2H1UA

Porcine pancreatic elastase complexed with metpheleuglu at ph 5.0
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
240
structure length
240
Chain Sequence
b'VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MFLE
publication title Structural analyses on intermediates in serine protease catalysis.
pubmed doi rcsb
molecule tags Hydrolase
total genus 60
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2006-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2h1uA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2h1uA01
1AQ7A 1DX5M 1C4V2 1FZZA 1WCZA 3A7WA 2BDGA 2ZCKP 3RC6A 1HYLA 4O03A 1AKSB 2ZU5A 3UWIA 2C93B 1S84A 2HNTC 1DLEA 3MU1A 4IMZA 1EXFA 1V2LT 1W7GH 2AYWA 1BJUA 3M3SA 2ZU1A 1AB9C 1WQSA 3F9EA 2SGDE 1V2NT 2BLQA 2VWMA 3H5CB 1PQ8A 2Z6BD 2OBQA 5A09A 1FAKH 1DT2A 2A2XH 1IQKA 2Q6DA 3ZVDA 1GJ5H 3O8CA 1UJ1A 1N6XA 3RUOA 2DE8A 1Z8GA 3SUGA 7KMEH 1SFQB 3O8RA 3ZZDA 1OP2A 4FU7A 3MU4A 2WPLS 1Y59T 2ZPRA 4R0IA 4QT8C 3QDZB 1QY6A 2ZI2H 4RN6A 1CGHA 4IS5A 3SUDA 1K28D 1O5FH 5GDSH 2BQ6B 2GZ8A 2PGQB 1SL3A 2ZKSA 1EJMA 1SVPA 1F0RA 4VGCC 1HLTH 3TJNA 3GY5A 1BRCE 1AVXA 1PPZA 3F6UH 5L30H 3EGKH 2FEQH 1ABIH 1ELTA 3F1SB 3Q76A 1JXPA 3BTDE 1ESBA 3VB7A 3VXFH 1YLCA 1W14U 3A8AA 1QBVH 3ENSB 5DG6A 3PTBA 1Y3YA 1OX1A 4TWYA 1GGDC 1GHAG 1O5BB 2H5DA 1EZSC 1PYTC 2BZ6H 2GTBA 1CBWC 2O9QA 1GWAA 2Z3DA 3UUZA 2G52A 4ZMAH 1C9TA 5I46H 4DVAU 2A32A 2ZFTA 1O3HA 3MH5A 1P2OA 5TCCA 3SUEA 1FJSA 4IW4E 1G2LA 1PQ7A 4B2BA 6GCHG 1O32A 1GCTC 3SOSA 1VCPA 2TGTA 3TIUA 2FOFA 3BG8A 1THRH 1PPCE 1BT7A 3TJUA 2C90B 3SU2A 3Q3YA 2VWLA 3P6ZB 4X2WA 1DDJA 1TMUH 3QLPH 3MH6A 1D3QB 1IQHA 4Q2KA 4NA7A 1K1NA 1ZOMA 2ZFFH 2BD3A 3GY6A 4DT7B 1MZAA 1LVOA 3LKWA 2ZDVH 1V2MT 1CA0C 3TK6A 2D2DA 2BD7A 2SNWA 4BAKB 1GHZA 2WINI 1ETRH 3K6YA 4O9VA 4E7NA 3RXPA 5JBTA 3NKKA 4SGBE 3QO6A 3SV8A 3HPTB 1SGRE 3TPIZ 1UHBA 4OS4A 4DG4A 3HK6B 4X8TH 3M7QA 1LTOA 2XXLA 3BG4C 3URDA 1ACBE 4WVPE 3TJVA 3TH3H 1P9UA 2ZPSA 3EA8A 1AWFH 2DE9A 1O3JA 1TQ0B 1JWTA 3BTFE 3UTUH 2BVXH 4DW2U 3ZVFA 2TGAA 1UK2A 1UTLM 1HFDA 1QRXA 1O2YA 3SNEA 2CHAB 3E90B 3TK9A 1CHOF 2ZU3A 3Q00A 3S7KB 1D6WA 3ODFA 4Z0KA 3BTHE 2H1UA 1L1GA 2ZHFH 3UR6A 1Q2WA 3MU0A 2CF8H 1O3EA 5E2OA 1YP9A 1DY8A 1QNJA 4BAQB 4ZAEA 3SNBA 1KXAA 4THNH 4WXVA 3I29A 1QB1A 4Q7XA 1TX8A 2B8OH 2KAIA 1C1WH 1MZDA 4RKOB 1O3MA 3VB3A 3K9XB 1SGNE 3HK3B 2R3UA 2G5NA 5FBIA 1DM4B 3BTKE 2FX6A 1O2KA 1TGBA 3EYDA 1LKAA 1O5AB 2PV9B 6LPRA 1A3EH 1P2IA 4CR5A 3EQ0H 2XC0A 3PROA 4GHTA 1RRKA 4GSOA 2QAAA 2XBVA 1K1MA 2AIPA 1B5GH 2ILNA 3KNXA 1GI3A 2A1DB 1KTSB 4I8LA 4Y8YA 1OXGA 1FIWA 1ZSKA 3M5OA 5C5NA 2AEIH 8KME2 2PUQH 5DP8A 3TVJB 1UVUH 1THSH 1YYY1 2WPKS 1TA2A 3U1IB 4ASHA 1W0YH 3GY7A 2HLCA 2ZEBA 2O8MA 4ZUHA 4MNWA 4GAWA 2M5TA 3GCHC 1WQVH 3PO1B 1HDTH 2J95A 5EODA 4IN2A 5I25A 3KCGH 3SUFA 1H9IE 3S0NA 1TRYA 3P8OA 3SQEE 1ZPCA 1SC8U 6CHAC 1VGCC 5FBEA 1DXPA 1G3CA 1Z8IB 1SHYA 1GI8B 2WV4A 1O2TA 1NFUA 3N7OA 1EB2A 4KP0A 4AORA 2V3HH 3SGBE 3A7YA 2O8UA 2YNAA 1ANBA 4TYDA 3GY4A 1EUFA 4MG3A 2P93A 4KKDA 1EOLA 2QA9E 3SV2H 4MVNA 1O5CB 1GJ9B 1P0SH 2AGGX 1TRMA 2WYGA 1IHSH 1GCDA 3MMGA 3LGTA 3SU1A 1CA8B 5FXLA 1QIXB 3VB6A 2XCNA 5FCKA 1C1MA 1F2SE 4ISHH 3TNSA 2ODQA 3M36A 1GI2A 3A8CA 3LGYA 4LXBH 1BRUP 2HNTF 4K60A 1RJXB 1NU7B 1W7XH 1EPTA 1GHAF 5E2PA 2G4UA 4DIIH 4U01A 4LK4A 1A46H 7LPRA 4X6PA 2ZTZA 2PSXA 4D8NA 1AVWA 2GT7A 2G00A 5EG4A 1VCQA 3JZ1B 1K22H 1QQ4A 1DSTA 1UTPA 3RXAA 5H4IB 2GDDA 1VJ9U 3SU5A 4LZ4B 1K1IA 1TNHA 2P8OB 3BIUH 1UCYE 3Q3KA 5DP7A 1L0ZA 3IG6B 2JETB 1KLIH 2EI7A 6GCHF 1BMLA 1P12E 2QIQA 1GJ8B 4F49A 4X1SU 3SORA 4A5TS 1GBKA 1GI5A 4A1XA 1CGJE 1O3BA 2Z9LA 1ELGA 1YBWA 5A8YA 1O0DH 1SOTA 2AERH 4DCDA 1ZTLA 1YGCH 3SV7A 2PLXA 2ALPA 1IAUA 2OUAA 3F9GA 2EC9H 1YKTA 4K5ZA 2GMTC 3DUXH 1AWHB 2BXTH 2ZQ1A 1UCYH 2FOCA 1GBEA 5GWZA 4HZHA 4AG2A 2FWWA 4MPUA 2ASUB 3LDXH 3Q77A 1P2NA 3ZV8A 1D3PB 3SBKA 1GBHA 2VIPA 5DJ7A 2OTVA 1GBLA 4AGJA 1YPJH 3RMMH 3T27A 2PKSB 3NWUA 2HOBA 5ESTE 2WV5A 4XFQA 1HAYB 1UVPA 2NU0E 5FPTA 1C5MD 2STBE 3RXIA 2H9EH 2OINA 1K2I1 2FOHA 1AIXH 1UHBB 1C1PA 1EP6A 1GBFA 1T4VH 3SW2B 1S81A 5JBCS 3ZYEA 4TWWA 1AGJA 1GJ4H 2Z9GA 3KQDA 2Q1JA 1F5KU 1TA6A 4OS1A 1XUIA 1C5VA 2TGDA 2OD3B 1TNLA 2UUFB 1BQYA 1XUJA 1W8BH 1SFIA 1G9IE 4DOQA 4BAHB 1BTXA 3ZVGA 1PJPA 1KLJH 1RXPA 2D26C 1AD8H 2AMQA 3BV9B 4K1EA 1ESTA 1UTQA 2GT8A 2ZTYA 4MLFB 3SI4H 1C5OH 3P8GA 2KAIB 2B9LA 1ELDE 1TPOA 3F9HA 3OYPA 3BTME 1O2UA 2FMJA 2QXJA 1O2SA 3RXFA 4HGCA 1YPEH 2PTCE 4J1YA 3ZYDA 1KYNA 4OS6A 1SGQE 1HXEH 2ANKH 2BDHA 3T26A 1T7CA 4K69A 1GMCG 4BAMB 4BXWA 3GDVA 3QN7A 3SJIA 2VIWA 3UQOA 2AMPA 1A7SA 1GJAB 2AFQB 3U98H 1TGCA 3BTTE 3UWJH 2ZP0H 3B8JA 3NZIA 1TBRH 1WTHD 5CMXH 4GHQA 2PKAA 1ZSJA 3SZNA 3DFLA 1HAHH 4I8HA 2ODYB 1GBCA 2TIOA 2HPQH 3ITIA 3TGKE 4NIXA 3LH1A 4ZHMU 3RXEA 2Z9KA 6ESTA 4DJZB 5IYTA 1OS8A 1ZGIA 2ZHDA 2TGPZ 5TJXA 1V2TT 1YPKH 1MD7A 1DWEH 4CRDA 5IDKA 1UMAH 4CRFA 2BHGA 3F9FA 2ZCLP 1N8OB 1TE0A 1V3XA 1P05A 2QY0B 1HAPH 2VIVA 4NG9H 3M7TA 4Q7ZA 3FZZA 2A7JA 3C27B 1GBBA 2HVXA 3GISB 1XMNB 1C5YB 2VNTA 2Y80A 4Y8ZA 1LO6A 1C4Y2 2QF3A 3KQCA 3BIVH 1VZQH 2Z94A 1GJDB 1D3DB 1O33A 2F9PA 2P3FH 1O2MA 4GUXA 2V0BA 9ESTA 2VIDA 2R2MB 1B0EA 2Q6GA 2OC8A 3NK8A 3VGCB 2Y6TA 1GBDA 1MTVA 3E8LA 1CE5A 1EAIA 3LH3A 3A86A 3L6PA 2GKVE 3KF2A 2FIRH 1SGEE 4CH2B 1IQLA 3TLOA 3QZQA 7GCHG 4AGKA 3M5NA 2NU1E 4MTBA 1WBGB 1BTZA 1IQFA 1EPTB 1FY1A 4MNXA 4E05H 2BZAA 4AG1A 1QCPA 1QJ6B 4X0WU 1RIWB 4B75A 4JYUH 4NIVA 1O2JA 5EOKA 1FAXA 5DP9A 3DD2H 1SGIB 1A3BH 1C1OA 3M5MA 2ZWLH 1ZPZA 4NSYA 4UDWH 4FUCA 3RU4D 1LVBA 1T31A 1GPZA 1O39A 5EGMA 3RXTA 1AZ8A 1MMJN 1ZJKA 2AIQA 1FNIA 4BXSA 1TQ7B 1QJ7B 2STAE 1XKBC 1BMAA 1W3CA 4AYVB 1QFKH 1N1LA 4GPGA 4O3TA 4BNRA 5ABWA 3DT0H 2VB0A 1JRSA 2HWLB 2P95A 1SQAA 2HALA 2AH4X 3OSYA 5A2MH 3KEEA 3BTEE 1H8IH 4K1SA 4NFEA 4YLUA 2VWNA 1C1NA 1C5LH 4K3JA 3B23B 1O2ZA 4ZROA 4FVBA 2Y7ZA 1AFEH 2G5VA 2BY9X 1NC6A 2BTCE 4NSVA 4CBOA 4WXIA 1QRZA 1KXDA 1UK4A 1HGTH 3E91A 1XUHA 1NN6A 1GI7B 3S7HB 4YOIA 1GDUA 1V2JT 2J92A 1XX9A 1FY5A 3RXVA 1TB6H 4WWYA 1O34A 4B73A 4BAOB 2A7CA 1OWDA 1RTFB 3MNSA 2BMGB 3RMNH 1FN6A 5C5OA 4Y0YE 1GHWH 1Y3UA 4A1TA 5JYIA 1TGTA 3PLPA 3A7XA 1FXYA 5EXLA 4TY6A 3AAUA 2BM2A 1W2KH 4R8TB 1V2QT 1V2PT 1FPHH 1KSNA 4H6SB 1AB9B 4ABEA 2W7UA 2J4IA 2BD4A 1LDTT 2UWLA 3FP7E 1LMWB 2QGRA 4FUGA 1TLDA 3RXGA 1KXEA 3A7VA 1P06A 1EATA 5LPEA 4ZHLU 1HAOH 1HAVA 2FTLE 2ZF0H 1DWCH 2XTTB 3K65B 1O37A 2CN0H 3KIDU 3RMOH 1EAWA 1GMCF 1NTPA 5F6MA 2GX4A 2XWBI 4CRAA 3RMLH 4OS5A 3W95A 2GCTC 1PFXC 2CMYA 5JB9S 5HYOA 2P3TB 1NU9A 2HRVA 2ZU4A 1TNGA 1BRAA 5L2ZH 1Y3VA 3C1KA 3LGVA 2BDCA 3OTJE 1C5QA 2VH0A 3U9AH 4KELA 4OGXA 2BQWB 2ZHWH 5CHAB 4I33A 4Y7BA 1GVLA 2FYRA 5E0HA 5A0CA 1C5TA 1EX3A 1MH0A 5A8ZA 4CRBA 3TITA 2ZC9H 2PKAB 1UVOA 2FO9A 1OYQA 2R3YA 3IWMA 1A0LA 1ELEE 1GL1A 1HNEE 1NM6A 1O2RA 2NU4E 1Y3WA 1G30B 2XBXA 1TX7A 4MQAA 2TBSA 3BTWE 4X8VH 4AX9H 2J2UA 1E34B 5C1XA 1GDQA 1BDAA 2LPRA 5FX6A 4ABAA 2ZZUH 2H9TH 1TPAE 2CHAC 2F9UA 4ZKNU 4K8YA 2OQUA 3U69H 1WOFA 4DGJA 4B2AA 1AUTC 1CBWB 4ISOA 1QJ1B 1KXBA 2F9NA 1MQ6A 1K1JA 3RP2A 2JH0D 3FP6E 1BMNH 3A89A 3RXBA 3QWCH 1PQAA 2DUCA 1KTTB 1L4ZA 5T6GA 1LHEH 1S0RA 2BY7X 5T3HA 4I31A 4ABGA 7GCHF 4XSKU 2IPHA 5DO4H 1HXFH 8ESTE 5PTPA 3E0PB 1O35A 1O3NA 1UTKA 3A80A 5EW2H 1P3EA 1T8MA 1TIOA 2VU8E 1O2OA 2P59A 1C1QA 1C2FA 2SGPE 1ZYOA 2BY5X 2UUKB 1Y5AT 4TPYA 3M37A 4UFDH 2O8TA 5GCHF 1JMOH 4ZKSU 1GG6B 1ANEA 5GPIB 4YOGA 1DFPA 1B0FA 3SGAE 1S6HA 4I8KA 1V2UT 1HAIH 2HNTE 4E7RG 1A4WH 1MTSA 1JIMA 2GDEH 2A4OA 2P16A 1ZHPA 3BG4B 4NZQA 1ZTKA 1O2VA 4LOYH 2FODA 1BIOA 5F8TA 3MH7A 4AN7A 1W10U 1HAZB 2VIQA 4F4OC 3ATIA 1C2KA 1ANDA 3A7ZA 1W13U 2SGEE 1TAWA 2VVVA 1EZQA 3FFGA 2SGQE 1KY9A 2OQ5A 3UOPA 1AE8H 4YESB 4YZUA 1ZSLA 2W5EA 1C2JA 3GCNA 1JIRA 1BRBE 5GXPA 4SGAE 1SLVB 1P10A 4A7IB 1HJAC 1W0ZU 2ESTE 1O3PB 2ZPQA 5HM2A 2SNVA 1ELFA 1NRPH 1TMBH 3TU7H 2OBOA 1C1RA 1XVOA 2BD8A 1SGYE 4YLQH 5LPRA 1L4DA 2GGVB 5TCAA 3V7TA 3ZZ9A 2VVCA 1YM0A 2VWOA 3M35A 4JYVH 1P9SA 1C2DA 5K0HA 1RTKA 4Q7YA 3A7TA 1A0HB 3UOUA 5C3NA 1GI9B 3RXUA 3FZDA 1LCYA 1AFQC 1MKWH 2GZ7A 2BDBA 3PLKA 2ZHEH 3PTNA 4BOHA 4X1NU 1O2GH 1J15A 1FI8A 2ZO3H 4UFFH 3SU4A 4AB9A 5E0GA 1OOKB 2EEKA 1C5PA 4HFPB 2XBYA 1DOJA 1RTLA 1SHHB 1H8DH 1KIGH 4ABDA 5C2ZA 3LU9B 3HGNA 4D9RA 4ISLA 4AFZA 5DP4A 2P8OC 4HI3A 3A88A 4GCHG 4O3UA 3SHAH 1WUNH 1LVMA 1J8AA 5F8XA 8GCHG 4XOJA 2W3KA 3DA9B 1QTFA 4NCYA 2C8YB 3GCHB 1SB1H 3BEFB 2RDLA 1V2ST 3TK5A 2IOTA 3TNTA 1O3OA 2RA3A 4B71A 3SGQE 2A2QH 6CHAB 1CT2E 1VGCB 1Y5BT 1TOMH 2D1JA 1T8NA 1O2HA 3B9FH 1HAVB 5JB8S 3A87A 1AVGH 3RLYH 3JZ2B 5EQQA 1J16A 1PPGE 2BB4A 2BD5A 1P2JA 1P11E 3SJ9A 2HGTH 1C2LA 3L33A 4D7GA 3NXPA 1S6FA 2FI4E 1C5NH 1WSSH 3TH2H 1GBMA 3HKJB 1G2MA 1SQOA 1O3GA 2OXSA 3ZV9A 4YT7H 4JZEH 3LT3A 1XUGA 5EPNA 2ALVA 3UQVA 3RXKA 3BEUA 2QXGA 2BOKA 3GYMA 3GY8A 4BANB 2P94A 1P02A 1NZQH 3PB1E 1BB0B 5DP3A 4X6OA 2PKSC 2VINA 2QF0A 5DPAA 1OWKA 1DUEA 4Z6AH 5DKMA 1S83A 3E1XB 1EASA 2ZGXH 4MDSA 1Z8RA 1CT0E 1NS3A 1LKBA 1C1VH 1SR5C 5DGJA 1EZXC 1GHBG 1CVWH 2BDIA 2VGCC 3LGUA 1FLEE 5EQSA 3QZRA 2ZCHP 2Y81A 3LJOA 4FU8A 1TNJA 3A8DA 3ZZAA 1TX6A 1EAUA 1TFXA 2H6MA 1ZMLA 1BBRK 3BEIB 2O8WA 1MKWK 1K1LA 2BVRH 2ZDKA 2BY8X 2H9HA 2FESH 1IQMA 1UTNA 1SLXB 1Z1IA 1TNIA 3GY2A 5GIBA 2BYAX 4AOQA 1QA7A 1NROH 2XRCA 4X2YA 3H7TA 2BY6X 3MU5A 2AMDA 1O2XA 1OP0A 1O3FA 1DPOA 2QYIA 2WPMS 3MNXA 3PMHB 3RXMA 4ESTE 2FLBH 2ZFPH 2AS9A 3WY8A 3RXRA 5J4SA 9LPRA 2GVFA 1UO6A 4IN1A 2XCFA 1TGSZ 1A5HA 1UK3A 2GMTB 4OGYA 1GJBB 5C1UA 1ZRKA 2FXRA 4JZFH 1O2QA 2SGAA 5LH8A 2BDAA 1CQQA 1MD8A 1Z1JA 3PM3A 2FDAA 5FX5A 1D3TB 1QL9A 3MTYA 2BQ7B 1G32B 3UREA 4WJG2 1ZTJA 3G01A 3SU6A 4KGAA 1HAXB 1GJCB 5K7RA 1H1BA 3URCA 1Q31A 4ZXYH 1EKBB 1A2CH 2XWAA 1X7AC 1L1NA 2Q6FA 3SNCA 3STIA 4AYYB 3BF6H 1C2EA 1PPHE 4AZ2B 1YPLH 1XUFA 4A92A 1CGIE 3MNBA 3A84A 1GBAA 1N8OC 2PGBB 2CF9H 4JK5A 3VXEH 1BTUA 1KXCA 1MBQA 4ABBA 4Y76A 3LGWA 3D65E 3EA9A 2F3CE 4KTSA 3UFAA 1XXFA 3MNCA 1TBQH 2CGAA 1BJVA 1FDPA 1SLUB 1C2IA 2A45B 1GJ6A 1AUJA 3KHVA 3AVZA 2CV3A 1UTJA 2SFAA 1AI8H 1O3DA 1HUTH 1PPFE 2A4QA 4IGDA 1AY6H 2B5TB 2ZFQH 4CR9A 1J17T 1P3CA 4WF8A 5BPEA 2F91A 1W11U 4MNYA 1T32A 1SSXA 5ETXA 3RXHA 4YTAA 1IHTH 3K6ZA 4NA9H 1MTWA 2ZNKH 4CHAC 2FOMB 1YCPM 1QQUA 1S85A 3P95A 1FQ3A 3V0XA 1G37A 1Z6JH 2F83A 3QGJA 1GBJA 5EW1H 1DUAA 4GCHF 3TGIE 3UNQA 4IBLH 3AAVA 8GCHF 1T8LA 2CXVA 5AF9H 1RS0A 2ZDLA 3GCOA 3MO3A 1SGTA 4RSPA 1O3AA 3ZZ3A 2OLGA 3GY3A 2B7DH 1GI6A 2ZHQH 2C3SA 4Y7AA 3SN8A 4ISNA 3RXJA 5T6FA 1F0TA 1MTNB 4UE7H 3TGJE 1V2WT 1YCPK 1BTPA 1LPGB 5EXNA 3LC5A 1AN1E 4KTUA 1SLWB 3D23A 4Y10E 1BCUH 1E35B 5JPMH 1F92A 1IQIA 3ATKA 1MBMA 4X1RU 5LGOA 2FTMA 5C67A 2BX4A 1AO5A 5GCHG 2Y5GA 3E6PH 5C1YA 2J9NA 4D7FA 1F0SA 4U30A 3VEQB 1ID5H 3FAOA 1FPCH 1O3IA 3LC3A 3M61U 4GLYA 1C5UA 3EAJA 4X2XA 1C2MA 4INLA 1NPMA 4NZLA 3OU0A 1C5RA 1ZHMA 1ORFA 4B2CA 3RXDA 1LPKB 1Y8TA 1LHGH 1GHBF 1NESE 5EU8A 1HJ8A 3V3MA 1ZRBA 4I7YH 1GMHG 4WMFA 4U32A 4K2YA 5JBAS 3PYHA 2Y7XA 3D62A 1J9CH 1VJAU 1O2LA 3BTGE 1OYTH 4KTCA 1P2QA 3ODDA 4FUDA 3L3TA 1BMMH 3HGPA 4LZ1H 4A1VA 4FU9A 1AMHA 3F68H 3P92A 4YOJA 1NO9H 1Z71A 2BOHB 3K2UA 1V2VT 4B76A 3S9CA 1J14A 1CSOE 2J38A 3PMBB 2WYJA 1QRWA 1TALA 3S69A 2G81E 3P17H 1O36A 2SGFE 4NWLA 1C2GA 1OPHB 2XC4A 1GI1A 2NU2E 1XKAC 2ANMH 3NUMA 4WH8A 1GVKB 3R0FA 3MO9A 2NU3E 4X8SH 2EA3A 1ESAA 2C8WB 1LHCH 4NGAH 1EJAA 1DITH 5HGGA 1E0FD 1WV7H 2WUCA 4IC6A 4FUEA 1VR1H 4TY7A 1C5XB 1TPPA 5EPYA 1D6RA 1WTGH 3S9AA 3ZZ4A 3VB4A 1NFWA 1OKXA 2A5AA 2VJ1A 3GDUA 3LJJA 1EZUC 1MKXK 2FX4A 3A85A 5CHAC 3AW0A 2ULLA 1ZMNA 2XC5A 1W12U 1Y3XA 5AFZH 2G4TA 4ZH8A 5ESBA 5FAHA 3GCTG 5L6NH 1T4UH 2BDYA 4Y0ZE 1PYTD 3MYWA 1YF4A 4AB8A 5BRRE 3MWIU 2UWOA 2HPPH 1BHXF 1YPHC 1FUJA 3SNDA 5A8XA 1KLTA 1FY4A 4OS7A 3T5FH 3RLWH 3GYLB 1SGCA 1NFYA 1O31A 1OWHA 1JRTA 1AHTH 3HATH 3QGNB 1QBNA 4VGCB 3ZZ6A 8LPRA 3PWCA 3RXOA 3LOXA 3VB5A 1QGFA 1L2EA 3RC5A 1U6QA 2FZZA 4CBNA 1S82A 2XW9A 1TRNA 4WH6A 1AU8A 1SGFG 2R0KA 1D4PB 3RXQA 2F9VA 1DLKB 3KQEA 2IJOB 1C4U2 1V2RT 4FUFA 3D49H 1DICA 4X8UH 1GGDB 4PROA 4JZIA 5F03A 4Y11E 5EQRA 4JZ1A 3E0NB 1O38A 1EQ9A 1MU6B 1SGDE 4NA8A 3SI3H 1GMDG 2GCTB 2GV6A 4FVDA 3SU0A 4XE4A 4FUBA 4JYTA 3PMJA 2XYAA 2FPZA 2PWXA 1MAYA 5AHGH 5C20A 1H9HE 2WPIS 1O2NA 2FI3E 4MNVA 2TRMA 1GDNA 2I6SA 1GG6C 1GBTA 2VIOA 1FN8A 1NT1A 1NRNH 5FCRA 1O30A 4K1TA 2GZ9A 4XBBA 2P3UB 1THPB 1GCTB 5F8ZA 1GI0A 1N6YA 2FI5E 4ZXXH 3AW1A 5E8EH 4XBDA 1RGQA 2ZFRH 4NFFA 3FVFB 1A0JA 3AASA 4X1PU 3MU8A 1V6DA 2FLRH 4Y8XA 3RM0H 2FOGA 2Y5FA 4X6MA 2PHBA 5L2YH 4YT6H 4TPIZ 3BN9A 4INHA 4E06H 3Q3XA 5AVDA 2GV7A 3GDSA 1SPJA 4YM9A 3T62A 1Y5UT 2F9BH 1CU1A 1HAGE 5EXMA 1E37B 2A7HA 2BLWA 2FM2A 1CA0B 2QXHA 4NWKA 2EI6A 1VITG 5CE1A 2THFB 1FY3A 1F5RA 5HXFA 1ANCA 3ZZBA 1HPGA 3MI4A 3RU4E 1GI4A 3U8TH 4U2WA 2H5CA 1IQJA 4IMQA 1MCVA 1MU8B 3FP8E 4K8BA 3PO1C 1KDQA 1AE5A 1A5IA 1RFNA 2WPJS 2AGEX 3KQBA 1QURH 2O8LA 1K1OA 2ZECA 3W94A 1GMHF 1ZJDA 1T8OA 1BTHH 4B74A 1P2KA 2QN5T 1TMTH 4X2VA 2H2ZA 2JH6D 4ZKRU 3PLBA 1HIAA 5GJ4B 1LQEA 2BLVA 1YLDA 1BBRE 2Z9JA 1FY8E 3QTOH 3NCLA 2Z3CA 1YPMH 1GHVH 2OC0A 1EOJA 1ABJH 2W26A 4DURA 1YC0A 1ETSH 4A6LA 1CHGA 3LPRA 1DWDH 1G3BA 2GCHG 2F9OA 3UY9A 4XBCA 2ANWA 2FS8A 2VVUA 2Z3EA 2XBWA 1NY22 1INCA 1MCTA 5FPYA 3O8BA 4ABFA 2ZDMA 2Y5HA 2TPIZ 4BTUB 1PPEE 1DXWA 1JBUH 2QCYA 4CREA 5J4QA 1H9LB 3ATLA 1GBIA 1BBRH 4UFGH 5HM9A 4Y71A 4O97A 3OX7U 3STJA 2BD9A 3UIRA 4OS2A 1WU1A 5JDUB 3LONA 3LIWA 4JMYA 3UNRA 4BTIB 1HJ9A 2R2WU 4JCNA 4CH8B 4ABHA 2JKHA 3ELAH 4ZKOU 2NWNA 2FOAA 2R0LA 2JETC 2QC2A 1ZPBA 4WMEA 3VPKA 1QR3E 1BOQA 1PQ5A 1LVYA 1LQDB 1BTWA 1NRRH 3V13A 2G8TA 5FPSA 1C5WB 4ISIH 1YPHE 3QTVH 3NPSA 1DY9A 1HJAB 2IN2A 3GCTF 4GVUA 2YNBA 2PTNA 3CP7A 3QK1A 3ATWA 1HB0B 3VFEA 1LHFH 1IQGA 4IC5A 1HBTH 1L1JA 3ZVAA 1TOCB 4B1TA 4FUIA 1O5EH 1BA8B 3EA7A 1IOEA 2PW8H 4YO9A 3P8FA 3M3TA 1EP5A 4AFSA 1C1UH 1DWBH 2BLOA 3U8RH 1AFQB 2OC7A 2XNIA 1EJNA 2G51A 3PMAB 4ABIA 4ABJA 1IQEA 1G36A 2ZGJA 1UVTH 1EAXA 2WPHS 4Q80A 3RXSA 3MFJA 2BD2A 1AZZA 4AFUA 2V6NA 3SU3A 3A82A 1TABE 3DFJA 2FS9A 1MTUA 3SJKA 3CS0A 2EI8A 1XUKA 5HMAA 2CJIA 3BTQE 4MPXA 4DY7B 5B6OA 1NFXA 1WAYB 4FXGH 3QX5H 2A31A 4H42U 1O2WA 2W7SA 1VITH 2LNCA 3ZZ5A 1GJ7B 5LPFA 1H4WA 1TWXB 3DHKH 4UFEH 1A1RA 1AKSA 1GMDF 2FP7B 3A81A 2Z7FE 3I77A 3SQHE 2ZTXA 1E38B 1QBOA 1QB9A 2FYQA 3IITA 3KN2A 2ZFSA 1G3EA 3MO6A 1PPBH 4H6TA 1DSUA 3E16B 3GOVB 1UTMA 4I8GA 3SV9A 2ANYA 1ZLRA 3LGIA 5A0AE 2C8ZB 1E36B 2OCVB 4X1QU 2B0FA 4ZHAA 2V3OH 1O5GH 1QB6A 2G55A 2ZG0H 3ESTA 1ZGVA 1DS2E 1M9UA 3T2NA 3QUMP 5DP5A 1TGNA 2C4FH 1ELVA 1JOUB 1K1PA 3KL6A 3O8DA 2ZU2A 1S0QA 2FOBA 2D8WA 3EDXB 1ELCA 3U8OH 1XM1A 1BITA 3KGPA 4NIYA 3RU4T 4RKJB 1ARCA 1Z8JB 1G3DA 3UR9A 3RDZA 1O2PA 2OC1A 3ZVBA 5A0BA 1OWJA 2QV1A 1C2HA 1ARBA 1VITF 2J94A 1CO7E 1ZR0A 2ZGBH 3CENA 3M7UA 2VGCB 1QL8A 2PR3A 1P57B 5T6DA 2FOEA 2Z9IA 3M3VA 1SOZA 1SI5H 3CS7A 4D9QA 1BZXE 3ZVEA 1K9OE 4Y79A 1TBZH 1QA0A 1YCPH 4JZDH 1CT4E 3U1JB 2BVSH 1RD3B 2UUYA 1BHXB 2A4RA 3T25A 3MH4A 4MPWA 2ZIQH 1SMFE 2PFEA 1SGFA 2ZGCA 1KDQB 3GICB 1FMGA 3ZZCA 3RC4A 1HCGA 4CRCA 3E3TA 3A83A 4D76A 2GP9B 2A0QB 4UD9H 1GHYH 3UPEA 2RA0A 3FANA 1ELBA 3ATMA 3ZZ7A 3TJOA 3MOCA 1MQ5A 1F0UA 1C1SA 1QL7A 1TPSA 1DANH 2GCHF 1P03A 3SHCH 2UUJB 2ZA5A 1HIAB 1WYKA 1EB1H 4DIHH 1C1TA 2BXUH 4I8JA 4FUJA 1S5SA 1P2MA 3M5LA 1FIZA 2J34A 1K21H 1SQTA 1O2IA 5DP6A 1C9PA 2PUXB 3EE0B 3SJ8A 3RXCA 3T29A 3VGCC 1HV7A 1UCYK 1O5DH 1FONA 1LPZB 1TYNA 1NRSH 2VH6A 2OP9A 1ELAA 4FUHA 3SV6A 1P04A 1GL0E 2R9PA 1B7XB 5SGAE 3H7OA 1MTNC 3OY5U 4NIWA 4J2YB 1O3LA 2JH5D 1EPTC 2A5KA 3P70B 4I32A 3S9BA 4Y6DA 1RIWC 3RXLA 1QHRB 3ZZ8A 4WY3A 1OSSA 2PSYA 2C8XB 1DVAH 2ZQ2A 1C5SA 1BTYA 1YPGH 1ETTH 3PWBA 1GHXH 3R3GB 5DK1A 1NRQH 1TNKA 2ODPA 1P09A 2A4GA 1A5GH 2RG3A 4XDEA 1C5ZB 3HKIB 1ZZZA 2QXIA 2ZDAH 5FHTA 1VCWA 3V12A 2ZDNA 7ESTE 3P8NA 3RM2H 3SNAA 3SO3A 3SJOA 1OWIA 1BUIA 2A5IA 5E0JA 3OY6U 2BX3A 3T28A 1Z7KA 3TH4H 2WUBA 1MUEB 4WMDA 3UNSA 1ZHRA 1LHDH 1D9IA 1MKXH 4CHAB 4BTTB 2K1QA 1HRTH 3A8BA 3MHWU 1O3CA 1P01A 1A61H 1XVMA 4HTCH 2Y82A 1CHOG 1SGPE 2YOLA 4H4FA 4AFQA 4UONA 2W3IA 2RCEA 4UEHH 3I78A 1ZMJA 1DE7H 1F5LA 4MPVA 1IQNA 1SG8B 1OWEA 4JK6A 2V35A 4X6NA 2I6QA 1UTOA 1OP8A 1GVZA 2AGIX 1MAXA 1F7ZA 1P8VC 1UVSH 1Z6EA 2GD4B 1XXDA 5JBBS 5AFYH 1V2KT 1KXFA 4INKA 3ZVCA 5G4BA 4M7GA 1Q3XA 4CRGA 1SBWA 1FV9A 2UWPA 3PV4A 3BSQA 1V2OT 2ZGHA 1O3KA 1TONA
chains in the Genus database with same CATH superfamily
1AQ7A 1DX5M 1C4V2 1FZZA 1WCZA 3A7WA 2BDGA 2ZCKP 3RC6A 1HYLA 4O03A 1AKSB 2ZU5A 3UWIA 2C93B 1S84A 2HNTC 1DLEA 3MU1A 4IMZA 1EXFA 1V2LT 1W7GH 2AYWA 1BJUA 3M3SA 2ZU1A 1AB9C 1WQSA 2KCAA 3F9EA 2SGDE 1V2NT 2BLQA 2VWMA 3H5CB 1PQ8A 2Z6BD 2OBQA 5A09A 1FAKH 1DT2A 2A2XH 1IQKA 2Q6DA 3ZVDA 1GJ5H 3O8CA 1UJ1A 1N6XA 3RUOA 2DE8A 1Z8GA 3F2HA 3SUGA 1SFQB 7KMEH 3ZZDA 3O8RA 1OP2A 4FU7A 3MU4A 3WWFA 2WPLS 1Y59T 2ZPRA 4R0IA 4QT8C 3QDZB 1QY6A 2ZI2H 4RN6A 1CGHA 4IS5A 3SUDA 1K28D 1O5FH 5GDSH 2BQ6B 2GZ8A 2PGQB 3AK5A 1SL3A 2ZKSA 1EJMA 1SVPA 1F0RA 4VGCC 1HLTH 3TJNA 3GY5A 1BRCE 1AVXA 1PPZA 3F6UH 5L30H 3DSGA 3EGKH 2FEQH 1ABIH 1ELTA 3F1SB 1K0HA 3Q76A 1JXPA 3BTDE 1ESBA 3VB7A 3VXFH 1YLCA 1W14U 3A8AA 1QBVH 3ENSB 5DG6A 3PTBA 1Y3YA 1OX1A 4TWYA 1GGDC 1GHAG 1O5BB 2H5DA 1EZSC 1PYTC 2BZ6H 2GTBA 1CBWC 5DSFA 2O9QA 1GWAA 2Z3DA 3UUZA 2G52A 4ZMAH 1C9TA 5I46H 4DVAU 2A32A 2ZFTA 1O3HA 3MH5A 1P2OA 5TCCA 3SUEA 1FJSA 4IW4E 1G2LA 1PQ7A 4B2BA 6GCHG 1O32A 1GCTC 3SOSA 1VCPA 2TGTA 3TIUA 2FOFA 3BG8A 3FN8A 1THRH 1PPCE 1BT7A 3TJUA 2C90B 3SU2A 3Q3YA 2VWLA 3P6ZB 4X2WA 1DDJA 1TMUH 3QLPH 3MH6A 1D3QB 1IQHA 3PRDA 4Q2KA 4NA7A 1K1NA 1ZOMA 2ZFFH 2BD3A 3GY6A 4DT7B 4ACAA 1MZAA 1LVOA 3KQ5A 2ZDVH 3LKWA 4ZCNA 1V2MT 1CA0C 3TK6A 2D2DA 4P00A 2BD7A 2SNWA 4BAKB 1GHZA 2WINI 1ETRH 3K6YA 4O9VA 4E7NA 3F2FA 3RXPA 5JBTA 3NKKA 4SGBE 3QO6A 3SV8A 3HPTB 1SGRE 3TPIZ 1UHBA 1E79D 4OS4A 4DG4A 3HK6B 4X8TH 3M7QA 1LTOA 2XXLA 3BG4C 3URDA 1OHHD 1ACBE 4WVPE 3TJVA 3TH3H 1P9UA 2ZPSA 3EA8A 1AWFH 2DE9A 1O3JA 1TQ0B 1JWTA 3BTFE 3UTUH 2BVXH 4DW2U 3OTPA 3ZVFA 2TGAA 1UK2A 1UTLM 1HFDA 1QRXA 1O2YA 3SNEA 2CHAB 3E90B 3TK9A 1CHOF 2ZU3A 3Q00A 3S7KB 1D6WA 3ODFA 4Z0KA 3BTHE 2H1UA 3DSOA 1L1GA 2ZHFH 3UR6A 1Q2WA 3MU0A 2CF8H 1O3EA 5E2OA 1YP9A 5DN6D 1DY8A 1COWD 1QNJA 4BAQB 4ZAEA 3U28C 3SNBA 1KXAA 4THNH 4WXVA 3I29A 1QB1A 4Q7XA 1TX8A 2B8OH 2KAIA 1C1WH 1MZDA 4RKOB 1O3MA 3VB3A 3K9XB 1SGNE 3HK3B 3MQKC 2R3UA 1NBME 2G5NA 5FBIA 1DM4B 3DSPA 3BTKE 4Z1MD 2FX6A 1O2KA 1TGBA 3EYDA 1LKAA 1O5AB 2PV9B 6LPRA 1A3EH 1P2IA 4CR5A 2F43B 2XC0A 3EQ0H 3PROA 4GHTA 1RRKA 4GSOA 2QAAA 2XBVA 1K1MA 2AIPA 1B5GH 2ILNA 3KNXA 1GI3A 2A1DB 1KTSB 4I8LA 4Y8YA 1OXGA 1FIWA 1ZSKA 3M5OA 5C5NA 2AEIH 8KME2 2PUQH 5DP8A 3TVJB 1UVUH 1THSH 1YYY1 2WPKS 1TA2A 3U1IB 4ASHA 1W0YH 3GY7A 2HLCA 2ZEBA 2O8MA 4ZUHA 4MNWA 4GAWA 2M5TA 3GCHC 1WQVH 3PO1B 3UB0A 1HDTH 2J95A 5EODA 4IN2A 5I25A 1E1QD 3KCGH 3SUFA 1H9IE 3S0NA 1TRYA 3P8OA 3SQEE 1ZPCA 1SC8U 2AHME 6CHAC 1VGCC 5FBEA 1DXPA 1G3CA 1Z8IB 1SHYA 1GI8B 2WV4A 1O2TA 1NFUA 3N7OA 1UW7A 1EB2A 4KP0A 4AORA 2V3HH 3SGBE 3A7YA 2O8UA 2YNAA 1ANBA 4TYDA 3GY4A 2WPDD 1EUFA 4MG3A 2P93A 3FO8D 4KKDA 1EOLA 2QA9E 3SV2H 3KYFA 1O5CB 1GJ9B 1P0SH 4MVNA 2AGGX 1TRMA 3N99A 2WYGA 1IHSH 1GCDA 3MMGA 3LGTA 3SU1A 1CA8B 5FXLA 1QIXB 3VB6A 2XCNA 2JJ1D 5FCKA 1C1MA 1F2SE 4ISHH 3TNSA 2ODQA 3M36A 1GI2A 3A8CA 3LGYA 4LXBH 1BRUP 2HNTF 4K60A 1RJXB 1NU7B 1W7XH 1EPTA 1GHAF 2W6JD 5E2PA 2G4UA 4DIIH 4U01A 4LK4A 1A46H 7LPRA 4X6PA 2ZTZA 2PSXA 4D8NA 1AVWA 2GT7A 2G00A 5EG4A 1VCQA 3JZ1B 1K22H 1QQ4A 1DSTA 1UTPA 3RXAA 5H4IB 2GDDA 1VJ9U 3SU5A 4LZ4B 1K1IA 1TNHA 2P8OB 3BIUH 1UCYE 3Q3KA 5DP7A 1L0ZA 3IG6B 2JETB 1KLIH 3F2GA 2EI7A 6GCHF 1BMLA 1P12E 2QIQA 1GJ8B 4F49A 4X1SU 3SORA 4A5TS 1GBKA 1GI5A 4A1XA 1CGJE 1O3BA 2Z9LA 1ELGA 1YBWA 5A8YA 1O0DH 1SOTA 2AERH 4DCDA 1ZTLA 1YGCH 3SV7A 2PLXA 5HIZA 2ALPA 1IAUA 2OUAA 3F9GA 2EC9H 1YKTA 4K5ZA 2GMTC 3DUXH 1AWHB 2BXTH 2ZQ1A 1UCYH 2FOCA 1GBEA 5GWZA 4HZHA 4AG2A 2FWWA 4MPUA 2ASUB 3LDXH 3Q77A 1P2NA 3ZV8A 1D3PB 3SBKA 1GBHA 2VIPA 5DJ7A 2OTVA 1GBLA 4AGJA 1YPJH 3RMMH 3T27A 2PKSB 3NWUA 2HOBA 2KX4A 5ESTE 2WV5A 4XFQA 1HAYB 1UVPA 2NU0E 5FPTA 1C5MD 2STBE 3RXIA 2H9EH 2OINA 1K2I1 2FOHA 1AIXH 1UHBB 1C1PA 3SZEA 1EP6A 1GBFA 1T4VH 3SW2B 3H09A 1S81A 5JBCS 3PV5A 3ZYEA 4TWWA 1AGJA 1GJ4H 2Z9GA 3KQDA 2Q1JA 1F5KU 1TA6A 4OS1A 1XUIA 1C5VA 2TGDA 2OD3B 1TNLA 2UUFB 1BQYA 2V3MA 1XUJA 1W8BH 1SFIA 1G9IE 2W6ID 4DOQA 4BAHB 4I86A 1BTXA 3ZVGA 1PJPA 1KLJH 1RXPA 2D26C 1AD8H 2AMQA 3BV9B 4K1EA 1ESTA 5KEDA 1UTQA 2GT8A 2ZTYA 4MLFB 3SI4H 1C5OH 3P8GA 2KAIB 2B9LA 1ELDE 1TPOA 3F9HA 3OYPA 3BTME 1O2UA 2FMJA 2QXJA 1O2SA 3RXFA 4HGCA 1YPEH 2PTCE 4J1YA 3ZYDA 1KYNA 4OS6A 1SGQE 1HXEH 2ANKH 2BDHA 3T26A 1T7CA 1H8ED 4K69A 1GMCG 4BAMB 4BXWA 3GDVA 3QN7A 3SJIA 2VIWA 3UQOA 2AMPA 1A7SA 1GJAB 2AFQB 3U98H 3WW7A 1TGCA 3BTTE 3UWJH 2ZP0H 3B8JA 3NZIA 1TBRH 1WTHD 5CMXH 4GHQA 2PKAA 3WWBA 1ZSJA 2KR7A 3SZNA 3DFLA 4M9FA 1HAHH 4I8HA 2ODYB 1GBCA 2TIOA 2HPQH 3ITIA 3TGKE 4NIXA 3LH1A 4ZHMU 3RXEA 2Z9KA 6ESTA 4DJZB 5IYTA 1OS8A 1ZGIA 2ZHDA 2IJD1 2TGPZ 5TJXA 1V2TT 1YPKH 1MD7A 1DWEH 4CRDA 5IDKA 1UMAH 4CRFA 2BHGA 3F9FA 2ZCLP 1N8OB 1TE0A 1V3XA 1P05A 2QY0B 1HAPH 2VIVA 4NG9H 3M7TA 4Q7ZA 3FZZA 2A7JA 3C27B 1GBBA 2HVXA 3GISB 2QF4A 1XMNB 1C5YB 2VNTA 2Y80A 4Y8ZA 1LO6A 2OK5A 1C4Y2 2QF3A 3KQCA 3BIVH 1VZQH 2Z94A 1GJDB 1D3DB 1O33A 2F9PA 2P3FH 1O2MA 4GUXA 2V0BA 9ESTA 2VIDA 2R2MB 1B0EA 2Q6GA 2OC8A 3NK8A 5IK2D 3VGCB 2Y6TA 1GBDA 1MTVA 1S6LA 3E8LA 1CE5A 1EAIA 3LH3A 3A86A 2J5UA 3L6PA 2GKVE 3KF2A 2FIRH 1SGEE 4CH2B 2WHXA 1IQLA 3TLOA 3QZQA 7GCHG 4AGKA 3M5NA 2NU1E 4MTBA 1WBGB 1BTZA 4Q63A 1IQFA 1EPTB 1FY1A 4MNXA 4E05H 2BZAA 4AG1A 1QCPA 1QJ6B 4X0WU 1RIWB 4B75A 4JYUH 4NIVA 1O2JA 5EOKA 1FAXA 5DP9A 3DD2H 1SGIB 1A3BH 1C1OA 3M5MA 2ZWLH 1ZPZA 4NSYA 4UDWH 2L6OA 4FUCA 3RU4D 1LVBA 1T31A 1GPZA 1O39A 5C0UA 5EGMA 3RXTA 4TT3D 1AZ8A 1MMJN 1ZJKA 2AIQA 1FNIA 4BXSA 1TQ7B 5T1VA 1QJ7B 2STAE 1XKBC 1BMAA 1VKYA 1W3CA 4AYVB 1QFKH 1N1LA 4GPGA 4O3TA 4BNRA 5ABWA 3DT0H 2VB0A 1JRSA 2HWLB 2P95A 1SQAA 2HALA 2AH4X 3OSYA 5A2MH 3KEEA 3BTEE 1H8IH 4K1SA 4NFEA 4YLUA 2VWNA 1C1NA 1C5LH 4K3JA 3B23B 1O2ZA 4ZROA 4FVBA 2Y7ZA 1AFEH 3OEHD 2G5VA 2BY9X 1NC6A 2BTCE 4NSVA 4CBOA 4WXIA 1QRZA 1KXDA 1UK4A 1HGTH 3E91A 1XUHA 1NN6A 1GI7B 3S7HB 4YOIA 1GDUA 1V2JT 5EJZA 2J92A 1XX9A 1FY5A 3RXVA 1TB6H 4WWYA 1O34A 3F3BA 4B73A 4BAOB 2A7CA 1OWDA 1RTFB 3MNSA 2BMGB 2CK3D 3RMNH 1FN6A 5C5OA 3FOAA 4Y0YE 1GHWH 1Y3UA 4A1TA 5JYIA 1TGTA 3PLPA 2LP6A 2KFWA 3A7XA 1FXYA 5EXLA 4TY6A 3AAUA 2BM2A 1W2KH 4R8TB 1V2QT 1V2PT 1FPHH 1KSNA 4H6SB 1AB9B 4ABEA 2W7UA 2J4IA 2BD4A 1LDTT 2UWLA 3FP7E 1LMWB 2QGRA 4FUGA 3SYJA 1TLDA 3RXGA 1KXEA 2KCOA 3A7VA 1P06A 1EATA 5LPEA 4ZHLU 1HAOH 1HAVA 2FTLE 2ZF0H 1DWCH 2XTTB 3K65B 1O37A 2L74A 2CN0H 3KIDU 3RMOH 1EAWA 1GMCF 1NTPA 5F6MA 2GX4A 2XWBI 4CRAA 3RMLH 4OS5A 3W95A 2GCTC 1PFXC 2CMYA 5JB9S 2WV9A 5HYOA 2P3TB 1NU9A 2HRVA 2ZU4A 1TNGA 5KECA 5KGOA 1BRAA 5L2ZH 1Y3VA 1W0KD 3C1KA 3LGVA 2BDCA 3OTJE 1C5QA 2VH0A 3U9AH 4KELA 4OGXA 2BQWB 2ZHWH 5CHAB 4I33A 4Y7BA 1GVLA 2FYRA 5E0HA 5A0CA 1C5TA 1EX3A 1MH0A 5A8ZA 4CRBA 2JJ2D 3TITA 2ZC9H 2PKAB 1UVOA 2FO9A 1OYQA 2R3YA 3IWMA 1A0LA 1ELEE 1GL1A 1HNEE 1NM6A 1O2RA 2NU4E 1Y3WA 3CNRA 4F55A 1W0JD 1G30B 2XBXA 1TX7A 4MQAA 2TBSA 3BTWE 4X8VH 4AX9H 2J2UA 1E34B 5C1XA 1GDQA 1BDAA 2LPRA 3PRBA 5FX6A 4ABAA 2ZZUH 2H9TH 1TPAE 2CHAC 2F9UA 4ZKNU 4K8YA 2OQUA 3U69H 1WOFA 4DGJA 4B2AA 1AUTC 1CBWB 4ISOA 1QJ1B 1KXBA 2F9NA 1MQ6A 1K1JA 3RP2A 2JH0D 3FP6E 1BMNH 3A89A 3RXBA 3QWCH 1PQAA 3VG8A 2DUCA 1KTTB 1L4ZA 5T6GA 3DCLA 1LHEH 1S0RA 2BY7X 5T3HA 4I31A 4ABGA 7GCHF 1EFRD 4XSKU 2IPHA 5DO4H 1HXFH 8ESTE 5PTPA 3E0PB 1O35A 1O3NA 5C17A 1UTKA 3A80A 5EW2H 1P3EA 1T8MA 1TIOA 2VU8E 1O2OA 2P59A 1C1QA 1C2FA 2SGPE 1ZYOA 2BY5X 2UUKB 1Y5AT 4TPYA 3M37A 4UFDH 2O8TA 5GCHF 1JMOH 3PV2A 4ZKSU 1GG6B 1ANEA 5GPIB 4YOGA 1DFPA 1B0FA 3SGAE 1S6HA 4I8KA 2KZ4A 1V2UT 1HAIH 2HNTE 4E7RG 5FL7D 1A4WH 1MTSA 1JIMA 2GDEH 2A4OA 2P16A 1ZHPA 3BG4B 4NZQA 1ZTKA 1O2VA 4LOYH 2FODA 1BIOA 5F8TA 4RT0A 2EY4C 3MH7A 4AN7A 1W10U 1HAZB 2VIQA 4F4OC 3ATIA 1C2KA 1ANDA 3A7ZA 1W13U 2SGEE 1TAWA 2VVVA 1EZQA 3FFGA 2SGQE 1KY9A 2OQ5A 3UOPA 1AE8H 4YESB 4YZUA 1ZSLA 2W5EA 1C2JA 3GCNA 1JIRA 1BRBE 5GXPA 4SGAE 1SLVB 1P10A 4A7IB 1HJAC 1W0ZU 2ESTE 1O3PB 2ZPQA 5HM2A 2SNVA 1ELFA 1NRPH 1TMBH 3TU7H 2OBOA 1C1RA 1XVOA 2BD8A 1SGYE 4YLQH 5LPRA 1L4DA 2GGVB 5TCAA 3V7TA 3ZZ9A 2VVCA 3GS9A 1YM0A 2VWOA 3M35A 4XD7D 4JYVH 1P9SA 1C2DA 5K0HA 2XNDD 1RTKA 4Q7YA 3A7TA 1A0HB 3UOUA 5C3NA 1GI9B 3RXUA 3FZDA 1LCYA 1AFQC 1MKWH 2GZ7A 2BDBA 3PLKA 2ZHEH 3OE7D 3PTNA 4BOHA 4X1NU 1O2GH 1J15A 1FI8A 2ZO3H 4UFFH 3SU4A 4AB9A 5E0GA 1OOKB 2EEKA 1C5PA 4HFPB 2XBYA 1DOJA 1RTLA 1SHHB 1H8DH 1KIGH 4ABDA 4YXWD 3LU9B 5C2ZA 3HGNA 4D9RA 4ISLA 4AFZA 5DP4A 2P8OC 4HI3A 3A88A 4GCHG 4O3UA 3SHAH 1WUNH 1LVMA 1J8AA 5F8XA 4FOUC 8GCHG 4XOJA 2W3KA 3DA9B 1QTFA 4NCYA 2C8YB 3GCHB 1SB1H 3BEFB 2RDLA 1V2ST 3TK5A 2IOTA 3TNTA 1O3OA 2RA3A 4B71A 3SGQE 2A2QH 6CHAB 1CT2E 1VGCB 1Y5BT 1TOMH 2D1JA 1T8NA 1O2HA 3B9FH 1HAVB 5JB8S 3A87A 1AVGH 3RLYH 3JZ2B 5EQQA 1J16A 1PPGE 2BB4A 2BD5A 1P2JA 1P11E 3SJ9A 2HGTH 1C2LA 3L33A 4D7GA 3NXPA 1S6FA 2FI4E 1C5NH 1WSSH 3TH2H 1GBMA 3HKJB 1G2MA 1SQOA 1O3GA 2OXSA 3ZV9A 4YT7H 4JZEH 3LT3A 1XUGA 3EE7A 5EPNA 2ALVA 3UQVA 5HIYA 3RXKA 3BEUA 2QXGA 2BOKA 3GYMA 3GY8A 4BANB 2P94A 1P02A 1NZQH 3PB1E 2HLDD 1BB0B 5DP3A 4X6OA 2PKSC 2VINA 2QF0A 5DPAA 4B6FA 3N7EA 1OWKA 1DUEA 4Z6AH 5DKMA 1S83A 3E1XB 1EASA 2ZGXH 4MDSA 1Z8RA 1CT0E 1NS3A 1LKBA 1C1VH 1SR5C 5DGJA 4RI0A 1EZXC 1GHBG 1CVWH 2BDIA 2VGCC 3LGUA 1FLEE 5EQSA 3QZRA 2ZCHP 2Y81A 3LJOA 4FU8A 1TNJA 3A8DA 3ZZAA 1TX6A 1EAUA 1TFXA 2H6MA 1ZMLA 1BBRK 3BEIB 2O8WA 1MKWK 1K1LA 2BVRH 2ZDKA 2BY8X 2H9HA 2FESH 3N7DA 1IQMA 1UTNA 1SLXB 2HVYB 1Z1IA 1TNIA 3GY2A 5GIBA 2BYAX 4AOQA 1QA7A 1NROH 2XRCA 4X2YA 3H7TA 2BY6X 3MU5A 2AMDA 1O2XA 1OP0A 1O3FA 1DPOA 2QYIA 2WPMS 3MNXA 3PMHB 3RXMA 4ESTE 2FLBH 2ZFPH 2AS9A 3WY8A 3RXRA 5J4SA 9LPRA 2GVFA 1UO6A 1YLNA 4IN1A 2XCFA 1TGSZ 1A5HA 1UK3A 2GMTB 4OGYA 1GJBB 5C1UA 1ZRKA 2FXRA 4JZFH 1O2QA 2SGAA 5LH8A 2BDAA 1CQQA 1MD8A 1Z1JA 2YMSB 4DT4A 3PM3A 2FDAA 5FX5A 1D3TB 1QL9A 1FX0B 3MTYA 2BQ7B 1G32B 3UREA 4WJG2 1ZTJA 3G01A 3SU6A 5C94A 4KGAA 1HAXB 1GJCB 5K7RA 1H1BA 3URCA 1Q31A 4ZXYH 1EKBB 1A2CH 2XWAA 1X7AC 1L1NA 2Q6FA 2M2AA 3SNCA 3STIA 4AYYB 3BF6H 1C2EA 1PPHE 4AZ2B 1YPLH 1XUFA 2J98A 4A92A 3OFND 1CGIE 3MNBA 3A84A 1GBAA 1N8OC 2PGBB 2CF9H 4JK5A 3VXEH 1BTUA 1KXCA 1MBQA 4ABBA 4Y76A 4RT1A 3LGWA 3D65E 3EA9A 2F3CE 4KTSA 3OAAD 3UFAA 1XXFA 3MNCA 2QE7D 1TBQH 2CGAA 1BJVA 1FDPA 2F4LA 1SLUB 4OM9A 1C2IA 2A45B 1GJ6A 1AUJA 3KHVA 3AVZA 2CV3A 1UTJA 2SFAA 1AI8H 1O3DA 1HUTH 1PPFE 2A4QA 4IGDA 1AY6H 2B5TB 2ZFQH 4CR9A 1J17T 1P3CA 4WF8A 5BPEA 2F91A 1W11U 5B6LA 4MNYA 1T32A 2JIZD 1SSXA 5ETXA 3RXHA 4YTAA 1IHTH 3K6ZA 4NA9H 1MTWA 2ZNKH 4HG6A 4CHAC 2FOMB 1YCPM 1QQUA 1S85A 3P95A 1FQ3A 3V0XA 1G37A 1Z6JH 2F83A 3QGJA 1GBJA 5EW1H 1DUAA 4GCHF 3TGIE 3UNQA 4IBLH 3AAVA 1YWUA 1T8LA 8GCHF 2CXVA 5AF9H 1RS0A 2ZDLA 1WXRA 3GCOA 3MO3A 1SGTA 4RSPA 1O3AA 3W1EA 3ZZ3A 2OLGA 3GY3A 2B7DH 1GI6A 2ZHQH 2C3SA 4Y7AA 1H8HD 3SN8A 4Q4LA 4ISNA 3RXJA 5T6FA 1F0TA 1MTNB 4UE7H 3TGJE 1V2WT 1YCPK 1BTPA 1LPGB 5EXNA 3LC5A 1AN1E 2KCYA 5C0TA 4KTUA 1SLWB 3D23A 4Y10E 1BCUH 1E35B 5JPMH 1F92A 1IQIA 3ATKA 1MBMA 4X1RU 5LGOA 2FTMA 5C67A 2BX4A 1AO5A 5GCHG 2Y5GA 3E6PH 5C1YA 2J9NA 4D7FA 1F0SA 4U30A 3VEQB 1ID5H 3FAOA 1FPCH 1O3IA 3LC3A 3M61U 4GLYA 1C5UA 3EAJA 4X2XA 1C2MA 4INLA 1NPMA 4NZLA 3OU0A 1C5RA 1ZHMA 1ORFA 3ZIAD 4B2CA 3RXDA 1LPKB 1Y8TA 1LHGH 1GHBF 1NESE 5EU8A 1HJ8A 3V3MA 1ZRBA 4I7YH 1GMHG 4WMFA 4U32A 4K2YA 5JBAS 3PYHA 2Y7XA 3D62A 1J9CH 1VJAU 1O2LA 3BTGE 1OYTH 2KM0A 4KTCA 1P2QA 3ODDA 4FUDA 3L3TA 1BMMH 2QF5A 3HGPA 4LZ1H 4A1VA 4FU9A 2WZQA 1AMHA 3F68H 3P92A 4YOJA 1NO9H 1Z71A 2BOHB 3K2UA 1V2VT 4B76A 3S9CA 1J14A 1CSOE 2J38A 3PMBB 2WYJA 1QRWA 1TALA 3S69A 2G81E 3P17H 1O36A 2SGFE 4NWLA 1C2GA 1OPHB 2XC4A 1GI1A 1SQRA 2NU2E 1XKAC 2ANMH 3NUMA 4WH8A 1GVKB 3R0FA 3MO9A 2NU3E 4X8SH 3F0OA 2EA3A 1ESAA 2C8WB 1LHCH 4NGAH 1EJAA 1DITH 5HGGA 1E0FD 1WV7H 2WUCA 4IC6A 4FUEA 1VR1H 4TY7A 1C5XB 1TPPA 5EPYA 1D6RA 1WTGH 3S9AA 3ZZ4A 3VB4A 1NFWA 1OKXA 2A5AA 2VJ1A 3GDUA 3LJJA 1EZUC 1MKXK 2FX4A 3A85A 5CHAC 3AW0A 2ULLA 1ZMNA 2XC5A 1W12U 1Y3XA 5AFZH 2G4TA 4ZH8A 5ESBA 5FAHA 3GCTG 5L6NH 1T4UH 2BDYA 4Y0ZE 1PYTD 3MYWA 1YF4A 4AB8A 5BRRE 3MWIU 1MABB 1WDIA 2UWOA 2HPPH 1BHXF 1YPHC 1FUJA 3SNDA 5A8XA 1KLTA 1FY4A 4OS7A 3T5FH 3RLWH 3GYLB 1SGCA 2J98B 1BMFD 1NFYA 1O31A 1OWHA 1JRTA 1AHTH 3HATH 3QGNB 1QBNA 4VGCB 3ZZ6A 5EJ1A 8LPRA 3PWCA 3RXOA 3NRLA 3LOXA 3VB5A 1QGFA 1L2EA 3RC5A 1U6QA 2FZZA 4CBNA 1S82A 2XW9A 1TRNA 2VBCA 4WH6A 1AU8A 1SGFG 2R0KA 1D4PB 3RXQA 2F9VA 3UAIC 1DLKB 4FETA 3KQEA 2IJOB 1C4U2 1V2RT 4FUFA 3D49H 1DICA 4X8UH 1GGDB 4PROA 4JZIA 5F03A 4Y11E 5EQRA 4JZ1A 3E0NB 1O38A 1EQ9A 1MU6B 1SGDE 4NA8A 3SI3H 1GMDG 2GCTB 2GV6A 4FVDA 3SU0A 4XE4A 4FUBA 4JYTA 3PMJA 2XYAA 2FPZA 2PWXA 1MAYA 5AHGH 5C20A 1H9HE 2WPIS 1O2NA 2FI3E 4MNVA 2TRMA 1GDNA 2I6SA 1E1RD 1GG6C 1GBTA 2VIOA 1FN8A 1NT1A 1NRNH 5FCRA 1O30A 4K1TA 2GZ9A 4XBBA 2P3UB 1THPB 1GCTB 5F8ZA 1GI0A 1N6YA 2FI5E 4ZXXH 3AW1A 5E8EH 4XBDA 1RGQA 2ZFRH 4NFFA 3FVFB 1A0JA 3AASA 4X1PU 3MU8A 1V6DA 2FLRH 4Y8XA 3RM0H 2FOGA 2Y5FA 4X6MA 2PHBA 5L2YH 4YT6H 4TPIZ 3BN9A 4INHA 4E06H 3Q3XA 5AVDA 2GV7A 3GDSA 1SPJA 4YM9A 3T62A 1Y5UT 2F9BH 1CU1A 1HAGE 5EXMA 1E37B 2A7HA 2BLWA 2FM2A 1CA0B 2QXHA 4NWKA 2EI6A 1VITG 5CE1A 2THFB 1FY3A 1F5RA 5HXFA 1ANCA 3ZZBA 1HPGA 3MI4A 3RU4E 1GI4A 3U8TH 4U2WA 2H5CA 1IQJA 4IMQA 1MCVA 1MU8B 3FP8E 4K8BA 3PO1C 1KDQA 1AE5A 1A5IA 1RFNA 2WPJS 2AGEX 3KQBA 1QURH 2O8LA 1K1OA 2ZECA 3W94A 1GMHF 1ZJDA 1T8OA 1BTHH 2XOKD 4B74A 1P2KA 2QN5T 1TMTH 4X2VA 2H2ZA 2JH6D 4ZKRU 3PLBA 1HIAA 5GJ4B 1LQEA 2BLVA 1YLDA 1BBRE 2Z9JA 1FY8E 3QTOH 3NCLA 2Z3CA 1YPMH 1GHVH 2OC0A 1EOJA 1ABJH 2W26A 4DURA 1YC0A 1ETSH 4A6LA 1CHGA 3LPRA 1DWDH 1G3BA 2GCHG 2GJGA 2F9OA 3UY9A 4XBCA 2ANWA 2FS8A 2VVUA 2Z3EA 2XBWA 1NY22 1INCA 1MCTA 5FPYA 3O8BA 4ABFA 2ZDMA 2Y5HA 2TPIZ 4BTUB 1PPEE 1DXWA 1JBUH 2QCYA 4CREA 5J4QA 1H9LB 3ATLA 1GBIA 1BBRH 4UFGH 5HM9A 4Y71A 2LELA 4O97A 3OX7U 3STJA 2BD9A 3UIRA 4OS2A 1WU1A 5JDUB 3LONA 3LIWA 4JMYA 3UNRA 4BTIB 1HJ9A 2R2WU 4JCNA 4CH8B 4ABHA 2JKHA 3ELAH 4ZKOU 2NWNA 1YY3A 2FOAA 2R0LA 2JETC 2QC2A 1ZPBA 4WMEA 3VPKA 1QR3E 1BOQA 1PQ5A 1LVYA 2V7QD 1LQDB 1BTWA 1NRRH 3V13A 2G8TA 5FPSA 1C5WB 4ISIH 1YPHE 3QTVH 3NPSA 1DY9A 1HJAB 2IN2A 3GCTF 4GVUA 2J97A 2YNBA 2PTNA 3CP7A 2K0QA 3QK1A 3ATWA 1HB0B 3VFEA 1LHFH 1IQGA 4IC5A 1HBTH 1L1JA 3ZVAA 1TOCB 4B1TA 4FUIA 1O5EH 1BA8B 3EA7A 1IOEA 2PW8H 5CDFE 4YO9A 2EQNA 3P8FA 3M3TA 1KMHB 4TSFD 1EP5A 4AFSA 1C1UH 1DWBH 2BLOA 3U8RH 3KYGA 1AFQB 2OC7A 2XNIA 1EJNA 2G51A 3PMAB 4ABIA 4ABJA 1IQEA 1G36A 2ZGJA 1UVTH 1EAXA 2WPHS 4Q80A 3RXSA 3MFJA 2BD2A 1AZZA 4AFUA 2V6NA 3SU3A 4ACBA 1SKYE 3A82A 1TABE 3DFJA 2FS9A 1MTUA 3SJKA 3CS0A 2EI8A 1XUKA 5HMAA 2CJIA 3BTQE 5EJLA 4MPXA 4DY7B 5B6OA 1NFXA 1WAYB 4FXGH 3QX5H 2A31A 4H42U 1O2WA 2W7SA 1VITH 2LNCA 3ZZ5A 1GJ7B 5LPFA 1H4WA 1TWXB 3DHKH 4UFEH 1A1RA 1AKSA 1GMDF 2FP7B 2YMSD 3A81A 2Z7FE 3I77A 3SQHE 2ZTXA 1E38B 1QBOA 1QB9A 2FYQA 3IITA 3KN2A 2ZFSA 1G3EA 3MO6A 1PPBH 4H6TA 1DSUA 3E16B 3GOVB 1UTMA 4I8GA 4B6EA 3SV9A 2ANYA 1ZLRA 3LGIA 5A0AE 2C8ZB 1E36B 2OCVB 4X1QU 2B0FA 4ZHAA 2V3OH 1O5GH 1QB6A 2G55A 2YMSC 2ZG0H 3ESTA 1ZGVA 1DS2E 1M9UA 3T2NA 3QUMP 2RDEA 1TGNA 2C4FH 5DP5A 1ELVA 1JOUB 4AC9A 1K1PA 3KL6A 3O8DA 2ZU2A 1S0QA 2FOBA 2D8WA 3EDXB 1ELCA 3U8OH 1XM1A 1BITA 4F48B 3KGPA 4NIYA 3RU4T 4RKJB 1ARCA 1Z8JB 1G3DA 3UR9A 3RDZA 1O2PA 2OC1A 3ZVBA 5A0BA 1OWJA 2QV1A 1C2HA 2IPQX 1ARBA 1VITF 2J94A 5CHBA 1CO7E 1ZR0A 2ZGBH 3CENA 3M7UA 2VGCB 1QL8A 2PR3A 1P57B 5T6DA 2FOEA 2KCPA 2Z9IA 3M3VA 1SOZA 1SI5H 3CS7A 4D9QA 1BZXE 3ZVEA 1K9OE 4Y79A 1TBZH 1QA0A 1YCPH 4JZDH 4P02A 1CT4E 3U1JB 2BVSH 1RD3B 2UUYA 1BHXB 2A4RA 3T25A 3MH4A 4MPWA 2ZIQH 1SMFE 2PFEA 1SGFA 2PP6A 2ZGCA 1KDQB 3GICB 3F0PA 1FMGA 3ZZCA 3RC4A 1HCGA 4CRCA 3E3TA 3A83A 4D76A 2GP9B 5F53A 2A0QB 4ASUD 4UD9H 1GHYH 3UPEA 2RA0A 3FANA 1ELBA 3ATMA 3ZZ7A 3TJOA 3MOCA 1MQ5A 1F0UA 1C1SA 1QL7A 1TPSA 1DANH 2GCHF 1P03A 3SHCH 2UUJB 2ZA5A 1HIAB 1WYKA 1EB1H 4DIHH 1C1TA 2BXUH 4I8JA 4FUJA 1S5SA 1P2MA 3M5LA 1FIZA 2J34A 1K21H 1SQTA 1O2IA 5DP6A 1C9PA 2PUXB 3EE0B 3SJ8A 3RXCA 3T29A 3VGCC 1HV7A 1UCYK 1O5DH 3OEED 1QZ8A 1FONA 1LPZB 1TYNA 1NRSH 2VH6A 2OP9A 1ELAA 4FUHA 3SV6A 1P04A 1GL0E 5GNDA 2JDID 2R9PA 1B7XB 5SGAE 3H7OA 1MTNC 3OY5U 4NIWA 4J2YB 1O3LA 2JH5D 1EPTC 2A5KA 3P70B 4I32A 3S9BA 4Y6DA 1RIWC 3RXLA 1QHRB 3ZZ8A 4WY3A 1OSSA 2PSYA 2C8XB 1DVAH 2ZQ2A 1C5SA 1BTYA 1YPGH 1ETTH 3PWBA 1GHXH 3R3GB 5DK1A 1NRQH 1TNKA 2ODPA 1P09A 2A4GA 1A5GH 2RG3A 4XDEA 1C5ZB 3HKIB 1ZZZA 2QXIA 2ZDAH 5FHTA 1VCWA 2K8IA 3V12A 2ZDNA 7ESTE 3P8NA 5EIYA 3RM2H 3SNAA 3SO3A 3SJOA 1OWIA 1BUIA 2A5IA 5E0JA 3OY6U 2BX3A 3T28A 1Z7KA 3TH4H 2WUBA 1MUEB 5HKKD 4WMDA 3UNSA 4XRNA 1ZHRA 1LHDH 1D9IA 1MKXH 4CHAB 4BTTB 2K1QA 1HRTH 3A8BA 3MHWU 1O3CA 1P01A 1A61H 1XVMA 4HTCH 2Y82A 1CHOG 1SGPE 2YOLA 4H4FA 4AFQA 4UONA 2W3IA 2RCEA 4UEHH 3I78A 1ZMJA 1DE7H 1F5LA 4MPVA 1IQNA 1SG8B 1OWEA 4JK6A 2V35A 4X6NA 2I6QA 1UTOA 1OP8A 1GVZA 2RFKC 2AGIX 1MAXA 1F7ZA 1P8VC 1UVSH 1Z6EA 2GD4B 3FKSD 1XXDA 1NBMD 5JBBS 5AFYH 1V2KT 1KXFA 4INKA 3ZVCA 5G4BA 4M7GA 1Q3XA 4CRGA 1SBWA 1FV9A 2UWPA 2WSSD 3PV4A 3BSQA 1V2OT 2ZGHA 1O3KA 1TONA
chains in the Genus database with same CATH topology
1AQ7A 1DX5M 1C4V2 1FZZA 1WCZA 3A7WA 2BDGA 2ZCKP 3RC6A 1HYLA 4O03A 1AKSB 2ZU5A 3UWIA 2C93B 1S84A 2HNTC 1DLEA 3MU1A 4IMZA 1EXFA 1V2LT 1W7GH 2AYWA 1BJUA 3M3SA 2ZU1A 1AB9C 1WQSA 3F9EA 2SGDE 1V2NT 2BLQA 2VWMA 3H5CB 1PQ8A 2Z6BD 2OBQA 5A09A 1FAKH 1DT2A 2A2XH 1IQKA 2Q6DA 3ZVDA 1GJ5H 3O8CA 1UJ1A 1N6XA 3RUOA 2DE8A 1Z8GA 3SUGA 7KMEH 1SFQB 3O8RA 3ZZDA 1OP2A 4FU7A 3MU4A 2WPLS 1Y59T 2ZPRA 4R0IA 4QT8C 3QDZB 1QY6A 2ZI2H 4RN6A 1CGHA 4IS5A 3SUDA 1K28D 1O5FH 5GDSH 2BQ6B 2GZ8A 2PGQB 1SL3A 2ZKSA 1EJMA 1SVPA 1F0RA 4VGCC 1HLTH 3TJNA 3GY5A 1BRCE 1AVXA 1PPZA 3F6UH 5L30H 3EGKH 2FEQH 1ABIH 1ELTA 3F1SB 3Q76A 1JXPA 3BTDE 1ESBA 3VB7A 3VXFH 1YLCA 1W14U 3A8AA 1QBVH 3ENSB 5DG6A 3PTBA 1Y3YA 1OX1A 4TWYA 1GGDC 1GHAG 1O5BB 2H5DA 1EZSC 1PYTC 2BZ6H 2GTBA 1CBWC 2O9QA 1GWAA 2Z3DA 3UUZA 2G52A 4ZMAH 1C9TA 5I46H 4DVAU 2A32A 2ZFTA 1O3HA 3MH5A 1P2OA 5TCCA 3SUEA 1FJSA 4IW4E 1G2LA 1PQ7A 4B2BA 6GCHG 1O32A 1GCTC 3SOSA 1VCPA 2TGTA 3TIUA 2FOFA 3BG8A 1THRH 1PPCE 1BT7A 3TJUA 2C90B 3SU2A 3Q3YA 2VWLA 3P6ZB 4X2WA 1DDJA 1TMUH 3QLPH 3MH6A 1D3QB 1IQHA 4Q2KA 4NA7A 1K1NA 1ZOMA 2ZFFH 2BD3A 3GY6A 4DT7B 1MZAA 1LVOA 3LKWA 2ZDVH 1V2MT 1CA0C 3TK6A 2D2DA 2BD7A 2SNWA 4BAKB 1GHZA 2WINI 1ETRH 3K6YA 4O9VA 4E7NA 3RXPA 5JBTA 3NKKA 4SGBE 3QO6A 3SV8A 3HPTB 1SGRE 3TPIZ 1UHBA 4OS4A 4DG4A 3HK6B 4X8TH 3M7QA 1LTOA 2XXLA 3BG4C 3URDA 1ACBE 4WVPE 3TJVA 3TH3H 1P9UA 2ZPSA 3EA8A 1AWFH 2DE9A 1O3JA 1TQ0B 1JWTA 3BTFE 3UTUH 2BVXH 4DW2U 3ZVFA 2TGAA 1UK2A 1UTLM 1HFDA 1QRXA 1O2YA 3SNEA 2CHAB 3E90B 3TK9A 1CHOF 2ZU3A 3Q00A 3S7KB 1D6WA 3ODFA 4Z0KA 3BTHE 2H1UA 1L1GA 2ZHFH 3UR6A 1Q2WA 3MU0A 2CF8H 1O3EA 5E2OA 1YP9A 1DY8A 1QNJA 4BAQB 4ZAEA 3SNBA 1KXAA 4THNH 4WXVA 3I29A 1QB1A 4Q7XA 1TX8A 2B8OH 2KAIA 1C1WH 1MZDA 4RKOB 1O3MA 3VB3A 3K9XB 1SGNE 3HK3B 2R3UA 2G5NA 5FBIA 1DM4B 3BTKE 2FX6A 1O2KA 1TGBA 3EYDA 1LKAA 1O5AB 2PV9B 6LPRA 1A3EH 1P2IA 4CR5A 3EQ0H 2XC0A 3PROA 4GHTA 1RRKA 4GSOA 2QAAA 2XBVA 1K1MA 2AIPA 1B5GH 2ILNA 3KNXA 1GI3A 2A1DB 1KTSB 4I8LA 4Y8YA 1OXGA 1FIWA 1ZSKA 3M5OA 5C5NA 2AEIH 8KME2 2PUQH 5DP8A 3TVJB 1UVUH 1THSH 1YYY1 2WPKS 1TA2A 3U1IB 4ASHA 1W0YH 3GY7A 2HLCA 2ZEBA 2O8MA 4ZUHA 4MNWA 4GAWA 2M5TA 3GCHC 1WQVH 3PO1B 1HDTH 2J95A 5EODA 4IN2A 5I25A 3KCGH 3SUFA 1H9IE 3S0NA 1TRYA 3P8OA 3SQEE 1ZPCA 1SC8U 6CHAC 1VGCC 5FBEA 1DXPA 1G3CA 1Z8IB 1SHYA 1GI8B 2WV4A 1O2TA 1NFUA 3N7OA 1EB2A 4KP0A 4AORA 2V3HH 3SGBE 3A7YA 2O8UA 2YNAA 1ANBA 4TYDA 3GY4A 1EUFA 4MG3A 2P93A 4KKDA 1EOLA 2QA9E 3SV2H 4MVNA 1O5CB 1GJ9B 1P0SH 2AGGX 1TRMA 2WYGA 1IHSH 1GCDA 3MMGA 3LGTA 3SU1A 1CA8B 5FXLA 1QIXB 3VB6A 2XCNA 5FCKA 1C1MA 1F2SE 4ISHH 3TNSA 2ODQA 3M36A 1GI2A 3A8CA 3LGYA 4LXBH 1BRUP 2HNTF 4K60A 1RJXB 1NU7B 1W7XH 1EPTA 1GHAF 5E2PA 2G4UA 4DIIH 4U01A 4LK4A 1A46H 7LPRA 4X6PA 2ZTZA 2PSXA 4D8NA 1AVWA 2GT7A 2G00A 5EG4A 1VCQA 3JZ1B 1K22H 1QQ4A 1DSTA 1UTPA 3RXAA 5H4IB 2GDDA 1VJ9U 3SU5A 4LZ4B 1K1IA 1TNHA 2P8OB 3BIUH 1UCYE 3Q3KA 5DP7A 1L0ZA 3IG6B 2JETB 1KLIH 2EI7A 6GCHF 1BMLA 1P12E 2QIQA 1GJ8B 4F49A 4X1SU 3SORA 4A5TS 1GBKA 1GI5A 4A1XA 1CGJE 1O3BA 2Z9LA 1ELGA 1YBWA 5A8YA 1O0DH 1SOTA 2AERH 4DCDA 1ZTLA 1YGCH 3SV7A 2PLXA 2ALPA 1IAUA 2OUAA 3F9GA 2EC9H 1YKTA 4K5ZA 2GMTC 3DUXH 1AWHB 2BXTH 2ZQ1A 1UCYH 2FOCA 1GBEA 5GWZA 4HZHA 4AG2A 2FWWA 4MPUA 2ASUB 3LDXH 3Q77A 1P2NA 3ZV8A 1D3PB 3SBKA 1GBHA 2VIPA 5DJ7A 2OTVA 1GBLA 4AGJA 1YPJH 3RMMH 3T27A 2PKSB 3NWUA 2HOBA 5ESTE 2WV5A 4XFQA 1HAYB 1UVPA 2NU0E 5FPTA 1C5MD 2STBE 3RXIA 2H9EH 2OINA 1K2I1 2FOHA 1AIXH 1UHBB 1C1PA 1EP6A 1GBFA 1T4VH 3SW2B 1S81A 5JBCS 3ZYEA 4TWWA 1AGJA 1GJ4H 2Z9GA 3KQDA 2Q1JA 1F5KU 1TA6A 4OS1A 1XUIA 1C5VA 2TGDA 2OD3B 1TNLA 2UUFB 1BQYA 1XUJA 1W8BH 1SFIA 1G9IE 4DOQA 4BAHB 1BTXA 3ZVGA 1PJPA 1KLJH 1RXPA 2D26C 1AD8H 2AMQA 3BV9B 4K1EA 1ESTA 1UTQA 2GT8A 2ZTYA 4MLFB 3SI4H 1C5OH 3P8GA 2KAIB 2B9LA 1ELDE 1TPOA 3F9HA 3OYPA 3BTME 1O2UA 2FMJA 2QXJA 1O2SA 3RXFA 4HGCA 1YPEH 2PTCE 4J1YA 3ZYDA 1KYNA 4OS6A 1SGQE 1HXEH 2ANKH 2BDHA 3T26A 1T7CA 4K69A 1GMCG 4BAMB 4BXWA 3GDVA 3QN7A 3SJIA 2VIWA 3UQOA 2AMPA 1A7SA 1GJAB 2AFQB 3U98H 1TGCA 3BTTE 3UWJH 2ZP0H 3B8JA 3NZIA 1TBRH 1WTHD 5CMXH 4GHQA 2PKAA 1ZSJA 3SZNA 3DFLA 1HAHH 4I8HA 2ODYB 1GBCA 2TIOA 2HPQH 3ITIA 3TGKE 4NIXA 3LH1A 4ZHMU 3RXEA 2Z9KA 6ESTA 4DJZB 5IYTA 1OS8A 1ZGIA 2ZHDA 2TGPZ 5TJXA 1V2TT 1YPKH 1MD7A 1DWEH 4CRDA 5IDKA 1UMAH 4CRFA 2BHGA 3F9FA 2ZCLP 1N8OB 1TE0A 1V3XA 1P05A 2QY0B 1HAPH 2VIVA 4NG9H 3M7TA 4Q7ZA 3FZZA 2A7JA 3C27B 1GBBA 2HVXA 3GISB 1XMNB 1C5YB 2VNTA 2Y80A 4Y8ZA 1LO6A 1C4Y2 2QF3A 3KQCA 3BIVH 1VZQH 2Z94A 1GJDB 1D3DB 1O33A 2F9PA 2P3FH 1O2MA 4GUXA 2V0BA 9ESTA 2VIDA 2R2MB 1B0EA 2Q6GA 2OC8A 3NK8A 3VGCB 2Y6TA 1GBDA 1MTVA 3E8LA 1CE5A 1EAIA 3LH3A 3A86A 3L6PA 2GKVE 3KF2A 2FIRH 1SGEE 4CH2B 1IQLA 3TLOA 3QZQA 7GCHG 4AGKA 3M5NA 2NU1E 4MTBA 1WBGB 1BTZA 1IQFA 1EPTB 1FY1A 4MNXA 4E05H 2BZAA 4AG1A 1QCPA 1QJ6B 4X0WU 1RIWB 4B75A 4JYUH 4NIVA 1O2JA 5EOKA 1FAXA 5DP9A 3DD2H 1SGIB 1A3BH 1C1OA 3M5MA 2ZWLH 1ZPZA 4NSYA 4UDWH 4FUCA 3RU4D 1LVBA 1T31A 1GPZA 1O39A 5EGMA 3RXTA 1AZ8A 1MMJN 1ZJKA 2AIQA 1FNIA 4BXSA 1TQ7B 1QJ7B 2STAE 1XKBC 1BMAA 1W3CA 4AYVB 1QFKH 1N1LA 4GPGA 4O3TA 4BNRA 5ABWA 3DT0H 2VB0A 1JRSA 2HWLB 2P95A 1SQAA 2HALA 2AH4X 3OSYA 5A2MH 3KEEA 3BTEE 1H8IH 4K1SA 4NFEA 4YLUA 2VWNA 1C1NA 1C5LH 4K3JA 3B23B 1O2ZA 4ZROA 4FVBA 2Y7ZA 1AFEH 2G5VA 2BY9X 1NC6A 2BTCE 4NSVA 4CBOA 4WXIA 1QRZA 1KXDA 1UK4A 1HGTH 3E91A 1XUHA 1NN6A 1GI7B 3S7HB 4YOIA 1GDUA 1V2JT 2J92A 1XX9A 1FY5A 3RXVA 1TB6H 4WWYA 1O34A 4B73A 4BAOB 2A7CA 1OWDA 1RTFB 3MNSA 2BMGB 3RMNH 1FN6A 5C5OA 4Y0YE 1GHWH 1Y3UA 4A1TA 5JYIA 1TGTA 3PLPA 3A7XA 1FXYA 5EXLA 4TY6A 3AAUA 2BM2A 1W2KH 4R8TB 1V2QT 1V2PT 1FPHH 1KSNA 4H6SB 1AB9B 4ABEA 2W7UA 2J4IA 2BD4A 1LDTT 2UWLA 3FP7E 1LMWB 2QGRA 4FUGA 1TLDA 3RXGA 1KXEA 3A7VA 1P06A 1EATA 5LPEA 4ZHLU 1HAOH 1HAVA 2FTLE 2ZF0H 1DWCH 2XTTB 3K65B 1O37A 2CN0H 3KIDU 3RMOH 1EAWA 1GMCF 1NTPA 5F6MA 2GX4A 2XWBI 4CRAA 3RMLH 4OS5A 3W95A 2GCTC 1PFXC 2CMYA 5JB9S 5HYOA 2P3TB 1NU9A 2HRVA 2ZU4A 1TNGA 1BRAA 5L2ZH 1Y3VA 3C1KA 3LGVA 2BDCA 3OTJE 1C5QA 2VH0A 3U9AH 4KELA 4OGXA 2BQWB 2ZHWH 5CHAB 4I33A 4Y7BA 1GVLA 2FYRA 5E0HA 5A0CA 1C5TA 1EX3A 1MH0A 5A8ZA 4CRBA 3TITA 2ZC9H 2PKAB 1UVOA 2FO9A 1OYQA 2R3YA 3IWMA 1A0LA 1ELEE 1GL1A 1HNEE 1NM6A 1O2RA 2NU4E 1Y3WA 1G30B 2XBXA 1TX7A 4MQAA 2TBSA 3BTWE 4X8VH 4AX9H 2J2UA 1E34B 5C1XA 1GDQA 1BDAA 2LPRA 5FX6A 4ABAA 2ZZUH 2H9TH 1TPAE 2CHAC 2F9UA 4ZKNU 4K8YA 2OQUA 3U69H 1WOFA 4DGJA 4B2AA 1AUTC 1CBWB 4ISOA 1QJ1B 1KXBA 2F9NA 1MQ6A 1K1JA 3RP2A 2JH0D 3FP6E 1BMNH 3A89A 3RXBA 3QWCH 1PQAA 2DUCA 1KTTB 1L4ZA 5T6GA 1LHEH 1S0RA 2BY7X 5T3HA 4I31A 4ABGA 7GCHF 4XSKU 2IPHA 5DO4H 1HXFH 8ESTE 5PTPA 3E0PB 1O35A 1O3NA 1UTKA 3A80A 5EW2H 1P3EA 1T8MA 1TIOA 2VU8E 1O2OA 2P59A 1C1QA 1C2FA 2SGPE 1ZYOA 2BY5X 2UUKB 1Y5AT 4TPYA 3M37A 4UFDH 2O8TA 5GCHF 1JMOH 4ZKSU 1GG6B 1ANEA 5GPIB 4YOGA 1DFPA 1B0FA 3SGAE 1S6HA 4I8KA 1V2UT 1HAIH 2HNTE 4E7RG 1A4WH 1MTSA 1JIMA 2GDEH 2A4OA 2P16A 1ZHPA 3BG4B 4NZQA 1ZTKA 1O2VA 4LOYH 2FODA 1BIOA 5F8TA 3MH7A 4AN7A 1W10U 1HAZB 2VIQA 4F4OC 3ATIA 1C2KA 1ANDA 3A7ZA 1W13U 2SGEE 1TAWA 2VVVA 1EZQA 3FFGA 2SGQE 1KY9A 2OQ5A 3UOPA 1AE8H 4YESB 4YZUA 1ZSLA 2W5EA 1C2JA 3GCNA 1JIRA 1BRBE 5GXPA 4SGAE 1SLVB 1P10A 4A7IB 1HJAC 1W0ZU 2ESTE 1O3PB 2ZPQA 5HM2A 2SNVA 1ELFA 1NRPH 1TMBH 3TU7H 2OBOA 1C1RA 1XVOA 2BD8A 1SGYE 4YLQH 5LPRA 1L4DA 2GGVB 5TCAA 3V7TA 3ZZ9A 2VVCA 1YM0A 2VWOA 3M35A 4JYVH 1P9SA 1C2DA 5K0HA 1RTKA 4Q7YA 3A7TA 1A0HB 3UOUA 5C3NA 1GI9B 3RXUA 3FZDA 1LCYA 1AFQC 1MKWH 2GZ7A 2BDBA 3PLKA 2ZHEH 3PTNA 4BOHA 4X1NU 1O2GH 1J15A 1FI8A 2ZO3H 4UFFH 3SU4A 4AB9A 5E0GA 1OOKB 2EEKA 1C5PA 4HFPB 2XBYA 1DOJA 1RTLA 1SHHB 1H8DH 1KIGH 4ABDA 5C2ZA 3LU9B 3HGNA 4D9RA 4ISLA 4AFZA 5DP4A 2P8OC 4HI3A 3A88A 4GCHG 4O3UA 3SHAH 1WUNH 1LVMA 1J8AA 5F8XA 8GCHG 4XOJA 2W3KA 3DA9B 1QTFA 4NCYA 2C8YB 3GCHB 1SB1H 3BEFB 2RDLA 1V2ST 3TK5A 2IOTA 3TNTA 1O3OA 2RA3A 4B71A 3SGQE 2A2QH 6CHAB 1CT2E 1VGCB 1Y5BT 1TOMH 2D1JA 1T8NA 1O2HA 3B9FH 1HAVB 5JB8S 3A87A 1AVGH 3RLYH 3JZ2B 5EQQA 1J16A 1PPGE 2BB4A 2BD5A 1P2JA 1P11E 3SJ9A 2HGTH 1C2LA