2H1UA

Porcine pancreatic elastase complexed with metpheleuglu at ph 5.0
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MFLE
publication title Structural analyses on intermediates in serine protease catalysis.
pubmed doi rcsb
molecule tags Hydrolase
total genus 60
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2006-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2h1uA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2h1uA01
4K8YA 2G81E 3QTOH 2AERH 1ELCA 1GI5A 1Z8JB 4NA7A 3B23B 2JH6D 2ZO3H 1ZZZA 5C5NA 4ABFA 4INKA 3H5CB 2P59A 1N1LA 1DXWA 1QY6A 4R8TB 4UFFH 3S9CA 1GHXH 1BTYA 1CGHA 1BBRH 1CO7E 1HV7A 2YNBA 1Y59T 1L4DA 3LGTA 2ZCLP 5JYIA 1P2OA 4Y11E 3GY2A 1LHDH 5J4QA 1PQ8A 1TGTA 2PSYA 4FVBA 3LJJA 1SLWB 3I77A 1C2GA 3F68H 1VR1H 3TIUA 1ELVA 1NU7B 1K2I1 3ZVBA 1Z8GA 1TPOA 3FANA 3JZ2B 3NXPA 5LGOA 1SG8B 3SV6A 1NC6A 2ZEBA 1NFWA 1EPTA 1GBDA 3GYMA 4MDSA 3KGPA 1HAVA 1C5OH 3DFJA 1YYY1 3E1XB 5FCKA 1AVGH 3AVZA 1O32A 2VWMA 2FI4E 1AB9B 4OS6A 1C5VA 1N8OC 1CHOF 1GBEA 2VWLA 1HUTH 1C5WB 1JWTA 4X2YA 3A84A 2OD3B 1BRUP 2VGCC 4TY7A 3SN8A 4K69A 1ESTA 2F9PA 4GPGA 3MU0A 3ZV9A 1O3CA 1P9UA 1DVAH 2VINA 4NSVA 4NA9H 4Y0YE 1Y3WA 4B73A 5GXPA 1A0JA 4ABGA 1BIOA 4NA8A 1P8VC 4MNYA 1IAUA 7KMEH 2FXRA 4SGAE 2BD3A 4JZEH 2QF3A 1W13U 2V6NA 1KDQB 3A8AA 4O97A 1GBAA 2UWOA 1G30B 3MU5A 4I7YH 1HRTH 1MKWH 3QN7A 1RFNA 3E16B 5FX6A 2BD2A 1BRCE 1UTJA 3A7ZA 3LU9B 2D26C 1RIWC 1E34B 4NCYA 5HM2A 2ZPRA 5FHTA 3A89A 2Y82A 3BEUA 3MNXA 1DLEA 3RXKA 1TPPA 3M36A 1QJ7B 4WJG2 3GCHC 1UTLM 5CHAC 1GMHG 1P11E 3W94A 5AVDA 1WUNH 4INLA 3BTTE 3RXBA 3U69H 4ISOA 4XE4A 3EQ0H 7GCHG 1FY4A 5GCHG 1YCPH 3R3GB 1ZHMA 3RC6A 1QHRB 3ZZCA 1UK4A 4A1VA 4A7IB 3BTQE 5SGAE 1LHGH 2FODA 2BD4A 1S0QA 2GTBA 3R0FA 4Y8YA 4IMZA 2ZHWH 4BAKB 1EAXA 4UE7H 1FN6A 2HNTE 4AFSA 4X1SU 1NRSH 1P2IA 1AKSB 2H1UA 2CJIA 4IGDA 3SJKA 2NU3E 2AIPA 1D3PB 2GDDA 2W7SA 3E8LA 3MWIU 5EXNA 2O8TA 1O2WA 3GDSA 4U2WA 1F0UA 2BD8A 1OKXA 1V2RT 5GJ4B 2QXGA 1IHTH 2NU2E 1C5TA 4ZROA 2GVFA 4D76A 1ARCA 1NS3A 1A7SA 1PPZA 2F9VA 3MU4A 4AN7A 1DM4B 3O8CA 3VFEA 1GPZA 1EP5A 2A7HA 4CR5A 3ZVFA 6GCHF 4TY6A 3OSYA 3EA8A 1MZAA 1AE5A 1F92A 1MD8A 3ZVEA 3T28A 1GDNA 1O3AA 4Y76A 1GHBF 1MTWA 4LOYH 5CMXH 2VIWA 3QZQA 5HGGA 2A31A 5G4BA 2ZI2H 1PPCE 2UWPA 2WUBA 1EZUC 3PO1B 4IW4E 2GCTC 3EA9A 2R3UA 3LGVA 2J38A 1AZZA 2JKHA 2FTLE 1EASA 2EI8A 1FUJA 3QK1A 3RMNH 2ANWA 3NZIA 3SGQE 3UTUH 1NN6A 5ABWA 3LONA 2QXIA 3GISB 1HJAB 1NY22 2HVXA 3BF6H 4JK6A 3B9FH 4FXGH 1HIAA 1TRMA 2BDBA 1Z8IB 2BVXH 2FZZA 2XNIA 1LPGB 4XDEA 1J9CH 3S9AA 1LQEA 2PGBB 2ZU4A 4AB8A 1OOKB 1BCUH 2Q6FA 3T26A 1GHYH 1C5YB 2ULLA 3E3TA 1CHGA 2A32A 1YP9A 2BMGB 1L1GA 1P2MA 1TX6A 2M5TA 4JYVH 5JBAS 2YNAA 1SGCA 1T7CA 1WSSH 2CGAA 4X1PU 1LKBA 1BB0B 5DPAA 3LIWA 1RS0A 1KYNA 4X2VA 2ZHDA 4ZKOU 1RRKA 5L30H 1KLJH 1HAXB 1TPAE 4O3UA 2ASUB 2C4FH 3Q3YA 1O2UA 5F6MA 1O39A 2ANMH 2DE9A 3BIUH 3ODDA 1XUIA 1Z71A 1EATA 5AFZH 6CHAB 2FX4A 4UD9H 3RXVA 2B0FA 2A7CA 3RXIA 4MQAA 4TYDA 1BMAA 1Y8TA 4ESTE 1V6DA 4ABDA 1UTPA 3ODFA 1C1QA 3MMGA 4RKJB 1DFPA 2AS9A 2XBVA 3UWJH 1KSNA 1PPGE 3K2UA 2V3OH 3SJ9A 1SOTA 8GCHG 1F0SA 1TONA 1J8AA 1OX1A 1C5MD 2BLVA 1WCZA 4QT8C 1TX8A 1M9UA 1GL0E 1QB9A 3PMAB 3QGJA 2BOHB 4MVNA 3KQEA 1BMMH 4ZXYH 3VB4A 3QUMP 5TJXA 1ELTA 4NWLA 2XBYA 3URCA 3ZZAA 4X6MA 1EB1H 2ZDVH 1QRZA 4X8TH 1JRSA 2Y7XA 2PKSB 4ISLA 4ABJA 4X2WA 1ZTLA 3RU4E 3HGNA 4YM9A 1UVOA 1C9PA 2FDAA 4JCNA 4DURA 1MQ5A 3SBKA 1P57B 4HTCH 5GPIB 2ANKH 4ABIA 1QB1A 1HFDA 2F9BH 5L2ZH 3Q3XA 1EZXC 4A92A 1V2TT 1P02A 4YT7H 1J17T 4J1YA 1F5KU 3MNBA 3K65B 1ZJKA 1HDTH 4GHQA 5ESBA 1XUJA 1TGCA 3UREA 3LT3A 3SJOA 1QNJA 2ZU5A 1TNIA 1P01A 1CSOE 4Z6AH 3I29A 1ESAA 3O8BA 1TMBH 2XRCA 1GWAA 2J9NA 1BUIA 5JBCS 1FI8A 1BOQA 1Y3VA 3HKJB 1WTHD 1S85A 3RXQA 2IOTA 4ABHA 4E06H 7ESTE 1AY6H 1CBWB 1GJ4H 3UQOA 2Z9JA 2Z94A 3MO6A 2WPMS 1EQ9A 2BY7X 1SQAA 1GHWH 1EXFA 5FBEA 1AZ8A 3Q76A 2BY5X 3STJA 2ANYA 1XM1A 5LH8A 1GBBA 1DITH 2CF8H 1G37A 4K1TA 2CHAB 1GHAF 1ZRBA 4H6SB 1A46H 1X7AC 2UUKB 2I6QA 1C2LA 1C1OA 3GCTG 3VPKA 3TU7H 3TJUA 3MO9A 1OSSA 2JETC 2CN0H 1DXPA 1LCYA 1V2VT 2P8OC 1ETTH 5FPYA 1ZPCA 1TNHA 1O33A 4AX9H 2J95A 1UVSH 1YC0A 1OWIA 1T4UH 1MD7A 1LVBA 1HAGE 5A0BA 1DUAA 1B7XB 4JYUH 3SU6A 5DP4A 1VGCB 1AWFH 3ZZ7A 3GY3A 5DP9A 3BTME 2OCVB 1GI0A 4UEHH 3RXRA 2QCYA 4I31A 1LO6A 3OY6U 4BAQB 4D9RA 1UCYH 1MCTA 1DX5M 1KXCA 2A45B 1EJMA 5DP5A 9ESTA 2EI6A 2F9NA 3EE0B 1GL1A 2GX4A 3OX7U 1A2CH 1RXPA 2PSXA 2ZWLH 2ODPA 3TK5A 3I78A 1TFXA 2HRVA 1ID5H 1SHYA 1CT0E 1ZSJA 2BDIA 4Q7ZA 3LH1A 4UFGH 1BTUA 4AOQA 1GI9B 2ZA5A 1V2PT 1PQ7A 1SQTA 2AFQB 1IQLA 2G51A 3ITIA 1O2NA 2Z9IA 3EDXB 4CRAA 1V3XA 2HALA 3GCHB 3NK8A 1HAZB 3RLWH 1BBRE 3M37A 5CHAB 4I8HA 1MU6B 2FESH 1AD8H 3RXLA 1V2NT 4F49A 2AGGX 2ZGXH 2D1JA 1IQKA 1YLCA 2C8XB 4X8VH 1VJ9U 2BHGA 1BBRK 1UK2A 2SGAA 3E0NB 2HNTC 2Y5GA 3ATLA 1C2FA 1GJ9B 2AH4X 3GOVB 1T8LA 1UO6A 3LOXA 2FWWA 1P3EA 4GAWA 6ESTA 1TMUH 2FOBA 2XC5A 1EJAA 3OYPA 5T3HA 1NM6A 1QR3E 5FCRA 1TPSA 4AGKA 1O2YA 3SNAA 2HWLB 1K1PA 1BTHH 1CVWH 3BEFB 3V3MA 1C1VH 2GP9B 3LGYA 3SU3A 1LHEH 2ZGBH 1NFYA 4WH6A 1V2ST 1INCA 4FUHA 3CP7A 3W95A 2SGEE 3V12A 2UWLA 1IQMA 1ORFA 1ZGIA 2PKSC 4K60A 2G5VA 2ZIQH 2VH0A 1QBVH 2A5KA 3F6UH 1YPEH 2BDHA 1D3TB 1TQ0B 4MTBA 4YLUA 3TLOA 3DHKH 3ZVDA 3RDZA 1SQOA 2PTCE 1O31A 4DOQA 2ZU2A 1DWEH 1GVZA 3HK3B 1WBGB 4GLYA 4CREA 4OS4A 1HB0B 4YO9A 4THNH 2AEIH 1BRBE 1H9IE 1FNIA 3DFLA 5F8XA 1DLKB 1CT4E 2SGPE 3PM3A 3BTFE 2OBOA 1A3EH 1SGDE 2W26A 3RXSA 1C4V2 3UWIA 1AFEH 5DO4H 4X1QU 2GMTC 1FQ3A 2Q6DA 4K5ZA 1MKWK 1UVPA 3AW0A 1U6QA 4TWWA 4MLFB 1BJVA 2FI3E 2GCTB 4FUGA 1BTWA 4NFFA 1SBWA 5ETXA 3RP2A 8ESTE 1YPHE 4XSKU 2OC0A 1CBWC 1TRYA 1AFQC 1WOFA 1C2DA 7LPRA 3SV9A 1P04A 5T6GA 2O8WA 3TJVA 1SGTA 2W3KA 1P2QA 3A87A 1MTSA 2PLXA 4WXIA 1NT1A 3STIA 3MNCA 9LPRA 2V0BA 1SGIB 4Y10E 3TPIZ 2STAE 2CHAC 3FP7E 1MBQA 3RXUA 2ZFQH 1UTQA 1EZQA 1RTLA 1YCPK 1YPLH 3OY5U 4AG2A 1S0RA 2XBXA 1ZJDA 3FZDA 2GDEH 3RU4D 2ZHQH 1GGDC 1N6YA 4JYTA 3IITA 5A8XA 1P9SA 5JBTA 2WINI 2VIDA 4NGAH 1GI2A 3EA7A 1C1UH 1O2VA 1BMNH 1QL9A 1FONA 1ZMJA 2BQ6B 3HGPA 1DWCH 4WF8A 3HATH 3UOPA 1O5AB 2J94A 1RD3B 1SGPE 2PHBA 5T6DA 3C27B 1DDJA 3KF2A 1SGRE 2WPJS 5K0HA 4BTUB 1VGCC 5JBBS 2ZHEH 2TGTA 3BV9B 3GDVA 1QBNA 2GGVB 3U8RH 6GCHG 3DUXH 4I8KA 2VU8E 1HBTH 1ZLRA 1EZSC 5BRRE 2QXHA 1AUTC 3ENSB 2P93A 1LQDB 2HLCA 1T8OA 2WPLS 1K1NA 3U8TH 1GHBG 2DE8A 3A7XA 2PR3A 1WV7H 1TWXB 2ODYB 1O3FA 5EXLA 2FOAA 3ZZDA 3UFAA 1FMGA 2WPKS 3M7QA 3BIVH 5HYOA 1ELGA 3Q3KA 5E2PA 3L3TA 2SGDE 5EPYA 5FPTA 1W12U 2G4TA 1MZDA 1H4WA 5TCCA 3ATMA 1N6XA 4O03A 8KME2 1P0SH 1K28D 2ZZUH 2A0QB 1THPB 1K22H 2FOEA 4Q2KA 3S0NA 2SNWA 4X1RU 4Q7YA 1JMOH 3SORA 2FP7B 4O9VA 3UNSA 3O8DA 4IC5A 2P16A 4Y8ZA 3S7KB 4GUXA 3KCGH 1MAXA 3PB1E 4OS7A 3PMHB 1TE0A 3PV4A 4Y0ZE 1G2MA 1C5RA 2TGAA 1YPMH 2VNTA 1C9TA 1EOJA 1SLXB 4IN1A 3P8OA 3UNRA 5JB8S 4YLQH 1GBJA 5FXLA 2Z9LA 2G5NA 1W10U 2ZDKA 1ZTKA 1C2HA 1O2PA 3F9FA 5E2OA 4AG1A 3TNTA 1O3IA 4DJZB 1GI3A 5IYTA 1YKTA 1XKAC 2R2WU 1BMLA 2SFAA 1Y5BT 2BZAA 2BX4A 3QWCH 1W3CA 2J2UA 1MKXH 1FIWA 3SHCH 1GI6A 1V2OT 4AB9A 2VIQA 3F9GA 4D8NA 4GCHG 4IMQA 1GBMA 3TK6A 5F03A 1HCGA 3SHAH 3SUDA 8LPRA 2RA3A 2JETB 1TGBA 1O3MA 1H1BA 2XTTB 5GDSH 2VWOA 2D2DA 1QA0A 3P6ZB 2P8OB 1DICA 1O3NA 3E6PH 3SUFA 5FX5A 4BAMB 1Y3YA 2GZ7A 2VJ1A 4LXBH 3TK9A 1BHXB 5E0GA 2FMJA 2QYIA 1ZPZA 3GY5A 3GCOA 1O5FH 1FLEE 1O3HA 1DT2A 4OS2A 3QZRA 4JZFH 3UR6A 3UOUA 2ZHFH 1HAPH 3SZNA 1O5CB 4KTUA 3WY8A 1EAUA 4B2BA 4XFQA 3RM2H 3PMJA 4GHTA 1C2EA 1QB6A 3GY4A 3RXPA 3T2NA 4MPVA 3SV2H 3GYLB 5L2YH 3PROA 5C67A 1QQUA 1UTNA 2PFEA 1JIRA 2PUQH 1VCQA 2ZDLA 1IHSH 2G55A 3VB6A 1BT7A 1TALA 4X6PA 4FU7A 1BTZA 4FUDA 4LZ1H 1NRQH 4NIVA 3SJ8A 2FYRA 1V2QT 3T25A 1IQGA 1NRPH 1G36A 2BDCA 5HXFA 2C8WB 3P95A 5E0HA 7GCHF 3V13A 2RDLA 3TGKE 3AW1A 5GIBA 1CT2E 2A7JA 1BHXF 5C3NA 1SC8U 1QURH 3LJOA 1O5BB 1ETRH 1ZRKA 3MO3A 1O34A 1K1JA 4BAHB 3FFGA 2VVCA 1EX3A 1MAYA 5BPEA 3SNDA 1V2LT 1CA8B 1HGTH 5B6OA 4FUEA 3SV8A 2BDYA 4NSYA 4XBBA 1GHAG 1RTKA 1E36B 1XUFA 2O9QA 1AU8A 2XWAA 1FN8A 1LVOA 2PTNA 1O2HA 2D8WA 1IQEA 1JBUH 1ELFA 3A86A 3BTKE 1THSH 2WPHS 1D6RA 3PLBA 1C5NH 1O2SA 1C5UA 1C2KA 1IOEA 2VVUA 4X0WU 4CBNA 2PV9B 1C1MA 3D65E 1RGQA 1S84A 1MU8B 2KAIB 2ZPQA 3ZZ3A 1P3CA 5A2MH 2BOKA 1HAIH 2FX6A 4ISNA 4KTCA 1JRTA 1O2RA 4A1XA 2OBQA 3SV7A 3TH4H 5EQSA 1G2LA 4FVDA 1VZQH 4AGJA 4IN2A 3RUOA 1DY8A 1A3BH 4WXVA 4ABEA 5C1YA 1GJ5H 1F0RA 1UMAH 1GMCG 1D9IA 3NWUA 2HNTF 1OP0A 1DPOA 1HAHH 2XYAA 3A8DA 5EGMA 4CRFA 2V35A 3JZ1B 3BG4B 1ANDA 1UCYK 1QCPA 2ALVA 2P3FH 1YPJH 1ZR0A 3A7TA 1NRNH 4CH2B 2G52A 3M35A 4MNWA 2VIOA 2VIVA 4U32A 4OS5A 2ZQ1A 1XUGA 1TB6H 1YF4A 5HM9A 1YPKH 2GMTB 3BN9A 1FJSA 3BTEE 2TGDA 3P8FA 3VB5A 2IN2A 4Y71A 4YTAA 1BTPA 1G32B 1UK3A 5C1UA 1FPCH 3UQVA 1AFQB 2VWNA 3A7WA 1TABE 1AIXH 1Z6EA 3KQDA 2F9OA 3Q77A 2BB4A 2PKAB 1IQJA 1GBHA 1IQFA 2WYGA 2GV7A 1YGCH 2ZTXA 3SNEA 4BTIB 3H7OA 2OQ5A 3PTBA 3S69A 1FZZA 5T6FA 4YT6H 3M5OA 3TNSA 1O2LA 2EA3A 1YLDA 2GKVE 4MPXA 1XUHA 2PUXB 2Y6TA 3K6ZA 1T8NA 2O8UA 2FOGA 1QGFA 3SI4H 4A1TA 4WMFA 1GGDB 3E90B 3P70B 1Z7KA 1J15A 4HFPB 3SO3A 2NU4E 1UHBA 1ABIH 4WVPE 1Z8RA 4WWYA 5DJ7A 3UPEA 2ZGHA 3M3VA 4LZ4B 4I8GA 1EP6A 3VB3A 3M3SA 4I8JA 4Y7AA 5EQRA 2STBE 2JH5D 5L6NH 2FEQH 1GDQA 1FXYA 5LPEA 1DWBH 2QIQA 2LNCA 1HXEH 2ZPSA 4TPYA 1TIOA 2BD9A 1SLVB 2DUCA 1E35B 3LH3A 1EUFA 3FP6E 4ZHLU 1CA0C 4AORA 1O38A 4KKDA 1C1RA 1O3LA 5I25A 3SNBA 4IBLH 1PQAA 1TRNA 1LVMA 1GI8B 1HNEE 1MQ6A 4FUCA 3SQHE 3GY8A 2XC0A 2GCHF 3A8BA 2C8ZB 3URDA 1THRH 3DD2H 1OWKA 2HPQH 4DW2U 4NZQA 3UIRA 4X6NA 1LPKB 1O36A 1BZXE 2HGTH 1AMHA 1TBQH 2ZG0H 3MOCA 1OWDA 4JZIA 2Q1JA 3Q00A 1F5RA 4H42U 3KNXA 2AMQA 3T27A 1LHCH 3F9HA 2H9HA 1SMFE 1O2TA 3ZVGA 2PW8H 4D7FA 3A7VA 1PQ5A 5EXMA 1C5ZB 3P92A 1BTXA 1VCPA 2P3TB 3OU0A 4WMDA 1O2IA 3RM0H 2TBSA 2NU0E 2F9UA 2WUCA 1C1SA 1GG6C 1AVXA 5DP3A 1FV9A 4CHAC 3MH5A 1W8BH 1NZQH 1Z6JH 2A4OA 1GJ6A 2Y80A 4BAOB 1SOZA 3T5FH 1UVTH 2C8YB 4DY7B 1O2QA 4VGCB 2ZGCA 4K2YA 2IPHA 2TRMA 3KL6A 3NPSA 3LC3A 2W5EA 4WMEA 4K3JA 2G00A 2JH0D 4H4FA 1PPHE 4X6OA 3E0PB 1TNLA 2QGRA 3AASA 5DP8A 2TIOA 1K1LA 2VVVA 2OC7A 3RXCA 4NIWA 1T31A 3QDZB 3KEEA 2GT8A 1C5XB 1CHOG 2A5IA 4H6TA 1P2JA 4CRGA 2VB0A 2EC9H 3CS7A 3EYDA 2EI7A 1TMTH 3RC5A 1DE7H 1SFQB 1OWJA 4U30A 4NIXA 2QN5T 3NCLA 1O3DA 2FIRH 2SGQE 4ISHH 1H8DH 2FS8A 1UTMA 4BXSA 1GJ8B 2FS9A 4BANB 1GHVH 2FOFA 1WQVH 4CRCA 1AN1E 5JPMH 2BQWB 5DP6A 4Z0KA 1KLTA 1KDQA 4DIIH 1KXBA 1TA6A 1Y5AT 1ANCA 1B0FA 4NZLA 1KLIH 1TYNA 1B5GH 3BG4C 1ABJH 4BOHA 1DANH 1H8IH 1NFUA 1HAOH 1CQQA 3IWMA 4YOGA 1B0EA 1C5PA 2G4UA 1AHTH 2XC4A 3LGUA 2Z3CA 2ZFPH 5H4IB 3MFJA 1A5HA 1L1JA 2Q6GA 2AYWA 4WH8A 1C1PA 2GD4B 1W2KH 2AGEX 1C5LH 3TJNA 1C1WH 4FU8A 3VGCC 5C1XA 4JZDH 4I33A 3TH2H 1OYQA 3GICB 2H9TH 1O30A 4D9QA 1YBWA 1EB2A 4YOIA 2ZNKH 5LPRA 2BLQA 4NFEA 1PYTD 2W3IA 1P05A 3GY6A 5EW2H 1ZGVA 1PPEE 1G9IE 1SVPA 3MU8A 3PTNA 1MMJN 2BDGA 1VITF 4SGBE 2H2ZA 1LTOA 1QRWA 3HPTB 4AYVB 2ZF0H 1DY9A 1TBRH 1Z1JA 1AKSA 3T29A 1C5QA 1F0TA 2AIQA 4R0IA 3ZZ9A 4E7RG 1GJCB 1FY8E 3PLPA 3BSQA 1XVMA 3H7TA 1O0DH 2ZU3A 1GI4A 3ZZ8A 2ZTZA 3SI3H 4FUJA 2GZ9A 1TGNA 3SGBE 2FPZA 1WU1A 4B1TA 2BY6X 2AMDA 4JMYA 4ABBA 3D23A 2GZ8A 1ELBA 3VEQB 2P95A 1CE5A 2UUYA 1GMDF 1QBOA 1BQYA 2XXLA 3TGJE 2FI5E 2ZC9H 4F4OC 1NROH 1S5SA 2P94A 1TLDA 3M5NA 3OTJE 1WTGH 2B9LA 3MU1A 3ZYEA 1A5IA 4X1NU 2QA9E 4ZXXH 1K1MA 4IC6A 4OS1A 3ZV8A 1AUJA 1GCDA 4INHA 1CGIE 2TPIZ 1NO9H 2FOHA 2Y7ZA 1QRXA 1PYTC 2BTCE 1MBMA 2FYQA 2A1DB 3NUMA 1JOUB 3AAUA 1CGJE 1MKXK 2ZFFH 1KXAA 3TJOA 1A61H 1O35A 3A85A 4UONA 4ZMAH 1Y3XA 2ESTE 1W7GH 4LK4A 2ZDMA 2BX3A 4ZUHA 1ANEA 1IQNA 3ESTA 1LPZB 1O2JA 4WY3A 1A0LA 1QL7A 3A7YA 1MTNC 2UUJB 5EOKA 5DG6A 1GVKB 1KTTB 1VJAU 4XBDA 4ABAA 5A0AE 1F7ZA 1D6WA 4XBCA 1PJPA 5C2ZA 3A80A 1L0ZA 2A4RA 5LPFA 4XOJA 3A83A 1W14U 4MPUA 1FPHH 3M3TA 1ELDE 1RJXB 2H5DA 4TPIZ 3K9XB 2C93B 1KXFA 2QAAA 3U1JB 3U8OH 1OP8A 1O3EA 4Y79A 1NFXA 3F9EA 1E38B 1HLTH 4YZUA 1GJDB 3RMMH 2ZQ2A 2Z9GA 4HI3A 5FPSA 1O5EH 1DOJA 2OINA 1OPHB 4UFDH 3KN2A 1O2OA 1BDAA 4VGCC 1GI7B 3FAOA 1NPMA 2A4QA 3AAVA 1AGJA 3D62A 1XXDA 1XUKA 1WYKA 2GT7A 4DVAU 4A6LA 3ATKA 1HXFH 3LKWA 4K1EA 4RSPA 1ELEE 1QQ4A 1IQIA 3MH7A 4X8SH 1BA8B 1OYTH 1A0HB 1GBCA 1P2KA 1ZSKA 1SR5C 5GWZA 3SUGA 3A81A 1K1OA 2TGPZ 2ZU1A 2QF0A 2CXVA 4CR9A 3UNQA 1HYLA 1O37A 3P17H 1UVUH 3RXGA 2BY8X 1EPTB 2FLRH 4HZHA 1C1TA 1E37B 1K21H 1S6HA 1TAWA 2BVRH 3G01A 1HAVB 3M5MA 5EW1H 1SSXA 4ZKSU 1V2MT 1SGFA 4K1SA 1P12E 4AYYB 3CS0A 1SHHB 1LVYA 1UTOA 2XBWA 2NWNA 2W7UA 1ELAA 2Z6BD 3MYWA 1K9OE 2ODQA 4O3TA 2KAIA 3L6PA 2B7DH 3ATWA 2CV3A 1VCWA 4BTTB 5A09A 1FY5A 1QIXB 4D7GA 4AFUA 1XXFA 2CMYA 3RXDA 1S83A 4TWYA 2ALPA 1SFIA 3SU1A 1EAWA 3RXEA 1QJ1B 2FM2A 2GV6A 2BM2A 2Y5HA 3BTHE 5AHGH 4B71A 1EOLA 2ZDAH 2Z9KA 1HJ9A 2BXUH 2YOLA 3EGKH 2ZDNA 1E0FD 1TOCB 4OGYA 2OC1A 1L4ZA 3ZZ4A 2PGQB 1O2KA 3LGWA 3GY7A 1GCTC 1C2IA 3RMLH 1CA0B 3TH3H 1W0ZU 2OXSA 2QC2A 4NWKA 2ZGJA 1GBIA 3ZYDA 3MTYA 3LGIA 2ZCHP 1EJNA 4OGXA 3SUEA 2QXJA 2WPIS 2SNVA 3U9AH 5I46H 3A82A 1OS8A 2EEKA 4JK5A 4E7NA 1SGFG 5DP7A 1DWDH 1D3DB 1MTUA 4HGCA 3M7TA 3SJIA 3ZZBA 1P03A 4AZ2B 3KHVA 5DK1A 1WQSA 2J34A 2THFB 4DG4A 4I8LA 1GMHF 3EAJA 1FDPA 4AFZA 3HK6B 3FZZA 1O3PB 6LPRA 5J4SA 1PFXC 2BY9X 4DIHH 5HMAA 1NTPA 3SU2A 1UJ1A 2BXTH 2PKAA 5GCHF 1QJ6B 1XMNB 1FY1A 2XCNA 1T8MA 2Z3DA 1OWEA 4FUIA 5E0JA 2G8TA 1MTVA 2WYJA 2R9PA 1Z1IA 5AFYH 1HAYB 2BLWA 3A88A 2A4GA 1AE8H 1GG6B 4ISIH 2R2MB 4CHAB 4GVUA 4X2XA 2H9EH 2OP9A 3BEIB 3MNSA 4AFQA 1C4U2 3ZZ6A 1O2MA 1TA2A 3SU0A 3SW2B 1ACBE 4KGAA 2ZKSA 2ZFRH 1ZPBA 1DSUA 2LPRA 3KQBA 2B5TB 1AB9C 1LHFH 1ETSH 1V2KT 3RXJA 1A1RA 1FAXA 3M5LA 1ZMNA 3MHWU 1Y5UT 1ESBA 1C2MA 2AGIX 1OWHA 2UUFB 4B74A 4M7GA 2Y81A 1T32A 2A2QH 2F91A 3KQCA 2ZFSA 2RCEA 3O8RA 3BG8A 2Z7FE 4IS5A 1TBZH 1QTFA 2VH6A 3U98H 5ESTE 2OLGA 3BTGE 2H5CA 1QA7A 3S9BA 4FUFA 2ZTYA 4PROA 4GCHF 3T62A 3V7TA 4ZKNU 5A0CA 5TCAA 1ANBA 4YOJA 1ZTJA 4KP0A 3RXFA 5EPNA 3GDUA 1UCYE 4MNXA 5EU8A 1A5GH 3RC4A 4JZ1A 1P06A 3ZZ5A 3QLPH 3U1IB 5JDUB 2BLOA 2GCHG 1GBTA 3S7HB 3TGIE 1SGEE 2P3UB 1LMWB 1J16A 1L2EA 1JIMA 1GI1A 2XW9A 2C3SA 1GVLA 1YCPM 3ZVAA 2XWBI 1O3BA 1YPHC 1NESE 3QX5H 1HPGA 3E91A 3LDXH 1W11U 1Q31A 2QY0B 4Q7XA 3UR9A 1LDTT 5DKMA 3VXFH 1ZMLA 1O5DH 1K1IA 3LPRA 4E05H 2F3CE 1TGSZ 1LKAA 5C20A 3RU4T 2OQUA 3PWBA 3TITA 1SL3A 3VGCB 1HIAB 1YM0A 3QO6A 1WAYB 4NG9H 1C5SA 1GBLA 2OC8A 3LC5A 5EG4A 4K8BA 3MH4A 4FU9A 1H9LB 1FY3A 1SI5H 4CH8B 4A5TS 2I6SA 1KTSB 1BITA 1EPTC 1NRRH 4Y6DA 5IDKA 3NKKA 3SGAE 4FUBA 1V2JT 2FO9A 1UTKA 1CU1A 3D49H 4ZHMU 3RXMA 2PWXA 4BNRA 1D3QB 3N7OA 2QV1A 4Y7BA 4B75A 4MNVA 1FAKH 1JXPA 4RKOB 3RXHA 5JB9S 2NU1E 2ZFTA 1F5LA 2XCFA 1J14A 5DGJA 5F8TA 1O3OA 1IQHA 1XX9A 2K1QA 4CRDA 5AF9H 2J4IA 4B2CA 1RTFB 1O2XA 3CENA 1O3JA 3MI4A 1C1NA 1Y3UA 3SU5A 1C4Y2 1DUEA 2SGFE 1ZOMA 1S82A 1BJUA 1MUEB 1SPJA 1PPFE 4J2YB 2HOBA 1XVOA 1ZHPA 4RN6A 4ZHAA 1O3KA 2A5AA 5C5OA 4BXWA 1KXDA 3QGNB 8GCHF 1TQ7B 2O8MA 4MPWA 1G3BA 2R0KA 1N8OB 3M61U 4NIYA 3VXEH 1AI8H 4CRBA 1T4VH 2BVSH 1OP2A 1ZYOA 3ELAH 2VGCB 3PO1C 2ZECA 4YESB 3SQEE 2RA0A 2O8LA 3FVFB 3GCNA 2C90B 1O5GH 1V2WT 2AMPA 3VB7A 4ZH8A 1SGQE 3BTWE 2IJOB 1YPGH 1MTNB 3P8NA 1AWHB 1SGNE 1XKBC 4U01A 1KXEA 1HJAC 1Q3XA 2BQ7B 1KY9A 1ARBA 1HJ8A 2Z3EA 1GMCF 3TVJB 2R3YA 3B8JA 4ZKRU 3SNCA 2A2XH 1SGYE 3HKIB 3L33A 4ASHA 1S81A 1ZSLA 1O2GH 4B76A 1P09A 4I32A 1L1NA 1G3EA 3PWCA 1RIWB 1S6FA 2BYAX 2FOCA 1TNJA 1VITG 1MH0A 3A8CA 4B2AA 5EQQA 2Y5FA 1OXGA 2WV4A 4CBOA 1TNGA 1O2ZA 2BD5A 3UUZA 2HPPH 1DS2E 5PTPA 1QFKH 3RLYH 1GBFA 1GHZA 4MG3A 5FBIA 4ZAEA 1C2JA 1ZHRA 1P2NA 1FIZA 2VIPA 1TOMH 3BTDE 3DA9B 4DT7B 3PYHA 1NU9A 3ZVCA 5EODA 3K6YA 3IG6B 1PPBH 4Y8XA 6CHAC 1BRAA 2BD7A 2BDAA 2BZ6H 2H6MA 4Q80A 1GMDG 2FTMA 3ATIA 2R0LA 1QL8A 1G3DA 1GJ7B 1MCVA 2B8OH 3QTVH 2WV5A 1Q2WA 1KIGH 2RG3A 1DSTA 4X8UH 1W7XH 1GBKA 1SLUB 3GCTF 1EKBB 5F8ZA 3V0XA 1W0YH 2FOMB 4KTSA 4DCDA 1VITH 4KELA 3RMOH 1D4PB 5FAHA 2ZP0H 3RXOA 1A4WH 1UHBB 1GJAB 1H9HE 3UY9A 3KIDU 1AVWA 1O3GA 2ZCKP 1AQ7A 5K7RA 3PMBB 2OTVA 3RXAA 2FLBH 1F2SE 5E8EH 5A8YA 4GSOA 1V2UT 2OUAA 2V3HH 1GDUA 3F1SB 3SU4A 5CE1A 1EAIA 1AO5A 3PLKA 1G3CA 4UDWH 3M7UA 3DT0H 3RXTA 2F83A 3FP8E 3SOSA 5A8ZA 2J92A 1TX7A 4UFEH 1SB1H 2ILNA 3P8GA 1GJBB 1P10A 3MH6A 1TNKA 1GCTB 2CF9H 4DGJA 3C1KA
chains in the Genus database with same CATH superfamily
4K8YA 2G81E 3QTOH 2AERH 4TSFD 3F0OA 1ELCA 1GI5A 1Z8JB 4NA7A 3B23B 2JH6D 2ZO3H 1ZZZA 5C5NA 4XRNA 4ABFA 4INKA 3H5CB 2P59A 1N1LA 1DXWA 1QY6A 4R8TB 4UFFH 3S9CA 1GHXH 1BTYA 1CGHA 1BBRH 1CO7E 1HV7A 2YNBA 1Y59T 1L4DA 3LGTA 2ZCLP 5JYIA 1P2OA 4Y11E 3GY2A 1LHDH 5J4QA 1PQ8A 1TGTA 2PSYA 4FVBA 3LJJA 1SLWB 3I77A 1C2GA 3F68H 1VR1H 3TIUA 1ELVA 1NU7B 1K2I1 3ZVBA 1Z8GA 1TPOA 3FANA 1WXRA 3JZ2B 3NXPA 5LGOA 1SG8B 3SV6A 1NC6A 2ZEBA 1NFWA 1EPTA 1GBDA 3GYMA 4MDSA 3KGPA 4F48B 1HAVA 1C5OH 3DFJA 1YYY1 3E1XB 5FCKA 1AVGH 3AVZA 3OE7D 1O32A 2VWMA 2FI4E 1AB9B 4OS6A 1C5VA 1N8OC 1CHOF 1GBEA 2VWLA 1HUTH 1C5WB 1JWTA 4X2YA 3A84A 2OD3B 1BRUP 2VGCC 4TY7A 3SN8A 4K69A 1ESTA 2F9PA 4GPGA 3MU0A 3ZV9A 1O3CA 1P9UA 1DVAH 2VINA 4NSVA 1QZ8A 4NA9H 4Y0YE 1Y3WA 4B73A 5GXPA 1A0JA 4ABGA 1BIOA 4NA8A 1P8VC 4MNYA 1IAUA 7KMEH 2FXRA 4SGAE 2BD3A 4JZEH 2QF3A 1W13U 2V6NA 1KDQB 3A8AA 4O97A 1GBAA 2UWOA 1G30B 3MU5A 4I7YH 1HRTH 1MKWH 3QN7A 4TT3D 1RFNA 3E16B 5FX6A 2BD2A 1BRCE 1UTJA 3A7ZA 3LU9B 4F55A 2D26C 1RIWC 1E34B 4NCYA 5HM2A 2ZPRA 5FHTA 3A89A 2Y82A 3BEUA 3MNXA 1DLEA 3RXKA 1TPPA 3M36A 1QJ7B 4WJG2 3GCHC 1UTLM 5CHAC 1GMHG 1P11E 3W94A 5AVDA 1WUNH 4INLA 3DCLA 2WV9A 3BTTE 3RXBA 3U69H 4ISOA 4XE4A 4XD7D 3DSPA 3EQ0H 7GCHG 1FY4A 5GCHG 1YCPH 3R3GB 1ZHMA 3RC6A 1QHRB 3ZZCA 1UK4A 4A1VA 4A7IB 3BTQE 5SGAE 1LHGH 2FODA 2BD4A 1S0QA 2GTBA 3R0FA 4Y8YA 4IMZA 2ZHWH 4BAKB 1EAXA 4UE7H 1FN6A 2HNTE 4AFSA 4X1SU 1NRSH 1P2IA 1AKSB 2H1UA 2CJIA 4IGDA 3SJKA 2NU3E 2AIPA 1D3PB 2GDDA 2W7SA 3E8LA 3MWIU 5KGOA 5EXNA 2O8TA 1O2WA 3GDSA 4U2WA 1F0UA 2BD8A 1OKXA 1V2RT 5GJ4B 2QXGA 1IHTH 2NU2E 1C5TA 4ZROA 2GVFA 4D76A 1ARCA 1NS3A 3W1EA 1A7SA 1PPZA 2F9VA 3MU4A 4AN7A 1DM4B 3O8CA 3VFEA 1GPZA 1EP5A 3KQ5A 2A7HA 4CR5A 3ZVFA 6GCHF 4TY6A 3OSYA 3EA8A 1MZAA 1AE5A 1F92A 4RT1A 1MD8A 3ZVEA 3T28A 1GDNA 1O3AA 3F2GA 4Y76A 1GHBF 1MTWA 4LOYH 5CMXH 2VIWA 3QZQA 5HGGA 2A31A 5G4BA 2ZI2H 1PPCE 2UWPA 3PV5A 2WUBA 1EZUC 3PO1B 4IW4E 2GCTC 3EA9A 2R3UA 2W6ID 3LGVA 2J38A 1AZZA 2JKHA 2FTLE 1EASA 2EI8A 1FUJA 3QK1A 3RMNH 2ANWA 3NZIA 3SGQE 3UTUH 1NN6A 5ABWA 3LONA 2QXIA 3GISB 1HJAB 1NY22 2HVXA 2WZQA 3BF6H 4JK6A 3B9FH 4FXGH 1HIAA 1TRMA 2BDBA 1Z8IB 2BVXH 2FZZA 2XNIA 1LPGB 4XDEA 1J9CH 3S9AA 1LQEA 2PGBB 2ZU4A 4AB8A 1OOKB 1BCUH 2Q6FA 3T26A 3F3BA 1GHYH 2EQNA 2PP6A 1C5YB 2ULLA 3E3TA 1CHGA 2A32A 1YP9A 2BMGB 1L1GA 1P2MA 1TX6A 2M5TA 4JYVH 5JBAS 2YNAA 1SGCA 1T7CA 1WSSH 2IJD1 2CGAA 4X1PU 1LKBA 1BB0B 5DPAA 3LIWA 1RS0A 1KYNA 4X2VA 2ZHDA 4ZKOU 1RRKA 5L30H 1KLJH 1HAXB 1TPAE 4O3UA 2ASUB 2C4FH 3FO8D 3Q3YA 1O2UA 5F6MA 1O39A 2ANMH 2DE9A 3BIUH 3ODDA 1XUIA 1E79D 1Z71A 1EATA 5AFZH 6CHAB 2FX4A 4UD9H 3RXVA 2JDID 2B0FA 2A7CA 3RXIA 4MQAA 4TYDA 1BMAA 1Y8TA 4ESTE 1V6DA 4ABDA 1UTPA 3ODFA 1C1QA 3MMGA 4RKJB 1DFPA 2AS9A 5EJLA 2XBVA 3CNRA 2F4LA 3UWJH 1KSNA 1PPGE 3K2UA 2V3OH 3SJ9A 1SOTA 5EJ1A 8GCHG 1F0SA 1TONA 1J8AA 1OX1A 1C5MD 2BLVA 1WCZA 4QT8C 1TX8A 1M9UA 1GL0E 1QB9A 3PMAB 3QGJA 2BOHB 3F0PA 3KQEA 4MVNA 1BMMH 2QE7D 4ZXYH 3QUMP 3VB4A 5TJXA 1ELTA 2J98B 4NWLA 2XBYA 3URCA 3ZZAA 4X6MA 1EB1H 2ZDVH 1QRZA 4X8TH 1JRSA 2Y7XA 2PKSB 3VG8A 2JJ2D 4ISLA 4ABJA 4X2WA 1ZTLA 3RU4E 2CK3D 3HGNA 4YM9A 1UVOA 1C9PA 2FDAA 4JCNA 4DURA 1MQ5A 3SBKA 1P57B 4HTCH 2KX4A 5GPIB 2ANKH 4ABIA 1QB1A 1HFDA 2L74A 2F9BH 5L2ZH 3Q3XA 1EZXC 4A92A 1V2TT 1P02A 4YT7H 1J17T 4J1YA 1F5KU 3MNBA 3K65B 1ZJKA 1HDTH 4GHQA 5ESBA 1XUJA 1TGCA 3UREA 3LT3A 3SJOA 1QNJA 2ZU5A 1TNIA 1P01A 1CSOE 4Z6AH 3I29A 1ESAA 3O8BA 1TMBH 2XRCA 1GWAA 2J9NA 1BUIA 5JBCS 1FI8A 1BOQA 1Y3VA 3HKJB 1WTHD 1S85A 3RXQA 2IOTA 4ABHA 4E06H 7ESTE 1AY6H 1CBWB 1GJ4H 3UQOA 2Z9JA 2Z94A 3MO6A 2WPMS 1EQ9A 2BY7X 1SQAA 1GHWH 1EXFA 3DSOA 5FBEA 1AZ8A 3Q76A 2BY5X 3STJA 2ANYA 1XM1A 5LH8A 2M2AA 3PV2A 1GBBA 1DITH 2CF8H 1G37A 4K1TA 2CHAB 1GHAF 1ZRBA 4H6SB 1A46H 1X7AC 2UUKB 2I6QA 1C2LA 1C1OA 3GCTG 3VPKA 3TU7H 3TJUA 3MO9A 1OSSA 2JETC 2CN0H 1DXPA 1LCYA 1V2VT 2P8OC 1ETTH 5FPYA 1ZPCA 1TNHA 1O33A 4AX9H 2J95A 1UVSH 1YC0A 1OWIA 1T4UH 1MD7A 5C0UA 1LVBA 1HAGE 5A0BA 1DUAA 1B7XB 4JYUH 3SU6A 5DP4A 1VGCB 1AWFH 3ZZ7A 3GY3A 5DP9A 3BTME 2OCVB 1GI0A 4UEHH 3RXRA 2QCYA 4I31A 1LO6A 3OY6U 4BAQB 4D9RA 1UCYH 1MCTA 1DX5M 1KXCA 2A45B 1S6LA 1EJMA 5DP5A 9ESTA 2EI6A 2F9NA 3EE0B 1GL1A 2GX4A 3OX7U 1A2CH 1RXPA 2PSXA 2ZWLH 2K8IA 2ODPA 3TK5A 3I78A 1TFXA 2HRVA 1ID5H 1SHYA 1CT0E 1ZSJA 2BDIA 4Q7ZA 3LH1A 4UFGH 3N99A 1BTUA 4AOQA 1GI9B 2ZA5A 1V2PT 1PQ7A 1SQTA 2AFQB 2J97A 1IQLA 2G51A 2F43B 3ITIA 1O2NA 2Z9IA 3EDXB 4CRAA 1V3XA 2HALA 3GCHB 3NK8A 1HAZB 3RLWH 1BBRE 3M37A 5CHAB 1UW7A 1BMFD 4I8HA 1MU6B 2FESH 3OEHD 1AD8H 5F53A 3RXLA 1V2NT 4F49A 2AGGX 2ZGXH 2D1JA 1IQKA 1YLCA 2C8XB 4X8VH 1VJ9U 2BHGA 1BBRK 1UK2A 2SGAA 3E0NB 2HNTC 2Y5GA 3ATLA 1C2FA 1GJ9B 2AH4X 3GOVB 2WPDD 1T8LA 1UO6A 3LOXA 2FWWA 1P3EA 4GAWA 6ESTA 2KCOA 1TMUH 2FOBA 2XC5A 1EJAA 3OYPA 5T3HA 1NM6A 1QR3E 5FCRA 1TPSA 4AGKA 1O2YA 3SNAA 2HWLB 1K1PA 1BTHH 1CVWH 2QF5A 3BEFB 3V3MA 1C1VH 2GP9B 3LGYA 3SU3A 1LHEH 2ZGBH 1NFYA 4WH6A 1V2ST 1INCA 4FUHA 3CP7A 3W95A 1WDIA 3PRDA 2SGEE 3V12A 2UWLA 1IQMA 1ORFA 1ZGIA 2PKSC 4K60A 2G5VA 2ZIQH 2VH0A 1QBVH 2A5KA 3F6UH 1YPEH 2BDHA 1D3TB 1TQ0B 4MTBA 4ACAA 4YLUA 3TLOA 3DHKH 3ZVDA 3RDZA 1NBME 1SQOA 2PTCE 1O31A 5CHBA 4DOQA 2ZU2A 1DWEH 1GVZA 3HK3B 1WBGB 4GLYA 4CREA 4OS4A 1HB0B 4YO9A 4THNH 2AEIH 1BRBE 1H9IE 1FNIA 3DFLA 5F8XA 1DLKB 1CT4E 2SGPE 3PM3A 3BTFE 2OBOA 1A3EH 1SGDE 2W26A 3RXSA 1C4V2 3UWIA 1AFEH 5DO4H 4X1QU 2GMTC 1FQ3A 2Q6DA 4K5ZA 1MKWK 3GS9A 1UVPA 3AW0A 1U6QA 4TWWA 4MLFB 1BJVA 2FI3E 2YMSB 2GCTB 4FUGA 1BTWA 4NFFA 1SBWA 5ETXA 5HIYA 3RP2A 8ESTE 1YPHE 4XSKU 1CBWC 2OC0A 1TRYA 1AFQC 1WOFA 1C2DA 7LPRA 3SV9A 1P04A 5T6GA 2O8WA 3TJVA 1SGTA 2W3KA 1P2QA 3A87A 2RFKC 1MTSA 2PLXA 4WXIA 1NT1A 3STIA 3MNCA 9LPRA 2V0BA 1SGIB 4Y10E 3TPIZ 2STAE 2CHAC 3FP7E 1MBQA 3RXUA 2ZFQH 1UTQA 1EZQA 1RTLA 1YCPK 1YPLH 3OY5U 4OM9A 1S0RA 4AG2A 2L6OA 3AK5A 2XBXA 1ZJDA 3FZDA 2GDEH 3RU4D 2ZHQH 1GGDC 1N6YA 4JYTA 3IITA 5A8XA 1P9SA 5JBTA 2WINI 1K0HA 2VIDA 4NGAH 1GI2A 3EA7A 1C1UH 1O2VA 1BMNH 1QL9A 1FONA 1ZMJA 2BQ6B 3HGPA 1DWCH 4WF8A 3HATH 3UOPA 1O5AB 5CDFE 2J94A 1RD3B 1SGPE 2PHBA 5T6DA 3C27B 1DDJA 3KF2A 1YLNA 1SGRE 2WPJS 3KYGA 5K0HA 4BTUB 1VGCC 5JBBS 2ZHEH 2TGTA 3BV9B 3GDVA 1QBNA 2GGVB 3U8RH 6GCHG 3DUXH 4I8KA 2VU8E 1HBTH 1ZLRA 1EZSC 5BRRE 2QXHA 1AUTC 3ENSB 2P93A 1LQDB 2HLCA 1T8OA 2WPLS 1K1NA 3U8TH 1GHBG 2DE8A 3A7XA 2HVYB 2PR3A 1WV7H 1TWXB 2ODYB 1O3FA 3F2FA 5EXLA 2FOAA 3ZZDA 3UFAA 1FMGA 2WPKS 3M7QA 3BIVH 5HYOA 1ELGA 3Q3KA 5E2PA 3L3TA 2SGDE 5EPYA 5FPTA 1W12U 2G4TA 1MZDA 4P02A 1H4WA 5TCCA 3ATMA 1N6XA 4O03A 8KME2 1P0SH 1K28D 3OTPA 2ZZUH 2A0QB 1THPB 1K22H 2FOEA 2V3MA 4Q2KA 3S0NA 2SNWA 4X1RU 4Q7YA 1JMOH 3SORA 2FP7B 4O9VA 3UNSA 3O8DA 3WW7A 4IC5A 2P16A 1COWD 4Y8ZA 3S7KB 4GUXA 3KCGH 1MAXA 3PB1E 4OS7A 3PMHB 1TE0A 3PV4A 2KM0A 4Y0ZE 1G2MA 1C5RA 2TGAA 1YPMH 2VNTA 1C9TA 2LELA 1EOJA 1SLXB 2YMSD 4IN1A 3P8OA 3UNRA 5JB8S 4YLQH 1GBJA 5FXLA 2Z9LA 2G5NA 3N7EA 1W10U 2ZDKA 1ZTKA 1C2HA 1O2PA 3F9FA 5E2OA 4AG1A 3TNTA 1O3IA 4DJZB 1GI3A 2KCYA 5IYTA 1YKTA 1XKAC 2R2WU 1BMLA 2SFAA 2W6JD 1Y5BT 2BZAA 2BX4A 3DSGA 3PRBA 3QWCH 1W3CA 2J2UA 1MKXH 1FIWA 3SHCH 1GI6A 1V2OT 4AB9A 2VIQA 3F9GA 4D8NA 4GCHG 4IMQA 1GBMA 3TK6A 5F03A 1HCGA 5C94A 3SHAH 2VBCA 3SUDA 8LPRA 2RA3A 2JETB 1TGBA 2V7QD 1O3MA 1H1BA 2XTTB 5GDSH 2VWOA 2D2DA 1QA0A 3P6ZB 2P8OB 2J98A 1DICA 1O3NA 3E6PH 3SUFA 5FX5A 4BAMB 1Y3YA 2GZ7A 2VJ1A 4LXBH 3TK9A 1BHXB 5E0GA 2FMJA 2QYIA 1ZPZA 3GY5A 3GCOA 2YMSC 1O5FH 1FLEE 1O3HA 1DT2A 4OS2A 3QZRA 4JZFH 3UR6A 3UOUA 2ZHFH 1HAPH 3SZNA 1O5CB 4KTUA 3WY8A 1EAUA 1MABB 4XFQA 4B2BA 3RM2H 3PMJA 4GHTA 1C2EA 1QB6A 3GY4A 3RXPA 3T2NA 4MPVA 3SV2H 3GYLB 5IK2D 5L2YH 3PROA 2KR7A 4B6FA 5C67A 1QQUA 1UTNA 2PFEA 4ASUD 1JIRA 2PUQH 1VCQA 2ZDLA 1IHSH 2G55A 3VB6A 1BT7A 1TALA 4X6PA 5EJZA 4FU7A 1BTZA 4FUDA 4LZ1H 1NRQH 4NIVA 3SJ8A 2FYRA 1V2QT 3T25A 1IQGA 1NRPH 1G36A 2BDCA 5HXFA 1E1RD 2C8WB 3P95A 5E0HA 7GCHF 3V13A 2RDLA 3TGKE 3AW1A 5GIBA 1CT2E 3UB0A 1W0KD 5HKKD 2A7JA 1BHXF 5C3NA 1SC8U 1QURH 3LJOA 1O5BB 1ETRH 1ZRKA 1SQRA 3MO3A 1O34A 3FKSD 1K1JA 4BAHB 3FFGA 2VVCA 5DSFA 1EX3A 1MAYA 5BPEA 3SNDA 1V2LT 1CA8B 1HGTH 5B6OA 4FUEA 3SV8A 2BDYA 4NSYA 4XBBA 1GHAG 1RTKA 1E36B 1XUFA 2O9QA 5C17A 1AU8A 2XWAA 1FN8A 1LVOA 2PTNA 1O2HA 2D8WA 1IQEA 4FOUC 1JBUH 1ELFA 3A86A 3BTKE 1THSH 2WPHS 1D6RA 3PLBA 1C5NH 3SZEA 1O2SA 1C5UA 1C2KA 1IOEA 2VVUA 5HIZA 4X0WU 4CBNA 2PV9B 1C1MA 3D65E 1RGQA 1S84A 1MU8B 2KAIB 2ZPQA 3ZZ3A 1P3CA 5A2MH 2BOKA 1HAIH 4ZCNA 2FX6A 4ISNA 4KTCA 1JRTA 1O2RA 4A1XA 2OBQA 3SV7A 3TH4H 5EQSA 1G2LA 4FVDA 1VZQH 4AGJA 4IN2A 3RUOA 1DY8A 1A3BH 4WXVA 4ABEA 3N7DA 5C1YA 1GJ5H 1F0RA 1UMAH 1GMCG 1D9IA 3NWUA 2HNTF 1OP0A 1DPOA 1HAHH 2XYAA 3A8DA 5EGMA 4CRFA 2V35A 3JZ1B 3BG4B 1ANDA 1H8HD 1UCYK 1QCPA 2ALVA 2P3FH 1YPJH 1ZR0A 3SYJA 3A7TA 1NRNH 4CH2B 2G52A 3M35A 4MNWA 2VIOA 2VIVA 4U32A 4OS5A 2ZQ1A 1XUGA 1TB6H 1YF4A 4RT0A 5HM9A 1YPKH 2GMTB 3BN9A 1FJSA 3BTEE 2TGDA 3NRLA 3P8FA 3VB5A 2IN2A 4Y71A 4YTAA 1BTPA 1G32B 1UK3A 5C1UA 1FPCH 3UQVA 1AFQB 2VWNA 3A7WA 1TABE 5EIYA 1AIXH 1Z6EA 2IPQX 3KQDA 2F9OA 3Q77A 2BB4A 2PKAB 1IQJA 1GBHA 1IQFA 2WYGA 2GV7A 1YGCH 2ZTXA 3SNEA 4BTIB 3H7OA 2OQ5A 3PTBA 3S69A 1FZZA 5T6FA 4YT6H 3M5OA 3TNSA 4DT4A 1O2LA 2EA3A 1YLDA 2GKVE 4MPXA 1XUHA 2PUXB 5B6LA 2Y6TA 3K6ZA 1T8NA 2O8UA 2FOGA 1QGFA 3SI4H 4A1TA 4WMFA 1GGDB 3E90B 3P70B 1Z7KA 1J15A 4HFPB 3SO3A 2NU4E 1UHBA 1ABIH 4WVPE 1Z8RA 4WWYA 5DJ7A 3UPEA 2ZGHA 3M3VA 4LZ4B 3KYFA 4I8GA 1EP6A 3VB3A 3M3SA 4I8JA 4Y7AA 5EQRA 2STBE 2JH5D 4M9FA 5L6NH 2FEQH 1GDQA 1FXYA 5LPEA 1DWBH 2QIQA 2LNCA 1HXEH 2ZPSA 4TPYA 1TIOA 2BD9A 1SLVB 2DUCA 1E35B 3LH3A 1EUFA 3FP6E 4ZHLU 1CA0C 4AORA 1O38A 4KKDA 1C1RA 1O3LA 5I25A 3SNBA 4IBLH 1PQAA 1TRNA 1LVMA 1GI8B 1HNEE 1MQ6A 4FUCA 3SQHE 3GY8A 2XC0A 2GCHF 3A8BA 2C8ZB 3URDA 1THRH 3DD2H 1OWKA 2HPQH 4DW2U 4NZQA 3UIRA 4X6NA 1LPKB 1O36A 1BZXE 2HGTH 1AMHA 1TBQH 2ZG0H 3MOCA 1OWDA 4JZIA 2Q1JA 3Q00A 1F5RA 4H42U 3KNXA 2AMQA 3T27A 1LHCH 3F9HA 2H9HA 1SMFE 1O2TA 3ZVGA 2PW8H 4D7FA 3A7VA 1PQ5A 3WWFA 5EXMA 1C5ZB 3P92A 1BTXA 1VCPA 2P3TB 3OU0A 4WMDA 1O2IA 3RM0H 2TBSA 2NU0E 4P00A 2F9UA 2WUCA 1C1SA 1GG6C 1AVXA 3OEED 4HG6A 5DP3A 1FV9A 4CHAC 3MH5A 1W8BH 1NZQH 1Z6JH 2A4OA 1GJ6A 2Y80A 4BAOB 4YXWD 1SOZA 3T5FH 1UVTH 2C8YB 4DY7B 1O2QA 4VGCB 2ZGCA 4K2YA 2IPHA 2TRMA 3KL6A 3NPSA 3LC3A 2W5EA 4WMEA 4K3JA 2G00A 2JH0D 4H4FA 1PPHE 4X6OA 3E0PB 1TNLA 2QGRA 3AASA 5DP8A 2TIOA 1K1LA 2VVVA 2OC7A 3RXCA 4NIWA 1T31A 1YWUA 3QDZB 3KEEA 2GT8A 1C5XB 1CHOG 1EFRD 2A5IA 1P2JA 4H6TA 4CRGA 2VB0A 2EC9H 3CS7A 3EYDA 2EI7A 1TMTH 3RC5A 1DE7H 1SFQB 2K0QA 1OWJA 4U30A 4NIXA 2QN5T 3NCLA 1O3DA 2FIRH 2SGQE 4ISHH 1H8DH 2FS8A 1UTMA 4BXSA 1GJ8B 2FS9A 4BANB 1GHVH 2FOFA 1WQVH 4CRCA 1AN1E 5JPMH 2BQWB 3FOAA 5DP6A 4Z0KA 1KLTA 1KDQA 4DIIH 1KXBA 1TA6A 1Y5AT 1ANCA 1B0FA 4NZLA 1W0JD 1KLIH 1TYNA 1B5GH 3BG4C 1ABJH 4BOHA 1DANH 1H8IH 1NFUA 1HAOH 1CQQA 3IWMA 4YOGA 1B0EA 1C5PA 2G4UA 3WWBA 1AHTH 2XC4A 3LGUA 2Z3CA 2ZFPH 5H4IB 3MFJA 1A5HA 1L1JA 2Q6GA 2AYWA 4WH8A 1C1PA 2GD4B 1W2KH 2AGEX 1C5LH 3TJNA 1C1WH 4FU8A 3VGCC 5C1XA 4JZDH 4I33A 3TH2H 1OYQA 3GICB 2H9TH 1O30A 4D9QA 1YBWA 1EB2A 4YOIA 2ZNKH 5LPRA 2BLQA 4NFEA 1PYTD 2W3IA 1P05A 3GY6A 5EW2H 1ZGVA 1PPEE 1G9IE 1SVPA 2OK5A 3MU8A 3PTNA 1MMJN 2BDGA 1VITF 4SGBE 2H2ZA 1LTOA 1QRWA 3HPTB 4AYVB 2ZF0H 1DY9A 1TBRH 1Z1JA 5C0TA 1AKSA 3T29A 1C5QA 1F0TA 2AIQA 4R0IA 3ZZ9A 4E7RG 1GJCB 1FY8E 3PLPA 3BSQA 1XVMA 3H7TA 1O0DH 2ZU3A 1GI4A 3ZZ8A 2ZTZA 3SI3H 4FUJA 2GZ9A 1TGNA 3SGBE 2FPZA 1WU1A 4B1TA 2BY6X 2AMDA 4JMYA 4ABBA 3D23A 2GZ8A 1ELBA 3VEQB 2P95A 1CE5A 2UUYA 1GMDF 1QBOA 1BQYA 2XXLA 3TGJE 2FI5E 2ZC9H 4F4OC 1NROH 1YY3A 1S5SA 2P94A 1TLDA 3M5NA 3OTJE 1WTGH 2B9LA 3MU1A 3ZYEA 1A5IA 4X1NU 3OAAD 2QA9E 4ZXXH 1K1MA 4IC6A 4OS1A 3ZV8A 1AUJA 1GCDA 2JJ1D 4INHA 1CGIE 2HLDD 2TPIZ 1NO9H 2FOHA 2Y7ZA 1QRXA 1PYTC 2BTCE 1MBMA 2FYQA 2A1DB 3NUMA 1JOUB 3AAUA 1CGJE 1MKXK 2ZFFH 1KXAA 3TJOA 1A61H 1O35A 3A85A 4UONA 4ZMAH 1Y3XA 2ESTE 1W7GH 4LK4A 2ZDMA 2BX3A 4ZUHA 1ANEA 1IQNA 3ESTA 1LPZB 1O2JA 4WY3A 4FETA 1A0LA 1QL7A 3A7YA 1MTNC 2UUJB 5EOKA 5DG6A 1GVKB 1KTTB 1VJAU 4XBDA 4ABAA 5A0AE 1F7ZA 1D6WA 4XBCA 1PJPA 5C2ZA 3A80A 1L0ZA 2A4RA 5LPFA 4XOJA 3A83A 1W14U 4MPUA 1FPHH 3M3TA 1ELDE 1RJXB 2H5DA 4TPIZ 3K9XB 2C93B 1KXFA 2QAAA 3U1JB 3U8OH 1OP8A 1O3EA 4Y79A 1NFXA 3F9EA 2EY4C 1E38B 1HLTH 4YZUA 1GJDB 3RMMH 2ZQ2A 2Z9GA 4HI3A 5FPSA 1O5EH 1DOJA 2OINA 1OPHB 4UFDH 3KN2A 1O2OA 1BDAA 4VGCC 4Z1MD 1GI7B 3FAOA 1NPMA 2WSSD 2A4QA 3AAVA 1AGJA 3D62A 1XXDA 1XUKA 1WYKA 2GT7A 4DVAU 4A6LA 3ATKA 1HXFH 3LKWA 4K1EA 4RSPA 1ELEE 1QQ4A 1IQIA 3MH7A 4X8SH 2QF4A 1BA8B 4Q63A 1OYTH 1A0HB 1GBCA 1P2KA 1ZSKA 1SR5C 5GWZA 3SUGA 3A81A 1K1OA 2TGPZ 2ZU1A 2QF0A 2CXVA 4I86A 4CR9A 3UNQA 1HYLA 1O37A 3P17H 1UVUH 3RXGA 2BY8X 2KCPA 1EPTB 2FLRH 4HZHA 1C1TA 1E37B 1K21H 1S6HA 1TAWA 2BVRH 3G01A 1HAVB 3M5MA 5EW1H 1SSXA 4ZKSU 1V2MT 1OHHD 1SGFA 4K1SA 1P12E 4AYYB 3CS0A 1SHHB 1LVYA 1UTOA 2XBWA 2NWNA 2W7UA 1ELAA 2Z6BD 3MYWA 1K9OE 2ODQA 4O3TA 2KAIA 3L6PA 2B7DH 3ATWA 2CV3A 1VCWA 4BTTB 5A09A 1FY5A 1QIXB 4D7GA 4Q4LA 4AFUA 1XXFA 2CMYA 3RXDA 1S83A 4TWYA 2ALPA 1SFIA 3SU1A 1EAWA 3RXEA 1QJ1B 2FM2A 2GV6A 2BM2A 2Y5HA 3BTHE 5AHGH 4B71A 1EOLA 2ZDAH 2Z9KA 1HJ9A 2BXUH 2YOLA 3EGKH 2ZDNA 1E0FD 1TOCB 3U28C 4OGYA 2OC1A 1L4ZA 3ZZ4A 2PGQB 1O2KA 3LGWA 3GY7A 1GCTC 1C2IA 3RMLH 1CA0B 3TH3H 1W0ZU 2OXSA 2QC2A 4NWKA 2ZGJA 1GBIA 3ZYDA 3MTYA 3LGIA 2JIZD 2ZCHP 1EJNA 4OGXA 3SUEA 2XNDD 2QXJA 2WPIS 2SNVA 3U9AH 5I46H 3A82A 1OS8A 2EEKA 4JK5A 4ACBA 4E7NA 1SGFG 5DP7A 1DWDH 1D3DB 1MTUA 3F2HA 3M7TA 4HGCA 3SJIA 3ZZBA 1P03A 4AZ2B 3KHVA 5DK1A 1WQSA 2J34A 2THFB 3FN8A 4DG4A 4I8LA 1GMHF 3EAJA 1FDPA 4AFZA 3HK6B 3FZZA 1O3PB 6LPRA 5J4SA 1PFXC 2BY9X 4DIHH 5HMAA 1NBMD 1NTPA 3SU2A 1UJ1A 2WHXA 2BXTH 2PKAA 5GCHF 1QJ6B 1XMNB 1FY1A 2XCNA 1T8MA 2Z3DA 1OWEA 4FUIA 5E0JA 2G8TA 1MTVA 1FX0B 2WYJA 2R9PA 1Z1IA 5AFYH 1HAYB 2BLWA 3A88A 2A4GA 1AE8H 1GG6B 4ISIH 2R2MB 4CHAB 4GVUA 4X2XA 2H9EH 5KECA 2OP9A 3BEIB 3MNSA 4AFQA 1C4U2 3ZZ6A 1KMHB 1O2MA 1TA2A 3SU0A 3SW2B 1ACBE 4KGAA 2ZKSA 5DN6D 2ZFRH 1ZPBA 1DSUA 2LPRA 3KQBA 2B5TB 1AB9C 1LHFH 1ETSH 3OFND 1V2KT 3RXJA 1A1RA 1FAXA 3M5LA 1ZMNA 3MHWU 1Y5UT 1ESBA 1C2MA 2AGIX 1OWHA 2UUFB 4B74A 4M7GA 2Y81A 1T32A 2A2QH 2F91A 3KQCA 2ZFSA 2RCEA 4B6EA 3O8RA 3BG8A 2Z7FE 4IS5A 1TBZH 1QTFA 2VH6A 3U98H 5ESTE 2OLGA 3BTGE 2H5CA 1QA7A 3S9BA 4FUFA 2ZTYA 4PROA 4GCHF 3T62A 3V7TA 4ZKNU 3ZIAD 5A0CA 5TCAA 1ANBA 4YOJA 1ZTJA 4KP0A 3RXFA 2RDEA 5EPNA 3GDUA 1UCYE 4MNXA 5EU8A 1A5GH 3RC4A 4JZ1A 1P06A 3ZZ5A 3QLPH 3U1IB 5JDUB 2BLOA 2GCHG 1GBTA 3S7HB 3TGIE 1SGEE 1VKYA 2P3UB 1LMWB 1J16A 1L2EA 1JIMA 1GI1A 2XW9A 2C3SA 2LP6A 1GVLA 1YCPM 3ZVAA 2XWBI 1O3BA 1YPHC 1NESE 3QX5H 1HPGA 3E91A 3LDXH 1W11U 1Q31A 2QY0B 4Q7XA 3UR9A 1LDTT 5DKMA 3VXFH 1ZMLA 1O5DH 1K1IA 3LPRA 4E05H 2F3CE 1TGSZ 1LKAA 5C20A 3RU4T 2OQUA 3PWBA 3TITA 1SL3A 3VGCB 1HIAB 1YM0A 2KFWA 3QO6A 1WAYB 4NG9H 1C5SA 1GBLA 2OC8A 3LC5A 5EG4A 2AHME 4K8BA 3MH4A 4FU9A 1H9LB 1FY3A 1SI5H 4CH8B 4A5TS 2I6SA 1KTSB 1BITA 1EPTC 1NRRH 4Y6DA 5IDKA 3NKKA 3SGAE 4FUBA 1V2JT 2FO9A 1UTKA 1CU1A 1E1QD 3D49H 4ZHMU 3RXMA 2PWXA 4BNRA 1D3QB 3N7OA 2QV1A 4Y7BA 4B75A 4MNVA 1FAKH 1JXPA 4RKOB 3RXHA 5JB9S 2NU1E 2ZFTA 1F5LA 3UAIC 2XCFA 1J14A 5DGJA 5F8TA 1O3OA 1IQHA 1XX9A 2K1QA 4CRDA 5AF9H 2J4IA 4B2CA 1RTFB 1O2XA 3CENA 1O3JA 3MI4A 1C1NA 1Y3UA 3SU5A 1C4Y2 1DUEA 2SGFE 1ZOMA 1S82A 1BJUA 1MUEB 1SPJA 1PPFE 4J2YB 2HOBA 1XVOA 1ZHPA 4RN6A 4ZHAA 1O3KA 2A5AA 5C5OA 4BXWA 1KXDA 3QGNB 8GCHF 1TQ7B 2O8MA 4AC9A 4MPWA 1G3BA 2R0KA 3EE7A 1N8OB 3M61U 4NIYA 3VXEH 1AI8H 4CRBA 1T4VH 2BVSH 1OP2A 1ZYOA 3ELAH 2VGCB 3PO1C 2ZECA 4YESB 3SQEE 2RA0A 2O8LA 3FVFB 3GCNA 2C90B 1O5GH 1V2WT 2AMPA 3VB7A 4ZH8A 1SGQE 3BTWE 2IJOB 1YPGH 1SKYE 1MTNB 3P8NA 1AWHB 1SGNE 1XKBC 4U01A 1KXEA 1HJAC 1Q3XA 2BQ7B 1KY9A 1ARBA 1HJ8A 2Z3EA 1GMCF 3TVJB 2R3YA 3B8JA 4ZKRU 3SNCA 2A2XH 1SGYE 3HKIB 3L33A 3MQKC 2KCAA 4ASHA 1S81A 1ZSLA 1O2GH 4B76A 1P09A 4I32A 1L1NA 1G3EA 3PWCA 1RIWB 1S6FA 2BYAX 2FOCA 1TNJA 1VITG 1MH0A 3A8CA 4B2AA 5EQQA 2Y5FA 5T1VA 1OXGA 2WV4A 4CBOA 1TNGA 1O2ZA 2BD5A 3UUZA 2HPPH 3H09A 1DS2E 5PTPA 1QFKH 2XOKD 3RLYH 1GBFA 1GHZA 4MG3A 5FBIA 4ZAEA 1C2JA 1ZHRA 1P2NA 1FIZA 2VIPA 1H8ED 1TOMH 3BTDE 3DA9B 4DT7B 3PYHA 1NU9A 3ZVCA 5EODA 3K6YA 3IG6B 1PPBH 4Y8XA 6CHAC 1BRAA 2BD7A 2BDAA 2BZ6H 2H6MA 4Q80A 1GMDG 2FTMA 3ATIA 2R0LA 1QL8A 1G3DA 1GJ7B 1MCVA 2B8OH 3QTVH 2WV5A 1Q2WA 1KIGH 2RG3A 1DSTA 2GJGA 4X8UH 1W7XH 4RI0A 1GBKA 1SLUB 3GCTF 1EKBB 5F8ZA 3V0XA 1W0YH 2FOMB 4KTSA 4DCDA 1VITH 4KELA 3RMOH 1D4PB 5FAHA 2ZP0H 5FL7D 3RXOA 1A4WH 1UHBB 2KZ4A 1GJAB 1H9HE 3UY9A 2J5UA 3KIDU 1AVWA 1O3GA 2ZCKP 1AQ7A 5K7RA 3PMBB 2OTVA 3RXAA 2FLBH 1F2SE 5E8EH 5A8YA 5GNDA 4GSOA 1V2UT 2OUAA 2V3HH 1GDUA 3F1SB 3SU4A 5CE1A 1EAIA 1AO5A 3PLKA 1G3CA 4UDWH 3M7UA 3DT0H 3RXTA 2F83A 5KEDA 3FP8E 3SOSA 5A8ZA 2J92A 1TX7A 4UFEH 1SB1H 2ILNA 3P8GA 1GJBB 1P10A 3MH6A 1TNKA 1GCTB 2CF9H 4DGJA 3C1KA
chains in the Genus database with same CATH topology
4K8YA 2G81E 3QTOH 2AERH 1ELCA 1GI5A 1Z8JB 4NA7A 3B23B 2JH6D 2ZO3H 1ZZZA 5C5NA 4ABFA 4INKA 3H5CB 2P59A 1N1LA 1DXWA 1QY6A 4R8TB 4UFFH 3S9CA 1GHXH 1BTYA 1CGHA 1BBRH 1CO7E 1HV7A 2YNBA 1Y59T 1L4DA 3LGTA 2ZCLP 5JYIA 1P2OA 4Y11E 3GY2A 1LHDH 5J4QA 1PQ8A 1TGTA 2PSYA 4FVBA 3LJJA 1SLWB 3I77A 1C2GA 3F68H 1VR1H 3TIUA 1ELVA 1NU7B 1K2I1 3ZVBA 1Z8GA 1TPOA 3FANA 3JZ2B 3NXPA 5LGOA 1SG8B 3SV6A 1NC6A 2ZEBA 1NFWA 1EPTA 1GBDA 3GYMA 4MDSA 3KGPA 1HAVA 1C5OH 3DFJA 1YYY1 3E1XB 5FCKA 1AVGH 3AVZA 1O32A 2VWMA 2FI4E 1AB9B 4OS6A 1C5VA 1N8OC 1CHOF 1GBEA 2VWLA 1HUTH 1C5WB 1JWTA 4X2YA 3A84A 2OD3B 1BRUP 2VGCC 4TY7A 3SN8A 4K69A 1ESTA 2F9PA 4GPGA 3MU0A 3ZV9A 1O3CA 1P9UA 1DVAH 2VINA 4NSVA 4NA9H 4Y0YE 1Y3WA 4B73A 5GXPA 1A0JA 4ABGA 1BIOA 4NA8A 1P8VC 4MNYA 1IAUA 7KMEH 2FXRA 4SGAE 2BD3A 4JZEH 2QF3A 1W13U 2V6NA 1KDQB 3A8AA 4O97A 1GBAA 2UWOA 1G30B 3MU5A 4I7YH 1HRTH 1MKWH 3QN7A 1RFNA 3E16B 5FX6A 2BD2A 1BRCE 1UTJA 3A7ZA 3LU9B 2D26C 1RIWC 1E34B 4NCYA 5HM2A 2ZPRA 5FHTA 3A89A 2Y82A 3BEUA 3MNXA 1DLEA 3RXKA 1TPPA 3M36A 1QJ7B 4WJG2 3GCHC 1UTLM 5CHAC 1GMHG 1P11E 3W94A 5AVDA 1WUNH 4INLA 3BTTE 3RXBA 3U69H 4ISOA 4XE4A 3EQ0H 7GCHG 1FY4A 5GCHG 1YCPH 3R3GB 1ZHMA 3RC6A 1QHRB 3ZZCA 1UK4A 4A1VA 4A7IB 3BTQE 5SGAE 1LHGH 2FODA 2BD4A 1S0QA 2GTBA 3R0FA 4Y8YA 4IMZA 2ZHWH 4BAKB 1EAXA 4UE7H 1FN6A 2HNTE 4AFSA 4X1SU 1NRSH 1P2IA 1AKSB 2H1UA 2CJIA 4IGDA 3SJKA 2NU3E 2AIPA 1D3PB 2GDDA 2W7SA 3E8LA 3MWIU 5EXNA 2O8TA 1O2WA 3GDSA 4U2WA 1F0UA 2BD8A 1OKXA 1V2RT 5GJ4B 2QXGA 1IHTH 2NU2E 1C5TA 4ZROA 2GVFA 4D76A 1ARCA 1NS3A 1A7SA 1PPZA 2F9VA 3MU4A 4AN7A 1DM4B 3O8CA 3VFEA 1GPZA 1EP5A 2A7HA 4CR5A 3ZVFA 6GCHF 4TY6A 3OSYA 3EA8A 1MZAA 1AE5A 1F92A 1MD8A 3ZVEA 3T28A 1GDNA 1O3AA 4Y76A 1GHBF 1MTWA 4LOYH 5CMXH 2VIWA 3QZQA 5HGGA 2A31A 5G4BA 2ZI2H 1PPCE 2UWPA 2WUBA 1EZUC 3PO1B 4IW4E 2GCTC 3EA9A 2R3UA 3LGVA 2J38A 1AZZA 2JKHA 2FTLE 1EASA 2EI8A 1FUJA 3QK1A 3RMNH 2ANWA 3NZIA 3SGQE 3UTUH 1NN6A 5ABWA 3LONA 2QXIA 3GISB 1HJAB 1NY22 2HVXA 3BF6H 4JK6A 3B9FH 4FXGH 1HIAA 1TRMA 2BDBA 1Z8IB 2BVXH 2FZZA 2XNIA 1LPGB 4XDEA 1J9CH 3S9AA 1LQEA 2PGBB 2ZU4A 4AB8A 1OOKB 1BCUH 2Q6FA 3T26A 1GHYH 1C5YB 2ULLA 3E3TA 1CHGA 2A32A 1YP9A 2BMGB 1L1GA 1P2MA 1TX6A 2M5TA 4JYVH 5JBAS 2YNAA 1SGCA 1T7CA 1WSSH 2CGAA 4X1PU 1LKBA 1BB0B 5DPAA 3LIWA 1RS0A 1KYNA 4X2VA 2ZHDA 4ZKOU 1RRKA 5L30H 1KLJH 1HAXB 1TPAE 4O3UA 2ASUB 2C4FH 3Q3YA 1O2UA 5F6MA 1O39A 2ANMH 2DE9A 3BIUH 3ODDA 1XUIA 1Z71A 1EATA 5AFZH 6CHAB 2FX4A 4UD9H 3RXVA 2B0FA 2A7CA 3RXIA 4MQAA 4TYDA 1BMAA 1Y8TA 4ESTE 1V6DA 4ABDA 1UTPA 3ODFA 1C1QA 3MMGA 4RKJB 1DFPA 2AS9A 2XBVA 3UWJH 1KSNA 1PPGE 3K2UA 2V3OH 3SJ9A 1SOTA 8GCHG 1F0SA 1TONA 1J8AA 1OX1A 1C5MD 2BLVA 1WCZA 4QT8C 1TX8A 1M9UA 1GL0E 1QB9A 3PMAB 3QGJA 2BOHB 4MVNA 3KQEA 1BMMH 4ZXYH 3VB4A 3QUMP 5TJXA 1ELTA 4NWLA 2XBYA 3URCA 3ZZAA 4X6MA 1EB1H 2ZDVH 1QRZA 4X8TH 1JRSA 2Y7XA 2PKSB 4ISLA 4ABJA 4X2WA 1ZTLA 3RU4E 3HGNA 4YM9A 1UVOA 1C9PA 2FDAA 4JCNA 4DURA 1MQ5A 3SBKA 1P57B 4HTCH 5GPIB 2ANKH 4ABIA 1QB1A 1HFDA 2F9BH 5L2ZH 3Q3XA 1EZXC 4A92A 1V2TT 1P02A 4YT7H 1J17T 4J1YA 1F5KU 3MNBA 3K65B 1ZJKA 1HDTH 4GHQA 5ESBA 1XUJA 1TGCA 3UREA 3LT3A 3SJOA 1QNJA 2ZU5A 1TNIA 1P01A 1CSOE 4Z6AH 3I29A 1ESAA 3O8BA 1TMBH 2XRCA 1GWAA 2J9NA 1BUIA 5JBCS 1FI8A 1BOQA 1Y3VA 3HKJB 1WTHD 1S85A 3RXQA 2IOTA 4ABHA 4E06H 7ESTE 1AY6H 1CBWB 1GJ4H 3UQOA 2Z9JA 2Z94A 3MO6A 2WPMS 1EQ9A 2BY7X 1SQAA 1GHWH 1EXFA 5FBEA 1AZ8A 3Q76A 2BY5X 3STJA 2ANYA 1XM1A 5LH8A 1GBBA 1DITH 2CF8H 1G37A 4K1TA 2CHAB 1GHAF 1ZRBA 4H6SB 1A46H 1X7AC 2UUKB 2I6QA 1C2LA 1C1OA 3GCTG 3VPKA 3TU7H 3TJUA 3MO9A 1OSSA 2JETC 2CN0H 1DXPA 1LCYA 1V2VT 2P8OC 1ETTH 5FPYA 1ZPCA 1TNHA 1O33A 4AX9H 2J95A 1UVSH 1YC0A 1OWIA 1T4UH 1MD7A 1LVBA 1HAGE 5A0BA 1DUAA 1B7XB 4JYUH 3SU6A 5DP4A 1VGCB 1AWFH 3ZZ7A 3GY3A 5DP9A 3BTME 2OCVB 1GI0A 4UEHH 3RXRA 2QCYA 4I31A 1LO6A 3OY6U 4BAQB 4D9RA 1UCYH 1MCTA 1DX5M 1KXCA 2A45B 1EJMA 5DP5A 9ESTA 2EI6A 2F9NA 3EE0B 1GL1A 2GX4A 3OX7U 1A2CH 1RXPA 2PSXA 2ZWLH 2ODPA 3TK5A 3I78A 1TFXA 2HRVA 1ID5H 1SHYA 1CT0E 1ZSJA 2BDIA 4Q7ZA 3LH1A 4UFGH 1BTUA 4AOQA 1GI9B 2ZA5A 1V2PT 1PQ7A 1SQTA 2AFQB 1IQLA 2G51A 3ITIA 1O2NA 2Z9IA 3EDXB 4CRAA 1V3XA 2HALA 3GCHB 3NK8A 1HAZB 3RLWH 1BBRE 3M37A 5CHAB 4I8HA 1MU6B 2FESH 1AD8H 3RXLA 1V2NT 4F49A 2AGGX 2ZGXH 2D1JA 1IQKA 1YLCA 2C8XB 4X8VH 1VJ9U 2BHGA 1BBRK 1UK2A 2SGAA 3E0NB 2HNTC 2Y5GA 3ATLA 1C2FA 1GJ9B 2AH4X 3GOVB 1T8LA 1UO6A 3LOXA 2FWWA 1P3EA 4GAWA 6ESTA 1TMUH 2FOBA 2XC5A 1EJAA 3OYPA 5T3HA 1NM6A 1QR3E 5FCRA 1TPSA 4AGKA 1O2YA 3SNAA 2HWLB 1K1PA 1BTHH 1CVWH 3BEFB 3V3MA 1C1VH 2GP9B 3LGYA 3SU3A 1LHEH 2ZGBH 1NFYA 4WH6A 1V2ST 1INCA 4FUHA 3CP7A 3W95A 2SGEE 3V12A 2UWLA 1IQMA 1ORFA 1ZGIA 2PKSC 4K60A 2G5VA 2ZIQH 2VH0A 1QBVH 2A5KA 3F6UH 1YPEH 2BDHA 1D3TB 1TQ0B 4MTBA 4YLUA 3TLOA 3DHKH 3ZVDA 3RDZA 1SQOA 2PTCE 1O31A 4DOQA 2ZU2A 1DWEH 1GVZA 3HK3B 1WBGB 4GLYA 4CREA 4OS4A 1HB0B 4YO9A 4THNH 2AEIH 1BRBE 1H9IE 1FNIA 3DFLA 5F8XA 1DLKB 1CT4E 2SGPE 3PM3A 3BTFE 2OBOA 1A3EH 1SGDE 2W26A 3RXSA 1C4V2 3UWIA 1AFEH 5DO4H 4X1QU 2GMTC 1FQ3A 2Q6DA 4K5ZA 1MKWK 1UVPA 3AW0A 1U6QA 4TWWA 4MLFB 1BJVA 2FI3E 2GCTB 4FUGA 1BTWA 4NFFA 1SBWA 5ETXA 3RP2A 8ESTE 1YPHE 4XSKU 2OC0A 1CBWC 1TRYA 1AFQC 1WOFA 1C2DA 7LPRA 3SV9A 1P04A 5T6GA 2O8WA 3TJVA 1SGTA 2W3KA 1P2QA 3A87A 1MTSA 2PLXA 4WXIA 1NT1A 3STIA 3MNCA 9LPRA 2V0BA 1SGIB 4Y10E 3TPIZ 2STAE 2CHAC 3FP7E 1MBQA 3RXUA 2ZFQH 1UTQA 1EZQA 1RTLA 1YCPK 1YPLH 3OY5U 4AG2A 1S0RA 2XBXA 1ZJDA 3FZDA 2GDEH 3RU4D 2ZHQH 1GGDC 1N6YA 4JYTA 3IITA 5A8XA 1P9SA 5JBTA 2WINI 2VIDA 4NGAH 1GI2A 3EA7A 1C1UH 1O2VA 1BMNH 1QL9A 1FONA 1ZMJA 2BQ6B 3HGPA 1DWCH 4WF8A 3HATH 3UOPA 1O5AB 2J94A 1RD3B 1SGPE 2PHBA 5T6DA 3C27B 1DDJA 3KF2A 1SGRE 2WPJS 5K0HA 4BTUB 1VGCC 5JBBS 2ZHEH 2TGTA 3BV9B 3GDVA 1QBNA 2GGVB 3U8RH 6GCHG 3DUXH 4I8KA 2VU8E 1HBTH 1ZLRA 1EZSC 5BRRE 2QXHA 1AUTC 3ENSB 2P93A 1LQDB 2HLCA 1T8OA 2WPLS 1K1NA 3U8TH 1GHBG 2DE8A 3A7XA 2PR3A 1WV7H 1TWXB 2ODYB 1O3FA 5EXLA 2FOAA 3ZZDA 3UFAA 1FMGA 2WPKS 3M7QA 3BIVH 5HYOA 1ELGA 3Q3KA 5E2PA 3L3TA 2SGDE 5EPYA 5FPTA 1W12U 2G4TA 1MZDA 1H4WA 5TCCA 3ATMA 1N6XA 4O03A 8KME2 1P0SH 1K28D 2ZZUH 2A0QB 1THPB 1K22H 2FOEA 4Q2KA 3S0NA 2SNWA 4X1RU 4Q7YA 1JMOH 3SORA 2FP7B 4O9VA 3UNSA 3O8DA 4IC5A 2P16A 4Y8ZA 3S7KB 4GUXA 3KCGH 1MAXA 3PB1E 4OS7A 3PMHB 1TE0A 3PV4A 4Y0ZE 1G2MA 1C5RA 2TGAA 1YPMH 2VNTA 1C9TA 1EOJA 1SLXB 4IN1A 3P8OA 3UNRA 5JB8S 4YLQH 1GBJA 5FXLA 2Z9LA 2G5NA 1W10U 2ZDKA 1ZTKA 1C2HA 1O2PA 3F9FA 5E2OA 4AG1A 3TNTA 1O3IA 4DJZB 1GI3A 5IYTA 1YKTA 1XKAC 2R2WU 1BMLA 2SFAA 1Y5BT 2BZAA 2BX4A 3QWCH 1W3CA 2J2UA 1MKXH 1FIWA 3SHCH 1GI6A 1V2OT 4AB9A 2VIQA 3F9GA 4D8NA 4GCHG 4IMQA 1GBMA 3TK6A 5F03A 1HCGA 3SHAH 3SUDA 8LPRA 2RA3A 2JETB 1TGBA 1O3MA 1H1BA 2XTTB 5GDSH 2VWOA 2D2DA 1QA0A 3P6ZB 2P8OB 1DICA 1O3NA 3E6PH 3SUFA 5FX5A 4BAMB 1Y3YA 2GZ7A 2VJ1A 4LXBH 3TK9A 1BHXB 5E0GA 2FMJA 2QYIA 1ZPZA 3GY5A 3GCOA 1O5FH 1FLEE 1O3HA 1DT2A 4OS2A 3QZRA 4JZFH 3UR6A 3UOUA 2ZHFH 1HAPH 3SZNA 1O5CB 4KTUA 3WY8A 1EAUA 4B2BA 4XFQA 3RM2H 3PMJA 4GHTA 1C2EA 1QB6A 3GY4A 3RXPA 3T2NA 4MPVA 3SV2H 3GYLB 5L2YH 3PROA 5C67A 1QQUA 1UTNA 2PFEA 1JIRA 2PUQH 1VCQA 2ZDLA 1IHSH 2G55A 3VB6A 1BT7A 1TALA 4X6PA 4FU7A 1BTZA 4FUDA 4LZ1H 1NRQH 4NIVA 3SJ8A 2FYRA 1V2QT 3T25A 1IQGA 1NRPH 1G36A 2BDCA 5HXFA 2C8WB 3P95A 5E0HA 7GCHF 3V13A 2RDLA 3TGKE 3AW1A 5GIBA 1CT2E 2A7JA 1BHXF 5C3NA 1SC8U 1QURH 3LJOA 1O5BB 1ETRH 1ZRKA 3MO3A 1O34A 1K1JA 4BAHB 3FFGA 2VVCA 1EX3A 1MAYA 5BPEA 3SNDA 1V2LT 1CA8B 1HGTH 5B6OA 4FUEA 3SV8A 2BDYA 4NSYA 4XBBA 1GHAG 1RTKA 1E36B 1XUFA 2O9QA 1AU8A 2XWAA 1FN8A 1LVOA 2PTNA 1O2HA 2D8WA 1IQEA 1JBUH 1ELFA 3A86A 3BTKE 1THSH 2WPHS 1D6RA 3PLBA 1C5NH 1O2SA 1C5UA 1C2KA 1IOEA 2VVUA 4X0WU 4CBNA 2PV9B 1C1MA 3D65E 1RGQA 1S84A 1MU8B 2KAIB 2ZPQA 3ZZ3A 1P3CA 5A2MH 2BOKA 1HAIH 2FX6A 4ISNA 4KTCA 1JRTA 1O2RA 4A1XA 2OBQA 3SV7A 3TH4H 5EQSA 1G2LA 4FVDA 1VZQH 4AGJA 4IN2A 3RUOA 1DY8A 1A3BH 4WXVA 4ABEA 5C1YA 1GJ5H 1F0RA 1UMAH 1GMCG 1D9IA 3NWUA 2HNTF 1OP0A 1DPOA 1HAHH 2XYAA 3A8DA 5EGMA 4CRFA 2V35A 3JZ1B 3BG4B 1ANDA 1UCYK 1QCPA 2ALVA 2P3FH