1N6YA

Rip-phasing on bovine trypsin
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Trypsinogen, cationic
publication title Specific Radiation-Damage Can Be Used To Solve Macromolecular Crystal Structures
pubmed doi rcsb
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2002-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1n6yA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1n6yA02
2QF0A 1NO9H 1VCPA 1VZQH 3SU1A 5AHGH 1GHAF 1SGIB 2PWXA 1GI7B 1XUFA 3LC3A 1ZJKA 4OS7A 4CR9A 2FI4E 3BTHE 1DDJA 2AMQA 1EZSC 3K6YA 1XX9A 3LIWA 1IHSH 2Y81A 1DUAA 2GVFA 1O3JA 3LH1A 3TH2H 2WPJS 3M5NA 4ISNA 3QGNB 3BV9B 1G9IE 4XFQA 1C5OH 2FYRA 2B8OH 2QIQA 1H4WA 3M7TA 2BDCA 1TNHA 1TGTA 1NROH 1RGQA 3T5FH 1EKBB 3ZYDA 1YPHC 4KELA 5FPSA 6GCHF 1E0FD 1GJBB 1C1OA 5T3HA 1IQIA 1Q3XA 3TJNA 3R0FA 5FHTA 1H8DH 4CRCA 5K0HA 1CE5A 4NCYA 3F9FA 1ETRH 2A7HA 1O2HA 3SU0A 2TPIZ 1IQFA 5JDUB 2TGPZ 1Z8RA 3DA9B 1TBQH 3MU1A 5JBCS 1C1PA 2PTCE 1AFQC 1RS0A 3LOXA 3RXPA 1E38B 4KTCA 3ATMA 3M3SA 5F03A 3QWCH 1TMTH 4I8JA 1IQMA 1JXPA 2BZ6H 1QQUA 3ZVBA 3MTYA 4RKJB 1BTXA 1PFXC 1LTOA 5CHAB 2OUAA 3UQOA 1YPHE 1O5AB 2AIPA 1BOQA 1MBMA 1HPGA 3Q76A 4Q80A 2VJ1A 3MH6A 3PWCA 4OS6A 5LPRA 1UMAH 5ESBA 1IQHA 1C1MA 3QO6A 4ZHLU 2W26A 1G2MA 3RLYH 3F9GA 2EEKA 2OP9A 5FCRA 3A81A 3RXVA 4K1TA 4NIWA 5GCHF 2O8MA 1G3BA 1AE8H 1XVOA 2A5AA 2JH0D 1HAOH 2NWNA 2VU8E 4FU9A 1PPGE 2BVXH 1V2WT 3RM0H 5C20A 1YCPM 1BZXE 1MTNC 3ZVCA 3RMMH 3M7QA 5DGJA 4B2BA 5C2ZA 2WPHS 1GL0E 2BXTH 1CHOF 2OQUA 3TPIZ 3TGKE 4X6MA 1QURH 3NZIA 3FP8E 1T8NA 1V2QT 2ZEBA 2BY5X 2H9HA 3M3VA 1E34B 3EA7A 4X8UH 3M35A 2F9OA 1GWAA 1UTQA 1OSSA 1GHVH 4UFEH 3A7XA 4U01A 3B23B 2ODQA 2XW9A 2D8WA 2F91A 1ELDE 1GJAB 4TWYA 3RXGA 1GHXH 1PPHE 3RXHA 3GICB 1QJ6B 1RXPA 1TQ0B 3GY6A 1AB9B 2CJIA 2Z9GA 2G55A 4WF8A 4WXVA 4DIIH 3QDZB 1GBFA 3SO3A 4BAQB 1UTNA 1C1NA 1VCQA 2GT7A 2DUCA 4H42U 3RUOA 1CBWC 4AN7A 1O31A 2SGAA 1EOLA 1FY4A 3K65B 1BITA 4Y7AA 4WJG2 1AZZA 1NN6A 1PPCE 2AFQB 3RXDA 1GBEA 1HIAB 1L1JA 1DVAH 1JMOH 1EPTA 1V2KT 1YPJH 2ZCKP 1ANDA 1RD3B 3SZNA 1Z6EA 1F5KU 1O34A 4A5TS 5JBBS 1V6DA 5DP8A 5TCAA 2FZZA 3GY3A 3SJ8A 1FAKH 1RTKA 4NA8A 2WPLS 2BQ6B 2HNTC 5EPYA 1HRTH 4Y8ZA 3TGIE 1AWFH 1MU6B 3TU7H 1MTUA 3TIUA 1T4VH 4Z6AH 1L2EA 2C93B 3SJ9A 5LPEA 1AFEH 2PLXA 5T6GA 1O2UA 1RFNA 2C8WB 2XWAA 1PPFE 3ZZ9A 2VIDA 2Z94A 3KF2A 2ILNA 3ATLA 1T8OA 1AFQB 1ELTA 4ESTE 1N8OC 5SGAE 2P3UB 1OX1A 2HLCA 5T6DA 4A7IB 4A6LA 3U9AH 1O33A 3BTEE 1DWCH 4JK5A 1A3BH 5A8YA 1DS2E 3UOPA 1QB6A 1GJDB 1TNGA 2P3TB 4UFFH 1GI1A 1LHFH 2YOLA 4H4FA 3K6ZA 1O3LA 3F9HA 4K1EA 2QXJA 3IWMA 9LPRA 1GCDA 1TPSA 1AI8H 1EZQA 1U6QA 5F8XA 3ZZ5A 3RXSA 1UJ1A 4B76A 2BDYA 1MZAA 1QR3E 3KQCA 1RRKA 3P8NA 4IBLH 2BX4A 3A89A 2TGTA 1RTLA 3AASA 2GCHF 3MO9A 4CRGA 1W7GH 2VWNA 4I8GA 3RXOA 2GD4B 1KDQB 1F0UA 1ZHMA 1BJVA 4FUBA 1L0ZA 1D6WA 3SUEA 3T28A 1SGPE 1CGIE 3LC5A 4Y71A 1EUFA 1KIGH 3K9XB 2Y7XA 1O5GH 1MTNB 1OP8A 3RXCA 3MYWA 4JZFH 1EXFA 1BQYA 1TX6A 1O2SA 2VGCC 3RXRA 1SGFA 1EZUC 1F7ZA 1BMMH 3ZVAA 1P10A 3PMJA 4YO9A 3MH5A 2GT8A 5JYIA 2H1UA 2GTBA 1HAGE 1P9UA 3GYMA 3VPKA 3UUZA 5EQQA 2THFB 3SUGA 3SV7A 1PQ8A 2F3CE 3RU4T 1V2RT 3RC5A 1DXPA 1Z8IB 3LGIA 1WBGB 1BB0B 1DPOA 5IDKA 4E7RG 2XBWA 4UFDH 1GMDG 4BAOB 4BTUB 4X6OA 1V2TT 1MBQA 3SU5A 2O8UA 1ANCA 3A82A 2IPHA 1C5LH 2C90B 2ZU1A 3FAOA 2ZO3H 1UTLM 5EXMA 2H2ZA 4GSOA 1CBWB 5ESTE 1LHGH 2QC2A 3UREA 2ZNKH 2OCVB 4F4OC 1TIOA 3RXBA 1ZSLA 1GMCG 3LGYA 3MO3A 3PMBB 1KLJH 2Z9LA 3S7HB 1HXFH 2GV7A 2VVUA 2ZGJA 1HXEH 1L1NA 8KME2 3R3GB 3P8FA 8ESTE 3DHKH 1AIXH 3OY6U 1BBRH 1C5NH 2YNAA 3LPRA 3A83A 4RKOB 1O35A 3SNCA 4X1NU 3UNQA 2ZDMA 2VH0A 2VVVA 5E0HA 4YOGA 4XOJA 1J16A 2FTLE 1FJSA 4U30A 3RXJA 2A4GA 1OYQA 1QTFA 1YM0A 1F5RA 1ZHRA 3NUMA 1GBHA 4NA7A 3IITA 2BD8A 1FDPA 2ZTXA 1C1SA 2OD3B 2BOKA 4DG4A 3L6PA 1V2LT 4NWLA 3GYLB 3Q3XA 4ZMAH 1LQEA 1QA7A 2PKAB 2ZCLP 5HM2A 1Y3YA 2QN5T 2O8WA 2HWLB 1AUJA 3A7ZA 4FUCA 2GZ9A 2BYAX 3MU8A 3RC6A 1E36B 2ZU3A 2BVSH 1ELGA 3O8DA 2VIQA 3P8GA 2Y82A 2AMDA 3T26A 3MI4A 2NU1E 1AGJA 1ABIH 4LXBH 1MQ6A 1TA6A 4CRDA 1P06A 2XC0A 3SU2A 3M5OA 1TFXA 1SI5H 1Y3WA 3F6UH 3HKIB 1WSSH 1KY9A 3M5LA 3TK5A 1EAIA 2J9NA 3D49H 3M3TA 1C4U2 3SUDA 5A8XA 3UNSA 1TX8A 3DFLA 1HLTH 1T8MA 3E0PB 3LGTA 1JBUH 1G3DA 1K2I1 1S5SA 4O97A 1O2WA 1GBLA 3RM2H 4I8LA 1C1TA 2ZWLH 2BVRH 4MNXA 2NU4E 1O3CA 1ZMNA 2BLVA 3MNSA 1S6FA 1GHZA 2ODPA 1O3DA 1BTYA 3SU3A 1FLEE 4Y11E 2AGGX 4ABGA 5A8ZA 2VGCB 1ZSKA 1TABE 5C3NA 1Y3UA 5A0BA 4ISOA 1MZDA 4O3UA 1EJNA 1Y5AT 2AS9A 3OY5U 1GDUA 2D2DA 1FMGA 3MNBA 2A1DB 1P0SH 5DP6A 3O8CA 4XBBA 1P03A 1C2LA 4I8HA 1WCZA 1W0YH 1FIZA 2CMYA 5E8EH 1C2HA 2R0KA 3ENSB 4Y0YE 4YZUA 1HFDA 5F8TA 1ZOMA 4XE4A 3A84A 1V2VT 4ISIH 5B6OA 5IYTA 1J15A 4KTUA 1KXDA 1E37B 1O30A 2AH4X 5F8ZA 1KLIH 2KAIB 1NM6A 1TGNA 3ITIA 1S0QA 1THPB 1GG6C 4FU7A 3BEFB 3U1JB 1FPCH 3UWJH 2BY6X 2SFAA 1ESBA 1KDQA 1A5HA 5DKMA 3S9AA 3UIRA 4O9VA 4AGKA 3DFJA 1UK4A 4VGCC 3SGQE 1GJ9B 2H5DA 1B7XB 2SGDE 1ELCA 1NT1A 3S9CA 1IQNA 2ZDVH 1TMUH 4AFZA 3TLOA 3D65E 3ATWA 2ZDLA 1Y8TA 1WTHD 1K22H 1SLVB 2BM2A 2OC8A 1PQ7A 5LPFA 1XUHA 2HOBA 3OSYA 1BBRE 3EE0B 3KL6A 3VXFH 3ESTA 1LMWB 1O3HA 4GCHF 5ETXA 3KGPA 3SU6A 3F9EA 3GY7A 2ZZUH 1ZLRA 1O5BB 3NKKA 2FOHA 4ABAA 1V2MT 1LVOA 4CRAA 4ZKOU 2JETC 2A31A 5L2ZH 3BTKE 2J95A 1UVOA 1H9IE 3OTJE 4Q7YA 4MVNA 3PMAB 4ZH8A 4D8NA 2Y6TA 5J4SA 1T31A 3SUFA 3EDXB 1GVLA 4NWKA 1KSNA 1A5GH 1MKXH 4MPUA 2OXSA 4H6SB 1GI5A 1SFQB 1W13U 1BTHH 1ELEE 3MNCA 1AB9C 1MAXA 2D26C 2FMJA 3TJOA 4BXWA 1B5GH 2ZQ1A 2BLWA 1NFUA 4TPIZ 4YT6H 1MH0A 1EATA 1YPEH 1KXBA 4BANB 1TNKA 1QQ4A 1IAUA 2OBOA 1O3MA 1V2ST 3E0NB 1DANH 2XYAA 4GHTA 2QXHA 1A5IA 4WMDA 1CGHA 7GCHG 1UK2A 4DW2U 2BLQA 5HYOA 2PV9B 2EA3A 1Q2WA 2BD7A 5FBEA 1O2ZA 2FLBH 2OC7A 1G30B 2FOMB 1UHBB 1IOEA 3ZVGA 4K2YA 4UONA 1TRNA 1P09A 3QN7A 1H8IH 1EAXA 4MPVA 3TJVA 2PTNA 2BTCE 2FX6A 3UOUA 7ESTE 1SQTA 1C2KA 2W7SA 3IG6B 4MNWA 2XNIA 2F83A 1ZTLA 3WY8A 2XRCA 1WQVH 2QA9E 3Q3YA 3ZZ4A 5CMXH 2FXRA 1D3PB 1AVWA 2FOGA 2PKAA 4JMYA 1MMJN 2GV6A 3MU5A 2QF3A 2F9UA 3ZVEA 3PO1B 1LKBA 1QNJA 1C5XB 1GJ7B 4DVAU 3P6ZB 3BG4C 5A2MH 4BTIB 1B0EA 4AFSA 1V2PT 1O0DH 2XCFA 1BBRK 2G4UA 4I8KA 1O2QA 5C5NA 3RXUA 3GDUA 2XBVA 1GI3A 1ETSH 3CENA 1FAXA 1XUJA 1G2LA 2C8ZB 3SNBA 3VEQB 5H4IB 1GG6B 1OPHB 2WPMS 1NS3A 1NESE 1P04A 2ANWA 2OINA 3GDVA 3DT0H 4UEHH 2O8LA 1YLCA 2FO9A 1C5QA 4UE7H 1ARBA 1LHEH 2A32A 3A8BA 4INHA 3KCGH 2ANYA 2BHGA 3B9FH 3STJA 1A1RA 2QY0B 4VGCB 1QA0A 1ACBE 2FI3E 5EQSA 2A2XH 1PQ5A 3HK6B 1YP9A 1GI4A 1DXWA 2Q1JA 1ZGVA 2FOEA 2NU0E 5JB9S 1INCA 3JZ1B 1SGEE 1SHYA 3S7KB 2WYGA 5GXPA 3BTME 1TGCA 3V7TA 2V35A 2Z3EA 1O2KA 3SQHE 4MTBA 4KTSA 1O2NA 2C8XB 1GMDF 4B71A 1EOJA 1GHBG 3QZRA 2GGVB 1YYY1 1AMHA 1ZTJA 3RU4E 1QBNA 4IGDA 1GL1A 1PQAA 1ELBA 2V3HH 2WPIS 3KN2A 4WMFA 4ABHA 2P8OC 5PTPA 4U32A 4BTTB 1TRMA 1S6HA 1O3IA 2PKSC 3FZDA 1HAVB 3PTNA 2ZPSA 3FFGA 1A0JA 1O2GH 2WINI 1AY6H 2PSYA 1EAWA 1GMCF 2C8YB 1A3EH 2JETB 1VJ9U 3N7OA 2IOTA 4E05H 2KAIA 2FLRH 2C3SA 1UTKA 1HYLA 3BF6H 5G4BA 1G36A 3RXTA 5DK1A 1LHDH 2M5TA 2V6NA 2J92A 2ZG0H 3OU0A 3PYHA 4HTCH 2STAE 2ZHQH 1LVBA 4AZ2B 3LGUA 1FPHH 3UPEA 4B2CA 5I46H 2G52A 4FUEA 2A5IA 3CS0A 2H6MA 3GCHB 4I7YH 2ZTZA 1K1NA 2A4QA 1HAHH 3HGPA 4WMEA 3I78A 1O38A 1CT4E 2PUQH 1S0RA 4DY7B 1JWTA 3BEIB 1M9UA 1OWDA 1VGCC 3M61U 1K1OA 1UK3A 1P2IA 4Y10E 1QL9A 1BHXB 4JZDH 3LDXH 4NIVA 3D23A 1EAUA 3VFEA 2ZFFH 2AGEX 1LVMA 3OX7U 5HXFA 4THNH 4CRBA 1GBAA 1OKXA 1MU8B 2AGIX 2DE9A 1TLDA 2VINA 2HNTF 1QY6A 3NCLA 4NG9H 2ZDNA 3F68H 2V0BA 2J2UA 1KXCA 1O2IA 3GY2A 4YESB 3ODDA 4IMQA 2ZIQH 2SGEE 4ABDA 2TGAA 2VB0A 1C9TA 4IS5A 1HNEE 2GZ7A 2QXGA 1ESAA 1C5VA 2ZI2H 3A7YA 2VIPA 3BG4B 1T4UH 1V2NT 3SI4H 4X2YA 1MQ5A 1WU1A 1XXFA 5E2PA 2P3FH 1OWEA 1W7XH 1G3CA 2ZHFH 1O2VA 4OGYA 2BD5A 4TWWA 2TRMA 5CE1A 4OS1A 3EGKH 1O3NA 2A4RA 1OWHA 4FUDA 1QBOA 1CGJE 1P12E 3RMLH 2BLOA 4D9RA 1K1PA 4I32A 1C5ZB 1ELFA 1YPMH 3Q00A 1UHBA 3SORA 3ZYEA 2FOCA 4K8BA 1CO7E 2P16A 1BA8B 2HRVA 3H5CB 1JIMA 1MKXK 1SOTA 3TITA 1QJ1B 2Q6DA 1H9LB 1SMFE 1UCYE 4YT7H 5LGOA 2Z9JA 2BX3A 3BG8A 4YTAA 3SHAH 4B1TA 4R8TB 1ETTH 3UQVA 2AMPA 2XTTB 4UDWH 1P2KA 1TRYA 2PUXB 4YM9A 4OGXA 5DG6A 1EB1H 1UO6A 4Y8XA 3MU4A 1C2EA 1QB9A 1C1VH 4LK4A 1XUIA 2RA0A 2ALVA 1Z8JB 1HAPH 3FP7E 3GY4A 3H7OA 4X1PU 4AG2A 1BTUA 3A88A 2QV1A 2P8OB 4TYDA 5C1XA 4ZXXH 1BMAA 2HPQH 2PW8H 3L33A 1ZMJA 5EODA 2PKSB 1YPGH 4JK6A 4INLA 1C5SA 1DY9A 1QRWA 2ZPQA 5EXNA 4ABFA 4AYVB 4LZ4B 1FY3A 1P2NA 2WUBA 1HJ8A 5TCCA 2ZFQH 4IN1A 3KHVA 2XXLA 1IQGA 3V13A 1DY8A 1MAYA 2ZTYA 6CHAC 1LO6A 1GBIA 4ZHMU 1ZRKA 4CH2B 2VIVA 1IQJA 1O2XA 1GI0A 1BIOA 4YOIA 1TAWA 3SU4A 1JRSA 5C1YA 4ZAEA 1JIRA 4BXSA 3SJIA 4A1TA 2XBXA 1LQDB 2XC5A 4X2XA 1Z6JH 1O2OA 2YNBA 1CQQA 3O8BA 2F9NA 1D9IA 1DT2A 2BY7X 1EP5A 1HAYB 1BRAA 3HKJB 1UVTH 4NIYA 4Y8YA 1LHCH 4Q7XA 1VGCB 2SGPE 4INKA 2FPZA 1O37A 1NPMA 1NY22 1AKSB 1EZXC 4WXIA 1MTSA 3C27B 1X7AC 2EI6A 1E35B 1TX7A 1GI6A 4X2VA 1DLKB 3E6PH 2FX4A 1P02A 5E0JA 1HAVA 1GCTB 3LONA 1D3QB 1C5UA 1BDAA 1A2CH 1J17T 5T6FA 1H1BA 1YGCH 4GUXA 2ZGHA 2JH6D 2ZP0H 2GZ8A 3L3TA 4DCDA 1NRQH 1WYKA 1CA0C 5DJ7A 1F92A 3JZ2B 4AOQA 1IQKA 1FNIA 3EA8A 1XVMA 1Z1IA 1P57B 1YCPH 1ZPCA 1WTGH 4AYYB 5A0CA 1VR1H 4CBNA 2RA3A 1K9OE 1GBTA 7GCHF 1WUNH 1VITH 1OP2A 5EW1H 1T7CA 1HBTH 1P3CA 3RDZA 2VWOA 1DFPA 3EAJA 3P70B 5DPAA 1UTPA 2UUYA 1KLTA 1C1QA 2G00A 4ISHH 4ABIA 4HFPB 1LCYA 1TBRH 1PJPA 2BD3A 4CREA 1NRRH 2B9LA 5F6MA 3T29A 1O2MA 1SGNE 2CF9H 2BY9X 5AFYH 1WAYB 2WPKS 4X1SU 3BEUA 4YLQH 3URCA 3FP6E 4LZ1H 1HIAA 3M7UA 1BJUA 2F9BH 1ABJH 1O5FH 1LDTT 1SC8U 2FOFA 2A5KA 3QUMP 3C1KA 3TH3H 4O03A 5GIBA 4X8TH 1J8AA 2BQWB 1F0TA 1FY1A 2P59A 2ZGXH 3ZZ6A 2P94A 1LVYA 4J1YA 1HUTH 1C9PA 2FS8A 4YLUA 5BPEA 3SNEA 2ALPA 5DP3A 4B74A 3ZZ7A 4DGJA 2BDBA 4HGCA 4KGAA 3A87A 4ZUHA 2AIQA 2TIOA 3GCOA 1SLUB 2JKHA 1QRZA 3MH4A 3LGVA 2CHAC 2K1QA 1C4Y2 1C5RA 2A4OA 3QTOH 4ZKSU 4ISLA 4NGAH 3EYDA 3MO6A 3SGAE 1NTPA 5EW2H 1FI8A 4LOYH 2Z9IA 8GCHG 2WUCA 3GCTG 2B0FA 6LPRA 3GY5A 2STBE 1JRTA 2ZDKA 1BT7A 1IHTH 1S85A 4K8YA 1YBWA 2BD9A 4RN6A 4X8SH 4MQAA 3PO1C 2VWLA 2TBSA 2B5TB 1W12U 1SGTA 1YPKH 1SGQE 2W7UA 3SJOA 6CHAB 1FV9A 1HCGA 3UNRA 3SN8A 3B8JA 3KQBA 2V3OH 4M7GA 4ABBA 4O3TA 1FQ3A 1V3XA 2QAAA 3LKWA 1GBCA 1GHBF 2ZU5A 2R3YA 4UD9H 5HGGA 3ZZDA 4A1VA 3SI3H 4BOHA 3A7WA 5AVDA 1OP0A 3LH3A 1A7SA 3SNAA 1UTOA 5K7RA 5GJ4B 1P11E 1C5YB 1IQEA 1EX3A 3A85A 1DSUA 1BUIA 2GDDA 2ODYB 1ZHPA 1AVXA 3ATIA 1GDQA 3A7VA 1BRUP 3ZV8A 5C5OA 3SNDA 3E91A 4JZ1A 2ASUB 1FXYA 5E0GA 2BD2A 1GGDC 1AE5A 2BD4A 2HGTH 3CS7A 5DP5A 3VB4A 1NRPH 1TNIA 4JZEH 3Q77A 1P8VC 2J4IA 3PM3A 3BTDE 1TBZH 3LJJA 3UFAA 2G4TA 2FIRH 2ZGBH 1O2YA 3QTVH 3U8TH 2H9EH 1GBMA 1CA0B 1FN8A 2P95A 3RXLA 4OS2A 1C2JA 4K3JA 1KXAA 4NZQA 7KMEH 1C1UH 1TGSZ 4TPYA 2BB4A 4Y76A 2G5NA 1VCWA 4Z0KA 1SBWA 3RXQA 4WH8A 1TPPA 1XXDA 1GBJA 2ZF0H 1W11U 4E7NA 1ZYOA 1NRSH 1QFKH 1UVUH 1TNJA 4X8VH 5EG4A 2R3UA 3A86A 3T62A 1LPZB 4CH8B 1A46H 1O5CB 4AX9H 4NFFA 1F0RA 1QIXB 3ZZBA 2P93A 3GCHC 2AERH 3TK9A 1AVGH 2FS9A 1DX5M 1ZRBA 3EQ0H 4OS4A 3AW0A 4Y7BA 3ZV9A 2BMGB 1MD8A 3PLKA 1SLWB 2FTMA 3P17H 1P01A 2RDLA 1C2IA 1L4DA 5I25A 2W5EA 5EU8A 4SGAE 4JYVH 2BDHA 2GX4A 1BHXF 2UUFB 1QCPA 1RIWC 1AUTC 2PGQB 3M5MA 4NA9H 1HV7A 2CHAB 4UFGH 1CT0E 2GKVE 1Z1JA 2ZA5A 1S81A 5DP9A 1GJ4H 4I33A 2FOBA 1O2TA 3D62A 1QGFA 3OYPA 1O2LA 3VB7A 3SBKA 1VJAU 1DM4B 1H9HE 3QGJA 1MTVA 3QZQA 1J14A 2VH6A 3GOVB 3PMHB 2F9VA 4IC6A 3STIA 1MD7A 4JCNA 1W10U 4K60A 3AAUA 5FBIA 2J38A 4ZKRU 1SQAA 2SNWA 1GPZA 1P3EA 1KTSB 2ZFPH 3RXFA 3SV9A 3QLPH 2PR3A 7LPRA 4CHAC 1WQSA 3S69A 2GDEH 3V0XA 1SLXB 3MWIU 3ODFA 1CSOE 1BTPA 4AB8A 3E3TA 4TY6A 4XBCA 1C5WB 4ZXYH 1UTMA 1GBKA 2GCTC 2VNTA 4X2WA 2CV3A 1YCPK 3MMGA 1A0LA 3KIDU 1K21H 1XMNB 2A7CA 3AW1A 4YOJA 3LGWA 1EB2A 1P2QA 1O2RA 3U98H 3VB6A 1C1WH 3PLPA 3PTBA 1AZ8A 1SVPA 1UCYH 2G51A 2CXVA 1GVKB 3UWIA 5JBAS 1GGDB 2PHBA 1G32B 2WV5A 1P9SA 2I6QA 2FDAA 1S84A 3SJKA 1O3AA 3RXIA 3VB3A 2Z9KA 1GVZA 2DE8A 1BMLA 4X0WU 1DLEA 2ZHDA 2GMTC 1GMHG 1HAZB 2OC0A 1MTWA 4AORA 5A09A 1SGFG 1TYNA 1DE7H 2FWWA 1GBBA 4NFEA 4B73A 2CF8H 2FI5E 1SR5C 3Q3KA 1XUKA 3NXPA 4X6PA 2FOAA 5AF9H 1ZSJA 1Z71A 2XCNA 3PLBA 1VITG 1XUGA 1YLDA 3UR6A 2OC1A 3M36A 2UWPA 2FP7B 1O3GA 2XC4A 4FVBA 2R2MB 1FIWA 3SV2H 1N6XA 4H6TA 1THRH 2Y5HA 4J2YB 3GDSA 3BTGE 3I29A 5LH8A 2RCEA 1L1GA 3PV4A 3MNXA 1QB1A 2PGBB 4NSYA 1AWHB 1NRNH 3AVZA 4GVUA 3KNXA 1SGYE 1SGDE 4K1SA 1BRBE 2J94A 1TB6H 1S82A 4GHQA 2BDIA 1B0FA 1K1LA 2AYWA 2LPRA 4A92A 2BXUH 3E16B 2ULLA 3RMNH 1C2MA 5EGMA 2Q6FA 2Y5FA 3ZZ8A 1QL7A 1MCTA 1NU7B 1RIWB 1MKWH 2ZC9H 1O5EH 1NFYA 1GBDA 2ZQ2A 4GCHG 1AHTH 1D3DB 2R0LA 4XDEA 3RXAA 1JOUB 1GCTC 3P92A 2FODA 1CA8B 4HI3A 1ZPZA 1NC6A 1O5DH 2QCYA 4BNRA 4FUIA 1DWEH 2VWMA 4X6NA 2ZGCA 4OS5A 1TQ7B 2Y80A 4NIXA 1PPBH 1HJAC 1P05A 2ZKSA 1NFXA 3A8DA 1P2MA 2NU2E 1KXEA 4RSPA 1MCVA 2QXIA 2SNVA 4B75A 3FZZA 4WWYA 3RXMA 2Y5GA 4ZKNU 1O32A 2BDGA 1ZTKA 1CT2E 2ZECA 5C1UA 3BTWE 1TONA 1GHAG 1DWDH 3U69H 3SGBE 1Q31A 4CHAB 2OLGA 4BAKB 1CVWH 4WVPE 1Y3VA 3MOCA 4HZHA 1HJ9A 4I31A 5EQRA 2XWBI 2GCTB 4CR5A 2IN2A 8GCHF 5FCKA 3GCTF 4K69A 3G01A 3TH4H 1ZPBA 1CU1A 1KYNA 2ZFTA 4IW4E 2A0QB 5FAHA 1SGRE 3DUXH 3T27A 5GPIB 1SQOA 4AG1A 2ZFRH 4GAWA 1O2JA 3BN9A 1T32A 1XM1A 4FUGA 1XKBC 9ESTA 1K1MA 1O39A 2LNCA 3SOSA 6GCHG 2UUKB 4E06H 3PROA 3ZVDA 3RLWH 3SQEE 1RJXB 2BZAA 4FUFA 1SB1H 1D4PB 2R2WU 2HNTE 3U8RH 3BTTE 1OWKA 2Z6BD 5JBTA 3TJUA 1ORFA 1HGTH 4Q7ZA 3RU4D 3UY9A 1WOFA 1GHWH 2Z3CA 2J34A 3W95A 2ZHWH 2QGRA 3A8AA 1ESTA 3P8OA 2GMTB 3UTUH 1LPGB 1S83A 1HAIH 3RP2A 1SG8B 4D7FA 1GI9B 1ZJDA 3ZVFA 1NZQH 4F49A 4JYUH 2H5CA 1EJAA 5GWZA 4K5ZA 1C2FA 3E1XB 2OQ5A 1V2OT 4BAMB 4X1RU 4PROA 1THSH 1K28D 1W0ZU 4IC5A 1SOZA 3MU0A 1UTJA 3TNSA 1GJ6A 4MLFB 1AO5A 3GISB 1BMNH 1GI2A 2G5VA 3MFJA 3U1IB 2Z7FE 1QRXA 1YC0A 1SSXA 3PWBA 2RG3A 3TNTA 5L6NH 2ZU2A 1DICA 1WV7H 4X1QU 2A45B 2ZCHP 2UWOA 1GJ5H 1AU8A 4MPXA 1C2DA 3URDA 5JB8S 1TE0A 2W3KA 3V12A 3UR9A 1TPOA 3RC4A 1BTZA 5GCHG 1PYTC 1O3EA 3S0NA 1OXGA 4QT8C 1OYTH 3M37A 3ZZ3A 1O3OA 1EASA 2BOHB 3AAVA 3T25A 3VXEH 5HM9A 4FUHA 1Y59T 1DUEA 1QBVH 2UUJB 2BQ7B 5EXLA 1Y5BT 3T2NA 1DSTA 4CRFA 3DD2H 2PSXA 4Y79A 3SV8A 3KQEA 1CHOG 1FONA 1TPAE 5TJXA 1D3TB 5DO4H 1W3CA 1TGBA 3O8RA 1A0HB 2Y7ZA 1KXFA 1TALA 3MH7A 3LJOA 1O3PB 4XBDA 3E8LA 1YKTA 1ID5H 4IN2A 5L30H 1ELAA 2FEQH 5FX5A 3VGCC 1HJAB 1UCYK 1HAXB 3NWUA 2TGDA 2ESTE 2ZDAH 1BRCE 2W3IA 2BY8X 4MNVA 5FPYA 4AFQA 1GHYH 3PB1E 4CBOA 3BIUH 3H7TA 3HK3B 1C4V2 2HPPH 1EJMA 3HPTB 5FPTA 1SFIA 4U2WA 3S9BA 1HDTH 4KKDA 4ZROA 3GCNA 2B7DH 5J4QA 1EPTC 3ATKA 1ZZZA 1BCUH 1J9CH 2G81E 1AN1E 2WV4A 2NU3E 2FESH 1PPZA 3SHCH 2ZU4A 3A8CA 4TY7A 3FANA 2PFEA 1F0SA 1EP6A 3RXKA 5BRRE 1N8OB 3A7TA 1OS8A 3ZZCA 1QL8A 4ZHAA 3K2UA 1TNLA 2I6SA 4IMZA 3KEEA 1L4ZA 1Y5UT 5ABWA 4SGBE 4JZIA 3LU9B 3HATH 2ZPRA 3U8OH 4ASHA 3P95A 2ZFSA 2Q6GA 1TMBH 3VB5A 1F5LA 1TWXB 4MNYA 3E90B 3TK6A 3MHWU 5DP7A 2H9TH 4AB9A 4AGJA 2VIWA 2IJOB 2ANKH 4DIHH 3V3MA 5GDSH 4D7GA 2OBQA 1O36A 1CHGA 2CN0H 1GI8B 1N1LA 1O2PA 5EOKA 4MDSA 3RXEA 2OTVA 1W2KH 1AD8H 1A4WH 4FUJA 2BDAA 4FU8A 2SGFE 1LKAA 1MKWK 1DITH 1P2OA 1QHRB 1GDNA 4Q2KA 2WYJA 1SHHB 4JYTA 1A61H 1K1IA 1TOCB 3ZZAA 5DP4A 6ESTA 3BTQE 2EI8A 5HMAA 3CP7A 1O3KA 3LT3A 3FVFB 2XBYA 2FYQA 1NFWA 3I77A 1FN6A 1PPEE 1FY5A 1DWBH 2QYIA 1UVSH 1GMHF 1YF4A 2C4FH 1FUJA 2Z3DA 1SGCA 1T8LA 2GCHG 4FXGH 1Z8GA 1W14U 3RMOH 2R9PA 5A0AE 4R0IA 4Y0ZE 1DOJA 4KP0A 3TVJB 2SGQE 2HVXA 5E2OA 3A80A 4A1XA 1LPKB 3ELAH 1FZZA 3QK1A 4MPWA 4D76A 1ZGIA 4AFUA 1G37A 1VITF 5CHAC 4BAHB 1C5PA 1GJ8B 1F2SE 4WH6A 1C1RA 2FM2A 3F1SB 2HALA 4DT7B 8LPRA 1KTTB 1RTFB 3SW2B 1ANEA 1GJCB 1TA2A 4ABJA 1IQLA 1FY8E 4MG3A 2D1JA 2VVCA 1AQ7A 1EQ9A 2AEIH 1YPLH 4FVDA 1V2UT 1PYTD 2EI7A 3EA9A 1P2JA 1N6YA 4NSVA 1OWIA 1BTWA 4GPGA 1NU9A 5AFZH 4ABEA 1MUEB 3VGCB 1SPJA 3BIVH 1W8BH 4Y6DA 1ARCA 1ZMLA 5FXLA 3HGNA 4DJZB 1C5TA 5FX6A 1QJ7B 1TOMH 1C2GA 3BSQA 5L2YH 2O8TA 4DURA 2G8TA 2A7JA 1ZR0A 1OOKB 1Z7KA 4NZLA 1Y3XA 1EPTB 2ANMH 4D9QA 1HB0B 4XSKU 4WY3A 1OWJA 3W94A 3BTFE 2EC9H 2CGAA 3KQDA 2JH5D 2A2QH 1SL3A 1G3EA 1V2JT 2F9PA 3TGJE 1K1JA 4GLYA 1AKSA 5EPNA 3SV6A 1XKAC 2GP9B 4DOQA 5C67A 1ANBA 2UWLA 2O9QA 1ELVA 3NPSA 1C5MD 2VIOA 1D6RA 3QX5H 4B2AA 1O3FA 2ZHEH 1O3BA 3NK8A 5JPMH 3GY8A 1UVPA
chains in the Genus database with same CATH superfamily
2QF0A 1NO9H 1VCPA 1VZQH 3SU1A 5AHGH 1GHAF 1SGIB 2PWXA 1GI7B 1XUFA 3LC3A 1ZJKA 4OS7A 4CR9A 2FI4E 3BTHE 1DDJA 2AMQA 1EZSC 3K6YA 1XX9A 3LIWA 1IHSH 2Y81A 1DUAA 3DSOA 2GVFA 1O3JA 3LH1A 3TH2H 2WPJS 3M5NA 4ISNA 3QGNB 3BV9B 1G9IE 4XFQA 1C5OH 2FYRA 2B8OH 2QIQA 1H4WA 3M7TA 2BDCA 1TNHA 1TGTA 1NROH 1RGQA 3T5FH 1EKBB 3ZYDA 1YPHC 4KELA 5FPSA 6GCHF 1E0FD 1GJBB 1C1OA 5T3HA 1IQIA 1Q3XA 3TJNA 3R0FA 4RT1A 5FHTA 1H8DH 4CRCA 5K0HA 1CE5A 4NCYA 3F9FA 1ETRH 2A7HA 1O2HA 3SU0A 2TPIZ 2IJD1 3KYGA 1IQFA 5JDUB 2TGPZ 3KQ5A 1Z8RA 3DA9B 1TBQH 3U28C 4RI0A 3MU1A 5JBCS 1C1PA 2PTCE 1AFQC 1RS0A 3LOXA 3RXPA 1E38B 4KTCA 3ATMA 3M3SA 5F03A 4P02A 3QWCH 1KMHB 1TMTH 4I8JA 1IQMA 1JXPA 2BZ6H 1QQUA 3ZVBA 3MTYA 4RKJB 1BTXA 1PFXC 1LTOA 5CHAB 2OUAA 3UQOA 1YPHE 1O5AB 2AIPA 2L74A 1BOQA 1MBMA 1HPGA 3Q76A 4Q80A 2VJ1A 3MH6A 3PWCA 4OS6A 5LPRA 1UMAH 5ESBA 1IQHA 1C1MA 3QO6A 4ZHLU 3WWFA 2W26A 1G2MA 3RLYH 3F9GA 2EEKA 2OP9A 5FCRA 2J5UA 3A81A 3RXVA 4K1TA 4NIWA 5GCHF 2O8MA 1G3BA 1AE8H 1XVOA 2A5AA 2JH0D 1HAOH 2NWNA 2VU8E 4FU9A 1W0JD 1PPGE 2BVXH 1V2WT 3RM0H 2XOKD 5C20A 1YCPM 1BZXE 1MTNC 3ZVCA 3RMMH 3M7QA 5DGJA 4B2BA 5C2ZA 2WPHS 1GL0E 2BXTH 1CHOF 2OQUA 3TPIZ 3TGKE 4X6MA 1QURH 3NZIA 3FP8E 1T8NA 1V2QT 2ZEBA 2BY5X 2H9HA 3M3VA 1E34B 3EA7A 3OEED 4X8UH 3M35A 2F9OA 2GJGA 4ACAA 1GWAA 1UTQA 1OSSA 1GHVH 4UFEH 3A7XA 4U01A 3B23B 2ODQA 2XW9A 2D8WA 2F91A 1ELDE 1GJAB 4TWYA 3RXGA 1GHXH 1PPHE 1YY3A 3RXHA 3GICB 1QJ6B 1RXPA 1TQ0B 3GY6A 1AB9B 2CJIA 2Z9GA 2G55A 4WF8A 4WXVA 4DIIH 3QDZB 1GBFA 3SO3A 4BAQB 1UTNA 2K8IA 1C1NA 1VCQA 2GT7A 2DUCA 4H42U 3RUOA 1CBWC 4AN7A 1O31A 2SGAA 5KGOA 1EOLA 1FY4A 3K65B 4TT3D 2M2AA 1BITA 4Y7AA 4WJG2 1AZZA 1NN6A 1PPCE 2AFQB 3RXDA 1GBEA 1HIAB 1L1JA 1DVAH 1JMOH 1EPTA 1V2KT 1YPJH 2ZCKP 1ANDA 1RD3B 3SZNA 1Z6EA 1F5KU 1O34A 4A5TS 5JBBS 3F2HA 1V6DA 5DP8A 5TCAA 2FZZA 3GY3A 4RT0A 3SJ8A 1FAKH 1RTKA 3KYFA 4NA8A 2WPLS 2BQ6B 2HNTC 5EPYA 1HRTH 4Y8ZA 3TGIE 1AWFH 1MU6B 3DSPA 3TU7H 1MTUA 3TIUA 1T4VH 4Z6AH 1L2EA 2C93B 3SJ9A 5LPEA 1BMFD 1AFEH 2PLXA 5T6GA 1O2UA 1RFNA 2C8WB 2XWAA 1PPFE 3ZZ9A 2VIDA 2Z94A 3KF2A 2ILNA 3ATLA 1T8OA 1AFQB 3ZIAD 1ELTA 1MABB 4ESTE 1N8OC 5SGAE 2P3UB 1OX1A 2HLCA 5T6DA 4A7IB 4A6LA 3U9AH 5B6LA 1O33A 3BTEE 5HIYA 1DWCH 4JK5A 1A3BH 5A8YA 1DS2E 4YXWD 3UOPA 1SKYE 1QB6A 5T1VA 1GJDB 4I86A 1TNGA 2P3TB 4UFFH 1GI1A 1LHFH 2YOLA 4H4FA 3K6ZA 1O3LA 3F9HA 4K1EA 2QXJA 3IWMA 9LPRA 1GCDA 1TPSA 1AI8H 1EZQA 1U6QA 5F8XA 3ZZ5A 3RXSA 2JDID 1UJ1A 4B76A 2BDYA 1MZAA 1QR3E 3KQCA 1RRKA 3P8NA 4IBLH 2BX4A 3A89A 2TGTA 1RTLA 2AHME 3AASA 5IK2D 2GCHF 3MO9A 4CRGA 1W7GH 2VWNA 4I8GA 3RXOA 2GD4B 1KDQB 1F0UA 1ZHMA 1BJVA 4FUBA 1L0ZA 2YMSD 1D6WA 3SUEA 3T28A 1SGPE 1CGIE 3LC5A 4Y71A 1EUFA 1KIGH 3K9XB 2Y7XA 1O5GH 1MTNB 1OP8A 3DCLA 3RXCA 3MYWA 4JZFH 1EXFA 1BQYA 1TX6A 1O2SA 2VGCC 3RXRA 1SGFA 1EZUC 1F7ZA 1BMMH 3ZVAA 1P10A 3PMJA 4YO9A 3MH5A 2GT8A 5JYIA 2H1UA 2GTBA 1HAGE 1P9UA 3GYMA 3VPKA 3UUZA 5EQQA 2THFB 3SUGA 1YLNA 3SV7A 1PQ8A 2F3CE 3RU4T 1V2RT 3RC5A 1DXPA 1Z8IB 3LGIA 1WBGB 1BB0B 1DPOA 5IDKA 4E7RG 2XBWA 4UFDH 1GMDG 4BAOB 4TSFD 4BTUB 4X6OA 1V2TT 1MBQA 1OHHD 1E79D 3SU5A 3OTPA 2O8UA 1ANCA 3A82A 2IPHA 1C5LH 2C90B 2ZU1A 3FAOA 2ZO3H 1UTLM 5EXMA 2H2ZA 4GSOA 1CBWB 4FOUC 5ESTE 1LHGH 2QC2A 3UREA 2ZNKH 2OCVB 4F4OC 1TIOA 3RXBA 1ZSLA 1GMCG 3LGYA 3MO3A 3PMBB 1KLJH 2Z9LA 3S7HB 1HXFH 2GV7A 2VVUA 2ZGJA 1H8ED 1HXEH 1L1NA 8KME2 3R3GB 3P8FA 8ESTE 1NBME 3DHKH 1AIXH 3OY6U 1BBRH 1C5NH 2YNAA 3LPRA 3A83A 4RKOB 1O35A 3SNCA 4X1NU 3UNQA 2ZDMA 2VH0A 2VVVA 5E0HA 4YOGA 4XOJA 1J16A 2FTLE 1FJSA 4U30A 3RXJA 2A4GA 1OYQA 1QTFA 1YM0A 1F5RA 1ZHRA 3NUMA 1GBHA 4NA7A 3IITA 2BD8A 1FDPA 2ZTXA 1C1SA 2OD3B 2BOKA 4DG4A 3L6PA 1V2LT 4NWLA 3GYLB 3Q3XA 4ZMAH 1LQEA 1QA7A 2PKAB 2ZCLP 5HM2A 1Y3YA 2QN5T 1W0KD 2O8WA 2HWLB 1AUJA 3A7ZA 4FUCA 2GZ9A 2BYAX 3MU8A 3RC6A 1E36B 2ZU3A 2BVSH 1ELGA 3O8DA 2VIQA 3P8GA 2Y82A 2AMDA 3T26A 3MI4A 2NU1E 1AGJA 1ABIH 4LXBH 1MQ6A 1TA6A 4CRDA 1P06A 2XC0A 3SU2A 3M5OA 1TFXA 1SI5H 1Y3WA 3F6UH 3HKIB 1WSSH 1KY9A 3M5LA 3TK5A 1EAIA 2J9NA 3D49H 3M3TA 1C4U2 3SUDA 5A8XA 3UNSA 1TX8A 3DFLA 1HLTH 1T8MA 3E0PB 3LGTA 1JBUH 1G3DA 1K2I1 1S5SA 4O97A 1O2WA 1GBLA 3RM2H 4I8LA 1C1TA 2ZWLH 2BVRH 4MNXA 2NU4E 1O3CA 1ZMNA 2BLVA 3MNSA 1S6FA 1GHZA 2KM0A 2ODPA 1O3DA 1BTYA 3SU3A 1FLEE 4Y11E 2AGGX 4ABGA 5A8ZA 2VGCB 1ZSKA 1TABE 5C3NA 5C94A 1Y3UA 2HLDD 5EJLA 4ISOA 1MZDA 5A0BA 4O3UA 1EJNA 1Y5AT 2AS9A 3OY5U 1GDUA 2D2DA 1FMGA 3MNBA 2A1DB 1P0SH 5DP6A 3O8CA 4XBBA 1P03A 1C2LA 4I8HA 1WCZA 1W0YH 1FIZA 1YWUA 2CMYA 1C2HA 5E8EH 2R0KA 3ENSB 4Y0YE 4YZUA 1HFDA 5F8TA 1ZOMA 4XE4A 3A84A 1V2VT 4ISIH 5B6OA 5IYTA 1J15A 4KTUA 1KXDA 1E37B 2V7QD 1E1RD 1O30A 2AH4X 5F8ZA 1KLIH 2KAIB 2KZ4A 1NM6A 1TGNA 3ITIA 1S0QA 1THPB 1GG6C 4FU7A 3BEFB 3U1JB 1FPCH 3CNRA 3UWJH 2BY6X 2SFAA 1ESBA 1KDQA 1A5HA 5DKMA 3S9AA 3UIRA 4O9VA 4AGKA 3DFJA 1UK4A 4VGCC 3SGQE 3N99A 1GJ9B 2H5DA 1B7XB 2SGDE 1ELCA 1NT1A 3S9CA 1IQNA 2ZDVH 4HG6A 1TMUH 4AFZA 3TLOA 3D65E 3ATWA 2ZDLA 1Y8TA 1WTHD 1K22H 1SLVB 2BM2A 2OC8A 1PQ7A 5LPFA 2W6ID 1XUHA 2HOBA 3OSYA 1BBRE 3EE0B 3KL6A 3VXFH 3ESTA 1LMWB 1O3HA 4GCHF 5ETXA 2LELA 3KGPA 3SU6A 3F9EA 3OEHD 3GY7A 2ZZUH 1ZLRA 1O5BB 3NKKA 2FOHA 4ABAA 1V2MT 1LVOA 4CRAA 4ZKOU 2RFKC 2JETC 2A31A 5L2ZH 3BTKE 2J95A 1UVOA 1H9IE 3OTJE 4Q7YA 4MVNA 3PMAB 4ZH8A 4D8NA 2Y6TA 3VG8A 5J4SA 1T31A 3SUFA 3EDXB 1GVLA 4NWKA 1KSNA 1A5GH 1MKXH 4MPUA 2OXSA 4H6SB 1GI5A 2HVYB 1SFQB 1W13U 1BTHH 1ELEE 3MNCA 1AB9C 1FX0B 1MAXA 2D26C 2FMJA 3TJOA 4BXWA 1B5GH 2ZQ1A 2BLWA 1NFUA 4TPIZ 4YT6H 1MH0A 1EATA 1YPEH 4Z1MD 1KXBA 4BANB 1TNKA 1QQ4A 1IAUA 2OBOA 3N7EA 1O3MA 1V2ST 3E0NB 1DANH 2XYAA 4GHTA 2QXHA 1A5IA 4WMDA 1CGHA 7GCHG 1UK2A 4DW2U 5GNDA 2BLQA 5HYOA 2PV9B 2EA3A 1Q2WA 2BD7A 5FBEA 1O2ZA 2FLBH 2OC7A 1QZ8A 1G30B 2FOMB 1UHBB 1IOEA 3ZVGA 4K2YA 4UONA 1TRNA 1K0HA 1P09A 3QN7A 1H8IH 1EAXA 4MPVA 3TJVA 2PTNA 2BTCE 2FX6A 3UOUA 7ESTE 1SQTA 1C2KA 2W7SA 3IG6B 4MNWA 2KFWA 2XNIA 2F83A 1ZTLA 3WY8A 2XRCA 1WQVH 2QA9E 3Q3YA 3ZZ4A 5CMXH 2FXRA 1D3PB 1AVWA 2FOGA 2PKAA 4JMYA 1MMJN 2GV6A 3MU5A 2QF3A 2F9UA 3SYJA 2WZQA 3ZVEA 3PO1B 1LKBA 1QNJA 1C5XB 1GJ7B 4DVAU 3P6ZB 3BG4C 5A2MH 4BTIB 1B0EA 4AFSA 1V2PT 1O0DH 2XCFA 1BBRK 2G4UA 4I8KA 1O2QA 5C5NA 3RXUA 3GDUA 2XBVA 1GI3A 1ETSH 3CENA 1FAXA 1XUJA 1G2LA 2C8ZB 3SNBA 3VEQB 5H4IB 1GG6B 1OPHB 2WPMS 1NS3A 1NESE 1P04A 2ANWA 2OINA 3GDVA 3DT0H 4UEHH 2O8LA 1YLCA 2FO9A 1C5QA 4UE7H 1ARBA 1LHEH 2A32A 3A8BA 4INHA 3KCGH 2ANYA 2BHGA 3B9FH 3STJA 1A1RA 2QY0B 4VGCB 1QA0A 1ACBE 2FI3E 5EQSA 3F2FA 2A2XH 1PQ5A 3HK6B 1YP9A 1GI4A 1DXWA 2Q1JA 1ZGVA 2FOEA 2NU0E 5JB9S 1INCA 3JZ1B 1SGEE 1SHYA 3S7KB 2WYGA 5GXPA 3BTME 1TGCA 3V7TA 2V35A 2Z3EA 1O2KA 3SQHE 4MTBA 4KTSA 1O2NA 2C8XB 1GMDF 4B71A 1EOJA 1GHBG 3QZRA 2GGVB 1YYY1 1AMHA 1ZTJA 3RU4E 1QBNA 4IGDA 1GL1A 1PQAA 1ELBA 2V3HH 2WPIS 3KN2A 4WMFA 4ABHA 2P8OC 5PTPA 4U32A 4BTTB 1TRMA 1S6HA 1O3IA 2PKSC 3FZDA 1HAVB 3PTNA 2ZPSA 3FFGA 1A0JA 1O2GH 2WINI 5KECA 1AY6H 2PSYA 1EAWA 1GMCF 2C8YB 1A3EH 2JETB 1VJ9U 3N7OA 2IOTA 4E05H 2KAIA 2FLRH 2C3SA 1UTKA 1HYLA 3BF6H 5G4BA 1G36A 3RXTA 5DK1A 2KCPA 1LHDH 2M5TA 2V6NA 2J92A 2ZG0H 3OU0A 3PYHA 4HTCH 2STAE 2ZHQH 1LVBA 4AZ2B 3LGUA 1FPHH 3UPEA 4B2CA 5I46H 2WV9A 2G52A 4FUEA 2A5IA 3CS0A 2H6MA 3GCHB 4I7YH 2ZTZA 1K1NA 2A4QA 1HAHH 3HGPA 4WMEA 3I78A 1O38A 3FOAA 1CT4E 2PUQH 2W6JD 1S0RA 4DY7B 1JWTA 3BEIB 1M9UA 1OWDA 1VGCC 3M61U 1K1OA 1UK3A 1S6LA 1P2IA 4Y10E 1QL9A 1BHXB 4JZDH 3LDXH 4NIVA 3WW7A 3D23A 1EAUA 3VFEA 2ZFFH 2AGEX 1LVMA 3OX7U 5HXFA 4THNH 4CRBA 1GBAA 1OKXA 1MU8B 2AGIX 2DE9A 1TLDA 2VINA 2HNTF 1QY6A 3NCLA 4NG9H 2ZDNA 3F68H 2V0BA 2J2UA 1KXCA 1O2IA 3GY2A 4YESB 1H8HD 3DSGA 3ODDA 4IMQA 2ZIQH 2SGEE 4ABDA 2TGAA 2VB0A 1C9TA 4IS5A 1HNEE 2GZ7A 2QXGA 1ESAA 1C5VA 2ZI2H 3A7YA 2VIPA 3BG4B 1T4UH 1V2NT 3SI4H 4X2YA 5EJ1A 1MQ5A 1WU1A 1XXFA 5E2PA 2P3FH 1OWEA 1W7XH 1G3CA 2ZHFH 1O2VA 4OGYA 2BD5A 4TWWA 2KR7A 2TRMA 5CE1A 4OS1A 3EGKH 1O3NA 2A4RA 1OWHA 4FUDA 1QBOA 1UW7A 1CGJE 1P12E 3RMLH 2BLOA 4D9RA 1K1PA 4I32A 1C5ZB 1ELFA 1YPMH 3Q00A 1UHBA 3SORA 3ZYEA 2FOCA 4K8BA 1CO7E 2P16A 1BA8B 2HRVA 3H5CB 1JIMA 1MKXK 1SOTA 3TITA 1QJ1B 2Q6DA 1H9LB 1SMFE 1UCYE 4YT7H 5LGOA 2Z9JA 2BX3A 3BG8A 4YTAA 3SHAH 4B1TA 4R8TB 1ETTH 3UQVA 2AMPA 2XTTB 3PV2A 1P2KA 1TRYA 4UDWH 2PUXB 4YM9A 4OGXA 5DG6A 3F3BA 4ZCNA 1EB1H 1UO6A 4Y8XA 3MU4A 1C2EA 2IPQX 1QB9A 1C1VH 4LK4A 5HKKD 1XUIA 2RA0A 2ALVA 4ACBA 1Z8JB 1HAPH 3FP7E 3GY4A 3H7OA 4X1PU 4AG2A 1BTUA 3A88A 2QV1A 2P8OB 4TYDA 5C1XA 4ZXXH 1BMAA 3AK5A 2KCOA 2HPQH 2PW8H 3L33A 1ZMJA 5EODA 2PKSB 1YPGH 4JK6A 4INLA 1C5SA 1DY9A 1QRWA 2ZPQA 5EXNA 4ABFA 4AYVB 4LZ4B 1FY3A 1P2NA 1E1QD 2WUBA 1HJ8A 5TCCA 2ZFQH 4IN1A 3KHVA 2XXLA 1IQGA 2J97A 3V13A 1DY8A 1MAYA 2ZTYA 6CHAC 1LO6A 1GBIA 4ZHMU 1ZRKA 4CH2B 2VIVA 1IQJA 1O2XA 1GI0A 1SQRA 1BIOA 2KCYA 1TAWA 4YOIA 3SU4A 1JRSA 5C1YA 4ZAEA 1JIRA 4BXSA 3SJIA 4A1TA 2XBXA 1LQDB 2XC5A 4X2XA 1Z6JH 1O2OA 2YNBA 1CQQA 3O8BA 2F9NA 1D9IA 1DT2A 2BY7X 1EP5A 2V3MA 1HAYB 1BRAA 3HKJB 3F0PA 1UVTH 4NIYA 4FETA 1LHCH 4Q7XA 4Y8YA 1VGCB 2SGPE 1EFRD 4INKA 2FPZA 1O37A 2F4LA 1NPMA 1NY22 1AKSB 1EZXC 4WXIA 1MTSA 3C27B 1X7AC 2EI6A 1E35B 1TX7A 2JJ1D 1GI6A 4X2VA 1DLKB 3E6PH 2FX4A 1P02A 5E0JA 1HAVA 1GCTB 3LONA 1D3QB 1C5UA 1BDAA 1A2CH 1J17T 5T6FA 1H1BA 1YGCH 4GUXA 2ZGHA 2JH6D 2ZP0H 2GZ8A 3L3TA 4DCDA 1NRQH 1WYKA 1CA0C 5DJ7A 1F92A 3JZ2B 4AOQA 1IQKA 3MQKC 3FKSD 1FNIA 4Q4LA 3EA8A 1XVMA 1Z1IA 1P57B 1YCPH 1ZPCA 3F0OA 1WTGH 4AYYB 5A0CA 1VR1H 4CBNA 2RA3A 1K9OE 1GBTA 7GCHF 1WUNH 5KEDA 1VITH 1OP2A 5EW1H 1T7CA 1HBTH 1P3CA 3RDZA 2VWOA 1DFPA 3EAJA 3P70B 5DPAA 1UTPA 2UUYA 2JIZD 1KLTA 1C1QA 2G00A 4ISHH 4ABIA 4HFPB 1LCYA 1TBRH 1PJPA 2BD3A 4CREA 1NRRH 2B9LA 5F6MA 3T29A 2F43B 1O2MA 1SGNE 2CF9H 2BY9X 5AFYH 1WAYB 4B6EA 2WPKS 4X1SU 3BEUA 4YLQH 3URCA 3FP6E 4LZ1H 1HIAA 3M7UA 1BJUA 2F9BH 1ABJH 1O5FH 2RDEA 1LDTT 1SC8U 2FOFA 2A5KA 3QUMP 3C1KA 3TH3H 4O03A 5GIBA 4X8TH 1J8AA 2BQWB 2OK5A 1F0TA 1FY1A 2P59A 2ZGXH 3ZZ6A 2P94A 1LVYA 4J1YA 1HUTH 1C9PA 2FS8A 4YLUA 5BPEA 3SNEA 2ALPA 5DP3A 4B74A 3ZZ7A 4DGJA 2BDBA 4HGCA 4KGAA 3A87A 4ZUHA 2AIQA 2TIOA 3GCOA 1SLUB 2JKHA 1QRZA 3MH4A 3LGVA 2CHAC 2K1QA 2J98B 1C4Y2 1C5RA 2A4OA 3QTOH 4ZKSU 4ISLA 4NGAH 3EYDA 3MO6A 3FN8A 3SGAE 5C17A 1NTPA 5EW2H 1FI8A 4LOYH 2Z9IA 8GCHG 2WUCA 3GCTG 2B0FA 6LPRA 3GY5A 2STBE 1JRTA 2ZDKA 1BT7A 1IHTH 1S85A 4K8YA 5C0TA 1YBWA 2BD9A 4RN6A 4X8SH 4MQAA 4XRNA 3PO1C 2VWLA 2TBSA 2B5TB 1W12U 1SGTA 1YPKH 1SGQE 2W7UA 3SJOA 6CHAB 1FV9A 1HCGA 3UNRA 3SN8A 3B8JA 3KQBA 2V3OH 4M7GA 4ABBA 4F48B 4O3TA 2L6OA 1FQ3A 1V3XA 2QAAA 3LKWA 1GBCA 1GHBF 2ZU5A 2R3YA 4UD9H 5HGGA 3ZZDA 4A1VA 3SI3H 4BOHA 3A7WA 5AVDA 1OP0A 3LH3A 3SZEA 1A7SA 3SNAA 1UTOA 5K7RA 2WPDD 5GJ4B 1P11E 1C5YB 1IQEA 1EX3A 3A85A 1DSUA 1BUIA 2GDDA 2ODYB 1ZHPA 1AVXA 3ATIA 2LP6A 1GDQA 3A7VA 1BRUP 5DSFA 3ZV8A 5C5OA 3SNDA 4OM9A 3E91A 3OAAD 4JZ1A 2ASUB 1FXYA 2EQNA 5E0GA 2BD2A 1GGDC 1NBMD 1AE5A 2BD4A 2HGTH 3CS7A 3W1EA 5DP5A 3VB4A 1NRPH 1TNIA 4JZEH 3EE7A 3Q77A 1P8VC 2J4IA 3PM3A 3BTDE 1TBZH 2CK3D 3LJJA 3UFAA 2G4TA 2FIRH 2ZGBH 1O2YA 3QTVH 3U8TH 2H9EH 1GBMA 1VKYA 1CA0B 1FN8A 2P95A 3RXLA 4OS2A 1C2JA 4K3JA 1KXAA 4NZQA 7KMEH 1C1UH 1TGSZ 4TPYA 2BB4A 4Y76A 2G5NA 4ASUD 1VCWA 4Z0KA 1SBWA 3RXQA 4WH8A 1TPPA 1XXDA 1GBJA 2ZF0H 1W11U 4E7NA 1ZYOA 1NRSH 1QFKH 1UVUH 1TNJA 4X8VH 5EG4A 2R3UA 3A86A 3T62A 1LPZB 4CH8B 1A46H 1O5CB 4AX9H 4NFFA 1F0RA 1QIXB 3ZZBA 2P93A 3GCHC 2AERH 3TK9A 1AVGH 2FS9A 1DX5M 1ZRBA 3EQ0H 4OS4A 3AW0A 4Y7BA 3ZV9A 2BMGB 1MD8A 3PLKA 1SLWB 2FTMA 3P17H 1P01A 2RDLA 1C2IA 1L4DA 5I25A 2W5EA 5EU8A 4SGAE 4JYVH 2BDHA 2GX4A 1BHXF 2UUFB 1QCPA 1RIWC 1AUTC 3PV5A 2PGQB 3M5MA 2QE7D 4NA9H 1HV7A 2CHAB 4UFGH 1CT0E 2GKVE 1Z1JA 2ZA5A 1S81A 5DP9A 1GJ4H 4I33A 2FOBA 1O2TA 3D62A 1QGFA 3OYPA 1O2LA 3VB7A 3SBKA 1VJAU 1DM4B 1H9HE 3QGJA 1MTVA 3QZQA 1J14A 2VH6A 3GOVB 3PMHB 2F9VA 4IC6A 3STIA 1MD7A 4JCNA 1W10U 4K60A 3AAUA 5FBIA 2J38A 4ZKRU 1SQAA 2SNWA 1GPZA 1P3EA 1KTSB 2ZFPH 3RXFA 3SV9A 3QLPH 2PR3A 7LPRA 4CHAC 1WQSA 3S69A 2GDEH 3V0XA 1SLXB 2KCAA 3MWIU 3ODFA 1CSOE 1BTPA 3WWBA 4AB8A 3E3TA 4TY6A 4XBCA 1C5WB 4ZXYH 1UTMA 1GBKA 2GCTC 2VNTA 4X2WA 2CV3A 1YCPK 3MMGA 1A0LA 3KIDU 1K21H 1XMNB 2A7CA 3AW1A 2PP6A 4YOJA 3LGWA 1EB2A 1P2QA 1O2RA 3U98H 2J98A 3VB6A 1C1WH 3PLPA 3PTBA 2YMSC 1AZ8A 1SVPA 1UCYH 2G51A 2CXVA 5EIYA 1GVKB 3UWIA 5JBAS 1GGDB 2PHBA 2QF4A 1G32B 2WV5A 1P9SA 2I6QA 2FDAA 1S84A 3SJKA 1O3AA 3RXIA 3VB3A 2Z9KA 1WXRA 1GVZA 2DE8A 1BMLA 4X0WU 1DLEA 2ZHDA 2GMTC 1GMHG 1HAZB 2OC0A 1MTWA 4AORA 5A09A 1SGFG 1TYNA 1DE7H 2FWWA 1GBBA 4NFEA 4B73A 2CF8H 5CHBA 2FI5E 3F2GA 1SR5C 3Q3KA 1XUKA 3NXPA 4X6PA 2FOAA 5AF9H 3NRLA 1ZSJA 1Z71A 2XCNA 3FO8D 3PLBA 1VITG 1XUGA 1YLDA 3UR6A 2OC1A 3M36A 3OFND 2UWPA 4XD7D 2FP7B 1O3GA 2XC4A 4FVBA 2R2MB 1FIWA 3SV2H 1N6XA 4H6TA 1THRH 2Y5HA 4J2YB 3GDSA 3BTGE 3I29A 5LH8A 2RCEA 1L1GA 3PV4A 3MNXA 5FL7D 1QB1A 2PGBB 4NSYA 1AWHB 1NRNH 3AVZA 4GVUA 3KNXA 1SGYE 1SGDE 4K1SA 1BRBE 2J94A 1TB6H 1S82A 4GHQA 2BDIA 1B0FA 1K1LA 2AYWA 2LPRA 4A92A 2BXUH 3E16B 2ULLA 3RMNH 1C2MA 5EGMA 2Q6FA 2Y5FA 3ZZ8A 1QL7A 1MCTA 1NU7B 1RIWB 1MKWH 2ZC9H 1O5EH 1NFYA 1GBDA 2ZQ2A 4GCHG 1AHTH 1D3DB 2R0LA 3UAIC 4XDEA 3RXAA 1JOUB 1GCTC 3P92A 2FODA 1CA8B 4HI3A 1ZPZA 1NC6A 1O5DH 2QCYA 4BNRA 4FUIA 3N7DA 1DWEH 2VWMA 4X6NA 2ZGCA 4OS5A 1TQ7B 2Y80A 4NIXA 1PPBH 1HJAC 1P05A 2ZKSA 1NFXA 3A8DA 1P2MA 2NU2E 1KXEA 4RSPA 1MCVA 2QXIA 2SNVA 4B75A 3FZZA 4WWYA 3RXMA 2Y5GA 4ZKNU 1O32A 2BDGA 1ZTKA 1CT2E 2ZECA 5C1UA 3BTWE 1TONA 1GHAG 1DWDH 3U69H 3SGBE 1Q31A 4CHAB 2OLGA 4BAKB 1CVWH 4WVPE 1Y3VA 3MOCA 4HZHA 1HJ9A 4I31A 5EQRA 2XWBI 2GCTB 4CR5A 2IN2A 8GCHF 5FCKA 3GCTF 4K69A 3G01A 3TH4H 1ZPBA 1CU1A 1KYNA 2ZFTA 4IW4E 2A0QB 5FAHA 1SGRE 3DUXH 3T27A 5GPIB 1SQOA 4AG1A 2ZFRH 4GAWA 1O2JA 3BN9A 1T32A 2YMSB 1XM1A 4FUGA 1XKBC 9ESTA 1K1MA 1O39A 2LNCA 3SOSA 4AC9A 6GCHG 2UUKB 5CDFE 4E06H 3PROA 3ZVDA 3RLWH 3SQEE 1RJXB 2BZAA 4FUFA 1SB1H 1D4PB 2R2WU 2HNTE 3U8RH 3BTTE 1OWKA 2Z6BD 5JBTA 3TJUA 1ORFA 1HGTH 4Q7ZA 3RU4D 3UY9A 1WOFA 1GHWH 2Z3CA 2J34A 3W95A 2ZHWH 2QGRA 3A8AA 1ESTA 3P8OA 2GMTB 3UTUH 1LPGB 1S83A 1HAIH 3RP2A 1SG8B 4D7FA 1GI9B 1ZJDA 3ZVFA 1NZQH 4F49A 4JYUH 2H5CA 1EJAA 5GWZA 4K5ZA 1C2FA 3E1XB 2OQ5A 1V2OT 4BAMB 4X1RU 4PROA 1THSH 5DN6D 1K28D 1W0ZU 4IC5A 1SOZA 3MU0A 1UTJA 3TNSA 1GJ6A 4MLFB 1AO5A 3GISB 1BMNH 1GI2A 2G5VA 3MFJA 3U1IB 2Z7FE 1QRXA 1YC0A 1SSXA 3PWBA 2RG3A 3TNTA 5L6NH 2ZU2A 1DICA 1WV7H 4X1QU 2A45B 2ZCHP 2UWOA 1GJ5H 1AU8A 4MPXA 1C2DA 3URDA 5JB8S 1TE0A 4Q63A 2W3KA 3V12A 3UR9A 1TPOA 3RC4A 1BTZA 5GCHG 1PYTC 1O3EA 3S0NA 1OXGA 4QT8C 1OYTH 3M37A 3ZZ3A 1O3OA 1EASA 2BOHB 2EY4C 3AAVA 3T25A 3VXEH 3GS9A 5HM9A 4FUHA 1Y59T 1DUEA 1QBVH 5EJZA 2UUJB 2BQ7B 5EXLA 1Y5BT 3T2NA 1DSTA 4CRFA 3DD2H 2PSXA 4Y79A 3SV8A 3KQEA 1CHOG 1FONA 1TPAE 5TJXA 1D3TB 5DO4H 1W3CA 1TGBA 3PRDA 3O8RA 1A0HB 2Y7ZA 1KXFA 1TALA 3MH7A 3LJOA 1O3PB 4XBDA 3E8LA 1YKTA 1ID5H 4IN2A 5L30H 1ELAA 2FEQH 5FX5A 3VGCC 1HJAB 1UCYK 1HAXB 3NWUA 2TGDA 2ESTE 2ZDAH 1BRCE 2W3IA 2BY8X 4MNVA 5FPYA 4AFQA 1GHYH 3PB1E 4CBOA 3BIUH 3H7TA 3HK3B 1C4V2 2VBCA 2HPPH 1EJMA 3HPTB 5FPTA 3UB0A 1SFIA 4U2WA 2WHXA 3S9BA 1HDTH 4KKDA 4ZROA 3GCNA 2B7DH 5J4QA 1EPTC 3ATKA 1ZZZA 1BCUH 1J9CH 2G81E 1AN1E 2WV4A 2NU3E 2FESH 1PPZA 3SHCH 2ZU4A 3A8CA 4TY7A 3FANA 2PFEA 1F0SA 1EP6A 4M9FA 3RXKA 5BRRE 1N8OB 3A7TA 1OS8A 3ZZCA 1QL8A 2K0QA 4ZHAA 3K2UA 1TNLA 2I6SA 4IMZA 3KEEA 1L4ZA 1Y5UT 5ABWA 4SGBE 4JZIA 3LU9B 3HATH 2ZPRA 3U8OH 4ASHA 3P95A 2ZFSA 2Q6GA 1TMBH 1COWD 3VB5A 1F5LA 1TWXB 4MNYA 3E90B 3TK6A 3MHWU 5DP7A 2H9TH 4AB9A 4AGJA 2VIWA 2IJOB 2ANKH 4DIHH 3V3MA 5GDSH 4D7GA 4DT4A 2OBQA 1O36A 1CHGA 2CN0H 1GI8B 1N1LA 1O2PA 5EOKA 4MDSA 3RXEA 2OTVA 1W2KH 1AD8H 1A4WH 4FUJA 2BDAA 4FU8A 2SGFE 1LKAA 1MKWK 1DITH 3PRBA 1P2OA 1QHRB 1GDNA 4Q2KA 2QF5A 2WYJA 1SHHB 4JYTA 1A61H 1K1IA 1TOCB 3ZZAA 5DP4A 6ESTA 3BTQE 2EI8A 5HMAA 2XNDD 3CP7A 1O3KA 3LT3A 3FVFB 5HIZA 2XBYA 2FYQA 1NFWA 3I77A 1FN6A 1PPEE 1FY5A 1DWBH 2QYIA 1UVSH 1GMHF 1YF4A 2C4FH 1FUJA 2Z3DA 1SGCA 1T8LA 2GCHG 4FXGH 1Z8GA 1W14U 3RMOH 2R9PA 5A0AE 4R0IA 4Y0ZE 1DOJA 4KP0A 3TVJB 2SGQE 2HVXA 3H09A 5E2OA 3A80A 4A1XA 1LPKB 3ELAH 1FZZA 3QK1A 4MPWA 4D76A 1ZGIA 4AFUA 1G37A 1VITF 5CHAC 4BAHB 1C5PA 1GJ8B 1F2SE 4WH6A 1C1RA 2FM2A 3F1SB 2HALA 4DT7B 8LPRA 1KTTB 1RTFB 2JJ2D 4P00A 1ANEA 3SW2B 1GJCB 1TA2A 4ABJA 1IQLA 1FY8E 4MG3A 2D1JA 2VVCA 1AQ7A 3OE7D 1EQ9A 2AEIH 1YPLH 4FVDA 1V2UT 1PYTD 2EI7A 3EA9A 1P2JA 1N6YA 4NSVA 1OWIA 1BTWA 4GPGA 1NU9A 5AFZH 4ABEA 1MUEB 3VGCB 1SPJA 3BIVH 1W8BH 4Y6DA 1ARCA 1ZMLA 5FXLA 3HGNA 4DJZB 1C5TA 5FX6A 1QJ7B 1TOMH 1C2GA 3BSQA 5L2YH 2O8TA 4DURA 2G8TA 2A7JA 1ZR0A 1OOKB 1Z7KA 4NZLA 1Y3XA 1EPTB 2ANMH 4D9QA 2WSSD 1HB0B 4XSKU 4WY3A 1OWJA 3W94A 4F55A 3BTFE 2EC9H 2CGAA 3KQDA 2JH5D 2A2QH 5C0UA 1SL3A 4B6FA 1G3EA 1V2JT 2F9PA 3TGJE 1K1JA 4GLYA 1AKSA 5EPNA 3SV6A 1XKAC 2KX4A 2GP9B 4DOQA 5C67A 1ANBA 2UWLA 2O9QA 5F53A 1ELVA 3NPSA 1C5MD 2VIOA 1D6RA 1WDIA 3QX5H 1O3FA 2ZHEH 4B2AA 1O3BA 3NK8A 5JPMH 3GY8A 1UVPA
chains in the Genus database with same CATH topology
2QF0A 1NO9H 1VCPA 1VZQH 3SU1A 5AHGH 1GHAF 1SGIB 2PWXA 1GI7B 1XUFA 3LC3A 1ZJKA 4OS7A 4CR9A 2FI4E 3BTHE 1DDJA 2AMQA 1EZSC 3K6YA 1XX9A 3LIWA 1IHSH 2Y81A 1DUAA 2GVFA 1O3JA 3LH1A 3TH2H 2WPJS 3M5NA 4ISNA 3QGNB 3BV9B 1G9IE 4XFQA 1C5OH 2FYRA 2B8OH 2QIQA 1H4WA 3M7TA 2BDCA 1TNHA 1TGTA 1NROH 1RGQA 3T5FH 1EKBB 3ZYDA 1YPHC 4KELA 5FPSA 6GCHF 1E0FD 1GJBB 1C1OA 5T3HA 1IQIA 1Q3XA 3TJNA 3R0FA 5FHTA 1H8DH 4CRCA 5K0HA 1CE5A 4NCYA 3F9FA 1ETRH 2A7HA 1O2HA 3SU0A 2TPIZ 1IQFA 5JDUB 2TGPZ 1Z8RA 3DA9B 1TBQH 3MU1A 5JBCS 1C1PA 2PTCE 1AFQC 1RS0A 3LOXA 3RXPA 1E38B 4KTCA 3ATMA 3M3SA 5F03A 3QWCH 1TMTH 4I8JA 1IQMA 1JXPA 2BZ6H 1QQUA 3ZVBA 3MTYA 4RKJB 1BTXA 1PFXC 1LTOA 5CHAB 2OUAA 3UQOA 1YPHE 1O5AB 2AIPA 1BOQA 1MBMA 1HPGA 3Q76A 4Q80A 2VJ1A 3MH6A 3PWCA 4OS6A 5LPRA 1UMAH 5ESBA 1IQHA 1C1MA 3QO6A 4ZHLU 2W26A 1G2MA 3RLYH 3F9GA 2EEKA 2OP9A 5FCRA 3A81A 3RXVA 4K1TA 4NIWA 5GCHF 2O8MA 1G3BA 1AE8H 1XVOA 2A5AA 2JH0D 1HAOH 2NWNA 2VU8E 4FU9A 1PPGE 2BVXH 1V2WT 3RM0H 5C20A 1YCPM 1BZXE 1MTNC 3ZVCA 3RMMH 3M7QA 5DGJA 4B2BA 5C2ZA 2WPHS 1GL0E 2BXTH 1CHOF 2OQUA 3TPIZ 3TGKE 4X6MA 1QURH 3NZIA 3FP8E 1T8NA 1V2QT 2ZEBA 2BY5X 2H9HA 3M3VA 1E34B 3EA7A 4X8UH 3M35A 2F9OA 1GWAA 1UTQA 1OSSA 1GHVH 4UFEH 3A7XA 4U01A 3B23B 2ODQA 2XW9A 2D8WA 2F91A 1ELDE 1GJAB 4TWYA 3RXGA 1GHXH 1PPHE 3RXHA 3GICB 1QJ6B 1RXPA 1TQ0B 3GY6A 1AB9B 2CJIA 2Z9GA 2G55A 4WF8A 4WXVA 4DIIH 3QDZB 1GBFA 3SO3A 4BAQB 1UTNA 1C1NA 1VCQA 2GT7A 2DUCA 4H42U 3RUOA 1CBWC 4AN7A 1O31A 2SGAA 1EOLA 1FY4A 3K65B 1BITA 4Y7AA 4WJG2 1AZZA 1NN6A 1PPCE 2AFQB 3RXDA 1GBEA 1HIAB 1L1JA 1DVAH 1JMOH 1EPTA 1V2KT 1YPJH 2ZCKP 1ANDA 1RD3B 3SZNA 1Z6EA 1F5KU 1O34A 4A5TS 5JBBS 1V6DA 5DP8A 5TCAA 2FZZA 3GY3A 3SJ8A 1FAKH 1RTKA 4NA8A 2WPLS 2BQ6B 2HNTC 5EPYA 1HRTH 4Y8ZA 3TGIE 1AWFH 1MU6B 3TU7H 1MTUA 3TIUA 1T4VH 4Z6AH 1L2EA 2C93B 3SJ9A 5LPEA 1AFEH 2PLXA 5T6GA 1O2UA 1RFNA 2C8WB 2XWAA 1PPFE 3ZZ9A 2VIDA 2Z94A 3KF2A 2ILNA 3ATLA 1T8OA 1AFQB 1ELTA 4ESTE 1N8OC 5SGAE 2P3UB 1OX1A 2HLCA 5T6DA 4A7IB 4A6LA 3U9AH 1O33A 3BTEE 1DWCH 4JK5A 1A3BH 5A8YA 1DS2E 3UOPA 1QB6A 1GJDB 1TNGA 2P3TB 4UFFH 1GI1A 1LHFH 2YOLA 4H4FA 3K6ZA 1O3LA 3F9HA 4K1EA 2QXJA 3IWMA 9LPRA 1GCDA 1TPSA 1AI8H 1EZQA 1U6QA 5F8XA 3ZZ5A 3RXSA 1UJ1A 4B76A 2BDYA 1MZAA 1QR3E 3KQCA 1RRKA 3P8NA 4IBLH 2BX4A 3A89A 2TGTA 1RTLA 3AASA 2GCHF 3MO9A 4CRGA 1W7GH 2VWNA 4I8GA 3RXOA 2GD4B 1KDQB 1F0UA 1ZHMA 1BJVA 4FUBA 1L0ZA 1D6WA 3SUEA 3T28A 1SGPE 1CGIE 3LC5A 4Y71A 1EUFA 1KIGH 3K9XB 2Y7XA 1O5GH 1MTNB 1OP8A 3RXCA 3MYWA 4JZFH 1EXFA 1BQYA 1TX6A 1O2SA 2VGCC 3RXRA 1SGFA 1EZUC 1F7ZA 1BMMH 3ZVAA 1P10A 3PMJA 4YO9A 3MH5A 2GT8A 5JYIA 2H1UA 2GTBA 1HAGE 1P9UA 3GYMA 3VPKA 3UUZA 5EQQA 2THFB 3SUGA 3SV7A 1PQ8A 2F3CE 3RU4T 1V2RT 3RC5A 1DXPA 1Z8IB 3LGIA 1WBGB 1BB0B 1DPOA 5IDKA 4E7RG 2XBWA 4UFDH 1GMDG 4BAOB 4BTUB 4X6OA 1V2TT 1MBQA 3SU5A 2O8UA 1ANCA 3A82A 2IPHA 1C5LH 2C90B 2ZU1A 3FAOA 2ZO3H 1UTLM 5EXMA 2H2ZA 4GSOA 1CBWB 5ESTE 1LHGH 2QC2A 3UREA 2ZNKH 2OCVB 4F4OC 1TIOA 3RXBA 1ZSLA 1GMCG 3LGYA 3MO3A 3PMBB 1KLJH 2Z9LA 3S7HB 1HXFH 2GV7A 2VVUA 2ZGJA 1HXEH 1L1NA 8KME2 3R3GB 3P8FA 8ESTE 3DHKH 1AIXH 3OY6U 1BBRH 1C5NH 2YNAA 3LPRA 3A83A 4RKOB 1O35A 3SNCA 4X1NU 3UNQA 2ZDMA 2VH0A 2VVVA 5E0HA 4YOGA 4XOJA 1J16A 2FTLE 1FJSA 4U30A 3RXJA 2A4GA 1OYQA 1QTFA 1YM0A 1F5RA 1ZHRA 3NUMA 1GBHA 4NA7A 3IITA 2BD8A 1FDPA 2ZTXA 1C1SA 2OD3B 2BOKA 4DG4A 3L6PA 1V2LT 4NWLA 3GYLB 3Q3XA 4ZMAH 1LQEA 1QA7A 2PKAB 2ZCLP 5HM2A 1Y3YA 2QN5T 2O8WA 2HWLB 1AUJA 3A7ZA 4FUCA 2GZ9A 2BYAX 3MU8A 3RC6A 1E36B 2ZU3A 2BVSH 1ELGA 3O8DA 2VIQA 3P8GA 2Y82A 2AMDA 3T26A 3MI4A 2NU1E 1AGJA 1ABIH 4LXBH 1MQ6A 1TA6A 4CRDA 1P06A 2XC0A 3SU2A 3M5OA 1TFXA 1SI5H 1Y3WA 3F6UH 3HKIB 1WSSH 1KY9A 3M5LA 3TK5A 1EAIA 2J9NA 3D49H 3M3TA 1C4U2 3SUDA 5A8XA 3UNSA 1TX8A 3DFLA 1HLTH 1T8MA 3E0PB 3LGTA 1JBUH 1G3DA 1K2I1 1S5SA 4O97A 1O2WA 1GBLA 3RM2H 4I8LA 1C1TA 2ZWLH 2BVRH 4MNXA 2NU4E 1O3CA 1ZMNA 2BLVA 3MNSA 1S6FA 1GHZA 2ODPA 1O3DA 1BTYA 3SU3A 1FLEE 4Y11E 2AGGX 4ABGA 5A8ZA 2VGCB 1ZSKA 1TABE 5C3NA 1Y3UA 5A0BA 4ISOA 1MZDA 4O3UA 1EJNA 1Y5AT 2AS9A 3OY5U 1GDUA 2D2DA 1FMGA 3MNBA 2A1DB 1P0SH 5DP6A 3O8CA 4XBBA 1P03A 1C2LA 4I8HA 1WCZA 1W0YH 1FIZA 2CMYA 5E8EH 1C2HA 2R0KA 3ENSB 4Y0YE 4YZUA 1HFDA 5F8TA 1ZOMA 4XE4A 3A84A 1V2VT 4ISIH 5B6OA 5IYTA 1J15A 4KTUA 1KXDA 1E37B 1O30A 2AH4X 5F8ZA 1KLIH 2KAIB 1NM6A 1TGNA 3ITIA 1S0QA 1THPB 1GG6C 4FU7A 3BEFB 3U1JB 1FPCH 3UWJH 2BY6X 2SFAA 1ESBA 1KDQA 1A5HA 5DKMA 3S9AA 3UIRA 4O9VA 4AGKA 3DFJA 1UK4A 4VGCC 3SGQE 1GJ9B 2H5DA 1B7XB 2SGDE 1ELCA 1NT1A 3S9CA 1IQNA 2ZDVH 1TMUH 4AFZA 3TLOA 3D65E 3ATWA 2ZDLA 1Y8TA 1WTHD 1K22H 1SLVB 2BM2A 2OC8A 1PQ7A 5LPFA 1XUHA 2HOBA 3OSYA 1BBRE 3EE0B 3KL6A 3VXFH 3ESTA 1LMWB 1O3HA 4GCHF 5ETXA 3KGPA 3SU6A 3F9EA 3GY7A 2ZZUH 1ZLRA 1O5BB 3NKKA 2FOHA 4ABAA 1V2MT 1LVOA 4CRAA 4ZKOU 2JETC 2A31A 5L2ZH 3BTKE 2J95A 1UVOA 1H9IE 3OTJE 4Q7YA 4MVNA 3PMAB 4ZH8A 4D8NA 2Y6TA 5J4SA 1T31A 3SUFA 3EDXB 1GVLA 4NWKA 1KSNA 1A5GH 1MKXH 4MPUA 2OXSA 4H6SB 1GI5A 1SFQB 1W13U 1BTHH 1ELEE 3MNCA 1AB9C 1MAXA 2D26C 2FMJA 3TJOA 4BXWA 1B5GH 2ZQ1A 2BLWA 1NFUA 4TPIZ 4YT6H 1MH0A 1EATA 1YPEH 1KXBA 4BANB 1TNKA 1QQ4A 1IAUA 2OBOA 1O3MA 1V2ST 3E0NB 1DANH 2XYAA 4GHTA 2QXHA 1A5IA 4WMDA 1CGHA 7GCHG 1UK2A 4DW2U 2BLQA 5HYOA 2PV9B 2EA3A 1Q2WA 2BD7A 5FBEA 1O2ZA 2FLBH 2OC7A 1G30B 2FOMB 1UHBB 1IOEA 3ZVGA 4K2YA 4UONA 1TRNA 1P09A 3QN7A 1H8IH 1EAXA 4MPVA 3TJVA 2PTNA 2BTCE 2FX6A 3UOUA 7ESTE 1SQTA 1C2KA 2W7SA 3IG6B 4MNWA 2XNIA 2F83A 1ZTLA 3WY8A 2XRCA 1WQVH 2QA9E 3Q3YA 3ZZ4A 5CMXH 2FXRA 1D3PB 1AVWA 2FOGA 2PKAA 4JMYA 1MMJN 2GV6A 3MU5A 2QF3A 2F9UA 3ZVEA 3PO1B 1LKBA 1QNJA 1C5XB 1GJ7B 4DVAU 3P6ZB 3BG4C 5A2MH 4BTIB 1B0EA 4AFSA 1V2PT 1O0DH 2XCFA 1BBRK 2G4UA 4I8KA 1O2QA 5C5NA 3RXUA 3GDUA 2XBVA 1GI3A 1ETSH 3CENA 1FAXA 1XUJA 1G2LA 2C8ZB 3SNBA 3VEQB 5H4IB 1GG6B 1OPHB 2WPMS 1NS3A 1NESE 1P04A 2ANWA 2OINA 3GDVA 3DT0H 4UEHH 2O8LA 1YLCA 2FO9A 1C5QA 4UE7H 1ARBA 1LHEH 2A32A 3A8BA 4INHA 3KCGH 2ANYA 2BHGA 3B9FH 3STJA 1A1RA 2QY0B 4VGCB 1QA0A 1ACBE 2FI3E 5EQSA 2A2XH 1PQ5A 3HK6B 1YP9A 1GI4A 1DXWA 2Q1JA 1ZGVA 2FOEA 2NU0E 5JB9S 1INCA 3JZ1B 1SGEE 1SHYA 3S7KB 2WYGA 5GXPA 3BTME 1TGCA 3V7TA 2V35A 2Z3EA 1O2KA 3SQHE 4MTBA 4KTSA 1O2NA 2C8XB 1GMDF 4B71A 1EOJA 1GHBG 3QZRA 2GGVB 1YYY1 1AMHA 1ZTJA 3RU4E 1QBNA 4IGDA 1GL1A 1PQAA 1ELBA 2V3HH 2WPIS 3KN2A 4WMFA 4ABHA 2P8OC 5PTPA 4U32A 4BTTB 1TRMA 1S6HA 1O3IA 2PKSC 3FZDA 1HAVB 3PTNA 2ZPSA 3FFGA 1A0JA 1O2GH 2WINI 1AY6H 2PSYA 1EAWA 1GMCF 2C8YB 1A3EH 2JETB 1VJ9U 3N7OA 2IOTA 4E05H 2KAIA 2FLRH 2C3SA 1UTKA 1HYLA 3BF6H 5G4BA 1G36A 3RXTA 5DK1A 1LHDH 2M5TA 2V6NA 2J92A 2ZG0H 3OU0A 3PYHA 4HTCH 2STAE 2ZHQH 1LVBA 4AZ2B 3LGUA 1FPHH 3UPEA 4B2CA 5I46H 2G52A 4FUEA 2A5IA 3CS0A 2H6MA 3GCHB 4I7YH 2ZTZA 1K1NA 2A4QA 1HAHH 3HGPA 4WMEA 3I78A 1O38A 1CT4E 2PUQH 1S0RA 4DY7B 1JWTA 3BEIB 1M9UA 1OWDA 1VGCC 3M61U 1K1OA 1UK3A 1P2IA 4Y10E 1QL9A 1BHXB 4JZDH 3LDXH 4NIVA 3D23A 1EAUA 3VFEA 2ZFFH 2AGEX 1LVMA 3OX7U 5HXFA 4THNH 4CRBA 1GBAA 1OKXA 1MU8B 2AGIX 2DE9A 1TLDA 2VINA 2HNTF 1QY6A 3NCLA 4NG9H 2ZDNA 3F68H 2V0BA 2J2UA 1KXCA 1O2IA 3GY2A 4YESB 3ODDA 4IMQA 2ZIQH 2SGEE 4ABDA 2TGAA 2VB0A 1C9TA 4IS5A 1HNEE 2GZ7A 2QXGA 1ESAA 1C5VA 2ZI2H 3A7YA 2VIPA 3BG4B 1T4UH 1V2NT 3SI4H 4X2YA 1MQ5A 1WU1A 1XXFA 5E2PA 2P3FH 1OWEA 1W7XH 1G3CA 2ZHFH 1O2VA 4OGYA 2BD5A 4TWWA 2TRMA 5CE1A 4OS1A 3EGKH 1O3NA 2A4RA 1OWHA 4FUDA 1QBOA 1CGJE 1P12E 3RMLH 2BLOA 4D9RA 1K1PA 4I32A 1C5ZB 1ELFA 1YPMH 3Q00A 1UHBA 3SORA 3ZYEA 2FOCA 4K8BA 1CO7E 2P16A 1BA8B 2HRVA 3H5CB 1JIMA 1MKXK 1SOTA 3TITA 1QJ1B 2Q6DA 1H9LB 1SMFE 1UCYE 4YT7H 5LGOA 2Z9JA 2BX3A 3BG8A 4YTAA 3SHAH 4B1TA 4R8TB 1ETTH 3UQVA 2AMPA 2XTTB 4UDWH 1P2KA 1TRYA 2PUXB 4YM9A 4OGXA 5DG6A 1EB1H 1UO6A 4Y8XA 3MU4A 1C2EA 1QB9A 1C1VH 4LK4A 1XUIA 2RA0A 2ALVA 1Z8JB 1HAPH 3FP7E 3GY4A 3H7OA 4X1PU 4AG2A 1BTUA 3A88A 2QV1A 2P8OB 4TYDA 5C1XA 4ZXXH 1BMAA 2HPQH 2PW8H 3L33A 1ZMJA 5EODA 2PKSB 1YPGH 4JK6A 4INLA 1C5SA 1DY9A 1QRWA 2ZPQA 5EXNA 4ABFA 4AYVB 4LZ4B 1FY3A 1P2NA 2WUBA 1HJ8A 5TCCA 2ZFQH 4IN1A 3KHVA 2XXLA 1IQGA 3V13A 1DY8A 1MAYA