1ELDE

Structural analysis of the active site of porcine pancreatic elastase based on the x-ray crystal structures of complexes with trifluoroacetyl-dipeptide-anilide inhibitors
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
240
structure length
240
Chain Sequence
b'VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ELASTASE
publication title Structural analysis of the active site of porcine pancreatic elastase based on the X-ray crystal structures of complexes with trifluoroacetyl-dipeptide-anilide inhibitors.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Hydrolase/hydrolase inhibitor
total genus 59
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1994-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1eldE02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1eldE01
1G2LA 1RD3B 1S81A 1LVBA 3PB1E 4Y71A 1SHHB 1GJ4H 3FVFB 3TIUA 2PFEA 1TALA 1ESAA 1LKAA 3MU8A 3RU4E 1GI0A 4YM9A 3B23B 2O8UA 8LPRA 1XXDA 1C2LA 3GCOA 4WVPE 4KELA 1Z8GA 4A5TS 3CP7A 2QC2A 5JB8S 1K1OA 3IWMA 4INHA 3E0NB 1Y3YA 4WH8A 1LTOA 2W7UA 2Y82A 1TPAE 1AU8A 4CRFA 1AE8H 3VB6A 5HYOA 4KTCA 1IQLA 1TGSZ 2UUJB 1S0RA 3H7OA 2GMTC 3G01A 1HAXB 3KQEA 3M3VA 4B2AA 3SV2H 5GWZA 1SLWB 2NWNA 2PUQH 3PYHA 4NA7A 4J2YB 2NU2E 2FTLE 1ORFA 1GBHA 3CS7A 1A46H 3LT3A 2KAIA 4I32A 3ATIA 1LQDB 1ID5H 2B0FA 2STBE 5FPTA 2VWNA 1NROH 1DICA 2FIRH 1RGQA 4UDWH 2R0KA 4LOYH 4MPUA 5LPRA 1BHXB 2EI7A 3AW0A 1P01A 4VGCB 1AFQB 1J9CH 1UHBA 4NGAH 1O2VA 1BCUH 7LPRA 3QO6A 1YPKH 4OGXA 1G2MA 2XWBI 5TCAA 2ZDVH 1TOCB 1BUIA 1Q2WA 3M37A 1OOKB 2WUCA 2ANYA 4IGDA 3RP2A 4GSOA 4Y6DA 2AH4X 1GMHG 1MTUA 1CHGA 1SGEE 2W7SA 5L30H 1MTVA 1LQEA 3PROA 3HK3B 3LIWA 4ISNA 1DWDH 2SGPE 5J4SA 3GCTF 1O3DA 4DVAU 2FP7B 3A87A 3BF6H 2HNTF 1JRTA 1NFUA 3BTKE 4X1SU 4BTTB 1IQJA 1DY8A 1S6FA 3STJA 1QGFA 2TRMA 2ZTYA 1IHTH 1TQ0B 6LPRA 1V2LT 3GCNA 1GVLA 2SGFE 2BDGA 1DFPA 3UWIA 3FP8E 5F8ZA 3MHWU 2BMGB 2BM2A 8KME2 1B0EA 1GBIA 3E6PH 1H9IE 1MKXH 1O3EA 1ZHMA 4IW4E 1O3LA 2ZP0H 2GZ8A 3ZVGA 1C5TA 3AW1A 3L33A 1LVOA 2FPZA 2HPQH 1OKXA 3HGPA 2XBYA 1RIWB 4LZ4B 1OWDA 2ZHEH 5C3NA 4NG9H 3EAJA 1VGCC 1E37B 1L0ZA 1P2MA 3ODFA 4ZHMU 1O2LA 3M36A 2P95A 3TGJE 4X2XA 3V7TA 1BDAA 2XBXA 2PGBB 2Z9LA 2VWLA 2ZI2H 3HGNA 2W3IA 5B6OA 2UWOA 1PQ8A 2CHAC 1YM0A 1D4PB 3GDVA 3BTQE 2AGGX 1MD8A 2EI8A 3HKJB 3I29A 1TNIA 3GDUA 1C9TA 4JZEH 3RC6A 4IC5A 5LPFA 4MNXA 4ISHH 1D3DB 2BDAA 1Y3WA 1EZQA 2Q6GA 1W8BH 1YPHC 3IITA 4ABGA 5C1XA 3A8CA 2UUKB 1AY6H 4IMZA 3LGVA 5DKMA 3DD2H 1CSOE 1O33A 1IHSH 1PQ7A 1GBEA 1YGCH 4GHQA 3SJ9A 1QIXB 3ATLA 3GICB 4MLFB 5EGMA 1HIAA 1FY4A 1MBQA 3LGYA 3OTJE 3QGJA 1HAPH 1O2ZA 1TONA 1QL8A 1ZHRA 3BTME 1BTYA 1V2RT 2QY0B 1W3CA 2Y5GA 4OS7A 3SJ8A 3SU1A 2QXJA 1FAKH 3RMMH 1XM1A 2F9UA 3MNXA 2BD5A 2ZDNA 2ZU4A 2XYAA 5FXLA 2FYQA 4R8TB 3A83A 1S5SA 1GBAA 1CO7E 3KNXA 3QX5H 3GCHC 3SN8A 1ANBA 4XOJA 1YC0A 1ZGVA 2V3OH 1BTZA 1CQQA 1O2SA 2BLVA 9LPRA 1MKWK 3RXAA 3RDZA 2BQ6B 2D26C 4ESTE 4XBBA 1SQTA 4IC6A 2VU8E 1EP6A 2YOLA 2B8OH 2BHGA 2JH5D 3UNRA 3QUMP 1BJUA 3M7UA 1O3IA 2BZ6H 3RLYH 5AFZH 3NK8A 1WAYB 1AMHA 3RM2H 1MBMA 3SNDA 1Z7KA 2BD7A 1O5DH 1FUJA 1AB9C 3JZ2B 1BTPA 3A7ZA 1Z71A 4YOGA 3SU2A 1WTGH 4JCNA 2Z6BD 5E0HA 1FY3A 1EASA 1V2KT 4BANB 3UOPA 5GCHG 3GYMA 5EXLA 1SGFA 1LPZB 3GY3A 1CE5A 2O8LA 1F0SA 1HDTH 4B73A 1OWHA 3MH7A 2BYAX 2ZU1A 2XRCA 2ZPRA 1QJ6B 2OTVA 4AFQA 1G3BA 3GY5A 2PW8H 1DSUA 5G4BA 4B2BA 3M5OA 3VB4A 1RS0A 4UEHH 4KKDA 1SSXA 3H7TA 5JBCS 3M35A 1T8LA 3BIUH 1JRSA 1MQ6A 4UFGH 5JDUB 4IS5A 4OGYA 5EXMA 1C5LH 2G5NA 4WXVA 3TLOA 1OWJA 1O35A 1GBLA 1W12U 1THRH 2F9BH 2Z94A 1ELVA 4NWKA 1AKSA 2J2UA 2H2ZA 4K1SA 3LGWA 2CF9H 4TPIZ 3GOVB 1IQFA 3ZYDA 3TJNA 1AN1E 1HAHH 3GY7A 2VIPA 2ODYB 1DVAH 1NZQH 3MH5A 1T31A 2A0QB 3UNSA 2G00A 2P3FH 4ZROA 3UR9A 1GHAG 1BOQA 1EJMA 4BXWA 1BQYA 2R2MB 5C2ZA 1Z6EA 1L1JA 3M5NA 2TGPZ 3A89A 1C2MA 1G3EA 4H42U 3VXFH 1L1NA 4X8UH 4B71A 5GCHF 2ZGCA 5CHAB 2AYWA 2DE9A 2NU0E 1C1RA 1KXEA 2G4TA 2ANMH 2VGCB 1O3CA 1G30B 2VIDA 3QZRA 2ZKSA 3E0PB 1BHXF 1J14A 4ZKNU 1GL1A 1FY8E 4ZXXH 1TNKA 1FLEE 2DE8A 1ZSLA 3RMNH 3URCA 1J15A 1FAXA 2NU4E 1WOFA 1W14U 1SQAA 2EEKA 1LHGH 1QB1A 2A2XH 3P8FA 4X1QU 1HAVA 1KIGH 1YKTA 1XUJA 3TJOA 5T3HA 1SC8U 4Y76A 1LKBA 3OYPA 1C5MD 1KXFA 2WINI 1QR3E 5A0BA 1O39A 5A8XA 1SGTA 1ELBA 1FI8A 1C1SA 3A7WA 1C1WH 3T62A 3WY8A 4ABIA 2AFQB 1WTHD 1CBWC 2D2DA 2BLWA 1A0JA 1KXCA 5DJ7A 4CHAB 1ZTKA 1PPCE 1QCPA 1A3EH 1A5GH 1CGJE 1PPGE 1S83A 1IQNA 2FYRA 5LGOA 3A86A 1RXPA 2OC8A 2VIQA 1Z6JH 1PPEE 1WQSA 2AMQA 1VITG 4X6MA 2VIWA 1TRNA 1TRMA 2UWPA 3KN2A 4YOJA 1Z1JA 4BAHB 2FEQH 2BD8A 2BY5X 3OY6U 4CRDA 1C2FA 1B7XB 1QL7A 2P3TB 4MPVA 2GVFA 5A09A 4OS5A 1KXBA 4B2CA 4AOQA 5AHGH 3ODDA 1KYNA 1FN6A 2UWLA 1P3EA 2ZWLH 4AX9H 4WH6A 3SJIA 2O8TA 2CF8H 1O3MA 1SGRE 3UY9A 1ZSJA 1SHYA 4NA9H 3UREA 4WMDA 1F5RA 1GI7B 1C1PA 2PKAB 2BVXH 3RXMA 1MTNB 3LGUA 1HB0B 1O5FH 4CH8B 6GCHG 3JZ1B 3W95A 3F68H 1HCGA 1P11E 4OS4A 3PTBA 2F9PA 2ZU3A 1C1MA 1H9HE 1GCTB 3Q3KA 1UTJA 3ZZ3A 3BG4B 1V6DA 2HWLB 2ZCKP 3MFJA 2RA0A 3TNSA 1TBZH 3V0XA 1O2OA 2QXIA 2BQWB 4K8BA 5HM2A 3UUZA 4THNH 3SV8A 3RXIA 5JBBS 1QBNA 3O8RA 4DW2U 1ZPZA 1EZSC 2TIOA 3D65E 1DM4B 5HM9A 3A82A 1K2I1 1SG8B 4Q2KA 1NN6A 1O3KA 1CA8B 2C8WB 8GCHF 3VFEA 1LO6A 2BY6X 3S9BA 2G8TA 3UTUH 4OS1A 1CGHA 1S0QA 2ZIQH 4K69A 3PO1B 1DWBH 1T8MA 4E06H 5FHTA 5EXNA 1IQIA 1FY5A 1GVKB 1DWCH 1GCDA 2ZQ2A 4A6LA 4DIIH 2Z9IA 1GJ5H 5FBEA 1C4V2 1TNGA 1AWHB 4Z6AH 4YT6H 3BTFE 3SJKA 1JWTA 5DP9A 1GBDA 3TK6A 2CXVA 2O8MA 1HBTH 2HNTC 5H4IB 1GG6C 1QFKH 2ZHFH 3ATWA 2FZZA 5FPYA 5FCKA 1XUIA 1T32A 4K5ZA 1MH0A 1F92A 4NIXA 1MUEB 4INLA 1SGYE 3SQHE 3T27A 5LPEA 1NTPA 1VCQA 5I46H 5DP4A 1UCYH 3E90B 3LKWA 1F0TA 2TPIZ 1EX3A 2A2QH 1VJAU 2A31A 3KL6A 1YCPH 3OSYA 3SUGA 2G55A 1NRQH 4MQAA 1RTFB 1NFXA 1AIXH 2ZDKA 3RXDA 3SU0A 5A8ZA 5DP3A 3MU4A 3SGBE 1TOMH 1N8OB 4Y11E 3N7OA 1HPGA 1TGTA 2ZFTA 1GPZA 5EQRA 3LC3A 2WYJA 3MOCA 2ZA5A 2EI6A 1BBRK 1AZZA 5DG6A 5K0HA 2R2WU 2OQUA 3LC5A 2WV5A 3RU4T 2ZNKH 4NSVA 4UFEH 1IQEA 2XCFA 4ZH8A 2FOAA 1QQUA 3UR6A 4NZLA 3M3SA 4ABBA 1K1LA 4O3UA 3A8AA 1P57B 3RMOH 1BT7A 4FXGH 4GPGA 1OX1A 2QA9E 4AFZA 1AWFH 1HJAB 3URDA 3P95A 2ULLA 2SNVA 4X0WU 1BMAA 3E8LA 2QXHA 2BOHB 4FUFA 1K1IA 1GBCA 2GMTB 5J4QA 1O3PB 1OP0A 1ARBA 4TYDA 1GJ6A 4A7IB 4B76A 2GV6A 4X6OA 1FZZA 1W0YH 2HVXA 4X6NA 2VWOA 3DT0H 2ZPSA 2H9HA 2GT8A 1YYY1 4I8LA 1PYTC 1LPGB 1C1OA 3SNEA 1KDQB 1HRTH 1GDNA 5EU8A 4M7GA 1P06A 3D23A 1C5QA 5HGGA 1BTUA 4JMYA 1O2GH 3K6YA 2FX6A 1D6WA 4Y79A 4GCHF 1HAYB 4ABJA 1P02A 1P9SA 3Q00A 3ZZ6A 4DG4A 3KGPA 2Z3EA 2ZZUH 4AGJA 3KQCA 1V2OT 1Y3XA 4GLYA 1UTPA 3LGTA 1D3TB 2QN5T 1TABE 1ZMLA 1GI6A 4NIYA 1GHVH 3GCTG 1BRAA 1O5CB 1MU8B 4ZXYH 3A88A 1D6RA 1HJ8A 4HFPB 4JZIA 1HFDA 2ALPA 1SGFG 1YPMH 1SQOA 4YT7H 4FU7A 3BTHE 3GY4A 4Y7AA 2PKSC 3TK5A 4CBNA 1BB0B 1V2PT 2PR3A 1EOLA 1O2IA 4I33A 4FUHA 2J4IA 3MNCA 3SHAH 1C1TA 2PV9B 3KIDU 1W2KH 1MQ5A 3SNAA 3BV9B 4UD9H 1NU7B 3RXLA 1NRNH 1THPB 3RXCA 4YOIA 1DLKB 2GKVE 4X1NU 1O37A 5T6GA 2Y7ZA 2ZCLP 4Q7XA 1MAXA 3M61U 1C5UA 1UVUH 1BMMH 3PMHB 3RXOA 1K22H 1SLXB 1PYTD 4H6TA 1FV9A 2WPMS 1QURH 2CN0H 1JBUH 1VGCB 1W7XH 2Z9GA 2FWWA 2FOEA 3ITIA 5FX5A 1B5GH 5I25A 1XXFA 4NIVA 1IQGA 1Z1IA 3P8GA 2BLOA 2VH0A 1A0LA 3T25A 2STAE 3MMGA 3E3TA 1LHDH 2I6QA 1C2GA 2WYGA 5L2ZH 3RXUA 1UTQA 1H9LB 2OLGA 1O2YA 1GGDB 1NS3A 4K8YA 2FOBA 3SJOA 4BAMB 4CR5A 1ZR0A 2ZO3H 2Y5FA 3F9GA 2AMDA 5GPIB 4NFFA 2LPRA 1WQVH 3KEEA 6CHAC 2FLBH 3RXRA 4AZ2B 1A5HA 1MKXK 3VGCC 1MMJN 2W26A 4JYVH 2RG3A 2XC0A 3W94A 4ZHAA 1SGPE 4NSYA 2ZFSA 1PJPA 3MU0A 1WSSH 1P9UA 2H9EH 1DXPA 2ZFQH 1C5NH 1GJDB 1AGJA 4VGCC 1A4WH 1CU1A 2TGDA 1HAIH 1RTLA 3STIA 4JZFH 1ZGIA 1S84A 1C5YB 3NCLA 3A81A 1P2JA 4FUEA 1Q3XA 1PPBH 2GX4A 4INKA 2ZFFH 2OP9A 4A1VA 1FNIA 1YPJH 1Y3VA 3SUEA 1N1LA 1UJ1A 1J16A 4ZKRU 2V0BA 1TAWA 1EPTA 3ZZ7A 1FDPA 1KLJH 1IOEA 1QHRB 2VIOA 5DP7A 4CRCA 4ZKOU 1XVMA 4RKJB 1E35B 1FN8A 2ODQA 1HAGE 1V2QT 4XBDA 1WV7H 3CS0A 1SB1H 1HAZB 4WY3A 1ZMNA 1HJ9A 4LK4A 2JH6D 1EJAA 2QV1A 1C2KA 3R0FA 4XFQA 1C5XB 1GBFA 4YLUA 4GAWA 1BA8B 2HGTH 3ESTA 3S7HB 3NZIA 4DIHH 2BDHA 1ZPCA 3U98H 1O2QA 1KY9A 5C5NA 1SVPA 1YBWA 4B75A 1RIWC 1AD8H 3O8BA 4AYYB 2PGQB 4AG2A 1QA7A 4AB9A 1K1MA 1P2NA 1DITH 1AHTH 1YPEH 1YLCA 3LU9B 2AERH 2ZDAH 1V3XA 2Y7XA 3KQBA 3MU5A 4FUBA 2ZHWH 3A8BA 1FMGA 4BNRA 1P03A 1O3GA 1M9UA 2G52A 2FI4E 1A1RA 1GHZA 1DDJA 1G9IE 1JMOH 4NZQA 4MNWA 1C4Y2 4K3JA 2G5VA 2THFB 1J8AA 2ZGHA 1BBRE 2ALVA 2HOBA 4O97A 3O8DA 3K6ZA 2KAIB 3Q3XA 2Q1JA 1MKWH 4I31A 2JETB 4BAQB 5IYTA 1TBRH 1TFXA 1W7GH 1XKAC 2P94A 3S69A 1CA0B 1GMDF 3S9AA 3UPEA 1HLTH 4TWWA 3AAVA 2K1QA 1UHBB 1UO6A 4LZ1H 1L4ZA 1GJ9B 3NKKA 1EKBB 5F03A 2GCHF 3NUMA 2I6SA 3DFJA 2YNAA 2IJOB 3EE0B 3U69H 3UNQA 3C1KA 4DOQA 1F5LA 1V2WT 3PLKA 1MCVA 1T8NA 4CRAA 5JB9S 2A5IA 4R0IA 4Y8ZA 4ZUHA 3AAUA 3T5FH 1ZRBA 2BX4A 4Q80A 1GJCB 1TNHA 1TPOA 2XW9A 2P8OB 1C5WB 4IMQA 4X8TH 3MNBA 5EQQA 3EGKH 1KTTB 2HPPH 3VB3A 1G3CA 3MH4A 1BRBE 3M7QA 1ZZZA 2CMYA 4Y0YE 1GWAA 1ZTJA 3TPIZ 1SBWA 3ZYEA 3U1IB 3ZVEA 1W0ZU 3D49H 1W11U 3GISB 4JYTA 3SI3H 1V2ST 2PSYA 2ZU5A 3FZZA 3E1XB 1ELGA 1YLDA 3AVZA 3LJOA 4YZUA 2B7DH 4JK5A 1O2MA 1O2HA 3M3TA 1C2JA 4AGKA 1HUTH 1GHYH 2CGAA 1GBBA 2C90B 2Y5HA 4K1EA 1SL3A 2VB0A 2A4OA 1EB1H 1P2IA 2FLRH 1BTHH 4ZHLU 1ZOMA 1P04A 1V2JT 1UK3A 3BIVH 4GUXA 5E0JA 1ETTH 2C8XB 1P0SH 5PTPA 3P17H 1SMFE 5EPNA 1E34B 2RA3A 2ODPA 4DGJA 4F4OC 3ZZDA 3SU4A 1ZMJA 1GBTA 4X1PU 3RXBA 2H5DA 2XC5A 4AORA 3EYDA 2AMPA 1CT4E 3TH3H 1EAXA 3QWCH 2A4QA 1WU1A 1C5OH 1ZSKA 1C4U2 2AEIH 9ESTA 5DGJA 2VJ1A 2BDYA 3QGNB 3UQVA 3EA8A 1TX7A 2J34A 3PMJA 2ANWA 4WMEA 1TMUH 4H4FA 1DPOA 2ZTZA 1HIAB 4YO9A 1KSNA 2Y81A 4FU8A 2CV3A 4A1TA 2M5TA 1IQMA 4KTSA 1Z8RA 4K2YA 2O8WA 3ELAH 4FUJA 1TWXB 1EOJA 3DHKH 5EG4A 4D9QA 2FS8A 4AYVB 4X2WA 4Y8YA 1O5BB 1TRYA 1AQ7A 2BY9X 1TNLA 5IDKA 2FO9A 8GCHG 4NA8A 3RXHA 5TJXA 2OBQA 2XXLA 1OWEA 4BXSA 1AVGH 4HI3A 3GY2A 1TE0A 2D1JA 3BTGE 1P3CA 2BLQA 1EPTC 5L6NH 3TGIE 4HZHA 2C8ZB 3SUFA 2BDBA 2VINA 4MPWA 5CHAC 3Q3YA 1ELDE 2FS9A 4XDEA 1XUFA 2ANKH 3F1SB 3SNBA 5FAHA 3KCGH 1NT1A 3A8DA 4AB8A 1O2WA 4SGBE 1O3FA 2A32A 5AFYH 2JKHA 1N6YA 2A1DB 1GHWH 2Z7FE 3PMAB 4MDSA 3P8OA 2XTTB 1KDQA 2P3UB 4Q7YA 1P12E 1TX8A 3EQ0H 1ARCA 1TPSA 4DT7B 1GI3A 1C1NA 3GY6A 3H5CB 3MU1A 2V6NA 4JK6A 4FVBA 5L2YH 1A5IA 1GI4A 2GGVB 1NY22 2AS9A 2QGRA 3TU7H 2GCTB 1QBVH 1PQAA 1DSTA 1UVSH 3RLWH 2FOFA 3VB7A 1O3OA 1EJNA 2GTBA 3S9CA 4ABEA 1NFWA 1YPLH 4UE7H 3F6UH 4CHAC 4A92A 1KLTA 2ZFPH 5E8EH 1FQ3A 1XUGA 1TLDA 1O32A 1UMAH 1MU6B 2FX4A 4TPYA 2PHBA 2QAAA 2EC9H 3ZZ5A 2FOGA 1KLIH 5A2MH 3ZVCA 1O3AA 3LH1A 1BITA 4U01A 2IN2A 3PTNA 2HNTE 3SV9A 1NPMA 1A61H 1LCYA 1OYQA 5CMXH 1EATA 1GJAB 4IBLH 1O5GH 3PWCA 2GP9B 5FBIA 4ABDA 2C93B 3BEFB 4I7YH 2A5KA 1K1JA 2FXRA 2ZTXA 3T29A 3FP7E 4GHTA 8ESTE 1IQHA 3DUXH 5GIBA 4YLQH 1RFNA 1MTNC 5EODA 4AFUA 1AUJA 1HXFH 5ESTE 4AFSA 3IG6B 2ZQ1A 5FX6A 1ACBE 1GJ8B 5FPSA 3SI4H 3ZVFA 1HXEH 1AI8H 1GI1A 1SGQE 3T2NA 3B9FH 2FODA 1GCTC 2ZDLA 3BG4C 3BTWE 1LVYA 2Y80A 1O2XA 1UCYK 4CH2B 3SV6A 2QCYA 2GDEH 3SZNA 3ZV9A 7KMEH 3MTYA 1MAYA 4D7FA 5DP8A 2OUAA 1YCPK 4X2YA 1UVTH 4GCHG 5C5OA 1P8VC 3RXVA 2IPHA 1KXAA 1NM6A 4RSPA 3TJVA 1SGCA 1HAVB 2GD4B 1EZXC 3BTTE 3QN7A 1O2KA 1U6QA 1GJ7B 2SGEE 1BBRH 3QTOH 5EOKA 3PO1C 3L3TA 3P92A 4XE4A 4U32A 4ZAEA 2F9NA 1EP5A 3MO3A 1V2TT 2A7CA 1NRRH 2PSXA 1QQ4A 2FDAA 5C1UA 3RXPA 2BD9A 1CHOG 2OQ5A 1DANH 1OS8A 4JZDH 3P8NA 3SV7A 1EUFA 1K1PA 1QJ7B 1TQ7B 1VCWA 4NWLA 3B8JA 3TJUA 2J92A 2A45B 3SNCA 2GV7A 2F9VA 2GZ7A 1B0FA 3L6PA 3I78A 1BTWA 4JYUH 5ABWA 4NCYA 4D9RA 4ABHA 2Z3CA 5HMAA 4BOHA 1BRCE 3RC5A 2VVVA 1GBJA 1O2NA 1QA0A 1K28D 1DY9A 1SOTA 1HAOH 2VIVA 1BZXE 2XBVA 5A0AE 1MTSA 5C20A 3TNTA 3ZZAA 2BY8X 2JH0D 1S85A 5JBAS 4RN6A 4DY7B 1C1VH 5CE1A 2OC0A 3QDZB 3ZZCA 1K21H 1TB6H 3TH2H 3RXJA 2TGTA 2FESH 2J9NA 1KXDA 4BAOB 1SFQB 3KHVA 2G51A 4NIWA 1SGIB 1DT2A 5EW1H 1SFIA 2BVRH 4CBOA 1BMNH 3F9EA 1O36A 1EAUA 3BG8A 1O3JA 3V3MA 1QB9A 1CHOF 1S6HA 3M7TA 4NFEA 1AFEH 3F9FA 4X6PA 1E38B 2UUYA 4O3TA 1PFXC 4B74A 1C2IA 1YP9A 1D3QB 1ZLRA 1H4WA 1HJAC 2PTNA 1NRSH 1EQ9A 1QBOA 5BRRE 3M5LA 2HLCA 1SPJA 3SU6A 1V2VT 2AIQA 1EAIA 1ZTLA 1WBGB 4MPXA 1O0DH 1THSH 3RXTA 4K1TA 3VEQB 3A7TA 1E36B 3ZZ8A 2SGQE 3MNSA 5DK1A 4WMFA 1FPHH 1XKBC 1TA6A 3BEIB 7GCHF 1P09A 1UVPA 1MCTA 6CHAB 3T28A 1C2DA 2F91A 3FP6E 3RXQA 2VNTA 1TGNA 3VGCB 1EXFA 1YF4A 2AIPA 2RDLA 1L2EA 2XC4A 3E91A 4F49A 5EW2H 1CT2E 1FIWA 1GMCG 2ZHQH 2Z9KA 4CREA 1O3NA 3K9XB 5F6MA 3BN9A 2P59A 3SBKA 3Q77A 1O31A 2J38A 4XBCA 3SORA 3MWIU 4BTIB 3TK9A 2BD4A 2CHAB 1NFYA 1FJSA 2OXSA 3BSQA 4Y10E 1Y5BT 1T4UH 3E16B 1O2RA 1RRKA 1MZDA 4U30A 4ISIH 2Z9JA 3UQOA 1VR1H 3BTEE 1O38A 3ZVBA 1ELTA 2BD3A 3RU4D 2ZFRH 2R3UA 2W3KA 1IQKA 4YTAA 1IAUA 1UTMA 3FAOA 1HYLA 3P6ZB 1GHXH 4UFFH 3RXSA 5K7RA 4H6SB 1SLUB 1XVOA 1T7CA 1K1NA 5JYIA 4E05H 1OXGA 1AVXA 2C8YB 1DXWA 1D9IA 4Y7BA 1AFQC 4I8GA 2AGIX 4Z0KA 2F3CE 3VXEH 1YCPM 1HV7A 2BD2A 2B5TB 1SGDE 5T6FA 1GMCF 1JOUB 1YPHE 3BTDE 3P70B 1C2EA 2C4FH 4E7NA 1C2HA 1LHCH 4MNVA 3GCHB 2FOMB 3VB5A 1GMDG 2LNCA 1TIOA 2J94A 1GMHF 3A7XA 3FFGA 2SGDE 1OP8A 1GGDC 1SI5H 3BEUA 4IN1A 1OP2A 3RXEA 4KTUA 2OBOA 2GCHG 3PMBB 2QF3A 4OS2A 2ZECA 1AB9B 5E2OA 1TGCA 3I77A 3PWBA 2WPKS 2ZDMA 4WJG2 1ZRKA 1O3HA 2PTCE 3A85A 3LH3A 4FU9A 2BZAA 1AZ8A 1BIOA 1CVWH 3QTVH 1G36A 1QJ1B 4MG3A 2A7HA 1P05A 1OWKA 1OPHB 3U8TH 2OC7A 1UCYE 1QRZA 3ATKA 3LJJA 3RXGA 3S7KB 3MI4A 2VWMA 1T4VH 1C5PA 1W10U 3FZDA 1Z8JB 3DA9B 4X2VA 4O03A 2OCVB 1N6XA 2R0LA 3NXPA 2SGAA 2P93A 3RXKA 3TVJB 3NWUA 1QY6A 3ZZ4A 1NO9H 1UTLM 4ABAA 5FCRA 1A3BH 1SOZA 4TY6A 1P2KA 3SHCH 3C27B 5T6DA 2ZGJA 4WF8A 1H8DH 3VPKA 3RC4A 1FIZA 4FUCA 2AGEX 4CRGA 2QF0A 1EB2A 2XBWA 2HALA 2PKAA 1J17T 1TBQH 1AVWA 1BTXA 1FONA 2FI5E 3LONA 5GDSH 2HRVA 2NU3E 1DOJA 2FOHA 6ESTA 1DUEA 1RTKA 1CGIE 3GDSA 1V2MT 4YESB 4Y8XA 3SU5A 1WYKA 1QRWA 2BXUH 1L1GA 4GVUA 1GDQA 4JZ1A 1O2TA 4TWYA 2NU1E 1O34A 2ZCHP 4DJZB 4LXBH 2VVCA 1ABJH 1BRUP 1O30A 3U1JB 1O5AB 1ZHPA 3OU0A 3PV4A 3PLPA 2BXTH 5E2PA 2WPLS 1O2PA 1H8IH 1OSSA 1F0UA 1ZYOA 1ESTA 3SU3A 1MTWA 3CENA 1DWEH 1F5KU 2BQ7B 4ISOA 3K65B 4HTCH 1XMNB 3GY8A 4ZKSU 3U8RH 1PPHE 1PQ5A 2A5AA 3SO3A 1ETSH 3Q76A 4UONA 1DX5M 3A7VA 3KQDA 1X7AC 4PROA 1O3BA 2JETC 2Y6TA 4Y0ZE 1T8OA 4XSKU 1GJBB 2OD3B 2V35A 1GHBG 1CBWB 1CA0C 1RJXB 3OX7U 2BX3A 4ABFA 1ELEE 4FUDA 3OY5U 4J1YA 3TGKE 1C1UH 1LMWB 2P16A 2OC1A 5A0CA 3QLPH 1C5ZB 4TY7A 2FM2A 3PM3A 1P2QA 1VCPA 5AF9H 3U9AH 1QNJA 3GYLB 7ESTE 1ANDA 1SR5C 2QIQA 2G81E 2OINA 2ZEBA 4I8JA 4QT8C 1C5VA 1ELFA 1PPZA 1EPTB 3HKIB 2GT7A 1C5SA 1DLEA 2P8OC 1A0HB 3ZZ9A 3MO9A 1GI8B 1ZJDA 4I8HA 1DUAA 4A1XA 1MZAA 1F0RA 1ABIH 1S82A 3O8CA 5DP6A 1LPKB 1PPFE 3AASA 1ELCA 2C3SA 3UIRA 3FANA 4AN7A 1V2UT 1BJVA 1INCA 1P10A 1XUKA 2ZGXH 3DFLA 1VZQH 1JXPA 1YPGH 1OYTH 2RCEA 3MYWA 1ZJKA 1DS2E 1ESBA 3QZQA 4BAKB 4OS6A 4O9VA 3TITA 1TNJA 1O2UA 1GHBF 3QK1A 1TGBA 3UFAA 1Z8IB 2B9LA 1Y59T 1CT0E 1LDTT 4FUGA 1ANEA 4ASHA 4MTBA 3ZVAA 2Z3DA 1G37A 1GHAF 4U2WA 2BB4A 2VGCC 4ISLA 2R9PA 3ZZBA 2BOKA 2GZ9A 1NESE 1TMBH 1SLVB 1L4DA 2R3YA 1Y3UA 1KTSB 1SGNE 4CR9A 2F9OA 1UTKA 1WCZA 1NC6A 1Y8TA 2WPJS 2ZPQA 5HXFA 1G32B 2VVUA 1JIRA 2ZC9H 1OWIA 2FOCA 1TA2A 4HGCA 5E0GA 2WV4A 3SGAE 2BTCE 3UOUA 3EDXB 2YNBA 4MNYA 1FXYA 1QB6A 1FY1A 3F9HA 2PUXB 3MH6A 1GG6B 4DCDA 2QXGA 4WXIA 3SW2B 5LH8A 3LPRA 5DP5A 3HPTB 1BMLA 3RMLH 5EQSA 3RUOA 1JIMA 4ZMAH 3A84A 4KGAA 2Q6FA 3K2UA 4RKOB 3SOSA 4IN2A 1K9OE 1P2OA 2QYIA 2ZHDA 4X8VH 1VJ9U 4AG1A 1UTOA 3ATMA 2FMJA 1AE5A 4DURA 4FUIA 3A7YA 3KF2A 2ZU2A 2D8WA 2H1UA 4K60A 3EA7A 3T26A 1AKSB 5JPMH 3ZV8A 4X8SH 1MD7A 4B1TA 3LGIA 3M5MA 1EZUC 1DE7H 1H1BA 1VITF 2BY7X 1XX9A 4SGAE 4D8NA 5C1YA 2EA3A 5DPAA 4X1RU 2WPIS 1WUNH 1Y5UT 2A7JA 1GI9B 5JBTA 1NU9A 3TH4H 3LOXA 2BDCA 2ZGBH 2PLXA 2CJIA 3SGQE 1LHEH 4D76A 1O5EH 1HGTH 3SQEE 1GBKA 5BPEA 4E7RG 1EAWA 1ETRH 3SUDA 2A4RA 3HK6B 5AVDA 4CRBA 3RXFA 5A8YA 2GCTC 3D62A 1GBMA 6GCHF 1C1QA 1C9PA 2SNWA 4FVDA 4D7GA 3UWJH 3HATH 1XUHA 2W5EA 3NPSA 1GL0E 1TYNA 2TBSA 2ZF0H 1UK2A 2G4UA 1QL9A 3PLBA 5EPYA 5F8XA 5GJ4B 1AUTC 2H5CA 2WPHS 5F8TA 1G3DA 2ESTE 1W13U 1UTNA 2XCNA 3V12A 1ZPBA 4WWYA 3MO6A 1TPPA 2F83A 2SFAA 1TX6A 3S0NA 2GDDA 1FPCH 2Q6DA 3ZVDA 1A7SA 4BTUB 1QTFA 2TGAA 2BDIA 2IOTA 2UUFB 2ILNA 2VH6A 3LDXH 5DO4H 2V3HH 3U8OH 4I8KA 1D3PB 1VITH 5SGAE 1LVMA 1E0FD 3ENSB 1Y5AT 4Q7ZA 1TMTH 5C67A 3A80A 1QRXA 1ANCA 1F7ZA 2J95A 3R3GB 1GVZA 5GXPA 1F2SE 3RM0H 1C5RA 1GDUA 1O2JA 2BVSH 2XWAA 1AO5A 2PKSB 3V13A 2ZG0H 1HNEE 1LHFH 4KP0A 2XNIA 2FI3E 5ETXA 2A4GA 1A2CH 2O9QA 2ASUB 5ESBA 5TCCA 7GCHG 2FTMA 3EA9A 1UVOA 1V2NT 2PWXA 1GI5A 1GI2A 1UK4A 4MVNA 2DUCA 2WUBA 4UFDH 1Q31A 1ELAA 1NRPH 1N8OC 2H9TH 2H6MA
chains in the Genus database with same CATH superfamily
1G2LA 1RD3B 1S81A 1LVBA 3PB1E 4Y71A 1SHHB 1GJ4H 3FVFB 3TIUA 2PFEA 1TALA 1ESAA 1LKAA 3MU8A 3RU4E 1GI0A 4YM9A 3B23B 2O8UA 8LPRA 1XXDA 1C2LA 3GCOA 4WVPE 4KELA 1Z8GA 4A5TS 3CP7A 2QC2A 5JB8S 3ZIAD 1K1OA 3IWMA 4INHA 3E0NB 1Y3YA 4WH8A 1LTOA 2W7UA 2Y82A 1TPAE 5C94A 1AU8A 4CRFA 1AE8H 3VB6A 5HYOA 4KTCA 1IQLA 1TGSZ 2UUJB 1S0RA 3H7OA 2GMTC 3G01A 1HAXB 3KQEA 3M3VA 4B2AA 3SV2H 5GWZA 1SLWB 2NWNA 2PUQH 3PYHA 4NA7A 4J2YB 2NU2E 2FTLE 1ORFA 1GBHA 3CS7A 1A46H 3LT3A 2KAIA 4I32A 3ATIA 1LQDB 1ID5H 2B0FA 2STBE 5FPTA 2VWNA 1NROH 1DICA 2FIRH 1RGQA 4UDWH 2R0KA 4LOYH 4MPUA 5LPRA 1BHXB 2EI7A 3AW0A 1P01A 4VGCB 1AFQB 1J9CH 1K0HA 1H8ED 1UHBA 5C0UA 4NGAH 1O2VA 1BCUH 7LPRA 3QO6A 1YPKH 4OGXA 1G2MA 2XWBI 5TCAA 2ZDVH 1TOCB 1BUIA 1Q2WA 3M37A 1OOKB 2WUCA 2ANYA 4IGDA 3RP2A 4GSOA 4Y6DA 2AH4X 1GMHG 1MTUA 1CHGA 1SGEE 2W7SA 5L30H 1MTVA 1LQEA 5FL7D 3PROA 3HK3B 3LIWA 4ISNA 1DWDH 3KYGA 2SGPE 5KGOA 1COWD 5J4SA 3GCTF 1O3DA 5KEDA 2KZ4A 4DVAU 2FP7B 3A87A 3BF6H 2HNTF 3OFND 1JRTA 3FO8D 1NFUA 3BTKE 4X1SU 4BTTB 3OTPA 1IQJA 1DY8A 1S6FA 3STJA 1QGFA 2TRMA 2ZTYA 1IHTH 1TQ0B 6LPRA 3U28C 3GS9A 1V2LT 3GCNA 1GVLA 2SGFE 2BDGA 5B6LA 1DFPA 3UWIA 3FP8E 5F8ZA 3MHWU 2BMGB 2BM2A 3EE7A 1B0EA 1GBIA 3E6PH 8KME2 1H9IE 1MKXH 1O3EA 1ZHMA 4IW4E 1O3LA 2ZP0H 2GZ8A 3ZVGA 1C5TA 3AW1A 3L33A 5EJLA 1LVOA 2FPZA 2HPQH 1OKXA 3HGPA 2XBYA 1RIWB 4LZ4B 1OWDA 2ZHEH 5C3NA 4NG9H 3EAJA 1VGCC 1E37B 1L0ZA 1P2MA 3ODFA 4ZHMU 1O2LA 3M36A 2P95A 3TGJE 4X2XA 1SQRA 2KCPA 3V7TA 1BDAA 2XBXA 2PGBB 2Z9LA 2VWLA 1W0KD 2ZI2H 3HGNA 2W3IA 5B6OA 2UWOA 1PQ8A 2CHAC 1YM0A 1D4PB 3GDVA 3BTQE 2AGGX 1MD8A 2EI8A 3HKJB 3I29A 1TNIA 3GDUA 1C9TA 4JZEH 3RC6A 4IC5A 5LPFA 4MNXA 4ISHH 1D3DB 2BDAA 1Y3WA 1EZQA 2Q6GA 1W8BH 1YPHC 3IITA 4ABGA 5C1XA 3A8CA 2UUKB 5T1VA 1AY6H 4IMZA 3LGVA 5DKMA 3DD2H 1CSOE 1O33A 1IHSH 1PQ7A 1GBEA 1YGCH 4GHQA 3SJ9A 1QIXB 3ATLA 3GICB 4MLFB 5EGMA 1HIAA 1FY4A 1MBQA 3LGYA 3OTJE 3QGJA 1HAPH 1O2ZA 1TONA 1QL8A 1ZHRA 3BTME 1BTYA 1V2RT 2QY0B 1W3CA 2Y5GA 4OS7A 3SJ8A 3SU1A 2QF5A 2QXJA 1FAKH 3RMMH 1XM1A 4F48B 2F9UA 1VKYA 3MNXA 2BD5A 2ZDNA 2ZU4A 2XYAA 5FXLA 2FYQA 4R8TB 3A83A 1S5SA 1GBAA 3PV5A 1CO7E 3KNXA 3QX5H 3GCHC 3SN8A 1ANBA 4XOJA 1YC0A 1ZGVA 2V3OH 1BTZA 1CQQA 1O2SA 2BLVA 9LPRA 1MKWK 3RXAA 3RDZA 2BQ6B 2D26C 4ESTE 4XBBA 1SQTA 4IC6A 2VU8E 1EP6A 2YOLA 2B8OH 2BHGA 2JH5D 3UNRA 3QUMP 1BJUA 3M7UA 1O3IA 2BZ6H 3RLYH 5AFZH 3NK8A 1WAYB 1AMHA 3RM2H 1MBMA 3SNDA 1Z7KA 2BD7A 1O5DH 1FUJA 1AB9C 3JZ2B 1BTPA 3A7ZA 1Z71A 4YOGA 3SU2A 1WTGH 4JCNA 2Z6BD 5E0HA 1FY3A 1EASA 1V2KT 4BANB 3UOPA 5GCHG 3GYMA 5EXLA 1SGFA 1LPZB 3GY3A 1CE5A 2O8LA 1F0SA 1HDTH 4B73A 1OWHA 3MH7A 2BYAX 2ZU1A 2XRCA 1EFRD 2ZPRA 1QJ6B 3F0PA 2OTVA 4AFQA 1G3BA 3GY5A 2PW8H 1DSUA 5G4BA 4B2BA 3M5OA 3VB4A 1RS0A 4UEHH 4KKDA 1SSXA 3H7TA 5JBCS 3M35A 1T8LA 3BIUH 3SZEA 3VG8A 1JRSA 1MQ6A 2XOKD 4UFGH 5JDUB 4IS5A 4OGYA 5EXMA 1C5LH 2G5NA 4WXVA 3TLOA 1OWJA 1O35A 1GBLA 1W12U 1THRH 2F9BH 2Z94A 1ELVA 4NWKA 1AKSA 2J2UA 2H2ZA 4K1SA 3LGWA 2CF9H 4TPIZ 3GOVB 1IQFA 3ZYDA 3TJNA 1AN1E 1HAHH 3GY7A 2VIPA 2ODYB 1DVAH 1NZQH 3MH5A 1T31A 2A0QB 3UNSA 2G00A 2P3FH 4ZROA 3UR9A 1GHAG 2KR7A 1BOQA 1EJMA 4BXWA 1BQYA 2R2MB 5C2ZA 1Z6EA 1L1JA 3M5NA 2TGPZ 3A89A 1C2MA 1G3EA 4H42U 3VXFH 1L1NA 4X8UH 4B71A 5GCHF 2ZGCA 5CHAB 2AYWA 2DE9A 2NU0E 1C1RA 1KXEA 2G4TA 2ANMH 2VGCB 1O3CA 1G30B 2VIDA 3QZRA 2ZKSA 3E0PB 1BHXF 1J14A 4ZKNU 1GL1A 1FY8E 4ZXXH 1TNKA 1FLEE 2DE8A 1ZSLA 3RMNH 3URCA 1J15A 1FAXA 2NU4E 1WOFA 1W14U 1SQAA 2EEKA 1LHGH 1QB1A 2A2XH 3P8FA 4X1QU 1HAVA 1KIGH 1YKTA 1XUJA 3TJOA 5T3HA 1SC8U 4Y76A 1LKBA 3OYPA 1C5MD 1KXFA 2WINI 1QR3E 5A0BA 2EY4C 1O39A 5A8XA 1SGTA 1ELBA 1FI8A 1C1SA 3A7WA 1C1WH 3T62A 3WY8A 4XD7D 4ABIA 2AFQB 1WTHD 1CBWC 2D2DA 2BLWA 1A0JA 1KXCA 5DJ7A 4CHAB 1ZTKA 1PPCE 1QCPA 1A3EH 1A5GH 1CGJE 1PPGE 1S83A 1IQNA 2FYRA 5LGOA 3A86A 1RXPA 2OC8A 2VIQA 1Z6JH 1PPEE 1WQSA 2AMQA 1VITG 4X6MA 2VIWA 1TRNA 1TRMA 2KFWA 2UWPA 3KN2A 4YOJA 1Z1JA 4BAHB 2FEQH 2BD8A 2BY5X 3OY6U 4CRDA 1C2FA 3OEED 1B7XB 1QL7A 2P3TB 4MPVA 2GVFA 5A09A 4OS5A 3MQKC 1KXBA 4B2CA 4ACAA 4AOQA 5AHGH 3ODDA 1KYNA 1FN6A 2UWLA 1P3EA 2ZWLH 4AX9H 4WH6A 3SJIA 2O8TA 2CF8H 1O3MA 1SGRE 3UY9A 1ZSJA 1SHYA 4NA9H 3UREA 4WMDA 1F5RA 1GI7B 1C1PA 2PKAB 4DT4A 2BVXH 3RXMA 1MTNB 3LGUA 1HB0B 1O5FH 4CH8B 6GCHG 3JZ1B 3N99A 3W95A 3F68H 1HCGA 1P11E 4OS4A 3PTBA 2F9PA 2ZU3A 1C1MA 1H9HE 1GCTB 3Q3KA 1UTJA 3ZZ3A 3BG4B 1V6DA 2HWLB 2ZCKP 3MFJA 2RA0A 3TNSA 4ASUD 1TBZH 3V0XA 1O2OA 2QXIA 2BQWB 4K8BA 5HM2A 3UUZA 4THNH 3SV8A 3RXIA 5JBBS 1QBNA 3O8RA 4DW2U 1ZPZA 1EZSC 2TIOA 3D65E 2KCOA 1DM4B 5HM9A 3A82A 1K2I1 1SG8B 4Q2KA 1NN6A 1O3KA 4FETA 1CA8B 2C8WB 8GCHF 2KM0A 3VFEA 1LO6A 2BY6X 3S9BA 2G8TA 3UTUH 4OS1A 1CGHA 1S0QA 2ZIQH 4K69A 3PO1B 1DWBH 1T8MA 4E06H 5DN6D 5FHTA 5EXNA 3N7EA 1IQIA 1FY5A 1GVKB 4B6EA 1DWCH 1GCDA 2ZQ2A 4A6LA 4DIIH 2Z9IA 1GJ5H 5FBEA 1C4V2 1TNGA 2VBCA 1AWHB 4Z6AH 4YT6H 3BTFE 3SJKA 1JWTA 5DP9A 1GBDA 3TK6A 2CXVA 2O8MA 1HBTH 2V7QD 2K0QA 2HNTC 5H4IB 1GG6C 1QFKH 2ZHFH 3ATWA 2FZZA 5FPYA 5FCKA 1XUIA 1T32A 4K5ZA 1MH0A 1F92A 4NIXA 1MUEB 4INLA 1SGYE 3SQHE 3T27A 2HVYB 5LPEA 1NTPA 1VCQA 5I46H 5DP4A 1UCYH 3E90B 3LKWA 1F0TA 2TPIZ 1EX3A 2A2QH 1VJAU 2A31A 3KL6A 1KMHB 1YCPH 3OSYA 3SUGA 2G55A 1NRQH 4MQAA 1RTFB 1NFXA 1AIXH 4B6FA 2ZDKA 3RXDA 3SU0A 3F2FA 5A8ZA 5DP3A 3MU4A 3SGBE 1TOMH 1N8OB 4Y11E 3N7OA 1HPGA 1TGTA 2ZFTA 1GPZA 5EQRA 3LC3A 2WYJA 3MOCA 2ZA5A 2EI6A 1BBRK 1AZZA 5DG6A 5K0HA 2R2WU 2OQUA 3LC5A 2WV5A 3RU4T 2ZNKH 4NSVA 4UFEH 1IQEA 2XCFA 4ZH8A 2FOAA 3CNRA 4TSFD 2KCAA 1QQUA 2JJ1D 3UR6A 4NZLA 3M3SA 4ABBA 1K1LA 4O3UA 3A8AA 1P57B 3RMOH 1BT7A 2YMSC 4FXGH 4GPGA 1OX1A 2QA9E 4AFZA 1AWFH 1HJAB 3URDA 1QZ8A 3P95A 2ULLA 2SNVA 4X0WU 1BMAA 3E8LA 2QXHA 2BOHB 4FUFA 1K1IA 1GBCA 3W1EA 2GMTB 5J4QA 1O3PB 1OP0A 2QF4A 1ARBA 4TYDA 1GJ6A 4A7IB 4B76A 2GV6A 4X6OA 1FZZA 1W0YH 2KCYA 2HVXA 3F3BA 4X6NA 2VWOA 3DT0H 2ZPSA 2H9HA 2GT8A 1YYY1 4I8LA 1PYTC 1LPGB 1C1OA 2HLDD 3SNEA 1KDQB 1HRTH 1GDNA 5EU8A 4M7GA 1P06A 3D23A 1C5QA 5HGGA 1BTUA 4JMYA 2LP6A 1O2GH 3K6YA 2FX6A 1D6WA 4Y79A 4GCHF 1HAYB 4ABJA 1P02A 1P9SA 3Q00A 3ZZ6A 4DG4A 3KGPA 2Z3EA 2ZZUH 4AGJA 3KQCA 1V2OT 1Y3XA 4GLYA 1UTPA 3LGTA 1D3TB 4FOUC 2QN5T 1TABE 1FX0B 1ZMLA 1GI6A 4NIYA 1GHVH 3GCTG 3PRBA 1BRAA 1O5CB 1MU8B 2PP6A 4ZXYH 3A88A 1D6RA 1HJ8A 4HFPB 4JZIA 1HFDA 2ALPA 1SGFG 1YPMH 3UAIC 1SQOA 4YT7H 4FU7A 3BTHE 3GY4A 4Y7AA 2PKSC 3TK5A 4CBNA 1BB0B 1V2PT 2PR3A 1EOLA 1O2IA 4I33A 2WPDD 4FUHA 1MABB 2J4IA 3MNCA 3SHAH 1C1TA 4P02A 2PV9B 3KIDU 1W2KH 1MQ5A 3SNAA 4AC9A 3BV9B 4UD9H 1NU7B 3RXLA 1NRNH 1THPB 3RXCA 4YOIA 1DLKB 2GKVE 4X1NU 2K8IA 1O37A 5T6GA 2Y7ZA 2ZCLP 4Q7XA 1MAXA 3M61U 1C5UA 1UVUH 1BMMH 3PMHB 3RXOA 1K22H 1SLXB 2V3MA 1PYTD 4H6TA 1FV9A 2WPMS 1QURH 2CN0H 1JBUH 1VGCB 1W7XH 2Z9GA 2FWWA 2FOEA 3ITIA 5FX5A 1B5GH 5I25A 5CHBA 1XXFA 4NIVA 1IQGA 1Z1IA 3P8GA 2BLOA 2VH0A 1A0LA 3T25A 2STAE 3MMGA 3E3TA 1LHDH 2I6QA 1C2GA 2WYGA 5L2ZH 3RXUA 1UTQA 1H9LB 2OLGA 1O2YA 1GGDB 1NS3A 4K8YA 2FOBA 3SJOA 4BAMB 4CR5A 1ZR0A 2ZO3H 2Y5FA 3F9GA 2AMDA 5GPIB 4NFFA 2LPRA 1WQVH 3SYJA 3OEHD 2WV9A 3KEEA 6CHAC 2FLBH 3RXRA 4AZ2B 1A5HA 1MKXK 3VGCC 1MMJN 2W26A 4JYVH 2RG3A 2XC0A 3W94A 4ZHAA 1SGPE 4NSYA 2ZFSA 1PJPA 3MU0A 1WSSH 1P9UA 2H9EH 1DXPA 2ZFQH 1C5NH 1GJDB 1AGJA 4VGCC 1A4WH 1CU1A 2TGDA 3DSOA 1HAIH 1RTLA 3STIA 4JZFH 1ZGIA 1S84A 1C5YB 3NCLA 3A81A 1P2JA 4FUEA 1Q3XA 1PPBH 2GX4A 4INKA 2ZFFH 2OP9A 4A1VA 1FNIA 1YPJH 1Y3VA 3SUEA 1N1LA 1UJ1A 4RI0A 1J16A 4ZKRU 2V0BA 1TAWA 1EPTA 3ZZ7A 1E1QD 2LELA 1FDPA 1KLJH 1IOEA 1E1RD 1QHRB 2VIOA 5DP7A 4CRCA 4ZKOU 1XVMA 4RKJB 2L74A 1E35B 1FN8A 2ODQA 1HAGE 1V2QT 4XBDA 1WV7H 3KQ5A 3CS0A 1SB1H 1HAZB 4WY3A 1ZMNA 1HJ9A 4LK4A 2JH6D 1EJAA 2QV1A 1C2KA 3R0FA 4XFQA 1C5XB 1GBFA 4YLUA 4GAWA 1BA8B 2HGTH 3ESTA 3S7HB 3NZIA 4DIHH 2BDHA 1ZPCA 3U98H 1O2QA 1KY9A 5C5NA 1SVPA 1YBWA 4B75A 1RIWC 4YXWD 1AD8H 3O8BA 4AYYB 2PGQB 4AG2A 1QA7A 4AB9A 1K1MA 4XRNA 1P2NA 1DITH 2IJD1 1AHTH 1YPEH 1YLCA 3LU9B 2AERH 2ZDAH 1V3XA 2Y7XA 3KQBA 3MU5A 4FUBA 2ZHWH 3A8BA 1FMGA 4BNRA 1P03A 1O3GA 1M9UA 2G52A 2FI4E 1A1RA 1GHZA 3F0OA 1DDJA 1G9IE 1JMOH 4NZQA 4MNWA 1C4Y2 4K3JA 2G5VA 2THFB 1J8AA 2ZGHA 1BBRE 2ALVA 2HOBA 4O97A 3O8DA 3K6ZA 2KAIB 3Q3XA 2Q1JA 1MKWH 4I31A 2JETB 4BAQB 1OHHD 5IYTA 1TBRH 1TFXA 1W7GH 1XKAC 2P94A 3S69A 1CA0B 1GMDF 3S9AA 3UPEA 1HLTH 4TWWA 3AAVA 2K1QA 1UHBB 1UO6A 4LZ1H 1L4ZA 1GJ9B 1YY3A 3NKKA 1EKBB 5F03A 2GCHF 2XNDD 3NUMA 1WXRA 2I6SA 3DFJA 2YNAA 2IJOB 3EE0B 3U69H 3UNQA 3C1KA 4DOQA 1F5LA 1V2WT 3PLKA 4Q63A 1MCVA 1T8NA 4CRAA 5JB9S 2A5IA 4R0IA 4Y8ZA 4ZUHA 3AAUA 3T5FH 1ZRBA 2BX4A 4Q80A 1GJCB 1TNHA 1TPOA 2XW9A 2P8OB 1C5WB 4IMQA 4X8TH 3MNBA 5EQQA 3EGKH 2OK5A 1KTTB 2HPPH 3VB3A 1G3CA 3MH4A 1BRBE 3M7QA 1ZZZA 2CMYA 4Y0YE 1GWAA 1ZTJA 3TPIZ 1SBWA 3ZYEA 3U1IB 3ZVEA 1W0ZU 3D49H 1W11U 3GISB 4JYTA 3SI3H 1V2ST 2PSYA 2ZU5A 3FZZA 3E1XB 1ELGA 1YLDA 3AVZA 3LJOA 3KYFA 4YZUA 2B7DH 4JK5A 1O2MA 1O2HA 3M3TA 1C2JA 4AGKA 1HUTH 1GHYH 2CGAA 1GBBA 2C90B 2W6JD 2Y5HA 1SL3A 2VB0A 4K1EA 3F2GA 2A4OA 1EB1H 1P2IA 2FLRH 1BTHH 4ZHLU 1ZOMA 1P04A 1V2JT 1UK3A 3BIVH 4GUXA 2J97A 5E0JA 1ETTH 2C8XB 1P0SH 5PTPA 3P17H 1SMFE 5EPNA 1E34B 2RA3A 2ODPA 4DGJA 4F4OC 3ZZDA 3SU4A 1ZMJA 1GBTA 4X1PU 3RXBA 2H5DA 2XC5A 4AORA 3EYDA 2AMPA 1CT4E 2IPQX 1EAXA 3TH3H 3QWCH 2A4QA 1WU1A 1C5OH 1ZSKA 1C4U2 2AEIH 9ESTA 5DGJA 2VJ1A 2BDYA 3QGNB 3UQVA 3EA8A 1TX7A 3FN8A 2J34A 3PMJA 2ANWA 4WMEA 1TMUH 4H4FA 1DPOA 2ZTZA 1HIAB 4YO9A 1KSNA 2Y81A 4FU8A 2CV3A 2EQNA 4A1TA 2M5TA 1IQMA 4KTSA 1Z8RA 5C17A 4K2YA 2O8WA 5IK2D 3ELAH 4FUJA 1TWXB 1EOJA 3DHKH 5EG4A 4D9QA 2FS8A 4AYVB 4X2WA 4Y8YA 1O5BB 3FOAA 1TRYA 2RFKC 1AQ7A 2BY9X 1TNLA 5IDKA 2FO9A 8GCHG 4NA8A 3RXHA 5TJXA 2OBQA 2XXLA 1OWEA 4BXSA 1AVGH 4HI3A 3GY2A 5HIYA 1TE0A 2D1JA 3BTGE 1P3CA 2BLQA 1EPTC 5L6NH 3TGIE 4HZHA 2J5UA 2C8ZB 3SUFA 2BDBA 2VINA 4MPWA 5CHAC 3Q3YA 1ELDE 2FS9A 4XDEA 1XUFA 2ANKH 3F1SB 3SNBA 5FAHA 3KCGH 1NT1A 3A8DA 4AB8A 5C0TA 1O2WA 4SGBE 1O3FA 2A32A 5AFYH 2JKHA 1N6YA 1WDIA 1GHWH 2A1DB 2Z7FE 3PMAB 4MDSA 3P8OA 2XTTB 1KDQA 2P3UB 4Q7YA 1P12E 1TX8A 3EQ0H 1ARCA 1TPSA 4DT7B 1GI3A 1C1NA 2WSSD 3GY6A 3H5CB 3MU1A 3UB0A 2V6NA 4JK6A 4FVBA 5L2YH 1A5IA 1GI4A 2GGVB 1NY22 2AS9A 2QGRA 3TU7H 2GCTB 1QBVH 1PQAA 1DSTA 1UVSH 3RLWH 2FOFA 3WW7A 3VB7A 1O3OA 1EJNA 2GTBA 3S9CA 4ABEA 1NFWA 1YPLH 4UE7H 3F6UH 3NRLA 4CHAC 4A92A 1KLTA 2ZFPH 5E8EH 1FQ3A 1XUGA 1TLDA 1O32A 1UMAH 1MU6B 2FX4A 4TPYA 2PHBA 2QAAA 2EC9H 3ZZ5A 2FOGA 1KLIH 5A2MH 3ZVCA 1O3AA 3LH1A 1BITA 4U01A 2IN2A 3PTNA 2HNTE 3SV9A 1NPMA 1A61H 1LCYA 1OYQA 5CMXH 1EATA 1GJAB 4IBLH 1O5GH 2J98B 3PWCA 2GP9B 5FBIA 4ABDA 2C93B 3BEFB 4I7YH 2A5KA 1K1JA 2FXRA 2ZTXA 3T29A 3FP7E 4GHTA 8ESTE 1IQHA 3DUXH 5GIBA 4YLQH 1RFNA 1MTNC 3PV2A 5EODA 4AFUA 1AUJA 1HXFH 5ESTE 4AFSA 3IG6B 2ZQ1A 5FX6A 1ACBE 1GJ8B 5FPSA 3SI4H 3ZVFA 1HXEH 1AI8H 1GI1A 1SGQE 2JDID 3B9FH 2FODA 3T2NA 1GCTC 2ZDLA 3BG4C 3BTWE 1LVYA 2Y80A 2RDEA 1O2XA 1UCYK 3DSGA 4CH2B 3SV6A 2QCYA 2GDEH 3SZNA 3ZV9A 7KMEH 3MTYA 1MAYA 4D7FA 5DP8A 2OUAA 1YCPK 4X2YA 1UVTH 4GCHG 5C5OA 1P8VC 3RXVA 2IPHA 1KXAA 1NM6A 4RSPA 3TJVA 1SGCA 1HAVB 2GD4B 1EZXC 3BTTE 3QN7A 1O2KA 1U6QA 1GJ7B 2SGEE 1BBRH 3QTOH 5EOKA 3PO1C 3L3TA 3P92A 1UW7A 4XE4A 4U32A 4ZAEA 2F9NA 1EP5A 3MO3A 1V2TT 2A7CA 1NRRH 2PSXA 1QQ4A 2FDAA 5C1UA 3RXPA 2BD9A 1CHOG 2OQ5A 1DANH 1OS8A 4JZDH 3P8NA 4RT0A 3SV7A 1EUFA 1K1PA 1QJ7B 1TQ7B 1VCWA 4NWLA 3B8JA 3TJUA 2J92A 2CK3D 2A45B 3SNCA 2GV7A 2F9VA 4HG6A 2GZ7A 1B0FA 3L6PA 3I78A 1BTWA 4JYUH 5ABWA 4NCYA 4D9RA 4ABHA 2Z3CA 5HMAA 5GNDA 4BOHA 1BRCE 3RC5A 2VVVA 1GBJA 1O2NA 1QA0A 1K28D 1DY9A 1SOTA 2JJ2D 1HAOH 2VIVA 1BZXE 2XBVA 5A0AE 3OAAD 1MTSA 5C20A 3TNTA 3ZZAA 2BY8X 2JH0D 1S85A 5JBAS 4RN6A 4DY7B 1C1VH 5CE1A 2OC0A 3QDZB 3ZZCA 1K21H 1TB6H 3PRDA 3TH2H 3RXJA 2TGTA 2WZQA 2FESH 2J9NA 1KXDA 4BAOB 1SFQB 3KHVA 2G51A 4NIWA 1SGIB 1DT2A 5EW1H 1SFIA 2BVRH 4CBOA 1BMNH 3F9EA 1O36A 1EAUA 3BG8A 1O3JA 3V3MA 1QB9A 1CHOF 4Q4LA 1S6HA 3M7TA 4NFEA 4P00A 1AFEH 3F9FA 4X6PA 1E38B 2UUYA 2WHXA 4O3TA 1PFXC 4B74A 1C2IA 1YP9A 5HIZA 1D3QB 1ZLRA 1H4WA 2YMSD 1HJAC 2PTNA 1NRSH 1EQ9A 1QBOA 5BRRE 3M5LA 2HLCA 1SPJA 3SU6A 1V2VT 2AIQA 1EAIA 1ZTLA 1BMFD 1WBGB 4MPXA 1O0DH 1THSH 3RXTA 4K1TA 3VEQB 3A7TA 1E36B 3ZZ8A 2SGQE 3MNSA 5DK1A 5CDFE 4WMFA 1FPHH 1XKBC 1TA6A 3BEIB 7GCHF 1P09A 1UVPA 1MCTA 6CHAB 3T28A 1C2DA 2F91A 3FP6E 3RXQA 2VNTA 1TGNA 3VGCB 1EXFA 1YF4A 2AIPA 2RDLA 1L2EA 2XC4A 3E91A 4F49A 5EW2H 1NBMD 1S6LA 1CT2E 1FIWA 1GMCG 2ZHQH 2Z9KA 4CREA 1O3NA 3K9XB 5F6MA 3BN9A 2P59A 3SBKA 3Q77A 1YWUA 1O31A 3H09A 2J38A 4XBCA 3SORA 3MWIU 4BTIB 3TK9A 2BD4A 2CHAB 1NFYA 2W6ID 1FJSA 2OXSA 3BSQA 4Y10E 1Y5BT 1T4UH 3E16B 1O2RA 1RRKA 1MZDA 4U30A 4ISIH 2Z9JA 3UQOA 1VR1H 3BTEE 1O38A 3ZVBA 1ELTA 2BD3A 3RU4D 2GJGA 2ZFRH 2R3UA 2W3KA 1IQKA 4YTAA 1IAUA 1UTMA 3FAOA 1HYLA 3P6ZB 1GHXH 4UFFH 3RXSA 5K7RA 4H6SB 1SLUB 1XVOA 1T7CA 1K1NA 5JYIA 4E05H 1OXGA 1AVXA 2C8YB 1DXWA 1D9IA 4Y7BA 1AFQC 4I8GA 2AGIX 4Z0KA 4TT3D 2F3CE 3VXEH 1YCPM 1HV7A 2BD2A 2B5TB 1SGDE 5T6FA 1GMCF 1JOUB 1YPHE 3BTDE 3OE7D 3P70B 1C2EA 2C4FH 4E7NA 1C2HA 1LHCH 4MNVA 3GCHB 2FOMB 3VB5A 2AHME 1GMDG 2LNCA 1E79D 1TIOA 2J94A 1GMHF 3A7XA 3FFGA 2SGDE 1OP8A 1GGDC 1SI5H 5EJ1A 3DCLA 3BEUA 4IN1A 1OP2A 3RXEA 4KTUA 2OBOA 2GCHG 3PMBB 2QF3A 4OS2A 2ZECA 3N7DA 1AB9B 5E2OA 1TGCA 3I77A 3PWBA 2WPKS 2ZDMA 4WJG2 1ZRKA 1O3HA 2PTCE 3A85A 3LH3A 4FU9A 2BZAA 1AZ8A 1BIOA 1CVWH 3QTVH 1G36A 1QJ1B 4MG3A 2A7HA 1P05A 1OWKA 1OPHB 3U8TH 2OC7A 1UCYE 1QRZA 3ATKA 3LJJA 3RXGA 3S7KB 3MI4A 2VWMA 3DSPA 1T4VH 1C5PA 1W10U 3FZDA 1Z8JB 3DA9B 2M2AA 4X2VA 4O03A 2OCVB 1N6XA 2R0LA 3NXPA 2SGAA 2P93A 3RXKA 3TVJB 1H8HD 3NWUA 1QY6A 2F4LA 3ZZ4A 1NO9H 1UTLM 3FKSD 4ABAA 5FCRA 1A3BH 1SOZA 4TY6A 1P2KA 3SHCH 3C27B 5T6DA 2ZGJA 4WF8A 1H8DH 3VPKA 3RC4A 1FIZA 4FUCA 2AGEX 4CRGA 2QF0A 1EB2A 2XBWA 2HALA 2PKAA 1J17T 1TBQH 1AVWA 1BTXA 1FONA 2FI5E 3LONA 5GDSH 2HRVA 2NU3E 1DOJA 2FOHA 6ESTA 1DUEA 1RTKA 1CGIE 3GDSA 1V2MT 4YESB 4Y8XA 3SU5A 1WYKA 1QRWA 2BXUH 1L1GA 4GVUA 1GDQA 4JZ1A 1O2TA 4TWYA 2NU1E 5HKKD 1O34A 2ZCHP 4DJZB 4LXBH 2VVCA 1ABJH 1BRUP 1O30A 3U1JB 1O5AB 1ZHPA 3OU0A 3PV4A 3PLPA 2QE7D 2BXTH 5E2PA 2WPLS 1O2PA 1H8IH 1OSSA 1F0UA 1ZYOA 1ESTA 3SU3A 1MTWA 3CENA 1DWEH 1F5KU 2BQ7B 4ISOA 3K65B 4HTCH 1XMNB 3GY8A 4ZKSU 3U8RH 1PPHE 1PQ5A 2A5AA 3SO3A 1ETSH 3Q76A 4UONA 1DX5M 3A7VA 3KQDA 1X7AC 4PROA 1O3BA 2JETC 2Y6TA 4Y0ZE 1T8OA 4XSKU 1GJBB 2OD3B 2V35A 1GHBG 1CBWB 1CA0C 1RJXB 3OX7U 2J98A 2BX3A 4ABFA 1ELEE 4FUDA 3OY5U 4J1YA 3TGKE 1C1UH 1LMWB 2P16A 3AK5A 2OC1A 5A0CA 3QLPH 1C5ZB 4TY7A 2FM2A 3PM3A 1P2QA 1VCPA 5AF9H 3U9AH 1QNJA 3GYLB 7ESTE 1ANDA 1SR5C 2QIQA 2G81E 2OINA 2ZEBA 4I8JA 4QT8C 1C5VA 1ELFA 1PPZA 1EPTB 3HKIB 2GT7A 1C5SA 1DLEA 2P8OC 1A0HB 3ZZ9A 3MO9A 1GI8B 1ZJDA 4I8HA 1DUAA 4A1XA 1MZAA 1F0RA 1ABIH 5EJZA 1S82A 3O8CA 3WWFA 5DP6A 1LPKB 1PPFE 3AASA 1ELCA 2C3SA 3UIRA 3WWBA 3FANA 4AN7A 1V2UT 1BJVA 1INCA 1P10A 1XUKA 2ZGXH 3DFLA 1VZQH 4RT1A 1JXPA 4OM9A 1YPGH 1OYTH 2RCEA 3MYWA 1ZJKA 1DS2E 1ESBA 3QZQA 4BAKB 2L6OA 4OS6A 4O9VA 3TITA 1TNJA 1O2UA 1GHBF 3QK1A 1TGBA 3UFAA 1Z8IB 2B9LA 1Y59T 1CT0E 1LDTT 4FUGA 1ANEA 4ASHA 4MTBA 3ZVAA 2Z3DA 1G37A 1GHAF 1YLNA 4U2WA 2BB4A 2VGCC 4ISLA 2R9PA 3ZZBA 5KECA 2BOKA 2GZ9A 1NESE 1TMBH 1SLVB 1L4DA 2R3YA 1Y3UA 1KTSB 1SGNE 4CR9A 2F9OA 1UTKA 1WCZA 1NC6A 1Y8TA 2WPJS 3F2HA 1W0JD 2ZPQA 5HXFA 1G32B 2VVUA 1JIRA 2ZC9H 1OWIA 2FOCA 1TA2A 4HGCA 5E0GA 2WV4A 3SGAE 2BTCE 3UOUA 3EDXB 2YNBA 4MNYA 1FXYA 1QB6A 1FY1A 3F9HA 2PUXB 3MH6A 1GG6B 4DCDA 2QXGA 4WXIA 3SW2B 5LH8A 3LPRA 5DP5A 3HPTB 1BMLA 3RMLH 5EQSA 3RUOA 1JIMA 4ZMAH 3A84A 4KGAA 2Q6FA 3K2UA 4RKOB 3SOSA 4IN2A 1K9OE 1P2OA 2QYIA 2ZHDA 4ZCNA 4X8VH 1VJ9U 1SKYE 4AG1A 1UTOA 3ATMA 2FMJA 1AE5A 4DURA 4FUIA 2JIZD 4M9FA 3A7YA 3KF2A 2ZU2A 2D8WA 2H1UA 4K60A 3EA7A 3T26A 1AKSB 5JPMH 4F55A 3ZV8A 4X8SH 1MD7A 4B1TA 3LGIA 3M5MA 1EZUC 1DE7H 1H1BA 1VITF 2BY7X 4Z1MD 1XX9A 4SGAE 4D8NA 5C1YA 2EA3A 5DPAA 4X1RU 2F43B 2WPIS 1WUNH 1Y5UT 2A7JA 1GI9B 5JBTA 1NU9A 3TH4H 3LOXA 2BDCA 2ZGBH 5EIYA 2PLXA 2CJIA 2YMSB 3SGQE 1LHEH 4D76A 1O5EH 4ACBA 1HGTH 3SQEE 1GBKA 5BPEA 4E7RG 1EAWA 1ETRH 3SUDA 2A4RA 3HK6B 5AVDA 4CRBA 3RXFA 5A8YA 2GCTC 3D62A 1GBMA 6GCHF 1C1QA 1C9PA 2SNWA 4FVDA 4D7GA 3UWJH 3HATH 1XUHA 2W5EA 3NPSA 1GL0E 1TYNA 2TBSA 2ZF0H 1UK2A 2G4UA 1QL9A 3PLBA 5EPYA 5F8XA 5GJ4B 1AUTC 2H5CA 2WPHS 5F8TA 1G3DA 2ESTE 1W13U 1UTNA 2XCNA 3V12A 1ZPBA 4WWYA 3MO6A 1TPPA 2F83A 2SFAA 1TX6A 3S0NA 2GDDA 1FPCH 2Q6DA 3ZVDA 1A7SA 4BTUB 1QTFA 2TGAA 2BDIA 2IOTA 2UUFB 2ILNA 2VH6A 3LDXH 5DO4H 2V3HH 3U8OH 4I8KA 1D3PB 1VITH 5SGAE 1LVMA 1E0FD 3ENSB 4I86A 1Y5AT 4Q7ZA 1TMTH 5C67A 3A80A 1QRXA 1ANCA 1F7ZA 2J95A 3R3GB 1GVZA 5GXPA 1F2SE 3RM0H 1C5RA 1GDUA 1O2JA 2BVSH 2XWAA 5DSFA 1AO5A 2PKSB 3V13A 1NBME 2ZG0H 1HNEE 1LHFH 4KP0A 2XNIA 2FI3E 5ETXA 2A4GA 1A2CH 5F53A 2O9QA 2ASUB 5ESBA 5TCCA 7GCHG 2FTMA 3EA9A 2KX4A 1UVOA 1V2NT 2PWXA 1GI5A 1GI2A 1UK4A 4MVNA 2DUCA 2WUBA 4UFDH 1Q31A 1ELAA 1NRPH 1N8OC 2H9TH 2H6MA
chains in the Genus database with same CATH topology
1G2LA 1RD3B 1S81A 1LVBA 3PB1E 4Y71A 1SHHB 1GJ4H 3FVFB 3TIUA 2PFEA 1TALA 1ESAA 1LKAA 3MU8A 3RU4E 1GI0A 4YM9A 3B23B 2O8UA 8LPRA 1XXDA 1C2LA 3GCOA 4WVPE 4KELA 1Z8GA 4A5TS 3CP7A 2QC2A 5JB8S 1K1OA 3IWMA 4INHA 3E0NB 1Y3YA 4WH8A 1LTOA 2W7UA 2Y82A 1TPAE 1AU8A 4CRFA 1AE8H 3VB6A 5HYOA 4KTCA 1IQLA 1TGSZ 2UUJB 1S0RA 3H7OA 2GMTC 3G01A 1HAXB 3KQEA 3M3VA 4B2AA 3SV2H 5GWZA 1SLWB 2NWNA 2PUQH 3PYHA 4NA7A 4J2YB 2NU2E 2FTLE 1ORFA 1GBHA 3CS7A 1A46H 3LT3A 2KAIA 4I32A 3ATIA 1LQDB 1ID5H 2B0FA 2STBE 5FPTA 2VWNA 1NROH 1DICA 2FIRH 1RGQA 4UDWH 2R0KA 4LOYH 4MPUA 5LPRA 1BHXB 2EI7A 3AW0A 1P01A 4VGCB 1AFQB 1J9CH 1UHBA 4NGAH 1O2VA 1BCUH 7LPRA 3QO6A 1YPKH 4OGXA 1G2MA 2XWBI 5TCAA 2ZDVH 1TOCB 1BUIA 1Q2WA 3M37A 1OOKB 2WUCA 2ANYA 4IGDA 3RP2A 4GSOA 4Y6DA 2AH4X 1GMHG 1MTUA 1CHGA 1SGEE 2W7SA 5L30H 1MTVA 1LQEA 3PROA 3HK3B 3LIWA 4ISNA 1DWDH 2SGPE 5J4SA 3GCTF 1O3DA 4DVAU 2FP7B 3A87A 3BF6H 2HNTF 1JRTA 1NFUA 3BTKE 4X1SU 4BTTB 1IQJA 1DY8A 1S6FA 3STJA 1QGFA 2TRMA 2ZTYA 1IHTH 1TQ0B 6LPRA 1V2LT 3GCNA 1GVLA 2SGFE 2BDGA 1DFPA 3UWIA 3FP8E 5F8ZA 3MHWU 2BMGB 2BM2A 8KME2 1B0EA 1GBIA 3E6PH 1H9IE 1MKXH 1O3EA 1ZHMA 4IW4E 1O3LA 2ZP0H 2GZ8A 3ZVGA 1C5TA 3AW1A 3L33A 1LVOA 2FPZA 2HPQH 1OKXA 3HGPA 2XBYA 1RIWB 4LZ4B 1OWDA 2ZHEH 5C3NA 4NG9H 3EAJA 1VGCC 1E37B 1L0ZA 1P2MA 3ODFA 4ZHMU 1O2LA 3M36A 2P95A 3TGJE 4X2XA 3V7TA 1BDAA 2XBXA 2PGBB 2Z9LA 2VWLA 2ZI2H 3HGNA 2W3IA 5B6OA 2UWOA 1PQ8A 2CHAC 1YM0A 1D4PB 3GDVA 3BTQE 2AGGX 1MD8A 2EI8A 3HKJB 3I29A 1TNIA 3GDUA 1C9TA 4JZEH 3RC6A 4IC5A 5LPFA 4MNXA 4ISHH 1D3DB 2BDAA 1Y3WA 1EZQA 2Q6GA 1W8BH 1YPHC 3IITA 4ABGA 5C1XA 3A8CA 2UUKB 1AY6H 4IMZA 3LGVA 5DKMA 3DD2H 1CSOE 1O33A 1IHSH 1PQ7A 1GBEA 1YGCH 4GHQA 3SJ9A 1QIXB 3ATLA 3GICB 4MLFB 5EGMA 1HIAA 1FY4A 1MBQA 3LGYA 3OTJE 3QGJA 1HAPH 1O2ZA 1TONA 1QL8A 1ZHRA 3BTME 1BTYA 1V2RT 2QY0B 1W3CA 2Y5GA 4OS7A 3SJ8A 3SU1A 2QXJA 1FAKH 3RMMH 1XM1A 2F9UA 3MNXA 2BD5A 2ZDNA 2ZU4A 2XYAA 5FXLA 2FYQA 4R8TB 3A83A 1S5SA 1GBAA 1CO7E 3KNXA 3QX5H 3GCHC 3SN8A 1ANBA 4XOJA 1YC0A 1ZGVA 2V3OH 1BTZA 1CQQA 1O2SA 2BLVA 9LPRA 1MKWK 3RXAA 3RDZA 2BQ6B 2D26C 4ESTE 4XBBA 1SQTA 4IC6A 2VU8E 1EP6A 2YOLA 2B8OH 2BHGA 2JH5D 3UNRA 3QUMP 1BJUA 3M7UA 1O3IA 2BZ6H 3RLYH 5AFZH 3NK8A 1WAYB 1AMHA 3RM2H 1MBMA 3SNDA 1Z7KA 2BD7A 1O5DH 1FUJA 1AB9C 3JZ2B 1BTPA 3A7ZA 1Z71A 4YOGA 3SU2A 1WTGH 4JCNA 2Z6BD 5E0HA 1FY3A 1EASA 1V2KT 4BANB 3UOPA 5GCHG 3GYMA 5EXLA 1SGFA 1LPZB 3GY3A 1CE5A 2O8LA 1F0SA 1HDTH 4B73A 1OWHA 3MH7A 2BYAX 2ZU1A 2XRCA 2ZPRA 1QJ6B 2OTVA 4AFQA 1G3BA 3GY5A 2PW8H 1DSUA 5G4BA 4B2BA 3M5OA 3VB4A 1RS0A 4UEHH 4KKDA 1SSXA 3H7TA 5JBCS 3M35A 1T8LA 3BIUH 1JRSA 1MQ6A 4UFGH 5JDUB 4IS5A 4OGYA 5EXMA 1C5LH 2G5NA 4WXVA 3TLOA 1OWJA 1O35A 1GBLA 1W12U 1THRH 2F9BH 2Z94A 1ELVA 4NWKA 1AKSA 2J2UA 2H2ZA 4K1SA 3LGWA 2CF9H 4TPIZ 3GOVB 1IQFA 3ZYDA 3TJNA 1AN1E 1HAHH 3GY7A 2VIPA 2ODYB 1DVAH 1NZQH 3MH5A 1T31A 2A0QB 3UNSA 2G00A 2P3FH 4ZROA 3UR9A 1GHAG 1BOQA 1EJMA 4BXWA 1BQYA 2R2MB 5C2ZA 1Z6EA 1L1JA 3M5NA 2TGPZ 3A89A 1C2MA 1G3EA 4H42U 3VXFH 1L1NA 4X8UH 4B71A 5GCHF 2ZGCA 5CHAB 2AYWA 2DE9A 2NU0E 1C1RA 1KXEA 2G4TA 2ANMH 2VGCB 1O3CA 1G30B 2VIDA 3QZRA 2ZKSA 3E0PB 1BHXF 1J14A 4ZKNU 1GL1A 1FY8E 4ZXXH 1TNKA 1FLEE 2DE8A 1ZSLA 3RMNH 3URCA 1J15A 1FAXA 2NU4E 1WOFA 1W14U 1SQAA 2EEKA 1LHGH 1QB1A 2A2XH 3P8FA 4X1QU 1HAVA 1KIGH 1YKTA 1XUJA 3TJOA 5T3HA 1SC8U 4Y76A 1LKBA 3OYPA 1C5MD 1KXFA 2WINI 1QR3E 5A0BA 1O39A 5A8XA 1SGTA 1ELBA 1FI8A 1C1SA 3A7WA 1C1WH 3T62A 3WY8A 4ABIA 2AFQB 1WTHD 1CBWC 2D2DA 2BLWA 1A0JA 1KXCA 5DJ7A 4CHAB 1ZTKA 1PPCE 1QCPA 1A3EH 1A5GH 1CGJE 1PPGE 1S83A 1IQNA 2FYRA 5LGOA 3A86A 1RXPA 2OC8A 2VIQA 1Z6JH 1PPEE 1WQSA 2AMQA 1VITG 4X6MA 2VIWA 1TRNA 1TRMA 2UWPA 3KN2A 4YOJA 1Z1JA 4BAHB 2FEQH 2BD8A 2BY5X 3OY6U 4CRDA 1C2FA 1B7XB 1QL7A 2P3TB 4MPVA 2GVFA 5A09A 4OS5A 1KXBA 4B2CA 4AOQA 5AHGH 3ODDA 1KYNA 1FN6A 2UWLA 1P3EA 2ZWLH 4AX9H 4WH6A 3SJIA 2O8TA 2CF8H 1O3MA 1SGRE 3UY9A 1ZSJA 1SHYA 4NA9H 3UREA 4WMDA 1F5RA 1GI7B 1C1PA 2PKAB 2BVXH 3RXMA 1MTNB 3LGUA 1HB0B 1O5FH 4CH8B 6GCHG 3JZ1B 3W95A 3F68H 1HCGA 1P11E 4OS4A 3PTBA 2F9PA 2ZU3A 1C1MA 1H9HE 1GCTB 3Q3KA 1UTJA 3ZZ3A 3BG4B 1V6DA 2HWLB 2ZCKP 3MFJA 2RA0A 3TNSA 1TBZH 3V0XA 1O2OA 2QXIA 2BQWB 4K8BA 5HM2A 3UUZA 4THNH 3SV8A 3RXIA 5JBBS 1QBNA 3O8RA 4DW2U 1ZPZA 1EZSC 2TIOA 3D65E 1DM4B 5HM9A 3A82A 1K2I1 1SG8B 4Q2KA 1NN6A 1O3KA 1CA8B 2C8WB 8GCHF 3VFEA 1LO6A 2BY6X 3S9BA 2G8TA 3UTUH 4OS1A 1CGHA 1S0QA 2ZIQH 4K69A 3PO1B 1DWBH 1T8MA 4E06H 5FHTA 5EXNA 1IQIA 1FY5A 1GVKB 1DWCH 1GCDA 2ZQ2A 4A6LA 4DIIH 2Z9IA 1GJ5H 5FBEA 1C4V2 1TNGA 1AWHB 4Z6AH 4YT6H 3BTFE 3SJKA 1JWTA 5DP9A 1GBDA 3TK6A 2CXVA 2O8MA 1HBTH 2HNTC 5H4IB 1GG6C 1QFKH 2ZHFH 3ATWA 2FZZA 5FPYA 5FCKA 1XUIA 1T32A 4K5ZA 1MH0A 1F92A 4NIXA 1MUEB 4INLA 1SGYE 3SQHE 3T27A 5LPEA 1NTPA 1VCQA 5I46H 5DP4A 1UCYH 3E90B 3LKWA 1F0TA 2TPIZ 1EX3A 2A2QH 1VJAU 2A31A 3KL6A 1YCPH 3OSYA 3SUGA 2G55A 1NRQH 4MQAA 1RTFB 1NFXA 1AIXH 2ZDKA 3RXDA 3SU0A 5A8ZA 5DP3A 3MU4A 3SGBE 1TOMH 1N8OB 4Y11E 3N7OA 1HPGA 1TGTA 2ZFTA 1GPZA 5EQRA 3LC3A 2WYJA 3MOCA 2ZA5A 2EI6A 1BBRK 1AZZA 5DG6A 5K0HA 2R2WU 2OQUA 3LC5A 2WV5A 3RU4T 2ZNKH 4NSVA 4UFEH 1IQEA 2XCFA 4ZH8A 2FOAA 1QQUA 3UR6A 4NZLA 3M3SA 4ABBA 1K1LA 4O3UA 3A8AA 1P57B 3RMOH 1BT7A 4FXGH 4GPGA 1OX1A 2QA9E 4AFZA 1AWFH 1HJAB 3URDA 3P95A 2ULLA 2SNVA 4X0WU 1BMAA 3E8LA 2QXHA 2BOHB 4FUFA 1K1IA 1GBCA 2GMTB 5J4QA 1O3PB 1OP0A 1ARBA 4TYDA 1GJ6A 4A7IB 4B76A 2GV6A 4X6OA 1FZZA 1W0YH 2HVXA 4X6NA 2VWOA 3DT0H 2ZPSA 2H9HA 2GT8A 1YYY1 4I8LA 1PYTC 1LPGB 1C1OA 3SNEA 1KDQB 1HRTH 1GDNA 5EU8A 4M7GA 1P06A 3D23A 1C5QA 5HGGA 1BTUA 4JMYA 1O2GH 3K6YA 2FX6A 1D6WA 4Y79A 4GCHF 1HAYB 4ABJA 1P02A 1P9SA 3Q00A 3ZZ6A 4DG4A 3KGPA 2Z3EA 2ZZUH 4AGJA 3KQCA 1V2OT 1Y3XA 4GLYA 1UTPA 3LGTA 1D3TB 2QN5T 1TABE 1ZMLA 1GI6A 4NIYA 1GHVH 3GCTG 1BRAA 1O5CB 1MU8B 4ZXYH 3A88A 1D6RA 1HJ8A 4HFPB 4JZIA 1HFDA 2ALPA 1SGFG 1YPMH 1SQOA 4YT7H 4FU7A 3BTHE 3GY4A 4Y7AA 2PKSC 3TK5A 4CBNA 1BB0B 1V2PT 2PR3A 1EOLA 1O2IA 4I33A 4FUHA 2J4IA 3MNCA 3SHAH 1C1TA 2PV9B 3KIDU 1W2KH 1MQ5A 3SNAA 3BV9B 4UD9H 1NU7B 3RXLA 1NRNH 1THPB 3RXCA 4YOIA 1DLKB 2GKVE 4X1NU 1O37A 5T6GA 2Y7ZA 2ZCLP 4Q7XA 1MAXA 3M61U 1C5UA 1UVUH 1BMMH 3PMHB 3RXOA 1K22H 1SLXB 1PYTD 4H6TA 1FV9A 2WPMS 1QURH 2CN0H 1JBUH 1VGCB 1W7XH 2Z9GA 2FWWA 2FOEA 3ITIA 5FX5A 1B5GH 5I25A 1XXFA 4NIVA 1IQGA 1Z1IA 3P8GA 2BLOA 2VH0A 1A0LA 3T25A 2STAE 3MMGA 3E3TA 1LHDH 2I6QA 1C2GA 2WYGA 5L2ZH 3RXUA 1UTQA 1H9LB 2OLGA 1O2YA 1GGDB 1NS3A 4K8YA 2FOBA 3SJOA 4BAMB 4CR5A 1ZR0A 2ZO3H 2Y5FA 3F9GA 2AMDA 5GPIB 4NFFA 2LPRA 1WQVH 3KEEA 6CHAC 2FLBH 3RXRA 4AZ2B 1A5HA 1MKXK 3VGCC 1MMJN 2W26A 4JYVH 2RG3A 2XC0A 3W94A 4ZHAA 1SGPE 4NSYA 2ZFSA 1PJPA 3MU0A 1WSSH 1P9UA 2H9EH 1DXPA 2ZFQH 1C5NH 1GJDB 1AGJA 4VGCC 1A4WH 1CU1A 2TGDA 1HAIH 1RTLA 3STIA 4JZFH 1ZGIA 1S84A 1C5YB 3NCLA 3A81A 1P2JA 4FUEA 1Q3XA 1PPBH 2GX4A 4INKA 2ZFFH 2OP9A 4A1VA 1FNIA 1YPJH 1Y3VA 3SUEA 1N1LA 1UJ1A 1J16A 4ZKRU 2V0BA 1TAWA 1EPTA 3ZZ7A 1FDPA 1KLJH 1IOEA 1QHRB 2VIOA 5DP7A 4CRCA 4ZKOU 1XVMA 4RKJB 1E35B 1FN8A 2ODQA 1HAGE 1V2QT 4XBDA 1WV7H 3CS0A 1SB1H 1HAZB 4WY3A 1ZMNA 1HJ9A 4LK4A 2JH6D 1EJAA 2QV1A 1C2KA 3R0FA 4XFQA 1C5XB 1GBFA 4YLUA 4GAWA 1BA8B 2HGTH 3ESTA 3S7HB 3NZIA 4DIHH 2BDHA 1ZPCA 3U98H 1O2QA 1KY9A 5C5NA 1SVPA 1YBWA 4B75A 1RIWC 1AD8H 3O8BA 4AYYB 2PGQB 4AG2A 1QA7A 4AB9A 1K1MA 1P2NA 1DITH 1AHTH 1YPEH 1YLCA 3LU9B 2AERH 2ZDAH 1V3XA 2Y7XA 3KQBA 3MU5A 4FUBA 2ZHWH 3A8BA 1FMGA 4BNRA 1P03A 1O3GA 1M9UA 2G52A 2FI4E 1A1RA 1GHZA 1DDJA 1G9IE 1JMOH 4NZQA 4MNWA 1C4Y2 4K3JA 2G5VA 2THFB 1J8AA 2ZGHA 1BBRE 2ALVA 2HOBA 4O97A 3O8DA 3K6ZA 2KAIB 3Q3XA 2Q1JA 1MKWH 4I31A 2JETB 4BAQB 5IYTA 1TBRH 1TFXA 1W7GH 1XKAC 2P94A 3S69A 1CA0B 1GMDF 3S9AA 3UPEA 1HLTH 4TWWA 3AAVA 2K1QA 1UHBB 1UO6A 4LZ1H 1L4ZA 1GJ9B 3NKKA 1EKBB 5F03A 2GCHF 3NUMA 2I6SA 3DFJA 2YNAA 2IJOB 3EE0B 3U69H 3UNQA 3C1KA 4DOQA 1F5LA 1V2WT 3PLKA 1MCVA 1T8NA 4CRAA 5JB9S 2A5IA 4R0IA 4Y8ZA 4ZUHA 3AAUA 3T5FH 1ZRBA 2BX4A 4Q80A 1GJCB 1TNHA 1TPOA 2XW9A 2P8OB 1C5WB 4IMQA 4X8TH 3MNBA 5EQQA 3EGKH 1KTTB