK6B 1A0LA 2ZG0H 1H9LB 1SLXB 2XW9A 1UTNA 7LPRA 1ZYOA 2ZIQH 1H9HE 1YM0A 8ESTE 4MPVA 1A46H 5KECA 1YWUA 3SNCA 4E05H 5TCAA 2YNBA 3FP7E 5HIZA 1VJ9U 3PTBA 3RXFA 5DN6D 1JBUH 2Y6TA 3KYGA 1ZLRA 2KZ4A 3WY8A 2K1QA 3RXIA 1C2JA 2FI3E 5CHBA 2H9HA 1SHHB 1LHFH 1FV9A 5J4QA 1XUHA 1F5RA 3GICB 1D3TB 2BZAA 1ANEA 1ZTKA 3QTVH 4F55A 4DIHH 3Q00A 3BG8A 5FBIA 2SFAA 1D9IA 2ZGBH 4WF8A 1TMUH 2GCHF 1Q2WA 4Y7BA 1THRH 4JZIA 2AERH 3I78A 3A7XA 2AGGX 2J4IA 3RXDA 1GGDB 1K1OA 5FL7D 1WAYB 1LHGH 1QA7A 2OBQA 3AASA 2ZCHP 1NFUA 2QXIA 2W7SA 1RTLA 2HVYB 1T31A 1BHXB 4B73A 5C0UA 8KME2 1PPHE 1F92A 3OY5U 4XD7D 5E8EH 2H1UA 3SORA 4BAQB 2B8OH 1Q31A 1MCVA 3FP6E 2VIOA 1CA0C 1KXCA 1TIOA 3QZQA 3RU4D 2J9NA 2PLXA 2WINI 3QWCH 3M5MA 2IJD1 1A0HB 3UQVA 1ANDA 2HNTC 5CHAC 1IHSH 2I6SA 2XWBI 2A4QA 2ZFFH 1O2PA 2NU3E 1AFQB 1O2LA 1Z8RA 2OC7A 1C5ZB 2BD4A 1O2TA 1XM1A 3SI4H 2SNVA 3UUZA 2TGAA 1OS8A 2W7UA 7GCHG 5E0GA 4MVNA 1HUTH 2XWAA 3HGNA 1ZJKA 5LPEA 2QXHA 1V2PT 2BLOA 2CJIA 2WPKS 3DFJA 1OP0A 5G4BA 3CNRA 1IQIA 3MU4A 4O3UA 1ZSJA 1BQYA 3OYPA 1K1JA 1BBRH 2QE7D 2ZGXH 1GI5A 3EDXB 2QF3A 4Y10E 2CHAC 1O2HA 2Y82A 4GUXA 1FY4A 1S6LA 2WPIS 2HLCA 1V2RT 3TH2H 2HALA 4KTCA 4DOQA 4IGDA 1MQ5A 1O3MA 2P93A 5IDKA 1UTLM 3S9CA 5K0HA 1CGHA 1XUGA 2G51A 2BD2A 4FUIA 3MI4A 3ODFA 3SI3H 4X8SH 2BD8A 1P12E 3W95A 3NXPA 4CR5A 2BD5A 3T29A 3DSGA 2BDHA 5DP6A 5EQRA 1AWHB 1NESE 2FOCA 2OBOA 3BG4B 4BTUB 1D4PB 1O5DH 1O2NA 4TSFD 1ZPBA 4K8BA 1VGCC 1EAUA 2BX4A 5EPNA 3PLBA 5C2ZA 1QIXB 1GCDA 2Z9JA 1F5LA 2WPLS 1DPOA 1DDJA 4E7NA 3BN9A 1O2JA 2F9OA 3RXTA 1ESAA 2J5UA 5L6NH 2OTVA 1GBEA 1O2GH 2ODQA 4X6MA 2J34A 7GCHF 2ZGJA 2ZTZA 4AFSA 3ZV8A 2ZKSA 3M5NA 5DP4A 2W26A 3DUXH 1O36A 1SSXA 4X1RU 1ORFA 1EZUC 2Y5FA 1YF4A 1P04A 1AFEH 3HKIB 4Y0ZE 3E16B 4AZ2B 2Z3DA 2AEIH 3T25A 2Z7FE 1GI8B 1QRXA 2VIPA 4X6OA 1LDTT 5B6LA 1TGCA 2A4RA 1F7ZA 2Q6DA 1P8VC 1UCYK 1GBHA 1GBMA 5A09A 4K1EA 3PRDA 4ZUHA 1DUAA 1F0UA 4MNXA 1DICA 3K6YA 4NFEA 1SR5C 2ZGHA 4IN2A 2QY0B 3ZVCA 2A5AA 1KDQB 4K1SA 1DWDH 3H7OA 1OKXA 5FCKA 1UTPA 1YLNA 1O2MA 1UW7A 4TPYA 4AORA 2W3KA 1DWBH 1C5WB 1QB9A 4M7GA 1PQAA 1G32B 1GMDF 2BVXH 1C5SA 4YO9A 1P2KA 1RD3B 1SB1H 2VVUA 1O38A 1C2IA 1N6XA 2F9BH 2QXJA 2TGDA 1O2XA 1GI4A 5ABWA 3ZVBA 3Q76A 1XUFA 1B7XB 2FOMB 3EA8A 2ZGCA 4FUBA 4X1QU 2QYIA 2AFQB 2ZCKP 3TJUA 2PTCE 2BVRH 2Q6FA 2HPPH 1NFWA 1S5SA 1MTSA 1FN6A 2A0QB 2BLQA 3URDA 1IQFA 1JIMA 1MQ6A 1NM6A 1C4V2 1UTJA 3RXQA 1V3XA 5A8ZA 3TJOA 3PYHA 4Q4LA 4NSVA 2WV5A 3LGTA 1FPHH 3BTFE 3E90B 2GT7A 4B2BA 1C4U2 1C1RA 1TOMH 3IITA 3S7HB 4UFGH 1SLWB 3UIRA 5F8ZA 1ZMNA 2OLGA 1K1PA 2V3OH 2G8TA 3BSQA 6CHAB 2AS9A 1W8BH 1KXBA 1Z6JH 1P3CA 2QGRA 3MU1A 5EG4A 4X1PU 4ZHMU 1ESTA 2P8OC 5IYTA 1V6DA 1TAWA 1O30A 1NT1A 1F0SA 1LQEA 3VB5A 2G55A 1BJUA 1AB9B 1FAXA 1YCPM 1IQGA 2KAIA 5FXLA 3SW2B 4U01A 4Y8YA 1ZHMA 1TRMA 3EE0B 4D9QA 2C8YB 1TMBH 2FS8A 2ESTE 2FWWA 2QC2A 4ZH8A 2WHXA 2OINA 2FXRA 1O5GH 2ZU2A 3M3SA 2KFWA 1EOLA 1PYTD 3BEUA 4ISOA 1KMHB 1K1LA 2CMYA 1TNHA 3F3BA 2F91A 3B8JA 2FEQH 1O3AA 3F1SB 2SGDE 1TBZH 1ZMJA 1O3HA 2PSYA 1O2YA 1QQ4A 1ELCA 2PKAA 2ZHQH 1QR3E 5C5NA 1P2QA 1GVLA 4THNH 2A1DB 3MMGA 3S0NA 1HJ9A 1K28D 3LGIA 4Q7ZA 1G9IE 3ZYDA 1CHOF 2A2QH 2RA0A 2ZTYA 1P57B 3MU5A 1FJSA 1V2WT 3F6UH 3NKKA 4MNVA 1QCPA 1K1IA 3TU7H 2PFEA 2XBWA 1DUEA 2ZHFH 3KF2A 2J92A 1Y59T 5FAHA 1OP2A 1C5MD 6GCHG 3STJA 4AG2A 3PB1E 4ZKOU 3QX5H 1J14A 4ESTE 3BTQE 1P2JA 2B0FA 2ZFTA 1FIWA 1VCPA 3VFEA 3GY5A 1E35B 4F48B 4B2AA 3V3MA 1YPJH 1LKBA 1BTUA 1TPSA 4BXSA 4B75A 4CH8B 1TONA 2G5NA 3KIDU 4LXBH 4GAWA 4ABEA 2RG3A 1K9OE 4AB9A 4Y76A 4R0IA 3OEED 4X2XA 3GCTG 1DXPA 2HRVA 1RS0A 1GMCG 1SQOA 1KYNA 2Y7ZA 3M3VA 5CE1A 4D76A 4BAHB 2R3YA 4AN7A 3HK3B 3O8RA 1GHBG 1ZRKA 4AYVB 1YPEH 2P16A 4XOJA 2HLDD 1YPHE 5FCRA 1LPGB 4OGXA 1RJXB 4DIIH 1LTOA 5C0TA 4YOGA 2Z9LA 2D8WA 1O2KA 3M35A 1FAKH 1ID5H 3E8LA 1ELEE 1MD8A 2BDBA 4CRDA 1CA0B 1COWD 2ZDMA 3MH5A 3O8DA 2RA3A 2NU1E 1MU8B 3A88A 4X0WU 1W7XH 2R0KA 1SHYA 1E34B 1S6FA 3E1XB 1ARCA 1SI5H 1NO9H 1TGNA 3M5OA 1SQRA 5DJ7A 2AMDA 1Z71A 2AGIX 3L33A 3RXMA 1B0EA 4MPWA 5LPFA 2ZO3H 3SJOA 1W3CA 3SNAA 3SU2A 4IMQA 3MO6A 4FETA 2AMQA 4E06H 1ANCA 1FMGA 4X1SU 3ZZ5A 3VGCC 4KGAA 1T4UH 2R2MB 3UNQA 1EASA 2QAAA 2G4UA 1NFYA 2B9LA 1LHCH 3UWJH 1TALA 3NCLA 1ABIH 3TGJE 2BMGB 1O2RA 1IAUA 3ATKA 1SGQE 4BAOB 1O2VA 4OS1A 4JZ1A 3KQCA 2EY4C 2KCAA 3M7TA 4I7YH 2XCNA 2BY6X 4ZXYH 2UUYA 1CT2E 1GHBF 4FUFA 2HOBA 1P2MA 2ANMH 1PYTC 1QBNA 2PW8H 3FZDA 1TX8A 4BAKB 9LPRA 3SGBE 1DE7H 1GJBB 1C1OA 2P3FH 5HIYA 4D7FA 4ZROA 2FM2A 2BQ6B 3ATIA 1SPJA 2ZZUH 1DITH 1K1MA 3PRBA 4MTBA 2ALPA 2EI6A 1H4WA 1W14U 3DD2H 1O3DA 1FY5A 4P02A 5C1YA 3N7EA 3C1KA 2ZTXA 1BTWA 5E0HA 1P01A 1P9SA 3PMBB 2F4LA 1ELDE 2FYRA 3A7ZA 2VIQA 1YPMH 4AC9A 2G5VA 3U28C 2JETC 4JMYA 1FNIA 2H9TH 3ELAH 3RXVA 2CF9H 2UUFB 5T3HA 1DSUA 4WY3A 1Z1IA 3ZVAA 3ESTA 3RU4E 2P3TB 4GHTA 5GDSH 1GI9B 2FS9A 5EIYA 1FY3A 1SC8U 1OYTH 2C8XB 4UD9H 1GJ8B 2UWLA 1ANBA 4MLFB 1EZXC 3M5LA 3N7DA 2XBXA 1HAVA 4NZLA 6CHAC 2TBSA 2Y5HA 3DSOA 1KTTB 3GY7A 1GL1A 4FU8A 3UFAA 1EB1H 4J1YA 2FX6A 2LNCA 1C5OH 1EKBB 1NRQH 1Q3XA 3SUFA 4DG4A 3ATMA 1ELTA 1TBRH 1O33A 5HXFA 1P02A 1O2OA 3H7TA 2A32A 2BY5X 1O34A 2CV3A 3PV2A 1GI3A 1C1TA 1GI7B 2AYWA 1BRAA 2GX4A 4XBBA 1E1QD 2RCEA 4YESB 1E38B 2JJ2D 1AB9C 1Y3UA 3W94A 5C20A 5EW2H 4GVUA 1MKWH 2KAIB 1CGIE 1E0FD 3PROA 4OS4A 1ETTH 2Z3CA 1DWEH 1J17T 1LO6A 2J97A 2ILNA 3P8NA 1C5VA 2GCHG 4JK5A 3KQEA 1IQEA 2XCFA 5IK2D 3ZVGA 2BYAX 1X7AC 2V35A 1MBMA 1SBWA 1O3EA 2C3SA 1SFIA 3AW1A 2ZFQH 5T1VA 1P11E 2GGVB 1TGTA 3I77A 5FX5A 3U8TH 3U98H 1TB6H 1CBWC 1HV7A 2STBE 1J16A 3GISB 2A5KA 3A86A 3MYWA 1E36B 2GZ9A 2BD9A 2BLVA 4H6SB 3GY3A 1L4ZA 5GXPA 4IS5A 5EW1H 1GJDB 1TX6A 2PKAB 1YPLH 3U8RH 1NRSH 1GJ9B 4XDEA 1EP6A 2KCOA 1SGIB 1MZDA 3WW7A 2W5EA 3P70B 3A81A 3LC3A 3LGUA 2H5DA 4HI3A 2Q6GA 1MU6B 2A7JA 5DG6A 1E79D 2GD4B 3LJJA 2FLRH 2GT8A 2H5CA 1W11U 1QA0A 2BDIA 3VB4A 5PTPA 4KKDA 1Z6EA 4BOHA 1NROH 1DT2A 1KLTA 4DT7B 4B6EA 2Y7XA 2F83A 1Y5AT 3FO8D 4B71A 1IOEA 1HAIH 2WPJS 3MO9A 5H4IB 2H9EH 3G01A 3RXGA 2FPZA 4INLA 2K8IA 2FDAA 1C5LH 2B7DH 2QIQA 3CS0A 3P8FA 1V2JT 3B23B 1HYLA 1QBVH 2VWLA 3AW0A 3SUGA 3RXBA 1KXDA 2P8OB 1THPB 1O3BA 3TIUA 1A7SA 3NRLA 4LZ4B 2J38A 2DE9A 1P9UA 3DFLA 1FY8E 3LT3A 1OWHA 1OOKB 1W10U 2FOBA 1SGFA 4JYTA 3GY8A 2VWOA 5JBAS 1CO7E 4YM9A 2BX3A 2EC9H 3K9XB 4K60A 1ZPCA 4E7RG 4ACBA 2JDID 3AK5A 3TITA 1NRPH 1QRZA 4Y79A 3SQEE 1AWFH 1TYNA 1A3EH 3RMNH 5DK1A 5F03A 1DVAH 1DXWA 1MCTA 1KTSB 1TWXB 3MH4A 3Q3XA 2ZA5A 2W3IA 3F0PA 3RXUA 3ZZCA 1JRSA 1UVTH 4AFQA 1P0SH 1C2GA 1TFXA 5E2OA 2GDDA 2XBYA 3UQOA 2GMTB 1EFRD 1HAZB 2Z9KA 3NUMA 5AFYH 2OC8A 4ABBA 1SLVB 2Y80A 4HZHA 3BTGE 1DLEA 1MD7A 2ZFSA 1QNJA 1HGTH 3MNSA 4FU9A 2FZZA 1HXFH 3PMAB 2K0QA 2Z3EA 1WQVH 1RFNA 2QF4A 1ZGIA 4ISNA 2V3MA 1P2OA 4HG6A 1Y5UT 1UTMA 4AB8A 2ODYB 3OY6U 4JYUH 2KR7A 1C9PA 4OS5A 1VJAU 2SGQE 4JZEH 1C5RA 3ODDA 1HJAC 3LJOA 1CE5A 4F49A 3EAJA 1EOJA 4WVPE 2C90B 4ABDA 1TRNA 2I6QA 3CP7A 5JYIA 1NBMD 3DA9B 2VU8E 1JMOH 4ZMAH 1GPZA 1FX0B 2KCPA 3SUDA 4AX9H 1KY9A 4PROA 4ASUD 1XVOA 3GYLB 1FDPA 3VB3A 4NA9H 1HCGA 3BTME 3RXEA 4ZHAA 4NWLA 3T28A 1XMNB 1AVXA 4MPUA 1MUEB 1TGBA 3F2GA 2TGTA 4BXWA 2NU0E 3LH1A 1EZSC 1EJAA 1GMDG 1ZPZA 4UE7H 4BTIB 4J2YB 3SU1A 2C93B 3O8BA 4ZKSU 5JB9S 1A5IA 3ZZ9A 2BQ7B 5T6GA 3QO6A 1GJAB 4K1TA 3RXJA 1MH0A 2O8TA 1DM4B 3SV8A 1BRCE 3KCGH 5KGOA 4ACAA 1HNEE 1S0RA 4HGCA 1LHDH 1TE0A 1AY6H 1UO6A 2BOHB 2AIQA 4KTSA 1C1NA 4ABFA 3BTTE 3BEFB 1O5CB 2LPRA 3E3TA 4A1TA 2PGBB 1PPZA 4GCHF 2HGTH 3VGCB 2OD3B 2TIOA 2HPQH 1S6HA 3GCHB 3OTPA 4GLYA 3GDSA 2OK5A 1LCYA 4B2CA 1WTGH 4R8TB 5C67A 1QRWA 3T5FH 2QXGA 2G00A 3F2FA 1SVPA 2F9UA 4ZAEA 4WMDA 3ATLA 3VB6A 1N8OC 1MBQA 2PHBA 3SOSA 4O3TA 5C3NA 1L4DA 4X2YA 1ZHRA 2M2AA 4LOYH 3LIWA 1C5PA 2FOFA 3M37A 2Z6BD 3A8DA 1GI0A 3TK5A 3UWIA 1NRNH 3PM3A 1C1QA 2BZ6H 1ELFA 5EU8A 1MTUA 2WPHS 1YPGH 2ZHEH 3RMLH 5FPYA 1P10A 2ZDAH 2ZPRA 3U9AH 3VXEH 5EXNA 1V2ST 2FOAA 4RKOB 2XNIA 3CS7A 3M7UA 1LPKB 2PUQH 1BHXF 1WCZA 4INKA 2JETB 2FLBH 1UVOA 5EPYA 2XYAA 3OFND 3SQHE 4IMZA 4FUHA 1GBAA 2FI4E 3SZEA 4I33A 3HKJB 2G52A 5SGAE 4JYVH 3N99A 1EP5A 2WYGA 4X8TH 3SJ9A 1GJ7B 1SQAA 2QCYA 1CHOG 2C8WB 3SBKA 3PLKA 5AVDA 3OU0A 1BA8B 1O32A 3BTDE 1HXEH 1O2IA 3MOCA 2GCTB 3SU0A 1B0FA 1KLIH 1ZSLA 1IQLA 4KP0A 2VNTA 2YMSB 2BY7X 1S83A 2BDYA 1GBLA 1WQSA 4Y8XA 1PQ5A 3RXAA 1UCYH 5GJ4B 1ZGVA 2QN5T 3GY4A 2ANYA 3ATWA 4X2VA 3PWBA 5BPEA 1XUJA 2VIDA 1BMMH 3SJ8A 4ABHA 1F2SE 1CT4E 5F6MA 1H8HD 3U1IB 3JZ2B 2G81E 1C1PA 1A5GH 3NZIA 1PJPA 1V2UT 1THSH 1AO5A 1ESBA 1Y3XA 3UY9A 1WSSH 3RUOA 1LVBA 2FI5E 1ZRBA 4RT0A 2R9PA 2P94A 1HRTH 1CBWB 2Q1JA 3GDUA 4Y71A 4UONA 3HPTB 1AZ8A 1FUJA 2HVXA 1OP8A 4CR9A 1AZZA 4CRGA 1LMWB 1RIWB 1L1NA 1UK3A 4YLUA 3FKSD 4A1XA 3QDZB 3KGPA 2W6JD 2GMTC 1AHTH 3M3TA 1AU8A 5ESBA 3IWMA 3RXKA 4BANB 1K21H 1SGCA 1S0QA 4KELA 1P3EA 4DJZB 3BIVH 4OS7A 2RDEA 4AYYB 2D2DA 4Z1MD 1BT7A 3PMJA 4WXVA 1SQTA 5EJ1A 5EOKA 1FZZA 4LZ1H 4RI0A 1GG6B 2BQWB 2V6NA 2ZDLA 2HNTE 1C1UH 1UTKA 2J95A 1C1WH 1UHBA 4NWKA 4CREA 5FX6A 2ZDNA 2L74A 1BMAA 2CK3D 1GHYH 4X6PA 4SGBE 1J15A 1NPMA 2ZFPH 2P3UB 2XNDD 1LVYA 3GOVB 4JCNA 1BITA 3R0FA 2YMSD 2BD7A 3T62A 1H1BA 1BBRE 2FIRH 2VWMA 3RXLA 2XTTB 2VH6A 1SFQB 4WXIA 5C1XA 3PTNA 1S84A 1F0TA 1Y8TA 2VBCA 2A31A 4YXWD 1PPCE 3FANA 1YCPK 1O3NA 4FU7A 3SHCH 3H5CB 1GDUA 1BCUH 1VR1H 2R0LA 1GI1A 1TABE 1C5YB 1W7GH 2FOEA 3RXSA 1SGFG
chains in the Genus database with same CATH topology
3RXCA 1O5BB 1EPTA 3LDXH 1CA8B 1GBKA 2AH4X 2A4OA 4XFQA 2JH0D 4X6NA 1IQJA 1S81A 4WJG2 5A0AE 3UPEA 2J2UA 4GPGA 4NGAH 1C5XB 5LH8A 1CQQA 3P6ZB 1A1RA 1MKXH 2SGEE 5E0JA 2PUXB 4NCYA 4ABGA 1D6RA 1TGSZ 5GCHF 2OC1A 1O31A 1TMTH 5HMAA 1KSNA 3SNEA 5HGGA 3ZYEA 3E0NB 4YLQH 3RLWH 4ABAA 1S85A 5LGOA 1NRRH 1VZQH 3PV4A 1KXEA 5BRRE 3T27A 4KTUA 3FVFB 1CSOE 4K8YA 1A3BH 3GCHC 1UVPA 1K1NA 1C5NH 1CT0E 1V2VT 1T7CA 1ZMLA 4CBOA 1GBIA 1DOJA 5GPIB 2O8UA 1HIAA 3R3GB 4D9RA 4CH2B 3A87A 3QN7A 2BVSH 3SV6A 8GCHF 1V2QT 1HJAB 1FI8A 1TQ7B 4YT7H 2AGEX 1GBCA 1XVMA 1OWKA 3ZZ6A 1WUNH 2YOLA 2PSXA 1O3PB 3LGWA 1MKWK 1B5GH 2IN2A 3M7QA 1SGEE 4BNRA 1GJ4H 4NG9H 1FPCH 1SGPE 4AGKA 2OXSA 3U1JB 1Z1JA 3E6PH 2VVVA 3M61U 2DUCA 3PWCA 3C27B 2ZQ2A 3ZZ8A 3MTYA 1D3PB 1RGQA 1ETSH 2ZI2H 2P95A 4UDWH 1TBQH 1VITF 1UK2A 1P03A 1P06A 4ZKNU 1NU9A 3EA9A 3LU9B 2ZC9H 1NU7B 1BRBE 4I8KA 3SU4A 1SGTA 2GV6A 2ZNKH 4YT6H 1K2I1 3TK6A 1Y5BT 2IPHA 1TQ0B 1ZTJA 1DLKB 4A7IB 3QLPH 1JIRA 1O5FH 4RN6A 1MAYA 3FP8E 8LPRA 1EZQA 4CRAA 1D6WA 3SGQE 3SZNA 2CF8H 3P95A 1SGDE 2ZECA 2GCTC 2UUJB 3RC6A 2GZ8A 2XBVA 1HJ8A 1T8OA 2O9QA 3I29A 4XBCA 4ZXXH 3SJIA 4WWYA 1ZSKA 1KIGH 4Q7XA 2ANKH 6LPRA 1E37B 5HYOA 3SGAE 1HLTH 3A84A 1IQKA 1ZOMA 4I8HA 1YPKH 1BTHH 1O3KA 5J4SA 4MNWA 3V7TA 1Z8GA 1GMHF 1N8OB 3SU3A 1SMFE 2OUAA 1O2UA 3JZ1B 1LVMA 3SUEA 1G3EA 4D7GA 1EX3A 1AGJA 3SN8A 4CRBA 3MH7A 3VPKA 1DS2E 1EQ9A 1OSSA 2A45B 3QGJA 3P17H 2A4GA 1CGJE 1QTFA 2CN0H 5L30H 1RIWC 2BXUH 7ESTE 1G36A 3TK9A 1XUIA 4IBLH 3SJKA 1GDNA 2TPIZ 1VITH 1TA6A 3OTJE 2YNAA 1PQ7A 2VIWA 2VGCC 5LPRA 3NWUA 4FUCA 3RXRA 3MFJA 1MZAA 1OXGA 5ETXA 1NZQH 3A83A 5B6OA 4YOIA 1O3IA 1ZR0A 2G4TA 1YLDA 2BY8X 1ELVA 4Y8ZA 3D23A 1GG6C 2GVFA 2O8LA 1KXAA 2STAE 1UHBB 5AHGH 2ODPA 1SOZA 1HBTH 1JXPA 3D49H 5A2MH 2ZP0H 1C4Y2 4Q80A 4DURA 3N7OA 2PR3A 3QK1A 1GJ6A 2ZQ1A 1FIZA 4FUJA 3QUMP 1O2WA 4NSYA 1C2KA 2HNTF 2IJOB 4FUGA 1AUJA 1CVWH 1YBWA 4WH6A 3MNCA 3RC5A 3A89A 1BBRK 1NFXA 2UUKB 3RLYH 4UEHH 3RM2H 1O3GA 1NN6A 1QB1A 4AOQA 3M36A 1H8IH 1PPFE 4O97A 2VIVA 2D26C 1GWAA 7KMEH 2R2WU 1GHVH 1BRUP 5AF9H 2A7CA 3HATH 1S82A 4O03A 5FHTA 3ENSB 1P09A 1ARBA 2A5IA 1QJ1B 1DANH 3NPSA 3KQBA 1C1SA 1W2KH 1A0JA 5DP5A 1BOQA 1EAWA 1GBFA 3MO3A 1IQMA 2BTCE 4Y6DA 1W12U 1TNJA 5JBBS 1OYQA 2EI7A 1EPTB 3RXPA 2AMPA 2BDAA 2SGAA 2Z94A 4CRCA 2VVCA 2ZDVH 3VB7A 1BMNH 1V2OT 1C2FA 3TH3H 3KQDA 4DVAU 1UTQA 3LOXA 5DP8A 4Q7YA 1L1GA 4I8LA 1WU1A 4TYDA 3RMMH 3UNRA 2VWNA 4TPIZ 4ISHH 2C8ZB 4GSOA 2PGQB 1G3CA 1QY6A 1OWIA 1A4WH 4NIXA 1T8MA 4I8JA 1OPHB 5DP3A 2GDEH 1HDTH 1A5HA 1QL8A 3SU5A 1TNLA 2BM2A 3A8AA 1O37A 2BHGA 1BTXA 4OS2A 1GVZA 2UWOA 5T6FA 4TWYA 2SGPE 1FY1A 1HIAB 1C2LA 2ZU4A 2M5TA 3ZZ4A 1H9IE 2FTLE 4FUEA 4GCHG 1WV7H 1J9CH 1LVOA 2FOGA 4ABIA 3PLPA 1BTZA 2AIPA 1OWEA 3F9GA 2OP9A 2XXLA 3S9AA 3SV7A 5JBTA 3UOPA 2PV9B 1O3JA 1PPGE 3DHKH 3SO3A 1C2HA 1G3BA 4MDSA 3RXOA 2ALVA 3BTWE 2OCVB 1T32A 1HFDA 4SGAE 3SU6A 4A5TS 1VCQA 2GTBA 1YPHC 2BOKA 1AVGH 4D8NA 4B76A 1U6QA 2ZU1A 3TPIZ 2Z9GA 1JRTA 3LGVA 2FESH 1AN1E 1GHAG 3TJVA 4QT8C 3MNXA 4TY7A 4IC5A 3P8OA 1XXDA 1Z8JB 3RP2A 5A0CA 3MH6A 5JDUB 4MQAA 4F4OC 1O35A 1W0YH 1MAXA 1AKSA 5C5OA 3A82A 3TJNA 1C1VH 1QFKH 3GYMA 2RDLA 1IQHA 1MTNC 1HAVB 1ACBE 4X8VH 3MWIU 1YYY1 4UFDH 1JOUB 1TX7A 3F9FA 5ESTE 5AFZH 3P92A 2IOTA 4VGCB 2FP7B 4NA7A 1TPPA 5EXLA 1GVKB 3LONA 2FMJA 3ZZAA 1O3CA 4ASHA 4NFFA 3CENA 3E0PB 1ELBA 1O5EH 1LQDB 4DW2U 1K22H 1GCTC 5DKMA 1QB6A 1O3OA 4GHQA 3ZZBA 3AAVA 5FPSA 5FBEA 1GHZA 3A8CA 5I46H 1W0ZU 4BAMB 1INCA 4XBDA 2GV7A 1EATA 4MPXA 1F5KU 3BIUH 3S9BA 4IW4E 2GZ7A 3K65B 1C5TA 5EQQA 4AFUA 1AE8H 1JWTA 1YC0A 1HAHH 1YP9A 2ZCLP 4NA8A 3E91A 4YOJA 4HFPB 1UVUH 1GDQA 3RDZA 1AMHA 2PTNA 4BTTB 3LC5A 3GDVA 3A7YA 1RTKA 1GHAF 3URCA 1QL7A 5T6DA 1NC6A 1AIXH 1L0ZA 1TNIA 2VH0A 2ZHDA 3ITIA 4INHA 3A7WA 1DWCH 3V12A 3D65E 1T4VH 2FODA 2WYJA 4MNYA 4K69A 1C2MA 1GHXH 1ELAA 4LK4A 1ZHPA 2V0BA 3OX7U 3ZVEA 5A8YA 4I32A 3L3TA 3A8BA 4HTCH 3ZZDA 2PKSC 4XSKU 1C2DA 1O39A 4FVDA 4UFFH 3K2UA 4WMEA 3BEIB 3U69H 1V2MT 1V2NT 1G37A 3F9EA 1UTOA 5TJXA 2SNWA 1TA2A 1FONA 2JH5D 1N1LA 2ZFRH 4FVBA 3U8OH 5A0BA 5GWZA 3S69A 2F9NA 1UMAH 4CHAB 3QZRA 1IQNA 2XC5A 4CBNA 3MNBA 2FYQA 1GHWH 1XKBC 3DT0H 3T26A 3TVJB 3PO1B 1RTFB 3Q3YA 3MU8A 1WOFA 1EAIA 3A7TA 1C2EA 4H42U 3UR6A 2WUCA 1F0RA 5DGJA 4Y7AA 1BJVA 3EA7A 1LPZB 5CMXH 1PFXC 4JZFH 4NZQA 4DCDA 3NK8A 1RXPA 2P59A 2DE8A 2OC0A 1AVWA 2EEKA 4A92A 1P05A 4ABJA 4H6TA 1GGDC 1NTPA 3Q77A 2JH6D 1EPTC 1TOCB 1GI6A 5L2ZH 1LKAA 3KNXA 1HAPH 1O2ZA 3FAOA 1HAOH 4TY6A 4Y0YE 2Y81A 4K2YA 2ANWA 2ASUB 3HGPA 4U32A 1BZXE 2VJ1A 2VGCB 1CU1A 1O3FA 2XC4A 3UOUA 1QBOA 1VCWA 9ESTA 2D1JA 3ZVFA 5F8TA 4K5ZA 3VXFH 1MKXK 2HWLB 1Z7KA 1QHRB 3GCOA 4ISLA 3BTKE 5HM2A 1AD8H 5GCHG 2H2ZA 1O0DH 3ZZ3A 4DY7B 3GY2A 3ZVDA 1AFQC 2WV4A 1BIOA 1QJ6B 2EI8A 3EQ0H 1Y3WA 3Q3KA 3TGIE 2C4FH 3BF6H 4UFEH 3P8GA 1W13U 1Y3VA 4FUDA 3RU4T 3UTUH 1AUTC 4U2WA 1AQ7A 3AVZA 2QF0A 1GI2A 1J8AA 2O8WA 1FN8A 2CXVA 1BTYA 3MHWU 1TPAE 1YLCA 1QJ7B 3L6PA 2R3UA 1O3LA 1G2MA 8GCHG 2FOHA 3O8CA 2XC0A 2BLWA 2ZPQA 2BY9X 1SGYE 5JPMH 1XUKA 4I8GA 4IN1A 1P2IA 5EQSA 4X1NU 5EGMA 5TCCA 1PPEE 3RMOH 1UVSH 1SG8B 1L1JA 3A85A 2ULLA 1O5AB 1V2TT 5E2PA 1VITG 2VINA 3BG4C 1IHTH 2FTMA 3SV9A 1TNKA 2ZPSA 3TLOA 2NWNA 1BMLA 3KN2A 4X2WA 1TRYA 1AKSB 1P2NA 1DFPA 1Y3YA 2J94A 2JKHA 3T2NA 3BTEE 3UREA 2OQ5A 3V13A 3EYDA 5JB8S 2BD3A 4B1TA 5EXMA 1BTPA 5GIBA 4Y11E 1GL0E 1HAXB 4NIWA 2ZU5A 1XKAC 1NY22 2O8MA 4VGCC 5DP7A 3AAUA 5DP9A 3SNBA 2Y5GA 3A7VA 3BV9B 5CHAB 4A1VA 3UR9A 1V2KT 2FO9A 3SV2H 6GCHF 4RSPA 3F68H 2NU4E 1SGRE 1WTHD 6ESTA 1UK4A 1AI8H 3TH4H 3GCNA 4AGJA 1A61H 2QA9E 2VB0A 1HPGA 1XX9A 3K6ZA 2BXTH 1WYKA 3KEEA 5EODA 2ZU3A 5JBCS 1EAXA 1L2EA 3LH3A 3ZV9A 4O9VA 3F9HA 3KL6A 4U30A 1A2CH 3BTHE 4B74A 1ZTLA 3GCTF 4ZHLU 4AFZA 4H4FA 1GMCF 2OQUA 1KLJH 3LPRA 2CHAB 1GMHG 1O2SA 2WUBA 4FXGH 1D3QB 1YCPH 4NIYA 4XE4A 1O2QA 5DPAA 1Z8IB 1DX5M 1G2LA 1YKTA 1OWJA 2BDGA 2NU2E 1D3DB 1HAYB 4IC6A 4JK6A 2ZEBA 1AE5A 1QGFA 3LGYA 3STIA 5K7RA 1MTWA 1MTVA 3VEQB 2GKVE 2UWPA 1LHEH 4AG1A 1UJ1A 2GP9B 1HB0B 3TNSA 2XRCA 3S7KB 5A8XA 3FFGA 3MU0A 1VGCB 3UNSA 1EXFA 5FPTA 3RC4A 3TNTA 1GBBA 1MTNB 4ZKRU 4CHAC 3ZZ7A 1FQ3A 1GBJA 3PMHB 3V0XA 1N6YA 3PO1C 3QTOH 1FXYA 1PPBH 2Z9IA 4CRFA 5HM9A 1GJCB 2PWXA 4OGYA 1C5QA 4MG3A 1ABJH 5L2YH 4Z0KA 1G3DA 2QV1A 2BB4A 5DO4H 4NIVA 5F8XA 4Q2KA 1V2LT 2A7HA 2CGAA 2TRMA 1GJ5H 4TWWA 3RM0H 1SL3A 1QQUA 2F9PA 1EJMA 2THFB 1TNGA 1NS3A 3D62A 1PQ8A 1DY8A 3OSYA 1TPOA 4K3JA 1BUIA 1ZZZA 1GCTB 2F9VA 1ZJDA 2ZDKA 3SHAH 2H6MA 1SOTA 4Z6AH 4RKJB 1CHGA 1RRKA 4OS6A 1UCYE 1G30B 3RXHA 1H8DH 3SNDA 1SGNE 2B5TB 1OX1A 5C1UA 1TLDA 3LKWA 4ISIH 3EGKH 3KHVA 2ZF0H 1WBGB 1BDAA 2TGPZ 1EJNA 1DSTA 1YGCH 1BB0B 2BDCA 1KDQA 1T8NA 1C5UA 3A80A 1DY9A 2V3HH 1EB2A 1FLEE 3GY6A 2ZHWH 3TGKE 2EA3A 3FZZA 4DGJA 2WPMS 1OWDA 1GBTA 1KXFA 1C1MA 4WMFA 4YZUA 1ETRH 3B9FH 2A2XH 1C9TA 5I25A 2ZWLH 2SGFE 1T8LA 1ELGA 3QGNB 1MMJN 1EUFA 1HAGE 4WH8A 1QL9A 1M9UA 4JZDH 4X8UH 4YTAA 2PKSB 1GBDA 2FX4A 1SLUB 3IG6B 4A6LA 1XXFA 1QURH 4I31A 2F3CE 3HK6B 1A0LA 2ZG0H 1H9LB 1SLXB 2XW9A 1UTNA 7LPRA 1ZYOA 2ZIQH 1H9HE 1YM0A 8ESTE 4MPVA 1A46H 3SNCA 4E05H 5TCAA 2YNBA 3FP7E 1VJ9U 3PTBA 3RXFA 1JBUH 2Y6TA 1ZLRA 3WY8A 2K1QA 3RXIA 1C2JA 2FI3E 2H9HA 1SHHB 1LHFH 1FV9A 5J4QA 1XUHA 1F5RA 3GICB 1D3TB 2BZAA 1ANEA 1ZTKA 3QTVH 4DIHH 3Q00A 3BG8A 5FBIA 2SFAA 1D9IA 2ZGBH 4WF8A 1TMUH 2GCHF 1Q2WA 4Y7BA 1THRH 4JZIA 2AERH 3I78A 3A7XA 2AGGX 2J4IA 3RXDA 1GGDB 1K1OA 1WAYB 1LHGH 1QA7A 2OBQA 3AASA 2ZCHP 1NFUA 2QXIA 2W7SA 1RTLA 1T31A 1BHXB 4B73A 8KME2 1PPHE 1F92A 3OY5U 5E8EH 2H1UA 3SORA 4BAQB 2B8OH 1Q31A 1MCVA 3FP6E 2VIOA 1CA0C 1KXCA 1TIOA 3QZQA 3RU4D 2J9NA 2PLXA 2WINI 3QWCH 3M5MA 3UQVA 1A0HB 1ANDA 2HNTC 5CHAC 1IHSH 2I6SA 2XWBI 2A4QA 2ZFFH 1O2PA 2NU3E 1AFQB 1O2LA 1Z8RA 2OC7A 1C5ZB 2BD4A 1O2TA 1XM1A 3SI4H 2SNVA 3UUZA 2TGAA 1OS8A 2W7UA 7GCHG 5E0GA 4MVNA 1HUTH 2XWAA 3HGNA 1ZJKA 5LPEA 2QXHA 1V2PT 2BLOA 2CJIA 2WPKS 3DFJA 1OP0A 5G4BA 1IQIA 3MU4A 4O3UA 1ZSJA 1BQYA 3OYPA 1K1JA 1BBRH 2ZGXH 1GI5A 3EDXB 2QF3A 4Y10E