1N6YA

Rip-phasing on bovine trypsin
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsinogen, cationic
publication title Specific Radiation-Damage Can Be Used To Solve Macromolecular Crystal Structures
pubmed doi rcsb
molecule tags Hydrolase
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2002-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1n6yA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1n6yA02
1FMGA 2FM2A 3T62A 2PSYA 1GJAB 3NZIA 2Z3CA 5FCKA 2HWLB 3NWUA 1MU8B 3P8OA 4Y11E 1P0SH 2F91A 1MTSA 1YM0A 1P3EA 2BD4A 4WMDA 3BTDE 3OY5U 5FCRA 3HPTB 1C1WH 3RMOH 1L1NA 3GY6A 1IHTH 2ZCHP 3JZ2B 4I8KA 1C1SA 3GCTG 1EZXC 3HATH 1D6RA 1T7CA 5FPTA 7ESTE 1BRUP 1GI7B 1SSXA 3SJ8A 1BJUA 1DWCH 3GYMA 1SLXB 1O38A 1SGFA 3MH6A 2ZDMA 2B5TB 3MNXA 1ZPZA 3EA9A 4ABAA 1LKAA 1DE7H 2Y6TA 1CT2E 3URCA 1NRSH 1C5QA 2NU3E 4J2YB 4CRDA 1B0FA 4YT6H 2WYGA 1O31A 5A2MH 2GCTC 5T6GA 2GP9B 3HGPA 2GCHF 3SGBE 4AFSA 1C1TA 5E0GA 5TCCA 3ZVEA 4WMEA 1IQLA 4FXGH 5BRRE 4Y8XA 2Z6BD 1KLJH 3DT0H 3E91A 3M7UA 3SI3H 2GDDA 4XOJA 1G2LA 1UHBA 1C5YB 1O2NA 1TX7A 3MO9A 1XUGA 4ZXYH 3IITA 1TGNA 1CO7E 2ZWLH 4O03A 1VJ9U 1ANBA 2DUCA 4IBLH 1FY4A 3A86A 4OS6A 1O3GA 1O5BB 2WUCA 1Q3XA 1TFXA 4CH2B 1TPPA 1H9HE 3PB1E 1F0RA 3IG6B 2PGBB 4Q7YA 1ZMNA 5AVDA 4B73A 1ZZZA 3SV2H 4YLUA 1C4Y2 1LMWB 1HYLA 4VGCB 4Y10E 2WPKS 3D62A 1XKAC 1VCQA 2PTNA 3TK6A 1THRH 3TJNA 1E34B 1HNEE 1IQIA 4CBOA 1P9SA 2HPPH 1AY6H 3RXLA 4GCHF 1PPBH 4NFFA 3VGCB 2OC0A 4CBNA 3K65B 4DJZB 5JB9S 3S9CA 2HPQH 2ZDKA 2OQ5A 3M3VA 4NIXA 2FOCA 1BOQA 1O3LA 1A46H 1KXDA 4BTTB 2BD5A 3SNDA 2ODQA 3RXSA 3VEQB 3PMAB 1ZJKA 4Z0KA 1SGRE 5T6FA 4ISOA 1D3QB 3GDVA 3RXMA 3AAUA 1KXAA 3M5MA 1Y3UA 1DANH 1N6XA 4ZHMU 2VVVA 1MUEB 2ULLA 1TRYA 1B5GH 2GV6A 1TGCA 4AN7A 1O3EA 1QJ1B 1Z7KA 2ZTZA 3QUMP 4MG3A 4KTUA 4DT7B 3O8RA 2GZ7A 4ABGA 2P8OB 3K9XB 1O5EH 1PQ7A 2B7DH 1ESTA 4A7IB 1DITH 3LJOA 1Y3WA 2OC8A 6GCHF 1QL9A 1LHEH 2AH4X 2Q6DA 1DUAA 2VU8E 1GBLA 3LONA 1UO6A 3ZV8A 1EX3A 1WV7H 4GHQA 3EDXB 3TNSA 3ZYDA 4SGBE 1SGQE 5C5OA 2H9TH 1MD8A 1NRPH 1ETSH 2EEKA 4Y6DA 1C1NA 3F9GA 3RDZA 8ESTE 2JH5D 3EAJA 1C5OH 4MNVA 1KXEA 3NCLA 2FDAA 2ZPSA 2EA3A 2A7JA 2R0KA 1CVWH 2GCHG 4MNXA 1GI5A 3I29A 3VXFH 1MBQA 5K7RA 4D76A 3D65E 1WU1A 2PSXA 1LQDB 4DIHH 5T6DA 4KGAA 3AAVA 1XVOA 1DWDH 1FONA 3ZZDA 1GCTC 1TRNA 1SFQB 4CR5A 4H6TA 1SL3A 3RXIA 5E2OA 1FAXA 3P6ZB 1EUFA 3QLPH 1V2LT 2GCTB 1KTTB 1XUKA 6CHAC 4ISHH 3F1SB 1JBUH 2OINA 3KN2A 4GAWA 1T8OA 1QURH 1HAOH 1TB6H 2TBSA 2G81E 2AIQA 4IMZA 1Z71A 4A1TA 1HAHH 3ATIA 3FZDA 3UWIA 2ZQ2A 2FIRH 2WUBA 1HAPH 1BBRH 1T32A 1F5RA 5ETXA 3SHAH 2GZ9A 2IPHA 3TGIE 4GCHG 1CGJE 1W8BH 1UK3A 2BXTH 2TGPZ 1YGCH 5I46H 1AU8A 1MQ6A 1HIAA 1SGFG 3BTME 3RMNH 1D6WA 1MCTA 2DE9A 1ANEA 1INCA 1B7XB 1C1QA 1DPOA 2BLWA 1C9PA 4CRFA 3O8BA 4NWLA 3U8RH 4KELA 2EI6A 1C2KA 1K1NA 5A0BA 1UVPA 1AFEH 3RXJA 3P8FA 1O30A 3PWBA 3SU4A 2C8ZB 3SUEA 2VH0A 1HBTH 5GXPA 3GOVB 4Q7XA 4MTBA 2H9HA 4GPGA 3H7OA 3RXEA 3M3SA 2RA3A 1JOUB 2STBE 3P8NA 1PPFE 3UFAA 1PPZA 2OP9A 3MU8A 2C4FH 1EAUA 1EJNA 5J4SA 1BUIA 3E0NB 5EQRA 5FBEA 3GY3A 4Y8ZA 2ODYB 4IC5A 1BJVA 2F9OA 4I32A 1ZHPA 2ZCKP 1EZSC 3K2UA 1ORFA 5LPRA 1S81A 1XUFA 2A1DB 1A0LA 1GHBF 1KSNA 4NZQA 2PR3A 1EP5A 5SGAE 2CF8H 1GBCA 1V6DA 4HZHA 5DP7A 2SGAA 5EGMA 1MTNB 1Y5AT 2B9LA 2BD9A 1TE0A 3RC4A 5T3HA 3TPIZ 5CMXH 3P17H 1VCPA 3TH2H 2SFAA 2I6SA 5L30H 1C2FA 3SJOA 2PWXA 3EYDA 5A8ZA 1MTWA 2ZHFH 1MKXH 3IWMA 2YOLA 4YTAA 1TNIA 5GJ4B 1CHGA 1D4PB 1G3DA 1YF4A 1BCUH 4Q2KA 3Q3XA 1MQ5A 2ZU1A 3B8JA 2STAE 1QRXA 4CRCA 2ZPRA 1J14A 4FUGA 4WY3A 2BZ6H 5DP9A 2WPHS 1JXPA 1GJCB 2BDAA 5EG4A 3ZZBA 4CHAC 3V3MA 1JWTA 1IOEA 2C90B 4MNWA 2SNVA 4XDEA 1GCTB 1XX9A 2C8YB 5JDUB 4YESB 1K1MA 1XVMA 3QZQA 1GG6C 4AZ2B 1U6QA 2AGEX 2TGAA 3DA9B 1S6FA 3TJUA 5C1UA 3QDZB 5TJXA 3ZVAA 4B2CA 1GJ7B 2QAAA 2XWAA 1QJ6B 1K1PA 1TBZH 3M36A 3KQCA 3UY9A 5C3NA 2H1UA 1AI8H 1AHTH 2IJOB 4ZHLU 4IC6A 1TX6A 3SHCH 1ELFA 3E3TA 3A85A 2ZHQH 3MH4A 9LPRA 3TK5A 1TNLA 2VH6A 2SGFE 3HKIB 2V3HH 2QY0B 4I31A 1GJBB 1HAVB 2ZFSA 4MVNA 1PQAA 1TGBA 3LH3A 4TPYA 1KTSB 1SLWB 2RA0A 3A8DA 4JK5A 2G51A 2ZPQA 3MNSA 2QF0A 4X2XA 1GBHA 1NFWA 2D8WA 3VB3A 2OD3B 1GI6A 4THNH 6LPRA 3G01A 4I8JA 5LGOA 3STJA 1P10A 3KL6A 4X1NU 1W0YH 2OQUA 3SV9A 4MPXA 3PO1C 1BBRE 3M5OA 3S7HB 1V2QT 4X1RU 5HM9A 5A0CA 3ZZ3A 1GI8B 3MU0A 3QX5H 4NIVA 1Z8RA 3BV9B 2ZHWH 5EQSA 4AGKA 1C2GA 3ATKA 1HAZB 4D8NA 2ZO3H 3SGAE 1GHBG 2VB0A 1B0EA 5CE1A 2VVCA 5AF9H 1TBRH 1GDQA 2A4QA 3NXPA 4PROA 2AMDA 3D49H 4X1PU 1AIXH 3BTGE 1AB9C 4K60A 4E7RG 5JBCS 5B6OA 5DK1A 2FS9A 2UWPA 3PMJA 3GCHB 1QL7A 3VXEH 1QTFA 1C5VA 1GI9B 4X0WU 1EKBB 1YPEH 3GISB 2P16A 2Q6FA 2ZQ1A 3A88A 1RS0A 3BTFE 2HNTC 2I6QA 1UCYK 1HRTH 5E2PA 3A7WA 3DHKH 4IN2A 2XC0A 1O36A 1O2MA 1G3EA 1GI1A 4RKOB 4GLYA 1QR3E 1ZHRA 1NPMA 2IN2A 1LTOA 2TGDA 1BB0B 1O3IA 2FS8A 2XCFA 1Z1IA 2AMQA 2QA9E 1TX8A 4BXWA 1GMCG 1IAUA 4MPUA 1MAYA 2P93A 1J15A 1NO9H 3MU1A 4Y76A 2XC5A 3LGVA 1SQAA 2BX3A 4E06H 1W12U 4INHA 4B71A 1GPZA 2GD4B 3O8CA 2TGTA 2ZGHA 4LK4A 5DJ7A 1UTNA 4FUEA 5I25A 3T2NA 3RXPA 1GJ6A 2AYWA 3S9AA 1E37B 1TWXB 1ZR0A 3STIA 3BG4C 4OS7A 1O5FH 2QIQA 4Z6AH 3SU1A 2PKAB 1MCVA 2BTCE 5HYOA 4CHAB 2YNAA 3SUFA 4JK6A 2M5TA 3FFGA 1GJ8B 1SGYE 4MNYA 4Y71A 3RXVA 1K22H 4IS5A 1GG6B 2FTLE 2ZTXA 1DS2E 4I7YH 4NA9H 5ESTE 1O2SA 2HGTH 3A8AA 2BY7X 3FP7E 4RSPA 2XW9A 1TNJA 1EP6A 3FVFB 3GYLB 2W3KA 3MHWU 2GMTC 1V2JT 1AQ7A 2TPIZ 1O3HA 3LGIA 1ZGIA 2A0QB 3VGCC 2BD8A 1SQTA 4YOIA 1Q2WA 1ANCA 3S9BA 3W95A 2WV5A 3ZZAA 1C5XB 2BVRH 2XBYA 2FZZA 1GBMA 1OKXA 2FODA 3EE0B 1C5PA 1NROH 1THSH 1MBMA 2FLBH 5IDKA 3D23A 4XE4A 3TIUA 3PO1B 1AKSA 1CT4E 1OXGA 3K6YA 1QB1A 3C27B 1KXFA 2OBOA 2ZECA 1GHWH 4LZ4B 2BX4A 3ZVFA 5F6MA 1LPKB 1N1LA 2P8OC 4WWYA 1HJ8A 1V2UT 2FPZA 2A2XH 1N8OB 1DT2A 3I78A 3LC3A 3RXCA 1V2MT 3W94A 1ELAA 1AB9B 1EAXA 1SGDE 3A80A 4FU8A 3SU2A 2ZU2A 1GBKA 1BMNH 1NZQH 1GHZA 4NG9H 4NSYA 1DX5M 2ZDAH 2A4RA 1FY3A 1TA6A 1ESBA 2A4OA 3FP8E 2O8UA 3RC5A 1C1VH 4HFPB 3R0FA 7GCHG 1HDTH 1EPTA 1EXFA 1XM1A 1L1GA 2PTCE 2G4UA 4UFGH 2BDIA 3ZZCA 4D9RA 1NTPA 1P2MA 1HJ9A 1W11U 1CBWC 3TH4H 4BAKB 2BXUH 1CE5A 1C5WB 4FVDA 1AGJA 1IQKA 2VJ1A 1IQJA 4FUIA 1KXBA 2ILNA 2ZIQH 1G9IE 1GHVH 4XBCA 3WY8A 2BY6X 4GUXA 2Y5GA 3A82A 1OP0A 3BTEE 1QRWA 2A5KA 3GY4A 2G00A 4RN6A 4K8YA 5A09A 1JRTA 1O5AB 1DDJA 2KAIA 1FI8A 3BG4B 1SB1H 1EJMA 5EOKA 1NN6A 3BEIB 1MKXK 2OXSA 1CA0C 2FTMA 3CS7A 3RUOA 1TNKA 3BN9A 1QL8A 4LOYH 1J9CH 5LPFA 5JB8S 4A6LA 3S7KB 1MZDA 1H9LB 1O2VA 3A89A 1QFKH 2QC2A 4NA7A 1EJAA 3NKKA 1SHHB 5BPEA 1BTYA 1SFIA 2BDBA 4A5TS 1W13U 4AFQA 1ZMJA 3UIRA 2LPRA 1ZSKA 2Y81A 3UQOA 1AN1E 5FPYA 2OCVB 4E05H 1VCWA 1OOKB 1BRAA 2VGCC 2F9NA 1C2JA 1BTUA 2GMTB 1V2RT 2H9EH 2BB4A 1N6YA 4NGAH 1DXWA 2OBQA 1A1RA 5FHTA 4IMQA 3L6PA 5DGJA 3L33A 3SQEE 1GL0E 1EASA 2A5IA 1S82A 2PUQH 1SI5H 3H7TA 1BTZA 1O2JA 4KKDA 1O5GH 4WH6A 4AX9H 5CHAC 2W7UA 3TJVA 1OX1A 2ZNKH 1L4DA 5JYIA 1H4WA 1ZMLA 1P9UA 4MPVA 1FIWA 4U01A 1W2KH 1QHRB 1W7GH 3BG8A 1GI3A 3OYPA 1ZLRA 2GGVB 5K0HA 1RD3B 4YM9A 3TGJE 4YLQH 1KDQA 1TALA 1V2OT 2CHAC 3F68H 1QA7A 1GHXH 4ABIA 4NIWA 1TMTH 2F9PA 1NRQH 3HGNA 1DLEA 1MTNC 1O37A 3BEFB 5EXNA 2XC4A 2C3SA 2NU1E 3MNCA 1C1PA 7KMEH 1O33A 3F9HA 1EB1H 4NA8A 4A1VA 1ACBE 4HI3A 4MLFB 1O0DH 1TOMH 1TRMA 2FI4E 2UUYA 4WVPE 8LPRA 2CJIA 1GBFA 1GGDB 1UTQA 1W0ZU 4FVBA 3RXBA 2ZF0H 2BM2A 1DY8A 4DGJA 2BD2A 2PKSC 4TPIZ 2ZU4A 1CBWB 4WF8A 3LJJA 2BOHB 1L4ZA 2AFQB 2BDYA 1LPZB 3P92A 3RLYH 1O35A 4JYUH 3MO3A 1TOCB 1UVUH 2JH0D 1UVTH 1QGFA 2UUKB 1P2QA 2J4IA 2O8LA 2AERH 5EW2H 2QGRA 2TIOA 1NT1A 1J17T 3U1IB 5GPIB 1Z8JB 1C1OA 2FOBA 5GDSH 3DFJA 3ENSB 1EOLA 1P09A 1TYNA 3U69H 3V0XA 1S83A 1KLTA 4OGXA 3MMGA 1PYTC 3CP7A 3SV6A 1FY1A 1CA0B 1TNGA 1V2TT 1HPGA 2A31A 2XBXA 1SC8U 3RXGA 4GVUA 1O2XA 3K6ZA 2LNCA 1FN6A 1C2IA 1O2PA 2XXLA 2R3YA 1E38B 1D9IA 1V2PT 3M7QA 3SO3A 1TAWA 1C2LA 2GT8A 1EZQA 1GVKB 1D3DB 2VIQA 3CENA 2UWLA 1O3NA 4GHTA 1LVOA 1Z1JA 1O2HA 1Z8GA 1IQHA 1HAYB 2EI7A 1GBDA 2ZDLA 1GBTA 1O3BA 4D7FA 2RCEA 1Z6JH 2C8XB 1ELDE 3ODDA 2VGCB 3UNSA 6ESTA 1OPHB 1K28D 4MQAA 2C8WB 1F5KU 1L0ZA 2THFB 1C2MA 3M5LA 1GHAG 1GI0A 1O3PB 1UTLM 2Y80A 3BTHE 4X2VA 2GTBA 1CQQA 1WYKA 1FY8E 4DIIH 5CHAB 1ELCA 1RTFB 5EPYA 1WSSH 5GIBA 3Q3KA 1O32A 2GT7A 1MU6B 3H5CB 1SGNE 1O2YA 4ABBA 3RMMH 1ELGA 2VWMA 4INKA 1G2MA 3U1JB 1LO6A 4WXVA 1O2TA 4ZUHA 3UR6A 4X8TH 1P06A 1TIOA 1ELTA 3GCHC 5F8XA 1Y5BT 1P2KA 1O2WA 1NU7B 1MD7A 3LGYA 2CHAB 1NM6A 1UK2A 4UDWH 2BOKA 1C2DA 3A7VA 3M37A 2RDLA 3CS0A 4ZHAA 3RC6A 2PUXB 1OWJA 4Y79A 2J95A 1YPKH 1ZTLA 1EOJA 5C2ZA 1O2OA 2G52A 1HXEH 2W3IA 4YT7H 1TPAE 3SUDA 1WUNH 4BNRA 3GY2A 1MMJN 3A87A 5GCHF 4BAQB 4CRAA 4OS5A 2BY9X 1FQ3A 1BTPA 4FUFA 2BLOA 1C1MA 1AVXA 1IQEA 1C4U2 1MAXA 1SMFE 2PKSB 2Z9JA 1OP8A 3GY7A 3QGNB 4JZ1A 2ODPA 4ABEA 2XNIA 4Y0YE 2OLGA 2BDCA 1P11E 1DWEH 3ESTA 1GMCF 3RXKA 1F0UA 4BAHB 1Y59T 4FUDA 1UTPA 1BDAA 3NUMA 1SG8B 4ISLA 1TNHA 2FI3E 3E90B 3FAOA 4J1YA 2BY8X 2FOAA 1LQEA 4UD9H 4DW2U 1ARCA 1GMDF 3FP6E 5AHGH 1YKTA 3FANA 4A92A 1DLKB 2JETC 2EC9H 1SBWA 1C2HA 1G3CA 1YPGH 4DY7B 3UQVA 1ESAA 2ESTE 2FYRA 2TRMA 3AW1A 4DG4A 1PQ8A 3ZZ4A 1RXPA 3A7ZA 1K21H 1DUEA 5A0AE 1Y3YA 4X6MA 3AVZA 2VNTA 3SJIA 1G36A 2ZFTA 1SGEE 3PYHA 2D26C 2ZHEH 4I8LA 4TY6A 4MPWA 1BHXF 1VR1H 1EATA 5IYTA 2P3UB 3QTOH 3E1XB 1NU9A 5HGGA 1W10U 1FAKH 2QF3A 4B2AA 1BTWA 1SR5C 3NK8A 2GV7A 2HALA 4Y7BA 2J9NA 2ZGBH 2XCNA 4XBDA 1ELVA 4O97A 1C1RA 2ZCLP 1E36B 1FLEE 2OC1A 3EA8A 2QXGA 3ZVBA 4MDSA 2ZEBA 2XRCA 3KF2A 5TCAA 2W7SA 1NC6A 2Z9KA 1C5RA 4INLA 1A3BH 1N8OC 3LKWA 3M5NA 1O2QA 4R0IA 1X7AC 2Z94A 3SZNA 1XUJA 8GCHG 3Q3YA 3KIDU 3RM2H 1YLCA 3GY8A 3MOCA 1GDNA 2R2WU 3T28A 1O3AA 5A8YA 3TVJB 1ELBA 1HAVA 1H8IH 4BTIB 5GCHG 2VIDA 4E7NA 1QB9A 1AMHA 1M9UA 1TMUH 1NRRH 4JYTA 3F6UH 2PW8H 3F9FA 3A83A 1UTMA 2SGEE 4K1TA 4K5ZA 1D3PB 3VB7A 1ETTH 1HGTH 2O8WA 5G4BA 1HAIH 3RP2A 1FXYA 1OWKA 4OGYA 1XXDA 2FOHA 4K1EA 1C5LH 4JCNA 2Z9GA 1C5UA 1UTKA 3C1KA 1L1JA 3A8BA 3LGTA 1QIXB 3ZVGA 2NU4E 7GCHF 2Q6GA 2WPIS 2ZDVH 1IQNA 1TBQH 2Z3EA 2NWNA 1PPCE 2Y82A 1G32B 4BXSA 1GMDG 3LIWA 1EZUC 1T31A 2GX4A 1P2OA 3ZZ7A 2VWNA 4CR9A 2BY5X 2HNTE 2PHBA 4AYVB 2YNBA 2BVSH 3HK3B 1GCDA 1YLDA 3DUXH 5A8XA 4ZKOU 3BSQA 1RFNA 3PV4A 1ZJDA 2ZI2H 1LKBA 1JIMA 1P2IA 1V2KT 4XBBA 2BYAX 4X6PA 5F8ZA 1VITH 1PPHE 1Q31A 1A7SA 5JBBS 3LGUA 2CV3A 2BDGA 2V0BA 1J8AA 2JETB 1QQ4A 3RXAA 3RXUA 2BD3A 4ZXXH 1Y5UT 4ZH8A 3MO6A 1P04A 5L2YH 1GDUA 3SJKA 4ABHA 4HTCH 1TGTA 1ZPBA 1E0FD 1GBIA 1F2SE 3P70B 1A5IA 1QA0A 2A5AA 1O3DA 2P59A 3Q77A 2J92A 4YOJA 5DP5A 1SHYA 2ZKSA 3VFEA 2BHGA 1CA8B 2OC7A 4BTUB 5EQQA 1YP9A 1O5DH 1DICA 2ZFFH 3DFLA 2ZA5A 1E35B 1LHDH 4K3JA 1Y8TA 1O39A 3VB4A 2ALPA 2B0FA 5DP8A 3MYWA 2ZHDA 3SV7A 1BBRK 3SJ9A 2O9QA 2Z9IA 3MI4A 1LHFH 2GDEH 1WBGB 4ABDA 1A61H 1BMMH 3A81A 4JZDH 1THPB 1F7ZA 2SNWA 1BA8B 3AASA 3SGQE 1XMNB 4ASHA 3BTWE 1C9TA 1OWHA 1GHYH 5C20A 1NY22 1DWBH 2Y5FA 1ETRH 1GJDB 2FX4A 3N7OA 1O3KA 1LVBA 4WXIA 2J2UA 4JZEH 2ZGXH 5EXMA 1G30B 3EA7A 1G37A 3ZZ5A 3LU9B 4WH8A 2R9PA 3GCNA 4AOQA 1S84A 4O9VA 1QQUA 1YC0A 4IW4E 1ID5H 1GGDC 1YCPH 5J4QA 1SLVB 1H1BA 1V2WT 1UVSH 2F3CE 1RJXB 4M7GA 1XXFA 1UHBB 1OWIA 1J16A 5EW1H 4X8UH 1EQ9A 2BQWB 1XUHA 2WPLS 9ESTA 1HCGA 5FX5A 4UFDH 1YCPM 2ANWA 2AEIH 2VIWA 1GWAA 1CGHA 1SPJA 1AUTC 4I8GA 4YO9A 1EAWA 3RXFA 2QXHA 1QCPA 2QXJA 2V3OH 3V7TA 3LT3A 3BIUH 4AFZA 5ABWA 3SOSA 2FOMB 2GKVE 8KME2 2ZU5A 1FZZA 3KGPA 1ZSLA 4UONA 1SQOA 2BDHA 1T4UH 3FZZA 5FBIA 1FDPA 2BZAA 3KQEA 5L2ZH 1S5SA 3GCOA 1O2KA 4X6NA 4H42U 1FJSA 5FPSA 3UNRA 1FPCH 3B9FH 4FU9A 1KLIH 3RXOA 1ZHMA 3R3GB 1BZXE 3M35A 3OY6U 3U8TH 1SGTA 3ITIA 3UREA 1V3XA 3PLKA 2ANYA 1S85A 3E6PH 2FMJA 1LVMA 3LC5A 2UUFB 1A3EH 1QBNA 1AE8H 2Y7XA 2CF9H 3RXDA 3QTVH 2G5NA 4YOGA 1TMBH 1UK4A 1HB0B 2G55A 3ODFA 1FN8A 1ZOMA 5L6NH 1HUTH 1BITA 5E0JA 4DOQA 2VIPA 1AFQC 1KDQB 4X8SH 1GMHG 4UEHH 3PTBA 4X2WA 4ABFA 1P03A 3RU4D 4AB8A 3MU5A 1UTOA 1T8NA 1F0TA 1QJ7B 3Q00A 1MKWH 4CH8B 4LZ1H 2FESH 3SNAA 4AB9A 1K1JA 4TWWA 1UTJA 3P8GA 1K1LA 3T25A 5GWZA 1QB6A 1SGIB 3LGWA 5C1XA 1TONA 2Z3DA 1GHAF 1UJ1A 1TPOA 2W26A 1NRNH 1MTVA 4I33A 1GI2A 1H8DH 1A2CH 1UCYH 1AE5A 2G8TA 1HFDA 2WPMS 3KEEA 5AFZH 3UPEA 2ZTYA 1OP2A 5C5NA 2SGQE 4TY7A 2FOEA 2J94A 3MNBA 4QT8C 1DY9A 5C67A 1RTKA 2F9BH 4FU7A 2G4TA 2P94A 1HJAB 3ELAH 1YBWA 1DXPA 1PYTD 1IHSH 4ZROA 1O3CA 3EGKH 3GDSA 2HNTF 3LDXH 1BTXA 3PTNA 3BEUA 3VB6A 1GJ5H 1C2EA 3O8DA 5DP4A 1P3CA 2FLRH 2QN5T 4B2BA 1YYY1 3PLPA 1NFYA 3T29A 1UVOA 2ALVA 1PPGE 3PM3A 4AG1A 1ANDA 1EAIA 4ZMAH 1O34A 1BMAA 3RU4T 4CRBA 3QGJA 3OX7U 2XYAA 1DVAH 4O3TA 5EODA 4K69A 1TPSA 3TITA 4B76A 2DE8A 2HOBA 3TNTA 1HIAB 4FUJA 2G5VA 2ANKH 3SU5A 4DVAU 4O3UA 3TU7H 1MTUA 2VIVA 3VPKA 1F5LA 3E8LA 1O3JA 3QK1A 3RXQA 3SI4H 2J38A 4JMYA 1P01A 3RU4E 1IQMA 1BQYA 4AFUA 3ZZ8A 1NESE 4K8BA 3UR9A 4XFQA 2FP7B 1PJPA 1W14U 1FUJA 2B8OH 1T4VH 2P95A 4FUCA 1ZRBA 4OS4A 2F9UA 1FPHH 3UUZA 2P3FH 2QV1A 4AYYB 2FI5E 2AIPA 3MU4A 2CGAA 4CRGA 2FYQA 5DP3A 4K2YA 4NIYA 4WMFA 3SQHE 1TABE 4TYDA 4NWKA 1RIWC 4JYVH 1FNIA 1GBEA 1GJ9B 1AWFH 2FWWA 2ZFPH 1T8MA 3ZVCA 4D7GA 1S0RA 1ZGVA 5F8TA 5HXFA 4I8HA 1ZTJA 4KTSA 4UE7H 1AFQB 2A4GA 3UWJH 2W5EA 2WV4A 4BAMB 4D9QA 1A4WH 1K1IA 2Y5HA 1ZYOA 2QCYA 3QZRA 2A7CA 1FV9A 2ANMH 5C1YA 1BHXB 3GICB 1P12E 1V2NT 1P2JA 3A7YA 2A2QH 2NU2E 1O2RA 3OSYA 1GBAA 1O3MA 2IOTA 4U2WA 4F49A 1AWHB 3HK6B 1SGPE 2AGIX 2GZ8A 2WPJS 1P8VC 4ZKSU 3GY5A 2H6MA 5JBTA 3QN7A 1DSTA 1RGQA 1QBVH 2K1QA 2CN0H 1VGCC 1IQFA 1K1OA 1Y3VA 1TQ7B 1KY9A 5LH8A 1CT0E 6GCHG 3PMHB 2XBWA 1C1UH 3AW0A 4NFEA 2ZP0H 1BTHH 2V35A 3GDUA 1SLUB 2FOGA 1QRZA 1DSUA 3OTJE 2BMGB 1OSSA 4XSKU 4H6SB 4DCDA 1GL1A 3TGKE 8GCHF 1T8LA 3SU6A 5DP6A 2EI8A 2FOFA 2ASUB 4Y8YA 1WTHD 1WQSA 3SORA 3A7TA 1UCYE 1WQVH 5LPEA 1OWEA 3HKJB 5E8EH 3KCGH 1C5ZB 3UTUH 1RTLA 1FY5A 5FX6A 2QXIA 1A5HA 1BMLA 5PTPA 3QO6A 1DFPA 3M7TA 4JZIA 4U30A 1JRSA 3PLBA 2R3UA 3SNEA 1NFXA 4BAOB 1Z6EA 2A7HA 3MWIU 3ZVDA 2PV9B 1QBOA 2BLQA 3ZZ6A 1O5CB 2XWBI 3LH1A 2ZU3A 3BTTE 3UOUA 1AVGH 1GBJA 1MZAA 1YCPK 1AD8H 2V6NA 1LDTT 2FEQH 1SOZA 1DOJA 2ZG0H 1VITF 3NPSA 3PROA 5EPNA 4ISIH 3MTYA 5EU8A 1YPHC 3KQBA 4IN1A 3MH7A 3SUGA 3BF6H 1P05A 4Q7ZA 3UNQA 3F9EA 4NCYA 2BD7A 2ZGCA 4K1SA 1EB2A 4NZLA 3E0PB 4R8TB 3RM0H 1C5MD 1G3BA 1AZZA 1HV7A 2D2DA 3VB5A 4Y7AA 1O3FA 6CHAB 1KIGH 1LPGB 3M61U 1PQ5A 1K9OE 2A32A 1GVLA 1ELEE 3MFJA 4ESTE 1V2VT 3I77A 4JZFH 2XBVA 1O2UA 2ZDNA 1HAGE 2JKHA 1O3OA 1K2I1 1RIWB 4A1XA 1F0SA 1BRCE 3SBKA 3B23B 4IGDA 3S69A 4WJG2 1MH0A 1A5GH 3U9AH 2O8MA 3P95A 1QY6A 4X8VH 3ATMA 2A45B 5AFYH 1NFUA 2H5DA 4B75A 3KHVA 1WCZA 1EPTC 4B1TA 1YPHE 1ABJH 1C5TA 2J34A 4BOHA 1CU1A 3EQ0H 3ZV9A 1VZQH 2FX6A 1LHCH 1JMOH 1CHOF 1Z8IB 4X1SU 1HAXB 3KNXA 1C4V2 3LPRA 4ZKRU 1OYTH 3SNCA 1TGSZ 1O2IA 1IQGA 1KXCA 2F83A 2VWLA 4X6OA 3T27A 2BQ6B 1ZSJA 2WINI 4OS1A 4RKJB 5E0HA 3U8OH 1VGCB 1H9IE 1P57B 1TA2A 5F03A 1UMAH 4TWYA 1OYQA 3BTKE 3TH3H 1GBBA 4SGAE 4HGCA 1PPEE 1GJ4H 1MKWK 1WTGH 2Z7FE 2AGGX 4U32A 3RXRA 4F4OC 1SVPA 3A7XA 3A8CA 3U98H 2BVXH 2PLXA 5ESBA 2CXVA 2HRVA 5H4IB 2AS9A 1HLTH 3PMBB 5FAHA 2C93B 3LOXA 4OS2A 4UFEH 3TJOA 1P02A 3OU0A 4LXBH 1L2EA 2FXRA 5DPAA 1P2NA 3URDA 1ZRKA 2NU0E 4FUHA 1BT7A 5FXLA 1LVYA 1OWDA 1ZTKA 1O2GH 1D3TB 1AO5A 1ABIH 3SU3A 3ATWA 3TK9A 1VITG 1LCYA 4AGJA 1QNJA 2R0LA 1KYNA 2AMPA 2XTTB 5JBAS 3S0NA 1AZ8A 3RXTA 2OUAA 2VIOA 1CGIE 1ZPCA 3T26A 3UOPA 1TLDA 2UUJB 3GCTF 4FUBA 4GSOA 4ISNA 1S0QA 5JPMH 2OTVA 3M3TA 1VJAU 2RG3A 3SW2B 1BRBE 4DURA 1YPLH 4X2YA 1Y3XA 1BIOA 4UFFH 3E16B 4H4FA 4Q80A 3V12A 1V2ST 4ZKNU 3DD2H 4CREA 1DM4B 3MH5A 1AKSB 3ZYEA 1HXFH 1LHGH 1SGCA 2Y7ZA 1C5NH 1TQ0B 3RXHA 7LPRA 2Z9LA 2PFEA 1GI4A 4Y0ZE 1FIZA 2ZFRH 3PWCA 2QYIA 1YPJH 3SN8A 2VVUA 2O8TA 2P3TB 2SGPE 1S6HA 3RMLH 3RLWH 1RRKA 2SGDE 2UWOA 2VWOA 3SV8A 1XKBC 2JH6D 1A0JA 1NS3A 5EXLA 1SOTA 1CHOG 3ZZ9A 5HM2A 3V13A 2H5CA 4VGCC 2H2ZA 4BANB 3JZ1B 2D1JA 1AVWA 1WAYB 3L3TA 3TLOA 5HMAA 3BTQE 1AUJA 1ARBA 2PKAA 3BIVH 5DKMA 2CMYA 3A84A 2HVXA 4AG2A 5DG6A 2BQ7B 1PFXC 1GMHF 2VINA 1EPTB 1W3CA 1A0HB 1CSOE 1JIRA 2R2MB 2PGQB 3SU0A 5DO4H 3QWCH 1WOFA 4B74A 2WYJA 3ATLA 4KTCA 1OS8A 2ZZUH 2ZFQH 4KP0A 1O2ZA 1F92A 4NSVA 4YZUA 2FO9A 1W7XH 4AORA 1YPMH 3SNBA 2Q1JA 4X1QU 1HJAC 2GVFA 1O2LA 3KQDA 4ZAEA 2BLVA 1GVZA 2ZC9H 3Q76A 2F9VA 2ZGJA 4ABJA 2KAIB 2HLCA 1C5SA 1XUIA 3T5FH
chains in the Genus database with same CATH superfamily
1FMGA 2FM2A 3T62A 2PSYA 1GJAB 3NZIA 2Z3CA 5FCKA 2HWLB 3NWUA 1MU8B 3P8OA 4Y11E 1P0SH 2F91A 1MTSA 1YM0A 1P3EA 2BD4A 4WMDA 3BTDE 4DT4A 3OY5U 5FCRA 3HPTB 1C1WH 3RMOH 1L1NA 3GY6A 1IHTH 2ZCHP 3JZ2B 4I8KA 1C1SA 3GCTG 1EZXC 3HATH 1D6RA 1T7CA 5FPTA 7ESTE 1BRUP 1GI7B 1SSXA 3SJ8A 1BJUA 1DWCH 3GYMA 1SLXB 1O38A 1SGFA 3MH6A 2ZDMA 2B5TB 3MNXA 1ZPZA 3EA9A 4ABAA 1LKAA 1DE7H 2Y6TA 1CT2E 5GNDA 3URCA 1NRSH 1WDIA 1C5QA 2NU3E 4J2YB 4CRDA 1B0FA 4YT6H 2WYGA 1O31A 5A2MH 2GCTC 5T6GA 2GP9B 3HGPA 2GCHF 3SGBE 4AFSA 1C1TA 5E0GA 5TCCA 3ZVEA 4WMEA 1IQLA 4FXGH 5BRRE 4Y8XA 2Z6BD 1KLJH 3DT0H 3E91A 3M7UA 3SI3H 2GDDA 4XOJA 1G2LA 1UHBA 1C5YB 1O2NA 1TX7A 3MO9A 1XUGA 4ZXYH 3IITA 1TGNA 1CO7E 2ZWLH 4O03A 2EQNA 1VJ9U 1ANBA 2DUCA 4IBLH 1FY4A 3A86A 4OS6A 1O3GA 1O5BB 2WUCA 1Q3XA 1TFXA 4CH2B 1TPPA 1H9HE 3PB1E 1F0RA 3IG6B 2PGBB 4Q7YA 1ZMNA 1W0JD 5AVDA 4B73A 3SYJA 1ZZZA 3SV2H 4YLUA 1C4Y2 1LMWB 1HYLA 4VGCB 4Y10E 2WPKS 3D62A 1XKAC 1VCQA 2PTNA 3TK6A 1THRH 3TJNA 3OAAD 1E34B 2K8IA 1HNEE 1IQIA 4CBOA 1P9SA 2HPPH 1AY6H 3RXLA 4GCHF 1PPBH 4NFFA 3VGCB 2OC0A 4CBNA 3K65B 4DJZB 5JB9S 3S9CA 2HPQH 2ZDKA 2OQ5A 3M3VA 4NIXA 2FOCA 1BOQA 1O3LA 1A46H 1KXDA 4BTTB 2BD5A 3SNDA 2ODQA 3RXSA 3VEQB 3PMAB 1ZJKA 4Z0KA 1SGRE 5T6FA 4ISOA 1D3QB 3GDVA 3RXMA 3AAUA 1KXAA 3M5MA 1Y3UA 1DANH 1N6XA 4ZHMU 2VVVA 1MUEB 2ULLA 1TRYA 1B5GH 2GV6A 1TGCA 4AN7A 1O3EA 1QJ1B 1Z7KA 2ZTZA 3QUMP 4MG3A 4KTUA 4DT7B 1UW7A 3O8RA 2GZ7A 4ABGA 2P8OB 3K9XB 1O5EH 1PQ7A 2B7DH 1ESTA 4A7IB 1DITH 3LJOA 1Y3WA 2OC8A 6GCHF 1QL9A 1LHEH 2AH4X 2Q6DA 1DUAA 2VU8E 1GBLA 3LONA 1UO6A 3ZV8A 1EX3A 1WV7H 4GHQA 4I86A 3EDXB 3TNSA 3ZYDA 4SGBE 1SGQE 5C5OA 2H9TH 1MD8A 1NRPH 1ETSH 2EEKA 4Y6DA 1C1NA 3F9GA 3RDZA 8ESTE 2JH5D 3EAJA 1C5OH 4MNVA 1KXEA 3NCLA 2FDAA 2ZPSA 2EA3A 2A7JA 2R0KA 1CVWH 2GCHG 4MNXA 1GI5A 3I29A 3VXFH 1MBQA 5K7RA 4D76A 3D65E 1WU1A 2PSXA 1LQDB 1MABB 4DIHH 5T6DA 4KGAA 3AAVA 1XVOA 1DWDH 1FONA 3ZZDA 1GCTC 1TRNA 1SFQB 4CR5A 4H6TA 1SL3A 3RXIA 5E2OA 1FAXA 3P6ZB 1EUFA 3QLPH 1V2LT 2GCTB 1KTTB 1XUKA 6CHAC 4ISHH 2YMSC 3F1SB 1JBUH 2OINA 3KN2A 2J5UA 3KYGA 4GAWA 1T8OA 1QURH 1HAOH 1TB6H 2TBSA 2G81E 2AIQA 4XD7D 4IMZA 1Z71A 4A1TA 1HAHH 3ATIA 3FZDA 3UWIA 5EJLA 2ZQ2A 2FIRH 2WUBA 1E79D 1HAPH 1BBRH 1T32A 1F5RA 5ETXA 3SHAH 2GZ9A 2IPHA 3TGIE 4GCHG 1CGJE 1W8BH 1UK3A 2BXTH 2TGPZ 1YGCH 5I46H 1AU8A 1MQ6A 1HIAA 1SGFG 3BTME 3RMNH 1D6WA 1MCTA 2DE9A 1ANEA 5EIYA 1INCA 1B7XB 1C1QA 1DPOA 2BLWA 1C9PA 4CRFA 3O8BA 4NWLA 3U8RH 4KELA 2EI6A 1C2KA 1K1NA 5A0BA 1UVPA 1AFEH 3RXJA 3P8FA 1O30A 3PWBA 3SU4A 2C8ZB 3SUEA 2VH0A 2IJD1 1HBTH 5GXPA 3GOVB 4Q7XA 4MTBA 3PRDA 2H9HA 3VG8A 4GPGA 3H7OA 3RXEA 3M3SA 3OEED 2RA3A 1JOUB 2STBE 3P8NA 1PPFE 3UFAA 1PPZA 2OP9A 3MU8A 2C4FH 1EAUA 1EJNA 5J4SA 1BUIA 3E0NB 5EQRA 5FBEA 3GY3A 4Y8ZA 2L74A 2ODYB 4IC5A 1BJVA 2F9OA 4I32A 1ZHPA 3CNRA 2ZCKP 4RI0A 1EZSC 3F2GA 3K2UA 1ORFA 3OE7D 5LPRA 2EY4C 1S81A 1XUFA 2A1DB 1A0LA 1GHBF 1KSNA 4NZQA 2PR3A 1EP5A 5SGAE 2CF8H 1GBCA 1V6DA 4HZHA 5DP7A 2SGAA 5EGMA 1MTNB 1OHHD 1Y5AT 2B9LA 2BD9A 1TE0A 3RC4A 2KCPA 5T3HA 3TPIZ 5CMXH 3P17H 1VCPA 3TH2H 2SFAA 2I6SA 4ACBA 2WZQA 5L30H 1C2FA 3SJOA 2PWXA 3EYDA 5EJZA 1MTWA 5A8ZA 2ZHFH 1MKXH 3FOAA 3IWMA 2YOLA 4YTAA 2KZ4A 1TNIA 5GJ4B 1CHGA 1D4PB 1G3DA 1YF4A 1BCUH 4Q2KA 3Q3XA 1MQ5A 2ZU1A 4P00A 3B8JA 2STAE 1QRXA 4CRCA 2ZPRA 1J14A 4FUGA 4WY3A 2BZ6H 5DP9A 2WPHS 1JXPA 1GJCB 2BDAA 5EG4A 3ZZBA 4CHAC 3V3MA 1JWTA 1IOEA 2C90B 4MNWA 2SNVA 4XDEA 1GCTB 1XX9A 2C8YB 5JDUB 4YESB 1K1MA 1XVMA 3QZQA 1GG6C 4AZ2B 1U6QA 2AGEX 2TGAA 3DA9B 3WW7A 2YMSB 1S6FA 3TJUA 5C1UA 3QDZB 5TJXA 3ZVAA 4B2CA 1GJ7B 2QAAA 4AC9A 2XWAA 1QJ6B 3AK5A 1K1PA 1TBZH 3M36A 3KQCA 3UY9A 5C3NA 2H1UA 1AI8H 1AHTH 2IJOB 4ZHLU 4IC6A 1TX6A 3SHCH 1ELFA 3E3TA 3A85A 2ZHQH 3MH4A 9LPRA 3TK5A 1TNLA 2VH6A 2SGFE 3HKIB 2V3HH 2QY0B 4I31A 1GJBB 1HAVB 2ZFSA 4MVNA 1PQAA 1TGBA 3LH3A 4TPYA 1KTSB 1SLWB 2RA0A 3A8DA 4JK5A 2G51A 2ZPQA 3MNSA 2QF0A 4X2XA 1GBHA 1NFWA 2D8WA 3VB3A 2OD3B 1GI6A 4THNH 6LPRA 3G01A 4I8JA 5LGOA 3STJA 1P10A 3KL6A 4X1NU 1W0YH 2OQUA 3SV9A 4MPXA 3PO1C 1BBRE 3M5OA 3S7HB 1V2QT 4X1RU 5HM9A 5A0CA 3ZZ3A 1GI8B 3MU0A 3QX5H 4NIVA 1Z8RA 3BV9B 2ZHWH 5EQSA 4AGKA 1C2GA 3ATKA 1HAZB 4D8NA 2ZO3H 3SGAE 1GHBG 2VB0A 1B0EA 5CE1A 2VVCA 4B6EA 5AF9H 1TBRH 1GDQA 2A4QA 3NXPA 5C0UA 4PROA 2AMDA 3D49H 2GJGA 4X1PU 2KFWA 1AIXH 3BTGE 1AB9C 4K60A 4E7RG 5JBCS 5B6OA 5DK1A 2FS9A 2UWPA 3PMJA 3GCHB 1QL7A 3VXEH 1QTFA 1C5VA 1GI9B 4X0WU 1EKBB 1YPEH 3GISB 2P16A 2Q6FA 2ZQ1A 3A88A 2JJ1D 1RS0A 3BTFE 2HNTC 2I6QA 1UCYK 1HRTH 5E2PA 3A7WA 3DHKH 4IN2A 2XC0A 1O36A 1O2MA 1G3EA 1GI1A 4RKOB 4GLYA 1QR3E 1ZHRA 1NPMA 2IN2A 1LTOA 2TGDA 1BB0B 1O3IA 2FS8A 2XCFA 1Z1IA 5KGOA 2AMQA 2QA9E 1TX8A 4BXWA 1GMCG 1IAUA 4YXWD 4MPUA 1MAYA 2P93A 1J15A 1NO9H 3MU1A 4Y76A 2XC5A 3LGVA 1SQAA 2BX3A 4E06H 1W12U 4INHA 4B71A 1GPZA 2GD4B 3O8CA 2TGTA 2ZGHA 4LK4A 5DJ7A 1UTNA 4FUEA 5I25A 3T2NA 3RXPA 1GJ6A 2AYWA 3S9AA 1E37B 1TWXB 1ZR0A 2K0QA 3STIA 3BG4C 4OS7A 5FL7D 1O5FH 2XNDD 2QIQA 4Z6AH 3SU1A 2PKAB 1MCVA 2BTCE 5HYOA 4CHAB 2YNAA 3SUFA 3GS9A 4JK6A 2M5TA 3FFGA 5C0TA 1GJ8B 1SGYE 4MNYA 2W6ID 4Y71A 3RXVA 1K22H 4IS5A 3F2HA 1GG6B 2FTLE 2ZTXA 1DS2E 4I7YH 4NA9H 5ESTE 1O2SA 2HGTH 3A8AA 2BY7X 3FP7E 4RSPA 2XW9A 1TNJA 1EP6A 3FVFB 3GYLB 2W3KA 3MHWU 3EE7A 2GMTC 1V2JT 1AQ7A 2TPIZ 1O3HA 3LGIA 1ZGIA 2A0QB 3VGCC 2BD8A 1SQTA 4YOIA 1Q2WA 1ANCA 3S9BA 3W95A 2WV5A 3ZZAA 1C5XB 2BVRH 2XBYA 2FZZA 1GBMA 1OKXA 2FODA 2WPDD 3EE0B 1C5PA 1NROH 1THSH 1MBMA 2JJ2D 2FLBH 3N99A 2KR7A 5IDKA 3D23A 4XE4A 3TIUA 3PO1B 1AKSA 1CT4E 1OXGA 3K6YA 1QB1A 3C27B 1KXFA 2J98B 2OBOA 4F48B 2QF5A 2ZECA 1GHWH 4LZ4B 1VKYA 2BX4A 3ZVFA 5F6MA 1LPKB 1N1LA 2P8OC 4WWYA 1HJ8A 1V2UT 2FPZA 2A2XH 1N8OB 1DT2A 3I78A 3LC3A 3RXCA 1V2MT 1NBMD 3W94A 1ELAA 1AB9B 1EAXA 1SGDE 3A80A 4FU8A 3SU2A 2ZU2A 1GBKA 1BMNH 1NZQH 1GHZA 4NG9H 4NSYA 1DX5M 2ZDAH 2A4RA 1FY3A 1TA6A 1ESBA 2A4OA 3FP8E 2O8UA 3RC5A 1C1VH 4HFPB 3R0FA 7GCHG 1HDTH 1EPTA 1EXFA 1XM1A 1L1GA 2PTCE 2G4UA 4UFGH 2BDIA 3ZZCA 4D9RA 1NTPA 5HKKD 1P2MA 1HJ9A 1W11U 3PV5A 1CBWC 3TH4H 4BAKB 2BXUH 1CE5A 3PRBA 1C5WB 4FVDA 1AGJA 1IQKA 2VJ1A 1IQJA 4FUIA 1KXBA 2ILNA 2ZIQH 1G9IE 1GHVH 2WHXA 4XBCA 2BY6X 3WY8A 4GUXA 2Y5GA 3A82A 3DSOA 1OP0A 3BTEE 1QRWA 2A5KA 3GY4A 2G00A 4RN6A 4K8YA 5A09A 1JRTA 1O5AB 1DDJA 2KAIA 1FI8A 3BG4B 1SB1H 1EJMA 2M2AA 1NN6A 5EOKA 3BEIB 1MKXK 2OXSA 1CA0C 2FTMA 3CS7A 3RUOA 1TNKA 3BN9A 1QL8A 4LOYH 1J9CH 5LPFA 5JB8S 4A6LA 3S7KB 1MZDA 1H9LB 1O2VA 3A89A 1QFKH 2QC2A 4NA7A 1EJAA 3NKKA 1SHHB 5BPEA 1BTYA 1SFIA 2BDBA 4A5TS 1W13U 4AFQA 1ZMJA 3UIRA 2LPRA 1ZSKA 2Y81A 3UQOA 1AN1E 5FPYA 2OCVB 3DCLA 4E05H 1VCWA 1OOKB 1BRAA 2VGCC 2F9NA 1NBME 1EFRD 1C2JA 1BTUA 2GMTB 1V2RT 2H9EH 2BB4A 1N6YA 4NGAH 1DXWA 2OBQA 1A1RA 5FHTA 4IMQA 3L6PA 5DGJA 1BMFD 3L33A 1GL0E 1EASA 3SQEE 2A5IA 1S82A 2PUQH 1SI5H 3H7TA 1BTZA 1O2JA 4KKDA 1E1QD 1O5GH 4WH6A 4AX9H 2JDID 5CHAC 2W7UA 3TJVA 1OX1A 2ZNKH 1L4DA 5JYIA 3F0OA 1H4WA 1ZMLA 1P9UA 4MPVA 1FIWA 4U01A 1W2KH 1QHRB 2IPQX 1W7GH 3BG8A 1GI3A 3UB0A 3OYPA 1ZLRA 2GGVB 5K0HA 1RD3B 4YM9A 3TGJE 4YLQH 1KDQA 1TALA 1V2OT 2CHAC 3F68H 1QA7A 1GHXH 4ABIA 4NIWA 3U28C 1TMTH 2F9PA 1NRQH 3HGNA 1DLEA 1MTNC 1O37A 3BEFB 5EXNA 2YMSD 2XC4A 2C3SA 2NU1E 3MNCA 1C1PA 5CDFE 7KMEH 1O33A 3F9HA 1EB1H 4NA8A 4A1VA 1ACBE 4HI3A 4MLFB 1O0DH 1TOMH 1TRMA 2FI4E 2UUYA 4WVPE 8LPRA 2CJIA 1GBFA 1GGDB 1UTQA 1W0ZU 4FVBA 3RXBA 2ZF0H 2BM2A 1DY8A 4DGJA 2BD2A 2PKSC 4TPIZ 2ZU4A 1CBWB 2J97A 3LJJA 4WF8A 2BOHB 1L4ZA 2AFQB 2BDYA 1LPZB 3P92A 3RLYH 1O35A 4JYUH 3MO3A 1TOCB 1YWUA 1UVUH 2JH0D 1UVTH 1QGFA 2UUKB 1P2QA 2J4IA 2O8LA 2AERH 5EW2H 2QGRA 2TIOA 1NT1A 1J17T 3U1IB 5GPIB 1Z8JB 1C1OA 2FOBA 5GDSH 3DFJA 3ENSB 1EOLA 2W6JD 1P09A 1TYNA 3U69H 3V0XA 1S83A 1KLTA 3WWBA 4OGXA 1KMHB 3MMGA 1PYTC 3CP7A 3SV6A 1FY1A 1CA0B 1TNGA 1V2TT 1HPGA 2A31A 2XBXA 1SC8U 2CK3D 3RXGA 4GVUA 1O2XA 3K6ZA 2LNCA 1FN6A 3F0PA 1C2IA 1O2PA 2XXLA 2R3YA 1E38B 1D9IA 1V2PT 3M7QA 3SO3A 1TAWA 1C2LA 2GT8A 1EZQA 1GVKB 1D3DB 2VIQA 3CENA 2UWLA 1O3NA 4GHTA 1FX0B 1LVOA 1Z1JA 1O2HA 1Z8GA 1IQHA 1HAYB 2EI7A 1GBDA 2ZDLA 1GBTA 1O3BA 4D7FA 2RCEA 1Z6JH 2C8XB 1ELDE 3ODDA 2VGCB 3UNSA 6ESTA 1OPHB 1K28D 4MQAA 2C8WB 1F5KU 1L0ZA 2THFB 1C2MA 3M5LA 1GHAG 1GI0A 1O3PB 1UTLM 5C94A 2Y80A 3BTHE 2QE7D 4X2VA 2GTBA 1CQQA 1WYKA 1FY8E 4DIIH 5CHAB 1ELCA 1RTFB 5EPYA 1WSSH 5GIBA 3Q3KA 1O32A 2GT7A 1MU6B 3H5CB 1SGNE 1O2YA 1YY3A 3RMMH 4ABBA 1ELGA 2VWMA 4INKA 1G2MA 3U1JB 1LO6A 4WXVA 1O2TA 4ZUHA 4Q63A 3UR6A 4X8TH 1P06A 1TIOA 1ELTA 3GCHC 5F8XA 1Y5BT 1P2KA 1O2WA 1NU7B 1MD7A 3LGYA 3H09A 1YLNA 2CHAB 1NM6A 1UK2A 4UDWH 2BOKA 1C2DA 3A7VA 3M37A 2RDLA 3CS0A 4ZHAA 2KCOA 3F3BA 3RC6A 2PUXB 1OWJA 3OEHD 4Y79A 2J95A 2LELA 1YPKH 1ZTLA 1EOJA 5C2ZA 1O2OA 3F2FA 2G52A 1HXEH 2W3IA 4YT7H 1TPAE 3SUDA 1WUNH 4BNRA 3GY2A 1MMJN 3A87A 5GCHF 4BAQB 4CRAA 4OS5A 2BY9X 2RDEA 5B6LA 1FQ3A 1BTPA 4FUFA 2BLOA 1C1MA 1AVXA 1IQEA 1C4U2 1MAXA 1SMFE 2PKSB 2Z9JA 1OP8A 3GY7A 3QGNB 4JZ1A 2ODPA 4ABEA 2XNIA 4Y0YE 2OLGA 2BDCA 1P11E 1DWEH 3ESTA 1GMCF 2JIZD 3RXKA 1F0UA 4BAHB 1Y59T 4FUDA 1UTPA 1BDAA 3NUMA 1SG8B 4ISLA 1TNHA 2FI3E 3E90B 3FAOA 4J1YA 2BY8X 2FOAA 1LQEA 4UD9H 1W0KD 4DW2U 1ARCA 1GMDF 3FP6E 5AHGH 1YKTA 3FANA 4A92A 1DLKB 2JETC 2EC9H 1SBWA 4Q4LA 1C2HA 1G3CA 1YPGH 4DY7B 3UQVA 1ESAA 2ESTE 2FYRA 2TRMA 3AW1A 4DG4A 1PQ8A 3ZZ4A 1RXPA 4TT3D 2PP6A 3A7ZA 1K21H 1DUEA 5A0AE 1Y3YA 4X6MA 3AVZA 2VNTA 3SJIA 1G36A 2ZFTA 1SGEE 3PYHA 2D26C 2ZHEH 4I8LA 4TY6A 4MPWA 1BHXF 1VR1H 1EATA 5IYTA 2P3UB 3QTOH 3E1XB 1NU9A 5HGGA 1W10U 1FAKH 2QF3A 4B2AA 1BTWA 2WSSD 1SR5C 3NK8A 2GV7A 2HALA 4Y7BA 2J9NA 2ZGBH 2XCNA 4XBDA 1ELVA 4O97A 4FOUC 1C1RA 2ZCLP 1E36B 1FLEE 2OC1A 3EA8A 2QXGA 3ZVBA 4MDSA 2ZEBA 3N7EA 2XRCA 3KF2A 5TCAA 2W7SA 1NC6A 2Z9KA 1C5RA 3FN8A 1A3BH 1N8OC 2KM0A 4INLA 3LKWA 3M5NA 1O2QA 4R0IA 1X7AC 2Z94A 3SZNA 1XUJA 8GCHG 3Q3YA 3KIDU 3RM2H 1YLCA 5T1VA 3GY8A 3MOCA 1GDNA 2R2WU 3T28A 1O3AA 3W1EA 5A8YA 3TVJB 1ELBA 1HAVA 1H8IH 4BTIB 5GCHG 2VIDA 4E7NA 1QB9A 1AMHA 1M9UA 1TMUH 1NRRH 4JYTA 3F6UH 2PW8H 3F9FA 3A83A 1UTMA 2SGEE 4K1TA 4K5ZA 1D3PB 3VB7A 1ETTH 1HGTH 2O8WA 5G4BA 1HAIH 3RP2A 1FXYA 1OWKA 4OGYA 1XXDA 2FOHA 4K1EA 1C5LH 4JCNA 2Z9GA 1C5UA 1UTKA 3C1KA 1L1JA 1H8ED 1K0HA 3A8BA 3LGTA 1QIXB 3ZVGA 2NU4E 7GCHF 2Q6GA 2WPIS 2ZDVH 1IQNA 1TBQH 2Z3EA 2NWNA 1PPCE 2Y82A 1G32B 4BXSA 1GMDG 3LIWA 1EZUC 4HG6A 1T31A 2GX4A 1P2OA 3ZZ7A 2VWNA 4CR9A 3WWFA 2BY5X 2HNTE 2PHBA 4AYVB 2YNBA 2BVSH 3HK3B 1GCDA 1YLDA 3DUXH 5A8XA 4ZKOU 3BSQA 1RFNA 3PV4A 1ZJDA 2ZI2H 1LKBA 1SKYE 1JIMA 1P2IA 1V2KT 4XBBA 2BYAX 4X6PA 5F8ZA 1VITH 1PPHE 1Q31A 1A7SA 5JBBS 3LGUA 5IK2D 2CV3A 2BDGA 2V0BA 2V7QD 1J8AA 2JETB 1QQ4A 3RXAA 3RXUA 2BD3A 4ZXXH 1Y5UT 4ZH8A 3MO6A 1P04A 5L2YH 1GDUA 2L6OA 3SJKA 4ABHA 4HTCH 1TGTA 1ZPBA 1E0FD 1GBIA 1F2SE 3P70B 1A5IA 1QA0A 2A5AA 1O3DA 2P59A 3Q77A 5DN6D 2J92A 4YOJA 5DP5A 1SHYA 2ZKSA 3VFEA 2BHGA 1CA8B 2OC7A 4BTUB 5EQQA 1YP9A 2QF4A 3ZIAD 1O5DH 1DICA 2ZFFH 3DFLA 2ZA5A 1E35B 1LHDH 4K3JA 1Y8TA 1O39A 3VB4A 2ALPA 2B0FA 5DP8A 3MYWA 3SZEA 2ZHDA 3SV7A 1BBRK 3SJ9A 2O9QA 2Z9IA 3MI4A 1LHFH 2GDEH 1WBGB 4ABDA 1A61H 1BMMH 3A81A 4JZDH 1THPB 1F7ZA 1WXRA 2SNWA 1BA8B 3AASA 3SGQE 1XMNB 5HIYA 4ASHA 3BTWE 1C9TA 1OWHA 1GHYH 5C20A 1NY22 1DWBH 2Y5FA 1ETRH 1GJDB 2FX4A 3N7OA 1O3KA 5KECA 2XOKD 1LVBA 4WXIA 2J2UA 4JZEH 2ZGXH 5EXMA 1G30B 3EA7A 1G37A 3ZZ5A 3LU9B 4WH8A 2R9PA 3GCNA 4AOQA 1S84A 4O9VA 1QQUA 1YC0A 4IW4E 1ID5H 1GGDC 1YCPH 5J4QA 1SLVB 1H1BA 1V2WT 1UVSH 2F3CE 1RJXB 4M7GA 4B6FA 1XXFA 1UHBB 1OWIA 1J16A 5EW1H 4X8UH 1EQ9A 2BQWB 1XUHA 2WPLS 9ESTA 1HCGA 5FX5A 4UFDH 1YCPM 2ANWA 2AEIH 2VIWA 1GWAA 1CGHA 1SPJA 1AUTC 4I8GA 4YO9A 1EAWA 3RXFA 2QXHA 1QCPA 2J98A 2QXJA 4RT0A 2V3OH 3V7TA 3LT3A 3BIUH 4AFZA 5ABWA 3MQKC 3PV2A 2FOMB 3SOSA 2GKVE 8KME2 2ZU5A 1FZZA 3KGPA 1ZSLA 4UONA 1SQOA 2BDHA 1T4UH 3FZZA 5FBIA 1FDPA 2BZAA 3KQEA 5L2ZH 1S5SA 3GCOA 1O2KA 4X6NA 4H42U 1FJSA 5FPSA 3UNRA 2OK5A 1FPCH 3B9FH 4FU9A 1KLIH 3RXOA 1ZHMA 3R3GB 1BZXE 3M35A 3OY6U 3U8TH 1SGTA 3ITIA 3UREA 1V3XA 3PLKA 2ANYA 1S85A 3E6PH 2FMJA 1LVMA 3LC5A 2UUFB 1A3EH 1QBNA 1AE8H 2Y7XA 2CF9H 3RXDA 3QTVH 2G5NA 4YOGA 1TMBH 1UK4A 1HB0B 2G55A 3ODFA 1FN8A 1ZOMA 5L6NH 1HUTH 1BITA 5E0JA 4DOQA 2VIPA 1AFQC 1KDQB 4X8SH 1GMHG 4UEHH 3PTBA 4X2WA 4ABFA 2AHME 1P03A 3RU4D 4AB8A 3MU5A 3DSGA 1UTOA 1T8NA 1F0TA 1QJ7B 3Q00A 1MKWH 4CH8B 4LZ1H 2FESH 3SNAA 4AB9A 1K1JA 4TWWA 1UTJA 3P8GA 1K1LA 3T25A 5GWZA 1QB6A 1SGIB 3LGWA 5C1XA 1TONA 2Z3DA 1GHAF 1UJ1A 1TPOA 2W26A 1NRNH 1MTVA 4I33A 1GI2A 1H8DH 1A2CH 1UCYH 1AE5A 2G8TA 1HFDA 2WPMS 3KEEA 5AFZH 3UPEA 2ZTYA 1OP2A 5C5NA 2SGQE 4TY7A 2FOEA 2KX4A 2J94A 3MNBA 4QT8C 1DY9A 5C67A 1RTKA 2F9BH 4FU7A 2G4TA 2P94A 1HJAB 3ELAH 1YBWA 1DXPA 1PYTD 1IHSH 4ZROA 1O3CA 3EGKH 3GDSA 2HNTF 3LDXH 1BTXA 3PTNA 3BEUA 3VB6A 1GJ5H 1C2EA 3O8DA 5DP4A 1P3CA 2FLRH 2QN5T 4B2BA 1YYY1 3PLPA 1NFYA 3T29A 1UVOA 2ALVA 1PPGE 3PM3A 4AG1A 1ANDA 1EAIA 3DSPA 4ZMAH 1O34A 1BMAA 3RU4T 4CRBA 5KEDA 3QGJA 3OX7U 2XYAA 1DVAH 4O3TA 5EODA 4K69A 1TPSA 3TITA 4B76A 2DE8A 2HOBA 3TNTA 1HIAB 4FUJA 2G5VA 4RT1A 2ANKH 3SU5A 4DVAU 4O3UA 3TU7H 1MTUA 2VIVA 3VPKA 1F5LA 3E8LA 1O3JA 3QK1A 3RXQA 3SI4H 2J38A 4JMYA 1P01A 3RU4E 3OFND 1IQMA 1BQYA 4AFUA 3ZZ8A 1NESE 4K8BA 3UR9A 4XFQA 2FP7B 3UAIC 1PJPA 1W14U 1FUJA 2B8OH 1T4VH 1H8HD 2P95A 4FUCA 1ZRBA 4OS4A 2F9UA 1FPHH 3UUZA 5CHBA 2P3FH 2QV1A 4AYYB 2FI5E 2AIPA 1COWD 2CGAA 3MU4A 4CRGA 2KCYA 2FYQA 2KCAA 5DP3A 4K2YA 4NIYA 4WMFA 3SQHE 1E1RD 1TABE 4TYDA 4NWKA 1RIWC 4JYVH 1FNIA 1GBEA 1GJ9B 1AWFH 2FWWA 2ZFPH 1T8MA 3ZVCA 4D7GA 1S0RA 1ZGVA 5F8TA 5HXFA 4I8HA 1ZTJA 4KTSA 5DSFA 4UE7H 1AFQB 2A4GA 3UWJH 2W5EA 2WV4A 4BAMB 4D9QA 1A4WH 1K1IA 2Y5HA 1ZYOA 2QCYA 3QZRA 2A7CA 1FV9A 2ANMH 5C1YA 1BHXB 3GICB 1P12E 1V2NT 1P2JA 3A7YA 2A2QH 2NU2E 1O2RA 3OSYA 1GBAA 1O3MA 2IOTA 4U2WA 4ASUD 4F49A 1AWHB 3HK6B 1SGPE 2AGIX 2GZ8A 2WPJS 1P8VC 4ZKSU 3GY5A 2H6MA 5JBTA 3QN7A 1DSTA 1RGQA 1QBVH 2K1QA 2CN0H 1VGCC 1IQFA 1K1OA 1Y3VA 1TQ7B 1KY9A 5LH8A 1CT0E 6GCHG 3PMHB 2XBWA 1C1UH 3AW0A 4NFEA 2ZP0H 1BTHH 2V35A 3GDUA 1SLUB 2FOGA 1QRZA 1DSUA 2LP6A 3OTJE 2BMGB 1OSSA 4XSKU 4H6SB 4DCDA 1GL1A 3TGKE 8GCHF 1T8LA 3SU6A 5DP6A 2EI8A 2FOFA 2ASUB 4Y8YA 1WTHD 1WQSA 3SORA 3A7TA 1UCYE 1WQVH 5LPEA 1OWEA 3HKJB 5E8EH 3KCGH 1C5ZB 3UTUH 1RTLA 1FY5A 5FX6A 2QXIA 1A5HA 1BMLA 5PTPA 3QO6A 1DFPA 3M7TA 4JZIA 4U30A 1JRSA 3OTPA 3PLBA 2R3UA 3SNEA 1NFXA 4BAOB 1Z6EA 2A7HA 3MWIU 3ZVDA 2PV9B 1QBOA 2BLQA 3ZZ6A 1O5CB 2XWBI 3LH1A 2ZU3A 3BTTE 3UOUA 1AVGH 1GBJA 1MZAA 1YCPK 1AD8H 2V6NA 1LDTT 2FEQH 1SOZA 1DOJA 2ZG0H 1VITF 3NPSA 3PROA 5EPNA 4ISIH 3MTYA 5EU8A 2WV9A 4TSFD 1YPHC 3KQBA 4IN1A 3MH7A 3SUGA 3BF6H 1P05A 4Q7ZA 4OM9A 3UNQA 3F9EA 4NCYA 1S6LA 2BD7A 2ZGCA 4K1SA 1EB2A 4NZLA 3E0PB 4R8TB 3RM0H 1C5MD 1G3BA 1AZZA 1HV7A 2D2DA 3VB5A 4Y7AA 1O3FA 6CHAB 1KIGH 1LPGB 3M61U 1PQ5A 1K9OE 2A32A 1GVLA 1ELEE 3MFJA 4ESTE 1V2VT 3I77A 4JZFH 2XBVA 1O2UA 2ZDNA 1HAGE 2JKHA 1O3OA 1K2I1 1RIWB 4A1XA 1F0SA 1BRCE 3SBKA 3B23B 4FETA 4IGDA 3S69A 4WJG2 1MH0A 1A5GH 3U9AH 2O8MA 3KYFA 3P95A 1QY6A 4X8VH 3ATMA 4ZCNA 4F55A 2A45B 2F4LA 5AFYH 1NFUA 2H5DA 4B75A 3KHVA 1WCZA 1EPTC 4B1TA 1YPHE 1ABJH 1C5TA 2J34A 4BOHA 1CU1A 3EQ0H 3ZV9A 1VZQH 2FX6A 1LHCH 1JMOH 1CHOF 1Z8IB 2RFKC 4X1SU 1HAXB 3KNXA 1C4V2 3LPRA 4ZKRU 1OYTH 3SNCA 1TGSZ 1O2IA 1IQGA 1KXCA 2F83A 2VWLA 4X6OA 3T27A 2BQ6B 1ZSJA 2WINI 4OS1A 4RKJB 5E0HA 3U8OH 1VGCB 1H9IE 1P57B 1TA2A 5F03A 1UMAH 4TWYA 1OYQA 3BTKE 3TH3H 1GBBA 4SGAE 4HGCA 1PPEE 1GJ4H 1MKWK 1WTGH 2Z7FE 2AGGX 4U32A 3RXRA 4F4OC 2HVYB 1SVPA 3A7XA 3A8CA 3U98H 2BVXH 2PLXA 3NRLA 5ESBA 2CXVA 5F53A 2HRVA 5H4IB 2AS9A 1HLTH 3PMBB 5FAHA 2C93B 3LOXA 4OS2A 4UFEH 3TJOA 1P02A 1SQRA 3OU0A 4LXBH 1L2EA 2FXRA 5DPAA 1P2NA 3URDA 1ZRKA 2HLDD 2NU0E 4FUHA 1BT7A 5FXLA 1LVYA 1OWDA 1ZTKA 1O2GH 1D3TB 1AO5A 1ABIH 3SU3A 3ATWA 3TK9A 1VITG 1LCYA 4AGJA 1QNJA 2R0LA 1KYNA 2AMPA 2XTTB 5JBAS 3S0NA 1AZ8A 3RXTA 2OUAA 2VIOA 1CGIE 3FO8D 1ZPCA 3T26A 3UOPA 1TLDA 2UUJB 3N7DA 3GCTF 3KQ5A 4FUBA 4GSOA 1S0QA 4ISNA 5JPMH 2OTVA 3M3TA 1VJAU 2RG3A 3SW2B 1BRBE 4DURA 1YPLH 5EJ1A 4X2YA 1Y3XA 1QZ8A 2V3MA 1BIOA 4UFFH 3E16B 4H4FA 4Q80A 3V12A 1V2ST 4ZKNU 3DD2H 4CREA 1DM4B 3MH5A 1AKSB 3ZYEA 1HXFH 1LHGH 1SGCA 4XRNA 2Y7ZA 1C5NH 1TQ0B 3RXHA 5C17A 7LPRA 2Z9LA 4M9FA 2PFEA 4ACAA 1GI4A 4Y0ZE 1FIZA 2ZFRH 3PWCA 2QYIA 1YPJH 3SN8A 2VVUA 2O8TA 2P3TB 2SGPE 1S6HA 3RMLH 3RLWH 1RRKA 2SGDE 2UWOA 2VWOA 3SV8A 1XKBC 2JH6D 1A0JA 1NS3A 5EXLA 1SOTA 1CHOG 3ZZ9A 5HM2A 3V13A 2H5CA 4VGCC 2H2ZA 4BANB 3JZ1B 5HIZA 2D1JA 1AVWA 1WAYB 3L3TA 3TLOA 5HMAA 3BTQE 3FKSD 1AUJA 1ARBA 2PKAA 3BIVH 5DKMA 2F43B 2CMYA 3A84A 2HVXA 4AG2A 4Z1MD 5DG6A 2BQ7B 1PFXC 1GMHF 2VINA 1EPTB 1W3CA 1A0HB 1CSOE 1JIRA 2R2MB 2PGQB 3SU0A 5DO4H 3QWCH 1WOFA 4B74A 2WYJA 3ATLA 4KTCA 1OS8A 2ZZUH 2ZFQH 4KP0A 1O2ZA 1F92A 4P02A 4NSVA 4YZUA 2FO9A 2VBCA 1W7XH 4AORA 1YPMH 3SNBA 2Q1JA 4X1QU 1HJAC 2GVFA 1O2LA 3KQDA 4ZAEA 2BLVA 1GVZA 2ZC9H 3Q76A 2F9VA 2ZGJA 4ABJA 2KAIB 2HLCA 1C5SA 1XUIA 3T5FH
chains in the Genus database with same CATH topology
1FMGA 2FM2A 3T62A 2PSYA 1GJAB 3NZIA 2Z3CA 5FCKA 2HWLB 3NWUA 1MU8B 3P8OA 4Y11E 1P0SH 2F91A 1MTSA 1YM0A 1P3EA 2BD4A 4WMDA 3BTDE 3OY5U 5FCRA 3HPTB 1C1WH 3RMOH 1L1NA 3GY6A 1IHTH 2ZCHP 3JZ2B 4I8KA 1C1SA 3GCTG 1EZXC 3HATH 1D6RA 1T7CA 5FPTA 7ESTE 1BRUP 1GI7B 1SSXA 3SJ8A 1BJUA 1DWCH 3GYMA 1SLXB 1O38A 1SGFA 3MH6A 2ZDMA 2B5TB 3MNXA 1ZPZA 3EA9A 4ABAA 1LKAA 1DE7H 2Y6TA 1CT2E 3URCA 1NRSH 1C5QA 2NU3E 4J2YB 4CRDA 1B0FA 4YT6H 2WYGA 1O31A 5A2MH 2GCTC 5T6GA 2GP9B 3HGPA 2GCHF 3SGBE 4AFSA 1C1TA 5E0GA 5TCCA 3ZVEA 4WMEA 1IQLA 4FXGH 5BRRE 4Y8XA 2Z6BD 1KLJH 3DT0H 3E91A 3M7UA 3SI3H 2GDDA 4XOJA 1G2LA 1UHBA 1C5YB 1O2NA 1TX7A 3MO9A 1XUGA 4ZXYH 3IITA 1TGNA 1CO7E 2ZWLH 4O03A 1VJ9U 1ANBA 2DUCA 4IBLH 1FY4A 3A86A 4OS6A 1O3GA 1O5BB 2WUCA 1Q3XA 1TFXA 4CH2B 1TPPA 1H9HE 3PB1E 1F0RA 3IG6B 2PGBB 4Q7YA 1ZMNA 5AVDA 4B73A 1ZZZA 3SV2H 4YLUA 1C4Y2 1LMWB 1HYLA 4VGCB 4Y10E 2WPKS 3D62A 1XKAC 1VCQA 2PTNA 3TK6A 1THRH 3TJNA 1E34B 1HNEE 1IQIA 4CBOA 1P9SA 2HPPH 1AY6H 3RXLA 4GCHF 1PPBH 4NFFA 3VGCB 2OC0A 4CBNA 3K65B 4DJZB 5JB9S 3S9CA 2HPQH 2ZDKA 2OQ5A 3M3VA 4NIXA 2FOCA 1BOQA 1O3LA 1A46H 1KXDA 4BTTB 2BD5A 3SNDA 2ODQA 3RXSA 3VEQB 3PMAB 1ZJKA 4Z0KA 1SGRE 5T6FA 4ISOA 1D3QB 3GDVA 3RXMA 3AAUA 1KXAA 3M5MA 1Y3UA 1DANH 1N6XA 4ZHMU 2VVVA 1MUEB 2ULLA 1TRYA 1B5GH 2GV6A 1TGCA 4AN7A 1O3EA 1QJ1B 1Z7KA 2ZTZA 3QUMP 4MG3A 4KTUA 4DT7B 3O8RA 2GZ7A 4ABGA 2P8OB 3K9XB 1O5EH 1PQ7A 2B7DH 1ESTA 4A7IB 1DITH 3LJOA 1Y3WA 2OC8A 6GCHF 1QL9A 1LHEH 2AH4X 2Q6DA 1DUAA 2VU8E 1GBLA 3LONA 1UO6A 3ZV8A 1EX3A 1WV7H 4GHQA 3EDXB 3TNSA 3ZYDA 4SGBE 1SGQE 5C5OA 2H9TH 1MD8A 1NRPH 1ETSH 2EEKA 4Y6DA 1C1NA 3F9GA 3RDZA 8ESTE 2JH5D 3EAJA 1C5OH 4MNVA 1KXEA 3NCLA 2FDAA 2ZPSA 2EA3A 2A7JA 2R0KA 1CVWH 2GCHG 4MNXA 1GI5A 3I29A 3VXFH 1MBQA 5K7RA 4D76A 3D65E 1WU1A 2PSXA 1LQDB 4DIHH 5T6DA 4KGAA 3AAVA 1XVOA 1DWDH 1FONA 3ZZDA 1GCTC 1TRNA 1SFQB 4CR5A 4H6TA 1SL3A 3RXIA 5E2OA 1FAXA 3P6ZB 1EUFA 3QLPH 1V2LT 2GCTB 1KTTB 1XUKA 6CHAC 4ISHH 3F1SB 1JBUH 2OINA 3KN2A 4GAWA 1T8OA 1QURH 1HAOH 1TB6H 2TBSA 2G81E 2AIQA 4IMZA 1Z71A 4A1TA 1HAHH 3ATIA 3FZDA 3UWIA 2ZQ2A 2FIRH 2WUBA 1HAPH 1BBRH 1T32A 1F5RA 5ETXA 3SHAH 2GZ9A 2IPHA 3TGIE 4GCHG 1CGJE 1W8BH 1UK3A 2BXTH 2TGPZ 1YGCH 5I46H 1AU8A 1MQ6A 1HIAA 1SGFG 3BTME 3RMNH 1D6WA 1MCTA 2DE9A 1ANEA 1INCA 1B7XB 1C1QA 1DPOA 2BLWA 1C9PA 4CRFA 3O8BA 4NWLA 3U8RH 4KELA 2EI6A 1C2KA 1K1NA 5A0BA 1UVPA 1AFEH 3RXJA 3P8FA 1O30A 3PWBA 3SU4A 2C8ZB 3SUEA 2VH0A 1HBTH 5GXPA 3GOVB 4Q7XA 4MTBA 2H9HA 4GPGA 3H7OA 3RXEA 3M3SA 2RA3A 1JOUB 2STBE 3P8NA 1PPFE 3UFAA 1PPZA 2OP9A 3MU8A 2C4FH 1EAUA 1EJNA 5J4SA 1BUIA 3E0NB 5EQRA 5FBEA 3GY3A 4Y8ZA 2ODYB 4IC5A 1BJVA 2F9OA 4I32A 1ZHPA 2ZCKP 1EZSC 3K2UA 1ORFA 5LPRA 1S81A 1XUFA 2A1DB 1A0LA 1GHBF 1KSNA 4NZQA 2PR3A 1EP5A 5SGAE 2CF8H 1GBCA 1V6DA 4HZHA 5DP7A 2SGAA 5EGMA 1MTNB 1Y5AT 2B9LA 2BD9A 1TE0A 3RC4A 5T3HA 3TPIZ 5CMXH 3P17H 1VCPA 3TH2H 2SFAA 2I6SA 5L30H 1C2FA 3SJOA 2PWXA 3EYDA 5A8ZA 1MTWA 2ZHFH 1MKXH 3IWMA 2YOLA 4YTAA 1TNIA 5GJ4B 1CHGA 1D4PB 1G3DA 1YF4A 1BCUH 4Q2KA 3Q3XA 1MQ5A 2ZU1A 3B8JA 2STAE 1QRXA 4CRCA 2ZPRA 1J14A 4FUGA 4WY3A 2BZ6H 5DP9A 2WPHS 1JXPA 1GJCB 2BDAA 5EG4A 3ZZBA 4CHAC 3V3MA 1JWTA 1IOEA 2C90B 4MNWA 2SNVA 4XDEA 1GCTB 1XX9A 2C8YB 5JDUB 4YESB 1K1MA 1XVMA 3QZQA 1GG6C 4AZ2B 1U6QA 2AGEX 2TGAA 3DA9B 1S6FA 3TJUA 5C1UA 3QDZB 5TJXA 3ZVAA 4B2CA 1GJ7B 2QAAA 2XWAA 1QJ6B 1K1PA 1TBZH 3M36A 3KQCA 3UY9A 5C3NA 2H1UA 1AI8H 1AHTH 2IJOB 4ZHLU 4IC6A 1TX6A 3SHCH 1ELFA 3E3TA 3A85A 2ZHQH 3MH4A 9LPRA 3TK5A 1TNLA 2VH6A 2SGFE 3HKIB 2V3HH 2QY0B 4I31A 1GJBB 1HAVB 2ZFSA 4MVNA 1PQAA 1TGBA 3LH3A 4TPYA 1KTSB 1SLWB 2RA0A 3A8DA 4JK5A 2G51A 2ZPQA 3MNSA 2QF0A 4X2XA 1GBHA 1NFWA 2D8WA 3VB3A 2OD3B 1GI6A 4THNH 6LPRA 3G01A 4I8JA 5LGOA 3STJA 1P10A 3KL6A 4X1NU 1W0YH 2OQUA 3SV9A 4MPXA 3PO1C 1BBRE 3M5OA 3S7HB 1V2QT 4X1RU 5HM9A 5A0CA 3ZZ3A 1GI8B 3MU0A 3QX5H 4NIVA 1Z8RA 3BV9B 2ZHWH 5EQSA 4AGKA 1C2GA 3ATKA 1HAZB 4D8NA 2ZO3H 3SGAE 1GHBG 2VB0A 1B0EA 5CE1A 2VVCA 5AF9H 1TBRH 1GDQA 2A4QA 3NXPA 4PROA 2AMDA 3D49H 4X1PU 1AIXH 3BTGE 1AB9C 4K60A 4E7RG 5JBCS 5B6OA 5DK1A 2FS9A 2UWPA 3PMJA 3GCHB 1QL7A 3VXEH 1QTFA 1C5VA 1GI9B 4X0WU 1EKBB 1YPEH 3GISB 2P16A 2Q6FA 2ZQ1A 3A88A 1RS0A 3BTFE 2HNTC 2I6QA 1UCYK 1HRTH 5E2PA 3A7WA 3DHKH 4IN2A 2XC0A 1O36A 1O2MA 1G3EA 1GI1A 4RKOB 4GLYA 1QR3E 1ZHRA 1NPMA 2IN2A 1LTOA 2TGDA 1BB0B 1O3IA 2FS8A 2XCFA 1Z1IA 2AMQA 2QA9E 1TX8A 4BXWA 1GMCG 1IAUA 4MPUA 1MAYA 2P93A 1J15A 1NO9H 3MU1A 4Y76A 2XC5A 3LGVA 1SQAA 2BX3A 4E06H 1W12U 4INHA 4B71A 1GPZA 2GD4B 3O8CA 2TGTA 2ZGHA 4LK4A 5DJ7A 1UTNA 4FUEA 5I25A 3T2NA 3RXPA 1GJ6A 2AYWA 3S9AA 1E37B 1TWXB 1ZR0A 3STIA 3BG4C 4OS7A 1O5FH 2QIQA 4Z6AH 3SU1A 2PKAB 1MCVA 2BTCE 5HYOA 4CHAB 2YNAA 3SUFA 4JK6A 2M5TA 3FFGA 1GJ8B 1SGYE 4MNYA 4Y71A 3RXVA 1K22H 4IS5A 1GG6B 2FTLE 2ZTXA 1DS2E 4I7YH 4NA9H 5ESTE 1O2SA 2HGTH 3A8AA 2BY7X 3FP7E 4RSPA 2XW9A 1TNJA 1EP6A 3FVFB 3GYLB 2W3KA 3MHWU 2GMTC 1V2JT 1AQ7A 2TPIZ 1O3HA 3LGIA 1ZGIA 2A0QB 3VGCC 2BD8A 1SQTA 4YOIA 1Q2WA 1ANCA 3S9BA 3W95A 2WV5A 3ZZAA 1C5XB 2BVRH 2XBYA 2FZZA 1GBMA 1OKXA 2FODA 3EE0B 1C5PA 1NROH 1THSH 1MBMA 2FLBH 5IDKA 3D23A 4XE4A 3TIUA 3PO1B 1AKSA 1CT4E 1OXGA 3K6YA 1QB1A 3C27B 1KXFA 2OBOA 2ZECA 1GHWH 4LZ4B 2BX4A 3ZVFA 5F6MA 1LPKB 1N1LA 2P8OC 4WWYA 1HJ8A 1V2UT 2FPZA 2A2XH 1N8OB 1DT2A 3I78A 3LC3A 3RXCA 1V2MT 3W94A 1ELAA 1AB9B 1EAXA 1SGDE 3A80A 4FU8A 3SU2A 2ZU2A 1GBKA 1BMNH 1NZQH 1GHZA 4NG9H 4NSYA 1DX5M 2ZDAH 2A4RA 1FY3A 1TA6A 1ESBA 2A4OA 3FP8E 2O8UA 3RC5A 1C1VH 4HFPB 3R0FA 7GCHG 1HDTH 1EPTA 1EXFA 1XM1A 1L1GA 2PTCE 2G4UA 4UFGH 2BDIA 3ZZCA 4D9RA 1NTPA 1P2MA 1HJ9A 1W11U 1CBWC 3TH4H 4BAKB 2BXUH 1CE5A 1C5WB 4FVDA 1AGJA 1IQKA 2VJ1A 1IQJA 4FUIA 1KXBA 2ILNA 2ZIQH 1G9IE 1GHVH 4XBCA 3WY8A 2BY6X 4GUXA 2Y5GA 3A82A 1OP0A 3BTEE 1QRWA 2A5KA 3GY4A 2G00A 4RN6A 4K8YA 5A09A 1JRTA 1O5AB 1DDJA 2KAIA 1FI8A 3BG4B 1SB1H 1EJMA 5EOKA 1NN6A 3BEIB 1MKXK 2OXSA 1CA0C 2FTMA 3CS7A 3RUOA 1TNKA 3BN9A 1QL8A 4LOYH 1J9CH 5LPFA 5JB8S 4A6LA 3S7KB 1MZDA 1H9LB 1O2VA 3A89A 1QFKH 2QC2A 4NA7A 1EJAA 3NKKA 1SHHB 5BPEA 1BTYA 1SFIA 2BDBA 4A5TS 1W13U 4AFQA 1ZMJA 3UIRA 2LPRA 1ZSKA 2Y81A 3UQOA 1AN1E 5FPYA 2OCVB 4E05H 1VCWA 1OOKB 1BRAA 2VGCC 2F9NA 1C2JA 1BTUA 2GMTB 1V2RT 2H9EH 2BB4A 1N6YA 4NGAH 1DXWA 2OBQA 1A1RA 5FHTA 4IMQA 3L6PA 5DGJA 3L33A 3SQEE 1GL0E 1EASA 2A5IA 1S82A 2PUQH 1SI5H 3H7TA 1BTZA 1O2JA 4KKDA 1O5GH 4WH6A 4AX9H 5CHAC 2W7UA 3TJVA 1OX1A 2ZNKH 1L4DA 5JYIA 1H4WA 1ZMLA 1P9UA 4MPVA 1FIWA 4U01A 1W2KH 1QHRB 1W7GH 3BG8A 1GI3A 3OYPA 1ZLRA 2GGVB 5K0HA 1RD3B 4YM9A 3TGJE 4YLQH 1KDQA 1TALA 1V2OT 2CHAC 3F68H 1QA7A 1GHXH 4ABIA 4NIWA 1TMTH 2F9PA 1NRQH 3HGNA 1DLEA 1MTNC 1O37A 3BEFB 5EXNA 2XC4A 2C3SA 2NU1E 3MNCA 1C1PA 7KMEH 1O33A 3F9HA 1EB1H 4NA8A 4A1VA 1ACBE 4HI3A 4MLFB 1O0DH 1TOMH 1TRMA 2FI4E 2UUYA 4WVPE 8LPRA 2CJIA 1GBFA 1GGDB 1UTQA 1W0ZU 4FVBA 3RXBA 2ZF0H 2BM2A 1DY8A 4DGJA 2BD2A 2PKSC 4TPIZ 2ZU4A 1CBWB 4WF8A 3LJJA 2BOHB 1L4ZA 2AFQB 2BDYA 1LPZB 3P92A 3RLYH 1O35A 4JYUH 3MO3A 1TOCB 1UVUH 2JH0D 1UVTH 1QGFA 2UUKB 1P2QA 2J4IA 2O8LA 2AERH 5EW2H 2QGRA 2TIOA 1NT1A 1J17T 3U1IB 5GPIB 1Z8JB 1C1OA 2FOBA 5GDSH 3DFJA 3ENSB 1EOLA 1P09A 1TYNA 3U69H 3V0XA 1S83A 1KLTA 4OGXA 3MMGA 1PYTC 3CP7A 3SV6A 1FY1A 1CA0B 1TNGA 1V2TT 1HPGA 2A31A 2XBXA 1SC8U 3RXGA 4GVUA 1O2XA 3K6ZA 2LNCA 1FN6A 1C2IA 1O2PA 2XXLA 2R3YA 1E38B 1D9IA 1V2PT 3M7QA 3SO3A 1TAWA 1C2LA 2GT8A 1EZQA 1GVKB 1D3DB 2VIQA 3CENA 2UWLA 1O3NA 4GHTA 1LVOA 1Z1JA 1O2HA 1Z8GA 1IQHA 1HAYB 2EI7A 1GBDA 2ZDLA 1GBTA 1O3BA 4D7FA 2RCEA 1Z6JH 2C8XB 1ELDE 3ODDA 2VGCB 3UNSA 6ESTA 1OPHB 1K28D 4MQAA 2C8WB 1F5KU 1L0ZA 2THFB 1C2MA 3M5LA 1GHAG 1GI0A 1O3PB 1UTLM 2Y80A 3BTHE 4X2VA 2GTBA 1CQQA 1WYKA 1FY8E 4DIIH 5CHAB 1ELCA 1RTFB 5EPYA 1WSSH 5GIBA 3Q3KA 1O32A 2GT7A 1MU6B 3H5CB 1SGNE 1O2YA 4ABBA 3RMMH 1ELGA 2VWMA 4INKA 1G2MA 3U1JB 1LO6A 4WXVA 1O2TA 4ZUHA 3UR6A 4X8TH 1P06A 1TIOA 1ELTA 3GCHC 5F8XA 1Y5BT 1P2KA 1O2WA 1NU7B 1MD7A 3LGYA 2CHAB 1NM6A 1UK2A 4UDWH 2BOKA 1C2DA 3A7VA 3M37A 2RDLA 3CS0A 4ZHAA 3RC6A 2PUXB 1OWJA 4Y79A 2J95A 1YPKH 1ZTLA 1EOJA