2H1UA

Porcine pancreatic elastase complexed with metpheleuglu at ph 5.0
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analyses on intermediates in serine protease catalysis.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords MFLE
total genus 60
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2006-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2h1uA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2h1uA01
2F3CE 4JCNA 2BYAX 1D3QB 5HGGA 1ELTA 1LHFH 1YBWA 1A3BH 2BY6X 4JZIA 1AQ7A 3F6UH 4CH8B 1EOJA 4WVPE 3SJKA 1F5RA 1EZSC 3BSQA 1CHOF 3MNCA 3RXJA 3C1KA 1C1VH 1V2MT 4I33A 1GBMA 3GISB 1C5PA 1P3EA 1SGCA 3BIVH 5DP5A 1OWDA 3U9AH 1ANDA 4ISNA 2GDEH 3ESTA 2SNWA 5A8XA 3QGJA 4AB9A 3GCNA 4NA9H 4ZKRU 1QRZA 3U8RH 1CU1A 2CXVA 2BD4A 2EI6A 3FP8E 3ZZ8A 1C5UA 2NU3E 3O8RA 3M3TA 3BTKE 4Y8ZA 2A45B 1SGRE 3SJIA 4AGKA 3MYWA 3VB7A 2A5IA 2BY9X 2O8UA 3K6YA 1ELBA 1GBAA 1BTWA 1O2SA 4X1RU 3VB3A 4IC5A 4Y7BA 4WH6A 1BRCE 2BDHA 2PTNA 1C5NH 1ZOMA 4FU7A 1MQ5A 4GHTA 3DFJA 3QLPH 4YT6H 3GY5A 1HAVA 2XW9A 1D3TB 2UUJB 3PO1B 1O38A 3GYMA 1BB0B 3NPSA 2XTTB 1NS3A 1BBRE 3CENA 1BOQA 4VGCB 3ZVBA 2XNIA 4MQAA 1ANCA 3PMJA 1FIWA 4IN1A 1MBQA 4TY6A 4WF8A 2W7UA 1DSTA 4HTCH 4BOHA 1AKSB 1JOUB 1PPFE 3IG6B 2NU4E 2GCTC 1ARCA 3GY8A 2ODPA 2BDBA 4Q80A 2ZIQH 3A80A 1HJAC 4FXGH 2BD8A 2OC8A 1L1NA 1QHRB 1Y3WA 4MNYA 4MVNA 4WY3A 3BTQE 1O3PB 2ZPQA 4Y8YA 2FP7B 4ZXXH 2ZI2H 3D62A 4MNVA 1YCPH 3EGKH 1KDQB 1XXFA 4NWLA 1TX6A 3MH6A 3L33A 1BRAA 4GUXA 4AYYB 2PGBB 1FY3A 2QXIA 4OGYA 1O5DH 1OS8A 3H7TA 2SGQE 2ZTZA 4LXBH 3RXGA 2W7SA 2FODA 1ZRKA 2W5EA 3ATMA 2EEKA 2ZFSA 8GCHF 1Y3XA 1LO6A 4Y76A 4D7FA 3UNQA 1SPJA 3MNSA 3EDXB 4DT7B 2A2QH 1Z8JB 3LT3A 1DY8A 4A7IB 4FUDA 1ZPZA 3ZVEA 2AIQA 1DFPA 2OP9A 1MUEB 1T31A 4IGDA 3SUFA 1MBMA 4BXWA 1WOFA 2J95A 2FO9A 3M5NA 2GDDA 1ZHMA 2XBXA 1ANEA 2C8ZB 1GDUA 2OXSA 1C2HA 2O8MA 3A8BA 3RM2H 4WXIA 4Y10E 2XC5A 1HV7A 3MH7A 3ATKA 1E37B 1YYY1 1TMBH 1O3GA 4AFUA 1MKWK 4X2XA 2Q6DA 3SI3H 2UWPA 4NZLA 1NO9H 4K8YA 1IQMA 1NRRH 2AERH 1K1MA 1EAXA 1ZPCA 1IQGA 3GYLB 1P2NA 3MH5A 3TJUA 1P2QA 1SVPA 1V2OT 1P09A 1BTPA 3V12A 1RTLA 2O8WA 2VJ1A 4TYDA 3I78A 1FI8A 3BTWE 5HM9A 2ANYA 3TJOA 1O33A 2C93B 5J4QA 4AGJA 4I8JA 4CRDA 4TWYA 1K1NA 2EI8A 3GCHC 5TJXA 4NA8A 1V6DA 3UNRA 4B2BA 1O3IA 2BY5X 1A5IA 2A5KA 4UFEH 4JZDH 5JB8S 2QXGA 1E35B 1SB1H 3RXOA 1IQNA 3VXFH 3RLWH 3UREA 1BBRK 2JH0D 4ABBA 4X8SH 1MZAA 2JH6D 1O37A 1KXBA 2VIWA 1QQUA 1GG6B 1K2I1 3H5CB 3N7OA 1FQ3A 4Q2KA 1Q2WA 2PHBA 4ZUHA 1VITH 1O2IA 5ABWA 1OWEA 3SU4A 2HALA 5FPSA 1BHXF 1BMLA 1UTJA 3ZYDA 2D1JA 1ZYOA 4KELA 1C2IA 1QL8A 1A4WH 4X6NA 1VGCC 4IMQA 5CHAC 3KEEA 2D8WA 4CHAC 3M7QA 1O2VA 1NY22 2V3HH 1C4Y2 2SGDE 1XVMA 4E06H 1O5CB 2J94A 1NPMA 1QB6A 5K7RA 1JRSA 1O5GH 1P57B 1GBIA 3GDSA 1Z6EA 5ETXA 5AVDA 3SO3A 2Z9GA 2BX3A 3TK5A 4NA7A 4X2VA 5EPYA 1DANH 2QCYA 3MU1A 1ACBE 1G37A 3STJA 3RU4D 3R3GB 4BANB 5FCKA 1AB9C 4ABEA 1KXFA 3E16B 1UTLM 2ZHQH 3UNSA 3AASA 4X2WA 4FUJA 3SBKA 1O5EH 3QGNB 2ZGJA 4YLUA 1GDQA 4X1QU 2YNAA 3K6ZA 1AI8H 2BY7X 1QBNA 3GCHB 1SGEE 1HAVB 1P2KA 5L30H 2QA9E 4GPGA 5DP9A 5A09A 1TNLA 3LJOA 3ATLA 3EE0B 1KXCA 3RXPA 1MD8A 2VVUA 2BTCE 1A3EH 3HKIB 3UY9A 3OY6U 5EQQA 3SZNA 1ZTKA 2C4FH 5C5OA 3NKKA 4VGCC 4MDSA 1AN1E 1N6YA 1O5AB 1C1RA 3BG8A 5A0BA 1LVMA 1F0UA 4Q7XA 2FOBA 3RXTA 2VINA 4I8LA 1P03A 3SOSA 4AG2A 3M3VA 1TLDA 4MPUA 1GJ4H 3E0NB 3I29A 1LPGB 1PYTC 1SGTA 1WBGB 1JRTA 3SNBA 2FOHA 1KTTB 5A2MH 1O2OA 3NZIA 2ZECA 2STAE 1V2KT 1BZXE 1ELCA 2ZHEH 1TNIA 3M7TA 1EB2A 2BD5A 1TQ0B 3F9FA 3F68H 3HK3B 2BLOA 1C5MD 1DE7H 4AX9H 1Z1IA 2VVCA 1V2QT 5TCAA 2OC7A 1O5BB 3ELAH 1BIOA 3TGKE 5GJ4B 8ESTE 3P8NA 1Q31A 3SHCH 2OBQA 4GAWA 1SQOA 3ZZ5A 2DE8A 1NM6A 2ZP0H 1ZPBA 4WMEA 3UTUH 1HAIH 4NG9H 4FUEA 5K0HA 2QF3A 1KLIH 2Q6FA 1TIOA 2A32A 3P8OA 2A0QB 2LPRA 2J38A 1F5LA 1AU8A 4A1TA 1OWKA 1YPLH 1GWAA 4NZQA 1WTHD 5F8TA 2F9PA 6LPRA 5IDKA 4ZROA 4CRCA 1HAGE 1L4DA 2AFQB 4RKOB 3LC5A 1AWHB 2GX4A 1ZGIA 2OBOA 1PPZA 2AGIX 3SJOA 1O2UA 1LHCH 5IYTA 1PPHE 1GHAF 1FN8A 2EA3A 3DA9B 1W0YH 1C5XB 4DCDA 1LPZB 1AIXH 3U1IB 2VNTA 1GHBF 1TQ7B 1UVSH 1P2JA 2QF0A 2YOLA 5C5NA 1TYNA 2JETB 3OTJE 1CHGA 1NFXA 1O2MA 1S85A 3GCOA 1O3AA 3TLOA 5SGAE 1DLEA 3UR9A 2ZU1A 2V0BA 3H7OA 1K1PA 1UCYK 1FN6A 3RMLH 1O2NA 3PYHA 3A87A 3ITIA 3UWJH 1ETRH 1UHBA 2RG3A 3MMGA 4ZKNU 2VIPA 1IOEA 4MG3A 4YZUA 1BMMH 3RXIA 4BAMB 4JYVH 1C1QA 1C4V2 1LMWB 4FUIA 1V2ST 2O9QA 1ANBA 1VJAU 2C8YB 1HAOH 4Z0KA 2FOAA 4NCYA 1GJ8B 1C2GA 2SGPE 3QZRA 1C5SA 2ODYB 1IQLA 3UFAA 1EPTB 1QCPA 1EAWA 1GCDA 1FMGA 4U2WA 2FI5E 4ESTE 1H9LB 3KN2A 1PQ5A 1GVKB 1SGQE 4R0IA 1YPHC 2YNBA 1H1BA 3MO9A 1E0FD 3TGJE 1YLDA 2BQ7B 5C3NA 1AD8H 2PW8H 3T29A 2OC1A 3A7YA 2BDIA 1O3KA 1LDTT 1SGDE 2C90B 1SMFE 2BZAA 5C1YA 1TBZH 4AN7A 4X0WU 1GPZA 4NIXA 4XFQA 1AZ8A 2G5NA 2PV9B 4DG4A 2CGAA 3EA9A 4ABHA 3Q3KA 1CE5A 3SGQE 1Y5AT 3SJ8A 1ETSH 4FUBA 5JB9S 2BHGA 4K1EA 2OQ5A 4ABDA 2BMGB 3OYPA 3LGIA 3TK9A 1GJDB 4WMDA 1GBLA 3PV4A 1WQVH 2FDAA 2XBWA 3V3MA 1GI9B 2AS9A 2TIOA 4Y71A 1QL9A 5T6FA 1Y3YA 1BJVA 3LC3A 4XBBA 1KDQA 4E7NA 1GMCF 1P12E 4I31A 1D6WA 3GCTG 1NU7B 1FONA 1DPOA 2SFAA 1XXDA 1J17T 3K9XB 2QC2A 2H9TH 1DDJA 4FVBA 1ID5H 3Q3XA 1ZSLA 2BDGA 4K69A 6GCHG 3ZZ3A 8KME2 3SNCA 2FI3E 1GVZA 3TVJB 1TFXA 4ABFA 3MFJA 1YPKH 1SOZA 2RA0A 9ESTA 5E8EH 1TABE 1VCPA 2BD9A 4ZH8A 3GY3A 2PUXB 3KGPA 1SLUB 5DO4H 1ZHPA 5L6NH 5FAHA 2ZGXH 4B75A 3TH2H 2ANKH 1TRNA 1VITF 2B0FA 1C2DA 3P92A 1P11E 1TGCA 3HGNA 2CMYA 3KHVA 1O3BA 3HPTB 3BG4C 1YCPM 4B73A 1HAYB 1GI3A 1K21H 1HXEH 2WUBA 3UWIA 3RXDA 3PLBA 2P8OC 3M37A 1UO6A 1C5LH 3ZZ9A 2ZU2A 4BNRA 4LOYH 3M7UA 5DP7A 3MO3A 1DX5M 1JMOH 1AB9B 1CHOG 2FTMA 1RIWC 1VZQH 1YC0A 1NTPA 1CGIE 2F9NA 3A84A 2R3YA 2ODQA 1KIGH 5EW2H 4YM9A 2FS9A 2PGQB 3FP6E 1TGNA 4JZ1A 3RP2A 4HZHA 1GJCB 1O39A 4BAOB 1W10U 1B5GH 1DWEH 3M35A 1C5YB 2F91A 3PLPA 4NFFA 4Y7AA 2D2DA 1KXAA 3TITA 1RXPA 3P6ZB 4B2CA 2Z3EA 4XBDA 5CHAB 3QWCH 3RC6A 2AYWA 1C5OH 1SC8U 1F5KU 3HK6B 1B0FA 4ZHAA 1PFXC 1DY9A 3SV2H 3UIRA 1A61H 3HATH 3VFEA 3SU5A 2NU2E 3NXPA 3NCLA 2ZCHP 2O8LA 4LZ1H 2FEQH 3K65B 2QXHA 1JIMA 1HJ8A 2CJIA 3RXVA 6ESTA 2A1DB 4KTUA 1ESBA 4K8BA 2Z7FE 2OINA 3UOPA 3ENSB 4JZFH 5FXLA 3SN8A 3VB5A 4GCHG 2AH4X 4DIIH 2GV6A 1W13U 2Y7ZA 2A7HA 1O2PA 1UTKA 3PTNA 2BVXH 1KLTA 3QO6A 2G52A 1EKBB 5E0GA 3VB4A 1DITH 1XUKA 3LGYA 3LPRA 4GHQA 3S7HB 1V2VT 1P2OA 2J34A 3RXUA 2BVRH 3TNTA 3VGCB 1XM1A 1DLKB 3TPIZ 3T2NA 1A2CH 1T32A 1HDTH 4FUCA 2ULLA 2ZPRA 3SU0A 3EYDA 1HXFH 2GGVB 2BM2A 1DM4B 1LKBA 2NWNA 1G36A 5DKMA 2G81E 1FIZA 2Z3DA 1QR3E 1LQDB 1MD7A 2H6MA 1IHTH 3LONA 3E91A 1GI2A 2VIVA 1UTOA 3MU0A 1G32B 1AFQC 1A0LA 4Z6AH 3SV8A 1HB0B 1FPCH 5JPMH 1O2HA 4WMFA 3SNDA 2BQ6B 3RXHA 1G9IE 1S81A 3MTYA 3U8OH 1EPTA 1VCQA 4DURA 1OPHB 1A46H 1O2TA 4JMYA 3ZVDA 2TGDA 2TRMA 2XYAA 1D3PB 1C5ZB 1BTXA 1DWDH 5EODA 2SGEE 3PROA 3ZV9A 1F2SE 5AF9H 3RXAA 3RU4E 2V3OH 1GI1A 4E05H 1P2MA 4CRAA 1C9TA 3CP7A 1C2KA 1BMAA 2WPHS 1ZGVA 2RDLA 4I7YH 4KTCA 1HUTH 1T8OA 4Y8XA 1DT2A 3W94A 2GZ8A 2DUCA 1ARBA 1SBWA 2BXUH 3A7ZA 1GHVH 3MH4A 1FLEE 3A7XA 1C5QA 1X7AC 4OS6A 1SFQB 3S9BA 3E0PB 4K3JA 1NT1A 3L3TA 2A7JA 1HYLA 5HYOA 3LDXH 3QTVH 5LPRA 1GHXH 2C8XB 4LZ4B 1F0SA 1K9OE 5HMAA 4UFGH 5F6MA 2ZGBH 1UVUH 1GI6A 5FX5A 3VPKA 1B0EA 3P8FA 1TA6A 1WU1A 3UQVA 1SGYE 2VVVA 4LK4A 3VGCC 3WY8A 3O8BA 1P2IA 1TNKA 3O8DA 1HJAB 1KYNA 3TH3H 3KL6A 3QTOH 1S0RA 2BD3A 1A0HB 3SU2A 3AW1A 2B5TB 2UWLA 2ZGCA 4HGCA 1K1IA 1RIWB 3A86A 1NFUA 1UTMA 4CHAB 2H9HA 3SJ9A 1CT0E 1PQ8A 1LKAA 3S0NA 7LPRA 1EASA 3O8CA 1FUJA 4D7GA 2G00A 2FM2A 3AVZA 3FANA 4K5ZA 1MTWA 1O3JA 1P01A 1S6FA 3RXBA 2CF8H 3FVFB 4AFQA 2FXRA 4YOIA 1PQ7A 2BX4A 1GMDG 3QK1A 3T25A 3V13A 3TU7H 1K1JA 2Z9LA 1BUIA 3U98H 3MU5A 4D76A 7GCHG 4H4FA 1GBEA 1EXFA 1ELAA 1W11U 1HAHH 1SQAA 2BLWA 1WAYB 3GY6A 3ZVGA 1XX9A 1MU6B 4NFEA 1C1SA 2V6NA 2QAAA 4ABJA 1LHGH 4YOJA 2IN2A 1FPHH 2HWLB 2P3TB 3LH1A 1GJBB 3LOXA 4KTSA 1SQTA 2ZKSA 1DXPA 2CHAB 4I32A 2F9OA 3VEQB 1IQHA 3DUXH 2C3SA 1AMHA 3MNBA 5EXLA 2VIDA 5FBIA 1YGCH 4X2YA 5A0AE 1G3EA 5JBBS 2Q6GA 3RXQA 5LH8A 2Z3CA 2BB4A 1C5RA 2WPMS 2EC9H 4B74A 4BAHB 5C1UA 3MI4A 3PB1E 3EA7A 2KAIB 2TBSA 1H4WA 1ZSJA 1TBRH 1Z7KA 5C2ZA 3PWCA 1G3CA 1O32A 1GJ6A 4BXSA 4SGBE 1L1GA 2OD3B 4H42U 4B2AA 3BIUH 3GDUA 1TGBA 3EQ0H 1EATA 1IHSH 5JBAS 1W7GH 1GHYH 1ZSKA 2QN5T 1T8NA 1HGTH 1KTSB 4ISHH 5DG6A 2ZFTA 1GMDF 3Q76A 1EQ9A 1XKBC 3GCTF 4YT7H 1QJ1B 2HVXA 3SHAH 2FOCA 1GBTA 3LKWA 4B71A 4DY7B 5B6OA 1O2JA 1MAXA 5EXMA 1WYKA 1BMNH 1TX8A 4IBLH 1BRUP 6GCHF 4BAKB 1SGPE 2BZ6H 1DVAH 2TGAA 2R9PA 2WYJA 4UFDH 4ISIH 3RXMA 3SV9A 2F83A 1GHAG 3ODDA 3GDVA 1BA8B 1O2GH 1U6QA 3P70B 7KMEH 4ZHMU 4K1SA 2FI4E 1WSSH 2AIPA 1K1LA 2FLBH 3FP7E 1O2YA 1PPBH 3QZQA 1QQ4A 3E1XB 2J2UA 1OSSA 4THNH 4OS1A 1BTHH 2R0KA 1C2FA 1NFWA 2F9VA 1C1TA 2AMDA 3DT0H 2PSXA 1A5HA 1QL7A 2ESTE 1C1MA 1T7CA 3RMOH 1MTNC 3UUZA 1EP5A 4R8TB 2GZ9A 1C5VA 2HPPH 5FX6A 2WUCA 1ZJKA 2ILNA 1IQFA 5JBCS 1O2QA 2BD2A 1CBWB 4B1TA 1OXGA 4Q7ZA 2TGPZ 1CQQA 2FYQA 3A85A 1MKWH 1Y5BT 2ZFFH 4INLA 4OS2A 1YM0A 2HNTC 4O3UA 5T6GA 4FVDA 4NIYA 2UUYA 3PLKA 1HAZB 1GMCG 1O0DH 4AG1A 2A31A 1UK2A 2XCNA 2F9BH 2ANWA 2RCEA 4FUGA 3RLYH 1DICA 1NN6A 1E34B 1ZTJA 4IMZA 4FUHA 1JBUH 2ZQ1A 4BTUB 2FYRA 2GVFA 5E2PA 2ZFPH 1GBCA 3GY2A 1TA2A 1LVOA 1OOKB 2QXJA 2SGFE 3ODFA 3UPEA 1IQKA 3BTME 2C8WB 1TNGA 4AFZA 2VGCC 2WV4A 8LPRA 5G4BA 5BPEA 2Z6BD 4NGAH 2IOTA 3RXKA 4XBCA 3S9AA 2XWAA 2ZQ2A 3MOCA 2PR3A 3RM0H 1EP6A 3RDZA 4X6MA 2OUAA 3M5OA 1H9HE 2XRCA 3RC5A 1O2KA 2XXLA 2ZHDA 4X8TH 1CSOE 1FDPA 2BOKA 2PWXA 1TX7A 2B9LA 1G30B 4FUFA 3UR6A 1EOLA 3SGBE 2JH5D 1Z6JH 1O2ZA 2IPHA 1EUFA 1UVPA 2ZPSA 1GMHF 1AUJA 1GJ9B 4AORA 1TNJA 1PYTD 2A4RA 4IN2A 1GI8B 2UUFB 3B9FH 3M3SA 4RKJB 1L4ZA 4MPWA 2I6QA 1GBKA 2A2XH 3UQOA 3U69H 6CHAC 4IS5A 3F9GA 4CBNA 3RU4T 2A4GA 4F49A 4WWYA 1INCA 1TB6H 1S6HA 2J92A 2ZTYA 5F8XA 1TPPA 3KQCA 3T62A 1UMAH 1GG6C 1WUNH 1O3CA 3M36A 3QDZB 1RS0A 2HNTE 1O2LA 1HRTH 2G4UA 1NRPH 4CH2B 1GI0A 3BF6H 1OWHA 3R0FA 2BLVA 2OCVB 3HKJB 1EZXC 4BAQB 1UK4A 1YKTA 1W0ZU 2PKAB 3PMAB 3OU0A 3SV7A 2FX4A 3E8LA 3KNXA 2BY8X 4CRBA 4YTAA 3E3TA 1OYTH 3DD2H 2Z94A 1P04A 2PFEA 4CREA 1A1RA 2QIQA 1QURH 2WPLS 2ZWLH 3ZZ4A 3V0XA 1HCGA 1V2NT 4UONA 4O03A 5GDSH 1GL1A 3B8JA 3LGVA 3D23A 2BLQA 1BT7A 1GI5A 1AFQB 2CHAC 1A7SA 1EB1H 4GVUA 3BTEE 3PMHB 4O3TA 1D9IA 3PTBA 3T28A 1SLWB 1CO7E 2GZ7A 2P16A 1AWFH 3PWBA 1O3FA 4O9VA 5JYIA 1W7XH 4UE7H 1YF4A 1K22H 1ZTLA 1LHDH 3GOVB 1LVYA 2ZTXA 3RC4A 2WINI 3SGAE 1MCVA 2ZO3H 2SNVA 1LHEH 2Y82A 2Y7XA 1GI7B 1W8BH 1BHXB 5BRRE 1NROH 2G8TA 4WJG2 3ZVFA 4D9RA 1UCYE 1GBDA 3A8DA 5L2YH 1HFDA 2XC0A 1YPGH 1THSH 2HLCA 1AUTC 2ZHWH 2AGGX 2NU0E 1C9PA 1SHHB 1OP8A 3A89A 2EI7A 3U1JB 1IQEA 1N1LA 1D6RA 5AHGH 4ASHA 1M9UA 2RA3A 3LGUA 1P3CA 3VXEH 2FS8A 5GCHG 3A82A 5GXPA 5CE1A 2W26A 3KQDA 1Z8GA 2P95A 3PM3A 2ZDVH 3MNXA 1LPKB 4DVAU 5E2OA 2ALPA 1SGIB 1W2KH 1ORFA 1C1WH 3OSYA 2A4QA 2HOBA 9LPRA 2TGTA 3C27B 2PTCE 1XUFA 2AMPA 2Z9IA 1FJSA 2WPJS 3JZ1B 1ZMLA 4YO9A 2FPZA 4A6LA 2Q1JA 4ZHLU 3F9EA 1ABJH 2FTLE 3HGPA 4H6TA 4AB8A 3FZDA 3ZZ6A 3L6PA 4PROA 1WCZA 1CT2E 2P93A 4ZKOU 1NU9A 3MHWU 4OS4A 1P0SH 3V7TA 1XKAC 1AVGH 4MPVA 4UEHH 3STIA 3E6PH 1A0JA 1DUAA 1VGCB 1RFNA 2KAIA 1ZJDA 3T5FH 1XVOA 1EZQA 2OC0A 3NK8A 4ZKSU 1SGFG 3A81A 3T27A 4YESB 1F0TA 2WPIS 4TPIZ 4RSPA 5LPEA 4YOGA 2ZEBA 4Y6DA 2P59A 1C1NA 1AHTH 1OKXA 1WV7H 1H9IE 2WV5A 4XSKU 1O3HA 2R3UA 4F4OC 1GBBA 5F8ZA 1MMJN 1NRSH 1OP2A 2GMTB 3DFLA 3W95A 1UVTH 4JK5A 4KGAA 1AVXA 1GL0E 3DHKH 1NFYA 1GGDB 2ZF0H 3KQBA 3BG4B 4DJZB 4U01A 1IQIA 1CGJE 2W3KA 1O34A 1FY1A 1XUGA 4Y11E 2PKAA 1LCYA 5ESTE 4ZMAH 4AZ2B 1F0RA 1C5TA 4IC6A 4CR5A 3RUOA 2FWWA 1BRBE 1EJNA 1NESE 3S7KB 1KXEA 3UOUA 1HIAB 2P3FH 1KSNA 1MH0A 5C1XA 3LJJA 1Y5UT 1YPJH 2AEIH 2ZDNA 2WYGA 1QBOA 2ZZUH 1GBFA 6CHAB 1Z8RA 2Y5FA 3FZZA 1T8LA 1GJ7B 2Z9KA 1TPSA 3EAJA 1AFEH 5T3HA 1WQSA 1S82A 1GCTC 1BCUH 5DP3A 4GSOA 1DS2E 2VGCB 2ZGHA 4SGAE 5I25A 3QN7A 5T6DA 2O8TA 1KLJH 1V2LT 5FCRA 1CA0C 1MTUA 1C2EA 1BQYA 1EJMA 1P02A 4O97A 1GI4A 3BEUA 2FESH 4MPXA 1ZZZA 2GCTB 1H8IH 1O3LA 4CRGA 2B7DH 8GCHG 1K1OA 2H5CA 1HPGA 1JIRA 2HGTH 4J2YB 1Y3UA 4JZEH 1DWBH 1TWXB 5GCHF 1O3DA 1QBVH 1WTGH 3OY5U 3SI4H 5DP4A 1C1PA 2BDAA 2PLXA 1SSXA 4BTIB 1YPEH 1W14U 2OQUA 2G4TA 1E36B 1QGFA 3MU8A 4GCHF 1BTZA 2QGRA 1CBWC 2ZDAH 3SU1A 4UFFH 4X6OA 1QB1A 1TONA 4X8VH 5EG4A 4WH8A 5FBEA 2PSYA 4X1SU 1TAWA 2ZCKP 3P17H 1V3XA 2GKVE 4I8KA 1L0ZA 1S0QA 1NRNH 1DUEA 3CS0A 4GLYA 1Y8TA 4DGJA 1J16A 3D65E 1IAUA 3OX7U 1OWIA 2CF9H 1O5FH 2ZFQH 2VIOA 4HI3A 1DSUA 2VU8E 3LH3A 3S9CA 5LPFA 1BTYA 1EPTC 1O35A 1P10A 2GT7A 5GWZA 2GTBA 3QUMP 3ZZCA 1QNJA 5E0HA 1Z71A 4NSYA 4INKA 1MTVA 4TWWA 4B76A 3AAVA 1O3OA 1SHYA 2VB0A 2BQWB 5DPAA 4MTBA 4I8GA 1ABIH 2HRVA 3TIUA 1ZR0A 1Y59T 2G51A 1QA7A 1V2PT 2Z9JA 2BDCA 4H6SB 3A8CA 1HNEE 2ZA5A 2ZDMA 1K28D 2B8OH 5I46H 3G01A 2ALVA 2PKSB 4U32A 3ZVAA 2BDYA 3LGTA 1TRYA 3TH4H 4M7GA 3ZYEA 1MTNB 1BTUA 4XOJA 1GCTB 4AFSA 5LGOA 1AY6H 2R2MB 1ELDE 1LQEA 3RMNH 1RD3B 2CV3A 1AE8H 4DOQA 1MKXH 4KP0A 5DP8A 3E90B 3QX5H 3RXSA 2I6SA 3ATWA 4A92A 5A0CA 3Q3YA 1V2UT 3MU4A 5CMXH 1S84A 1YPHE 1HBTH 3PMBB 2ZDKA 1CT4E 4RN6A 3VB6A 1P9SA 2GCHG 3LIWA 4UDWH 3RXCA 2AMQA 3KIDU 3S69A 1MQ6A 4TPYA 1TMUH 3SUGA 1TPAE 1UTQA 5A8YA 2PKSC 3M61U 1O3EA 3B23B 3T26A 2ZHFH 1FZZA 1C2MA 5TCCA 1QJ7B 4NIWA 1GBJA 1MTSA 1QRWA 1QTFA 3SNAA 4OS5A 1FXYA 1O31A 2XCFA 3CS7A 1N8OB 2BVSH 3IITA 2IJOB 5GPIB 1THPB 5PTPA 4A1VA 1P05A 1THRH 3TK6A 1SGNE 1VJ9U 1GBHA 3AW0A 4NIVA 5ESBA 1J9CH 2A4OA 3A7VA 1EAUA 2FOGA 2ZDLA 1GHZA 4OGXA 2QV1A 4ABAA 2DE9A 1O2WA 5FPTA 1SFIA 4E7RG 2ANMH 3KF2A 1ZRBA 1SGFA 4XDEA 1HLTH 1IQJA 2ZG0H 3I77A 1P9UA 4Y0ZE 1TRMA 4K1TA 4A5TS 2FOMB 2ZU5A 1TALA 3RXRA 3BEFB 4HFPB 1D3DB 2GMTC 5EGMA 3FAOA 1O2RA 4MNWA 4XE4A 2ZNKH 2FOEA 4CBOA 1BBRH 2R0LA 1V2JT 1SLVB 3SQEE 1AGJA 1F92A 1KXDA 1VCWA 2Y81A 2ZC9H 1C1OA 2VWOA 1PPCE 4IW4E 1HAXB 1QB9A 2M5TA 3Q77A 5EW1H 1B7XB 4ISLA 1OP0A 1HIAA 1LTOA 2VH6A 2CN0H 5HXFA 1YCPK 3ZZBA 1HJ9A 1SL3A 5EXNA 3KCGH 2VH0A 1AVWA 3BTFE 3M5LA 1EX3A 1UTPA 1A5GH 1FAXA 2JETC 1GHBG 5DJ7A 4OS7A 1BDAA 1AZZA 2XBVA 3URDA 1ZHRA 5EU8A 1GDNA 1CA0B 4U30A 2GP9B 3A8AA 1ZMNA 1OX1A 4J1YA 1G2LA 1CA8B 1AO5A 2H5DA 1W12U 1H8DH 1DOJA 1RGQA 5A8ZA 1C2JA 3A83A 1SR5C 4I8HA 1G2MA 1RJXB 3BTTE 2ZCLP 1TOCB 1XUHA 1ETTH 3KQEA 1TOMH 2BXTH 2Y5GA 2R2WU 2V35A 1RTFB 1FAKH 1TMTH 2FIRH 2J4IA 3SU6A 3ZZAA 2H9EH 1NRQH 5AFZH 1F7ZA 2P3UB 1PJPA 3P8GA 1HAPH 1XUJA 4WXVA 5C20A 4X8UH 2ZU4A 1SLXB 5JBTA 2XC4A 3GICB 1V2TT 7GCHF 4ZXYH 5JDUB 3NUMA 1MKXK 1NZQH 5EQRA 1GJAB 2GCHF 1GGDC 2HNTF 5DK1A 1VR1H 4ABGA 2K1QA 1C4U2 3MO6A 4JYUH 3ZV8A 1O3NA 3K2UA 7ESTE 2TPIZ 3A7TA 3ZZDA 3F1SB 4CR9A 2P94A 4D9QA 2XWBI 1TGSZ 2AGEX 1CGHA 3P95A 3TJVA 1V2RT 4JYTA 1AKSA 4K2YA 3EA8A 2Y5HA 4FU9A 2BOHB 1ELFA 1YPMH 4X1PU 1FY8E 4AYVB 5E0JA 5F03A 5DP6A 3TJNA 2H2ZA 1DXWA 2XBYA 1PPEE 1LVBA 3ZZ7A 1ESAA 1Y3VA 2UWOA 4QT8C 1UHBB 3NWUA 3SV6A 2NU1E 4K60A 4DW2U 3TGIE 1MAYA 2ZFRH 4D8NA 1GMHG 5HM2A 4FU8A 1UVOA 2D26C 2GV7A 1O36A 5EOKA 2BD7A 3ATIA 3RXFA 1MZDA 2ZU3A 3GY7A 3URCA 1RTKA 1J15A 1EAIA 3RXEA 2STBE 1S5SA 5AFYH 1L1JA 1YLCA 3SUDA 2G55A 1GJ5H 1UTNA 1DWCH 2FX6A 1GVLA 3SU3A 2LNCA 2JKHA 3M5MA 3SW2B 4AOQA 1QA0A 4JK6A 1EJAA 2H1UA 5EQSA 1CVWH 2QY0B 1UCYH 4A1XA 1KY9A 1P8VC 2HPQH 4MNXA 3SNEA 1E38B 1FV9A 1T4VH 2OTVA 3SORA 4Y0YE 1C1UH 4X1NU 4ABIA 4NSVA 3SQHE 1QFKH 3ZVCA 4TY7A 1BJUA 5DGJA 2FMJA 5J4SA 4Y79A 3A88A 1C5WB 1N6XA 1TE0A 2P8OB 1S83A 3JZ2B 3U8TH 1PQAA 1TBQH 1QJ6B 2GT8A 3BTDE 3Q00A 5FHTA 2FLRH 1ELEE 4ZAEA 4NWKA 3F9HA 1Z1JA 1W3CA 2SGAA 1UJ1A 4YLQH 1T4UH 1ELVA 3RMMH 1TGTA 2QYIA 2FOFA 1BITA 1QY6A 1C2LA 2THFB 3BTGE 1EZUC 3AAUA 1L2EA 1ELGA 1QRXA 1OYQA 2VWLA 4ISOA 5L2ZH 1O3MA 1ZLRA 3TNSA 1N8OC 3BV9B 4KKDA 1PPGE 4DIHH 2F9UA 5C67A 3BN9A 3GY4A 2UUKB 1TNHA 4Q7YA 2G5VA 1OWJA 3PO1C 1NC6A 1MU8B 4X6PA 4INHA 3D49H 1XUIA 1SI5H 3SUEA 1D4PB 2GD4B 3BTHE 3RXLA 1SG8B 3LGWA 2PUQH 2ASUB 1QIXB 1FNIA 3BEIB 2W3IA 3IWMA 1G3DA 2VIQA 1XMNB 1JXPA 2A7CA 1G3BA 1AE5A 1RRKA 3MWIU 1FY5A 2Y80A 3LU9B 1J8AA 1MCTA 1UK3A 1O30A 1Q3XA 4BTTB 2FZZA 2VWMA 2WPKS 1FY4A 4MLFB 1O2XA 1J14A 3A7WA 1SOTA 3FFGA 1ZMJA 5EPNA 2A5AA 4UD9H 1YP9A 1T8MA 2J9NA 2Y6TA 1ESTA 2VWNA 5FPYA 1V2WT 2OLGA 4CRFA 1JWTA 5H4IB 1GHWH 1VITG 5GIBA 1Z8IB 1TPOA 1P06A
chains in the Genus database with same CATH superfamily
2F3CE 4JCNA 2BYAX 1D3QB 1KMHB 5HGGA 1ELTA 1LHFH 1YBWA 1A3BH 2BY6X 4JZIA 1AQ7A 3F6UH 4CH8B 1EOJA 4WVPE 3SJKA 1F5RA 1EZSC 2QE7D 3BSQA 1CHOF 3MNCA 3RXJA 3C1KA 1C1VH 1V2MT 4I33A 1GBMA 3GISB 1C5PA 1P3EA 1SGCA 3BIVH 5DP5A 1OWDA 3U9AH 1YLNA 1ANDA 4ISNA 2GDEH 2GJGA 3ESTA 3FO8D 2SNWA 5A8XA 3QGJA 4AB9A 3GCNA 4NA9H 4ZKRU 1QRZA 3U8RH 1CU1A 2CXVA 2BD4A 2EI6A 3FP8E 3ZZ8A 1C5UA 2NU3E 3O8RA 3M3TA 1VKYA 3BTKE 2JDID 4Y8ZA 2A45B 2F43B 1SGRE 5EJ1A 3SJIA 4AGKA 3MYWA 1E79D 3VB7A 2A5IA 2BY9X 2O8UA 3K6YA 3EE7A 1ELBA 2OK5A 1GBAA 1BTWA 1O2SA 4X1RU 3VB3A 4IC5A 3MQKC 4Y7BA 4WH6A 1BRCE 2BDHA 2PTNA 1C5NH 1ZOMA 1BMFD 4FU7A 1MQ5A 4GHTA 3DFJA 3QLPH 4YT6H 3GY5A 1HAVA 2XW9A 1YWUA 1D3TB 2UUJB 3PO1B 4Q63A 1O38A 3GYMA 1BB0B 3NPSA 2XTTB 3FKSD 1NS3A 1BBRE 3CENA 1BOQA 4VGCB 3ZVBA 2L6OA 2XNIA 4MQAA 5GNDA 1ANCA 3PMJA 1FIWA 4IN1A 1MBQA 4TY6A 4WF8A 2W7UA 1DSTA 4HTCH 4BOHA 1AKSB 1JOUB 1PPFE 3IG6B 2NU4E 2GCTC 1ARCA 3GY8A 2ODPA 2BDBA 4Q80A 2ZIQH 3A80A 1HJAC 4FXGH 2BD8A 2OC8A 1L1NA 1QHRB 1Y3WA 4MNYA 4MVNA 4WY3A 3BTQE 1O3PB 2ZPQA 4Y8YA 2FP7B 4ZXXH 2ZI2H 3D62A 4MNVA 1YCPH 1S6LA 3EGKH 1KDQB 1XXFA 4NWLA 1TX6A 3MH6A 3L33A 4YXWD 1BRAA 4GUXA 4AYYB 2PGBB 1FY3A 2QXIA 4OGYA 1O5DH 1OS8A 3H7TA 4DT4A 2SGQE 2ZTZA 4LXBH 2WZQA 3RXGA 2W7SA 2FODA 1ZRKA 2W5EA 3ATMA 2EEKA 2KFWA 2ZFSA 8GCHF 1Y3XA 1LO6A 4Y76A 4D7FA 3UNQA 1SPJA 3MNSA 3EDXB 4DT7B 2A2QH 1Z8JB 3LT3A 1DY8A 4A7IB 4FUDA 1ZPZA 3ZVEA 2JIZD 2AIQA 1DFPA 2OP9A 1MUEB 1T31A 4IGDA 3SUFA 1MBMA 4BXWA 1WOFA 2J95A 2FO9A 3M5NA 2GDDA 1ZHMA 2XBXA 1ANEA 3PRBA 2C8ZB 1GDUA 2OXSA 1C2HA 2O8MA 3A8BA 3RM2H 4WXIA 4Y10E 2XC5A 1HV7A 3MH7A 3ATKA 1E37B 1YYY1 1TMBH 1O3GA 4AFUA 2KCPA 1MKWK 4X2XA 2Q6DA 3SI3H 2UWPA 4NZLA 1NO9H 4K8YA 1IQMA 1NRRH 2AERH 1K1MA 1EAXA 1ZPCA 1IQGA 3GYLB 1P2NA 3MH5A 2LELA 3TJUA 1P2QA 1SVPA 1V2OT 1P09A 1BTPA 3V12A 1RTLA 2XNDD 2O8WA 2VJ1A 4TYDA 3I78A 1FI8A 3BTWE 5HM9A 2ANYA 3TJOA 1O33A 2C93B 2QF5A 5J4QA 4AGJA 4I8JA 4CRDA 4TWYA 1K1NA 2EI8A 3GCHC 5TJXA 4NA8A 1V6DA 3UNRA 4B2BA 3DSPA 1O3IA 2BY5X 1A5IA 2A5KA 4UFEH 4JZDH 5JB8S 2QXGA 1E35B 1SB1H 3RXOA 4HG6A 1IQNA 3VXFH 3RLWH 3UREA 1BBRK 2JH0D 4ABBA 4X8SH 1MZAA 2JH6D 1O37A 1KXBA 2VIWA 1QQUA 1GG6B 1K2I1 3H5CB 3N7OA 1FQ3A 4Q2KA 1Q2WA 2PHBA 4ZUHA 1VITH 1O2IA 5ABWA 1OWEA 3SU4A 2HALA 5FPSA 1BHXF 1BMLA 1UTJA 3ZYDA 2D1JA 1ZYOA 4KELA 1C2IA 1QL8A 1A4WH 4X6NA 1VGCC 4IMQA 5CHAC 3KEEA 2D8WA 4CHAC 3M7QA 5KECA 1O2VA 1NY22 2V3HH 1C4Y2 2SGDE 1XVMA 2RDEA 4E06H 1O5CB 2J94A 5DSFA 1NPMA 1QB6A 5K7RA 1JRSA 1O5GH 1P57B 1GBIA 3GDSA 1Z6EA 5ETXA 5AVDA 3SO3A 2YMSD 2HLDD 2Z9GA 2BX3A 3TK5A 4NA7A 4X2VA 5EPYA 1DANH 3F2HA 2QCYA 3MU1A 1ACBE 1G37A 3STJA 3RU4D 3R3GB 4BANB 5FCKA 1AB9C 4ABEA 1KXFA 3E16B 1UTLM 3OAAD 2ZHQH 3UNSA 3AASA 4X2WA 4FUJA 3SBKA 1O5EH 2YMSB 3QGNB 2ZGJA 4YLUA 1GDQA 4X1QU 2YNAA 3K6ZA 1AI8H 2BY7X 1QBNA 3GCHB 1SGEE 1HAVB 1P2KA 5L30H 2QA9E 4GPGA 5DP9A 5A09A 1TNLA 3LJOA 3ATLA 3EE0B 5C0UA 1KXCA 3RXPA 1MD8A 2VVUA 2BTCE 1A3EH 3HKIB 3UY9A 3OY6U 5EQQA 3SZNA 1ZTKA 2C4FH 5C5OA 3NKKA 4VGCC 4MDSA 1AN1E 1N6YA 1O5AB 1C1RA 3BG8A 5A0BA 1LVMA 1F0UA 4Q7XA 1E1RD 2FOBA 3RXTA 2VINA 4I8LA 1P03A 3SOSA 4AG2A 3M3VA 1TLDA 4MPUA 3W1EA 1GJ4H 3E0NB 3I29A 1LPGB 1PYTC 1SGTA 1WBGB 1JRTA 3SNBA 2FOHA 1KTTB 5A2MH 1O2OA 3NZIA 2ZECA 2STAE 1V2KT 1BZXE 1ELCA 2ZHEH 1TNIA 3M7TA 1EB2A 2BD5A 1TQ0B 3F9FA 3F68H 3HK3B 2BLOA 1C5MD 1DE7H 4AX9H 1Z1IA 2VVCA 1V2QT 5TCAA 2OC7A 5CHBA 1O5BB 3ELAH 1BIOA 3TGKE 5GJ4B 8ESTE 3P8NA 1Q31A 3SHCH 2OBQA 4GAWA 1SQOA 3ZZ5A 2DE8A 1NM6A 2ZP0H 1ZPBA 4WMEA 3UTUH 1HAIH 4NG9H 4FUEA 5C94A 5K0HA 2QF3A 1KLIH 2Q6FA 1TIOA 2A32A 3P8OA 2A0QB 2LPRA 2J97A 2J38A 1F5LA 1AU8A 4A1TA 1OWKA 1YPLH 1GWAA 4B6EA 4NZQA 1WTHD 5F8TA 2F9PA 6LPRA 5IDKA 4ZROA 4CRCA 1HAGE 1L4DA 2AFQB 4RKOB 3LC5A 1AWHB 1SKYE 2GX4A 4RI0A 1ZGIA 2OBOA 1PPZA 2AGIX 4F55A 3SJOA 1O2UA 1LHCH 3N7DA 5IYTA 1PPHE 1GHAF 1FN8A 2EA3A 3DA9B 1W0YH 2WPDD 2PP6A 1C5XB 4DCDA 1LPZB 1AIXH 3U1IB 1TQ7B 1GHBF 2VNTA 1UVSH 1P2JA 2QF0A 2YOLA 5C5NA 1TYNA 2JETB 3OTJE 1CHGA 1NFXA 1O2MA 1S85A 2KCAA 1O3AA 3GCOA 3TLOA 5SGAE 3F2FA 1DLEA 3UR9A 2ZU1A 2V0BA 3H7OA 1K1PA 1UCYK 1FN6A 3RMLH 1O2NA 3PYHA 3A87A 3ITIA 3UWJH 1ETRH 1UHBA 2RG3A 3UAIC 2IJD1 3MMGA 4ZKNU 2VIPA 4AC9A 1IOEA 4MG3A 4YZUA 1BMMH 3RXIA 4BAMB 4JYVH 1C1QA 1C4V2 1LMWB 4FUIA 1V2ST 2O9QA 1ANBA 3VG8A 1VJAU 2C8YB 1HAOH 4Z0KA 4RT0A 2FOAA 4NCYA 1GJ8B 3N99A 1C2GA 2SGPE 3QZRA 1C5SA 2ODYB 1IQLA 3UFAA 1EPTB 1QCPA 1EAWA 1GCDA 1FMGA 2WSSD 2FI5E 4U2WA 4ESTE 1H9LB 3KN2A 1WDIA 1PQ5A 1GVKB 1SGQE 4R0IA 1YPHC 2YNBA 1H1BA 3MO9A 1E0FD 4XRNA 3TGJE 1YLDA 2BQ7B 5C3NA 1AD8H 2PW8H 3T29A 3SYJA 2OC1A 3A7YA 2BDIA 1O3KA 1LDTT 1SGDE 2C90B 1SMFE 2BZAA 5C1YA 1TBZH 4AN7A 4X0WU 1GPZA 3CNRA 4NIXA 4XFQA 1AZ8A 3F0PA 2G5NA 2J98A 2PV9B 4DG4A 2CGAA 3EA9A 4ABHA 3Q3KA 3DSOA 1CE5A 3SGQE 1Y5AT 3SJ8A 1ETSH 4FUBA 5JB9S 3OTPA 2BHGA 4K1EA 2OQ5A 4ABDA 2BMGB 3OYPA 3LGIA 5FL7D 3TK9A 1GJDB 4WMDA 1GBLA 3PV4A 1WQVH 2FDAA 2XBWA 3V3MA 1GI9B 2AS9A 1MABB 2TIOA 4Y71A 1QL9A 5T6FA 1Y3YA 1BJVA 3LC3A 4XBBA 1KDQA 4E7NA 1GMCF 1P12E 4I31A 1D6WA 3GCTG 1NU7B 1FONA 1DPOA 2SFAA 1XXDA 1J17T 3K9XB 2QC2A 2H9TH 1DDJA 4FVBA 3SZEA 1ID5H 3Q3XA 1ZSLA 2BDGA 4K69A 6GCHG 3ZZ3A 8KME2 3SNCA 3PV5A 2FI3E 1GVZA 3TVJB 1TFXA 4ABFA 3MFJA 1YPKH 4Z1MD 1SOZA 2RA0A 9ESTA 5E8EH 1TABE 1VCPA 2BD9A 4ZH8A 3GY3A 2PUXB 3KGPA 1SLUB 5DO4H 1ZHPA 5L6NH 5FAHA 2ZGXH 4B75A 3TH2H 2ANKH 1TRNA 1VITF 2B0FA 1C2DA 1EFRD 3P92A 1P11E 1TGCA 3ZIAD 3HGNA 2CMYA 3KHVA 1O3BA 3HPTB 2YMSC 3BG4C 1YCPM 4B73A 1HAYB 1GI3A 1K21H 1HXEH 2WUBA 3UWIA 3RXDA 3PLBA 2P8OC 3M37A 1UO6A 1C5LH 3ZZ9A 2ZU2A 4BNRA 4LOYH 3M7UA 5DP7A 3MO3A 1DX5M 1JMOH 1AB9B 1CHOG 2FTMA 1RIWC 1VZQH 1YC0A 1NTPA 1CGIE 2F9NA 3A84A 2R3YA 2ODQA 5KEDA 1KIGH 5EW2H 4YM9A 2FS9A 2PGQB 3FP6E 1TGNA 4JZ1A 3RP2A 4HZHA 1GJCB 1O39A 4BAOB 1W10U 1B5GH 1DWEH 3M35A 1C5YB 2F91A 3PLPA 4NFFA 4Y7AA 2D2DA 1KXAA 3TITA 1RXPA 3P6ZB 4B2CA 2Z3EA 4XBDA 5CHAB 3QWCH 3RC6A 2AYWA 1C5OH 1SC8U 1F5KU 3HK6B 1B0FA 4ZHAA 1PFXC 1DY9A 3SV2H 3UIRA 1A61H 3HATH 3VFEA 3SU5A 2NU2E 3NXPA 3NCLA 2ZCHP 3GS9A 2O8LA 4LZ1H 2FEQH 3K65B 2QXHA 1JIMA 1HJ8A 2CJIA 3RXVA 6ESTA 2A1DB 4KTUA 1ESBA 4K8BA 2Z7FE 2OINA 3UOPA 3ENSB 4JZFH 5FXLA 3SN8A 3VB5A 3KQ5A 4GCHG 2AH4X 4DIIH 2GV6A 1W13U 2Y7ZA 2A7HA 1O2PA 1UTKA 3PTNA 2BVXH 1KLTA 3QO6A 2G52A 1EKBB 5E0GA 3VB4A 1DITH 1XUKA 3LGYA 3LPRA 4GHQA 3S7HB 1V2VT 1P2OA 2J34A 3RXUA 2BVRH 3TNTA 3VGCB 1XM1A 1DLKB 3TPIZ 3T2NA 1A2CH 1T32A 1HDTH 4FUCA 2ULLA 2ZPRA 3SU0A 3EYDA 1HXFH 2GGVB 2BM2A 1DM4B 1LKBA 2NWNA 1G36A 5DKMA 2G81E 1FIZA 1OHHD 2Z3DA 1QR3E 1LQDB 1MD7A 2H6MA 1IHTH 3LONA 3E91A 1GI2A 2VIVA 1UTOA 3MU0A 1G32B 1AFQC 1A0LA 4Z6AH 3SV8A 1HB0B 1FPCH 5JPMH 1O2HA 4WMFA 3SNDA 2BQ6B 3RXHA 1G9IE 1S81A 3MTYA 3U8OH 1EPTA 2HVYB 1VCQA 4DURA 1OPHB 1A46H 1O2TA 4JMYA 3ZVDA 2TGDA 2TRMA 2XYAA 1D3PB 1C5ZB 1BTXA 1DWDH 5EODA 1COWD 2V7QD 2SGEE 3PROA 3ZV9A 1F2SE 2XOKD 5AF9H 3RXAA 3RU4E 2V3OH 1GI1A 4E05H 1P2MA 4CRAA 1C9TA 3CP7A 1C2KA 1BMAA 4XD7D 2WPHS 1ZGVA 2RDLA 4I7YH 4KTCA 1HUTH 1T8OA 4Y8XA 1DT2A 3W94A 2GZ8A 2DUCA 1ARBA 1SBWA 2BXUH 3A7ZA 1GHVH 3MH4A 1FLEE 3A7XA 1C5QA 1X7AC 4OS6A 1SFQB 1QZ8A 3S9BA 2J98B 3E0PB 4K3JA 1NT1A 3L3TA 2A7JA 1HYLA 5HYOA 3LDXH 3QTVH 5LPRA 1GHXH 2C8XB 4LZ4B 4I86A 1F0SA 1K9OE 5HMAA 4UFGH 5F6MA 2ZGBH 1UVUH 1GI6A 5FX5A 3VPKA 1B0EA 2LP6A 3P8FA 1TA6A 1WU1A 3UQVA 1SGYE 2VVVA 4LK4A 3VGCC 3WY8A 3F2GA 3O8BA 1P2IA 1TNKA 3O8DA 1HJAB 1KYNA 3TH3H 3KL6A 3QTOH 1S0RA 2BD3A 1A0HB 3SU2A 3AW1A 2B5TB 2UWLA 2ZGCA 4HGCA 1K1IA 1RIWB 3A86A 1NFUA 1UTMA 4CHAB 2H9HA 3SJ9A 1CT0E 1PQ8A 1LKAA 3S0NA 7LPRA 1EASA 1H8HD 1FUJA 3O8CA 4D7GA 2G00A 2FM2A 3AVZA 3FANA 4K5ZA 1MTWA 1O3JA 1P01A 1S6FA 3RXBA 2CF8H 3FVFB 4AFQA 2FXRA 4YOIA 1PQ7A 2BX4A 1GMDG 3QK1A 3T25A 3V13A 3TU7H 1K1JA 2Z9LA 1BUIA 3U98H 3MU5A 4D76A 7GCHG 4H4FA 3AK5A 1GBEA 1EXFA 1ELAA 1W11U 1HAHH 1SQAA 2BLWA 1WAYB 2AHME 3GY6A 3ZVGA 1XX9A 1MU6B 4NFEA 1C1SA 2V6NA 2QAAA 4ABJA 1LHGH 4YOJA 2IN2A 1FPHH 2HWLB 2P3TB 2JJ1D 1GJBB 3LH1A 3LOXA 4KTSA 5EJLA 1SQTA 2ZKSA 3PRDA 1DXPA 2CHAB 4I32A 2F9OA 3VEQB 1IQHA 3DUXH 2C3SA 1AMHA 3MNBA 5EXLA 2VIDA 1H8ED 5FBIA 1YGCH 4X2YA 5A0AE 1G3EA 5JBBS 2Q6GA 3RXQA 5LH8A 2Z3CA 2BB4A 1C5RA 2WPMS 2EC9H 2KX4A 4B74A 4BAHB 5F53A 5C1UA 3MI4A 3PB1E 3EA7A 2KAIB 2TBSA 1H4WA 1ZSJA 1TBRH 1Z7KA 5C2ZA 3PWCA 1G3CA 1O32A 1GJ6A 4BXSA 4SGBE 1L1GA 2OD3B 4H42U 4B2AA 3BIUH 3GDUA 1TGBA 3EQ0H 3F3BA 1EATA 1IHSH 5JBAS 1W7GH 4FOUC 1GHYH 1ZSKA 2QN5T 1T8NA 1HGTH 1KTSB 4ISHH 5DG6A 2ZFTA 1GMDF 3Q76A 1EQ9A 1XKBC 3GCTF 4YT7H 1QJ1B 2HVXA 3SHAH 2FOCA 1GBTA 3LKWA 4B71A 4DY7B 5B6OA 1O2JA 1MAXA 5EXMA 1WYKA 1BMNH 1TX8A 4IBLH 1BRUP 6GCHF 4BAKB 1SGPE 2L74A 2BZ6H 2J5UA 1DVAH 2TGAA 2R9PA 2WYJA 4UFDH 4ISIH 3RXMA 3SV9A 2F83A 1GHAG 3ODDA 3GDVA 1BA8B 1O2GH 1U6QA 3P70B 7KMEH 4ZHMU 4K1SA 2FI4E 1WSSH 2AIPA 1K1LA 2FLBH 3FP7E 1O2YA 1PPBH 3QZQA 3F0OA 1QQ4A 3E1XB 2J2UA 1OSSA 4THNH 4ACAA 4OS1A 1BTHH 2R0KA 1C2FA 1WXRA 1NFWA 2F9VA 2KCOA 1C1TA 2AMDA 3DT0H 2PSXA 1A5HA 1QL7A 2ESTE 1C1MA 1T7CA 3RMOH 1MTNC 3UUZA 1EP5A 4R8TB 2GZ9A 1C5VA 2HPPH 5FX6A 2WUCA 1ZJKA 2ILNA 1IQFA 5JBCS 1O2QA 2BD2A 1CBWB 4B1TA 1OXGA 4Q7ZA 2TGPZ 1CQQA 2FYQA 3A85A 1MKWH 1Y5BT 2ZFFH 4INLA 4OS2A 1YM0A 2HNTC 4O3UA 5T6GA 4FVDA 4NIYA 2UUYA 3PLKA 1HAZB 1GMCG 1O0DH 4AG1A 2A31A 1UK2A 2XCNA 2F9BH 2ANWA 2RCEA 4FUGA 3RLYH 1DICA 1NN6A 1E34B 1ZTJA 4IMZA 4FUHA 3NRLA 1JBUH 1K0HA 2CK3D 2ZQ1A 4BTUB 5T1VA 2FYRA 2GVFA 3H09A 5E2PA 2ZFPH 1GBCA 3GY2A 1TA2A 1LVOA 1OOKB 2QXJA 2SGFE 3ODFA 3UPEA 1IQKA 3BTME 2C8WB 1TNGA 4AFZA 2VGCC 2WV4A 8LPRA 5G4BA 5BPEA 2Z6BD 4NGAH 2IOTA 3RXKA 4XBCA 3S9AA 2XWAA 2ZQ2A 3MOCA 2PR3A 3RM0H 1EP6A 3RDZA 4X6MA 2OUAA 3M5OA 1H9HE 2XRCA 5IK2D 3RC5A 1O2KA 2XXLA 2ZHDA 4X8TH 1CSOE 1FDPA 2BOKA 2PWXA 2M2AA 1TX7A 2B9LA 1G30B 4FUFA 3UR6A 1EOLA 3SGBE 2JH5D 1Z6JH 4P00A 2RFKC 1O2ZA 2IPHA 1EUFA 1UVPA 2ZPSA 1GMHF 1AUJA 1GJ9B 3DCLA 1TNJA 4AORA 1PYTD 2A4RA 4IN2A 1GI8B 2UUFB 3B9FH 5B6LA 3M3SA 4RKJB 1L4ZA 4MPWA 2I6QA 1GBKA 2A2XH 3UQOA 3U69H 6CHAC 4IS5A 3F9GA 4CBNA 3RU4T 2A4GA 4F49A 4WWYA 1INCA 1TB6H 1E1QD 1S6HA 2J92A 2ZTYA 5F8XA 1TPPA 3KQCA 3T62A 1UMAH 1GG6C 1WUNH 1O3CA 3N7EA 3M36A 3QDZB 3WW7A 1RS0A 2HNTE 1O2LA 1HRTH 2G4UA 1NRPH 4CH2B 2KM0A 1GI0A 3BF6H 1OWHA 3R0FA 2BLVA 2OCVB 3HKJB 1EZXC 4BAQB 1UK4A 1YKTA 3WWFA 1W0ZU 2PKAB 3PMAB 3OU0A 3SV7A 2FX4A 3E8LA 3KNXA 2BY8X 4CRBA 4YTAA 3E3TA 1OYTH 3DD2H 2Z94A 1P04A 2PFEA 4CREA 1A1RA 2QIQA 1QURH 2WPLS 2ZWLH 3ZZ4A 3V0XA 1HCGA 1V2NT 4UONA 4O03A 5GDSH 1GL1A 3B8JA 3LGVA 3D23A 2BLQA 1BT7A 1GI5A 1AFQB 2CHAC 2IPQX 1A7SA 1EB1H 4GVUA 3BTEE 3PMHB 4O3TA 1D9IA 3UB0A 3PTBA 3T28A 1SLWB 1CO7E 2GZ7A 2P16A 1AWFH 3PWBA 1O3FA 4O9VA 5JYIA 1W7XH 4UE7H 1YF4A 1K22H 1ZTLA 1LHDH 3GOVB 5CDFE 1LVYA 2ZTXA 3RC4A 2WINI 3SGAE 1MCVA 2ZO3H 2SNVA 1LHEH 2EY4C 2Y82A 2Y7XA 1GI7B 1W8BH 1BHXB 5BRRE 1NROH 2G8TA 4WJG2 3ZVFA 4D9RA 1UCYE 2KR7A 1GBDA 3A8DA 5L2YH 1HFDA 2XC0A 1YPGH 1THSH 2HLCA 1AUTC 2ZHWH 2AGGX 2NU0E 1C9PA 1SHHB 1OP8A 3A89A 2EI7A 3U1JB 1IQEA 1N1LA 1D6RA 5AHGH 4ASHA 1M9UA 2RA3A 3LGUA 1P3CA 3VXEH 2FS8A 5GCHG 3A82A 5GXPA 5CE1A 2W26A 3KQDA 1Z8GA 2P95A 3PM3A 2ZDVH 3MNXA 1LPKB 4DVAU 5E2OA 2ALPA 1SGIB 1W2KH 1ORFA 4ASUD 1C1WH 3OSYA 2A4QA 2HOBA 9LPRA 2TGTA 3C27B 2PTCE 1XUFA 2AMPA 2Z9IA 1FJSA 2WPJS 3JZ1B 1ZMLA 4YO9A 2FPZA 4A6LA 2Q1JA 4ZHLU 3F9EA 1ABJH 2FTLE 3HGPA 4H6TA 4AB8A 3FZDA 3ZZ6A 1SQRA 2JJ2D 3L6PA 4PROA 1WCZA 1CT2E 4B6FA 2P93A 4ZKOU 1NU9A 3MHWU 4OS4A 1P0SH 3V7TA 1XKAC 1AVGH 4MPVA 4UEHH 4RT1A 3STIA 3E6PH 1A0JA 1DUAA 2KAIA 1RFNA 1VGCB 1ZJDA 3T5FH 1XVOA 1EZQA 2OC0A 3NK8A 4ZKSU 1SGFG 3A81A 3T27A 4YESB 1F0TA 2WPIS 4TPIZ 4RSPA 5LPEA 4YOGA 2ZEBA 4Y6DA 2P59A 1C1NA 1AHTH 1OKXA 1WV7H 1H9IE 2WV5A 4XSKU 1O3HA 2R3UA 4F4OC 1GBBA 5F8ZA 1MMJN 1NRSH 1OP2A 2GMTB 3DFLA 3W95A 1UVTH 4JK5A 4KGAA 1AVXA 1GL0E 3DHKH 1NFYA 1GGDB 2ZF0H 3KQBA 3PV2A 3BG4B 4DJZB 4U01A 1IQIA 1CGJE 2W3KA 1O34A 1FY1A 1XUGA 4Y11E 2PKAA 1YY3A 1LCYA 5ESTE 4ZMAH 4AZ2B 1F0RA 1C5TA 4IC6A 4CR5A 3RUOA 2FWWA 1BRBE 1EJNA 1NESE 3S7KB 1KXEA 3UOUA 1HIAB 2P3FH 1KSNA 1MH0A 5C1XA 3LJJA 1Y5UT 1YPJH 2AEIH 1NBMD 2ZDNA 2WYGA 1QBOA 2ZZUH 1GBFA 6CHAB 1Z8RA 2Y5FA 3DSGA 1T8LA 1GJ7B 2Z9KA 3FZZA 1TPSA 3EAJA 1FX0B 1AFEH 5T3HA 1WQSA 1S82A 1GCTC 1BCUH 5DP3A 4GSOA 1DS2E 3WWBA 2VGCB 2ZGHA 4SGAE 5I25A 3QN7A 5T6DA 2O8TA 1KLJH 1V2LT 2QF4A 5FCRA 1CA0C 1MTUA 1C2EA 1BQYA 1EJMA 1P02A 4O97A 1GI4A 3BEUA 2FESH 4MPXA 1ZZZA 2GCTB 1H8IH 1O3LA 4CRGA 2B7DH 8GCHG 1K1OA 2H5CA 1HPGA 1JIRA 3KYGA 2HGTH 4J2YB 1Y3UA 4JZEH 1DWBH 1TWXB 5GCHF 1O3DA 1QBVH 1WTGH 3OY5U 3SI4H 5DP4A 1C1PA 2BDAA 2PLXA 4TSFD 1SSXA 4BTIB 1YPEH 1W14U 5DN6D 2OQUA 2G4TA 1E36B 1QGFA 3MU8A 4GCHF 1BTZA 2QGRA 1CBWC 2ZDAH 3SU1A 4UFFH 4X6OA 1QB1A 1TONA 4M9FA 4X8VH 5EG4A 4WH8A 5FBEA 2PSYA 4X1SU 1TAWA 2ZCKP 3P17H 1V3XA 2GKVE 4I8KA 1L0ZA 1S0QA 1NRNH 1DUEA 3CS0A 4Q4LA 4GLYA 1Y8TA 4DGJA 1J16A 3D65E 1IAUA 3OX7U 1OWIA 2CF9H 1O5FH 2ZFQH 2VIOA 4HI3A 1DSUA 2VU8E 3LH3A 3S9CA 5LPFA 1BTYA 1EPTC 1O35A 1P10A 2GT7A 5GWZA 2GTBA 3QUMP 3ZZCA 1QNJA 5E0HA 1Z71A 4NSYA 4INKA 1MTVA 4TWWA 4B76A 3AAVA 1O3OA 1SHYA 2VB0A 2BQWB 5DPAA 4MTBA 4I8GA 1ABIH 2HRVA 3TIUA 1ZR0A 1Y59T 2G51A 1QA7A 1V2PT 2Z9JA 2BDCA 4H6SB 3A8CA 1HNEE 2ZA5A 2ZDMA 1K28D 2B8OH 5I46H 3G01A 2ALVA 2PKSB 4U32A 3ZVAA 2BDYA 3LGTA 1TRYA 3TH4H 2WHXA 4M7GA 3ZYEA 3OE7D 1MTNB 1BTUA 4XOJA 1GCTB 4AFSA 5LGOA 3OFND 1AY6H 2R2MB 1ELDE 1LQEA 3RMNH 1RD3B 2CV3A 1AE8H 4DOQA 1MKXH 4KP0A 5DP8A 3E90B 3QX5H 3RXSA 2I6SA 3ATWA 4A92A 5A0CA 3Q3YA 1V2UT 3MU4A 5CMXH 1S84A 1YPHE 1HBTH 3PMBB 2ZDKA 1CT4E 4RN6A 3VB6A 1P9SA 2GCHG 4ZCNA 3LIWA 4UDWH 3RXCA 2AMQA 3KIDU 3KYFA 1MQ6A 4TPYA 3S69A 1TMUH 3SUGA 1TPAE 1UTQA 5A8YA 2PKSC 3M61U 1O3EA 3B23B 3T26A 2ZHFH 1FZZA 1C2MA 5TCCA 4FETA 1QJ7B 4NIWA 5C17A 1GBJA 1MTSA 2WV9A 1QRWA 1QTFA 3SNAA 4OS5A 1FXYA 1O31A 2XCFA 3CS7A 1N8OB 2BVSH 3IITA 2IJOB 5GPIB 1THPB 5PTPA 4A1VA 1P05A 1THRH 3TK6A 1SGNE 2K0QA 1VJ9U 1GBHA 3AW0A 4NIVA 5ESBA 1J9CH 2A4OA 3A7VA 1EAUA 1W0KD 2FOGA 2ZDLA 1GHZA 4OGXA 2QV1A 4ABAA 2DE9A 1O2WA 5FPTA 1SFIA 4E7RG 2ANMH 3KF2A 1ZRBA 1SGFA 4XDEA 1HLTH 1IQJA 2ZG0H 3I77A 5EIYA 1P9UA 4Y0ZE 1TRMA 2V3MA 4K1TA 4A5TS 2FOMB 2ZU5A 1TALA 3RXRA 3BEFB 4HFPB 4F48B 1D3DB 2GMTC 5EGMA 3FAOA 1O2RA 4MNWA 4XE4A 2ZNKH 2FOEA 4CBOA 1BBRH 2R0LA 1V2JT 1SLVB 3SQEE 1AGJA 1F92A 1KXDA 1VCWA 2Y81A 2ZC9H 1C1OA 2VWOA 1PPCE 4IW4E 1HAXB 1QB9A 2M5TA 3Q77A 2KCYA 5EW1H 1B7XB 4ISLA 1OP0A 1HIAA 1LTOA 2VH6A 2CN0H 5HXFA 1YCPK 3ZZBA 1HJ9A 1SL3A 5EXNA 3KCGH 2VH0A 1AVWA 3BTFE 3M5LA 1EX3A 3OEHD 1UTPA 1A5GH 1FAXA 2JETC 1GHBG 5DJ7A 4OS7A 3OEED 1BDAA 1AZZA 2XBVA 3URDA 1ZHRA 5EU8A 1GDNA 1CA0B 4U30A 2GP9B 3A8AA 1ZMNA 1OX1A 4J1YA 1G2LA 1CA8B 1AO5A 1W0JD 2H5DA 1W12U 1H8DH 1DOJA 1RGQA 5A8ZA 1C2JA 3A83A 1SR5C 4I8HA 1G2MA 1RJXB 3BTTE 2ZCLP 1TOCB 1XUHA 1ETTH 3KQEA 1TOMH 2BXTH 2Y5GA 2R2WU 2V35A 1RTFB 1FAKH 1TMTH 2FIRH 2J4IA 3SU6A 3ZZAA 2H9EH 1NRQH 4TT3D 5AFZH 1F7ZA 2P3UB 1PJPA 3P8GA 1HAPH 1XUJA 4WXVA 5C20A 2VBCA 4X8UH 2ZU4A 1SLXB 5JBTA 2XC4A 3GICB 1V2TT 7GCHF 4ZXYH 5JDUB 3NUMA 1MKXK 1NZQH 2K8IA 5EQRA 1GJAB 2GCHF 3FOAA 1GGDC 2HNTF 5DK1A 1VR1H 4ABGA 2K1QA 1C4U2 3MO6A 4JYUH 2F4LA 3ZV8A 1O3NA 3K2UA 2W6ID 3U28C 7ESTE 2TPIZ 3A7TA 3ZZDA 3F1SB 4CR9A 2P94A 4D9QA 5EJZA 5HKKD 2XWBI 1TGSZ 2AGEX 1CGHA 3P95A 5HIZA 3TJVA 1V2RT 4JYTA 1AKSA 4K2YA 3EA8A 2Y5HA 4FU9A 2BOHB 1ELFA 1YPMH 4X1PU 1FY8E 4AYVB 5E0JA 5F03A 5DP6A 3TJNA 2H2ZA 1DXWA 2XBYA 1PPEE 1LVBA 3ZZ7A 1ESAA 1Y3VA 2UWOA 4QT8C 1UHBB 3NWUA 3SV6A 2NU1E 4K60A 4DW2U 3TGIE 1MAYA 2ZFRH 4D8NA 1GMHG 5HM2A 4FU8A 1UVOA 2D26C 2GV7A 1O36A 5EOKA 2BD7A 3ATIA 3RXFA 1MZDA 2ZU3A 3GY7A 3URCA 1RTKA 1J15A 1EAIA 5C0TA 3RXEA 2STBE 1S5SA 5AFYH 1L1JA 1YLCA 3SUDA 2G55A 1GJ5H 1UTNA 1DWCH 4ACBA 2FX6A 1GVLA 3SU3A 2LNCA 2JKHA 3M5MA 3SW2B 4AOQA 1QA0A 4JK6A 1EJAA 2H1UA 5EQSA 1CVWH 2QY0B 1UCYH 4A1XA 1KY9A 1P8VC 2HPQH 2KZ4A 4MNXA 3SNEA 1E38B 1FV9A 1T4VH 2OTVA 3SORA 5HIYA 4Y0YE 1C1UH 4X1NU 4ABIA 4NSVA 3SQHE 1QFKH 3ZVCA 4TY7A 1BJUA 5DGJA 2FMJA 5J4SA 4Y79A 3A88A 1C5WB 1N6XA 1TE0A 2P8OB 1S83A 3JZ2B 3U8TH 1PQAA 1TBQH 1QJ6B 2GT8A 3BTDE 3Q00A 5FHTA 1UW7A 2FLRH 1ELEE 4ZAEA 4NWKA 2W6JD 3F9HA 1Z1JA 1W3CA 2SGAA 1UJ1A 4YLQH 1T4UH 1ELVA 3RMMH 3FN8A 1TGTA 2QYIA 2FOFA 1BITA 1QY6A 1C2LA 2THFB 3BTGE 1EZUC 3AAUA 1L2EA 1ELGA 1QRXA 1OYQA 2VWLA 4ISOA 5L2ZH 4OM9A 1O3MA 1ZLRA 3TNSA 1N8OC 3BV9B 4KKDA 1PPGE 4DIHH 2F9UA 5C67A 3BN9A 3GY4A 2UUKB 1TNHA 4Q7YA 2G5VA 1OWJA 3PO1C 1NC6A 1MU8B 4X6PA 4INHA 3D49H 1XUIA 1SI5H 3SUEA 1D4PB 2GD4B 3BTHE 3RXLA 1SG8B 3LGWA 2PUQH 2ASUB 1QIXB 1FNIA 3BEIB 2W3IA 3IWMA 1G3DA 2VIQA 1XMNB 1JXPA 1NBME 2A7CA 1G3BA 1AE5A 1RRKA 3MWIU 1FY5A 2Y80A 3LU9B 1J8AA 1MCTA 1UK3A 1O30A 1Q3XA 4BTTB 2FZZA 2VWMA 2WPKS 1FY4A 4MLFB 1O2XA 1J14A 3A7WA 1SOTA 4P02A 3FFGA 1ZMJA 2EQNA 5EPNA 2A5AA 4UD9H 1YP9A 1T8MA 2J9NA 2Y6TA 1ESTA 2VWNA 5FPYA 1V2WT 2OLGA 4CRFA 1JWTA 5H4IB 1GHWH 1VITG 5GIBA 1Z8IB 1TPOA 1P06A 5KGOA
chains in the Genus database with same CATH topology
2F3CE 4JCNA 2BYAX 1D3QB 5HGGA 1ELTA 1LHFH 1YBWA 1A3BH 2BY6X 4JZIA 1AQ7A 3F6UH 4CH8B 1EOJA 4WVPE 3SJKA 1F5RA 1EZSC 3BSQA 1CHOF 3MNCA 3RXJA 3C1KA 1C1VH 1V2MT 4I33A 1GBMA 3GISB 1C5PA 1P3EA 1SGCA 3BIVH 5DP5A 1OWDA 3U9AH 1ANDA 4ISNA 2GDEH 3ESTA 2SNWA 5A8XA 3QGJA 4AB9A 3GCNA 4NA9H 4ZKRU 1QRZA 3U8RH 1CU1A 2CXVA 2BD4A 2EI6A 3FP8E 3ZZ8A 1C5UA 2NU3E 3O8RA 3M3TA 3BTKE 4Y8ZA 2A45B 1SGRE 3SJIA 4AGKA 3MYWA 3VB7A 2A5IA 2BY9X 2O8UA 3K6YA 1ELBA 1GBAA 1BTWA 1O2SA 4X1RU 3VB3A 4IC5A 4Y7BA 4WH6A 1BRCE 2BDHA 2PTNA 1C5NH 1ZOMA 4FU7A 1MQ5A 4GHTA 3DFJA 3QLPH 4YT6H 3GY5A 1HAVA 2XW9A 1D3TB 2UUJB 3PO1B 1O38A 3GYMA 1BB0B 3NPSA 2XTTB 1NS3A 1BBRE 3CENA 1BOQA 4VGCB 3ZVBA 2XNIA 4MQAA 1ANCA 3PMJA 1FIWA 4IN1A 1MBQA 4TY6A 4WF8A 2W7UA 1DSTA 4HTCH 4BOHA 1AKSB 1JOUB 1PPFE 3IG6B 2NU4E 2GCTC 1ARCA 3GY8A 2ODPA 2BDBA 4Q80A 2ZIQH 3A80A 1HJAC 4FXGH 2BD8A 2OC8A 1L1NA 1QHRB 1Y3WA 4MNYA 4MVNA 4WY3A 3BTQE 1O3PB 2ZPQA 4Y8YA 2FP7B 4ZXXH 2ZI2H 3D62A 4MNVA 1YCPH 3EGKH 1KDQB 1XXFA 4NWLA 1TX6A 3MH6A 3L33A 1BRAA 4GUXA 4AYYB 2PGBB 1FY3A 2QXIA 4OGYA 1O5DH 1OS8A 3H7TA 2SGQE 2ZTZA 4LXBH 3RXGA 2W7SA 2FODA 1ZRKA 2W5EA 3ATMA 2EEKA 2ZFSA 8GCHF 1Y3XA 1LO6A 4Y76A 4D7FA 3UNQA 1SPJA 3MNSA 3EDXB 4DT7B 2A2QH 1Z8JB 3LT3A 1DY8A 4A7IB 4FUDA 1ZPZA 3ZVEA 2AIQA 1DFPA 2OP9A 1MUEB 1T31A 4IGDA 3SUFA 1MBMA 4BXWA 1WOFA 2J95A 2FO9A 3M5NA 2GDDA 1ZHMA 2XBXA 1ANEA 2C8ZB 1GDUA 2OXSA 1C2HA 2O8MA 3A8BA 3RM2H 4WXIA 4Y10E 2XC5A 1HV7A 3MH7A 3ATKA 1E37B 1YYY1 1TMBH 1O3GA 4AFUA 1MKWK 4X2XA 2Q6DA 3SI3H 2UWPA 4NZLA 1NO9H 4K8YA 1IQMA 1NRRH 2AERH 1K1MA 1EAXA 1ZPCA 1IQGA 3GYLB 1P2NA 3MH5A 3TJUA 1P2QA 1SVPA 1V2OT 1P09A 1BTPA 3V12A 1RTLA 2O8WA 2VJ1A 4TYDA 3I78A 1FI8A 3BTWE 5HM9A 2ANYA 3TJOA 1O33A 2C93B 5J4QA 4AGJA 4I8JA 4CRDA 4TWYA 1K1NA 2EI8A 3GCHC 5TJXA 4NA8A 1V6DA 3UNRA 4B2BA 1O3IA 2BY5X 1A5IA 2A5KA 4UFEH 4JZDH 5JB8S 2QXGA 1E35B 1SB1H 3RXOA 1IQNA 3VXFH 3RLWH 3UREA 1BBRK 2JH0D 4ABBA 4X8SH 1MZAA 2JH6D 1O37A 1KXBA 2VIWA 1QQUA 1GG6B 1K2I1 3H5CB 3N7OA 1FQ3A 4Q2KA 1Q2WA 2PHBA 4ZUHA 1VITH 1O2IA 5ABWA 1OWEA 3SU4A 2HALA 5FPSA 1BHXF 1BMLA 1UTJA 3ZYDA 2D1JA 1ZYOA 4KELA 1C2IA 1QL8A 1A4WH 4X6NA 1VGCC 4IMQA 5CHAC 3KEEA 2D8WA 4CHAC 3M7QA 1O2VA 1NY22 2V3HH 1C4Y2 2SGDE 1XVMA 4E06H 1O5CB 2J94A 1NPMA 1QB6A 5K7RA 1JRSA 1O5GH 1P57B 1GBIA 3GDSA 1Z6EA 5ETXA 5AVDA 3SO3A 2Z9GA 2BX3A 3TK5A 4NA7A 4X2VA 5EPYA 1DANH 2QCYA 3MU1A 1ACBE 1G37A 3STJA 3RU4D 3R3GB 4BANB 5FCKA 1AB9C 4ABEA 1KXFA 3E16B 1UTLM 2ZHQH 3UNSA 3AASA 4X2WA 4FUJA 3SBKA 1O5EH 3QGNB 2ZGJA 4YLUA 1GDQA 4X1QU 2YNAA 3K6ZA 1AI8H 2BY7X 1QBNA 3GCHB 1SGEE 1HAVB 1P2KA 5L30H 2QA9E 4GPGA 5DP9A 5A09A 1TNLA 3LJOA 3ATLA 3EE0B 1KXCA 3RXPA 1MD8A 2VVUA 2BTCE 1A3EH 3HKIB 3UY9A 3OY6U 5EQQA 3SZNA 1ZTKA 2C4FH 5C5OA 3NKKA 4VGCC 4MDSA 1AN1E 1N6YA 1O5AB 1C1RA 3BG8A 5A0BA 1LVMA 1F0UA 4Q7XA 2FOBA 3RXTA 2VINA 4I8LA 1P03A 3SOSA 4AG2A 3M3VA 1TLDA 4MPUA 1GJ4H 3E0NB 3I29A 1LPGB 1PYTC 1SGTA 1WBGB 1JRTA 3SNBA 2FOHA 1KTTB 5A2MH 1O2OA 3NZIA 2ZECA 2STAE 1V2KT 1BZXE 1ELCA 2ZHEH 1TNIA 3M7TA 1EB2A 2BD5A 1TQ0B 3F9FA 3F68H 3HK3B 2BLOA 1C5MD 1DE7H 4AX9H 1Z1IA 2VVCA 1V2QT 5TCAA 2OC7A 1O5BB 3ELAH 1BIOA 3TGKE 5GJ4B 8ESTE 3P8NA 1Q31A 3SHCH 2OBQA 4GAWA 1SQOA 3ZZ5A 2DE8A 1NM6A 2ZP0H 1ZPBA 4WMEA 3UTUH 1HAIH 4NG9H 4FUEA 5K0HA 2QF3A 1KLIH 2Q6FA 1TIOA 2A32A 3P8OA 2A0QB 2LPRA 2J38A 1F5LA 1AU8A 4A1TA 1OWKA 1YPLH 1GWAA 4NZQA 1WTHD 5F8TA 2F9PA 6LPRA 5IDKA 4ZROA 4CRCA 1HAGE 1L4DA 2AFQB 4RKOB 3LC5A 1AWHB 2GX4A 1ZGIA 2OBOA 1PPZA 2AGIX 3SJOA 1O2UA 1LHCH 5IYTA 1PPHE 1GHAF 1FN8A 2EA3A 3DA9B 1W0YH 1C5XB 4DCDA 1LPZB 1AIXH 3U1IB 2VNTA 1GHBF 1TQ7B 1UVSH 1P2JA 2QF0A 2YOLA 5C5NA 1TYNA 2JETB 3OTJE 1CHGA 1NFXA 1O2MA 1S85A 3GCOA 1O3AA 3TLOA 5SGAE 1DLEA 3UR9A 2ZU1A 2V0BA 3H7OA 1K1PA 1UCYK 1FN6A 3RMLH 1O2NA 3PYHA 3A87A 3ITIA 3UWJH 1ETRH 1UHBA 2RG3A 3MMGA 4ZKNU 2VIPA 1IOEA 4MG3A 4YZUA 1BMMH 3RXIA 4BAMB 4JYVH 1C1QA 1C4V2 1LMWB 4FUIA 1V2ST 2O9QA 1ANBA 1VJAU 2C8YB 1HAOH 4Z0KA 2FOAA 4NCYA 1GJ8B 1C2GA 2SGPE 3QZRA 1C5SA 2ODYB 1IQLA 3UFAA 1EPTB 1QCPA 1EAWA 1GCDA 1FMGA 4U2WA 2FI5E 4ESTE 1H9LB 3KN2A 1PQ5A 1GVKB 1SGQE 4R0IA 1YPHC 2YNBA 1H1BA 3MO9A 1E0FD 3TGJE 1YLDA 2BQ7B 5C3NA 1AD8H 2PW8H 3T29A 2OC1A 3A7YA 2BDIA 1O3KA 1LDTT 1SGDE 2C90B 1SMFE 2BZAA 5C1YA 1TBZH 4AN7A 4X0WU 1GPZA 4NIXA 4XFQA 1AZ8A 2G5NA 2PV9B 4DG4A 2CGAA 3EA9A 4ABHA 3Q3KA 1CE5A 3SGQE 1Y5AT 3SJ8A 1ETSH 4FUBA 5JB9S 2BHGA 4K1EA 2OQ5A 4ABDA 2BMGB 3OYPA 3LGIA 3TK9A 1GJDB 4WMDA 1GBLA 3PV4A 1WQVH 2FDAA 2XBWA 3V3MA 1GI9B 2AS9A 2TIOA 4Y71A 1QL9A 5T6FA 1Y3YA 1BJVA 3LC3A 4XBBA 1KDQA 4E7NA 1GMCF 1P12E 4I31A 1D6WA 3GCTG 1NU7B 1FONA 1DPOA 2SFAA 1XXDA 1J17T 3K9XB 2QC2A 2H9TH 1DDJA 4FVBA 1ID5H 3Q3XA 1ZSLA 2BDGA 4K69A 6GCHG 3ZZ3A 8KME2 3SNCA 2FI3E 1GVZA 3TVJB 1TFXA 4ABFA 3MFJA 1YPKH 1SOZA 2RA0A 9ESTA 5E8EH 1TABE 1VCPA 2BD9A 4ZH8A 3GY3A 2PUXB 3KGPA 1SLUB 5DO4H 1ZHPA 5L6NH 5FAHA 2ZGXH 4B75A 3TH2H 2ANKH 1TRNA 1VITF 2B0FA 1C2DA 3P92A 1P11E 1TGCA 3HGNA 2CMYA 3KHVA 1O3BA 3HPTB 3BG4C 1YCPM 4B73A 1HAYB 1GI3A 1K21H 1HXEH 2WUBA 3UWIA 3RXDA 3PLBA 2P8OC 3M37A 1UO6A 1C5LH 3ZZ9A 2ZU2A 4BNRA 4LOYH 3M7UA 5DP7A 3MO3A 1DX5M 1JMOH 1AB9B 1CHOG 2FTMA 1RIWC 1VZQH 1YC0A 1NTPA 1CGIE 2F9NA 3A84A 2R3YA 2ODQA 1KIGH 5EW2H 4YM9A 2FS9A 2PGQB 3FP6E 1TGNA 4JZ1A 3RP2A 4HZHA 1GJCB 1O39A 4BAOB 1W10U 1B5GH 1DWEH 3M35A 1C5YB 2F91A 3PLPA 4NFFA 4Y7AA 2D2DA 1KXAA 3TITA 1RXPA 3P6ZB 4B2CA 2Z3EA 4XBDA 5CHAB 3QWCH 3RC6A 2AYWA 1C5OH 1SC8U 1F5KU 3HK6B 1B0FA 4ZHAA 1PFXC 1DY9A 3SV2H 3UIRA 1A61H 3HATH 3VFEA 3SU5A 2NU2E 3NXPA 3NCLA 2ZCHP 2O8LA 4LZ1H 2FEQH 3K65B 2QXHA 1JIMA 1HJ8A 2CJIA 3RXVA 6ESTA 2A1DB 4KTUA 1ESBA 4K8BA 2Z7FE 2OINA 3UOPA 3ENSB 4JZFH 5FXLA 3SN8A 3VB5A 4GCHG 2AH4X 4DIIH 2GV6A 1W13U 2Y7ZA 2A7HA 1O2PA 1UTKA 3PTNA 2BVXH 1KLTA 3QO6A 2G52A 1EKBB 5E0GA 3VB4A 1DITH 1XUKA 3LGYA 3LPRA 4GHQA 3S7HB 1V2VT 1P2OA 2J34A 3RXUA 2BVRH 3TNTA 3VGCB 1XM1A 1DLKB 3TPIZ 3T2NA 1A2CH 1T32A 1HDTH 4FUCA 2ULLA 2ZPRA 3SU0A 3EYDA 1HXFH 2GGVB 2BM2A 1DM4B 1LKBA 2NWNA 1G36A 5DKMA 2G81E 1FIZA 2Z3DA 1QR3E 1LQDB 1MD7A 2H6MA 1IHTH 3LONA 3E91A 1GI2A 2VIVA 1UTOA 3MU0A 1G32B 1AFQC 1A0LA 4Z6AH 3SV8A 1HB0B 1FPCH 5JPMH 1O2HA 4WMFA 3SNDA 2BQ6B 3RXHA 1G9IE 1S81A 3MTYA 3U8OH 1EPTA 1VCQA 4DURA 1OPHB 1A46H 1O2TA 4JMYA 3ZVDA 2TGDA 2TRMA 2XYAA 1D3PB 1C5ZB 1BTXA 1DWDH 5EODA 2SGEE 3PROA 3ZV9A 1F2SE 5AF9H 3RXAA 3RU4E 2V3OH 1GI1A 4E05H 1P2MA 4CRAA 1C9TA 3CP7A 1C2KA 1BMAA 2WPHS 1ZGVA 2RDLA 4I7YH 4KTCA 1HUTH 1T8OA 4Y8XA 1DT2A 3W94A 2GZ8A 2DUCA 1ARBA 1SBWA 2BXUH 3A7ZA 1GHVH 3MH4A 1FLEE 3A7XA 1C5QA 1X7AC 4OS6A 1SFQB 3S9BA 3E0PB 4K3JA 1NT1A 3L3TA 2A7JA 1HYLA 5HYOA 3LDXH 3QTVH 5LPRA 1GHXH 2C8XB 4LZ4B 1F0SA 1K9OE 5HMAA 4UFGH 5F6MA 2ZGBH 1UVUH 1GI6A 5FX5A 3VPKA 1B0EA 3P8FA 1TA6A 1WU1A 3UQVA 1SGYE 2VVVA 4LK4A 3VGCC 3WY8A 3O8BA 1P2IA 1TNKA 3O8DA 1HJAB 1KYNA 3TH3H 3KL6A 3QTOH 1S0RA 2BD3A 1A0HB 3SU2A 3AW1A 2B5TB 2UWLA 2ZGCA 4HGCA 1K1IA 1RIWB 3A86A 1NFUA 1UTMA 4CHAB 2H9HA 3SJ9A 1CT0E 1PQ8A 1LKAA 3S0NA 7LPRA 1EASA 3O8CA 1FUJA 4D7GA 2G00A 2FM2A 3AVZA 3FANA 4K5ZA 1MTWA 1O3JA 1P01A 1S6FA 3RXBA 2CF8H 3FVFB 4AFQA 2FXRA 4YOIA 1PQ7A 2BX4A 1GMDG 3QK1A 3T25A 3V13A 3TU7H 1K1JA 2Z9LA 1BUIA 3U98H 3MU5A 4D76A 7GCHG 4H4FA 1GBEA 1EXFA 1ELAA 1W11U 1HAHH 1SQAA 2BLWA 1WAYB 3GY6A 3ZVGA 1XX9A 1MU6B 4NFEA 1C1SA 2V6NA 2QAAA 4ABJA 1LHGH 4YOJA 2IN2A 1FPHH 2HWLB 2P3TB 3LH1A 1GJBB 3LOXA 4KTSA 1SQTA 2ZKSA 1DXPA 2CHAB 4I32A 2F9OA 3VEQB 1IQHA 3DUXH 2C3SA 1AMHA 3MNBA 5EXLA 2VIDA 5FBIA 1YGCH 4X2YA 5A0AE 1G3EA 5JBBS 2Q6GA 3RXQA 5LH8A 2Z3CA 2BB4A 1C5RA 2WPMS 2EC9H 4B74A 4BAHB 5C1UA 3MI4A 3PB1E 3EA7A 2KAIB 2TBSA 1H4WA 1ZSJA 1TBRH 1Z7KA 5C2ZA 3PWCA 1G3CA 1O32A 1GJ6A 4BXSA 4SGBE 1L1GA 2OD3B 4H42U 4B2AA 3BIUH 3GDUA 1TGBA 3EQ0H 1EATA 1IHSH 5JBAS 1W7GH 1GHYH 1ZSKA 2QN5T 1T8NA 1HGTH 1KTSB 4ISHH 5DG6A 2ZFTA 1GMDF 3Q76A 1EQ9A 1XKBC 3GCTF 4YT7H 1QJ1B 2HVXA 3SHAH 2FOCA 1GBTA 3LKWA 4B71A 4DY7B 5B6OA 1O2JA 1MAXA 5EXMA 1WYKA 1BMNH 1TX8A 4IBLH 1BRUP 6GCHF 4BAKB 1SGPE 2BZ6H 1DVAH 2TGAA 2R9PA 2WYJA 4UFDH 4ISIH