1ELDE

Structural analysis of the active site of porcine pancreatic elastase based on the x-ray crystal structures of complexes with trifluoroacetyl-dipeptide-anilide inhibitors
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords ELASTASE
publication title Structural analysis of the active site of porcine pancreatic elastase based on the X-ray crystal structures of complexes with trifluoroacetyl-dipeptide-anilide inhibitors.
pubmed doi rcsb
source organism Sus scrofa
total genus 59
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1994-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1eldE02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1eldE01
3U8OH 2ZF0H 1C5TA 3TGJE 1AUTC 1O3HA 1KTTB 3E6PH 5HYOA 1XUHA 1PPZA 2ZDMA 6LPRA 1TBQH 2ZNKH 4HZHA 1G36A 3TH4H 2GCTC 2C3SA 4X1PU 4Y0YE 4B2CA 1KTSB 2GCHG 4ZKOU 1XVMA 3RXVA 1EZUC 2QC2A 4UFGH 1MU8B 1KXFA 3ZVCA 1HRTH 1WSSH 1C4U2 2VJ1A 2CXVA 2XCFA 5HXFA 2VWNA 2OBOA 2VINA 1ESBA 2SNVA 2ZU1A 1HAZB 1BB0B 2P8OC 5LPFA 1IHTH 1CQQA 1GDUA 4FUHA 2VGCB 1EPTB 1GBJA 1MD7A 2J2UA 1SQOA 2O8LA 1UVOA 4GLYA 1DWDH 2Z6BD 2OC8A 4ZH8A 2GMTB 1SGYE 4E06H 4IC5A 1NFWA 4H6TA 4JZEH 2J95A 1KDQB 5DG6A 3PTNA 2B5TB 1EX3A 3A7XA 1K1MA 1K28D 3UOUA 1GI7B 1L0ZA 5A2MH 4Y10E 3RP2A 3SV2H 4IMZA 2KAIB 2PTCE 4BTTB 1SQTA 1TA2A 1LVBA 4JZIA 3EAJA 1QFKH 2VIPA 1B7XB 1NPMA 2BOKA 1VJ9U 4TWWA 1BTUA 1EZXC 1ZPZA 1LHFH 1EP6A 4DT7B 5CE1A 2ZHDA 1P01A 1TGTA 1SB1H 3KN2A 2Q6DA 5FX5A 3S0NA 1OWEA 4O97A 5L2ZH 1VGCC 1ZHRA 1A0LA 3RXDA 3UWJH 2VVUA 1GBHA 1ZGVA 3BTWE 1YPHE 1F2SE 4AORA 1BRBE 3FZDA 3RXAA 3P17H 1OWJA 4INKA 1PPGE 1EJMA 3GY2A 3SGAE 2Z3EA 4AOQA 5A8XA 3KQCA 1YPMH 1ZHPA 2BXTH 1KLJH 1IQFA 3SHAH 4BANB 3V7TA 3EYDA 4CRDA 4RKJB 2WV4A 3BTFE 1C1PA 3ITIA 4K1TA 3M3VA 5GCHG 1O2TA 3QGNB 3ZZ3A 1U6QA 2G5VA 1GDQA 1FY4A 5JBTA 1C1MA 1IQLA 1LHEH 4RSPA 1DY8A 2XBWA 3EE0B 4JZFH 2TGDA 5E0HA 3RXCA 4XBCA 4DGJA 1O3OA 2J9NA 1C1NA 2A32A 2B9LA 1NRRH 2J92A 5DP3A 4BAKB 3A7ZA 1SLWB 2GZ8A 1ELFA 4FUJA 3T28A 1FLEE 4K1EA 1J9CH 5CHAB 2FYRA 5EOKA 4RN6A 2BVXH 1WTGH 2FM2A 4DIHH 3H7OA 1BMLA 4OS1A 2FOBA 1EATA 1CSOE 1QBNA 1VZQH 1O3EA 1A0HB 1CBWC 2BD8A 1RRKA 3GY3A 1E38B 1TPOA 1C5XB 2UWLA 2FI3E 4NCYA 1TRNA 3NK8A 1Q31A 1UTPA 3PO1B 5EPYA 2PR3A 1FV9A 4U32A 1YPLH 1A1RA 1TNIA 3H7TA 2ZCHP 3W94A 5C20A 2EI8A 4GSOA 5DPAA 1O2JA 3K65B 4H6SB 1DUEA 1ZHMA 5HM9A 3HK3B 4B2BA 1G3BA 3A80A 3FP8E 4IN2A 4M7GA 1AD8H 2EA3A 3GYMA 4O3TA 3CP7A 5JB8S 2FOGA 3CS7A 3F6UH 4HI3A 2FOAA 1MKXK 2XXLA 1FDPA 1VITH 1C1TA 4ISHH 2A4GA 4I8JA 1NC6A 1OP8A 3KGPA 4TY7A 4O9VA 1TB6H 1TWXB 4CRGA 3LH3A 2O9QA 2UUYA 5FBEA 3T2NA 2AGGX 1CGHA 1AB9B 5AVDA 1O2OA 1NU7B 2A1DB 1BTPA 3RXFA 3N7OA 2ZHQH 1C5YB 1PYTC 1XKAC 1T4VH 2VVVA 1F5RA 4KTSA 2AGIX 4JYTA 3F68H 1PJPA 1O5DH 4OS5A 5DP5A 3SUDA 1V2QT 1VR1H 1ZRKA 1PQ8A 4TYDA 2BLOA 2ZFRH 3UPEA 3P8GA 1A7SA 2OD3B 1HAGE 2BHGA 1TQ7B 2ZGJA 1W7GH 2ZTZA 3UQOA 1C5ZB 2VWOA 3MNCA 1GI5A 5F8ZA 3U1IB 1KLTA 3M35A 1XUGA 2XC4A 5EODA 1F0SA 1TNHA 1DSUA 1LVMA 3MU0A 4Y7AA 1GBMA 1XUJA 3RC6A 1LPZB 2I6QA 2QXJA 3D23A 1WYKA 2VIVA 1K1PA 4NFFA 2ULLA 4VGCC 2PFEA 1HYLA 3BEIB 2VVCA 2Z9LA 2FESH 1ESAA 1UTKA 2G8TA 3M5OA 3ODFA 1O2YA 4B75A 1QA7A 1SGPE 1TQ0B 4AFSA 1O31A 3QN7A 4ABEA 1O35A 1QGFA 2FXRA 2QV1A 2ZTXA 1T8OA 4IGDA 1ZMNA 2NU0E 1V2MT 1YCPM 1UO6A 4TPYA 5EQSA 2SNWA 1ZLRA 2Y5HA 1V2KT 2UUFB 1WV7H 4SGAE 4Y71A 3HGPA 1GI3A 1GMHG 1ESTA 2AIPA 1LDTT 2OBQA 3UY9A 1GI4A 2BY9X 1RGQA 1RJXB 2BDCA 1V2NT 4XE4A 2FYQA 2BB4A 2HNTF 1YPJH 1Z71A 1P2MA 1C2HA 1O34A 3TJUA 5JBAS 1DUAA 3MU5A 1TGNA 1ETTH 2GT8A 3QDZB 4CH8B 1HB0B 4FUCA 1HXEH 4B2AA 1HJAB 5EW2H 3KL6A 3ZZDA 3JZ1B 2BD9A 4YLUA 3RLYH 4BAMB 4FVDA 4AG1A 2A7HA 4MG3A 3BTTE 1IAUA 1TBRH 4X8SH 2XWAA 4WH8A 1DLKB 3K6ZA 1LPGB 1DT2A 1SGNE 3JZ2B 4X1NU 1NS3A 3A88A 1GHBG 3ZZCA 3L6PA 1TGBA 1MD8A 2C93B 3ZZAA 2VIDA 2B8OH 1BHXB 1GBEA 2BY6X 2HPQH 1LQEA 1MBQA 1UK3A 4I33A 4JCNA 2H9EH 1FJSA 2ZGHA 1D3PB 2EI6A 3A86A 5A8YA 1N1LA 5EW1H 3TVJB 4KKDA 1CT4E 3LGYA 2AMQA 2W5EA 3MO6A 2H9HA 1V6DA 1YM0A 1ANCA 2J94A 2OC0A 2P8OB 4NIYA 4ASHA 2UUJB 3C27B 1Z7KA 3SNAA 3VXFH 1EZQA 2JETC 1F0TA 1T8NA 4ESTE 2P95A 1V2OT 1DVAH 4FXGH 1FONA 2QGRA 1O2MA 1G3EA 1CU1A 7KMEH 1MH0A 4K3JA 3P92A 1KYNA 1ANBA 2EI7A 1TX8A 4D76A 1DWBH 3SV9A 5C5OA 4I8KA 1TOMH 1P05A 1BTYA 4YOJA 4GUXA 3GDUA 5C1UA 8KME2 1C5RA 3AW1A 4YZUA 3QK1A 1MKWH 4B73A 1C1VH 1P06A 2A7CA 5A0AE 4FU9A 1ELAA 1FIWA 4D8NA 4LK4A 5C3NA 3BG8A 4CR9A 1C2DA 3LOXA 1QBVH 1W0YH 2ZFPH 3U8RH 2BOHB 3Q3YA 3TH2H 2K1QA 1BBRE 2FLRH 6CHAC 3U8TH 1PPEE 4B74A 1N6YA 2BD5A 1Z1JA 2R3UA 4MDSA 1W3CA 4ZMAH 3SORA 2Y6TA 4MTBA 1XUKA 2OCVB 1A3BH 2P3FH 1BZXE 1HPGA 3A7TA 1DOJA 2R9PA 1MQ5A 1W11U 1SGIB 2GCHF 1MTNB 1YPEH 3MTYA 1PPBH 1KY9A 3RMMH 2UWOA 1BMNH 4U01A 2D1JA 3TK5A 2FI5E 3W95A 1W14U 1AIXH 2QF3A 1C2KA 1H9IE 1C5VA 2AYWA 1LCYA 3GCTF 2G4TA 3C1KA 1D6RA 1KXAA 1O2LA 1EB1H 1UHBA 4ABIA 3RXKA 4AN7A 1V2RT 2BLWA 4R0IA 3SU0A 2BLQA 3SV7A 4J2YB 4ZHLU 1CGIE 1F5LA 4BNRA 3TIUA 1Y5BT 1GHZA 1Z1IA 2ZQ2A 2WINI 1C4Y2 2C90B 5C1XA 4JYUH 3E91A 1BRUP 2OUAA 8GCHG 4ABAA 1WUNH 1IQNA 1QBOA 1E35B 1INCA 1NN6A 3SJ9A 3ODDA 4CRFA 5A0BA 3SQEE 1BTZA 2RG3A 1MUEB 1ZMJA 1TPSA 2PKAA 2XC5A 1GBDA 3FZZA 3V12A 3UTUH 5EQQA 4OGYA 1FY3A 5L2YH 2NU1E 4NGAH 5FHTA 4IW4E 1CA0B 2D2DA 1XUFA 2FOHA 4MNWA 1ACBE 1ORFA 1AE8H 2ZECA 1H8IH 1O5FH 2WPIS 4NSYA 9LPRA 4OS7A 1JWTA 2Y5FA 5FPTA 1G32B 1GGDB 1DPOA 1HAYB 2F9VA 1MCTA 1W8BH 5DO4H 2R0KA 3M7QA 2ANWA 2BY5X 7LPRA 3KCGH 2C8YB 2PUXB 1PQAA 1NRQH 1TE0A 2J38A 1EXFA 3VFEA 4X2XA 1UCYK 3GCHB 4I32A 4MPXA 3RU4T 1YGCH 2WPJS 4BAHB 3UNRA 5FBIA 2ANYA 3QWCH 1UJ1A 7ESTE 4X6PA 4ZKRU 1F92A 2PLXA 5E0GA 3HKIB 3STIA 2Y7ZA 2H9TH 2WUBA 4WXVA 1C5LH 5A09A 1TABE 3RXLA 3NZIA 1IQJA 1C5WB 1A3EH 4CBOA 3AW0A 3WY8A 1QJ1B 3LU9B 1CHOG 1WU1A 2LPRA 2HNTE 3M36A 1O2RA 3S9BA 2Y80A 4WMDA 4FUDA 4X1SU 3GY7A 1K21H 4NWKA 3PMHB 3S9AA 1NM6A 2PSYA 4ISOA 4J1YA 4Y6DA 4YT6H 4RKOB 1KXBA 1HCGA 2O8UA 1SGFG 2ZWLH 5HM2A 4UFEH 4X8UH 2GKVE 1GBIA 2FP7B 1GI0A 1T32A 1P0SH 1O2WA 1UVSH 2CN0H 2R0LA 2C8XB 4GCHG 1DE7H 2A0QB 3EA9A 3MFJA 2VH6A 1DX5M 1QL9A 5FAHA 3BTKE 1O2PA 2P3UB 1MCVA 4VGCB 3QTOH 5ABWA 2FS9A 3TLOA 1QCPA 3ZYEA 1JMOH 4ABJA 1PQ7A 1LVOA 4NIXA 1A2CH 3PM3A 1RTKA 3VB6A 2F9PA 1CHGA 2ZCKP 5L6NH 3FVFB 3VEQB 2OP9A 2IN2A 1AHTH 3NCLA 4Y76A 5AFYH 5LPEA 1C5UA 1SOTA 1YCPK 2A5IA 1GBKA 3ENSB 3HK6B 3A85A 2ZGBH 1ID5H 3RXBA 2TGAA 3MO9A 1O2QA 1IQMA 1MAXA 1KXDA 3LDXH 3OY5U 3VB5A 4TY6A 1P8VC 3KF2A 4Y7BA 1OS8A 1SOZA 4GHTA 2HLCA 1SLVB 1SGRE 1TNGA 1PPCE 2G00A 4B1TA 1SC8U 3F9EA 1UMAH 2AMPA 4Y8XA 5T3HA 2BTCE 4JZ1A 3SZNA 1K1JA 1NTPA 3LGTA 1EJAA 3VXEH 3GISB 4WF8A 2QN5T 3ATLA 3RU4D 4ABHA 5GDSH 1W7XH 1F7ZA 1AO5A 1AZZA 1NESE 2Q6FA 1RIWB 2Z9GA 3MWIU 4XOJA 1EUFA 2XWBI 3MH4A 5J4QA 2VWLA 2P94A 1E34B 3A89A 1JOUB 1D3DB 1AWHB 2A2QH 2Y82A 1RTLA 2VNTA 5JBBS 2CF8H 1Y3XA 1C5MD 2P3TB 1QL8A 4MPWA 1VCPA 3PLBA 1TLDA 1P2OA 1XX9A 1SHYA 1PPHE 2V6NA 1X7AC 4A5TS 1T4UH 5GJ4B 1Z8GA 4I8HA 3D65E 1MTSA 6GCHF 1O2UA 7GCHG 2QCYA 1C5QA 3LIWA 2WYGA 4BAQB 3S9CA 1ZPCA 3A8AA 1DSTA 3SOSA 4CREA 1EKBB 1P10A 4UFFH 1MKXH 4A6LA 3F9FA 5EG4A 3OYPA 2ZDKA 4MPUA 1NRNH 3SU2A 2H2ZA 3KQDA 4CH2B 2GZ9A 1NFUA 2BDBA 4Q2KA 1GMHF 2PGQB 1O3DA 4OS6A 1SMFE 3UR9A 2A31A 1ZPBA 1FMGA 2P59A 1GJCB 1P04A 1ZSKA 1VCQA 2BVSH 1SQAA 1NFYA 1SGDE 4JZDH 1OP0A 1ZMLA 3M7UA 2GDEH 3R3GB 5DGJA 2NWNA 3SGQE 2BZ6H 1GJ6A 2FIRH 1S5SA 1FAXA 4GAWA 1FI8A 4X6OA 1TGCA 2ZG0H 4JYVH 2BDAA 3SU3A 2CF9H 4ZUHA 2QXGA 3O8RA 1DICA 1GJ4H 1S6HA 1GJDB 1D3QB 4U2WA 2ZCLP 3E3TA 3UIRA 4ZXYH 1HIAB 1TIOA 4AYYB 1SI5H 1PPFE 3RXHA 3K9XB 5CMXH 4FU8A 2QAAA 2ZI2H 2ZPRA 3SUEA 4CR5A 4X0WU 2VB0A 4KTCA 1GBLA 1MQ6A 3DA9B 1QHRB 3IG6B 4SGBE 5ETXA 1B0EA 1F0UA 2ZPSA 1OSSA 1SGQE 3NWUA 4Q7ZA 3SNDA 2SGQE 4UONA 1OKXA 4YLQH 1C2LA 1ARBA 5GIBA 4NZLA 4Y79A 1GMCF 2VU8E 4YOGA 2ODQA 2EC9H 2TGTA 3RXGA 1XM1A 4NZQA 1CT2E 3ATKA 1QIXB 2PSXA 1RFNA 1UHBB 3SI3H 1GBCA 2VIOA 3RMLH 1SHHB 3DD2H 4ZKSU 5LGOA 1GBTA 2NU2E 1NRPH 5EGMA 2W7SA 1KSNA 4FVBA 5F6MA 4IC6A 2IOTA 3SUFA 1P2IA 3PLPA 1BIOA 2FLBH 2Z7FE 3M3SA 3BTME 4B71A 2TPIZ 1YPGH 1YPKH 1IQHA 1MBMA 4KTUA 1C9PA 1P2JA 2M5TA 3A87A 2PKAB 3U1JB 1QJ6B 3GDVA 1DITH 3QGJA 3RLWH 1ABIH 1CA8B 4WY3A 3SN8A 3UOPA 1BMAA 2W3IA 1A61H 3FFGA 1ZJKA 1P9SA 1TNLA 1PQ5A 3ZZ5A 4HFPB 2ZKSA 3LC3A 2FOFA 1ZYOA 4UEHH 1P02A 1ELGA 3BG4C 5E2PA 2PW8H 2FX6A 2ZU3A 3LGIA 4FUIA 4CRAA 2AIQA 3TITA 1QA0A 1ZTJA 1TPPA 3G01A 3GCOA 3RXJA 1E37B 3NUMA 2BQWB 1N8OB 2VIQA 4MLFB 1L4ZA 2Z94A 4ISLA 1PYTD 1QJ7B 1Z6JH 1NZQH 3E16B 2XCNA 4Q7YA 2ZC9H 4XFQA 4Z0KA 3SQHE 1O32A 3MH6A 4ZXXH 1DXPA 3SV6A 1O5CB 2H1UA 5EXMA 3RMOH 1O2NA 3DT0H 2FI4E 3UNQA 1W2KH 2BZAA 4E7NA 4MQAA 3K2UA 3SU1A 1O3GA 4KP0A 5DK1A 1GG6B 1S84A 3SJIA 1P3CA 3HPTB 1NU9A 1P2KA 1Z6EA 2ZGXH 3MYWA 3L3TA 1H8DH 3DFJA 3MU8A 1DLEA 2VGCC 1ETSH 1EPTC 2HNTC 3VGCB 3BEFB 4A1VA 1EAUA 1FIZA 3HATH 3DFLA 3F9HA 1BOQA 2BYAX 2PV9B 4R8TB 1O5AB 1AY6H 4UE7H 2WPKS 4INLA 1H4WA 4KELA 1P2QA 1P03A 4X1QU 3EDXB 3L33A 5AF9H 3ZVAA 8GCHF 1O3BA 3PMBB 4MNVA 1T7CA 5G4BA 1IQIA 1FQ3A 2TGPZ 3CENA 1C9TA 1GHAF 3SNBA 1TAWA 1QR3E 1THSH 2GGVB 1GI2A 2WPHS 1ELVA 4K60A 4WWYA 1AVWA 1ZTKA 2XC0A 3LGVA 3RUOA 2CHAC 2NU3E 2BY8X 1A4WH 4HTCH 3K6YA 2GCTB 3P8OA 1TMBH 2Z3DA 3LC5A 1ZSJA 5BRRE 1BCUH 2QY0B 2ZIQH 3A81A 3BV9B 1BQYA 2TIOA 4ZROA 1DWEH 5FCRA 1IQEA 1IOEA 3UQVA 4YM9A 1JBUH 1G3DA 1YP9A 3BTEE 3ZZ7A 4ZAEA 1TALA 2CGAA 3RXSA 3URCA 4DVAU 5GXPA 3ZZ9A 2I6SA 1AKSA 2FEQH 3ESTA 4UD9H 1GBFA 3P8FA 1UVPA 2F91A 1NROH 1UTQA 2B7DH 2NU4E 1EAXA 1GDNA 4CRBA 1B5GH 4UFDH 5F03A 2G52A 1C1SA 1ZR0A 2Q1JA 2ILNA 2SGFE 1O3CA 2BDIA 1BITA 4NFEA 3MNSA 3EA8A 1P12E 1GVLA 1SR5C 1ZGIA 4MPVA 5BPEA 1RS0A 1K9OE 1SGFA 1BA8B 3OX7U 1ZRBA 2ZHFH 3SJKA 4IN1A 1WCZA 1WTHD 2SGPE 5CHAC 1YPHC 5IYTA 4H42U 3ZVEA 2HALA 1JXPA 3LGUA 3SU6A 3M3TA 1HIAA 4I7YH 2PGBB 3Q76A 1VGCB 2J34A 4AX9H 1O2KA 3R0FA 2ZFTA 5F8TA 1TRMA 1OWKA 3PO1C 2ODPA 3KQEA 3PMJA 3BTDE 1FPHH 5JYIA 1MTVA 4FU7A 2ZA5A 4BXSA 2V3HH 1GJBB 2QXHA 2BX4A 1Z8IB 2F9OA 1RXPA 4NIWA 4FUGA 2GVFA 3BF6H 5DP8A 1O5BB 1A0JA 1GJ9B 1UCYH 2F9BH 1GWAA 1UVUH 2A5AA 5A0CA 4K8YA 2G51A 4QT8C 1UTNA 1HXFH 2SGDE 1J17T 3RXOA 3ZV8A 3RXIA 1NY22 1V2WT 2PHBA 1IQKA 3M7TA 1S6FA 2H5CA 2R3YA 3LJOA 1O3KA 2V35A 1TMUH 4AB9A 2XBYA 4IBLH 2ZFSA 2ZP0H 5C1YA 1AMHA 1O3AA 2ANKH 1C2GA 4NA8A 2PWXA 3UR6A 1HAVA 2G81E 1FY1A 1QQ4A 1FZZA 1BRCE 1Y3YA 1DFPA 5A8ZA 2BY7X 2FTLE 3B23B 4WJG2 2A2XH 1AFQC 1V2JT 1BTXA 4ABGA 4Z6AH 2BDHA 2GT7A 3TJVA 4GHQA 1WBGB 1EAIA 5H4IB 1HV7A 1V2PT 2CMYA 4LOYH 1CO7E 1O2VA 1JIRA 1ELCA 1HLTH 1JRTA 1UTOA 2CV3A 3T5FH 1CBWB 2P93A 1SG8B 1O3FA 3ZVDA 1OYTH 3T26A 4WXIA 4K1SA 3OY6U 3QTVH 5K7RA 1GJ7B 1GMDG 1GHXH 1N6XA 2SFAA 1A5HA 1EOLA 2ANMH 4ABFA 1GCDA 1FUJA 1YKTA 2ZU4A 2HGTH 3RXRA 1XVOA 2ZZUH 1S85A 1LKAA 4XBDA 2YNBA 3RXEA 4X2VA 5E8EH 1BRAA 4DCDA 1DANH 1OPHB 2O8MA 4F49A 1HUTH 1O3MA 1TOCB 2ZU2A 1OXGA 5F8XA 3B8JA 3F1SB 1CVWH 4DG4A 2A4OA 3MNBA 3RC5A 3VB3A 1L4DA 1YCPH 3GDSA 1GCTC 3D49H 3PV4A 1AN1E 3UWIA 3O8DA 5TJXA 1KXEA 5GCHF 1O3IA 1SFIA 3ZYDA 5FCKA 2GP9B 1K1IA 3UNSA 1OYQA 3RXUA 1O5EH 5ESTE 1UTLM 2B0FA 1O37A 2GD4B 2WV5A 2TRMA 2WYJA 3Q3KA 4IS5A 1BJVA 4X2WA 1QQUA 1RD3B 3FP7E 1LTOA 3GY8A 3HKJB 1BBRK 1ZOMA 2ODYB 1T8MA 1Y3VA 5DP6A 4X8TH 4D7GA 3E90B 3ZVGA 3BSQA 1AI8H 3UFAA 1E0FD 1O36A 1THPB 2XNIA 2Y81A 2FOCA 4X8VH 2D26C 1YYY1 3MNXA 5LH8A 4WMEA 3ZVBA 4WMFA 2ZU5A 4INHA 3GYLB 1GHWH 4BXWA 1FY8E 4AFQA 1BTHH 3GY6A 3MMGA 4I8LA 2STAE 1FN6A 2A45B 2Z9JA 4O03A 3ZZ8A 1T31A 5JB9S 1LHGH 1GPZA 3SV8A 5JBCS 2O8WA 4ISIH 1TPAE 1GL1A 3SI4H 1O33A 1AGJA 5JDUB 1BHXF 2XW9A 4XDEA 2GV7A 2THFB 2H6MA 3UREA 1C5SA 2VWMA 3QO6A 1SGTA 1UK2A 1BJUA 1QB6A 2HWLB 3SGBE 4THNH 2AEIH 3NKKA 1LKBA 1LPKB 2QXIA 5T6DA 4F4OC 3A7VA 1SSXA 1GVKB 4BOHA 3I78A 3A83A 1AVXA 2UWPA 3GCTG 1ARCA 1XXDA 2BLVA 1ANEA 1SLUB 3FANA 2FWWA 1SVPA 1YC0A 3A7WA 4GPGA 1O3LA 3TK9A 3TNTA 1VJAU 1VITG 2AH4X 4Y0ZE 1LHDH 2FDAA 1H9HE 5HGGA 2OTVA 3S7KB 3TJNA 4AGKA 1ABJH 1C2FA 1W0ZU 4YO9A 4D7FA 1HAOH 2BXUH 1LHCH 1C2MA 1G9IE 2ZHEH 1QL7A 1XKBC 3QZQA 4NSVA 2Y7XA 1EAWA 1O2ZA 1C1QA 2W3KA 3A82A 1MZDA 3EGKH 1P57B 2UUKB 3U69H 5EPNA 9ESTA 2A4QA 2XBVA 4A1XA 2ZDAH 1MTUA 2CHAB 2HVXA 2AGEX 1EP5A 1MTWA 1O2XA 1QURH 1V2VT 3ATWA 3HGNA 2G4UA 1P2NA 2Q6GA 1DXWA 4DIIH 5I25A 5EQRA 3LT3A 3MOCA 4ZHAA 2RA3A 2GV6A 2ZQ1A 1SGCA 3H5CB 2A4RA 1AKSB 1OWIA 2WPMS 1D9IA 5DKMA 2Z9IA 1A5IA 3LKWA 1MTNC 1QNJA 5LPRA 1GBBA 1GI8B 2ALPA 3URDA 1HAPH 1K1LA 1H1BA 4I8GA 3QLPH 5IDKA 2QYIA 3Q00A 1HAIH 2FS8A 1O0DH 1P3EA 3EQ0H 4Y8ZA 4AGJA 2ZHWH 2JETB 3M5MA 4OS4A 2OQ5A 3P70B 1ELDE 1ETRH 3BTHE 1TYNA 1L1JA 2XYAA 1W13U 3RXMA 2YNAA 5K0HA 1ELTA 2AMDA 1GVZA 2OQUA 1ZJDA 3TNSA 3GICB 4PROA 5C5NA 3KEEA 5FPSA 4LXBH 1NO9H 3TH3H 1EASA 2YOLA 3SNCA 2QA9E 4AFZA 1BTWA 1CE5A 1JIMA 4MVNA 1S0QA 3OSYA 2XBXA 3TJOA 2Y5GA 3RMNH 3KIDU 4K8BA 2QIQA 1GI9B 5DP9A 3A8BA 4DJZB 2VIWA 1Q3XA 1GI6A 1P09A 1CT0E 4ISNA 1MMJN 2FZZA 2PKSC 4D9RA 1GJ8B 3B9FH 2ZDNA 6CHAB 3RC4A 1CA0C 3KQBA 1YF4A 2FTMA 3U98H 1GHBF 3D62A 3T27A 1Y5UT 1KIGH 1SLXB 2IJOB 2BVRH 1GGDC 5TCCA 3DHKH 4GVUA 1GJ5H 5FPYA 2FX4A 4IMQA 5B6OA 2STBE 2GDDA 3TGKE 3TPIZ 1NRSH 6ESTA 1BUIA 1G2MA 1C5PA 1FY5A 4CBNA 3GCHC 4FUBA 1ELEE 1LVYA 3ELAH 2AS9A 1V2LT 1OP2A 4E7RG 1QB1A 4AG2A 1K2I1 1KLIH 2A7JA 4WVPE 3PYHA 1YLCA 1V2TT 3A8CA 3FAOA 3PROA 4A7IB 3SW2B 2AERH 1T8LA 3QX5H 2VH0A 1HAVB 4CHAC 1GJAB 2P16A 3RM2H 2V0BA 3ATMA 2OXSA 2R2MB 1WQVH 2ZFFH 3SJ8A 1A46H 4KGAA 4NA9H 2ASUB 3RDZA 1Y5AT 5TCAA 5L30H 2ZDVH 4O3UA 3VB7A 3PB1E 1AQ7A 1DY9A 3BN9A 2WPLS 1UVTH 1AFQB 1G30B 3BTQE 1DM4B 1TNJA 3IWMA 2OINA 1O5GH 3TK6A 3I77A 3GOVB 1K1NA 3IITA 1XUIA 3P6ZB 3BTGE 5FX6A 4X1RU 1C4V2 1XXFA 3M5LA 3TU7H 3MH7A 3Q77A 3LGWA 5EXNA 4X6NA 2CJIA 1AUJA 2AFQB 4E05H 1D3TB 1S81A 3T62A 4AYVB 3SUGA 4NA7A 1B0FA 1LO6A 1OWDA 2LNCA 2OC1A 4DURA 1WQSA 2GX4A 1EJNA 3T29A 3NXPA 1Z8JB 3ZZBA 2ZPQA 4BTUB 1FN8A 4NIVA 2C8WB 6GCHG 4X6MA 1W10U 1Z8RA 2ALVA 4Y11E 2HRVA 3M5NA 1BMMH 1LQDB 1BT7A 1GCTB 1Y3WA 3SHCH 3U9AH 3RU4E 1FPCH 3V13A 1DDJA 3Q3XA 1LMWB 4JK5A 2GMTC 3GCNA 3E1XB 2SGEE 1SFQB 2DUCA 4U30A 3T25A 5DJ7A 1EPTA 1HNEE 2PTNA 4LZ1H 2C8ZB 5AFZH 1JRSA 3PMAB 2C4FH 1G37A 2JH5D 4YT7H 4H4FA 1HJ8A 1Y3UA 1HAHH 1KDQA 2HPPH 3ATIA 1O2HA 4YOIA 8ESTE 2FPZA 1C5NH 4LZ4B 2KAIA 1O2GH 1AU8A 5AHGH 1ANDA 4JK6A 3SU4A 2EEKA 1AFEH 1F5KU 4I31A 3GY5A 1ELBA 2D8WA 1RIWC 1P9UA 2W7UA 4Q80A 2ZEBA 2G5NA 2F9NA 4ZHMU 5EU8A 1Y8TA 1GMDF 3O8BA 4NWLA 2Z3CA 1HGTH 1C1UH 1WAYB 1XMNB 1GMCG 3V3MA 1L2EA 4MNYA 1H9LB 1NFXA 4A92A 1S83A 4FUEA 1J16A 1TGSZ 3LONA 1AZ8A 1O3PB 4X2YA 4OGXA 1HDTH 3I29A 1J8AA 2BD3A 4UDWH 2G55A 3VB4A 3SNEA 3LPRA 4DW2U 3PWCA 1UK4A 1QB9A 2BX3A 2FOEA 2ZTYA 1TRYA 4AB8A 1FAKH 5C2ZA 2QF0A 2XRCA 1TX6A 1MU6B 1L1NA 3TGIE 1S82A 1CHOF 1J14A 1C2JA 3KHVA 1UCYE 2BD7A 3FP6E 1S0RA 1RTFB 4Y8YA 4K5ZA 1A5GH 3V0XA 2PUQH 1O30A 1ZZZA 3PWBA 1WOFA 3NPSA 1SGEE 1C1WH 3RXTA 1YLDA 2BDYA 3E0PB 2ZO3H 1O2IA 1C1OA 4OS2A 3AASA 2W26A 1EQ9A 4YTAA 4AZ2B 3BIVH 1OX1A 1ZSLA 1FNIA 1UTMA 1C5OH 2TBSA 3A7YA 1O3JA 4GCHF 5T6GA 1GI1A 3S7HB 4JMYA 5J4SA 3PLKA 5I46H 1TNKA 2ESTE 3O8CA 1TA6A 4TPIZ 1HJ9A 1W12U 4ABDA 2J4IA 4AFUA 4MNXA 4DOQA 1QTFA 5DP7A 3E0NB 2HOBA 5T6FA 3MI4A 1AVGH 4Q7XA 1AE5A 2F3CE 5PTPA 1O2SA 3EA7A 4ABBA 1UTJA 1FXYA 1F0RA 3BEUA 1C2EA 2ZDLA 2GZ7A 1V2UT 1HFDA 1TX7A 3MU4A 2OC7A 3PTBA 1DWCH 2F9UA 2H5DA 3ZZ4A 1EB2A 3E8LA 1AB9C 2BM2A 5GPIB 1YBWA 5C67A 3A84A 1GHVH 1G3CA 1J15A 5E2OA 1V2ST 2DE8A 3A8DA 1QY6A 1D4PB 1VCWA 1TFXA 2RDLA 2BD2A 1QRZA 5DP4A 4HGCA 1QRWA 3SBKA 1K22H 1DS2E 1BBRH 1GHYH 2SGAA 4FUFA 5HMAA 4NG9H 1O38A 5ESBA 1Q2WA 1VITF 3AAUA 1SL3A 5FXLA 1D6WA 1Y59T 2O8TA 2R2WU 1OWHA 3STJA 3P8NA 1GHAG 8LPRA 1MKWK 1THRH 1SBWA 3MO3A 3ZVFA 4XSKU 3ZZ6A 3LH1A 3P95A 1GL0E 3BIUH 3ZV9A 3SU5A 4BTIB 3SO3A 3CS0A 5SGAE 4YESB 2PKSB 2FODA 4B76A 2BDGA 2IPHA 3LJJA 1MZAA 1N8OC 1GBAA 3RM0H 3M37A 1C2IA 1EOJA 5JPMH 4XBBA 1K1OA 3M61U 1O3NA 2BQ6B 2RCEA 2XTTB 3RXPA 3KNXA 1HBTH 2BQ7B 2V3OH 3GY4A 1OOKB 1ZTLA 4TWYA 7GCHF 1P11E 4K2YA 3MHWU 3RXQA 1CGJE 1TMTH 1PFXC 2BMGB 1TBZH 1V3XA 2JH6D 4CRCA 1GG6C 2Z9KA 5E0JA 3AVZA 1MAYA 1IHSH 3DUXH 2ZFQH 3VPKA 2F83A 4K69A 1O39A 1TONA 1QRXA 1E36B 4CHAB 1BDAA 3VGCC 2WUCA 1EZSC 2ZGCA 1C1RA 5GWZA 1G2LA 2FMJA 3OU0A 1NT1A 2FOMB 4WH6A 3SJOA 1L1GA 2DE9A 1M9UA 4D9QA 2FO9A 3S69A 1HJAC 2JH0D 1HAXB 2JKHA 2BD4A 1SPJA 2RA0A 2GTBA 3AAVA 3OTJE 4A1TA 4DY7B 1IQGA 4ZKNU 1KXCA 2OLGA 3MH5A 3QZRA 3UUZA 3QUMP 5EXLA 3BG4B 3F9GA 1AWFH 3MU1A 2A5KA 4BAOB
chains in the Genus database with same CATH superfamily
3U8OH 2ZF0H 1C5TA 3TGJE 1AUTC 1O3HA 1KTTB 3E6PH 4TT3D 5HYOA 2QF4A 1XUHA 2V7QD 1PPZA 2ZDMA 6LPRA 1TBQH 2ZNKH 4HZHA 1G36A 3TH4H 2GCTC 2C3SA 4X1PU 3PV5A 4Y0YE 3NRLA 4B2CA 1KTSB 2GCHG 4ZKOU 1XVMA 3RXVA 1EZUC 2QC2A 4UFGH 1MU8B 1KXFA 3ZVCA 1HRTH 1WSSH 1C4U2 2VJ1A 2CXVA 2XCFA 5HXFA 2VWNA 2OBOA 3DSOA 2VINA 1ESBA 2SNVA 2ZU1A 1HAZB 1BB0B 2P8OC 5LPFA 1IHTH 1CQQA 1GDUA 4FUHA 2VGCB 1EPTB 1GBJA 1MD7A 2J2UA 1SQOA 2O8LA 1UVOA 4GLYA 1DWDH 2Z6BD 2OC8A 4ZH8A 2GMTB 1SGYE 4E06H 4IC5A 1NFWA 4H6TA 1FX0B 4JZEH 2J95A 1KDQB 5DG6A 3PTNA 2B5TB 1EX3A 3A7XA 1K1MA 1K28D 3UOUA 1GI7B 1L0ZA 5A2MH 4Y10E 3RP2A 3SV2H 4IMZA 2KAIB 2PTCE 4RT0A 4BTTB 1SQTA 1TA2A 1LVBA 4JZIA 3EAJA 1QFKH 2VIPA 4XD7D 4OM9A 1B7XB 1NPMA 2BOKA 1VJ9U 4TWWA 1BTUA 1EZXC 1ZPZA 1LHFH 1EP6A 4DT7B 5CE1A 2ZHDA 1P01A 1TGTA 1SB1H 3KN2A 2Q6DA 5FX5A 3S0NA 1OWEA 4O97A 5L2ZH 1VGCC 1ZHRA 1A0LA 3RXDA 3UWJH 2VVUA 1GBHA 1ZGVA 3BTWE 1YPHE 1F2SE 4AORA 1BRBE 3FZDA 3RXAA 3P17H 1OWJA 3VG8A 4INKA 1PPGE 1EJMA 3GY2A 3SGAE 2Z3EA 4AOQA 5A8XA 3KQCA 1YPMH 1ZHPA 2BXTH 2RFKC 1KLJH 1IQFA 3SHAH 4BANB 5DSFA 2F43B 3EYDA 3V7TA 4CRDA 4RKJB 2WV4A 3BTFE 1C1PA 3ITIA 4K1TA 3M3VA 5GCHG 1O2TA 3QGNB 3ZZ3A 1U6QA 2G5VA 1GDQA 1FY4A 3ZIAD 5JBTA 1C1MA 1IQLA 1LHEH 4RSPA 1DY8A 2XBWA 3EE0B 4JZFH 2TGDA 5E0HA 3RXCA 4XBCA 4DGJA 1O3OA 2J9NA 1VKYA 1C1NA 2A32A 2B9LA 1NRRH 2J92A 5DP3A 4BAKB 3A7ZA 1SLWB 3N7DA 5GNDA 5CHBA 2GZ8A 1ELFA 4FUJA 3T28A 1FLEE 4K1EA 1J9CH 5CHAB 2FYRA 5EOKA 4RN6A 2BVXH 1WTGH 2FM2A 4DIHH 3H7OA 1BMLA 4OS1A 2FOBA 1EATA 1CSOE 1QBNA 1VZQH 1O3EA 1A0HB 1CBWC 2BD8A 1RRKA 3GY3A 1E38B 1TPOA 1C5XB 2UWLA 2FI3E 4NCYA 1TRNA 3NK8A 1Q31A 1UTPA 3PO1B 5EPYA 2PR3A 1FV9A 4U32A 1YPLH 1A1RA 1TNIA 3H7TA 2ZCHP 3W94A 5C20A 2EI8A 4GSOA 5DPAA 1O2JA 1H8ED 3K65B 4H6SB 1DUEA 1ZHMA 5HM9A 3HK3B 4B2BA 1G3BA 3A80A 3FP8E 4IN2A 4M7GA 1AD8H 2EA3A 3GYMA 4O3TA 3CP7A 5JB8S 2YMSD 2FOGA 3CS7A 3F6UH 4HI3A 2FOAA 1MKXK 2XXLA 5KECA 3OAAD 1FDPA 1VITH 1C1TA 4ISHH 2A4GA 4I8JA 1NC6A 1OP8A 3KGPA 4TY7A 4O9VA 1TB6H 1TWXB 4CRGA 3LH3A 2O9QA 2UUYA 5FBEA 3T2NA 2AGGX 1CGHA 1AB9B 5AVDA 1O2OA 1NU7B 2A1DB 1BTPA 3RXFA 3N7OA 2ZHQH 1C5YB 1PYTC 1XKAC 1T4VH 2VVVA 1F5RA 4KTSA 2AGIX 4JYTA 3F68H 1PJPA 1O5DH 4OS5A 5DP5A 3SUDA 1V2QT 1VR1H 1ZRKA 2PP6A 1PQ8A 4TYDA 4Z1MD 2BLOA 2ZFRH 3UPEA 3P8GA 1A7SA 2OD3B 1HAGE 2BHGA 1TQ7B 2ZGJA 1W7GH 2ZTZA 3UQOA 1C5ZB 2VWOA 3MNCA 1GI5A 5F8ZA 3U1IB 1KLTA 3M35A 1XUGA 1UW7A 2XC4A 5EODA 1F0SA 1TNHA 1DSUA 1LVMA 3MU0A 4Y7AA 1GBMA 1XUJA 3RC6A 1LPZB 2I6QA 2QXJA 3D23A 1WYKA 2VIVA 1K1PA 4NFFA 2ULLA 4VGCC 2PFEA 1HYLA 3BEIB 2VVCA 2Z9LA 5C0UA 2FESH 1ESAA 1UTKA 2G8TA 3M5OA 3ODFA 1O2YA 5EIYA 4B75A 1QA7A 1SGPE 1TQ0B 4AFSA 1O31A 3QN7A 4ABEA 1O35A 1QGFA 2FXRA 2QV1A 2ZTXA 1T8OA 4IGDA 1ZMNA 2NU0E 1V2MT 1YCPM 1UO6A 4TPYA 5EQSA 2SNWA 1ZLRA 2Y5HA 1V2KT 2UUFB 1WV7H 4SGAE 4Y71A 3HGPA 1GI3A 1GMHG 5EJ1A 1ESTA 2AIPA 1LDTT 2OBQA 3UY9A 1GI4A 2BY9X 1RGQA 1RJXB 2OK5A 2BDCA 1V2NT 4XE4A 2FYQA 2BB4A 2HNTF 3KQ5A 1YPJH 3H09A 1Z71A 1P2MA 1C2HA 1O34A 2WSSD 3TJUA 5JBAS 1DUAA 3MU5A 1TGNA 1ETTH 2GT8A 3QDZB 1NBMD 4CH8B 1HB0B 4FUCA 1HXEH 4B2AA 1HJAB 5EW2H 3KL6A 3ZZDA 3JZ1B 2BD9A 4YLUA 3RLYH 4BAMB 4FVDA 4AG1A 2A7HA 4MG3A 3F0PA 3BTTE 1IAUA 1TBRH 4X8SH 2XWAA 4WH8A 1DLKB 3K6ZA 1LPGB 1DT2A 1SGNE 1SQRA 3JZ2B 4X1NU 1NS3A 3A88A 1GHBG 3ZZCA 3L6PA 1TGBA 1MD8A 2C93B 3ZZAA 2VIDA 2B8OH 1BHXB 1GBEA 2BY6X 2HPQH 1LQEA 1MBQA 1UK3A 4I33A 4JCNA 2H9EH 1FJSA 2ZGHA 1D3PB 2EI6A 3A86A 5A8YA 1N1LA 5EW1H 3TVJB 4KKDA 1CT4E 3LGYA 2AMQA 2W5EA 3MO6A 2H9HA 1V6DA 1YM0A 1ANCA 2J94A 2OC0A 2P8OB 2CK3D 4NIYA 4ASUD 4ASHA 2UUJB 3C27B 3OEHD 1Z7KA 3SNAA 3VXFH 1EZQA 2JETC 1F0TA 1T8NA 4ESTE 2P95A 1V2OT 1YY3A 1DVAH 4FXGH 1FONA 2QGRA 1O2MA 1G3EA 1CU1A 7KMEH 1MH0A 4K3JA 3P92A 1KYNA 1ANBA 4ZCNA 2EI7A 1TX8A 4D76A 1DWBH 3SV9A 5C5OA 4I8KA 1TOMH 1P05A 1W0JD 1BTYA 4YOJA 4GUXA 3GDUA 5C1UA 8KME2 1C5RA 3AW1A 4YZUA 3QK1A 1MKWH 4B73A 1C1VH 1P06A 2A7CA 5A0AE 2XOKD 4FU9A 1ELAA 1FIWA 3FO8D 4D8NA 4LK4A 3FKSD 5C3NA 3BG8A 4CR9A 1C2DA 3LOXA 1QBVH 1W0YH 2ZFPH 3U8RH 2BOHB 3Q3YA 3TH2H 2K1QA 1BBRE 2FLRH 6CHAC 3U8TH 1PPEE 4B74A 1N6YA 2BD5A 3F2HA 1Z1JA 3PRDA 2R3UA 4MDSA 1W3CA 4ZMAH 3SORA 2Y6TA 4MTBA 1XUKA 5KEDA 2OCVB 5B6LA 1A3BH 2P3FH 1BZXE 1HPGA 3A7TA 1DOJA 3DCLA 2R9PA 1MQ5A 1W11U 1SGIB 2GCHF 1MTNB 1YPEH 3MTYA 1PPBH 1KY9A 3RMMH 2UWOA 1BMNH 4U01A 2D1JA 3TK5A 2FI5E 3W95A 1W14U 1AIXH 4I86A 2QF3A 1C2KA 1H9IE 1C5VA 2AYWA 1LCYA 3GCTF 2G4TA 3C1KA 1D6RA 1KXAA 1O2LA 1EB1H 1UHBA 4ABIA 3RXKA 4AN7A 1V2RT 2BLWA 4R0IA 3SU0A 2BLQA 3SV7A 4J2YB 4ZHLU 1CGIE 1F5LA 4BNRA 3TIUA 1Y5BT 1GHZA 1Z1IA 2ZQ2A 2WINI 1C4Y2 2C90B 5C1XA 4JYUH 2YMSB 3E91A 1BRUP 2OUAA 8GCHG 4ABAA 1WUNH 1IQNA 1QBOA 1E35B 1INCA 1NN6A 3SJ9A 3ODDA 4CRFA 5A0BA 3SQEE 1BTZA 2RG3A 1MUEB 1ZMJA 1TPSA 2PKAA 2XC5A 1GBDA 3FZZA 3V12A 3UTUH 5EQQA 4OGYA 4TSFD 1FY3A 3F0OA 5L2YH 2NU1E 4NGAH 5FHTA 2W6JD 4IW4E 1CA0B 2D2DA 1XUFA 2FOHA 4MNWA 1ACBE 1ORFA 1AE8H 2ZECA 1K0HA 1H8IH 1O5FH 2WPIS 4NSYA 9LPRA 4OS7A 1JWTA 2Y5FA 3UAIC 5FPTA 1G32B 1GGDB 1DPOA 1HAYB 2F9VA 1MCTA 1W8BH 5DO4H 2R0KA 3M7QA 2ANWA 2BY5X 7LPRA 3KCGH 2C8YB 2PUXB 1PQAA 1NRQH 1TE0A 2J38A 1EXFA 3VFEA 4X2XA 1UCYK 3GCHB 4I32A 4MPXA 3RU4T 1YGCH 2WPJS 1WXRA 4BAHB 3UNRA 5FBIA 2ANYA 3QWCH 1UJ1A 7ESTE 4X6PA 4ZKRU 1F92A 2PLXA 5E0GA 3HKIB 3STIA 2Y7ZA 2H9TH 2WUBA 4WXVA 1C5LH 5A09A 1TABE 3RXLA 3NZIA 1IQJA 1C5WB 1A3EH 4CBOA 3AW0A 3WY8A 1QJ1B 3LU9B 1CHOG 1WU1A 2LPRA 2HNTE 3M36A 1O2RA 3S9BA 2Y80A 4WMDA 4FUDA 4X1SU 3GY7A 1K21H 4NWKA 3PMHB 3S9AA 1YWUA 1NM6A 2PSYA 4ISOA 4J1YA 4Y6DA 4YT6H 4RKOB 1KXBA 1HCGA 2O8UA 1SGFG 2ZWLH 3U28C 5HM2A 4UFEH 4X8UH 2GKVE 1GBIA 2FP7B 1GI0A 1T32A 1P0SH 1O2WA 1UVSH 2CN0H 2R0LA 2C8XB 4GCHG 1DE7H 2A0QB 3EA9A 3MFJA 2VH6A 1DX5M 1QL9A 2KCYA 5FAHA 4F55A 3BTKE 1O2PA 2P3UB 1MCVA 4VGCB 3QTOH 5ABWA 2FS9A 3TLOA 1QCPA 3ZYEA 1JMOH 4ABJA 3FN8A 1PQ7A 1LVOA 4NIXA 1A2CH 3PM3A 1RTKA 3VB6A 2F9PA 1CHGA 2ZCKP 5L6NH 3FVFB 3VEQB 2OP9A 2IN2A 1AHTH 3NCLA 4Y76A 5AFYH 5LPEA 1C5UA 1SOTA 1YCPK 2A5IA 1GBKA 3ENSB 3HK6B 3A85A 2ZGBH 1ID5H 3RXBA 2TGAA 3MO9A 1O2QA 1IQMA 1MAXA 1KXDA 3LDXH 3OY5U 3VB5A 4TY6A 1P8VC 3KF2A 3F2GA 1E79D 4Y7BA 1OS8A 1SOZA 4GHTA 2HLCA 1SLVB 5T1VA 1SGRE 1TNGA 1PPCE 2G00A 4B1TA 1SC8U 3F9EA 1UMAH 2AMPA 4Y8XA 5T3HA 2BTCE 4JZ1A 3SZNA 1K1JA 1NTPA 3GS9A 1EJAA 3LGTA 3GISB 3VXEH 4FETA 4WF8A 2QN5T 3ATLA 3RU4D 4ABHA 5GDSH 1W7XH 1F7ZA 1AO5A 1AZZA 1NESE 2Q6FA 1RIWB 2Z9GA 3MWIU 4XOJA 1EUFA 2XWBI 3MH4A 5J4QA 2VWLA 2P94A 1E34B 3A89A 1JOUB 1D3DB 1AWHB 2A2QH 2Y82A 1RTLA 2VNTA 5JBBS 2CF8H 1Y3XA 1C5MD 2P3TB 1QL8A 4MPWA 1VCPA 3PLBA 1TLDA 1P2OA 1XX9A 1SHYA 1PPHE 2V6NA 1X7AC 4A5TS 1T4UH 5GJ4B 1Z8GA 4I8HA 3D65E 1MTSA 6GCHF 2KCAA 1O2UA 7GCHG 2QCYA 1C5QA 3LIWA 2WYGA 2KCPA 4BAQB 3S9CA 1ZPCA 3A8AA 1DSTA 3SOSA 4CREA 1EKBB 1P10A 4UFFH 1MKXH 4A6LA 3F9FA 5EG4A 3OYPA 2ZDKA 4MPUA 1NRNH 3SU2A 2H2ZA 3KQDA 4CH2B 2GZ9A 1NFUA 5HKKD 2BDBA 4Q2KA 1GMHF 2PGQB 1O3DA 4OS6A 1SMFE 3UR9A 2A31A 1ZPBA 1FMGA 2P59A 1GJCB 1P04A 1ZSKA 1VCQA 2BVSH 1SQAA 1NFYA 1SGDE 4JZDH 1OP0A 1ZMLA 3M7UA 3OTPA 2GDEH 3R3GB 5DGJA 2NWNA 3SGQE 2BZ6H 1GJ6A 2FIRH 1S5SA 1FAXA 4P00A 4GAWA 1FI8A 4X6OA 3EE7A 1TGCA 2ZG0H 4JYVH 2BDAA 3SU3A 2CF9H 2LP6A 4ZUHA 2QXGA 2V3MA 3O8RA 1DICA 1GJ4H 1S6HA 1GJDB 1D3QB 4U2WA 2ZCLP 3E3TA 3UIRA 4ZXYH 1HIAB 1TIOA 4AYYB 1SI5H 1PPFE 3RXHA 3K9XB 5CMXH 4FU8A 3UB0A 2QAAA 2ZI2H 2ZPRA 3SUEA 4CR5A 4X0WU 2VB0A 4KTCA 1GBLA 1MQ6A 3DA9B 1QHRB 3IG6B 4SGBE 5ETXA 1B0EA 1F0UA 2ZPSA 1OSSA 1SGQE 3NWUA 4Q7ZA 3SNDA 2SGQE 4UONA 1OKXA 3WW7A 4YLQH 1C2LA 1ARBA 5GIBA 4NZLA 4Y79A 1GMCF 2VU8E 4YOGA 2ODQA 2EC9H 2TGTA 3RXGA 1OHHD 1XM1A 4NZQA 1CT2E 2J5UA 3ATKA 1QIXB 2PSXA 1RFNA 1UHBB 3SI3H 1GBCA 2VIOA 3RMLH 1SHHB 3DD2H 4ZKSU 5LGOA 2EY4C 1GBTA 2NU2E 1NRPH 5EGMA 2W7SA 1KSNA 4FVBA 5F6MA 4IC6A 2IOTA 3SUFA 1P2IA 3PLPA 1BIOA 2FLBH 2Z7FE 3M3SA 3BTME 4B71A 2TPIZ 1YPGH 1YPKH 1IQHA 1MBMA 4KTUA 1C9PA 1P2JA 2M5TA 3A87A 2PKAB 3U1JB 1QJ6B 3GDVA 1DITH 3QGJA 3RLWH 1ABIH 1CA8B 4WY3A 3SN8A 3UOPA 1BMAA 2W3IA 1A61H 3FFGA 3OFND 1ZJKA 1P9SA 1TNLA 1PQ5A 3ZZ5A 4HFPB 2ZKSA 3LC3A 2FOFA 1ZYOA 4UEHH 1P02A 1ELGA 3BG4C 5E2PA 2PW8H 2FX6A 2ZU3A 3LGIA 4FUIA 4CRAA 3WWBA 5DN6D 2AIQA 3TITA 1QA0A 1ZTJA 1TPPA 3G01A 3GCOA 3RXJA 1E37B 4P02A 3NUMA 2BQWB 1N8OB 2VIQA 4MLFB 1L4ZA 2Z94A 4ISLA 1PYTD 1QJ7B 1Z6JH 1NZQH 3E16B 2XCNA 4Q7YA 2ZC9H 4XFQA 4Z0KA 3SQHE 1O32A 3MH6A 4ZXXH 1DXPA 3SV6A 1O5CB 2H1UA 5EXMA 3RMOH 1O2NA 3DT0H 2FI4E 3UNQA 2W6ID 1W2KH 2BZAA 2WHXA 4AC9A 4E7NA 2HLDD 4MQAA 3K2UA 3SU1A 1O3GA 4KP0A 5DK1A 1GG6B 1S84A 3SJIA 1P3CA 3HPTB 1NU9A 1P2KA 1Z6EA 2ZGXH 3MYWA 3L3TA 1H8DH 3DFJA 3MU8A 1DLEA 2VGCC 1ETSH 4FOUC 1EPTC 2HNTC 3VGCB 3BEFB 4A1VA 1EAUA 1FIZA 3HATH 3DFLA 3F9HA 1BOQA 2BYAX 2PV9B 4R8TB 1O5AB 1AY6H 4UE7H 2WPKS 4INLA 2KFWA 1H4WA 4KELA 1P2QA 1P03A 4X1QU 3EDXB 3L33A 5AF9H 3ZVAA 8GCHF 1O3BA 3PMBB 4MNVA 1T7CA 5G4BA 1IQIA 1FQ3A 2TGPZ 3CENA 1C9TA 1GHAF 5EJZA 3SNBA 1TAWA 1QR3E 1THSH 3SZEA 2GGVB 1GI2A 2EQNA 1WDIA 2WPHS 1ELVA 4K60A 4WWYA 1AVWA 1ZTKA 2XC0A 3LGVA 3RUOA 2CHAC 2NU3E 2BY8X 1A4WH 4HTCH 3K6YA 2GCTB 3P8OA 1TMBH 2Z3DA 3LC5A 1ZSJA 5BRRE 1BCUH 2KCOA 2QY0B 2ZIQH 3A81A 3BV9B 5C17A 1BQYA 2TIOA 4ZROA 1DWEH 2IPQX 2JIZD 5FCRA 1IQEA 1IOEA 3W1EA 3UQVA 4YM9A 1JBUH 1G3DA 1YP9A 3BTEE 3ZZ7A 4ZAEA 1TALA 2CGAA 3RXSA 3URCA 4DVAU 5GXPA 3ZZ9A 2I6SA 1AKSA 5KGOA 2FEQH 3ESTA 4UD9H 1GBFA 3P8FA 1UVPA 2F91A 1NROH 1UTQA 2B7DH 2NU4E 4ACBA 1EAXA 1GDNA 4CRBA 1B5GH 4UFDH 5F53A 5F03A 2G52A 1C1SA 1ZR0A 2Q1JA 2ILNA 2SGFE 1O3CA 2BDIA 1BITA 4NFEA 3MNSA 3EA8A 1P12E 1GVLA 1SR5C 1ZGIA 4MPVA 5BPEA 1RS0A 1K9OE 1SGFA 1BA8B 3OX7U 1ZRBA 2ZHFH 3SJKA 4IN1A 1WCZA 1WTHD 2SGPE 5CHAC 1YPHC 5IYTA 4H42U 3ZVEA 2HALA 4DT4A 1JXPA 3LGUA 3SU6A 3M3TA 1HIAA 4I7YH 2PGBB 3Q76A 1VGCB 2J34A 1H8HD 4AX9H 1O2KA 3R0FA 2ZFTA 5F8TA 1TRMA 1OWKA 2KR7A 3PO1C 2ODPA 3KQEA 3PMJA 3BTDE 1FPHH 5JYIA 1MTVA 4FU7A 2ZA5A 4BXSA 2V3HH 1GJBB 2QXHA 2BX4A 1Z8IB 2F9OA 1RXPA 4NIWA 4FUGA 2GVFA 3BF6H 5DP8A 1O5BB 1A0JA 1GJ9B 1UCYH 2F9BH 4ACAA 1GWAA 1UVUH 2A5AA 5A0CA 4K8YA 2G51A 4QT8C 1UTNA 1HXFH 2SGDE 1J17T 3F3BA 3RXOA 3ZV8A 3RXIA 1NY22 1V2WT 2PHBA 1IQKA 3M7TA 1S6FA 2H5CA 2R3YA 3LJOA 1O3KA 2JJ2D 1TMUH 2V35A 2XBYA 4IBLH 4AB9A 2ZFSA 2ZP0H 5C1YA 1AMHA 1O3AA 2ANKH 1C2GA 4NA8A 2PWXA 3UR6A 1HAVA 2G81E 1FY1A 1QQ4A 1FZZA 1BRCE 1Y3YA 1DFPA 5A8ZA 2BY7X 2FTLE 3B23B 4WJG2 2A2XH 1AFQC 1V2JT 1BTXA 4ABGA 4Z6AH 2BDHA 2GT7A 3TJVA 4GHQA 1WBGB 1EAIA 5H4IB 1HV7A 1V2PT 2CMYA 4LOYH 1CO7E 1O2VA 1JIRA 1ELCA 1HLTH 1JRTA 1UTOA 2CV3A 3T5FH 1CBWB 2P93A 1SG8B 1O3FA 3ZVDA 1OYTH 3T26A 4WXIA 4K1SA 3OY6U 3QTVH 5K7RA 1GJ7B 1GMDG 1GHXH 1N6XA 2SFAA 1A5HA 2M2AA 1EOLA 2ANMH 4ABFA 1GCDA 1FUJA 1YKTA 2ZU4A 2HGTH 3RXRA 1XVOA 5EJLA 2ZZUH 1S85A 1LKAA 4XBDA 2YNBA 3RXEA 4X2VA 5E8EH 1BRAA 4DCDA 1DANH 1NBME 1OPHB 2O8MA 4F49A 1HUTH 1O3MA 3SYJA 1TOCB 2ZU2A 1OXGA 5F8XA 3B8JA 3F1SB 1CVWH 2J98B 4DG4A 2A4OA 3MNBA 3RC5A 3VB3A 2WZQA 1L4DA 1YCPH 3GDSA 1GCTC 3D49H 3PV4A 1AN1E 3UWIA 3O8DA 5TJXA 1KXEA 5GCHF 1O3IA 1SFIA 3ZYDA 5FCKA 2GP9B 5C94A 1K1IA 3UNSA 1OYQA 3RXUA 1O5EH 5ESTE 1UTLM 2B0FA 1O37A 2GD4B 2WV5A 2TRMA 2WYJA 3Q3KA 4IS5A 1BJVA 4X2WA 1QQUA 1RD3B 3FP7E 1LTOA 3GY8A 3HKJB 1BBRK 1ZOMA 2ODYB 1T8MA 1Y3VA 5DP6A 4X8TH 4D7GA 4F48B 3E90B 3ZVGA 3OE7D 3BSQA 1AI8H 2JDID 3UFAA 1E0FD 1O36A 1THPB 2XNIA 1EFRD 2Y81A 2FOCA 4X8VH 2D26C 1YYY1 3MNXA 2QE7D 5LH8A 4WMEA 3ZVBA 4Q63A 4WMFA 2ZU5A 2WPDD 4INHA 3GYLB 1GHWH 4BXWA 1FY8E 4AFQA 1BTHH 3GY6A 3MMGA 4I8LA 2STAE 1FN6A 2A45B 2Z9JA 4O03A 3ZZ8A 1T31A 5JB9S 1LHGH 1GPZA 3SV8A 5JBCS 2O8WA 4ISIH 1TPAE 1GL1A 3SI4H 1O33A 1AGJA 5JDUB 1BHXF 2XW9A 4XDEA 2GV7A 2THFB 2H6MA 3UREA 1C5SA 2VWMA 3QO6A 1SGTA 1UK2A 1BJUA 1QB6A 2HWLB 3SGBE 4THNH 2AEIH 3NKKA 1LKBA 1LPKB 2QXIA 5T6DA 4F4OC 3A7VA 1SSXA 3MQKC 1GVKB 4BOHA 3I78A 3A83A 1AVXA 2UWPA 3GCTG 1ARCA 1XXDA 2BLVA 1ANEA 1SLUB 2J97A 3FANA 2FWWA 2VBCA 1SVPA 1YC0A 3A7WA 4GPGA 1O3LA 3TK9A 2HVYB 3TNTA 1COWD 3N7EA 1VJAU 1VITG 2AH4X 4Y0ZE 1LHDH 2FDAA 1H9HE 5HGGA 2OTVA 3S7KB 3TJNA 4AGKA 1ABJH 1C2FA 1W0ZU 4YO9A 4D7FA 1HAOH 2BXUH 1LHCH 1C2MA 1G9IE 2ZHEH 1QL7A 1XKBC 3QZQA 4NSVA 2Y7XA 1EAWA 1O2ZA 1C1QA 2W3KA 3A82A 1MZDA 3EGKH 1P57B 2UUKB 2KZ4A 3U69H 5EPNA 9ESTA 2A4QA 2XBVA 4A1XA 1BMFD 2ZDAH 2L74A 1MTUA 2CHAB 2HVXA 2AGEX 1EP5A 5C0TA 1MTWA 1O2XA 1QURH 1V2VT 3ATWA 3HGNA 2G4UA 1P2NA 2Q6GA 1DXWA 4DIIH 5I25A 5EQRA 3LT3A 3MOCA 4ZHAA 2RA3A 2GV6A 4B6FA 2ZQ1A 1SGCA 3H5CB 2A4RA 1AKSB 1OWIA 2WPMS 4RT1A 1D9IA 5DKMA 3CNRA 2Z9IA 1A5IA 3LKWA 1MTNC 1QNJA 5LPRA 1GBBA 1GI8B 2ALPA 3URDA 1HAPH 1K1LA 1H1BA 4I8GA 3KYGA 3QLPH 5IDKA 2QYIA 3Q00A 1HAIH 2FS8A 1O0DH 1P3EA 3EQ0H 4Y8ZA 4AGJA 2ZHWH 1S6LA 2JETB 3M5MA 4OS4A 2OQ5A 3P70B 1ELDE 1ETRH 3BTHE 1TYNA 1L1JA 2XYAA 1W13U 2XNDD 3RXMA 2YNAA 5K0HA 2IJD1 1ELTA 3FOAA 2AMDA 1GVZA 2OQUA 1ZJDA 3TNSA 3GICB 4PROA 5C5NA 2YMSC 3KEEA 5FPSA 4LXBH 1NO9H 3TH3H 1EASA 2YOLA 3SNCA 2QA9E 4AFZA 1BTWA 1CE5A 1JIMA 4MVNA 1S0QA 3OSYA 2XBXA 3TJOA 2Y5GA 3RMNH 3KIDU 4K8BA 2QIQA 1GI9B 5DP9A 3A8BA 4DJZB 2VIWA 1Q3XA 1GI6A 1P09A 1CT0E 4ISNA 1MMJN 2FZZA 2PKSC 4D9RA 1GJ8B 3B9FH 2ZDNA 6CHAB 3RC4A 1CA0C 3KQBA 1YF4A 2FTMA 3U98H 1GHBF 3D62A 3T27A 1Y5UT 1KIGH 1SLXB 2IJOB 2BVRH 1GGDC 5TCCA 5CDFE 3DHKH 4GVUA 1GJ5H 5FPYA 2FX4A 4IMQA 5B6OA 2STBE 2GDDA 3TGKE 3TPIZ 1NRSH 6ESTA 1BUIA 1G2MA 1C5PA 1FY5A 4CBNA 3GCHC 4FUBA 1ELEE 1LVYA 2J98A 3ELAH 2AS9A 1V2LT 1OP2A 4E7RG 1QB1A 4AG2A 1K2I1 1KLIH 2A7JA 4WVPE 3PYHA 1YLCA 1V2TT 3A8CA 3FAOA 3PRBA 3PROA 4A7IB 3SW2B 2AERH 1T8LA 2JJ1D 3QX5H 2VH0A 1HAVB 4CHAC 1GJAB 2P16A 3RM2H 2V0BA 3ATMA 2OXSA 2R2MB 1WQVH 2ZFFH 3DSPA 3SJ8A 1A46H 4KGAA 4NA9H 2ASUB 1SKYE 3RDZA 1Y5AT 5TCAA 5L30H 2ZDVH 4O3UA 3VB7A 3PB1E 1AQ7A 1DY9A 3BN9A 2WPLS 1UVTH 1AFQB 1G30B 3BTQE 5IK2D 1DM4B 1TNJA 3IWMA 2OINA 1O5GH 3TK6A 1KMHB 1E1QD 3I77A 3GOVB 1K1NA 3IITA 1XUIA 3P6ZB 3BTGE 5FX6A 4X1RU 1C4V2 1XXFA 3M5LA 3TU7H 3MH7A 3Q77A 3LGWA 5EXNA 4X6NA 2CJIA 1AUJA 2AFQB 4E05H 1D3TB 1S81A 3T62A 4AYVB 3SUGA 4NA7A 1B0FA 1LO6A 1OWDA 2LNCA 2OC1A 4DURA 1WQSA 2GX4A 1EJNA 3T29A 3NXPA 1Z8JB 3ZZBA 2ZPQA 3PV2A 4BTUB 1FN8A 4NIVA 2C8WB 6GCHG 4X6MA 1W10U 1Z8RA 2ALVA 4Y11E 2LELA 2HRVA 3M5NA 1BMMH 1LQDB 1BT7A 1GCTB 1Y3WA 3SHCH 2RDEA 3RU4E 3U9AH 1FPCH 3V13A 4Q4LA 1DDJA 3Q3XA 1LMWB 4JK5A 2GMTC 3GCNA 3E1XB 2SGEE 1SFQB 2DUCA 4U30A 3T25A 4HG6A 5DJ7A 1EPTA 1HNEE 2PTNA 2AHME 4LZ1H 2C8ZB 5AFZH 1JRSA 3PMAB 2C4FH 1G37A 2JH5D 4YT7H 1W0KD 4H4FA 1HJ8A 1Y3UA 1HAHH 1KDQA 2K8IA 2HPPH 3ATIA 1O2HA 4YOIA 8ESTE 2FPZA 1C5NH 4LZ4B 2KAIA 1O2GH 1AU8A 5AHGH 1ANDA 4JK6A 3SU4A 2EEKA 1AFEH 1F5KU 4I31A 3GY5A 1ELBA 2D8WA 1RIWC 1P9UA 2W7UA 4Q80A 2ZEBA 2G5NA 2F9NA 4ZHMU 3KYFA 5EU8A 1Y8TA 4B6EA 1GMDF 3O8BA 3AK5A 4NWLA 2Z3CA 1HGTH 1C1UH 1WAYB 2WV9A 1XMNB 1GMCG 3V3MA 1L2EA 4MNYA 1H9LB 1NFXA 4A92A 2KX4A 1S83A 4FUEA 1J16A 1TGSZ 3LONA 1AZ8A 1O3PB 4X2YA 4OGXA 1HDTH 3I29A 1J8AA 2BD3A 4UDWH 2G55A 3VB4A 3SNEA 1QZ8A 3LPRA 4DW2U 3PWCA 1UK4A 5HIYA 1QB9A 2BX3A 2FOEA 2ZTYA 1TRYA 4AB8A 1FAKH 5C2ZA 2QF0A 2XRCA 1TX6A 1MU6B 1L1NA 3TGIE 2L6OA 1S82A 1CHOF 1J14A 1C2JA 3KHVA 1UCYE 2BD7A 3FP6E 1S0RA 1RTFB 3F2FA 4Y8YA 4K5ZA 1A5GH 3V0XA 2PUQH 1O30A 1ZZZA 3PWBA 1WOFA 3NPSA 1SGEE 1C1WH 3RXTA 1YLDA 2BDYA 3E0PB 2ZO3H 1O2IA 1C1OA 4OS2A 3AASA 3N99A 2W26A 1EQ9A 4YTAA 4AZ2B 3BIVH 1OX1A 1ZSLA 1FNIA 1UTMA 1C5OH 2TBSA 3A7YA 1O3JA 4GCHF 5T6GA 1GI1A 3S7HB 4JMYA 5J4SA 3PLKA 5I46H 1TNKA 2ESTE 3O8CA 1TA6A 4TPIZ 1HJ9A 1W12U 4ABDA 2J4IA 4AFUA 4MNXA 4DOQA 1QTFA 5DP7A 3E0NB 2HOBA 5T6FA 3MI4A 1AVGH 4Q7XA 1AE5A 2F3CE 5PTPA 1O2SA 3EA7A 4ABBA 1UTJA 1FXYA 1F0RA 2F4LA 3BEUA 1C2EA 2ZDLA 2GZ7A 1V2UT 1HFDA 1TX7A 2K0QA 3MU4A 2OC7A 3PTBA 1DWCH 2F9UA 2H5DA 3ZZ4A 4YXWD 1EB2A 3E8LA 1AB9C 2BM2A 5GPIB 1YBWA 5C67A 3A84A 1GHVH 3DSGA 1G3CA 1J15A 5E2OA 1V2ST 2DE8A 3A8DA 1QY6A 1D4PB 1VCWA 1TFXA 2RDLA 2BD2A 1QRZA 5DP4A 5HIZA 5FL7D 4HGCA 1QRWA 3SBKA 1K22H 1DS2E 1BBRH 1E1RD 1GHYH 2SGAA 4FUFA 5HMAA 4NG9H 1O38A 5ESBA 1Q2WA 1VITF 3AAUA 1SL3A 5FXLA 1D6WA 1Y59T 2O8TA 2R2WU 1OWHA 3STJA 3P8NA 1GHAG 8LPRA 1MKWK 1THRH 4XRNA 1SBWA 3MO3A 3ZVFA 4RI0A 4XSKU 3ZZ6A 3LH1A 3P95A 1GL0E 3BIUH 2QF5A 3SU5A 3ZV9A 4BTIB 3SO3A 3CS0A 5SGAE 4YESB 2PKSB 2FODA 4B76A 2BDGA 2IPHA 3LJJA 1MZAA 1N8OC 1GBAA 3RM0H 2KM0A 3M37A 1C2IA 1EOJA 5JPMH 4XBBA 1K1OA 3M61U 1O3NA 2BQ6B 2RCEA 2XTTB 3RXPA 3KNXA 1HBTH 2BQ7B 2V3OH 3GY4A 1OOKB 1ZTLA 4TWYA 7GCHF 1P11E 4K2YA 1MABB 3MHWU 1CGJE 3RXQA 1TMTH 1PFXC 2BMGB 2GJGA 3WWFA 1TBZH 1V3XA 2JH6D 4CRCA 1GG6C 4M9FA 2Z9KA 5E0JA 3AVZA 1MAYA 1IHSH 3DUXH 2ZFQH 3VPKA 2F83A 4K69A 1O39A 1TONA 1QRXA 1E36B 4CHAB 1BDAA 3VGCC 2WUCA 1EZSC 2ZGCA 1C1RA 5GWZA 1G2LA 2FMJA 3OU0A 1NT1A 2FOMB 4WH6A 3SJOA 3OEED 1L1GA 2DE9A 1M9UA 4D9QA 2FO9A 3S69A 1HJAC 2JH0D 1HAXB 2JKHA 2BD4A 1SPJA 2RA0A 2GTBA 3AAVA 3OTJE 4A1TA 4DY7B 1IQGA 4ZKNU 1KXCA 2OLGA 3MH5A 3QZRA 3UUZA 3QUMP 5EXLA 3BG4B 1YLNA 3F9GA 1AWFH 3MU1A 2A5KA 4BAOB
chains in the Genus database with same CATH topology
3U8OH 2ZF0H 1C5TA 3TGJE 1AUTC 1O3HA 1KTTB 3E6PH 5HYOA 1XUHA 1PPZA 2ZDMA 6LPRA 1TBQH 2ZNKH 4HZHA 1G36A 3TH4H 2GCTC 2C3SA 4X1PU 4Y0YE 4B2CA 1KTSB 2GCHG 4ZKOU 1XVMA 3RXVA 1EZUC 2QC2A 4UFGH 1MU8B 1KXFA 3ZVCA 1HRTH 1WSSH 1C4U2 2VJ1A 2CXVA 2XCFA 5HXFA 2VWNA 2OBOA 2VINA 1ESBA 2SNVA 2ZU1A 1HAZB 1BB0B 2P8OC 5LPFA 1IHTH 1CQQA 1GDUA 4FUHA 2VGCB 1EPTB 1GBJA 1MD7A 2J2UA 1SQOA 2O8LA 1UVOA 4GLYA 1DWDH 2Z6BD 2OC8A 4ZH8A 2GMTB 1SGYE 4E06H 4IC5A 1NFWA 4H6TA 4JZEH 2J95A 1KDQB 5DG6A 3PTNA 2B5TB 1EX3A 3A7XA 1K1MA 1K28D 3UOUA 1GI7B 1L0ZA 5A2MH 4Y10E 3RP2A 3SV2H 4IMZA 2KAIB 2PTCE 4BTTB 1SQTA 1TA2A 1LVBA 4JZIA 3EAJA 1QFKH 2VIPA 1B7XB 1NPMA 2BOKA 1VJ9U 4TWWA 1BTUA 1EZXC 1ZPZA 1LHFH 1EP6A 4DT7B 5CE1A 2ZHDA 1P01A 1TGTA 1SB1H 3KN2A 2Q6DA 5FX5A 3S0NA 1OWEA 4O97A 5L2ZH 1VGCC 1ZHRA 1A0LA 3RXDA 3UWJH 2VVUA 1GBHA 1ZGVA 3BTWE 1YPHE 1F2SE 4AORA 1BRBE 3FZDA 3RXAA 3P17H 1OWJA 4INKA 1PPGE 1EJMA 3GY2A 3SGAE 2Z3EA 4AOQA 5A8XA 3KQCA 1YPMH 1ZHPA 2BXTH 1KLJH 1IQFA 3SHAH 4BANB 3V7TA 3EYDA 4CRDA 4RKJB 2WV4A 3BTFE 1C1PA 3ITIA 4K1TA 3M3VA 5GCHG 1O2TA 3QGNB 3ZZ3A 1U6QA 2G5VA 1GDQA 1FY4A 5JBTA 1C1MA 1IQLA 1LHEH 4RSPA 1DY8A 2XBWA 3EE0B 4JZFH 2TGDA 5E0HA 3RXCA 4XBCA 4DGJA 1O3OA 2J9NA 1C1NA 2A32A 2B9LA 1NRRH 2J92A 5DP3A 4BAKB 3A7ZA 1SLWB 2GZ8A 1ELFA 4FUJA 3T28A 1FLEE 4K1EA 1J9CH 5CHAB 2FYRA 5EOKA 4RN6A 2BVXH 1WTGH 2FM2A 4DIHH 3H7OA 1BMLA 4OS1A 2FOBA 1EATA 1CSOE 1QBNA 1VZQH 1O3EA 1A0HB 1CBWC 2BD8A 1RRKA 3GY3A 1E38B 1TPOA 1C5XB 2UWLA 2FI3E 4NCYA 1TRNA 3NK8A 1Q31A 1UTPA 3PO1B 5EPYA 2PR3A 1FV9A 4U32A 1YPLH 1A1RA 1TNIA 3H7TA 2ZCHP 3W94A 5C20A 2EI8A 4GSOA 5DPAA 1O2JA 3K65B 4H6SB 1DUEA 1ZHMA 5HM9A 3HK3B 4B2BA 1G3BA 3A80A 3FP8E 4IN2A 4M7GA 1AD8H 2EA3A 3GYMA 4O3TA 3CP7A 5JB8S 2FOGA 3CS7A 3F6UH 4HI3A 2FOAA 1MKXK 2XXLA 1FDPA 1VITH 1C1TA 4ISHH 2A4GA 4I8JA 1NC6A 1OP8A 3KGPA 4TY7A 4O9VA 1TB6H 1TWXB 4CRGA 3LH3A 2O9QA 2UUYA 5FBEA 3T2NA 2AGGX 1CGHA 1AB9B 5AVDA 1O2OA 1NU7B 2A1DB 1BTPA 3RXFA 3N7OA 2ZHQH 1C5YB 1PYTC 1XKAC 1T4VH 2VVVA 1F5RA 4KTSA 2AGIX 4JYTA 3F68H 1PJPA 1O5DH 4OS5A 5DP5A 3SUDA 1V2QT 1VR1H 1ZRKA 1PQ8A 4TYDA 2BLOA 2ZFRH 3UPEA 3P8GA 1A7SA 2OD3B 1HAGE 2BHGA 1TQ7B 2ZGJA 1W7GH 2ZTZA 3UQOA 1C5ZB 2VWOA 3MNCA 1GI5A 5F8ZA 3U1IB 1KLTA 3M35A 1XUGA 2XC4A 5EODA 1F0SA 1TNHA 1DSUA 1LVMA 3MU0A 4Y7AA 1GBMA 1XUJA 3RC6A 1LPZB 2I6QA 2QXJA 3D23A 1WYKA 2VIVA 1K1PA 4NFFA 2ULLA 4VGCC 2PFEA 1HYLA 3BEIB 2VVCA 2Z9LA 2FESH 1ESAA 1UTKA 2G8TA 3M5OA 3ODFA 1O2YA 4B75A 1QA7A 1SGPE 1TQ0B 4AFSA 1O31A 3QN7A 4ABEA 1O35A 1QGFA 2FXRA 2QV1A 2ZTXA 1T8OA 4IGDA 1ZMNA 2NU0E 1V2MT 1YCPM 1UO6A 4TPYA 5EQSA 2SNWA 1ZLRA 2Y5HA 1V2KT 2UUFB 1WV7H 4SGAE 4Y71A 3HGPA 1GI3A 1GMHG 1ESTA 2AIPA 1LDTT 2OBQA 3UY9A 1GI4A 2BY9X 1RGQA 1RJXB 2BDCA 1V2NT 4XE4A 2FYQA 2BB4A 2HNTF 1YPJH 1Z71A 1P2MA 1C2HA 1O34A 3TJUA 5JBAS 1DUAA 3MU5A 1TGNA 1ETTH 2GT8A 3QDZB 4CH8B 1HB0B 4FUCA 1HXEH 4B2AA 1HJAB 5EW2H 3KL6A 3ZZDA 3JZ1B 2BD9A 4YLUA 3RLYH 4BAMB 4FVDA 4AG1A 2A7HA 4MG3A 3BTTE 1IAUA 1TBRH 4X8SH 2XWAA 4WH8A 1DLKB 3K6ZA 1LPGB 1DT2A 1SGNE 3JZ2B 4X1NU 1NS3A 3A88A 1GHBG 3ZZCA 3L6PA 1TGBA 1MD8A 2C93B 3ZZAA 2VIDA 2B8OH 1BHXB 1GBEA 2BY6X 2HPQH 1LQEA 1MBQA 1UK3A 4I33A 4JCNA 2H9EH 1FJSA 2ZGHA 1D3PB 2EI6A 3A86A 5A8YA 1N1LA 5EW1H 3TVJB 4KKDA 1CT4E 3LGYA 2AMQA 2W5EA 3MO6A 2H9HA 1V6DA 1YM0A 1ANCA 2J94A 2OC0A 2P8OB 4NIYA 4ASHA 2UUJB 3C27B 1Z7KA 3SNAA 3VXFH 1EZQA 2JETC 1F0TA 1T8NA 4ESTE 2P95A 1V2OT 1DVAH 4FXGH 1FONA 2QGRA 1O2MA 1G3EA 1CU1A 7KMEH 1MH0A 4K3JA 3P92A 1KYNA 1ANBA 2EI7A 1TX8A 4D76A 1DWBH 3SV9A 5C5OA 4I8KA 1TOMH 1P05A 1BTYA 4YOJA 4GUXA 3GDUA 5C1UA 8KME2 1C5RA 3AW1A 4YZUA 3QK1A 1MKWH 4B73A 1C1VH 1P06A 2A7CA 5A0AE 4FU9A 1ELAA 1FIWA 4D8NA 4LK4A 5C3NA 3BG8A 4CR9A 1C2DA 3LOXA 1QBVH 1W0YH 2ZFPH 3U8RH 2BOHB 3Q3YA 3TH2H 2K1QA 1BBRE 2FLRH 6CHAC 3U8TH 1PPEE 4B74A 1N6YA 2BD5A 1Z1JA 2R3UA 4MDSA 1W3CA 4ZMAH 3SORA 2Y6TA 4MTBA 1XUKA 2OCVB 1A3BH 2P3FH 1BZXE 1HPGA 3A7TA 1DOJA 2R9PA 1MQ5A 1W11U 1SGIB 2GCHF 1MTNB 1YPEH 3MTYA 1PPBH 1KY9A 3RMMH 2UWOA 1BMNH 4U01A 2D1JA 3TK5A 2FI5E 3W95A 1W14U 1AIXH 2QF3A 1C2KA 1H9IE 1C5VA 2AYWA 1LCYA 3GCTF 2G4TA 3C1KA 1D6RA 1KXAA 1O2LA 1EB1H 1UHBA 4ABIA 3RXKA 4AN7A 1V2RT 2BLWA 4R0IA 3SU0A 2BLQA 3SV7A 4J2YB 4ZHLU 1CGIE 1F5LA 4BNRA 3TIUA 1Y5BT 1GHZA 1Z1IA 2ZQ2A 2WINI 1C4Y2 2C90B 5C1XA 4JYUH 3E91A 1BRUP 2OUAA 8GCHG 4ABAA 1WUNH 1IQNA 1QBOA 1E35B 1INCA 1NN6A 3SJ9A 3ODDA 4CRFA 5A0BA 3SQEE 1BTZA 2RG3A 1MUEB 1ZMJA 1TPSA 2PKAA 2XC5A 1GBDA 3FZZA 3V12A 3UTUH 5EQQA 4OGYA 1FY3A 5L2YH 2NU1E 4NGAH 5FHTA 4IW4E 1CA0B 2D2DA 1XUFA 2FOHA 4MNWA 1ACBE 1ORFA 1AE8H 2ZECA 1H8IH 1O5FH 2WPIS 4NSYA 9LPRA 4OS7A 1JWTA 2Y5FA 5FPTA 1G32B 1GGDB 1DPOA 1HAYB 2F9VA 1MCTA 1W8BH 5DO4H 2R0KA 3M7QA 2ANWA 2BY5X 7LPRA 3KCGH 2C8YB 2PUXB 1PQAA 1NRQH 1TE0A 2J38A 1EXFA 3VFEA 4X2XA 1UCYK 3GCHB 4I32A 4MPXA 3RU4T 1YGCH 2WPJS 4BAHB 3UNRA 5FBIA 2ANYA 3QWCH 1UJ1A 7ESTE 4X6PA 4ZKRU 1F92A 2PLXA 5E0GA 3HKIB 3STIA 2Y7ZA 2H9TH 2WUBA 4WXVA 1C5LH 5A09A 1TABE 3RXLA 3NZIA 1IQJA 1C5WB 1A3EH 4CBOA 3AW0A 3WY8A 1QJ1B 3LU9B 1CHOG 1WU1A 2LPRA 2HNTE 3M36A 1O2RA 3S9BA 2Y80A 4WMDA 4FUDA 4X1SU 3GY7A 1K21H 4NWKA 3PMHB 3S9AA 1NM6A 2PSYA 4ISOA 4J1YA 4Y6DA 4YT6H 4RKOB 1KXBA 1HCGA 2O8UA 1SGFG 2ZWLH 5HM2A 4UFEH 4X8UH 2GKVE 1GBIA 2FP7B 1GI0A 1T32A 1P0SH 1O2WA 1UVSH 2CN0H 2R0LA 2C8XB 4GCHG 1DE7H 2A0QB 3EA9A 3MFJA 2VH6A 1DX5M 1QL9A 5FAHA 3BTKE 1O2PA 2P3UB 1MCVA 4VGCB 3QTOH 5ABWA 2FS9A 3TLOA 1QCPA 3ZYEA 1JMOH 4ABJA 1PQ7A 1LVOA 4NIXA 1A2CH 3PM3A 1RTKA 3VB6A 2F9PA 1CHGA 2ZCKP 5L6NH 3FVFB 3VEQB 2OP9A 2IN2A 1AHTH 3NCLA 4Y76A 5AFYH 5LPEA 1C5UA 1SOTA 1YCPK 2A5IA 1GBKA 3ENSB 3HK6B 3A85A 2ZGBH 1ID5H 3RXBA 2TGAA 3MO9A 1O2QA 1IQMA 1MAXA 1KXDA 3LDXH 3OY5U 3VB5A 4TY6A 1P8VC 3KF2A 4Y7BA 1OS8A 1SOZA 4GHTA 2HLCA 1SLVB 1SGRE 1TNGA 1PPCE 2G00A 4B1TA 1SC8U 3F9EA 1UMAH 2AMPA 4Y8XA 5T3HA 2BTCE 4JZ1A 3SZNA 1K1JA 1NTPA 3LGTA 1EJAA 3VXEH 3GISB 4WF8A 2QN5T 3ATLA 3RU4D 4ABHA 5GDSH 1W7XH 1F7ZA 1AO5A 1AZZA 1NESE 2Q6FA 1RIWB 2Z9GA 3MWIU 4XOJA 1EUFA 2XWBI 3MH4A 5J4QA 2VWLA 2P94A 1E34B 3A89A 1JOUB 1D3DB 1AWHB 2A2QH 2Y82A 1RTLA 2VNTA 5JBBS 2CF8H 1Y3XA 1C5MD 2P3TB 1QL8A 4MPWA 1VCPA 3PLBA 1TLDA 1P2OA 1XX9A 1SHYA 1PPHE 2V6NA 1X7AC 4A5TS 1T4UH 5GJ4B 1Z8GA 4I8HA 3D65E 1MTSA 6GCHF 1O2UA 7GCHG 2QCYA 1C5QA 3LIWA 2WYGA 4BAQB 3S9CA 1ZPCA 3A8AA 1DSTA 3SOSA 4CREA 1EKBB 1P10A 4UFFH 1MKXH 4A6LA 3F9FA 5EG4A 3OYPA 2ZDKA 4MPUA 1NRNH 3SU2A 2H2ZA 3KQDA 4CH2B 2GZ9A 1NFUA 2BDBA 4Q2KA 1GMHF 2PGQB 1O3DA 4OS6A 1SMFE 3UR9A 2A31A 1ZPBA 1FMGA 2P59A 1GJCB 1P04A 1ZSKA 1VCQA 2BVSH 1SQAA 1NFYA 1SGDE 4JZDH 1OP0A 1ZMLA 3M7UA 2GDEH 3R3GB 5DGJA 2NWNA 3SGQE 2BZ6H 1GJ6A 2FIRH 1S5SA 1FAXA 4GAWA 1FI8A 4X6OA 1TGCA 2ZG0H 4JYVH 2BDAA 3SU3A 2CF9H 4ZUHA 2QXGA 3O8RA 1DICA 1GJ4H 1S6HA 1GJDB 1D3QB 4U2WA 2ZCLP 3E3TA 3UIRA 4ZXYH 1HIAB 1TIOA 4AYYB 1SI5H 1PPFE 3RXHA 3K9XB 5CMXH 4FU8A 2QAAA 2ZI2H 2ZPRA 3SUEA 4CR5A 4X0WU 2VB0A 4KTCA 1GBLA 1MQ6A 3DA9B 1QHRB 3IG6B 4SGBE 5ETXA 1B0EA 1F0UA 2ZPSA 1OSSA 1SGQE 3NWUA 4Q7ZA 3SNDA 2SGQE 4UONA 1OKXA 4YLQH 1C2LA 1ARBA 5GIBA 4NZLA 4Y79A 1GMCF 2VU8E 4YOGA 2ODQA 2EC9H 2TGTA 3RXGA 1XM1A 4NZQA 1CT2E 3ATKA 1QIXB 2PSXA 1RFNA 1UHBB 3SI3H 1GBCA 2VIOA 3RMLH 1SHHB 3DD2H 4ZKSU 5LGOA 1GBTA 2NU2E 1NRPH 5EGMA 2W7SA 1KSNA 4FVBA 5F6MA 4IC6A 2IOTA 3SUFA 1P2IA 3PLPA 1BIOA 2FLBH 2Z7FE 3M3SA 3BTME 4B71A 2TPIZ 1YPGH 1YPKH 1IQHA 1MBMA 4KTUA 1C9PA 1P2JA 2M5TA 3A87A 2PKAB 3U1JB 1QJ6B 3GDVA 1DITH 3QGJA 3RLWH 1ABIH 1CA8B 4WY3A 3SN8A 3UOPA 1BMAA 2W3IA 1A61H 3FFGA 1ZJKA 1P9SA 1TNLA 1PQ5A 3ZZ5A 4HFPB 2ZKSA 3LC3A 2FOFA 1ZYOA 4UEHH 1P02A 1ELGA 3BG4C 5E2PA 2PW8H 2FX6A 2ZU3A 3LGIA 4FUIA 4CRAA 2AIQA 3TITA 1QA0A 1ZTJA 1TPPA 3G01A 3GCOA 3RXJA 1E37B 3NUMA 2BQWB 1N8OB 2VIQA 4MLFB 1L4ZA 2Z94A 4ISLA 1PYTD 1QJ7B 1Z6JH 1NZQH 3E16B 2XCNA 4Q7YA 2ZC9H 4XFQA 4Z0KA 3SQHE 1O32A 3MH6A 4ZXXH 1DXPA 3SV6A 1O5CB 2H1UA 5EXMA 3RMOH 1O2NA 3DT0H 2FI4E 3UNQA 1W2KH 2BZAA 4E7NA 4MQAA 3K2UA 3SU1A 1O3GA 4KP0A 5DK1A 1GG6B 1S84A 3SJIA 1P3CA 3HPTB 1NU9A