2H1UA

Porcine pancreatic elastase complexed with metpheleuglu at ph 5.0
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords MFLE
publication title Structural analyses on intermediates in serine protease catalysis.
pubmed doi rcsb
total genus 60
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2006-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2h1uA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2h1uA01
3E0NB 2Z9JA 2VWMA 1C9PA 1W11U 3AASA 1VGCB 1BRAA 1MKWH 4AFUA 3SNDA 1BBRK 1M9UA 1XVMA 1FY3A 3A87A 1YCPK 2ANMH 4I8HA 4YLUA 3UOUA 4WMEA 3SNAA 2Z9GA 4ISNA 5DJ7A 2AMPA 4UFDH 1NRRH 1OWKA 2GKVE 3KHVA 3RM0H 4BNRA 2SFAA 1NT1A 5DP4A 2GMTB 1TNJA 2TRMA 1A3EH 3KCGH 1WSSH 1KXBA 1O2ZA 1W0ZU 1BMMH 3FAOA 3RC6A 2WPMS 2V0BA 4KP0A 2R0KA 1FMGA 1GG6B 1PQ5A 1O3HA 2PUQH 4KELA 3TJUA 2ZHFH 3LU9B 4X2VA 3E8LA 2IPHA 1WAYB 2GVFA 4AGJA 1ZLRA 1P2JA 3QZQA 2P93A 4NFEA 1CVWH 3TK6A 4X1RU 2UWLA 1FY8E 1RFNA 1E37B 1HJ8A 3SUFA 1EXFA 1MBQA 2A31A 2B0FA 2P3FH 3GDSA 4E7NA 3NWUA 1Z8JB 1GBTA 2WPJS 1KLJH 3B23B 1ZR0A 1CBWB 4J1YA 3TJOA 2P94A 4K60A 4DVAU 2BVXH 3RU4D 4ISHH 1L1NA 3K9XB 1P2QA 4GAWA 2FLBH 2ZU1A 1L0ZA 2XWBI 1DOJA 1O3BA 3URCA 3LGIA 1O2OA 3ZV8A 1GBIA 1T7CA 1LPZB 1T8MA 1BJUA 1QA0A 3A86A 3BTKE 4JYVH 2FXRA 2BD8A 1V2MT 3A83A 3KEEA 1G2MA 1A5IA 3RM2H 2VU8E 2ZECA 2OCVB 2ZGHA 2SGFE 1O2HA 4XE4A 3FVFB 2J34A 5DG6A 2NWNA 1ACBE 3B8JA 1CT2E 1TRNA 1YBWA 1XXDA 1UCYH 1FZZA 4MDSA 4SGBE 4ZXYH 2ZQ1A 6GCHG 3L6PA 2ZCLP 4BAQB 2G51A 1VCPA 1Z6JH 2WUCA 1DX5M 1NM6A 1QB9A 3M36A 3PV4A 1UTOA 1PPFE 4AB8A 1CA0B 3ZVFA 4F49A 1HAOH 4Y79A 2HPPH 4I31A 5FBEA 2QIQA 5CHAC 1IQGA 2SGPE 1YP9A 4CH8B 4DIHH 5HM2A 4NWKA 1DY8A 2Q6GA 1WUNH 1J14A 1KIGH 1EQ9A 4Y6DA 1XKBC 1K1NA 2FZZA 2XTTB 3H7TA 3MNCA 3V7TA 4Z6AH 4CRGA 5ETXA 1UK2A 3MHWU 1O5BB 2V3OH 4CRFA 3IG6B 1GDQA 1AVWA 2OXSA 3L33A 3SHAH 1LKBA 1QJ6B 1F5KU 4LZ1H 3RXRA 2VVVA 3SJ8A 1JBUH 5DP6A 3LPRA 1GBDA 1C4U2 1FQ3A 2FOAA 3ZZBA 4CH2B 3LGVA 1YPHC 1P12E 2F9PA 1ZSKA 2FS9A 4VGCB 2C93B 1LHDH 1IQHA 2G5VA 4OS7A 1HAPH 2FEQH 8ESTE 3ESTA 3LC5A 1SMFE 2NU3E 2R9PA 5DP7A 3RU4E 1C1SA 1C2EA 1J15A 2A5KA 3BTQE 4U32A 2XYAA 1E0FD 6GCHF 1W14U 1MKXK 1X7AC 3CP7A 2AGIX 1MQ6A 1P57B 2GT8A 1BHXB 1DWDH 4GUXA 2Y80A 2XRCA 1AWHB 4DCDA 2G00A 2VWOA 1ZHPA 1DT2A 2GV7A 2H9HA 3A85A 2OBOA 3TITA 3KQDA 1HB0B 4JYTA 4DG4A 2BZAA 2Y5HA 3JZ2B 1PYTC 2ZF0H 1PPCE 1C1OA 3TH4H 1AZ8A 1IAUA 5AVDA 2J9NA 2BLWA 2PHBA 1V6DA 1ELAA 3KQEA 2PSXA 1KTTB 2HOBA 4JZIA 1BMLA 3QN7A 1SQTA 1BBRH 3HPTB 2XC5A 1HXEH 5HXFA 1YCPH 5FX5A 4BTUB 1C1MA 1NO9H 1BTWA 3GDVA 1O2XA 2A7CA 1NTPA 4H6SB 2UUJB 1KXCA 5A8XA 1PQAA 4AG1A 2AERH 2A4GA 3VB4A 3SUEA 2R3YA 4K1SA 3F9GA 3MH6A 1XM1A 1G36A 2AMQA 3A8AA 3PMAB 2PGQB 3LC3A 2VH0A 3GYMA 4ZH8A 3R0FA 2SGEE 1GL1A 2GP9B 1AY6H 1V2NT 3BF6H 4MTBA 1TYNA 1OP2A 1TGCA 2FX6A 3IITA 1AU8A 3OX7U 1OX1A 2A2XH 3UREA 1DXWA 2H9EH 1K1MA 2EI6A 3BV9B 1MMJN 3K6ZA 2FOHA 1AE8H 4INLA 4FVDA 1KDQB 1TNKA 1L1GA 2PFEA 1G2LA 4B2CA 3UQVA 4Y8ZA 4IC6A 3CS0A 3EQ0H 2OQ5A 1BTXA 3ZVCA 2W26A 1SGCA 2GDEH 2BY8X 3A7TA 4NA9H 1GBLA 1E38B 1OYQA 4ABHA 5A09A 1UK4A 2CGAA 3QK1A 1QCPA 1G32B 1YGCH 1ANDA 4ISLA 2XW9A 1F0UA 2ZDNA 4MG3A 4Q2KA 5E0JA 1O5FH 1FXYA 1SGFG 1MZAA 1XUFA 5T6GA 4BTIB 5GCHG 3M5LA 1K28D 4CRAA 2OC0A 1GBJA 3W94A 1DY9A 2CF9H 1GCTB 1O3EA 4OS5A 5JBAS 2R2MB 3ZZ8A 2HWLB 2FYQA 4RSPA 1K21H 5LH8A 1ZSLA 1O5DH 5LPEA 2EEKA 1Y3VA 3PLBA 2QYIA 2F91A 1BUIA 1YPHE 4FUBA 1P09A 1ELVA 1THRH 1O31A 4ABJA 1FPCH 1LQEA 1QFKH 3TJVA 1HJAC 2ZTXA 1H8IH 5JBCS 4THNH 1SBWA 1AD8H 1F5LA 1NRQH 3M37A 1DFPA 2ALPA 1GBKA 4MNYA 2NU4E 1C5UA 3K6YA 3LKWA 1ZMLA 3B9FH 1C5SA 1C5RA 1BCUH 2ZGCA 1P2NA 2ZEBA 1MAXA 1OP0A 2FOBA 4CHAC 3BTEE 4FUFA 1SI5H 1D4PB 3F9FA 4Q80A 1KDQA 1UTLM 1D3DB 2FO9A 2BQ7B 3U98H 1Z8GA 1QJ7B 3EA7A 2BY7X 1GHVH 2J94A 5BRRE 4BXWA 1SOZA 1H8DH 1HGTH 3P95A 1QL8A 3K2UA 1Y3WA 4CRCA 2A7HA 1O5CB 5E2PA 4Z0KA 4ZKOU 5GCHF 1CA8B 1S84A 2W7UA 1QGFA 4UD9H 3LH3A 4X6OA 5TJXA 3RXIA 1C5PA 3M5MA 2ZHWH 2FOMB 1GMHG 1SL3A 4AOQA 1NU7B 1P05A 2ZHDA 1N8OC 2P8OC 4IN1A 4BAHB 1BTHH 5BPEA 1A7SA 2Z9KA 1BRCE 3T62A 3KNXA 4TYDA 3I77A 3GY6A 3EGKH 2FMJA 1DDJA 2ZNKH 3GCTG 3KGPA 4WH6A 1BT7A 1SR5C 1VJAU 4A1VA 2BY6X 1HUTH 2J92A 4A1XA 1VGCC 4NIXA 4GVUA 4X1SU 3BSQA 3HKIB 1MKXH 1Z71A 3U69H 7KMEH 2BDCA 2GTBA 1DS2E 5GXPA 2ZGBH 1YYY1 1SSXA 1PPBH 3HGNA 1EUFA 5A0AE 1HAGE 3RXKA 3EA8A 1HNEE 3KQCA 3ATWA 3RLYH 4RKOB 1HAHH 3RXMA 2GDDA 2PW8H 4UE7H 2QCYA 3DUXH 4AX9H 1TMTH 2GMTC 2VGCB 5FHTA 3HK6B 1RD3B 3FZDA 4GPGA 2WPLS 3M3SA 2QAAA 2FODA 3SOSA 3LIWA 3GCNA 2BD2A 3P92A 1GG6C 3TGIE 3MI4A 1A4WH 1GPZA 4ZUHA 2BDAA 1GMHF 5B6OA 2PLXA 1BTYA 3V0XA 1E36B 2B8OH 3ZVDA 4DGJA 5DP8A 2ASUB 4E05H 4B73A 2IN2A 3GCTF 4H4FA 4ZXXH 3DD2H 1GHAG 2GV6A 3E16B 4MPUA 8KME2 2UWOA 2VIQA 2BHGA 2UUKB 1P06A 4ZAEA 3PB1E 2A1DB 4X8TH 2A4QA 3VPKA 1KY9A 2VVUA 3Q76A 3OYPA 1JWTA 2GCTB 1O2TA 1F0TA 2A5AA 2AFQB 2ZC9H 2GD4B 4Y7BA 2F3CE 3RXGA 1EPTC 1FY5A 1GVLA 2CJIA 1CBWC 2BOKA 1PPHE 2ZTZA 1TNGA 3SV7A 1K2I1 4HI3A 1TONA 4NWLA 1QQ4A 1ESTA 3RMMH 3V3MA 1XUHA 3ZZ3A 1BZXE 1LTOA 1MZDA 2BD5A 1JIMA 2ZWLH 2JH6D 4A1TA 1YPLH 1EJMA 1JIRA 2Q6FA 1O3LA 3SJIA 1FIWA 3STJA 2WPKS 1SGFA 1IQKA 1ETSH 2Z3DA 3A82A 3LGTA 4NFFA 1NESE 2Y5FA 1P11E 3RXQA 1J17T 4O3TA 3A8DA 1IHSH 1TQ0B 4BANB 1UTMA 4LOYH 2ZHQH 2G55A 1EAWA 3BTHE 4YT6H 4ISOA 2BM2A 1D3QB 1Z8RA 2D8WA 2F9NA 1INCA 3PYHA 4Q7YA 3M3VA 3CENA 1CA0C 5L30H 2PKSB 1EATA 3RC4A 1H4WA 2WV5A 2TGAA 5C3NA 1N6YA 3UPEA 2BZ6H 1K9OE 4FUIA 1C2HA 1C4Y2 1GVKB 1C1RA 3TNSA 2ALVA 2H9TH 1L4DA 1AFEH 3SU1A 2ILNA 1GCDA 5DKMA 1C1VH 3LH1A 1OXGA 2O8UA 2FOCA 2AEIH 3RXDA 5T3HA 1BJVA 1VJ9U 1GJ5H 3PLKA 1Z1JA 3S9BA 2H2ZA 1NU9A 1O37A 2FI3E 3MFJA 1K1PA 1V3XA 2FOEA 4AN7A 1XKAC 6CHAC 1YPKH 4CR9A 1GBCA 5C2ZA 2BD3A 1GJ9B 2O9QA 1GI1A 3UNRA 1G37A 1DM4B 4VGCC 4ABAA 1KXEA 1MD8A 1AGJA 1ZPCA 1G3EA 2ZPSA 4MLFB 5EQQA 5T6FA 1O3OA 4X8VH 3U8OH 3RXFA 3UOPA 4A92A 3I78A 1GJDB 1TOCB 4DW2U 4X6NA 2BD9A 1TGBA 3MU8A 3RXJA 1TQ7B 4ZHMU 3V12A 1GI7B 4UEHH 2A4OA 5E2OA 1VITH 2B9LA 1TMUH 1FIZA 1MU6B 2PSYA 3EA9A 2GCHG 1GJ7B 2O8TA 4FU9A 5EXLA 3SJOA 2SGDE 3RXTA 5G4BA 4B2BA 1WU1A 3A81A 2OTVA 1PQ8A 1QTFA 1O35A 3MU4A 4H42U 1FN8A 3PWBA 3ATLA 4DY7B 1UTJA 1O3MA 3VB7A 4X6PA 2F9UA 1T31A 3BN9A 3E90B 3RXHA 1ZTLA 3SV2H 4IBLH 3S69A 2PTNA 1SOTA 2FIRH 1O39A 2XBYA 4LK4A 4O9VA 5DO4H 4D9RA 1EZSC 3FP7E 1O3IA 1NC6A 2VIPA 2FOFA 1SGPE 1S82A 1JMOH 3RP2A 3O8CA 3T25A 1B0EA 1HAXB 4X1QU 1MTNB 4E06H 1TBRH 3VB3A 3ENSB 3GY2A 4FU7A 3RXPA 5JB9S 1TGTA 1XUJA 2PR3A 5GPIB 1K22H 2QXJA 5DP9A 1C5VA 2GCHF 3DT0H 4CREA 1HIAA 4X1PU 2K1QA 1FAXA 1K1LA 3T28A 4IGDA 1W13U 1T8LA 5HYOA 1F5RA 1CT0E 3LJOA 5T6DA 3ZZDA 2BOHB 3RXBA 3SNBA 2OP9A 4TPIZ 1MTVA 4TY6A 2XXLA 4I8LA 3UNQA 2VNTA 4X2WA 1TNHA 2BLOA 1SGTA 4FUDA 3GISB 4RKJB 2ZPQA 1V2JT 5EODA 1KXFA 2CF8H 2VIWA 3UR9A 3MO3A 3ZZ7A 3S0NA 1QIXB 2OD3B 4OS2A 1UTPA 3P8FA 1ZZZA 3PLPA 1XUIA 4YM9A 1O33A 2A45B 1A46H 5ESBA 4NIVA 3A7VA 2BB4A 1GCTC 2HRVA 2LPRA 4ZHAA 1TA2A 2ZFFH 2VWNA 1S6HA 4O97A 1Q3XA 3SU4A 1DLEA 1FLEE 1JOUB 3TGJE 5EU8A 3SNCA 1V2UT 1O0DH 3ODDA 2OQUA 1GBAA 3PTNA 2ZU2A 1TALA 2RA0A 7ESTE 1E34B 2XCNA 4JZ1A 2H5CA 1GI5A 1C5OH 2VIOA 4ZKRU 4KGAA 4XFQA 2ZDKA 4ZHLU 3Q77A 3SQEE 3GYLB 3MO9A 1IHTH 3BEFB 4UDWH 1OOKB 1ANBA 4X0WU 3BG4B 2CXVA 1NROH 1F2SE 1MCVA 3GICB 3VXFH 1O2MA 3NXPA 4Y0ZE 4KTSA 2V3HH 3T26A 1AVGH 4Q7XA 3SZNA 3GCOA 1GBFA 1LHGH 3HK3B 3U1IB 1QB1A 1ID5H 3FP8E 3A7YA 1J9CH 2AH4X 1LVYA 1NFXA 3T29A 1B0FA 4XOJA 3A84A 3U9AH 3SNEA 2ANKH 3RMNH 4JCNA 3R3GB 3UUZA 1H9LB 1SGIB 1AVXA 1ELGA 5EPNA 4WMDA 2F9VA 2FPZA 1A5GH 4WY3A 1V2PT 1CHGA 1AHTH 1C5WB 1VCWA 2W7SA 5IYTA 1GMCG 5HMAA 3U8TH 2ZDLA 3QO6A 2ZFPH 1SGNE 2QGRA 1LHCH 1Z1IA 1C5QA 1YLCA 5EQRA 3PMHB 2TBSA 4NSVA 1Y5BT 1NS3A 4D7GA 5GDSH 2A4RA 2BXUH 1DPOA 1BIOA 2VIVA 4NIYA 3SBKA 3V13A 1TABE 1QRWA 1P10A 4PROA 1BBRE 3M7QA 7GCHG 1SGQE 1S81A 1YM0A 4MPWA 2EA3A 4LZ4B 2PWXA 1YCPM 1J16A 2FS8A 1QY6A 1VCQA 5L6NH 1OWHA 3AW1A 3BIVH 8LPRA 1O2SA 4CBNA 1DLKB 2SNVA 2QXHA 2OBQA 1QA7A 2GZ9A 1T8NA 4FU8A 1GHBG 2BLVA 2NU2E 4ESTE 4I8KA 5C5NA 1HAIH 3LT3A 2ZFTA 3A7ZA 1HYLA 3LJJA 1CGHA 1GMCF 4QT8C 2KAIB 1AO5A 1AB9B 4NZLA 1TFXA 2YOLA 5FPTA 2AS9A 2GCTC 4Y7AA 1C2IA 1WOFA 1XMNB 2C8XB 4YESB 1P03A 2FP7B 2C3SA 2FDAA 3EDXB 3SORA 2ZCHP 3BIUH 2P95A 2STAE 3M7TA 1TNIA 3NK8A 3E3TA 1TX7A 2EI7A 3LGYA 3TH2H 5C1YA 3UR6A 1OS8A 1G30B 2OUAA 1HAVA 1KLIH 2XWAA 4YZUA 2A5IA 3QGJA 1SFQB 1PYTD 1C1UH 7GCHF 1ZJDA 3STIA 2GGVB 2OC7A 5JB8S 2BQ6B 4ASHA 2Y5GA 1SQOA 1AUJA 2AYWA 1O2WA 1AN1E 1NN6A 2FM2A 4GLYA 1UVPA 1HPGA 3A7WA 4FUGA 1NY22 3RC5A 2O8LA 1GBMA 1GHBF 2QN5T 5F03A 4XSKU 2SGQE 2TGTA 1JXPA 1O3NA 4WH8A 4YO9A 2FI4E 1YKTA 1L1JA 4AZ2B 3AW0A 1B5GH 4GSOA 1EJNA 2LNCA 1C1TA 3SJKA 1FDPA 1J8AA 1GDUA 1AKSA 1Y3UA 2P3UB 2PKSC 3HATH 4ZROA 1EOJA 1RTLA 1GBHA 1SFIA 1Z6EA 1O2IA 4K3JA 3P8NA 1TPOA 3F6UH 2XBXA 4O03A 1EAUA 2BTCE 1UVTH 5EQSA 5FAHA 4H6TA 4Y8YA 5CMXH 1W7XH 1LQDB 3PTBA 1A2CH 2BDGA 2HNTC 1EP5A 2HVXA 2ZIQH 1FY1A 3SUDA 2KAIA 1ZYOA 1THSH 3SU6A 1LMWB 1ZMNA 1K1IA 1P2KA 2ZDVH 1TX6A 1PQ7A 2Y7ZA 1C9TA 3Q3YA 1P9UA 2OC8A 3OTJE 3SV6A 1ELDE 3D65E 1O2LA 1MBMA 2ZG0H 1C1NA 1NRPH 1O2RA 5GWZA 1ZMJA 3ZZ9A 4BAKB 1OWIA 2BMGB 4UFGH 1FONA 1LKAA 1S85A 2XC4A 3C1KA 1A5HA 2F9BH 3MH5A 4K5ZA 1B7XB 3ZVEA 3TIUA 1ELEE 3D23A 4D76A 1QR3E 5C1XA 1Y5UT 5E0GA 3F68H 1OPHB 3LDXH 5EXNA 5FBIA 2AIPA 3QGNB 3TPIZ 1YPEH 3UQOA 2Z3EA 4Y71A 4HTCH 2XBVA 1KTSB 2A0QB 4D7FA 3ZV9A 2PGBB 1RGQA 3ATMA 2BVSH 5AHGH 1O2QA 2ANWA 3QUMP 2R3UA 1EASA 1OSSA 4GHTA 4XBDA 4D8NA 1RTFB 3KN2A 1K1OA 3SHCH 1FJSA 1TA6A 1H9IE 3M61U 5LPRA 1BB0B 2QF0A 2Z94A 2BX4A 4OS1A 3SGBE 1Y3XA 4INHA 3Q00A 3P17H 4ABGA 4AORA 1N1LA 1CU1A 4A6LA 4AFQA 1RS0A 1TGNA 3RXCA 1MUEB 2J95A 2FTMA 1MTNC 4X2XA 1W10U 4AFSA 2BDYA 3ELAH 1Q2WA 1G3CA 1FUJA 3FP6E 2VWLA 4M7GA 1P3CA 1O38A 1TNLA 3ZZ5A 4IC5A 2CMYA 4AYVB 4R0IA 1ZHMA 3W95A 1C5NH 4K1EA 4U01A 3RMOH 1GMDG 4K69A 2XCFA 1W12U 1DITH 1FY4A 1ORFA 1UTNA 2ODYB 3O8RA 2XNIA 3BEUA 3SU5A 1C2KA 2AGEX 2JH5D 2SNWA 2M5TA 1AWFH 3GCHB 1WQVH 1ESAA 3Q3KA 3QX5H 1F0RA 1KYNA 1G3BA 2EC9H 2DUCA 5FPSA 5C67A 2PTCE 3D62A 1D3PB 2HNTE 3VB6A 1Y3YA 1AFQB 2NU0E 3GY7A 3ZZCA 1UMAH 1UVSH 1EAXA 2J38A 1T4UH 3NKKA 2FTLE 2G8TA 1SGEE 2Y81A 3PROA 1GI2A 3WY8A 4YOIA 3JZ1B 1UJ1A 1WQSA 4TWWA 2G81E 3NPSA 1NPMA 1O3DA 3PO1B 1GJAB 5I46H 1IQLA 2H5DA 4I8JA 3AAUA 4ISIH 1TPAE 2AMDA 5AFZH 1EOLA 2D2DA 3MO6A 1GMDF 4MPXA 1LDTT 1P9SA 3UTUH 1P0SH 2C8WB 3BG4C 1O2YA 1D9IA 1U6QA 5F8TA 1O3KA 3UNSA 2HNTF 5ESTE 5A8ZA 3BTDE 2IOTA 4ZKSU 2ZGJA 2VH6A 1A0HB 3A89A 2J4IA 5L2ZH 5L2YH 3FZZA 1BDAA 1SGRE 4INKA 1T4VH 1D6RA 1UVOA 1CQQA 3OSYA 2JKHA 1ABIH 1P01A 2G4UA 2ANYA 4K8YA 1C1QA 1A0JA 3UWJH 3VGCB 3UWIA 3ITIA 1TAWA 4Y8XA 3ZVAA 1ANEA 3SJ9A 3RXSA 2V35A 4IMZA 1BITA 1GHYH 1O5EH 1GI4A 1H9HE 2F9OA 4LXBH 3TLOA 1V2ST 5K7RA 2ODQA 4KTUA 1IQJA 2Y6TA 2UUFB 4JMYA 3MH4A 1HIAB 1MD7A 3OU0A 1QBNA 2I6SA 2ZU3A 4UFFH 4YOGA 4KTCA 3P8GA 6ESTA 3PMBB 1EB1H 1SVPA 1HLTH 5JBTA 5LPFA 1ESBA 1BOQA 1O2JA 4JK5A 4WJG2 1C1PA 3UIRA 4YLQH 1QQUA 1AZZA 2D1JA 1PFXC 4Y76A 2W5EA 2GX4A 1BTZA 2C8ZB 4MNVA 4AG2A 4IW4E 4X8UH 1YF4A 3F1SB 4ZMAH 1V2WT 4B75A 1TRMA 1EB2A 3SN8A 1P2IA 3GY4A 1TPSA 1SLWB 2ZA5A 1L4ZA 4Q7ZA 4B71A 1C5XB 3PMJA 1O32A 2P8OB 1SLVB 1MTUA 1SHHB 1YPMH 1QRZA 1FV9A 4TY7A 1RTKA 4E7RG 1DUEA 3E1XB 2P3TB 1TGSZ 1A3BH 3OY6U 1PPZA 1F92A 1TRYA 1C5ZB 3SUGA 3SV9A 4NGAH 2DE9A 4MNWA 4WWYA 1LHFH 1AB9C 4AYYB 1OP8A 1UTKA 1MCTA 1NFYA 2RCEA 1ANCA 4BXSA 3KIDU 1CO7E 4NA8A 1MAYA 1XVOA 5A0CA 1O3PB 1GVZA 3BTME 3ZYEA 4OGXA 2BVRH 4OS6A 1HFDA 4NCYA 1S6FA 1NFWA 3BG8A 4WMFA 4JZFH 1KSNA 3BTTE 4B1TA 4DURA 1UTQA 3RXAA 4ABDA 1V2LT 1ABJH 3MOCA 2ODPA 4BTTB 4ZKNU 3DHKH 3P70B 1ARBA 2CHAB 3PM3A 2GZ7A 4CRBA 3VFEA 1IQEA 1XXFA 1IOEA 1GJ6A 3ZZAA 3M35A 2A2QH 1IQIA 3M3TA 3FANA 4JZDH 3HKJB 7LPRA 2QXGA 4BOHA 1QRXA 1SHYA 2ZO3H 3E0PB 2PKAB 3TK5A 1V2OT 2FESH 1SB1H 1GJ8B 2PV9B 2STBE 2EI8A 3NUMA 1LVOA 2RG3A 5EPYA 3FFGA 1SQAA 3KQBA 3VXEH 1FN6A 3PWCA 2BYAX 3MU1A 1KLTA 4FVBA 2A32A 3DFJA 5GIBA 1P2OA 3AAVA 1THPB 2ZI2H 1CT4E 1EPTB 9LPRA 5DK1A 1C2FA 1ELBA 4JZEH 5SGAE 1TE0A 1GI3A 3TK9A 1GHWH 1UCYE 2BY5X 4FXGH 3TVJB 1G9IE 5JDUB 1LPKB 3MU5A 5FCRA 5I25A 4X6MA 5FXLA 1QL7A 3S9CA 1O2VA 3K65B 3P8OA 1C4V2 1QB6A 4I32A 1QURH 3TGKE 4DOQA 2YNAA 1QJ1B 2JH0D 3SGAE 1DWCH 1FNIA 3MTYA 3TJNA 4U30A 3QWCH 2TIOA 2HLCA 3SU3A 2C4FH 3LGWA 2ZFRH 6LPRA 2DE8A 3SGQE 4WVPE 2ZFQH 1HV7A 3DA9B 3A80A 3M5NA 5F8ZA 1MQ5A 1ZSJA 1P04A 5H4IB 1LVBA 1O30A 1HRTH 1DSUA 4BAOB 3O8BA 1ZPZA 4YOJA 2D26C 2AIQA 2FOGA 4FUCA 2QY0B 4DT7B 2H1UA 3H5CB 5C20A 2BQWB 1HXFH 3T27A 1C5TA 3CS7A 2PKAA 1GL0E 5J4SA 1BHXF 4RN6A 2BD7A 3RXEA 1O2NA 3M7UA 5C1UA 1YC0A 1PPGE 2WV4A 3DFLA 3QDZB 4NG9H 1HAVB 3KF2A 2FYRA 1A0LA 1RIWB 1C2MA 2B5TB 3GOVB 1EPTA 4NIWA 3LONA 1ZRKA 4FUEA 2QV1A 6CHAB 1NRSH 1ARCA 1GGDB 3A8BA 5ABWA 1ETRH 9ESTA 1QHRB 1HBTH 1V2TT 2WINI 5DP5A 2W3IA 3RDZA 1EZQA 2W3KA 3U1JB 4UONA 2C8YB 3LOXA 2F83A 2JETB 2TGPZ 3QLPH 1CGJE 1GHZA 2VGCC 1SC8U 2WUBA 1ELTA 2VB0A 2Z9LA 1Z7KA 3S7KB 3HGPA 5FX6A 3SQHE 2CV3A 1AKSB 3SO3A 5AFYH 5JPMH 4BAMB 1LVMA 2ZCKP 3SV8A 2UUYA 2ZDMA 1HAZB 1Y5AT 3EE0B 1AQ7A 5F8XA 1TIOA 2FX4A 4DIIH 1GI8B 3RXLA 3SI4H 1Q31A 1TB6H 1EJAA 2J2UA 2XC0A 4XBBA 1KXDA 3MU0A 5AF9H 1MTWA 1ZGIA 1EZXC 5HM9A 2ZHEH 1F7ZA 3OY5U 3SU0A 3GCHC 4WXVA 1O34A 1RRKA 2HPQH 3Q3XA 4ABEA 1Z8IB 4NSYA 1V2KT 2FI5E 1C2LA 3MNSA 1SLUB 1GI6A 4KKDA 1MH0A 2P16A 2QF3A 1ZOMA 1QBOA 1G3DA 1HAYB 1OYTH 1AFQC 3A88A 4HZHA 4WF8A 1FPHH 4Y0YE 3P6ZB 1GJBB 2GT7A 1HDTH 3ZVBA 2WYGA 1SG8B 4TPYA 3MYWA 8GCHG 1UVUH 3TU7H 1NFUA 1BRBE 1O2UA 1TMBH 4YT7H 2WYJA 1AMHA 2OLGA 5EW1H 1BTPA 2Y82A 3PO1C 1DWEH 1S0RA 2H6MA 1S5SA 1DXPA 3RU4T 1W0YH 4WXIA 1MU8B 2ZU4A 3BTFE 1XUGA 1BMNH 1IQNA 2ZPRA 1O3JA 4OGYA 4SGAE 1OWDA 1V2QT 1F0SA 3UY9A 5FPYA 1Y8TA 1LPGB 1AUTC 3T2NA 3ZZ4A 1ZPBA 1WCZA 1BA8B 1KXAA 2ZU5A 1Y59T 5IDKA 1HJ9A 3I29A 1LCYA 1TBQH 3C27B 5CE1A 1S83A 1BMAA 2HGTH 2ZGXH 1TX8A 4IMQA 5EG4A 4XBCA 1WBGB 1O36A 3A7XA 5GJ4B 3VGCC 1C2GA 2WPIS 2Z6BD 2Z9IA 3KL6A 3MNXA 2ZP0H 2V6NA 8GCHF 1FI8A 3ODFA 1GBEA 3RXVA 2G5NA 3SU2A 3EYDA 3SW2B 4NZQA 4UFEH 1W2KH 1D6WA 1VR1H 3E91A 2ULLA 3RUOA 2Z7FE 2ZDAH 3U8RH 3G01A 1BQYA 3RMLH 1P2MA 3TH3H 4ABBA 5DPAA 5EXMA 2VIDA 1W7GH 2Y7XA 5DP3A 1S0QA 3BTGE 3M5OA 1DUAA 5CHAB 1WTHD 1IQFA 5F6MA 4IS5A 5A2MH 4DJZB 2WPHS 2HALA 4FUJA 1TLDA 5DGJA 1BRUP 1IQMA 5C5OA 3F9HA 3URDA 1GJCB 4X8SH 3VB5A 2OINA 1QBVH 3EAJA 3MH7A 1TPPA 1WV7H 1EZUC 1DANH 5JBBS 2BDHA 1ZTJA 1ZJKA 2VVCA 3RXUA 5A0BA 4GHQA 1T8OA 3ATIA 1RJXB 1DVAH 3QZRA 3RLWH 5HGGA 5E0HA 1P02A 3S7HB 4XDEA 2ZZUH 1OKXA 4K1TA 5TCAA 2R0LA 1MKWK 3ZYDA 4ABFA 1D3TB 1V2VT 3MWIU 2FWWA 4OS4A 4I8GA 4HGCA 3VEQB 2ZTYA 1SGYE 1PJPA 1L2EA 2BX3A 1W3CA 4AGKA 2AGGX 1WYKA 1OWJA 3ZZ6A 2CHAC 2THFB 2C90B 5EGMA 2CN0H 3BTWE 3AVZA 3GDUA 4A7IB 2NU1E 2BLQA 1NRNH 4FUHA 2VJ1A 2SGAA 4X2YA 1CGIE 1ELCA 2PUXB 2YNBA 1P3EA 1XX9A 2QA9E 1K1JA 3F9EA 4NA7A 1TWXB 5J4QA 1W8BH 4AFZA 4GCHG 5EW2H 2UWPA 1CHOG 4I7YH 1EX3A 1C5YB 1YPGH 5TCCA 5EOKA 1TBZH 1DWBH 2RA3A 5E8EH 1UO6A 1SPJA 1OWEA 4JK6A 4HFPB 2BXTH 1GJ4H 1AIXH 1LO6A 4B76A 2QXIA 4R8TB 3D49H 2ZFSA 3ZVGA 1TOMH 4K8BA 3QTVH 1CSOE 2G4TA 2P59A 4CRDA 4I33A 3O8DA 1A61H 1EP6A 4Y10E 1O2GH 4MNXA 1SLXB 4ABIA 2BDBA 4MQAA 2RDLA 2ESTE 1QL9A 4O3UA 5K0HA 3IWMA 1CE5A 1ELFA 3N7OA 2BD4A 2BY9X 1GI9B 1AI8H 3ATKA 1O2KA 3A8CA 1QNJA 1PPEE 1AE5A 4U2WA 1JRSA 4CR5A 4TWYA 1H1BA 4IN2A 4GCHF 3QTOH 1C2JA 1E35B 4B2AA 1UHBB 1CHOF 3RXOA 1C1WH 1GHAF 1GWAA 1UCYK 1NZQH 2VINA 2Z3CA 3GY5A 1EAIA 4CBOA 3GY8A 1FAKH 2A7JA 1GDNA 2O8MA 1O5AB 5A8YA 3L3TA 1ZRBA 1O5GH 1VITG 4MVNA 2ZQ2A 2GZ8A 1XUKA 1BTUA 1DSTA 3BEIB 3NCLA 3LGUA 1WTGH 2Q1JA 1C2DA 2B7DH 2ZKSA 1O3GA 5FCKA 5LGOA 3GY3A 1ETTH 1SGDE 2G52A 1HJAB 1P8VC 1RIWC 1EKBB 4J2YB 2XBWA 2R2WU 3UFAA 1V2RT 1O3CA 4AB9A 1UK3A 1DICA 1ZHRA 1O3FA 4D9QA 1MTSA 1GGDC 2FLRH 2BDIA 1O3AA 5PTPA 1N6XA 4B74A 1ZTKA 1T32A 4CHAB 4A5TS 2TGDA 2JETC 3SI3H 2OC1A 1GBBA 4MPVA 2TPIZ 3MNBA 3MMGA 3T5FH 1C5MD 3H7OA 1GHXH 2QC2A 1A1RA 1HCGA 4X1NU 1YPJH 1DE7H 4Y11E 4JYUH 1GI0A 4K2YA 1VITF 5JYIA 3TNTA 1JRTA 4YTAA 2O8WA 3NZIA 2Q6DA 2I6QA 1LHEH 1RXPA 1VZQH 1C5LH 1ZGVA 1N8OB 1O2PA 3E6PH 4F4OC 1UHBA 2IJOB 3S9AA 1YLDA
chains in the Genus database with same CATH superfamily
3E0NB 2Z9JA 1BMFD 2VWMA 1C9PA 1W11U 3AASA 1VGCB 1BRAA 1MKWH 4AFUA 3SNDA 1BBRK 1M9UA 1XVMA 1FY3A 3A87A 3OEHD 1YCPK 2ANMH 4I8HA 4YLUA 3UOUA 4WMEA 3SNAA 2Z9GA 4ISNA 5DJ7A 2AMPA 4UFDH 1NRRH 1OWKA 2GKVE 3KHVA 3RM0H 4BNRA 2SFAA 1NT1A 5DP4A 2GMTB 1TNJA 2TRMA 1A3EH 3KCGH 1WSSH 1KXBA 2WV9A 1O2ZA 1W0ZU 1BMMH 3FAOA 3RC6A 2WPMS 2V0BA 4KP0A 2R0KA 1FMGA 1GG6B 1PQ5A 1O3HA 2PUQH 4KELA 3TJUA 4RI0A 2ZHFH 3LU9B 4X2VA 3E8LA 2W6ID 2IPHA 1WAYB 2GVFA 4AGJA 1ZLRA 1P2JA 3QZQA 2P93A 4NFEA 5F53A 1CVWH 3TK6A 4X1RU 2UWLA 1FY8E 1RFNA 1E37B 1HJ8A 3SUFA 1EXFA 1MBQA 2A31A 2B0FA 2P3FH 3GDSA 4E7NA 3NWUA 1W0JD 1Z8JB 1GBTA 2WPJS 1KLJH 3B23B 1ZR0A 1CBWB 4J1YA 3TJOA 2P94A 4K60A 4DVAU 2BVXH 3RU4D 4ISHH 1L1NA 3K9XB 1P2QA 4GAWA 2FLBH 2ZU1A 1L0ZA 2XWBI 1DOJA 1O3BA 3URCA 3LGIA 1O2OA 2F4LA 3ZV8A 1GBIA 1T7CA 1LPZB 1T8MA 1BJUA 1QA0A 3A86A 3BTKE 4JYVH 2FXRA 2BD8A 1V2MT 3A83A 3KEEA 3DSGA 2VBCA 1G2MA 1A5IA 3RM2H 2VU8E 2ZECA 1EFRD 2OCVB 2ZGHA 2SGFE 1O2HA 4XE4A 3FVFB 3NRLA 2J34A 5DG6A 4F55A 2NWNA 1ACBE 3F2HA 3B8JA 1CT2E 1COWD 1TRNA 1YBWA 1XXDA 1UCYH 1FZZA 4MDSA 4SGBE 4ZXYH 2ZQ1A 6GCHG 3L6PA 2ZCLP 4BAQB 2G51A 1VCPA 1Z6JH 2WUCA 1DX5M 1NM6A 1QB9A 3M36A 3PV4A 1UTOA 1PPFE 4AB8A 1CA0B 4TSFD 2HLDD 3ZVFA 4F49A 1HAOH 4Y79A 2HPPH 4I31A 5FBEA 2QIQA 5CHAC 1IQGA 2SGPE 1YP9A 4CH8B 4DIHH 5HM2A 4NWKA 1DY8A 3FOAA 2Q6GA 1WUNH 1J14A 1KIGH 1EQ9A 4Y6DA 1XKBC 1K1NA 2FZZA 2XTTB 3H7TA 3MNCA 3V7TA 4Z6AH 4CRGA 1H8HD 5ETXA 1UK2A 3MHWU 1O5BB 2V3OH 4CRFA 3IG6B 3OAAD 1GDQA 1AVWA 2OXSA 3L33A 3SHAH 1LKBA 1QJ6B 1F5KU 4LZ1H 3RXRA 2VVVA 3SJ8A 1JBUH 5DP6A 3LPRA 1GBDA 1C4U2 1FQ3A 2FOAA 3ZZBA 4CH2B 3LGVA 1YPHC 1P12E 2F9PA 1ZSKA 2FS9A 4VGCB 2C93B 1LHDH 1IQHA 2G5VA 4OS7A 1HAPH 2FEQH 8ESTE 3ESTA 3LC5A 1SMFE 2NU3E 2R9PA 5DP7A 3RU4E 1C1SA 1C2EA 1J15A 2A5KA 3BTQE 4U32A 2XYAA 1E0FD 6GCHF 1W14U 1MKXK 1X7AC 3CP7A 2AGIX 1MQ6A 1P57B 2GT8A 1BHXB 1DWDH 4GUXA 3PRDA 2Y80A 2XRCA 1AWHB 4DCDA 2G00A 2VWOA 3N7EA 1ZHPA 1DT2A 2GV7A 2H9HA 3A85A 2OBOA 3TITA 3KQDA 1HB0B 4JYTA 4DG4A 2BZAA 2Y5HA 3JZ2B 1PYTC 2ZF0H 1PPCE 1C1OA 3TH4H 1AZ8A 1IAUA 5AVDA 2J9NA 2BLWA 2PHBA 1V6DA 1ELAA 3KQEA 5T1VA 2PSXA 1KTTB 2HOBA 4JZIA 1BMLA 3QN7A 1SQTA 1BBRH 3HPTB 2XC5A 1HXEH 5HXFA 1YCPH 5FX5A 4BTUB 2KM0A 1C1MA 1NO9H 1BTWA 3GDVA 1O2XA 2A7CA 1NTPA 4H6SB 2UUJB 1KXCA 5A8XA 1PQAA 2CK3D 4AG1A 2AERH 2A4GA 3VB4A 3SUEA 2R3YA 4K1SA 3F9GA 3MH6A 1XM1A 1G36A 2AMQA 3A8AA 3PMAB 2PGQB 3LC3A 2VH0A 2JIZD 3GYMA 4ZH8A 3R0FA 2SGEE 1GL1A 2GP9B 1AY6H 1V2NT 3BF6H 4MTBA 1TYNA 1OP2A 1TGCA 1YWUA 2FX6A 1AU8A 3IITA 3OX7U 1OX1A 2A2XH 3UREA 1DXWA 2H9EH 1K1MA 2EI6A 3BV9B 1MMJN 3K6ZA 2FOHA 1AE8H 4INLA 4FVDA 1KDQB 2YMSC 1TNKA 1L1GA 2PFEA 1G2LA 4B2CA 3UQVA 4Y8ZA 4IC6A 3CS0A 4I86A 3EQ0H 2OQ5A 1BTXA 3ZVCA 2W26A 1SGCA 2GDEH 2BY8X 3A7TA 4NA9H 1GBLA 2PP6A 2KCYA 2RDEA 1E38B 1OYQA 4ABHA 5A09A 1UK4A 2CGAA 3QK1A 1QCPA 1G32B 1YGCH 1ANDA 4ISLA 3PV5A 2XW9A 1F0UA 2ZDNA 4MG3A 4Q2KA 5E0JA 1O5FH 1FXYA 1SGFG 1WDIA 1MZAA 1XUFA 5T6GA 4BTIB 2WHXA 5GCHG 3M5LA 1K28D 4CRAA 2OC0A 1GBJA 3W94A 1DY9A 2CF9H 1GCTB 1O3EA 4OS5A 5JBAS 2R2MB 3ZZ8A 3UAIC 2HWLB 2FYQA 4RSPA 1K21H 5LH8A 1ZSLA 1O5DH 5LPEA 2QE7D 2EEKA 1Y3VA 3PLBA 2QYIA 2F91A 1BUIA 1YPHE 4FUBA 1P09A 1ELVA 1THRH 1O31A 2YMSD 4ABJA 1FPCH 1LQEA 1QFKH 3TJVA 2WSSD 2K0QA 1HJAC 2ZTXA 1H8IH 5JBCS 4THNH 1SBWA 1AD8H 1F5LA 1QZ8A 1NRQH 2J97A 1DFPA 3M37A 2ALPA 1GBKA 4MNYA 2NU4E 4AC9A 1C5UA 3K6YA 3LKWA 1ZMLA 3B9FH 1C5SA 1C5RA 1BCUH 2ZGCA 1P2NA 2ZEBA 1MAXA 1OP0A 2FOBA 4CHAC 3BTEE 4FUFA 1SI5H 1D4PB 3F9FA 4Q80A 1KDQA 1UTLM 1D3DB 2FO9A 2BQ7B 3U98H 1Z8GA 1QJ7B 3EA7A 2BY7X 1GHVH 2J94A 5BRRE 4BXWA 1SOZA 1H8DH 1HGTH 3P95A 1QL8A 3K2UA 1Y3WA 4CRCA 2A7HA 2J98B 1O5CB 5E2PA 4Z0KA 4ZKOU 5GCHF 1CA8B 1S84A 2W7UA 1QGFA 4UD9H 3LH3A 4X6OA 5TJXA 3RXIA 1C5PA 3M5MA 2ZHWH 2FOMB 1GMHG 1SL3A 4AOQA 1NU7B 1P05A 2ZHDA 1N8OC 2P8OC 4IN1A 4BAHB 2L74A 1BTHH 5BPEA 1A7SA 2Z9KA 1BRCE 3T62A 3KNXA 4TYDA 3I77A 3GY6A 3EGKH 2FMJA 1DDJA 2ZNKH 3GCTG 3KGPA 4WH6A 5CHBA 1BT7A 1SR5C 1VJAU 4A1VA 2BY6X 3FKSD 2J92A 1HUTH 4A1XA 1VGCC 4NIXA 4GVUA 4X1SU 3BSQA 3HKIB 1MKXH 1Z71A 3U69H 7KMEH 2BDCA 2GTBA 1DS2E 1W0KD 5GXPA 2ZGBH 1YYY1 1SSXA 1PPBH 3HGNA 1EUFA 5A0AE 1HAGE 3RXKA 3EA8A 1HNEE 3KQCA 3ATWA 3RLYH 4RKOB 1HAHH 3RXMA 2GDDA 2PW8H 4UE7H 2QCYA 3DUXH 4AX9H 1TMTH 2GMTC 2VGCB 5FHTA 3HK6B 1RD3B 3FZDA 4OM9A 4GPGA 2WPLS 3M3SA 2QAAA 2FODA 3SOSA 3LIWA 3GCNA 2J5UA 2BD2A 3P92A 1GG6C 3TGIE 3MI4A 1A4WH 1GPZA 4ZUHA 2BDAA 1GMHF 5B6OA 2PLXA 1BTYA 3V0XA 1E36B 2B8OH 3ZVDA 4DGJA 5DP8A 2ASUB 4E05H 4B73A 2IN2A 3GCTF 4H4FA 4ZXXH 3DD2H 1GHAG 2GV6A 3E16B 4MPUA 8KME2 2UWOA 2VIQA 2BHGA 2UUKB 1P06A 4ZAEA 3PB1E 2A1DB 4X8TH 2A4QA 3VPKA 1KY9A 2EQNA 2XNDD 2VVUA 3Q76A 3OYPA 1JWTA 2GCTB 1O2TA 1F0TA 2A5AA 2AFQB 2ZC9H 2GD4B 4Y7BA 2F3CE 3RXGA 1EPTC 1FY5A 1GVLA 2CJIA 1CBWC 2BOKA 1PPHE 2ZTZA 1TNGA 3SV7A 1K2I1 4HI3A 1TONA 4NWLA 1QQ4A 1ESTA 3RMMH 3V3MA 3U28C 1XUHA 3ZZ3A 1BZXE 1LTOA 1MZDA 2BD5A 1JIMA 2ZWLH 2JH6D 4A1TA 1YPLH 1EJMA 1JIRA 2Q6FA 1O3LA 3SJIA 1FIWA 3STJA 2WPKS 1SGFA 1IQKA 1ETSH 2Z3DA 3A82A 3LGTA 4NFFA 1NESE 2Y5FA 1P11E 3RXQA 1J17T 4O3TA 3A8DA 1IHSH 1TQ0B 4BANB 1UTMA 4LOYH 2ZHQH 2G55A 1EAWA 3BTHE 4YT6H 4ISOA 2BM2A 1D3QB 1Z8RA 2D8WA 2F9NA 1INCA 3PYHA 4Q7YA 4P02A 3M3VA 3CENA 1CA0C 5L30H 2PKSB 1EATA 3RC4A 2KZ4A 1H4WA 2WV5A 2TGAA 5C3NA 1N6YA 3UPEA 2BZ6H 5FL7D 1K9OE 4FUIA 1C2HA 1C4Y2 1GVKB 1C1RA 3TNSA 2ALVA 2H9TH 1L4DA 1AFEH 3SU1A 2ILNA 1GCDA 5DKMA 1C1VH 2M2AA 3LH1A 1OXGA 2KCOA 2O8UA 2FOCA 2AEIH 3RXDA 5T3HA 1BJVA 1VJ9U 1GJ5H 3PLKA 1Z1JA 3S9BA 2H2ZA 1NU9A 1O37A 2FI3E 3MFJA 1K1PA 1V3XA 2FOEA 4AN7A 1XKAC 6CHAC 1YPKH 4CR9A 1GBCA 1WXRA 5C2ZA 2BD3A 1GJ9B 2O9QA 1GI1A 3UNRA 1G37A 1DM4B 4VGCC 4ABAA 1KXEA 1MD8A 3DCLA 1AGJA 1ZPCA 1G3EA 2ZPSA 4MLFB 5EQQA 5T6FA 1O3OA 4X8VH 3U8OH 3FN8A 3RXFA 3UOPA 4A92A 3I78A 1GJDB 1TOCB 4DW2U 4X6NA 2BD9A 1TGBA 3MU8A 3RXJA 1TQ7B 4ZHMU 5C94A 3V12A 1GI7B 4UEHH 5C0TA 2A4OA 5E2OA 1VITH 2B9LA 1TMUH 1FIZA 1MU6B 2PSYA 3EA9A 2GCHG 1GJ7B 2O8TA 4FU9A 5EXLA 3SJOA 2SGDE 3RXTA 5G4BA 4B2BA 1WU1A 3MQKC 3A81A 2OTVA 1PQ8A 1QTFA 1O35A 3MU4A 4H42U 1FN8A 3PWBA 3ATLA 4DY7B 1UTJA 1O3MA 3VB7A 1H8ED 4X6PA 2F9UA 1T31A 3BN9A 3E90B 3RXHA 4YXWD 1ZTLA 3SV2H 4IBLH 3S69A 1E1RD 1SOTA 2FIRH 2PTNA 1O39A 2XBYA 3VG8A 1VKYA 3KYFA 4LK4A 4O9VA 5DO4H 4D9RA 1EZSC 3FP7E 1O3IA 1NC6A 2VIPA 2FOFA 1SGPE 1S82A 4F48B 1JMOH 3RP2A 3O8CA 3T25A 1B0EA 1HAXB 4X1QU 1MTNB 4E06H 1TBRH 3VB3A 3ENSB 3GY2A 4FU7A 3RXPA 5JB9S 1KMHB 1TGTA 1XUJA 2PR3A 5GPIB 1K22H 2QXJA 5DP9A 1C5VA 2GCHF 3DT0H 2WPDD 4CREA 1HIAA 4X1PU 2K1QA 1FAXA 1K1LA 3T28A 4IGDA 1W13U 1T8LA 5HYOA 1F5RA 1CT0E 3LJOA 5T6DA 2KCPA 3ZZDA 2BOHB 3RXBA 3SNBA 2OP9A 4TPIZ 1MTVA 4TY6A 2XXLA 4I8LA 3UNQA 2VNTA 4X2WA 1TNHA 2BLOA 1SGTA 4FUDA 3GISB 4RKJB 2ZPQA 1V2JT 5EODA 1KXFA 2CF8H 2VIWA 3UR9A 2QF4A 3MO3A 3ZZ7A 3S0NA 1QIXB 2OD3B 4OS2A 1UTPA 3P8FA 1ZZZA 3PLPA 1XUIA 4YM9A 1O33A 2A45B 1A46H 5ESBA 4NIVA 3A7VA 3DSOA 3ZIAD 2BB4A 1GCTC 2HRVA 2LPRA 4ZHAA 1TA2A 2ZFFH 2VWNA 1S6HA 4O97A 1Q3XA 3SU4A 1DLEA 1FLEE 1JOUB 3TGJE 5EU8A 3SNCA 1V2UT 1O0DH 3ODDA 2OQUA 3WWFA 1FX0B 1GBAA 3PTNA 2ZU2A 1TALA 1MABB 2RA0A 7ESTE 1E34B 2XCNA 4JZ1A 2H5CA 1GI5A 1C5OH 2VIOA 4ZKRU 2OK5A 4KGAA 4XFQA 2ZDKA 4ZHLU 3Q77A 3SQEE 3GYLB 3MO9A 1IHTH 3BEFB 4UDWH 1OOKB 1ANBA 4X0WU 3BG4B 2CXVA 1NROH 1F2SE 1MCVA 3GICB 3VXFH 1O2MA 3NXPA 4Y0ZE 4KTSA 2V3HH 3T26A 1AVGH 4Q7XA 3SZNA 3GCOA 1GBFA 1LHGH 3HK3B 3U1IB 1QB1A 1ID5H 3FP8E 3A7YA 1J9CH 2AH4X 1LVYA 1NFXA 3T29A 5HKKD 1B0FA 4XOJA 3A84A 3U9AH 3SNEA 2ANKH 3RMNH 4JCNA 3R3GB 3UUZA 1H9LB 5KEDA 1SGIB 4B6FA 1AVXA 1ELGA 5EPNA 4WMDA 2F9VA 2FPZA 1A5GH 4WY3A 1V2PT 1CHGA 1AHTH 1C5WB 1VCWA 2W7SA 5IYTA 1GMCG 5HMAA 3U8TH 2ZDLA 3QO6A 2ZFPH 1SGNE 2QGRA 1LHCH 1Z1IA 1C5QA 1YLCA 5EQRA 3PMHB 2TBSA 4NSVA 1Y5BT 1NS3A 4D7GA 5GDSH 2A4RA 2BXUH 1DPOA 1BIOA 2VIVA 4NIYA 3SBKA 3V13A 1TABE 1QRWA 1P10A 4PROA 1BBRE 3M7QA 7GCHG 1SGQE 2KCAA 1S81A 1YM0A 4MPWA 2EA3A 4LZ4B 2PWXA 1YCPM 1J16A 2FS8A 1QY6A 1VCQA 5L6NH 1OWHA 3AW1A 3BIVH 8LPRA 1O2SA 4CBNA 1DLKB 2SNVA 2QXHA 2OBQA 1QA7A 2GZ9A 1T8NA 4FU8A 2F43B 1GHBG 2BLVA 2NU2E 4ESTE 4I8KA 5C5NA 1HAIH 3LT3A 2ZFTA 3A7ZA 1HYLA 3LJJA 1CGHA 1GMCF 4QT8C 2KAIB 1AO5A 1AB9B 4NZLA 1TFXA 5KGOA 2YOLA 5FPTA 2AS9A 2GCTC 4Y7AA 1C2IA 1WOFA 1XMNB 2C8XB 4YESB 4Z1MD 1P03A 2FP7B 2C3SA 2FDAA 3EDXB 3SORA 2ZCHP 3BIUH 2P95A 2STAE 3M7TA 1TNIA 3NK8A 3E3TA 1TX7A 2EI7A 3LGYA 3TH2H 5C1YA 3UR6A 1OS8A 1G30B 2OUAA 1HAVA 1KLIH 2XWAA 4YZUA 2A5IA 3QGJA 1SFQB 1PYTD 1C1UH 7GCHF 1ZJDA 4RT0A 3STIA 2GGVB 2OC7A 5JB8S 2EY4C 2BQ6B 4ASHA 2Y5GA 1SQOA 1AUJA 2AYWA 1O2WA 1AN1E 1NN6A 2FM2A 4GLYA 1UVPA 1HPGA 2AHME 3A7WA 4FUGA 1NY22 3RC5A 2O8LA 1GBMA 1GHBF 2QN5T 5F03A 4XSKU 2SGQE 2TGTA 1JXPA 1O3NA 4WH8A 4YO9A 2FI4E 1YKTA 1L1JA 4AZ2B 3AW0A 1B5GH 4GSOA 1EJNA 2LNCA 1C1TA 3SJKA 1FDPA 1J8AA 1GDUA 1AKSA 1Y3UA 2P3UB 2PKSC 3HATH 4ZROA 2XOKD 1EOJA 1RTLA 1GBHA 1SFIA 1Z6EA 1O2IA 4K3JA 3P8NA 1TPOA 3F6UH 2XBXA 4O03A 1EAUA 2BTCE 1UVTH 5EQSA 5FAHA 4H6TA 4Y8YA 1NBMD 5CMXH 1W7XH 1LQDB 3PTBA 1A2CH 1UW7A 2BDGA 2HNTC 1EP5A 2HVXA 2ZIQH 2RFKC 1FY1A 3SUDA 2KAIA 1ZYOA 1THSH 3SU6A 1LMWB 1ZMNA 1K1IA 1P2KA 2ZDVH 1TX6A 1PQ7A 2Y7ZA 3EE7A 1C9TA 3Q3YA 1P9UA 2OC8A 3OTJE 3SV6A 1ELDE 3D65E 3F2FA 1O2LA 1MBMA 2ZG0H 1C1NA 1NRPH 1O2RA 5GWZA 1ZMJA 3ZZ9A 4BAKB 1OWIA 2BMGB 4UFGH 1FONA 1LKAA 1S85A 2XC4A 3C1KA 1A5HA 2F9BH 3MH5A 4K5ZA 1B7XB 3ZVEA 3TIUA 1ELEE 3D23A 4D76A 1QR3E 5C1XA 1Y5UT 5E0GA 3F68H 1OPHB 3LDXH 5EXNA 5FBIA 2AIPA 3QGNB 3TPIZ 4Q4LA 1YPEH 2HVYB 3UQOA 2Z3EA 4Y71A 4HTCH 2XBVA 1KTSB 2A0QB 4D7FA 3ZV9A 2PGBB 1RGQA 3ATMA 2BVSH 5AHGH 1O2QA 1K0HA 3F0PA 2ANWA 3QUMP 2R3UA 1EASA 1OSSA 4GHTA 4XBDA 4D8NA 1RTFB 3KN2A 1K1OA 3SHCH 1FJSA 1TA6A 1H9IE 3M61U 5LPRA 5C17A 1BB0B 2QF0A 2Z94A 2BX4A 3OFND 4OS1A 3SGBE 1Y3XA 4INHA 3Q00A 3P17H 4ABGA 4AORA 1N1LA 1CU1A 1NBME 4M9FA 4A6LA 4AFQA 1RS0A 1TGNA 3RXCA 3SYJA 1MUEB 2J95A 2FTMA 1MTNC 4X2XA 1W10U 4AFSA 2BDYA 3ELAH 1Q2WA 1G3CA 1FUJA 3FP6E 2VWLA 4M7GA 2KR7A 1P3CA 1O38A 1TNLA 3ZZ5A 4IC5A 2CMYA 4AYVB 4FOUC 4R0IA 1ZHMA 3W95A 1C5NH 4K1EA 4U01A 3RMOH 1GMDG 4K69A 2XCFA 1W12U 1DITH 1FY4A 1ORFA 1UTNA 2ODYB 3O8RA 4ACBA 2XNIA 3BEUA 3SU5A 1C2KA 2AGEX 2JH5D 2SNWA 2M5TA 1AWFH 3GCHB 1WQVH 1ESAA 3Q3KA 3QX5H 1F0RA 1KYNA 1G3BA 2EC9H 2DUCA 5FPSA 5C67A 2PTCE 3D62A 2V7QD 1D3PB 2HNTE 5KECA 3VB6A 1Y3YA 1AFQB 2NU0E 3GY7A 3ZZCA 1UMAH 1UVSH 1EAXA 2J38A 1T4UH 3NKKA 2FTLE 2G8TA 1SGEE 2Y81A 3PROA 1GI2A 3WY8A 4YOIA 3JZ1B 1UJ1A 1WQSA 3W1EA 4TWWA 2G81E 3NPSA 1NPMA 1O3DA 3PO1B 1GJAB 5I46H 1IQLA 2H5DA 4I8JA 3AAUA 4ISIH 1TPAE 2AMDA 3OEED 1EOLA 5AFZH 1E1QD 2D2DA 3MO6A 1GMDF 3KQ5A 4MPXA 1LDTT 1P9SA 3UTUH 1P0SH 2C8WB 3BG4C 1O2YA 3N7DA 1D9IA 1U6QA 5F8TA 1O3KA 3UNSA 2HNTF 5ESTE 5A8ZA 3BTDE 2IOTA 4ZKSU 2ZGJA 2VH6A 1A0HB 3A89A 2J4IA 3H09A 5L2ZH 3KYGA 5L2YH 3FZZA 1BDAA 1SGRE 4INKA 1T4VH 1D6RA 1UVOA 2V3MA 1CQQA 2JJ2D 3OSYA 3F3BA 2JKHA 1ABIH 1P01A 2G4UA 2ANYA 4K8YA 1C1QA 1A0JA 3UWJH 3VGCB 3PV2A 3UWIA 3ITIA 1TAWA 4Y8XA 3FO8D 3ZVAA 1ANEA 3SJ9A 4XD7D 3RXSA 2V35A 4IMZA 1BITA 1GHYH 1O5EH 1GI4A 1H9HE 2F9OA 4LXBH 3TLOA 1V2ST 5K7RA 2ODQA 4KTUA 1IQJA 2Y6TA 2UUFB 4JMYA 3MH4A 1HIAB 1MD7A 3OU0A 1QBNA 4P00A 2I6SA 2ZU3A 4UFFH 4YOGA 4KTCA 3P8GA 6ESTA 3PMBB 1EB1H 1SVPA 1HLTH 5JBTA 5LPFA 1ESBA 1BOQA 1O2JA 4JK5A 4WJG2 1C1PA 3UIRA 4YLQH 1QQUA 1AZZA 2D1JA 1PFXC 4Y76A 2W5EA 2GX4A 5EIYA 1BTZA 2C8ZB 4MNVA 4AG2A 4IW4E 4X8UH 1YF4A 3F1SB 4ZMAH 5EJLA 1V2WT 4B75A 1TRMA 1EB2A 3SN8A 1P2IA 3GY4A 1TPSA 1SLWB 2ZA5A 1L4ZA 4Q7ZA 4B71A 1C5XB 3PMJA 1O32A 2P8OB 1SLVB 2GJGA 1MTUA 1SHHB 1YPMH 1QRZA 1FV9A 4TY7A 1RTKA 4E7RG 1DUEA 3E1XB 2P3TB 1TGSZ 1A3BH 3OY6U 1PPZA 1F92A 1TRYA 1C5ZB 3SUGA 3SV9A 4NGAH 2DE9A 4MNWA 4WWYA 1LHFH 1AB9C 4AYYB 1OP8A 1UTKA 1MCTA 1NFYA 2RCEA 1ANCA 4BXSA 3KIDU 1SKYE 1CO7E 2KX4A 4NA8A 1MAYA 1XVOA 5A0CA 1O3PB 1GVZA 3BTME 3ZYEA 4OGXA 2BVRH 4OS6A 1HFDA 4NCYA 2QF5A 1S6FA 1NFWA 3BG8A 4WMFA 4JZFH 1KSNA 3CNRA 3BTTE 4B1TA 4DURA 1UTQA 3RXAA 4ABDA 1V2LT 1ABJH 3MOCA 2ODPA 4BTTB 4ZKNU 3DHKH 3P70B 1ARBA 2CHAB 3PM3A 2GZ7A 4CRBA 3VFEA 1IQEA 1XXFA 1IOEA 1GJ6A 3ZZAA 3M35A 2A2QH 1IQIA 3M3TA 5EJZA 3FANA 4JZDH 3HKJB 7LPRA 2QXGA 4BOHA 1QRXA 1SHYA 2ZO3H 3E0PB 2PKAB 3TK5A 1V2OT 2FESH 1SB1H 1GJ8B 2PV9B 2STBE 2EI8A 3NUMA 1LVOA 2RG3A 5EPYA 3F2GA 3FFGA 1SQAA 3KQBA 1S6LA 3VXEH 1FN6A 3PWCA 2BYAX 3MU1A 1KLTA 4FVBA 2A32A 3DFJA 5GIBA 1P2OA 3AAVA 1THPB 2ZI2H 1CT4E 1EPTB 3N99A 5DK1A 1C2FA 1ELBA 4JZEH 5SGAE 1TE0A 1GI3A 3TK9A 1GHWH 1UCYE 2BY5X 4FXGH 3TVJB 1G9IE 5JDUB 1LPKB 3MU5A 2JJ1D 5FCRA 5I25A 9LPRA 4X6MA 5FXLA 1QL7A 3S9CA 1O2VA 3K65B 3P8OA 1C4V2 1QB6A 4I32A 1QURH 3TGKE 4DOQA 2YNAA 1QJ1B 2JH0D 3SGAE 1DWCH 1FNIA 3MTYA 3TJNA 4U30A 3QWCH 2TIOA 2HLCA 3SU3A 2C4FH 3LGWA 2ZFRH 6LPRA 2DE8A 3SGQE 4WVPE 2ZFQH 1HV7A 3DA9B 3A80A 3M5NA 5F8ZA 1MQ5A 1ZSJA 1P04A 5H4IB 3UB0A 1LVBA 1O30A 1HRTH 1DSUA 4BAOB 3O8BA 1ZPZA 4YOJA 2D26C 2AIQA 2FOGA 4FUCA 2QY0B 4DT7B 2H1UA 2LELA 3H5CB 5C20A 2BQWB 1HXFH 3T27A 5HIZA 1C5TA 3CS7A 2PKAA 1GL0E 5J4SA 1BHXF 4RN6A 2BD7A 3RXEA 1O2NA 3M7UA 5C1UA 1YC0A 1PPGE 2WV4A 3DFLA 3QDZB 4NG9H 1HAVB 3WWBA 3KF2A 2FYRA 1A0LA 1RIWB 1C2MA 2B5TB 3GOVB 1OHHD 1EPTA 4NIWA 3LONA 1ZRKA 4FUEA 2QV1A 6CHAB 1NRSH 1ARCA 1GGDB 1SQRA 3A8BA 5ABWA 1ETRH 9ESTA 1QHRB 1HBTH 1V2TT 2WINI 5DP5A 2K8IA 2W3IA 3RDZA 1EZQA 2W3KA 3U1JB 4UONA 2C8YB 3LOXA 2F83A 2JETB 2TGPZ 3QLPH 1CGJE 1GHZA 2VGCC 1SC8U 2WUBA 1ELTA 2VB0A 2Z9LA 1Z7KA 3S7KB 3HGPA 5FX6A 3SQHE 2CV3A 1AKSB 3SO3A 5AFYH 5JPMH 4BAMB 1LVMA 2ZCKP 3SV8A 2UUYA 2ZDMA 1HAZB 5EJ1A 1Y5AT 3EE0B 1AQ7A 5F8XA 1TIOA 2FX4A 4DIIH 1GI8B 3RXLA 3SI4H 1Q31A 1TB6H 1EJAA 2J2UA 2XC0A 4XBBA 1KXDA 3MU0A 5AF9H 1MTWA 5CDFE 1ZGIA 1EZXC 5HM9A 2ZHEH 1F7ZA 3OY5U 3F0OA 3SU0A 3GCHC 4WXVA 1O34A 1RRKA 2HPQH 3Q3XA 4ABEA 1Z8IB 4NSYA 1V2KT 2FI5E 1C2LA 3MNSA 1SLUB 4RT1A 1GI6A 4KKDA 4HG6A 1MH0A 2P16A 2QF3A 1ZOMA 1QBOA 2LP6A 1G3DA 1HAYB 1OYTH 1AFQC 3A88A 4HZHA 4WF8A 1FPHH 4Y0YE 3P6ZB 1GJBB 2GT7A 1HDTH 3ZVBA 2WYGA 1SG8B 4TPYA 3MYWA 8GCHG 1UVUH 3OTPA 1NFUA 3TU7H 1BRBE 1O2UA 1TMBH 4YT7H 2WYJA 1AMHA 2OLGA 5EW1H 1BTPA 2Y82A 3PO1C 1DWEH 1S0RA 2H6MA 1S5SA 1DXPA 3RU4T 4Q63A 1W0YH 4WXIA 1MU8B 2ZU4A 3BTFE 1XUGA 1BMNH 1IQNA 2ZPRA 1O3JA 4OGYA 4SGAE 1OWDA 1V2QT 1F0SA 3UY9A 5FPYA 1Y8TA 1LPGB 1AUTC 3T2NA 3ZZ4A 1ZPBA 1WCZA 1BA8B 1KXAA 2ZU5A 1Y59T 5IDKA 1HJ9A 3I29A 2KFWA 1LCYA 1TBQH 3C27B 5CE1A 1S83A 1BMAA 2HGTH 5B6LA 2ZGXH 1TX8A 4IMQA 5EG4A 4XBCA 1WBGB 1O36A 3A7XA 5GJ4B 3VGCC 1C2GA 2WPIS 2Z6BD 2Z9IA 3KL6A 3MNXA 2ZP0H 2V6NA 8GCHF 1FI8A 3ODFA 1GBEA 3RXVA 1YLNA 2G5NA 3SU2A 3EYDA 2IJD1 3SW2B 4NZQA 4UFEH 1W2KH 1D6WA 1VR1H 3E91A 2ULLA 4ZCNA 3RUOA 2Z7FE 3DSPA 2ZDAH 3U8RH 3G01A 1BQYA 3RMLH 1P2MA 3TH3H 4ABBA 5DPAA 5EXMA 2VIDA 1W7GH 2Y7XA 5DP3A 1S0QA 3BTGE 3M5OA 3OE7D 1DUAA 5CHAB 1WTHD 1IQFA 5F6MA 4IS5A 5A2MH 4DJZB 2WPHS 2HALA 4FUJA 1TLDA 4ASUD 5DGJA 1BRUP 1IQMA 5C5OA 3F9HA 3URDA 1GJCB 4X8SH 3VB5A 2OINA 1QBVH 3EAJA 1YY3A 3MH7A 1TPPA 5GNDA 1WV7H 1EZUC 1DANH 5JBBS 2BDHA 1ZTJA 1ZJKA 2VVCA 3RXUA 5A0BA 4GHQA 1T8OA 3ATIA 1RJXB 1DVAH 5HIYA 4TT3D 3QZRA 3RLWH 5HGGA 5E0HA 1P02A 3S7HB 4XDEA 2ZZUH 1OKXA 4K1TA 5TCAA 2R0LA 1MKWK 3ZYDA 4ABFA 1D3TB 1V2VT 3MWIU 2FWWA 4OS4A 4I8GA 4HGCA 3VEQB 2ZTYA 1SGYE 1PJPA 1L2EA 2BX3A 1W3CA 4AGKA 2AGGX 1WYKA 1OWJA 3ZZ6A 4B6EA 2CHAC 2THFB 2L6OA 5DN6D 2C90B 5EGMA 2CN0H 3BTWE 3AVZA 3GDUA 4A7IB 2NU1E 2BLQA 1NRNH 4FUHA 2VJ1A 2SGAA 4X2YA 1CGIE 1ELCA 2PUXB 2YNBA 1P3EA 1XX9A 2QA9E 1K1JA 3F9EA 4NA7A 1TWXB 5J4QA 1W8BH 4AFZA 4GCHG 5EW2H 3AK5A 2UWPA 1CHOG 4I7YH 1EX3A 1C5YB 1YPGH 5TCCA 2J98A 5EOKA 3GS9A 1TBZH 1DWBH 2RA3A 2W6JD 3WW7A 5E8EH 1UO6A 1SPJA 1OWEA 4JK6A 4HFPB 2BXTH 1GJ4H 1AIXH 1LO6A 4B76A 2QXIA 4R8TB 3D49H 2ZFSA 3ZVGA 1TOMH 4K8BA 3QTVH 1CSOE 2G4TA 2P59A 4CRDA 4I33A 3O8DA 1A61H 1EP6A 4Y10E 1O2GH 4MNXA 1SLXB 4ABIA 2BDBA 4MQAA 4XRNA 2RDLA 2ESTE 1QL9A 4O3UA 1E79D 2YMSB 5K0HA 3IWMA 1CE5A 1ELFA 3N7OA 2BD4A 2BY9X 1GI9B 1AI8H 3ATKA 1O2KA 3A8CA 1QNJA 1PPEE 1AE5A 4U2WA 1JRSA 4CR5A 4TWYA 1H1BA 4FETA 4IN2A 4GCHF 3QTOH 1C2JA 4DT4A 1E35B 4B2AA 1UHBB 1CHOF 2IPQX 3RXOA 1C1WH 1GHAF 1GWAA 1UCYK 1NZQH 2VINA 2Z3CA 5C0UA 3GY5A 1EAIA 4CBOA 3GY8A 1FAKH 2A7JA 1GDNA 2O8MA 1O5AB 5A8YA 3L3TA 1ZRBA 1O5GH 1VITG 4MVNA 2ZQ2A 2GZ8A 1XUKA 1BTUA 1DSTA 3SZEA 3BEIB 3NCLA 3LGUA 1WTGH 2Q1JA 5DSFA 1C2DA 2B7DH 2ZKSA 1O3GA 5FCKA 5LGOA 3GY3A 1ETTH 1SGDE 2G52A 1HJAB 1P8VC 1RIWC 1EKBB 4J2YB 2XBWA 2R2WU 3UFAA 1V2RT 1O3CA 4AB9A 1UK3A 1DICA 1ZHRA 1O3FA 4D9QA 1MTSA 1GGDC 2FLRH 2BDIA 1O3AA 5PTPA 1N6XA 4B74A 1ZTKA 1T32A 4CHAB 5IK2D 4A5TS 3PRBA 2TGDA 2JETC 3SI3H 2OC1A 1GBBA 4MPVA 2TPIZ 3MNBA 3MMGA 3T5FH 1C5MD 3H7OA 1GHXH 2QC2A 1A1RA 1HCGA 4X1NU 1YPJH 1DE7H 4Y11E 4JYUH 1GI0A 2JDID 1VITF 4K2YA 5JYIA 3TNTA 1JRTA 4YTAA 2O8WA 3NZIA 2Q6DA 2I6QA 1LHEH 1RXPA 2WZQA 1VZQH 1C5LH 1ZGVA 1N8OB 1O2PA 3E6PH 4F4OC 1UHBA 4ACAA 2IJOB 3S9AA 1YLDA
chains in the Genus database with same CATH topology
3E0NB 2Z9JA 2VWMA 1C9PA 1W11U 3AASA 1VGCB 1BRAA 1MKWH 4AFUA 3SNDA 1BBRK 1M9UA 1XVMA 1FY3A 3A87A 1YCPK 2ANMH 4I8HA 4YLUA 3UOUA 4WMEA 3SNAA 2Z9GA 4ISNA 5DJ7A 2AMPA 4UFDH 1NRRH 1OWKA 2GKVE 3KHVA 3RM0H 4BNRA 2SFAA 1NT1A 5DP4A 2GMTB 1TNJA 2TRMA 1A3EH 3KCGH 1WSSH 1KXBA 1O2ZA 1W0ZU 1BMMH 3FAOA 3RC6A 2WPMS 2V0BA 4KP0A 2R0KA 1FMGA 1GG6B 1PQ5A 1O3HA 2PUQH 4KELA 3TJUA 2ZHFH 3LU9B 4X2VA 3E8LA 2IPHA 1WAYB 2GVFA 4AGJA 1ZLRA 1P2JA 3QZQA 2P93A 4NFEA 1CVWH 3TK6A 4X1RU 2UWLA 1FY8E 1RFNA 1E37B 1HJ8A 3SUFA 1EXFA 1MBQA 2A31A 2B0FA 2P3FH 3GDSA 4E7NA 3NWUA 1Z8JB 1GBTA 2WPJS 1KLJH 3B23B 1ZR0A 1CBWB 4J1YA 3TJOA 2P94A 4K60A 4DVAU 2BVXH 3RU4D 4ISHH 1L1NA 3K9XB 1P2QA 4GAWA 2FLBH 2ZU1A 1L0ZA 2XWBI 1DOJA 1O3BA 3URCA 3LGIA 1O2OA 3ZV8A 1GBIA 1T7CA 1LPZB 1T8MA 1BJUA 1QA0A 3A86A 3BTKE 4JYVH 2FXRA 2BD8A 1V2MT 3A83A 3KEEA 1G2MA 1A5IA 3RM2H 2VU8E 2ZECA 2OCVB 2ZGHA 2SGFE 1O2HA 4XE4A 3FVFB 2J34A 5DG6A 2NWNA 1ACBE 3B8JA 1CT2E 1TRNA 1YBWA 1XXDA 1UCYH 1FZZA 4MDSA 4SGBE 4ZXYH 2ZQ1A 6GCHG 3L6PA 2ZCLP 4BAQB 2G51A 1VCPA 1Z6JH 2WUCA 1DX5M 1NM6A 1QB9A 3M36A 3PV4A 1UTOA 1PPFE 4AB8A 1CA0B 3ZVFA 4F49A 1HAOH 4Y79A 2HPPH 4I31A 5FBEA 2QIQA 5CHAC 1IQGA 2SGPE 1YP9A 4CH8B 4DIHH 5HM2A 4NWKA 1DY8A 2Q6GA 1WUNH 1J14A 1KIGH 1EQ9A 4Y6DA 1XKBC 1K1NA 2FZZA 2XTTB 3H7TA 3MNCA 3V7TA 4Z6AH 4CRGA 5ETXA 1UK2A 3MHWU 1O5BB 2V3OH 4CRFA 3IG6B 1GDQA 1AVWA 2OXSA 3L33A 3SHAH 1LKBA 1QJ6B 1F5KU 4LZ1H 3RXRA 2VVVA 3SJ8A 1JBUH 5DP6A 3LPRA 1GBDA 1C4U2 1FQ3A 2FOAA 3ZZBA 4CH2B 3LGVA 1YPHC 1P12E 2F9PA 1ZSKA 2FS9A 4VGCB 2C93B 1LHDH 1IQHA 2G5VA 4OS7A 1HAPH 2FEQH 8ESTE 3ESTA 3LC5A 1SMFE 2NU3E 2R9PA 5DP7A 3RU4E 1C1SA 1C2EA 1J15A 2A5KA 3BTQE 4U32A 2XYAA 1E0FD 6GCHF 1W14U 1MKXK 1X7AC 3CP7A 2AGIX 1MQ6A 1P57B 2GT8A 1BHXB 1DWDH 4GUXA 2Y80A 2XRCA 1AWHB 4DCDA 2G00A 2VWOA 1ZHPA 1DT2A 2GV7A 2H9HA 3A85A 2OBOA 3TITA 3KQDA 1HB0B 4JYTA 4DG4A 2BZAA 2Y5HA 3JZ2B 1PYTC 2ZF0H 1PPCE 1C1OA 3TH4H 1AZ8A 1IAUA 5AVDA 2J9NA 2BLWA 2PHBA 1V6DA 1ELAA 3KQEA 2PSXA 1KTTB 2HOBA 4JZIA 1BMLA 3QN7A 1SQTA 1BBRH 3HPTB 2XC5A 1HXEH 5HXFA 1YCPH 5FX5A 4BTUB 1C1MA 1NO9H 1BTWA 3GDVA 1O2XA 2A7CA 1NTPA 4H6SB 2UUJB 1KXCA 5A8XA 1PQAA 4AG1A 2AERH 2A4GA 3VB4A 3SUEA 2R3YA 4K1SA 3F9GA 3MH6A 1XM1A 1G36A 2AMQA 3A8AA 3PMAB 2PGQB 3LC3A 2VH0A 3GYMA 4ZH8A 3R0FA 2SGEE 1GL1A 2GP9B 1AY6H 1V2NT 3BF6H 4MTBA 1TYNA 1OP2A 1TGCA 2FX6A 3IITA 1AU8A 3OX7U 1OX1A 2A2XH 3UREA 1DXWA 2H9EH 1K1MA 2EI6A 3BV9B 1MMJN 3K6ZA 2FOHA 1AE8H 4INLA 4FVDA 1KDQB 1TNKA 1L1GA 2PFEA 1G2LA 4B2CA 3UQVA 4Y8ZA 4IC6A 3CS0A 3EQ0H 2OQ5A 1BTXA 3ZVCA 2W26A 1SGCA 2GDEH 2BY8X 3A7TA 4NA9H 1GBLA 1E38B 1OYQA 4ABHA 5A09A 1UK4A 2CGAA 3QK1A 1QCPA 1G32B 1YGCH 1ANDA 4ISLA 2XW9A 1F0UA 2ZDNA 4MG3A 4Q2KA 5E0JA 1O5FH 1FXYA 1SGFG 1MZAA 1XUFA 5T6GA 4BTIB 5GCHG 3M5LA 1K28D 4CRAA 2OC0A 1GBJA 3W94A 1DY9A 2CF9H 1GCTB 1O3EA 4OS5A 5JBAS 2R2MB 3ZZ8A 2HWLB 2FYQA 4RSPA 1K21H 5LH8A 1ZSLA 1O5DH 5LPEA 2EEKA 1Y3VA 3PLBA 2QYIA 2F91A 1BUIA 1YPHE 4FUBA 1P09A 1ELVA 1THRH 1O31A 4ABJA 1FPCH 1LQEA 1QFKH 3TJVA 1HJAC 2ZTXA 1H8IH 5JBCS 4THNH 1SBWA 1AD8H 1F5LA 1NRQH 3M37A 1DFPA 2ALPA 1GBKA 4MNYA 2NU4E 1C5UA 3K6YA 3LKWA 1ZMLA 3B9FH 1C5SA 1C5RA 1BCUH 2ZGCA 1P2NA 2ZEBA 1MAXA 1OP0A 2FOBA 4CHAC 3BTEE 4FUFA 1SI5H 1D4PB 3F9FA 4Q80A 1KDQA 1UTLM 1D3DB 2FO9A 2BQ7B 3U98H 1Z8GA 1QJ7B 3EA7A 2BY7X 1GHVH 2J94A 5BRRE 4BXWA 1SOZA 1H8DH 1HGTH 3P95A 1QL8A 3K2UA 1Y3WA 4CRCA 2A7HA 1O5CB 5E2PA 4Z0KA 4ZKOU 5GCHF 1CA8B 1S84A 2W7UA 1QGFA 4UD9H 3LH3A 4X6OA 5TJXA 3RXIA 1C5PA 3M5MA 2ZHWH 2FOMB 1GMHG 1SL3A 4AOQA 1NU7B 1P05A 2ZHDA 1N8OC 2P8OC 4IN1A 4BAHB 1BTHH 5BPEA 1A7SA 2Z9KA 1BRCE 3T62A 3KNXA 4TYDA 3I77A 3GY6A 3EGKH 2FMJA 1DDJA 2ZNKH 3GCTG 3KGPA 4WH6A 1BT7A 1SR5C 1VJAU 4A1VA 2BY6X 1HUTH 2J92A 4A1XA 1VGCC 4NIXA 4GVUA 4X1SU 3BSQA 3HKIB 1MKXH 1Z71A 3U69H 7KMEH 2BDCA 2GTBA 1DS2E 5GXPA 2ZGBH 1YYY1 1SSXA 1PPBH 3HGNA 1EUFA 5A0AE 1HAGE 3RXKA 3EA8A 1HNEE 3KQCA 3ATWA 3RLYH 4RKOB 1HAHH 3RXMA 2GDDA 2PW8H 4UE7H 2QCYA 3DUXH 4AX9H 1TMTH 2GMTC 2VGCB 5FHTA 3HK6B 1RD3B 3FZDA 4GPGA 2WPLS 3M3SA 2QAAA 2FODA 3SOSA 3LIWA 3GCNA 2BD2A 3P92A 1GG6C 3TGIE 3MI4A 1A4WH 1GPZA 4ZUHA 2BDAA 1GMHF 5B6OA 2PLXA 1BTYA 3V0XA 1E36B 2B8OH 3ZVDA 4DGJA 5DP8A 2ASUB 4E05H 4B73A 2IN2A 3GCTF 4H4FA 4ZXXH 3DD2H 1GHAG 2GV6A 3E16B 4MPUA 8KME2 2UWOA 2VIQA 2BHGA 2UUKB 1P06A 4ZAEA 3PB1E 2A1DB 4X8TH 2A4QA 3VPKA 1KY9A 2VVUA 3Q76A 3OYPA 1JWTA 2GCTB 1O2TA 1F0TA 2A5AA 2AFQB 2ZC9H 2GD4B 4Y7BA 2F3CE 3RXGA 1EPTC 1FY5A 1GVLA 2CJIA 1CBWC 2BOKA 1PPHE 2ZTZA 1TNGA 3SV7A 1K2I1 4HI3A 1TONA 4NWLA 1QQ4A 1ESTA 3RMMH 3V3MA 1XUHA 3ZZ3A 1BZXE 1LTOA 1MZDA 2BD5A 1JIMA 2ZWLH 2JH6D 4A1TA 1YPLH 1EJMA 1JIRA 2Q6FA 1O3LA 3SJIA 1FIWA 3STJA 2WPKS 1SGFA 1IQKA 1ETSH 2Z3DA 3A82A 3LGTA 4NFFA 1NESE 2Y5FA 1P11E 3RXQA 1J17T 4O3TA 3A8DA 1IHSH 1TQ0B 4BANB 1UTMA 4LOYH 2ZHQH 2G55A 1EAWA 3BTHE 4YT6H 4ISOA 2BM2A 1D3QB 1Z8RA 2D8WA 2F9NA 1INCA 3PYHA 4Q7YA 3M3VA 3CENA 1CA0C 5L30H 2PKSB 1EATA 3RC4A 1H4WA 2WV5A 2TGAA 5C3NA 1N6YA 3UPEA 2BZ6H 1K9OE 4FUIA 1C2HA 1C4Y2 1GVKB 1C1RA 3TNSA 2ALVA 2H9TH 1L4DA 1AFEH 3SU1A 2ILNA 1GCDA 5DKMA 1C1VH 3LH1A 1OXGA 2O8UA 2FOCA 2AEIH 3RXDA 5T3HA 1BJVA 1VJ9U 1GJ5H 3PLKA 1Z1JA 3S9BA 2H2ZA 1NU9A 1O37A 2FI3E 3MFJA 1K1PA 1V3XA 2FOEA 4AN7A 1XKAC 6CHAC 1YPKH 4CR9A 1GBCA 5C2ZA 2BD3A 1GJ9B 2O9QA 1GI1A 3UNRA 1G37A 1DM4B 4VGCC 4ABAA 1KXEA 1MD8A 1AGJA 1ZPCA 1G3EA 2ZPSA 4MLFB 5EQQA 5T6FA 1O3OA 4X8VH 3U8OH 3RXFA 3UOPA 4A92A 3I78A 1GJDB 1TOCB 4DW2U 4X6NA 2BD9A 1TGBA 3MU8A 3RXJA 1TQ7B 4ZHMU 3V12A 1GI7B 4UEHH 2A4OA 5E2OA 1VITH 2B9LA 1TMUH 1FIZA 1MU6B 2PSYA 3EA9A 2GCHG 1GJ7B 2O8TA 4FU9A 5EXLA 3SJOA 2SGDE 3RXTA 5G4BA 4B2BA 1WU1A 3A81A 2OTVA 1PQ8A 1QTFA 1O35A 3MU4A 4H42U 1FN8A 3PWBA 3ATLA 4DY7B 1UTJA 1O3MA 3VB7A 4X6PA 2F9UA 1T31A 3BN9A 3E90B 3RXHA 1ZTLA 3SV2H 4IBLH 3S69A 2PTNA 1SOTA 2FIRH 1O39A 2XBYA 4LK4A 4O9VA 5DO4H 4D9RA 1EZSC 3FP7E 1O3IA 1NC6A 2VIPA 2FOFA 1SGPE 1S82A 1JMOH 3RP2A 3O8CA 3T25A 1B0EA 1HAXB 4X1QU 1MTNB 4E06H 1TBRH 3VB3A 3ENSB 3GY2A 4FU7A 3RXPA 5JB9S 1TGTA 1XUJA 2PR3A 5GPIB 1K22H 2QXJA 5DP9A 1C5VA 2GCHF 3DT0H 4CREA 1HIAA 4X1PU 2K1QA 1FAXA 1K1LA 3T28A 4IGDA 1W13U 1T8LA 5HYOA 1F5RA 1CT0E 3LJOA 5T6DA 3ZZDA 2BOHB 3RXBA 3SNBA 2OP9A 4TPIZ 1MTVA 4TY6A 2XXLA 4I8LA 3UNQA 2VNTA 4X2WA 1TNHA 2BLOA 1SGTA 4FUDA 3GISB 4RKJB 2ZPQA 1V2JT 5EODA 1KXFA 2CF8H 2VIWA 3UR9A 3MO3A 3ZZ7A 3S0NA 1QIXB 2OD3B 4OS2A 1UTPA 3P8FA 1ZZZA 3PLPA 1XUIA 4YM9A 1O33A 2A45B 1A46H 5ESBA 4NIVA 3A7VA 2BB4A 1GCTC 2HRVA 2LPRA 4ZHAA 1TA2A 2ZFFH 2VWNA 1S6HA 4O97A 1Q3XA 3SU4A 1DLEA 1FLEE 1JOUB 3TGJE 5EU8A 3SNCA 1V2UT 1O0DH 3ODDA 2OQUA 1GBAA 3PTNA 2ZU2A 1TALA 2RA0A 7ESTE 1E34B 2XCNA 4JZ1A 2H5CA 1GI5A 1C5OH 2VIOA 4ZKRU 4KGAA 4XFQA 2ZDKA 4ZHLU 3Q77A 3SQEE 3GYLB 3MO9A 1IHTH 3BEFB 4UDWH 1OOKB 1ANBA 4X0WU 3BG4B 2CXVA 1NROH 1F2SE 1MCVA 3GICB 3VXFH 1O2MA 3NXPA 4Y0ZE 4KTSA 2V3HH 3T26A 1AVGH 4Q7XA 3SZNA 3GCOA 1GBFA 1LHGH 3HK3B 3U1IB 1QB1A 1ID5H 3FP8E 3A7YA 1J9CH 2AH4X 1LVYA 1NFXA 3T29A 1B0FA 4XOJA 3A84A 3U9AH 3SNEA 2ANKH 3RMNH 4JCNA 3R3GB 3UUZA 1H9LB 1SGIB 1AVXA 1ELGA 5EPNA 4WMDA 2F9VA 2FPZA 1A5GH 4WY3A 1V2PT 1CHGA 1AHTH 1C5WB 1VCWA 2W7SA 5IYTA 1GMCG 5HMAA 3U8TH 2ZDLA 3QO6A 2ZFPH 1SGNE 2QGRA 1LHCH 1Z1IA 1C5QA 1YLCA 5EQRA 3PMHB 2TBSA 4NSVA 1Y5BT 1NS3A 4D7GA 5GDSH 2A4RA 2BXUH 1DPOA 1BIOA 2VIVA 4NIYA 3SBKA 3V13A 1TABE 1QRWA 1P10A 4PROA 1BBRE 3M7QA 7GCHG 1SGQE 1S81A 1YM0A 4MPWA 2EA3A 4LZ4B 2PWXA 1YCPM 1J16A 2FS8A 1QY6A 1VCQA 5L6NH 1OWHA 3AW1A 3BIVH 8LPRA 1O2SA 4CBNA 1DLKB 2SNVA 2QXHA 2OBQA 1QA7A 2GZ9A 1T8NA 4FU8A 1GHBG 2BLVA 2NU2E 4ESTE 4I8KA 5C5NA 1HAIH 3LT3A 2ZFTA 3A7ZA 1HYLA 3LJJA 1CGHA 1GMCF 4QT8C 2KAIB 1AO5A 1AB9B 4NZLA 1TFXA 2YOLA 5FPTA 2AS9A 2GCTC 4Y7AA 1C2IA 1WOFA 1XMNB 2C8XB 4YESB 1P03A 2FP7B 2C3SA 2FDAA 3EDXB 3SORA 2ZCHP 3BIUH 2P95A 2STAE 3M7TA 1TNIA 3NK8A 3E3TA 1TX7A 2EI7A 3LGYA 3TH2H 5C1YA 3UR6A 1OS8A 1G30B 2OUAA 1HAVA 1KLIH 2XWAA 4YZUA 2A5IA 3QGJA 1SFQB 1PYTD 1C1UH 7GCHF 1ZJDA 3STIA 2GGVB 2OC7A 5JB8S 2BQ6B 4ASHA 2Y5GA 1SQOA 1AUJA 2AYWA 1O2WA