1N6YA

Rip-phasing on bovine trypsin
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsinogen, cationic
publication title Specific Radiation-Damage Can Be Used To Solve Macromolecular Crystal Structures
pubmed doi rcsb
molecule tags Hydrolase
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2002-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1n6yA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1n6yA02
1ZHPA 1P05A 5EW1H 2XWBI 5C1XA 3T62A 1SOZA 8LPRA 5CE1A 1EAWA 4Y76A 4F49A 1CHOF 4ZHAA 2HGTH 4U01A 3SNCA 1C1PA 1O3CA 1X7AC 1KLIH 5DKMA 1FXYA 1LTOA 1GHBG 1C5QA 2A5KA 3FFGA 2BD7A 3A80A 2FLRH 3ELAH 3ZZ9A 3CS7A 3BTTE 3F9FA 5DP5A 1DWCH 2FI4E 2ZIQH 4KTCA 1LQEA 2EA3A 3S7HB 3RXEA 1DWDH 2BVXH 4Q80A 2PUXB 2GMTC 5JDUB 1P2OA 3BIUH 4Y0YE 1G36A 1TNHA 2QV1A 3QO6A 4Y7AA 5A0BA 4I32A 3QK1A 5DO4H 4UFEH 2UUYA 2ILNA 3A7TA 3U9AH 1YCPM 1ANBA 3SJ8A 3Q3YA 2HVXA 1K28D 3KF2A 2PSYA 1AKSA 4BOHA 4ABBA 2PW8H 1Y8TA 1PQ7A 3CP7A 1A3BH 2C93B 1EZXC 1UCYE 4UDWH 3UUZA 1MQ6A 6CHAC 1V2PT 4ZH8A 1BQYA 1HLTH 1D4PB 2P3FH 2TIOA 4M7GA 3SJIA 3SW2B 1AFQB 3ZVGA 2OQ5A 2EI6A 3MU4A 1B0EA 1SMFE 1RIWB 4X2WA 1G30B 1SGFA 2ZPRA 3LH3A 2HWLB 4WXVA 1AZZA 2XC5A 5L6NH 1TOCB 5LPEA 2QXGA 2QN5T 5F8ZA 3BEFB 3VGCB 4U32A 3SGBE 3LGVA 1LHEH 3WY8A 5JBTA 1GMCG 1W13U 1GHXH 4NZQA 2TRMA 1OWIA 1SOTA 4ZKSU 3SBKA 1TBZH 5JBAS 1ELCA 1HCGA 3SQHE 4O3UA 3HK3B 5PTPA 2LPRA 1HIAB 2IJOB 2QYIA 2BD3A 4CH2B 1HBTH 2XWAA 1QL8A 1K1OA 5EQSA 1LQDB 3RC4A 2BLVA 2STBE 1TBQH 2VWLA 2ZQ1A 1WU1A 3BN9A 2F9UA 2J2UA 4X6NA 2UUKB 1K1JA 1TX7A 2A2QH 3KEEA 4AFSA 4X8TH 3LGIA 3RXRA 1THPB 4K1TA 5FX5A 1O5AB 2GZ8A 1Y3VA 1IQJA 1O2JA 4X6MA 5AFYH 1Z1JA 1C1QA 2H5CA 4MTBA 2BY6X 3H7TA 4J1YA 2FWWA 4FUIA 1NTPA 2ZGHA 1VITF 2AERH 4GSOA 5HGGA 3M7QA 4X2VA 1DDJA 5T6DA 5C2ZA 4BAKB 1IQNA 2ZF0H 3M61U 1GCTB 1O5DH 1JBUH 1W0YH 3V13A 4ABEA 1BZXE 1P3EA 2ZHDA 1KYNA 1A5GH 5BRRE 5IDKA 4K8BA 1JRSA 2BB4A 5EPNA 1P03A 5HM2A 3OTJE 4NIXA 3UY9A 3C27B 3DD2H 4TPIZ 3A85A 3A88A 1RFNA 3E91A 1LDTT 1D3QB 2XCNA 1AWHB 1KXBA 1DITH 1AGJA 1ELAA 1S5SA 1GJAB 1F2SE 1GDUA 4B75A 3A89A 2ZG0H 1PQAA 1UVTH 1QRXA 3EE0B 1HAYB 5HM9A 4X8SH 5E0HA 3TNTA 4BXWA 3GY8A 1AIXH 2FOBA 2Z3DA 5TJXA 5LPRA 1O31A 1T7CA 2IPHA 3UREA 1UHBA 1CU1A 3SV8A 1JOUB 1O2MA 3VEQB 1MTNC 1BT7A 1QJ1B 5C5NA 1GBAA 4H4FA 3S0NA 8GCHG 3PROA 1GJBB 3LT3A 3TLOA 2BVRH 3ZYEA 4MPUA 1BTXA 2BDCA 1WUNH 2WYJA 1T4UH 3V12A 1TLDA 1CGIE 4IGDA 1EATA 4IMZA 1CBWC 1ZOMA 3ZZ4A 4FVBA 4AFZA 3SU6A 1XUJA 5TCCA 2HPQH 2ZTZA 1O3IA 1DXWA 1WTGH 4A92A 2ZTXA 2FMJA 1CE5A 3RXSA 4E06H 2HLCA 1MTWA 4DIHH 2C4FH 2R3YA 2ZFSA 2JETB 1FNIA 2BY9X 4X1RU 3O8DA 4NG9H 5E2OA 1GCDA 1O2WA 4BNRA 2A1DB 1W11U 1C1WH 4CR9A 1HAVB 1T8OA 4GAWA 4ISIH 3SZNA 3LKWA 2G8TA 3ZZDA 2V3OH 3A84A 2A4RA 4DT7B 1F5RA 2ZQ2A 3EA8A 3PLBA 1TWXB 1SGDE 4UEHH 1S85A 3M3VA 2W3IA 3HPTB 2FS9A 4WWYA 4QT8C 2BX4A 2OXSA 4AOQA 4DOQA 4AFUA 1QR3E 1BOQA 1OPHB 2FYRA 1O3AA 1OYQA 2XBWA 4ASHA 2P59A 1C2KA 1QJ6B 1THSH 2GVFA 1GMHG 1IHTH 1BRUP 2VIQA 1HJ8A 1CA0B 2J95A 4DW2U 1C4Y2 4MQAA 5LGOA 3RXGA 2FOHA 4B1TA 2ZHEH 2CF8H 3RXCA 1JRTA 3P8FA 2RA3A 4THNH 3E3TA 1FPHH 6LPRA 1Y3YA 4X2XA 1QGFA 3UWIA 4ZROA 2R0LA 1O2UA 1GWAA 3Q3KA 1O36A 2SNWA 1NROH 1UTPA 3ZZ6A 1K21H 1MD8A 2VGCC 1DWBH 2TBSA 2BDGA 2FZZA 3S9CA 1B5GH 2ZGCA 3MU1A 4WVPE 2YNBA 1LHFH 4XBDA 1MQ5A 4WXIA 3MO6A 3D49H 1EXFA 1K1LA 3M5MA 4HI3A 1OWHA 1C2MA 2R2WU 5FCRA 1XUFA 2Z9KA 4D8NA 1MCTA 1MAXA 1QRZA 1Z8GA 1FY1A 1EASA 1AKSB 2ZNKH 1AO5A 3BEIB 1RRKA 3SO3A 3NKKA 1A0JA 5L30H 3LH1A 1C2LA 1TX6A 1C1UH 1FN8A 1Y3XA 5GCHG 2OC1A 1ABIH 2VB0A 4CRGA 1L4DA 4KKDA 1D6RA 1BTWA 1C1VH 1ETRH 4CHAB 3PB1E 3UPEA 2EI8A 1C5NH 4OS6A 1RTLA 2J38A 4H6TA 3SOSA 1TRYA 1YCPH 4Y8ZA 1BMNH 1QQ4A 2R2MB 2F91A 1P01A 5GPIB 2FP7B 2FOFA 1TNIA 4U30A 1KLJH 1TALA 4WY3A 3TJUA 3P8GA 5CHAB 1OWJA 1YPKH 4FUHA 1C1OA 3JZ1B 5I46H 4CRBA 3OU0A 1P11E 4KGAA 3O8BA 1E0FD 1FONA 4Z0KA 1VGCB 5FXLA 1SGFG 3PV4A 1C5VA 5HYOA 1BBRE 3GY6A 3AAUA 4B71A 4D9RA 3RLWH 1F0UA 1O3NA 2R9PA 4AG1A 2V3HH 4Y71A 2BYAX 4WJG2 3P8NA 2F83A 5EXNA 1UTQA 1NU7B 2EEKA 1IQGA 1TGNA 4BAMB 1K1IA 1VCPA 1RTFB 1OWKA 1D9IA 1P0SH 4IW4E 3TJVA 4AYYB 1CGJE 1P57B 3U8OH 2TGTA 3A8BA 2NU2E 2VIOA 1S83A 5FPSA 2FOCA 1KXDA 1C2IA 3HGNA 2H9TH 3O8RA 1FDPA 2F9OA 1DSTA 4AG2A 1AUTC 5L2ZH 2GV7A 2ULLA 3SHCH 3MU5A 2ZDMA 2GCHF 1AD8H 1IHSH 3HATH 2BZAA 2ZU3A 4BAHB 3A8AA 1F0TA 4A7IB 3KIDU 5DP3A 3G01A 1W10U 1ESTA 5FPYA 3TGIE 1O0DH 1YGCH 3T27A 1W8BH 3LGYA 1TGBA 1GJDB 1TPAE 3UNRA 1RTKA 1EPTB 1O3EA 3OYPA 5LPFA 5H4IB 3SQEE 1XVMA 3MNSA 1KIGH 2Y5GA 1O35A 1P12E 3LOXA 3NXPA 2WYGA 3SJKA 1ELBA 1ZTLA 5I25A 2AS9A 1EZUC 4NCYA 3ZZCA 3SV9A 3RMNH 3PMHB 1FLEE 4OS5A 1N6YA 3SU4A 1IQLA 2H6MA 1AUJA 4K5ZA 5DP8A 1GI8B 2Q6GA 3LJOA 1SGTA 3M37A 1XKBC 1MBMA 3R3GB 3SNDA 4F4OC 1ELVA 5F8TA 2J34A 3RMLH 3VB3A 4LZ4B 2OBOA 3F1SB 1UTNA 3UNQA 4CBNA 1NFWA 1S6HA 1CGHA 4UD9H 2ZEBA 3D65E 4WH8A 1TRNA 2Y7XA 4OS1A 2ANKH 1T8LA 2TGDA 1SGEE 1TB6H 1GI6A 4XE4A 1XVOA 1KXAA 5GDSH 3U98H 1P9SA 1UHBB 2Q1JA 1GBEA 2ZTYA 5JBBS 3DHKH 5CMXH 2PGQB 4FU7A 1CT0E 1BJVA 1DS2E 1L1NA 1C2DA 1UTJA 1P2JA 1XXDA 4AZ2B 1ZHMA 2PKSB 5EQQA 2O8MA 5F03A 1DOJA 3GYLB 2PSXA 2FPZA 3KL6A 5B6OA 2C8ZB 4JZ1A 1HAOH 2Z9LA 1G3DA 4Q7XA 1T8NA 1DANH 1WSSH 4I8HA 1YCPK 2FIRH 2BQ6B 1TGCA 1ZPBA 3MI4A 2NU3E 1L4ZA 3LDXH 3M36A 3RU4E 2H5DA 3ZVBA 2ZFPH 1NN6A 1TPOA 1IQEA 1XKAC 1NRSH 2P8OC 2PTCE 2P3TB 3SUFA 1W14U 2WINI 2VIPA 3ODFA 1KLTA 3VFEA 2F3CE 3GDSA 5EODA 3ITIA 2CV3A 4TYDA 4D7FA 1HAVA 5JBCS 3BTQE 1BMLA 1W2KH 4NWLA 2AMPA 3ZYDA 3EDXB 2FM2A 1HJ9A 2BY8X 2YOLA 1PPZA 1MD7A 1SPJA 4I8LA 1QQUA 2FO9A 2H1UA 1H9LB 1J8AA 1K1NA 3UQOA 1ELEE 3SU5A 3MO9A 2ZGJA 3ATMA 1OKXA 1V3XA 1GBBA 1EJAA 2ALVA 3SV2H 3O8CA 1G2MA 1QTFA 5LH8A 1FV9A 6GCHF 3NPSA 2HNTC 5T6GA 1G32B 2C8XB 1FAKH 1YBWA 3AVZA 1Y59T 1BIOA 1MTUA 3MO3A 3RMOH 3SUEA 4MNWA 3HGPA 1DE7H 3AAVA 3ZZBA 1ANDA 5DJ7A 1E36B 3F9EA 1LCYA 1GDQA 2ZU1A 3SJOA 1QIXB 1QY6A 1BRAA 2VJ1A 1DVAH 1O2TA 3BG4B 4HZHA 3MWIU 1D6WA 3RXAA 1P04A 3SV6A 3GYMA 3RUOA 1LKBA 3NCLA 2JKHA 5IYTA 1GJ6A 3F6UH 2PLXA 1C1RA 1UVUH 4JZIA 3TGJE 5FBEA 1SL3A 4DIIH 1E37B 3TH3H 2A45B 1BHXF 4K1EA 2ANYA 1GGDB 4SGAE 2THFB 4NIYA 4R8TB 1Z8IB 1WQSA 2OC7A 4YOJA 1INCA 1HFDA 1O2IA 1EAIA 1O2NA 3MNBA 3KNXA 1A0HB 3VB7A 3PMBB 4A1XA 1T4VH 2ANWA 2PR3A 1V2UT 1F92A 4XFQA 1HAXB 4SGBE 1JWTA 3TH4H 1EOLA 5A0CA 2OD3B 1TNGA 2J9NA 2TGPZ 2WPMS 3P17H 4ZKOU 8ESTE 4ISLA 5EG4A 5A09A 4X8UH 1GI3A 1TABE 1XX9A 1WAYB 1KXEA 2PFEA 4GCHG 4DJZB 1BRBE 3Q76A 4X1NU 4ZUHA 1HAGE 1LPZB 2AGGX 1V2JT 5ETXA 1YP9A 1FY4A 1C5MD 3M35A 1ZYOA 2FEQH 2GCTB 2RDLA 3N7OA 1UK3A 1A61H 4OGYA 4BANB 1O2LA 1O34A 1O3JA 2B0FA 1HNEE 3UNSA 3RXOA 1C5ZB 2SNVA 4YLUA 4K3JA 2W7SA 1OP8A 1S0RA 1O5FH 1P8VC 4JMYA 4NIVA 4WMEA 1GI4A 3PO1B 1TQ7B 3KQCA 2KAIB 1EB1H 1P10A 3ATKA 1HXEH 1QCPA 3RLYH 1HGTH 2B5TB 1QBOA 1ANCA 1V2QT 2QGRA 2ZHQH 4XDEA 1EX3A 4IMQA 2GD4B 1MU6B 2AGIX 1V2TT 1P3CA 1N6XA 1L1GA 3D62A 5E8EH 1OSSA 1C2FA 2QXHA 1RXPA 4JYUH 3Q00A 5K7RA 5EPYA 3AASA 1GI1A 2FOEA 3QZQA 1TAWA 1OXGA 3RXQA 2ZECA 3FZZA 3HK6B 1SLWB 3M5NA 4O9VA 1CHOG 4U2WA 1BHXB 4BAQB 2VVCA 3F68H 1C5LH 1EPTA 2SGDE 2VIVA 1GJ7B 1EAXA 1ZJKA 1MMJN 3P70B 4VGCB 4Y10E 3LIWA 3U8TH 1LMWB 3B8JA 1GJ9B 1WCZA 1O3GA 1O3KA 1LVYA 2F9VA 1K2I1 2Q6DA 3M7TA 2CHAB 1AI8H 3ZZ3A 1ZSJA 3L6PA 4O97A 4OGXA 1WV7H 4YLQH 1O2ZA 2FX4A 4LK4A 1AHTH 5HMAA 1BITA 1GBIA 4LZ1H 1C5WB 3BTFE 4AORA 1GI5A 2A31A 1O32A 1SGNE 2CJIA 3PYHA 2ZDNA 1Q3XA 1FPCH 3I78A 3SU2A 3GY2A 1DUEA 1ZSKA 5C67A 1BA8B 1OYTH 1HXFH 1ELDE 4Y6DA 4X0WU 2PWXA 2ZCHP 1F7ZA 1MU8B 3A7YA 3PWCA 1OS8A 2BZ6H 4B76A 1SFQB 2P94A 4IC6A 4CRFA 1P2IA 1ESBA 2W3KA 2CF9H 2FS8A 1QBNA 1W3CA 3SN8A 1H9IE 1QJ7B 3LGTA 1EP6A 3TGKE 1XUGA 2SFAA 1A7SA 5GXPA 1CA8B 2XC4A 1GBCA 4MLFB 1W12U 1Q31A 3QTVH 1C2GA 1HJAB 1GHYH 1GVKB 1SGPE 2AMQA 1C1NA 3HKJB 3ZVAA 1SSXA 2BY5X 2DUCA 1QNJA 1LVBA 1V2ST 1NT1A 3TJOA 1Z6JH 2VIWA 3GDUA 1V6DA 4FUJA 1DWEH 3BTME 1FY3A 1XMNB 1TGSZ 4ZMAH 1WYKA 2ESTE 3GCHB 1DT2A 1UCYH 3IWMA 1CQQA 1OP2A 3UFAA 2ZGXH 1GHVH 1O38A 4KP0A 2SGEE 1AB9C 3A7ZA 3E1XB 1YPJH 5DK1A 4A6LA 3A86A 3MNXA 2BX3A 1LO6A 3EAJA 1QBVH 2V0BA 4ESTE 5FBIA 1G3CA 1AVXA 1E38B 7GCHF 1AQ7A 1Z1IA 1BDAA 2PTNA 1C5YB 5AVDA 4Y11E 2XC0A 4A1VA 3CENA 3E6PH 5T3HA 2G4UA 1NFUA 3A7VA 4E7NA 3STIA 1GMDF 1C1SA 1GBHA 3RXHA 1Z8RA 2BOKA 3U69H 1NO9H 4TWYA 1XUKA 2ZHFH 3T28A 1ABJH 4GUXA 3EQ0H 1C5OH 3MTYA 1O5GH 4MDSA 1SFIA 2GZ9A 1THRH 1NFXA 2A4QA 1VITG 2A0QB 2RCEA 4X8VH 2BQ7B 2PKAB 1PPGE 1EZQA 3U1IB 1BMMH 3EA9A 4MG3A 1O33A 1LPGB 5EXMA 1TNLA 1BJUA 3ATIA 1KTSB 1SG8B 2K1QA 3EYDA 1EAUA 1SB1H 2GMTB 4AGKA 2IOTA 1C2EA 1O2HA 4BAOB 3KCGH 5FX6A 3A82A 1MCVA 1SC8U 2F9BH 3M5OA 1UVOA 3W94A 3KHVA 4MNYA 3FP7E 4AB8A 1FY8E 2D2DA 4X1SU 3A8CA 1C1TA 2J92A 6CHAB 4MPWA 2P16A 1MUEB 2P95A 1DSUA 4KTUA 1A46H 1ZSLA 2A4OA 2GT7A 2B8OH 2VVUA 4ABIA 2BD4A 4ISOA 7ESTE 1BB0B 1WBGB 1YYY1 4ABDA 1DLEA 1OWDA 4JCNA 2FESH 2VIDA 1ZMNA 3S69A 1K22H 1FAXA 2NU4E 3H5CB 3PMJA 4X1QU 5J4SA 2HOBA 4CBOA 1DFPA 2R3UA 1PQ5A 1RD3B 2G81E 1BTPA 3FAOA 4NFEA 1OOKB 3SORA 1C5UA 1AFQC 1NY22 3MFJA 1GHAF 4K69A 5HXFA 2H9HA 1RIWC 1IQMA 3K6YA 2O8UA 1KY9A 3RXTA 4JYTA 4YT7H 5JB9S 3P6ZB 3A83A 1BMAA 3SNBA 5FCKA 2BDAA 2R0KA 4X1PU 3SU1A 4Y79A 3L3TA 1UCYK 4YO9A 3GCTF 3A87A 2A7CA 4NSYA 1EQ9A 4Y0ZE 3HKIB 2FX6A 2Y6TA 5F6MA 9ESTA 1ZRKA 2FTMA 1VCWA 2CMYA 2ZDVH 4FUEA 2WV4A 2KAIA 2VH6A 5ABWA 1LKAA 2WV5A 4YTAA 1C5RA 1ACBE 4NA8A 2QXIA 4HGCA 2Z9GA 1HB0B 3VB6A 3W95A 2UUFB 2QA9E 4CH8B 4I33A 3QGNB 5C1YA 5K0HA 1TNJA 3TK5A 3T26A 2BDYA 2BD8A 1BCUH 3E0PB 4DG4A 4WH6A 2G5VA 3T5FH 1NS3A 3MNCA 4OS4A 2Z9JA 1OX1A 4ISHH 5F8XA 3RXPA 4NSVA 1QL9A 1RGQA 2ZDLA 1MZDA 1O2OA 1ZZZA 3MYWA 1RS0A 1UO6A 2WPKS 2FDAA 2YNAA 1Y3UA 1ZJDA 1AVGH 3TJNA 2AMDA 4FXGH 3RM0H 2Q6FA 1TNKA 3VB4A 2XBYA 4JZEH 5EW2H 3V3MA 1MTSA 1YPEH 1GHBF 3URCA 1NESE 2JH5D 1Y3WA 3T29A 1AFEH 2HPPH 2ZFTA 4DURA 2AGEX 3GISB 1IQIA 5A8YA 1VZQH 1ZGIA 3SV7A 3LC3A 1GCTC 4FUBA 4FU9A 5G4BA 5FAHA 1AE5A 3MH5A 3GY3A 4B74A 1GI2A 2STAE 3Q77A 1PJPA 4OS7A 3PM3A 4NFFA 3RXMA 2I6SA 1YLDA 2ODQA 3FP8E 1YPHC 1ELGA 1MTNB 1O30A 2VWMA 1ESAA 2BY7X 1H8DH 1O2QA 1VJ9U 3A7XA 2WPHS 1GBKA 1PYTD 2AIPA 4UFGH 4BTTB 2OTVA 1T8MA 1FIZA 1GG6C 1A3EH 2Y82A 4OS2A 3TVJB 1TOMH 3RU4T 1CHGA 3K6ZA 1CBWB 2G55A 3ZVDA 1LHDH 1SLUB 1ZR0A 1TGTA 1EP5A 4ZXXH 1N1LA 1J14A 4AFQA 1S81A 1OP0A 4K2YA 2UWPA 1DPOA 3ZV9A 3UWJH 3ENSB 3NWUA 4I8KA 1D3TB 3MH6A 3EGKH 2ZU2A 1QB9A 1E34B 3K65B 1ID5H 4TWWA 2A7JA 4D9QA 4YT6H 1GMCF 2P3UB 5TCAA 1LHCH 2FTLE 1LHGH 1NFYA 1TX8A 1S82A 1ZMLA 5AHGH 1UMAH 1SGRE 1DLKB 5GWZA 2BXTH 1V2KT 1YPGH 1YPLH 2BVSH 1MTVA 1AZ8A 3BSQA 4YESB 5AF9H 1AMHA 4WMFA 1KSNA 3ZZAA 1ZGVA 3FZDA 1O3BA 3B9FH 1AY6H 2GTBA 1Z8JB 2JETC 2ZA5A 2SGAA 2EI7A 1SLXB 1HUTH 1GBTA 1EOJA 2ZDKA 4ZXYH 3VXFH 5C20A 3AW0A 1H8IH 1QA7A 2ZU5A 4Y7BA 3UOPA 4I7YH 2XNIA 3NK8A 3E90B 4ABFA 1DICA 1VCQA 1W7GH 1HPGA 3PTBA 2GCHG 2SGPE 3IG6B 4B73A 1O39A 4ZHMU 1H4WA 1TYNA 2AYWA 4X6OA 3SJ9A 1BBRH 1ZPCA 1V2NT 2O9QA 2PKAA 1O2XA 2VGCB 4K8YA 2GDEH 2GDDA 3NZIA 2Z3CA 4ABJA 2B9LA 1MAYA 2GGVB 5JYIA 1SGYE 1P2MA 5DP6A 5JB8S 2FODA 3SUGA 1SHYA 4RN6A 2QF0A 1PPCE 1CA0C 1XM1A 2AH4X 3K2UA 2OINA 3P95A 4ZKNU 1P02A 1F5KU 5C1UA 1OWEA 3LGUA 3GCOA 2BDIA 4Q7YA 2NU1E 1QA0A 1A5IA 1VITH 3SI3H 3RXIA 4KELA 1ORFA 1ZPZA 1GBMA 1FUJA 1MKXH 1Z6EA 2WPIS 4LXBH 2XYAA 4DVAU 4BTIB 1ELTA 1DM4B 3SI4H 1CT2E 2QF3A 3V0XA 1Z7KA 2BMGB 1NC6A 2RA0A 1ELFA 1D3DB 4INKA 2FOAA 3M3TA 1Y5AT 3FVFB 2C90B 2Y81A 1QHRB 2ASUB 3RU4D 2J94A 1BTZA 1EJMA 4Y8XA 1GPZA 1S0QA 4H42U 1G9IE 4UFFH 3UR6A 3GY5A 2XBXA 4ABGA 4DGJA 2G5NA 4B2CA 2A4GA 3SNAA 1MZAA 4INHA 3BG8A 8GCHF 3Q3XA 3UIRA 3STJA 2VVVA 1AN1E 2CGAA 2D1JA 3GICB 4MVNA 4ZHLU 1LPKB 2ZGBH 2NU0E 2O8WA 1O2GH 2ZFRH 4O03A 5DG6A 1BTHH 2ZFFH 3BTHE 2B7DH 5DPAA 3E0NB 5E2PA 4ZAEA 1ETTH 3MH4A 3QWCH 3TK9A 4CHAC 1F5LA 3RC5A 4YOGA 3SUDA 4R0IA 2XBVA 1G3EA 1HYLA 1N8OC 2J4IA 3U8RH 1P2QA 1SGIB 1F0RA 3ZZ8A 4RKJB 4B2BA 3BTEE 5CHAC 3QLPH 7KMEH 4I31A 1SLVB 2ODYB 2Y80A 2XW9A 1PPBH 4NZLA 1O2VA 2BQWB 2Z6BD 1EKBB 4JZDH 1FJSA 2ZP0H 4XBCA 1IQKA 1VGCC 3BTWE 2RG3A 3OSYA 2GX4A 1O3PB 4HTCH 1GL0E 3E16B 2FI3E 4CR5A 1DY9A 1HDTH 1T32A 3RP2A 2A32A 3D23A 3DUXH 1GJ8B 1SQAA 3BTGE 1A5HA 2VH0A 1FZZA 1UVSH 2FOGA 1NRNH 2WPLS 3F9GA 1CVWH 1GMHF 5A8XA 4WMDA 1AE8H 1SGQE 6GCHG 4H6SB 3KQEA 4NIWA 1Z71A 5BPEA 2ZO3H 3ATLA 5EU8A 3QGJA 1HV7A 3AW1A 2QCYA 1BBRK 2DE8A 2LNCA 2HNTF 3UOUA 3SU0A 3GDVA 4RSPA 1F0SA 4BXSA 1FQ3A 5DP7A 2GP9B 4UFDH 3TK6A 4WF8A 3FANA 1S6FA 4YM9A 1BRCE 4O3TA 3V7TA 1UK4A 3RXFA 4HFPB 1K1MA 3OX7U 5DGJA 1EPTC 2ZWLH 1UTMA 1Y5UT 3JZ2B 1TQ0B 2WUBA 2ZFQH 1SHHB 1RJXB 1O2KA 2BDHA 2H9EH 2GKVE 3LPRA 1MKXK 5E0JA 1J16A 3TU7H 1G37A 3NUMA 4A1TA 1GG6B 2A2XH 4MNVA 1XUHA 2C3SA 4YZUA 3ZVCA 3RXKA 3RC6A 1V2MT 3DT0H 2BD2A 1H1BA 1SBWA 1FMGA 3QX5H 1C9TA 2SGFE 3LONA 1ZTJA 1P9UA 2CN0H 5GCHF 2A5IA 2V35A 2Z9IA 3PWBA 3R0FA 4D76A 4K60A 5EOKA 3TNSA 1DUAA 1TPPA 2XRCA 3VXEH 3A8DA 4Q2KA 2OP9A 3BIVH 1GHWH 1MKWH 1L1JA 1TMTH 2DE9A 4IBLH 5FHTA 1HAPH 1W7XH 2P8OB 3S9BA 4AB9A 1TA6A 1BTUA 3QTOH 4XBBA 1A0LA 1C5SA 3P92A 1L0ZA 1TFXA 2PKSC 1AWFH 2Y7ZA 1DX5M 1V2OT 3PTNA 2GT8A 3TIUA 1J15A 1GJ5H 5DP4A 2M5TA 4ZKRU 1O3OA 1KDQB 5ESTE 1QFKH 1YPMH 2BHGA 1C2HA 1M9UA 4FUFA 2UWOA 1PFXC 1ZMJA 5EQRA 3TH2H 2QXJA 2BLWA 7LPRA 1A2CH 1AVWA 2JH6D 3LJJA 2F9PA 4FUCA 3MMGA 2VINA 3RXLA 3CS0A 3T25A 4I8GA 1JIMA 3TITA 2BLQA 4AYVB 4NWKA 1O3FA 2Z3EA 5A0AE 1A4WH 4FUDA 3MU0A 1O2YA 4LOYH 3RXBA 1GJCB 1IOEA 1GI9B 2BM2A 1GBFA 1U6QA 2AIQA 1IQHA 3OY6U 4IS5A 3UTUH 2D26C 5C5OA 8KME2 2PHBA 2FXRA 3OY5U 4DCDA 2GZ7A 1TIOA 3RMMH 2XXLA 1Q2WA 4JZFH 1TMBH 1HAIH 1O3DA 2ZZUH 1LVMA 2O8LA 2VNTA 2QC2A 3M5LA 3RXVA 4GHQA 2H2ZA 4Y8YA 1YF4A 2TPIZ 5ESBA 1UJ1A 2BOHB 1O3MA 4XOJA 3URDA 3UQVA 1HAHH 3P8OA 4ISNA 3MH7A 1O5BB 4CRDA 1J17T 3SGQE 1C5XB 3QZRA 3KGPA 5GIBA 5A8ZA 1B0FA 4B2AA 3QDZB 3BEUA 2ZKSA 1O2SA 1FI8A 4IN1A 1UTLM 2G4TA 2W26A 1O37A 1V2RT 1GDNA 4Z6AH 5E0GA 3S9AA 2UWLA 3A81A 1NU9A 2XTTB 3BG4C 2I6QA 1UTKA 3FP6E 2ZU4A 2CXVA 1CT4E 1UK2A 3SGAE 3ESTA 4J2YB 1BUIA 1AU8A 1QL7A 2D8WA 2WUCA 3U1JB 1CO7E 1YPHE 2ZC9H 3L33A 2GV6A 3MOCA 2ALPA 2BDBA 4NA9H 3MU8A 3B23B 1KXFA 4AX9H 1GL1A 1W0ZU 1GGDC 2PGBB 2ZDAH 5FPTA 1E35B 2ZCLP 2ZHWH 2Y5FA 2Z7FE 2XCFA 5L2YH 1D3PB 3GOVB 2BTCE 1T31A 4FVDA 3LC5A 1NM6A 2HALA 3BV9B 2OLGA 1MKWK 1NRPH 1YKTA 4UONA 1SI5H 4GHTA 4E05H 5EXLA 1QURH 3ZVEA 1MBQA 1XXFA 1GBLA 3RDZA 2G51A 3M3SA 3T2NA 1FN6A 1VR1H 3QN7A 1N8OB 4MNXA 3VGCC 3KQBA 2A7HA 2O8TA 1SGCA 1O5CB 1TBRH 3H7OA 1JXPA 1V2WT 1GVLA 4GLYA 2G52A 2SGQE 5C3NA 4CRCA 2BD9A 2A5AA 1HIAA 3VB5A 1A1RA 3GY7A 1GJ4H 4RKOB 2G00A 2GCTC 3PLPA 3GCNA 3RM2H 1HRTH 4FUGA 2BXUH 1ZRBA 4D7GA 2OCVB 1C5TA 1O5EH 3QUMP 2OBQA 1C4V2 3LU9B 4ABAA 2FI5E 7GCHG 1EZSC 1P06A 2AFQB 2PUQH 4INLA 4CREA 1KXCA 1KTTB 2OQUA 1GMDG 1G2LA 3S7KB 5JPMH 3MHWU 1SQOA 2BLOA 1P09A 2BD5A 1C2JA 3BTDE 1UVPA 3PO1C 1GI0A 1DY8A 2HRVA 2HNTE 1V2LT 2OC0A 4ABHA 2VWOA 1YLCA 2QAAA 2V6NA 1ETSH 2FLBH 2NWNA 2PV9B 4E7RG 2C8YB 3IITA 4TY6A 1PPHE 5EGMA 2WPJS 1NRRH 3EA7A 3I29A 4BTUB 3ZZ5A 3BF6H 1G3BA 4I8JA 4JK5A 1J9CH 4Q7ZA 1LVOA 1H9HE 3PMAB 3C1KA 4UE7H 1NPMA 1JIRA 1TE0A 3DFLA 5DP9A 5GJ4B 1BTYA 3GY4A 1DXPA 4TPYA 4FU8A 1FIWA 2AEIH 1TRMA 1C1MA 5T6FA 1NRQH 1C5PA 4NGAH 4DY7B 4VGCC 1O3HA 2ODPA 3E8LA 1ANEA 2ZCKP 3RXDA 1S84A 2QIQA 1GBJA 3DA9B 2CHAC 4YOIA 4AGJA 4CRAA 1GHZA 1XUIA 1PPFE 1TA2A 1FY5A 3BTKE 3SNEA 3ZV8A 1ZTKA 2ZI2H 1ZLRA 4JYVH 2TGAA 1CSOE 1EB2A 4MPXA 1C4U2 6ESTA 1YM0A 1PQ8A 1ZHRA 1SQTA 4IC5A 4XSKU 5SGAE 1QB6A 1WQVH 2IN2A 3ATWA 1JMOH 1SR5C 9LPRA 1QRWA 1PPEE 4GCHF 1QB1A 4JK6A 4AN7A 2JH0D 1GBDA 1PYTC 1GHAG 1EJNA 1VJAU 3SU3A 4IN2A 4K1SA 1AB9B 1HJAC 4GVUA 5A2MH 1O3LA 3KN2A 1K1PA 1SVPA 1KDQA 4KTSA 2Y5HA 3DFJA 1IAUA 1B7XB 2W7UA 4X6PA 2OC8A 3ZVFA 2C8WB 1C9PA 4GPGA 2W5EA 1GVZA 3GCTG 3LGWA 4NA7A 2Z94A 1IQFA 1ARCA 1Y5BT 3F9HA 2QY0B 1HAZB 1WTHD 2P93A 2ANMH 3I77A 3SHAH 3GCHC 3RXJA 1P2KA 3ZZ7A 2ZPSA 1UTOA 5AFZH 1K9OE 3KQDA 2F9NA 2VWNA 4A5TS 4PROA 3TPIZ 2OUAA 1YC0A 1TMUH 3M7UA 5J4QA 3A7WA 1L2EA 4TY7A 2FOMB 1EUFA 3K9XB 1TONA 2FYQA 3ODDA 3RXUA 3PLKA 1MH0A 1P2NA 1TPSA 1O2PA 1ARBA 3VPKA 2ZPQA 1WOFA 1O2RA 1NZQH 3UR9A 4MPVA 1GI7B 2VU8E 1V2VT 4X2YA 2UUJB 2EC9H
chains in the Genus database with same CATH superfamily
1ZHPA 1P05A 2W6JD 5EW1H 2XWBI 5C1XA 3T62A 1SOZA 8LPRA 5CE1A 1EAWA 4Y76A 4F49A 1CHOF 3DCLA 1E79D 2HGTH 4ZHAA 4U01A 3SNCA 1C1PA 1O3CA 2KZ4A 1X7AC 1KLIH 5DKMA 1FXYA 1LTOA 1GHBG 1C5QA 2A5KA 3FFGA 2BD7A 3A80A 2FLRH 3ELAH 3ZZ9A 3CS7A 3FO8D 3BTTE 3F9FA 5DP5A 1DWCH 2FI4E 2ZIQH 4KTCA 1LQEA 2EA3A 3S7HB 3RXEA 1DWDH 2BVXH 4Q80A 2PUXB 2GMTC 5JDUB 1P2OA 3BIUH 4Y0YE 1G36A 1TNHA 2QV1A 3QO6A 4Y7AA 5A0BA 4I32A 3QK1A 5DO4H 4UFEH 2UUYA 2ILNA 3A7TA 3U9AH 1YCPM 1ANBA 4RI0A 3SJ8A 3Q3YA 2HVXA 1K28D 3KF2A 2PSYA 1AKSA 4BOHA 4ABBA 2PW8H 1Y8TA 1PQ7A 3CP7A 1A3BH 2C93B 1EZXC 1UCYE 4UDWH 3UUZA 1MQ6A 6CHAC 1V2PT 4ZH8A 1BQYA 1HLTH 1D4PB 2P3FH 2TIOA 4M7GA 3SJIA 3SW2B 1AFQB 3ZVGA 2OQ5A 2EI6A 3MU4A 1B0EA 1SMFE 1RIWB 4X2WA 4DT4A 1G30B 1SGFA 2ZPRA 3LH3A 2HWLB 4WXVA 1AZZA 2XC5A 4F55A 5L6NH 1TOCB 5LPEA 2QXGA 2QN5T 5F8ZA 3BEFB 3EE7A 3VGCB 4U32A 3SGBE 2WHXA 3LGVA 2XNDD 1LHEH 3WY8A 5JBTA 1GMCG 1W13U 1GHXH 4NZQA 2TRMA 1OWIA 1SOTA 4ZKSU 3CNRA 1TBZH 3SBKA 5EJ1A 5JBAS 1ELCA 1HCGA 3SQHE 4O3UA 3HK3B 5PTPA 2LPRA 2EQNA 1HIAB 2IJOB 2QYIA 2BD3A 4CH2B 1HBTH 2XWAA 1QL8A 1K1OA 5EQSA 1LQDB 3RC4A 2BLVA 2STBE 1TBQH 2VWLA 2ZQ1A 1WU1A 3BN9A 2F9UA 2J2UA 4X6NA 2F4LA 1K1JA 2UUKB 1TX7A 2A2QH 3KEEA 4AFSA 4X8TH 3LGIA 3RXRA 1THPB 4K1TA 5FX5A 1O5AB 2GZ8A 1Y3VA 1IQJA 1O2JA 4X6MA 5AFYH 1Z1JA 1C1QA 2H5CA 4MTBA 4B6EA 2BY6X 3H7TA 4J1YA 2FWWA 4FUIA 1NTPA 2ZGHA 3WWFA 1VITF 2AERH 4GSOA 5HGGA 2LP6A 3M7QA 1DDJA 4X2VA 5T6DA 5C2ZA 4BAKB 1IQNA 2ZF0H 3M61U 4YXWD 1GCTB 1O5DH 1JBUH 1W0YH 3V13A 4ABEA 1BZXE 1P3EA 2ZHDA 1KYNA 1A5GH 5BRRE 5IDKA 4K8BA 1JRSA 2BB4A 5EPNA 1P03A 5HM2A 3OTJE 4NIXA 3UY9A 3C27B 3DD2H 4TPIZ 3A85A 3A88A 1RFNA 3E91A 1LDTT 1D3QB 2XCNA 1AWHB 1KXBA 1DITH 1AGJA 1ELAA 1S5SA 1GJAB 1F2SE 1GDUA 4B75A 3A89A 2ZG0H 1PQAA 1UVTH 2IPQX 1QRXA 3EE0B 1HAYB 5HM9A 4X8SH 5E0HA 3TNTA 4BXWA 3GY8A 1AIXH 2FOBA 2Z3DA 5TJXA 5KECA 5LPRA 5EIYA 1O31A 1T7CA 2IPHA 3UREA 1UHBA 1CU1A 3SV8A 1JOUB 1O2MA 3VEQB 1MTNC 1BT7A 1QJ1B 3NRLA 5KGOA 5C5NA 5GNDA 1GBAA 4H4FA 3DSPA 3S0NA 8GCHG 3PROA 1GJBB 3LT3A 3TLOA 2BVRH 3ZYEA 4MPUA 2OK5A 1BTXA 2BDCA 1WUNH 2WYJA 1T4UH 3V12A 1TLDA 1CGIE 4IGDA 1EATA 4IMZA 1CBWC 1ZOMA 3ZZ4A 4FVBA 4AFZA 3SU6A 1XUJA 5TCCA 2HPQH 2ZTZA 1O3IA 1DXWA 1WTGH 4A92A 2ZTXA 2FMJA 1CE5A 3RXSA 4E06H 2HLCA 4XD7D 1MTWA 4DIHH 2C4FH 2R3YA 2RDEA 2ZFSA 2JETB 1FNIA 2BY9X 4X1RU 3GS9A 3O8DA 4NG9H 5E2OA 1GCDA 1O2WA 4BNRA 2A1DB 1W11U 1C1WH 4CR9A 1HAVB 1T8OA 4GAWA 3OAAD 4ISIH 3SZNA 3LKWA 2G8TA 3ZZDA 2V3OH 3A84A 2A4RA 4FOUC 4DT7B 1F5RA 2ZQ2A 3EA8A 3PLBA 3DSOA 1TWXB 1SGDE 4UEHH 1S85A 3M3VA 2W3IA 3HPTB 2FS9A 4WWYA 4QT8C 2BX4A 2OXSA 4AOQA 4DOQA 4AFUA 1QR3E 1BOQA 1OPHB 2FYRA 1O3AA 1OYQA 2XBWA 4ASHA 3UAIC 1BMFD 1C2KA 1THSH 1QJ6B 2P59A 2GVFA 1GMHG 1IHTH 2KCAA 1BRUP 2VIQA 1HJ8A 1CA0B 2J95A 4DW2U 1C4Y2 5FL7D 4MQAA 5LGOA 3RXGA 2FOHA 3F0PA 4B1TA 2ZHEH 2CF8H 3RXCA 1JRTA 3P8FA 2RA3A 4THNH 3E3TA 1FPHH 6LPRA 1Y3YA 4X2XA 1QGFA 3UWIA 4ZROA 2R0LA 1O2UA 1GWAA 3Q3KA 1O36A 2SNWA 1NROH 4FETA 1UTPA 3ZZ6A 1K21H 1MD8A 2VGCC 1DWBH 2TBSA 2BDGA 2FZZA 3S9CA 1B5GH 2ZGCA 3MU1A 4WVPE 2YNBA 1LHFH 4XBDA 1MQ5A 3PV5A 3MO6A 4WXIA 3D49H 1EXFA 1K1LA 3M5MA 4HI3A 1OWHA 1C2MA 2R2WU 5FCRA 1XUFA 2Z9KA 4D8NA 1MCTA 1MAXA 1QRZA 1Z8GA 1FY1A 1EASA 1AKSB 2ZNKH 1AO5A 2IJD1 3BEIB 1RRKA 3SO3A 3NKKA 1A0JA 5L30H 3LH1A 1C2LA 1TX6A 1C1UH 1FN8A 1Y3XA 5GCHG 2OC1A 1ABIH 2VB0A 2XOKD 4CRGA 1L4DA 4KKDA 1D6RA 2KX4A 1BTWA 1C1VH 1ETRH 4CHAB 3PB1E 3UPEA 2EI8A 1C5NH 4OS6A 1RTLA 2J38A 4H6TA 3SOSA 1TRYA 1YCPH 1NBME 1BMNH 4Y8ZA 1QQ4A 2R2MB 2F91A 2YMSB 1P01A 5GPIB 2FP7B 2FOFA 1TNIA 4U30A 1KLJH 1TALA 4WY3A 3TJUA 4AC9A 3P8GA 5CHAB 1OWJA 1YPKH 4FUHA 3MQKC 1C1OA 3JZ1B 4TT3D 5C94A 5I46H 4CRBA 3OU0A 1P11E 4KGAA 3O8BA 1E0FD 1FONA 4Z0KA 1VGCB 5FXLA 1SGFG 3PV4A 1C5VA 5HYOA 1BBRE 3GY6A 3AAUA 4B71A 4D9RA 3RLWH 1F0UA 2LELA 1O3NA 2R9PA 4AG1A 2V3HH 4Y71A 5CDFE 2BYAX 4WJG2 3P8NA 2F83A 5EXNA 1UTQA 1NU7B 2EEKA 3OE7D 1IQGA 1TGNA 2M2AA 5HIYA 4BAMB 1K1IA 1VCPA 3VG8A 1RTFB 1OWKA 1D9IA 1P0SH 4IW4E 3TJVA 4AYYB 1CGJE 1P57B 3U8OH 2TGTA 3A8BA 2NU2E 2VIOA 1S83A 5FPSA 2FOCA 1KXDA 1C2IA 1S6LA 2H9TH 3HGNA 1FDPA 2F9OA 3O8RA 1DSTA 4AG2A 1AUTC 5L2ZH 2GV7A 2ULLA 3SHCH 3MU5A 5C17A 2ZDMA 2GCHF 1AD8H 1IHSH 3HATH 2BZAA 2ZU3A 4BAHB 3A8AA 1F0TA 4A7IB 3KIDU 5DP3A 3G01A 1W10U 1ESTA 5FPYA 3TGIE 1O0DH 1YGCH 3T27A 1W8BH 3LGYA 1TGBA 1GJDB 1TPAE 3UNRA 1RTKA 1EPTB 1O3EA 3OYPA 5LPFA 5H4IB 1WDIA 3SQEE 1XVMA 3MNSA 1KIGH 2Y5GA 1O35A 1P12E 3LOXA 3NXPA 2WYGA 3SJKA 1ELBA 1ZTLA 5I25A 2AS9A 1EZUC 4NCYA 3ZZCA 3SV9A 3RMNH 3PMHB 1FLEE 4OS5A 1N6YA 3SU4A 1IQLA 2H6MA 1AUJA 4K5ZA 5DP8A 1GI8B 2Q6GA 3LJOA 1SGTA 3M37A 1XKBC 3H09A 1MBMA 3R3GB 3SNDA 4F4OC 1ELVA 5F8TA 2J34A 3RMLH 3VB3A 4LZ4B 2OBOA 3F1SB 1UTNA 3UNQA 4CBNA 1NFWA 1S6HA 1CGHA 4UD9H 2ZEBA 3D65E 4WH8A 1TRNA 2L74A 2Y7XA 4OS1A 2ANKH 3AK5A 1T8LA 2TGDA 1SGEE 1TB6H 1GI6A 4XE4A 1XVOA 2KCYA 1KXAA 5GDSH 3U98H 1P9SA 1UHBB 2Q1JA 1GBEA 2ZTYA 5JBBS 3DHKH 5CMXH 2PGQB 4FU7A 1CT0E 1BJVA 1DS2E 1L1NA 1C2DA 1UTJA 1P2JA 1XXDA 4AZ2B 1ZHMA 2VBCA 2PKSB 5EQQA 2O8MA 5F03A 2V3MA 1DOJA 3GYLB 2PSXA 2FPZA 3KL6A 5B6OA 2C8ZB 4JZ1A 1HAOH 2Z9LA 1G3DA 4Q7XA 1T8NA 1DANH 1WSSH 4I8HA 1YCPK 2FIRH 2BQ6B 1TGCA 1ZPBA 3MI4A 2NU3E 1L4ZA 3LDXH 3M36A 3RU4E 2EY4C 2H5DA 3ZVBA 2ZFPH 1NN6A 1TPOA 1IQEA 1XKAC 1NRSH 2P8OC 2PTCE 2P3TB 3SUFA 1W14U 2WINI 2VIPA 3ODFA 1KLTA 3VFEA 2F3CE 3GDSA 5EODA 3ITIA 2CV3A 4TYDA 4D7FA 1HAVA 5JBCS 3BTQE 1BMLA 1W2KH 4NWLA 3WW7A 2AMPA 3ZYDA 3EDXB 2FM2A 1HJ9A 2BY8X 2YOLA 1PPZA 1MD7A 1SPJA 4I8LA 1QQUA 2FO9A 2H1UA 1H9LB 1J8AA 1K1NA 1VKYA 3UQOA 1ELEE 3SU5A 3MO9A 3FN8A 2ZGJA 3ATMA 1OKXA 1V3XA 1GBBA 1EJAA 2ALVA 3SV2H 3O8CA 1G2MA 1QTFA 5LH8A 1FV9A 6GCHF 3NPSA 2HNTC 5T6GA 1G32B 2C8XB 1FAKH 1YBWA 3AVZA 1Y59T 1BIOA 1MTUA 3MO3A 3RMOH 3SUEA 4MNWA 3HGPA 1DE7H 3AAVA 3ZZBA 1ANDA 5DJ7A 1E36B 3F9EA 1LCYA 1GDQA 2ZU1A 3SJOA 1QIXB 1QY6A 1BRAA 2VJ1A 1DVAH 1O2TA 3BG4B 4HZHA 3MWIU 1K0HA 1D6WA 3RXAA 1P04A 3SV6A 3GYMA 3RUOA 1LKBA 3NCLA 2JKHA 5IYTA 1GJ6A 4B6FA 3F6UH 2PLXA 1C1RA 1UVUH 4JZIA 3TGJE 5FBEA 1SL3A 4DIIH 1E37B 4F48B 3TH3H 2A45B 1BHXF 4K1EA 2ANYA 1GGDB 4SGAE 2THFB 4NIYA 4R8TB 1Z8IB 1WQSA 2OC7A 4P02A 4YOJA 1INCA 1HFDA 1O2IA 1EAIA 1O2NA 4HG6A 3MNBA 3KNXA 1A0HB 3VB7A 3PMBB 4A1XA 1T4VH 2ANWA 2PR3A 1V2UT 1F92A 4XFQA 1HAXB 4SGBE 1JWTA 3TH4H 1EOLA 5A0CA 2OD3B 1TNGA 2J9NA 2TGPZ 2WPMS 3P17H 4ZKOU 8ESTE 4ISLA 5EG4A 5A09A 4X8UH 1GI3A 2YMSD 1TABE 1XX9A 1WAYB 1KXEA 2PFEA 2V7QD 4GCHG 4DJZB 1BRBE 3Q76A 4X1NU 4ZUHA 1HAGE 1LPZB 2AGGX 1V2JT 1W0JD 5ETXA 1YP9A 1FY4A 1C5MD 3M35A 1ZYOA 2FEQH 2GCTB 2RDLA 3N7OA 1UK3A 1A61H 4OGYA 4BANB 1O2LA 1O34A 1O3JA 2B0FA 1HNEE 3UNSA 3RXOA 1C5ZB 2SNVA 4YLUA 4K3JA 2WZQA 2W7SA 5F53A 1OP8A 1S0RA 2KM0A 1O5FH 3OEED 2CK3D 1P8VC 4JMYA 4NIVA 4WMEA 1GI4A 3PO1B 1TQ7B 3KQCA 3F0OA 2KAIB 1EB1H 1P10A 3ATKA 1HXEH 1QCPA 3RLYH 1HGTH 2B5TB 1QBOA 1ANCA 1V2QT 2QGRA 2ZHQH 4XDEA 1EX3A 4IMQA 2GD4B 1MU6B 2AGIX 1V2TT 1P3CA 1N6XA 1L1GA 3D62A 5E8EH 3N7EA 1OSSA 1C2FA 2QXHA 1RXPA 3FOAA 4JYUH 3Q00A 5K7RA 5EPYA 3AASA 1GI1A 2FOEA 3QZQA 1TAWA 1OXGA 3RXQA 2ZECA 3FZZA 3HK6B 1SLWB 3M5NA 4O9VA 1CHOG 4U2WA 1BHXB 1YLNA 4BAQB 2VVCA 3F68H 1C5LH 1EPTA 2SGDE 2VIVA 1GJ7B 1EAXA 1ZJKA 1MMJN 3P70B 4VGCB 4Y10E 3LIWA 3U8TH 1LMWB 3B8JA 1GJ9B 1WCZA 1O3GA 2JJ1D 1O3KA 1LVYA 2F9VA 1K2I1 2Q6DA 3M7TA 2CHAB 1AI8H 3ZZ3A 1ZSJA 3L6PA 4O97A 4OGXA 1WV7H 4YLQH 1O2ZA 2FX4A 4LK4A 1AHTH 5HMAA 1BITA 1GBIA 4LZ1H 1C5WB 3BTFE 4AORA 1GI5A 2A31A 1O32A 1SGNE 2CJIA 3PYHA 2ZDNA 1Q3XA 1H8ED 2QF5A 1FPCH 3I78A 3SU2A 3GY2A 1DUEA 1ZSKA 5C67A 1BA8B 1OYTH 1HXFH 1ELDE 4Y6DA 4X0WU 2PWXA 2ZCHP 3KQ5A 1F7ZA 1MU8B 3A7YA 3PWCA 1OS8A 2BZ6H 4B76A 1SFQB 2P94A 4IC6A 4CRFA 1P2IA 1ESBA 2W3KA 2CF9H 2FS8A 1QBNA 1W3CA 3SN8A 1H9IE 1QJ7B 3LGTA 1EP6A 1W0KD 3TGKE 1XUGA 2SFAA 1A7SA 5GXPA 1CA8B 2XC4A 1GBCA 4MLFB 1W12U 1Q31A 3QTVH 1C2GA 1HJAB 1GHYH 1GVKB 1SGPE 2AMQA 1C1NA 3HKJB 3ZVAA 1SSXA 2BY5X 2DUCA 1QNJA 1LVBA 1COWD 1V2ST 1NT1A 3TJOA 1Z6JH 2VIWA 3GDUA 1V6DA 4FUJA 1DWEH 3BTME 1FY3A 2JJ2D 1XMNB 1TGSZ 4ZMAH 1WYKA 2ESTE 3GCHB 1DT2A 1UCYH 3IWMA 1CQQA 1OP2A 3UFAA 2ZGXH 4P00A 1GHVH 1O38A 4KP0A 2SGEE 1AB9C 3A7ZA 3E1XB 1YPJH 5DK1A 4A6LA 3A86A 3MNXA 2BX3A 1LO6A 3EAJA 1QBVH 2V0BA 4ESTE 5FBIA 1G3CA 1AVXA 1E38B 7GCHF 1AQ7A 1Z1IA 1BDAA 2PTNA 1C5YB 2K0QA 5AVDA 4Y11E 2XC0A 2HLDD 4A1VA 3CENA 3E6PH 5T3HA 2G4UA 1NFUA 3A7VA 4E7NA 3FKSD 3STIA 1GMDF 1C1SA 1GBHA 3RXHA 1Z8RA 2BOKA 3U69H 1NO9H 4TWYA 1XUKA 2ZHFH 3T28A 1ABJH 4GUXA 4Q4LA 3EQ0H 2WSSD 1C5OH 3MTYA 1O5GH 2WV9A 4MDSA 1SFIA 2GZ9A 1THRH 1NFXA 2A4QA 1VITG 2A0QB 2RCEA 4X8VH 2BQ7B 2PKAB 1PPGE 1EZQA 3U1IB 1BMMH 3EA9A 4MG3A 1O33A 5EJLA 1LPGB 5EXMA 1TNLA 1BJUA 3ATIA 1KTSB 1E1QD 1SG8B 2K1QA 3EYDA 1EAUA 1SB1H 2GMTB 4AGKA 2IOTA 1C2EA 1O2HA 4BAOB 3KCGH 5FX6A 3A82A 1MCVA 1SC8U 2F9BH 3M5OA 1UVOA 3W94A 3KHVA 4MNYA 4ASUD 3FP7E 4AB8A 1FY8E 2D2DA 4X1SU 3A8CA 1C1TA 2J92A 6CHAB 4MPWA 2P16A 1MUEB 2P95A 1DSUA 4KTUA 1A46H 1ZSLA 2A4OA 2GT7A 3UB0A 2B8OH 2VVUA 4ABIA 2BD4A 4ISOA 7ESTE 1BB0B 1WBGB 1YYY1 4ABDA 1DLEA 1OWDA 4JCNA 2FESH 2VIDA 1ZMNA 3S69A 1K22H 1FAXA 2NU4E 3H5CB 3PMJA 4X1QU 5J4SA 2HOBA 4CBOA 1DFPA 2R3UA 1PQ5A 1RD3B 2G81E 1BTPA 3FAOA 4NFEA 1OOKB 3SORA 1C5UA 1AFQC 1NY22 3MFJA 1GHAF 4K69A 5HXFA 2H9HA 1RIWC 1IQMA 3K6YA 2O8UA 1KY9A 3RXTA 4JYTA 4YT7H 5JB9S 3P6ZB 3A83A 1BMAA 3SNBA 5FCKA 2BDAA 2R0KA 4X1PU 3SU1A 4Y79A 1WXRA 3L3TA 1UCYK 4YO9A 3GCTF 2RFKC 3A87A 2A7CA 4I86A 4NSYA 1EQ9A 4Y0ZE 3HKIB 2FX6A 2Y6TA 5F6MA 9ESTA 1ZRKA 2FTMA 1VCWA 2CMYA 2ZDVH 4FUEA 2WV4A 2KAIA 2VH6A 5ABWA 1LKAA 2WV5A 4YTAA 1C5RA 1ACBE 4NA8A 2QXIA 4HGCA 2Z9GA 1HB0B 3VB6A 3W95A 2UUFB 2QA9E 4CH8B 4I33A 3QGNB 5C1YA 5K0HA 1TNJA 3TK5A 3T26A 2BDYA 2BD8A 1BCUH 3E0PB 4DG4A 4WH6A 2G5VA 3T5FH 1NS3A 3MNCA 4OS4A 2Z9JA 1OX1A 4ISHH 5F8XA 3KYFA 3RXPA 1SQRA 1E1RD 1QL9A 4NSVA 1RGQA 2ZDLA 1MZDA 1O2OA 1ZZZA 3MYWA 1RS0A 1UO6A 2WPKS 5C0TA 2FDAA 2YNAA 1Y3UA 1ZJDA 1AVGH 3TJNA 2AMDA 4FXGH 3DSGA 3RM0H 5HKKD 2Q6FA 1TNKA 3VB4A 2XBYA 4JZEH 2J5UA 5EW2H 4ACAA 3V3MA 1MTSA 1YPEH 1GHBF 1OHHD 3URCA 1NESE 4Z1MD 2JH5D 1Y3WA 3T29A 1AFEH 2HPPH 2ZFTA 4DURA 2AGEX 3GISB 1IQIA 5A8YA 1VZQH 1ZGIA 3SV7A 3LC3A 1GCTC 4FUBA 4FU9A 5G4BA 5FAHA 1AE5A 3MH5A 3GY3A 4B74A 1GI2A 2STAE 3Q77A 1PJPA 4OS7A 3PM3A 4NFFA 3RXMA 2I6SA 1YLDA 2ODQA 3FP8E 1YPHC 1NBMD 1ELGA 1MTNB 3F2FA 1O30A 2VWMA 1ESAA 2BY7X 1H8DH 1O2QA 1VJ9U 3A7XA 2WPHS 1GBKA 1PYTD 2AIPA 4UFGH 4BTTB 2OTVA 1T8MA 1FIZA 1GG6C 1A3EH 2Y82A 4OS2A 3TVJB 1TOMH 4RT1A 3RU4T 1CHGA 2AHME 3K6ZA 1CBWB 2G55A 3ZVDA 2J97A 1LHDH 1SLUB 1ZR0A 1TGTA 1EP5A 4ZXXH 1N1LA 1J14A 4AFQA 1S81A 1KMHB 1OP0A 4K2YA 2UWPA 1UW7A 1DPOA 3OTPA 3UWJH 3ZV9A 3ENSB 3NWUA 4I8KA 1D3TB 3MH6A 3EGKH 5B6LA 2ZU2A 1QB9A 1E34B 3K65B 1ID5H 4TWWA 2A7JA 4D9QA 1EFRD 4YT6H 1GMCF 2P3UB 5TCAA 1LHCH 5T1VA 2FTLE 1LHGH 1NFYA 1TX8A 1S82A 1ZMLA 5AHGH 1UMAH 2QE7D 1SGRE 1DLKB 5GWZA 2BXTH 3WWBA 1V2KT 1YPGH 1YPLH 2BVSH 1MTVA 1AZ8A 3BSQA 4YESB 5AF9H 1AMHA 4WMFA 1KSNA 3ZZAA 1ZGVA 3FZDA 1O3BA 3B9FH 2QF4A 3PRDA 1AY6H 2GTBA 1Z8JB 2JETC 2ZA5A 2SGAA 2EI7A 1SLXB 1HUTH 1GBTA 1EOJA 2ZDKA 4ZXYH 3VXFH 5C20A 3AW0A 1H8IH 1QA7A 2ZU5A 4Y7BA 3UOPA 4I7YH 2XNIA 3NK8A 3E90B 4ABFA 1DICA 1VCQA 5DN6D 1W7GH 1HPGA 3PTBA 2GCHG 2SGPE 3IG6B 4B73A 1O39A 4ZHMU 1H4WA 1TYNA 2AYWA 4X6OA 3SJ9A 1BBRH 1ZPCA 1V2NT 2O9QA 2PKAA 1O2XA 2VGCB 4K8YA 4TSFD 2GDEH 2GDDA 3NZIA 2Z3CA 4ABJA 2B9LA 1MAYA 2GGVB 5JYIA 1SGYE 1P2MA 5DP6A 5JB8S 2FODA 3N7DA 1SHYA 3SUGA 4RN6A 2QF0A 1PPCE 1CA0C 1XM1A 2AH4X 3K2UA 2OINA 3P95A 4ZKNU 1P02A 2L6OA 1F5KU 5C1UA 1OWEA 3LGUA 3GCOA 2BDIA 4Q7YA 2NU1E 1QA0A 1A5IA 1VITH 3SI3H 2KFWA 3RXIA 4KELA 1ORFA 1ZPZA 1GBMA 2KCOA 1FUJA 1MKXH 1Z6EA 2WPIS 4LXBH 2XYAA 4DVAU 4BTIB 1ELTA 1DM4B 3SI4H 1CT2E 2QF3A 3V0XA 1Z7KA 2BMGB 1NC6A 2RA0A 1ELFA 1D3DB 4INKA 2FOAA 3M3TA 1Y5AT 3FVFB 2C90B 2Y81A 1QHRB 2ASUB 3RU4D 2J94A 1BTZA 1EJMA 4Y8XA 2W6ID 1GPZA 1S0QA 4XRNA 4H42U 1G9IE 4UFFH 3UR6A 3GY5A 2XBXA 4ABGA 4DGJA 2G5NA 4B2CA 2A4GA 3SNAA 1MZAA 4INHA 3BG8A 8GCHF 3Q3XA 3UIRA 1YWUA 3STJA 2VVVA 1AN1E 2CGAA 2D1JA 3GICB 4MVNA 4ZHLU 1LPKB 2ZGBH 4M9FA 2NU0E 2O8WA 1O2GH 2ZFRH 4O03A 5DG6A 1BTHH 2ZFFH 3BTHE 2B7DH 5DPAA 3ZIAD 3E0NB 5E2PA 4ZAEA 1ETTH 3MH4A 3QWCH 3TK9A 4CHAC 1FX0B 1F5LA 3RC5A 4YOGA 3SUDA 4R0IA 2XBVA 1G3EA 1HYLA 5EJZA 4Q63A 1N8OC 2YMSC 2J4IA 3U8RH 1P2QA 1SGIB 1F0RA 3ZZ8A 4RKJB 4B2BA 3BTEE 5CHAC 3QLPH 7KMEH 4I31A 1SLVB 2ODYB 2Y80A 2XW9A 1PPBH 4NZLA 1O2VA 2BQWB 2Z6BD 1EKBB 4JZDH 1FJSA 2ZP0H 4OM9A 4XBCA 1IQKA 1VGCC 3BTWE 2RG3A 3OSYA 2GX4A 2KR7A 1O3PB 4HTCH 1GL0E 1QZ8A 3E16B 2FI3E 4CR5A 1DY9A 1HDTH 1T32A 3RP2A 2A32A 3D23A 3DUXH 1GJ8B 1SQAA 3BTGE 1A5HA 2VH0A 1FZZA 1UVSH 2FOGA 1NRNH 2WPLS 3F9GA 1CVWH 1GMHF 5A8XA 4WMDA 1AE8H 1SGQE 6GCHG 4H6SB 3KQEA 4NIWA 1Z71A 5BPEA 2ZO3H 3ATLA 5EU8A 3QGJA 1HV7A 3AW1A 2QCYA 1BBRK 1YY3A 2DE8A 2LNCA 2HNTF 3UOUA 3SU0A 3GDVA 4RSPA 1F0SA 4BXSA 1FQ3A 5DP7A 2GP9B 4UFDH 5C0UA 3TK6A 4WF8A 3FANA 1S6FA 4YM9A 3F2GA 3F3BA 1BRCE 4O3TA 3V7TA 1UK4A 3RXFA 4HFPB 1K1MA 3OX7U 2J98B 5DGJA 1EPTC 2ZWLH 1UTMA 1Y5UT 3JZ2B 1TQ0B 2WUBA 2ZFQH 1SHHB 1RJXB 1O2KA 2BDHA 2H9EH 2F43B 2GKVE 3LPRA 1MKXK 5E0JA 1J16A 3TU7H 1G37A 3NUMA 4A1TA 1GG6B 2A2XH 4MNVA 1XUHA 2C3SA 4YZUA 3ZVCA 3RXKA 3RC6A 1V2MT 3DT0H 2BD2A 1H1BA 1SBWA 2K8IA 1FMGA 3QX5H 1C9TA 2SGFE 3LONA 1ZTJA 1P9UA 2CN0H 5GCHF 2A5IA 2V35A 2Z9IA 3PWBA 3R0FA 4D76A 4K60A 5EOKA 3TNSA 1DUAA 1TPPA 2XRCA 3VXEH 3W1EA 3A8DA 4Q2KA 2OP9A 3BIVH 1GHWH 1MKWH 1L1JA 1MABB 1TMTH 2DE9A 4IBLH 5FHTA 1HAPH 1W7XH 2P8OB 3S9BA 4AB9A 1TA6A 1BTUA 3QTOH 4XBBA 1A0LA 1C5SA 3P92A 1L0ZA 1TFXA 2PKSC 1AWFH 2Y7ZA 1DX5M 1V2OT 3PTNA 2GT8A 3TIUA 1J15A 1GJ5H 5DP4A 2M5TA 2WPDD 4ZKRU 1O3OA 1KDQB 5ESTE 1QFKH 1YPMH 2BHGA 1C2HA 1M9UA 2PP6A 3N99A 4FUFA 2UWOA 1PFXC 1ZMJA 5EQRA 3SYJA 3TH2H 2QXJA 2BLWA 7LPRA 1A2CH 1H8HD 1AVWA 2JH6D 3LJJA 2F9PA 4FUCA 3MMGA 2VINA 3RXLA 3CS0A 5CHBA 3T25A 4I8GA 1JIMA 3TITA 2BLQA 4AYVB 4NWKA 1O3FA 2Z3EA 5A0AE 1A4WH 4FUDA 3MU0A 1O2YA 4LOYH 3RXBA 1GJCB 1IOEA 1GI9B 2BM2A 1GBFA 1U6QA 2AIQA 1IQHA 3OY6U 4IS5A 3KYGA 3UTUH 2D26C 5C5OA 8KME2 2PHBA 2FXRA 3OY5U 4DCDA 2GZ7A 1TIOA 3RMMH 2XXLA 4RT0A 1Q2WA 4JZFH 1TMBH 1HAIH 1O3DA 2ZZUH 1LVMA 2O8LA 2VNTA 2QC2A 3M5LA 3RXVA 4GHQA 2H2ZA 4Y8YA 1YF4A 2TPIZ 5ESBA 1UJ1A 2BOHB 1O3MA 4XOJA 3URDA 3UQVA 1HAHH 3P8OA 4ISNA 3MH7A 1O5BB 4CRDA 1J17T 3SGQE 1C5XB 3QZRA 3KGPA 5GIBA 5A8ZA 3PV2A 1B0FA 4B2AA 3QDZB 3BEUA 2ZKSA 2KCPA 1O2SA 1FI8A 4IN1A 1UTLM 2G4TA 2W26A 1O37A 1V2RT 1GDNA 4Z6AH 5E0GA 3S9AA 2UWLA 3A81A 1NU9A 2XTTB 3BG4C 2I6QA 1UTKA 3FP6E 2ZU4A 2CXVA 1CT4E 1UK2A 3SGAE 3ESTA 4J2YB 1BUIA 2JIZD 1AU8A 1QL7A 2D8WA 2WUCA 3U1JB 1CO7E 1YPHE 2ZC9H 3L33A 2GV6A 3MOCA 2ALPA 2BDBA 4NA9H 3MU8A 3B23B 1KXFA 4AX9H 1GL1A 1W0ZU 1GGDC 2PGBB 2ZDAH 5FPTA 5DSFA 1E35B 2ZCLP 2ZHWH 2Y5FA 2Z7FE 2XCFA 5L2YH 5KEDA 1D3PB 3GOVB 2BTCE 1T31A 4FVDA 3LC5A 1NM6A 2HALA 3BV9B 2OLGA 1MKWK 1NRPH 1YKTA 4UONA 1SI5H 4GHTA 4E05H 5EXLA 1QURH 3ZVEA 1MBQA 1XXFA 1GBLA 3RDZA 2G51A 3M3SA 3T2NA 1FN6A 1VR1H 3QN7A 1N8OB 4MNXA 3VGCC 3KQBA 2A7HA 2O8TA 1SGCA 1O5CB 1TBRH 3H7OA 1JXPA 1V2WT 1GVLA 4GLYA 2G52A 2SGQE 5C3NA 4CRCA 2BD9A 2A5AA 1HIAA 3U28C 3VB5A 1A1RA 3GY7A 1GJ4H 4RKOB 2G00A 2GCTC 3PLPA 3GCNA 5IK2D 3RM2H 4ZCNA 1HRTH 4FUGA 2BXUH 1ZRBA 4D7GA 2OCVB 1C5TA 1O5EH 3QUMP 2OBQA 1C4V2 3LU9B 4ABAA 2FI5E 7GCHG 1EZSC 1P06A 2AFQB 2PUQH 4INLA 4CREA 1KXCA 1KTTB 2OQUA 1SKYE 1GMDG 1G2LA 3S7KB 5JPMH 3MHWU 1SQOA 2BLOA 1P09A 2BD5A 1C2JA 3BTDE 1UVPA 3PO1C 3OFND 1GI0A 1DY8A 2HRVA 2HNTE 1V2LT 2OC0A 4ABHA 2VWOA 1YLCA 2QAAA 2V6NA 1ETSH 2FLBH 2NWNA 2PV9B 4E7RG 2C8YB 3IITA 4TY6A 1PPHE 5EGMA 2WPJS 1NRRH 3EA7A 3I29A 4BTUB 3ZZ5A 3BF6H 1G3BA 4I8JA 4JK5A 1J9CH 4Q7ZA 1LVOA 1H9HE 3PMAB 3C1KA 4UE7H 1NPMA 1JIRA 1TE0A 2HVYB 3DFLA 5DP9A 5GJ4B 1BTYA 3GY4A 1DXPA 4TPYA 4FU8A 1FIWA 2AEIH 1TRMA 1C1MA 5T6FA 1NRQH 1C5PA 2J98A 4NGAH 4DY7B 4VGCC 1O3HA 2ODPA 3E8LA 1ANEA 2ZCKP 3RXDA 1S84A 2QIQA 1GBJA 3DA9B 2CHAC 4YOIA 4AGJA 4CRAA 1GHZA 1XUIA 1PPFE 1TA2A 3F2HA 1FY5A 3BTKE 3SNEA 3ZV8A 1ZTKA 2ZI2H 2GJGA 1ZLRA 4JYVH 2JDID 2TGAA 1CSOE 1EB2A 4MPXA 1C4U2 6ESTA 1YM0A 1PQ8A 1ZHRA 1SQTA 4IC5A 4XSKU 5SGAE 1QB6A 1WQVH 2IN2A 3ATWA 1JMOH 1SR5C 9LPRA 1QRWA 1PPEE 4GCHF 4ACBA 1QB1A 4JK6A 5HIZA 4AN7A 3OEHD 2JH0D 1GBDA 1PYTC 1GHAG 1EJNA 1VJAU 3SU3A 4IN2A 3SZEA 4K1SA 1AB9B 1HJAC 4GVUA 5A2MH 1O3LA 3KN2A 1K1PA 1SVPA 1KDQA 4KTSA 2Y5HA 3DFJA 1IAUA 1B7XB 2W7UA 4X6PA 2OC8A 3ZVFA 2C8WB 1C9PA 4GPGA 2W5EA 1GVZA 3GCTG 3LGWA 4NA7A 2Z94A 1IQFA 1ARCA 1Y5BT 3F9HA 2QY0B 1HAZB 1WTHD 2P93A 2ANMH 3I77A 3SHAH 3GCHC 3RXJA 1P2KA 3ZZ7A 2ZPSA 1UTOA 5AFZH 1K9OE 3KQDA 2F9NA 2VWNA 4A5TS 4PROA 3TPIZ 2OUAA 1YC0A 1TMUH 3M7UA 5J4QA 3A7WA 1L2EA 4TY7A 2FOMB 1EUFA 3K9XB 1TONA 2FYQA 3ODDA 3PRBA 3RXUA 3PLKA 1MH0A 1P2NA 1TPSA 1O2PA 1ARBA 3VPKA 2ZPQA 1WOFA 1O2RA 1NZQH 3UR9A 4MPVA 1GI7B 2VU8E 1V2VT 4X2YA 2UUJB 2EC9H
chains in the Genus database with same CATH topology
1ZHPA 1P05A 5EW1H 2XWBI 5C1XA 3T62A 1SOZA 8LPRA 5CE1A 1EAWA 4Y76A 4F49A 1CHOF 4ZHAA 2HGTH 4U01A 3SNCA 1C1PA 1O3CA 1X7AC 1KLIH 5DKMA 1FXYA 1LTOA 1GHBG 1C5QA 2A5KA 3FFGA 2BD7A 3A80A 2FLRH 3ELAH 3ZZ9A 3CS7A 3BTTE 3F9FA 5DP5A 1DWCH 2FI4E 2ZIQH 4KTCA 1LQEA 2EA3A 3S7HB 3RXEA 1DWDH 2BVXH 4Q80A 2PUXB 2GMTC 5JDUB 1P2OA 3BIUH 4Y0YE 1G36A 1TNHA 2QV1A 3QO6A 4Y7AA 5A0BA 4I32A 3QK1A 5DO4H 4UFEH 2UUYA 2ILNA 3A7TA 3U9AH 1YCPM 1ANBA 3SJ8A 3Q3YA 2HVXA 1K28D 3KF2A 2PSYA 1AKSA 4BOHA 4ABBA 2PW8H 1Y8TA 1PQ7A 3CP7A 1A3BH 2C93B 1EZXC 1UCYE 4UDWH 3UUZA 1MQ6A 6CHAC 1V2PT 4ZH8A 1BQYA 1HLTH 1D4PB 2P3FH 2TIOA 4M7GA 3SJIA 3SW2B 1AFQB 3ZVGA 2OQ5A 2EI6A 3MU4A 1B0EA 1SMFE 1RIWB 4X2WA 1G30B 1SGFA 2ZPRA 3LH3A 2HWLB 4WXVA 1AZZA 2XC5A 5L6NH 1TOCB 5LPEA 2QXGA 2QN5T 5F8ZA 3BEFB 3VGCB 4U32A 3SGBE 3LGVA 1LHEH 3WY8A 5JBTA 1GMCG 1W13U 1GHXH 4NZQA 2TRMA 1OWIA 1SOTA 4ZKSU 3SBKA 1TBZH 5JBAS 1ELCA 1HCGA 3SQHE 4O3UA 3HK3B 5PTPA 2LPRA 1HIAB 2IJOB 2QYIA 2BD3A 4CH2B 1HBTH 2XWAA 1QL8A 1K1OA 5EQSA 1LQDB 3RC4A 2BLVA 2STBE 1TBQH 2VWLA 2ZQ1A 1WU1A 3BN9A 2F9UA 2J2UA 4X6NA 2UUKB 1K1JA 1TX7A 2A2QH 3KEEA 4AFSA 4X8TH 3LGIA 3RXRA 1THPB 4K1TA 5FX5A 1O5AB 2GZ8A 1Y3VA 1IQJA 1O2JA 4X6MA 5AFYH 1Z1JA 1C1QA 2H5CA 4MTBA 2BY6X 3H7TA 4J1YA 2FWWA 4FUIA 1NTPA 2ZGHA 1VITF 2AERH 4GSOA 5HGGA 3M7QA 4X2VA 1DDJA 5T6DA 5C2ZA 4BAKB 1IQNA 2ZF0H 3M61U 1GCTB 1O5DH 1JBUH 1W0YH 3V13A 4ABEA 1BZXE 1P3EA 2ZHDA 1KYNA 1A5GH 5BRRE 5IDKA 4K8BA 1JRSA 2BB4A 5EPNA 1P03A 5HM2A 3OTJE 4NIXA 3UY9A 3C27B 3DD2H 4TPIZ 3A85A 3A88A 1RFNA 3E91A 1LDTT 1D3QB 2XCNA 1AWHB 1KXBA 1DITH 1AGJA 1ELAA 1S5SA 1GJAB 1F2SE 1GDUA 4B75A 3A89A 2ZG0H 1PQAA 1UVTH 1QRXA 3EE0B 1HAYB 5HM9A 4X8SH 5E0HA 3TNTA 4BXWA 3GY8A 1AIXH 2FOBA 2Z3DA 5TJXA 5LPRA 1O31A 1T7CA 2IPHA 3UREA 1UHBA 1CU1A 3SV8A 1JOUB 1O2MA 3VEQB 1MTNC 1BT7A 1QJ1B 5C5NA 1GBAA 4H4FA 3S0NA 8GCHG 3PROA 1GJBB 3LT3A 3TLOA 2BVRH 3ZYEA 4MPUA 1BTXA 2BDCA 1WUNH 2WYJA 1T4UH 3V12A 1TLDA 1CGIE 4IGDA 1EATA 4IMZA 1CBWC 1ZOMA 3ZZ4A 4FVBA 4AFZA 3SU6A 1XUJA 5TCCA 2HPQH 2ZTZA 1O3IA 1DXWA 1WTGH 4A92A 2ZTXA 2FMJA 1CE5A 3RXSA 4E06H 2HLCA 1MTWA 4DIHH 2C4FH 2R3YA 2ZFSA 2JETB 1FNIA 2BY9X 4X1RU 3O8DA 4NG9H 5E2OA 1GCDA 1O2WA 4BNRA 2A1DB 1W11U 1C1WH 4CR9A 1HAVB 1T8OA 4GAWA 4ISIH 3SZNA 3LKWA 2G8TA 3ZZDA 2V3OH 3A84A 2A4RA 4DT7B 1F5RA 2ZQ2A 3EA8A 3PLBA 1TWXB 1SGDE 4UEHH 1S85A 3M3VA 2W3IA 3HPTB 2FS9A 4WWYA 4QT8C 2BX4A 2OXSA 4AOQA 4DOQA 4AFUA 1QR3E 1BOQA 1OPHB 2FYRA 1O3AA 1OYQA 2XBWA 4ASHA 2P59A 1C2KA 1QJ6B 1THSH 2GVFA 1GMHG 1IHTH 1BRUP 2VIQA 1HJ8A 1CA0B 2J95A 4DW2U 1C4Y2 4MQAA 5LGOA 3RXGA 2FOHA 4B1TA 2ZHEH 2CF8H 3RXCA 1JRTA 3P8FA 2RA3A 4THNH 3E3TA 1FPHH 6LPRA 1Y3YA 4X2XA 1QGFA 3UWIA 4ZROA 2R0LA 1O2UA 1GWAA 3Q3KA 1O36A 2SNWA 1NROH 1UTPA 3ZZ6A 1K21H 1MD8A 2VGCC 1DWBH 2TBSA 2BDGA 2FZZA 3S9CA 1B5GH 2ZGCA 3MU1A 4WVPE 2YNBA 1LHFH 4XBDA 1MQ5A 4WXIA 3MO6A 3D49H 1EXFA 1K1LA 3M5MA 4HI3A 1OWHA 1C2MA 2R2WU 5FCRA 1XUFA 2Z9KA 4D8NA 1MCTA 1MAXA 1QRZA 1Z8GA 1FY1A 1EASA 1AKSB 2ZNKH 1AO5A 3BEIB 1RRKA 3SO3A 3NKKA 1A0JA 5L30H 3LH1A 1C2LA 1TX6A 1C1UH 1FN8A 1Y3XA 5GCHG 2OC1A 1ABIH 2VB0A 4CRGA 1L4DA 4KKDA 1D6RA 1BTWA 1C1VH 1ETRH 4CHAB 3PB1E 3UPEA 2EI8A 1C5NH 4OS6A 1RTLA 2J38A 4H6TA 3SOSA 1TRYA 1YCPH 4Y8ZA 1BMNH 1QQ4A 2R2MB 2F91A 1P01A 5GPIB 2FP7B 2FOFA 1TNIA 4U30A 1KLJH 1TALA 4WY3A 3TJUA 3P8GA 5CHAB 1OWJA 1YPKH 4FUHA 1C1OA 3JZ1B 5I46H 4CRBA 3OU0A 1P11E 4KGAA 3O8BA 1E0FD 1FONA 4Z0KA 1VGCB 5FXLA 1SGFG 3PV4A 1C5VA 5HYOA 1BBRE 3GY6A 3AAUA 4B71A 4D9RA 3RLWH 1F0UA 1O3NA 2R9PA 4AG1A 2V3HH 4Y71A 2BYAX 4WJG2 3P8NA 2F83A 5EXNA 1UTQA 1NU7B 2EEKA 1IQGA 1TGNA 4BAMB 1K1IA 1VCPA 1RTFB 1OWKA 1D9IA 1P0SH 4IW4E 3TJVA 4AYYB 1CGJE 1P57B 3U8OH 2TGTA 3A8BA 2NU2E 2VIOA 1S83A 5FPSA 2FOCA 1KXDA 1C2IA 3HGNA 2H9TH 3O8RA 1FDPA 2F9OA 1DSTA 4AG2A 1AUTC 5L2ZH 2GV7A 2ULLA 3SHCH 3MU5A 2ZDMA 2GCHF 1AD8H 1IHSH 3HATH 2BZAA 2ZU3A 4BAHB 3A8AA 1F0TA 4A7IB 3KIDU 5DP3A 3G01A 1W10U 1ESTA 5FPYA 3TGIE 1O0DH 1YGCH 3T27A 1W8BH 3LGYA 1TGBA 1GJDB 1TPAE 3UNRA 1RTKA 1EPTB 1O3EA 3OYPA 5LPFA 5H4IB 3SQEE 1XVMA 3MNSA 1KIGH 2Y5GA 1O35A 1P12E 3LOXA 3NXPA 2WYGA 3SJKA 1ELBA 1ZTLA 5I25A 2AS9A 1EZUC 4NCYA 3ZZCA 3SV9A 3RMNH 3PMHB 1FLEE 4OS5A 1N6YA 3SU4A 1IQLA 2H6MA 1AUJA 4K5ZA 5DP8A 1GI8B 2Q6GA 3LJOA 1SGTA 3M37A 1XKBC 1MBMA 3R3GB 3SNDA 4F4OC 1ELVA 5F8TA 2J34A 3RMLH 3VB3A 4LZ4B 2OBOA 3F1SB 1UTNA 3UNQA 4CBNA 1NFWA 1S6HA 1CGHA 4UD9H 2ZEBA 3D65E 4WH8A 1TRNA 2Y7XA 4OS1A 2ANKH 1T8LA 2TGDA 1SGEE 1TB6H 1GI6A 4XE4A 1XVOA 1KXAA 5GDSH 3U98H 1P9SA 1UHBB 2Q1JA 1GBEA 2ZTYA 5JBBS 3DHKH 5CMXH 2PGQB 4FU7A 1CT0E 1BJVA 1DS2E 1L1NA 1C2DA 1UTJA 1P2JA 1XXDA 4AZ2B 1ZHMA 2PKSB 5EQQA 2O8MA 5F03A 1DOJA 3GYLB 2PSXA 2FPZA 3KL6A 5B6OA 2C8ZB 4JZ1A 1HAOH 2Z9LA 1G3DA 4Q7XA 1T8NA 1DANH 1WSSH 4I8HA 1YCPK 2FIRH 2BQ6B 1TGCA 1ZPBA 3MI4A 2NU3E 1L4ZA 3LDXH 3M36A 3RU4E 2H5DA 3ZVBA 2ZFPH 1NN6A 1TPOA 1IQEA 1XKAC 1NRSH 2P8OC 2PTCE 2P3TB 3SUFA 1W14U 2WINI 2VIPA 3ODFA 1KLTA 3VFEA 2F3CE 3GDSA 5EODA 3ITIA 2CV3A 4TYDA 4D7FA 1HAVA 5JBCS 3BTQE 1BMLA 1W2KH 4NWLA 2AMPA 3ZYDA 3EDXB 2FM2A 1HJ9A 2BY8X 2YOLA 1PPZA 1MD7A 1SPJA 4I8LA 1QQUA 2FO9A 2H1UA 1H9LB 1J8AA 1K1NA 3UQOA 1ELEE 3SU5A 3MO9A 2ZGJA 3ATMA 1OKXA 1V3XA 1GBBA 1EJAA 2ALVA 3SV2H 3O8CA 1G2MA 1QTFA 5LH8A 1FV9A 6GCHF 3NPSA 2HNTC 5T6GA 1G32B 2C8XB 1FAKH 1YBWA 3AVZA 1Y59T 1BIOA 1MTUA 3MO3A 3RMOH 3SUEA 4MNWA 3HGPA 1DE7H 3AAVA 3ZZBA 1ANDA 5DJ7A 1E36B 3F9EA 1LCYA 1GDQA 2ZU1A 3SJOA 1QIXB 1QY6A 1BRAA 2VJ1A 1DVAH 1O2TA 3BG4B 4HZHA 3MWIU 1D6WA 3RXAA 1P04A 3SV6A 3GYMA 3RUOA 1LKBA 3NCLA 2JKHA 5IYTA 1GJ6A 3F6UH 2PLXA 1C1RA 1UVUH 4JZIA 3TGJE 5FBEA 1SL3A 4DIIH 1E37B 3TH3H 2A45B 1BHXF 4K1EA 2ANYA 1GGDB 4SGAE 2THFB 4NIYA 4R8TB 1Z8IB 1WQSA 2OC7A 4YOJA 1INCA 1HFDA 1O2IA 1EAIA 1O2NA 3MNBA 3KNXA 1A0HB 3VB7A 3PMBB 4A1XA 1T4VH 2ANWA 2PR3A 1V2UT 1F92A 4XFQA 1HAXB 4SGBE 1JWTA 3TH4H 1EOLA 5A0CA 2OD3B 1TNGA 2J9NA 2TGPZ 2WPMS 3P17H 4ZKOU 8ESTE 4ISLA 5EG4A 5A09A 4X8UH 1GI3A 1TABE 1XX9A 1WAYB 1KXEA 2PFEA 4GCHG 4DJZB 1BRBE 3Q76A 4X1NU 4ZUHA 1HAGE 1LPZB 2AGGX 1V2JT 5ETXA 1YP9A 1FY4A 1C5MD 3M35A 1ZYOA 2FEQH 2GCTB 2RDLA 3N7OA 1UK3A 1A61H 4OGYA 4BANB 1O2LA 1O34A 1O3JA 2B0FA 1HNEE 3UNSA 3RXOA 1C5ZB 2SNVA 4YLUA 4K3JA 2W7SA 1OP8A 1S0RA 1O5FH 1P8VC 4JMYA 4NIVA 4WMEA 1GI4A 3PO1B 1TQ7B 3KQCA 2KAIB 1EB1H 1P10A 3ATKA 1HXEH 1QCPA 3RLYH 1HGTH 2B5TB 1QBOA 1ANCA 1V2QT 2QGRA 2ZHQH 4XDEA 1EX3A 4IMQA 2GD4B 1MU6B 2AGIX 1V2TT 1P3CA 1N6XA 1L1GA 3D62A 5E8EH 1OSSA 1C2FA 2QXHA 1RXPA 4JYUH 3Q00A 5K7RA 5EPYA 3AASA 1GI1A 2FOEA 3QZQA 1TAWA 1OXGA 3RXQA 2ZECA 3FZZA 3HK6B 1SLWB 3M5NA 4O9VA 1CHOG 4U2WA 1BHXB 4BAQB 2VVCA 3F68H 1C5LH 1EPTA 2SGDE 2VIVA 1GJ7B 1EAXA 1ZJKA 1MMJN 3P70B 4VGCB 4Y10E 3LIWA 3U8TH 1LMWB 3B8JA 1GJ9B 1WCZA 1O3GA 1O3KA 1LVYA 2F9VA 1K2I1 2Q6DA 3M7TA 2CHAB 1AI8H 3ZZ3A 1ZSJA 3L6PA 4O97A 4OGXA 1WV7H 4YLQH 1O2ZA 2FX4A 4LK4A 1AHTH 5HMAA 1BITA 1GBIA 4LZ1H 1C5WB 3BTFE 4AORA 1GI5A 2A31A 1O32A 1SGNE 2CJIA 3PYHA 2ZDNA 1Q3XA 1FPCH 3I78A 3SU2A 3GY2A 1DUEA 1ZSKA 5C67A 1BA8B 1OYTH 1HXFH 1ELDE 4Y6DA 4X0WU 2PWXA 2ZCHP 1F7ZA 1MU8B 3A7YA 3PWCA 1OS8A 2BZ6H 4B76A 1SFQB 2P94A 4IC6A 4CRFA 1P2IA 1ESBA 2W3KA 2CF9H 2FS8A 1QBNA 1W3CA 3SN8A 1H9IE 1QJ7B 3LGTA 1EP6A 3TGKE 1XUGA 2SFAA 1A7SA 5GXPA 1CA8B 2XC4A 1GBCA 4MLFB 1W12U 1Q31A 3QTVH 1C2GA 1HJAB 1GHYH 1GVKB 1SGPE 2AMQA 1C1NA 3HKJB 3ZVAA 1SSXA 2BY5X 2DUCA 1QNJA 1LVBA 1V2ST 1NT1A 3TJOA 1Z6JH 2VIWA 3GDUA 1V6DA 4FUJA 1DWEH 3BTME 1FY3A 1XMNB 1TGSZ 4ZMAH 1WYKA 2ESTE 3GCHB 1DT2A 1UCYH 3IWMA 1CQQA 1OP2A 3UFAA 2ZGXH 1GHVH 1O38A 4KP0A 2SGEE 1AB9C 3A7ZA 3E1XB 1YPJH 5DK1A 4A6LA 3A86A 3MNXA 2BX3A 1LO6A 3EAJA 1QBVH 2V0BA 4ESTE 5FBIA 1G3CA 1AVXA 1E38B 7GCHF 1AQ7A 1Z1IA 1BDAA 2PTNA 1C5YB 5AVDA 4Y11E 2XC0A 4A1VA 3CENA 3E6PH 5T3HA 2G4UA 1NFUA 3A7VA 4E7NA 3STIA 1GMDF 1C1SA 1GBHA 3RXHA 1Z8RA 2BOKA 3U69H 1NO9H 4TWYA 1XUKA 2ZHFH 3T28A 1ABJH 4GUXA 3EQ0H 1C5OH 3MTYA 1O5GH 4MDSA 1SFIA 2GZ9A 1THRH 1NFXA 2A4QA 1VITG 2A0QB 2RCEA 4X8VH 2BQ7B 2PKAB 1PPGE 1EZQA 3U1IB 1BMMH 3EA9A 4MG3A 1O33A