2H1UA

Porcine pancreatic elastase complexed with metpheleuglu at ph 5.0
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MFLE
publication title Structural analyses on intermediates in serine protease catalysis.
pubmed doi rcsb
molecule tags Hydrolase
total genus 60
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2006-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2h1uA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2h1uA01
4FUIA 4BXSA 3EGKH 1O3MA 2BB4A 5DGJA 5DG6A 2BD9A 1ESTA 1FY8E 1C5PA 1G32B 4ABGA 1MU8B 1UJ1A 2W7UA 4NIYA 1OWEA 3SUFA 1RGQA 1S6FA 5JB8S 2YOLA 1Q2WA 5AHGH 4CHAC 1Z1JA 1O3BA 1Z6JH 1S81A 1C9TA 1JIMA 1MKXK 2DE9A 3RC6A 4XSKU 2ZFFH 4BAQB 1JMOH 3K9XB 1C1MA 2A5IA 1T8NA 1C1WH 4RKJB 2EA3A 5E2PA 3P17H 2ZWLH 2G52A 3UQOA 3BTTE 2BDBA 1ARCA 4LOYH 5JBTA 2QGRA 2UWPA 4I33A 1GMHF 3UFAA 3RMOH 2VGCC 3MU8A 4NZQA 1LO6A 3V3MA 2EEKA 1K28D 1EP5A 3A89A 3MU1A 3MTYA 2LPRA 2OC0A 1Y5UT 3SV2H 3LGIA 2R3YA 3NUMA 1A3BH 2BY8X 2BD5A 5A8ZA 5C67A 3WY8A 3O8BA 2A0QB 5EQRA 1P9UA 1SGNE 2GZ9A 2OC7A 5AF9H 2F83A 4KTSA 2G51A 2CXVA 1NT1A 1O3EA 5TCAA 1P12E 2V0BA 1L2EA 5EODA 4ZXXH 4AFUA 5LPEA 1GBJA 4NWKA 1GGDB 1Y3VA 2THFB 1MKWK 2Y7XA 5EW1H 1UVSH 2FS9A 1GJ6A 5IDKA 2PUQH 3UQVA 1LKBA 1PQ8A 1DANH 4AZ2B 1O2JA 1HJAB 4ISIH 3MU0A 3ZZAA 1WYKA 1TMBH 4KGAA 1BRCE 1LCYA 1EJNA 2FI5E 3MFJA 3LU9B 3LH3A 1CVWH 1FI8A 3URCA 1W13U 1O3OA 1SGFG 1GG6B 1Y3WA 1KXDA 3A85A 1YYY1 4XE4A 1N8OC 5EPYA 3SGBE 2QXIA 4MPXA 1ZRKA 1UO6A 4MQAA 1UTMA 1B0EA 1HIAA 1ZHPA 1IQMA 4FU9A 1C2DA 2BDYA 2BTCE 1O2MA 1P11E 2FOEA 1J17T 2ZGJA 1EPTA 4WJG2 3PWCA 1OWIA 4AYVB 2F9UA 1AE5A 1TNHA 3URDA 1CA0C 3RU4T 1V2JT 1C5RA 2QV1A 4FUGA 4WMEA 2YNAA 2ZZUH 2AGIX 1OKXA 1BDAA 3LOXA 1K1PA 1LPGB 5GDSH 1EZSC 4MG3A 1BZXE 1D3QB 1AY6H 1NROH 1LTOA 3D65E 2FWWA 5LGOA 2H9EH 1O0DH 2C90B 2QAAA 2OUAA 4X8UH 3QUMP 3E6PH 3CS0A 3SW2B 3P8NA 5TCCA 1BMNH 1GBAA 4ISNA 4YLUA 5T6FA 1WAYB 4D76A 4ZXYH 1ZGVA 3NCLA 5DK1A 3UR6A 1ESAA 1BTZA 4IN1A 4SGAE 2VVUA 2GP9B 2P8OB 1QA0A 3SJKA 1V2WT 3N7OA 5FCKA 1C4V2 1EAWA 2WPIS 1NFYA 1ZZZA 1MQ5A 3LH1A 2J94A 1TOMH 3RXTA 3P8FA 5BRRE 3HK6B 1D6WA 2HPQH 2CF8H 4K1EA 3U98H 5B6OA 1JXPA 2BX4A 4YZUA 3TITA 1YPJH 3RC5A 2BOKA 3RXLA 4B2BA 2CGAA 1YPHC 1GHBF 1K1MA 3A82A 2XC5A 3DUXH 3EA8A 2HVXA 3TNTA 3DD2H 4A1XA 4DIIH 1OYTH 1DWBH 5JDUB 1QRZA 1BMLA 1OP2A 1ELVA 1IQKA 2OQ5A 1T32A 1JWTA 4B71A 2ZU5A 1TAWA 1KIGH 1H8IH 1FAXA 1NC6A 1E38B 1C2JA 4FU7A 2QXGA 1C5LH 1RTLA 3L6PA 2A2QH 1T4VH 2BM2A 2R0KA 1A5HA 1NPMA 3F68H 1LHFH 4DIHH 1MCVA 3NXPA 4WH6A 1NY22 3BG8A 3UTUH 1XVOA 1NU9A 2VIOA 1DM4B 3ATMA 5ESBA 1TGNA 1ELBA 2D8WA 4YT7H 1WCZA 3O8RA 3Q3XA 3U1IB 1AQ7A 5DO4H 1TBQH 3ZZ9A 8GCHG 4MNYA 1BITA 1TPPA 1AI8H 2P3TB 4ZROA 2A32A 1P2IA 3MNXA 1UTLM 3TK6A 1TONA 2ZCLP 1XXFA 4DGJA 1O37A 1A1RA 3A84A 4Q7YA 4HFPB 1N6YA 1GL0E 3EA7A 3HPTB 2ZHQH 1BTXA 5F03A 5GWZA 1T7CA 4GVUA 1PQ7A 3BG4C 1BBRH 2F9PA 2TIOA 2HPPH 3M3VA 1AZ8A 2Y80A 1W0ZU 1ZJKA 2VU8E 1LHGH 2P3UB 1EOJA 1P09A 3QWCH 1LDTT 1GI7B 2ZNKH 4MNVA 1P05A 1UK4A 1WUNH 3HK3B 1GI4A 1GBHA 3LGTA 1CBWB 1ZR0A 2VH6A 4U32A 2RCEA 1GHYH 1MD8A 1G2LA 1P02A 3FP6E 4GAWA 1T8MA 1UK2A 1PYTC 1RD3B 2WYGA 1VGCC 1FNIA 3ZVAA 3TK5A 1UCYK 1O3AA 1DPOA 2GX4A 3PO1C 2R3UA 1KLIH 1C2MA 1NRQH 1CT4E 1IHTH 2OINA 3SQHE 1O2NA 1FY3A 3ATLA 3SUGA 2ZIQH 4QT8C 1BHXF 5L6NH 4X1NU 4NSYA 1O3HA 5ABWA 1C2KA 2J95A 4F4OC 2BOHB 1O5CB 4Y11E 3M5OA 3P8OA 2A1DB 1F7ZA 2ZU1A 4AOQA 3SI4H 4UONA 5EU8A 2A5AA 1Y5BT 1NU7B 1QBVH 1AN1E 2H6MA 1B0FA 1BTUA 1W7GH 4AGJA 4U30A 1O32A 4K5ZA 1KLJH 2BQWB 4ZAEA 3ZZ6A 1C1PA 3QTOH 4IGDA 2M5TA 1QGFA 4WMDA 4INKA 1WU1A 1SR5C 2PWXA 1O2LA 1GBEA 5C1YA 3R3GB 3SV6A 1B5GH 5DP5A 5BPEA 3TIUA 5A0AE 3PLPA 5GPIB 1PPGE 2GD4B 1O30A 5EGMA 1G36A 2FZZA 1S83A 2BY9X 2ZPSA 4R8TB 3QTVH 2KAIA 2BYAX 4ABHA 4GCHG 1YLCA 1NESE 3BF6H 3U1JB 1SLWB 2GCTB 2W7SA 1TRNA 4B2AA 1LHEH 1GCTC 3RXUA 1E36B 1C5MD 1QA7A 3E8LA 1LVBA 4IW4E 1DVAH 4JYTA 2J92A 1HAPH 2QF3A 3AVZA 2XCNA 4TPYA 1PJPA 2V6NA 3A81A 3RXFA 8ESTE 2FS8A 1NO9H 4ABEA 3BIVH 3K6ZA 1L1GA 3SI3H 1AFQC 4BTIB 3F9FA 4X2YA 2ZGBH 2Z94A 1EXFA 3ZVFA 3F9HA 1P2NA 2B8OH 1H4WA 3ODDA 3GCTF 1W12U 1CT2E 1L4ZA 3M35A 2W3IA 2PLXA 2ZPQA 4R0IA 1Y3UA 2R2WU 3RXSA 3TJUA 2P59A 1ETTH 5F8ZA 4I8LA 1JBUH 1OWDA 1P10A 1Y3YA 5I25A 1J16A 3KQBA 3KEEA 1O2GH 4X1PU 2K1QA 2VJ1A 4FUJA 1O5DH 4MDSA 2ZDLA 3ZVCA 3TGJE 2WV5A 3TJNA 1YGCH 1D3PB 4XBDA 2WPJS 1O3GA 4YT6H 4ABBA 1YPLH 1MD7A 2XWAA 4BNRA 2ZDMA 1O3IA 3QK1A 1FLEE 3TPIZ 1BB0B 4KKDA 1NFUA 1CGHA 3TJOA 2BDHA 1UVOA 1SFQB 1P2QA 3QLPH 3LJJA 1NZQH 5SGAE 1UVPA 2ANWA 1KXBA 2PKSC 2VVCA 2A5KA 2BDGA 2FLRH 1A0JA 5AFZH 3F9GA 1RTKA 1O5FH 2GV6A 2LNCA 4GHQA 2PKAB 1O2QA 2ODQA 2HLCA 1Z8GA 1BOQA 2IJOB 1HAYB 3AAVA 4FUFA 2DUCA 1RFNA 1EKBB 3F6UH 1O3NA 5I46H 4MPWA 2ZDKA 1S82A 4OS1A 4FUDA 4X1QU 5JPMH 2HRVA 1KY9A 3SUDA 3LT3A 1XUFA 4E06H 3P8GA 3PB1E 4ABDA 2HALA 1SPJA 3HGPA 1ZPBA 2VWLA 4XDEA 2EI7A 1G9IE 1C5VA 1SSXA 4NIVA 1ZMLA 5F8TA 2NU1E 2GCHG 3ZZ4A 3KCGH 3SORA 2C3SA 2FM2A 3EYDA 4Q80A 1O36A 2Q6FA 2TGTA 2TGPZ 1C1SA 4CBOA 1THPB 5FX5A 1K1JA 3MYWA 1GBFA 1TGCA 4VGCB 3D62A 4X2WA 1GVKB 5EPNA 3GICB 2ANYA 5GCHG 1J15A 1ESBA 1DUEA 5FHTA 3ATIA 1O5AB 1KDQB 2FI4E 1WV7H 4DT7B 3AAUA 5LPRA 1W8BH 3A8AA 2ZHFH 3SU6A 1QQ4A 3DFLA 1KXAA 2O8TA 1GJ4H 3V13A 2J38A 1OOKB 2QXHA 3BTQE 4AORA 1DITH 3OSYA 5PTPA 2HNTC 2ZGHA 1XUKA 1GMCG 4I8JA 2KAIB 4XBCA 3KQEA 4BTUB 1ETRH 3ZVEA 4H4FA 1CHGA 2D1JA 3TVJB 2G4TA 2OBQA 2C8WB 2GMTB 3QZQA 4CHAB 3GYMA 1C5OH 3A87A 1GI3A 1O2IA 3F1SB 1ZHMA 3Q76A 4X6MA 3STJA 3SZNA 3TH2H 1P01A 1DE7H 1YPGH 1HAGE 1JIRA 4WVPE 1HGTH 2V3HH 2ALPA 1T8OA 6GCHG 1MMJN 4TPIZ 1HV7A 3P95A 4Q7XA 1ELAA 1YP9A 2GGVB 1AVWA 5C5OA 3RP2A 1Z8JB 1A3EH 2VGCB 3Q77A 2R2MB 1A2CH 4ABIA 1ELDE 2A45B 2ZQ1A 1FY1A 1QJ1B 1EAIA 1G3CA 3PTBA 1MH0A 4U01A 3ZZ7A 1A5GH 4YOGA 1GVZA 3RLYH 5HXFA 1P9SA 5JBAS 1V2PT 4CRCA 2FMJA 4A6LA 2ZTYA 1NRSH 3GY3A 4THNH 5E8EH 1WBGB 4LZ1H 2G4UA 1HAIH 1PPEE 3PMAB 1V3XA 2JH5D 5C2ZA 1GBBA 1P2MA 1TFXA 2CHAC 2ZKSA 1C5UA 1AGJA 3MO3A 4BAMB 4CR5A 1O3FA 5K0HA 3UPEA 1GBLA 1ABJH 3L3TA 1UTQA 2H1UA 2EC9H 2C8ZB 1ZLRA 1SLVB 3UNQA 1C1QA 4Y7AA 3OTJE 1VITF 4I8GA 5CE1A 2FOBA 3I78A 3SV8A 1DFPA 4UFFH 2FIRH 1ZSLA 1FDPA 1GJ7B 1O3JA 3KQDA 1C1UH 3LDXH 1N8OB 2GZ8A 2XNIA 1GI2A 2OTVA 1Z8RA 1HYLA 5E0GA 3GDVA 1LHDH 3A88A 1X7AC 5IYTA 1THSH 4ZUHA 3NPSA 1WOFA 3A7YA 1ANEA 2FOAA 2ZU3A 2ZTXA 2XBVA 2UWOA 1EZXC 2SFAA 2FYRA 1HFDA 1SGEE 1PPCE 4A92A 1ZPZA 3RM0H 1CA0B 2O8UA 1H8DH 1FY5A 3ENSB 3UWJH 3BTFE 2BHGA 7LPRA 3FAOA 4Z0KA 4HGCA 3JZ1B 1SI5H 3RXCA 2QCYA 4UFDH 1CHOG 3FZDA 3B9FH 1W2KH 1K2I1 2GTBA 1C2GA 2IPHA 5DKMA 9LPRA 1O3KA 1ANCA 1P3CA 3UNRA 2OXSA 5A09A 1Z8IB 2PFEA 3O8CA 1O2VA 1IHSH 2FTLE 3ODFA 4OS7A 4WWYA 2XBXA 3SJOA 1VR1H 1OPHB 1V2MT 1EAUA 4ISHH 1DWCH 3M61U 1RS0A 1FN8A 1LVMA 4FUHA 2ZPRA 4ABFA 6CHAB 4NCYA 2FX6A 1AMHA 1P2KA 1UVTH 2BD8A 2Q6DA 1XVMA 1O2PA 2A4RA 4YESB 3P92A 1EZUC 1WQSA 1NS3A 1TB6H 1QURH 2XBWA 1ELTA 2O8MA 4I31A 1ELGA 1P03A 3E16B 2ZECA 1UK3A 3TJVA 1E0FD 2V3OH 4RN6A 1BBRE 4ASHA 3ZZBA 3SU1A 3GISB 1TBZH 1DSUA 4XOJA 3VB6A 1D4PB 2W3KA 1H9LB 4O03A 2Q6GA 1QB1A 1FIZA 1OP8A 3RU4D 3W94A 1O5EH 3T25A 1F92A 3PLBA 1C2IA 3C27B 2QYIA 3DT0H 3O8DA 3RXEA 1P2JA 4NA8A 1IOEA 1ZJDA 4DG4A 3QGNB 1VZQH 1Z6EA 2FPZA 3OY5U 1B7XB 1GJBB 4K3JA 1XX9A 3UWIA 4U2WA 1MCTA 3UR9A 5DP4A 1T4UH 1BUIA 3HATH 4BXWA 3SV9A 1VITH 5AFYH 3UREA 2O8LA 3SJ8A 1IQJA 3HKIB 3RXDA 5EQQA 1IQGA 1PPBH 2P95A 1U6QA 1YLDA 5CHAB 3AASA 4ZKRU 3MH4A 3RXGA 2PGQB 2VIDA 1O5BB 4FUEA 1FONA 3HGNA 4IMZA 1HPGA 1TQ7B 3A7VA 1GMHG 2FLBH 3PROA 2FO9A 1AHTH 1FPCH 1YM0A 3PMHB 1D3TB 1F0SA 3ZVGA 1GWAA 1ZHRA 5FBIA 3RXQA 2QY0B 1O2KA 4Y10E 5HM2A 4Y6DA 5E0JA 2VH0A 1FY4A 2BD3A 3QN7A 3TH4H 4ZKNU 3STIA 3RXIA 3BG4B 1MTWA 2WPMS 4INHA 5EW2H 1UHBA 1K21H 1L0ZA 2P8OC 3SNEA 1BMMH 3FFGA 3SBKA 1YCPM 2ZEBA 1G3BA 3LONA 2F3CE 1K1OA 5L30H 4KTUA 3GY6A 1F2SE 1TWXB 1KTSB 4ZHLU 1WTHD 2BY6X 1S84A 1XUIA 4JYVH 3W95A 4K2YA 2QC2A 1V2VT 3TGKE 1KXEA 1GMDF 3LGVA 1VGCB 1C4Y2 1F0UA 2UUYA 1YCPK 3MNBA 1DLKB 2VIPA 3PO1B 1TNLA 5T6GA 2Z9GA 1PFXC 2AH4X 1ZPCA 1MTNC 3UOPA 3SGAE 1DLEA 1ZOMA 4LZ4B 1SGPE 1QBNA 4DURA 1IQFA 1HIAB 1O2XA 1DY8A 3S0NA 4FVDA 1ETSH 1EPTB 2XRCA 1LPZB 1RJXB 1W11U 3PV4A 4YO9A 4A7IB 3ATWA 2WV4A 1XMNB 4FUCA 4Q2KA 2F9OA 3MH7A 1QB6A 2J2UA 2ZCKP 4NWLA 1TA6A 3BTWE 3K2UA 1PPZA 5EXMA 4CR9A 1F5LA 3VXEH 1TIOA 1BQYA 1DOJA 3H5CB 3U8RH 2V35A 4BANB 4Z6AH 5DP8A 1V2KT 1BTWA 3M7QA 1LQEA 4UDWH 2FOFA 5HGGA 1AKSA 5DP9A 1T8LA 2HOBA 1BRBE 1TX8A 1SHHB 1K22H 3ZYEA 5H4IB 3LGYA 4OS2A 2F91A 4Y8ZA 1O33A 1C5WB 2UUKB 5DP6A 3BV9B 1QCPA 1GCTB 1ZRBA 3KGPA 2ZCHP 3SUEA 4Y0YE 1VCWA 3KNXA 1EASA 2JH0D 4ZHAA 4Y76A 4BTTB 1SOTA 1ELEE 1E35B 4CRAA 2VWOA 3RUOA 1CQQA 1UTOA 2ZC9H 1MBMA 1XKAC 2HNTF 2H5CA 3LIWA 5ETXA 3T26A 3P6ZB 1CBWC 4AFQA 7GCHF 1C5SA 1QR3E 3JZ2B 2UUFB 3EA9A 1Y3XA 1GJCB 3GYLB 4X8TH 5FXLA 1HCGA 1QIXB 3T29A 3FZZA 4D7FA 2VB0A 2ZU2A 3IWMA 5A0BA 1GHBG 1TNJA 3MI4A 4J1YA 1GHAF 4UFGH 2P3FH 3RXHA 3PYHA 3LJOA 2CV3A 1TQ0B 3RXBA 1TNGA 1ZYOA 1FAKH 2BMGB 1EP6A 2BQ7B 2Z9KA 5EG4A 2OLGA 2Z3DA 5T6DA 1LMWB 3I77A 4E7RG 1FV9A 3T28A 1GDQA 3Q3KA 1SLXB 3TH3H 1C2FA 3KF2A 3KIDU 1NRRH 1WSSH 1QL9A 1JOUB 5FAHA 3AW0A 1GDNA 1UHBB 4IMQA 1O2OA 4HTCH 2BY5X 4JZ1A 1RIWB 5K7RA 2SGAA 4XFQA 4NA9H 1GHVH 3VB3A 1O39A 5T3HA 1BMAA 3CS7A 2FOGA 2J4IA 2AMQA 1TRYA 7ESTE 2VNTA 2H5DA 1TNKA 1O35A 2Z9IA 1EQ9A 2XC0A 4I7YH 3RLWH 2GT8A 1FIWA 2BVXH 2BY7X 2Z9JA 5F8XA 5GIBA 3GCHC 3ZV9A 1P04A 3Q3YA 2PW8H 1IQIA 1ELFA 2ZGXH 5DP3A 2ZF0H 2FODA 1C4U2 1V2NT 2F9BH 2ZFRH 1IAUA 2UWLA 1PPFE 1MZAA 2GT7A 1T31A 1FMGA 1O3CA 1MQ6A 4DW2U 2F9VA 3NWUA 3U69H 4TY7A 1HBTH 2P94A 6LPRA 2H9TH 1TALA 1BHXB 4I8KA 4FUBA 2ALVA 1GPZA 2ZFQH 5CMXH 2BDCA 4RSPA 1J14A 1DS2E 3BSQA 4I32A 2D26C 2XTTB 2B0FA 4X2XA 1ORFA 3PMBB 3BEIB 1UMAH 3QGJA 1GI1A 2O8WA 5G4BA 3SU2A 3RMLH 4DOQA 2OBOA 1YPEH 2OP9A 4IC5A 3BN9A 1SB1H 4NA7A 4H42U 1SLUB 4K8YA 1AKSB 2IOTA 1CO7E 4D9QA 3TLOA 4JZEH 1ARBA 4GSOA 1TGSZ 1SGFA 3TK9A 4KP0A 1TNIA 3MNSA 4D8NA 1W14U 4MNXA 4E7NA 3PWBA 1GL1A 4M7GA 4CRDA 1GI8B 3B23B 1AWHB 2TRMA 1ZTLA 1H1BA 2FI3E 1RTFB 4UFEH 3A8DA 2FYQA 1HXFH 3UOUA 1D9IA 1G3DA 3QDZB 1LKAA 3ZZ5A 2WUBA 5E0HA 1OXGA 4YLQH 1ZSKA 3FP7E 3E91A 3A7TA 3M5NA 1FN6A 3ZVDA 1QNJA 1UTKA 1THRH 3S7KB 4B74A 1L1JA 2STBE 1O38A 3SN8A 3T2NA 2B9LA 2HGTH 1K1IA 2ZTZA 1D3DB 1SFIA 3SU5A 3RXMA 4WF8A 4DJZB 1AB9C 3PMJA 1GBDA 3D49H 2BD4A 3LGWA 4TYDA 2PUXB 1DY9A 3VGCC 5JBBS 1NM6A 2H2ZA 3C1KA 1OSSA 4IS5A 4MTBA 1GDUA 1QJ6B 2ODYB 3BTDE 3QO6A 3CP7A 1EUFA 3A7ZA 1V2LT 1E34B 3MOCA 1F0TA 2O9QA 5FPYA 1GJAB 1K1LA 3ZVBA 4NG9H 2ZI2H 2A7CA 3KHVA 2GDEH 2W26A 2VIQA 3GOVB 1P0SH 1TMTH 2GV7A 1P8VC 4JMYA 5L2ZH 2PSXA 4UE7H 3GCNA 1F0RA 1XKBC 4KTCA 1UCYH 3GCTG 2ESTE 1TX6A 5AVDA 3GY8A 1Z7KA 2C4FH 4INLA 1BBRK 2BX3A 2Z9LA 1C2EA 3FVFB 2Q1JA 4D7GA 1VCQA 2WPLS 2BD2A 5GJ4B 1A0HB 2FOCA 4RKOB 1LHCH 1BRAA 4UEHH 2I6QA 3E3TA 2B5TB 1YPHE 1AVXA 2OCVB 5FX6A 4X1SU 5F6MA 1HUTH 1GCDA 2GMTC 1WTGH 1O2ZA 2SGPE 2JETC 3S9CA 3MH5A 4OS6A 1LVYA 2ODPA 1V2QT 2BDAA 1KTTB 1J8AA 1SHYA 5HYOA 3M7TA 3QX5H 4WH8A 1O3DA 2ZFPH 3IITA 4NSVA 2C8XB 2ANKH 4YOIA 3SO3A 4TWWA 2XXLA 2BVRH 3G01A 1VJ9U 1DT2A 4DVAU 1EJAA 3FANA 2ZHEH 4I8HA 1EX3A 1Q31A 7KMEH 2Z6BD 3SNBA 1E37B 1TA2A 4XBBA 3SGQE 1YF4A 1Y5AT 3SOSA 3GY4A 1Q3XA 2UUJB 4JK5A 3EE0B 4D9RA 1TGTA 4DY7B 1S5SA 2D2DA 4X6NA 2BLQA 1O2SA 1LQDB 3LC5A 3RXOA 1QRXA 4O97A 2WINI 5C20A 2CN0H 1CGJE 2XBYA 5A8XA 1L1NA 2ZHDA 1FZZA 3BTKE 8GCHF 2BXTH 2G81E 3M3TA 1F5RA 3RMNH 3T27A 8LPRA 1P06A 4NIXA 1QTFA 1BA8B 4B75A 1MUEB 4ZKSU 1SBWA 2VWMA 4H6SB 1OYQA 1YKTA 2ZGCA 3U8OH 1NN6A 2RG3A 1RXPA 4HZHA 4ZH8A 2R0LA 2G5NA 3UUZA 2ZDNA 3ZV8A 1YBWA 3BTME 1SC8U 4IC6A 1UTPA 1J9CH 4FU8A 3TU7H 3GY7A 3RM2H 4MVNA 3NK8A 3M37A 3T62A 3ZZ8A 3Q00A 4B73A 1AUJA 4AX9H 1GVLA 1Z71A 1NFXA 2G5VA 1EJMA 2TGAA 1TGBA 1ANBA 4K69A 4PROA 3RU4E 2CF9H 1C5XB 2AS9A 3EDXB 3QZRA 1SOZA 2G8TA 4LK4A 3A83A 2C8YB 1GGDC 3I29A 3E0NB 3SHAH 1A61H 1P3EA 2H9HA 4UD9H 1HAHH 3OY6U 5EXNA 1OP0A 1HJAC 2IN2A 4CRBA 4ISLA 2ZG0H 2EI8A 1OWJA 1PYTD 2QXJA 3GY2A 4FVBA 4IN2A 5A8YA 1DUAA 4OS4A 4O3UA 1SQAA 1UTNA 1GG6C 1TBRH 1ACBE 1SGCA 3HKJB 4NFEA 3V12A 5C1XA 3BTHE 3MNCA 3RXKA 1HAVA 1O2HA 3ATKA 2SGFE 1S0QA 1SGDE 4A1VA 1YPMH 1CA8B 2XCFA 2ZA5A 3MMGA 2TGDA 1ZTJA 3ZZDA 4NFFA 3E90B 5DJ7A 1KSNA 1MBQA 2QA9E 3ZZCA 1GHXH 2QF0A 1DICA 4K60A 1LVOA 2PHBA 1AVGH 5JBCS 4BAOB 2ASUB 1W3CA 1FPHH 2HWLB 6CHAC 1INCA 5LH8A 1TLDA 3MO9A 1W10U 4OS5A 4H6TA 3DFJA 2FX4A 3VXFH 1Z1IA 1NRNH 1P2OA 4NZLA 4B1TA 1MZDA 1XUJA 1C1RA 2SGQE 2VWNA 1C5ZB 2A31A 3ELAH 1O3PB 2NU3E 1KLTA 1AU8A 1V2OT 1SG8B 2Z3CA 1GI0A 3MHWU 1QRWA 4GCHF 2BQ6B 5J4SA 4KELA 2XC4A 5HM9A 1C2HA 4Y0ZE 3A8CA 1TRMA 1VITG 3P70B 1MTNB 4JCNA 4WXIA 3U8TH 1MAYA 1XUGA 1G2MA 2FTMA 2NU0E 1TX7A 1IQEA 1O2UA 2A4GA 1K1NA 3RMMH 2A7HA 2WYJA 1DXPA 1EZQA 1NTPA 2ZO3H 4GHTA 8KME2 1C9PA 1EATA 1W7XH 2AIQA 3A7XA 4YOJA 1C5TA 1DX5M 2PR3A 1HJ9A 3RXAA 2P93A 2NU4E 1O2YA 4HI3A 1TOCB 4ZMAH 1ZMJA 4ABJA 1ID5H 2FOMB 4Y8YA 1V6DA 5CHAC 4JZFH 1PQ5A 2AERH 3GDUA 5GXPA 1EB1H 3L33A 4CRFA 2VIVA 1TE0A 1HNEE 1ANDA 1FQ3A 1H9IE 3S9BA 4Y8XA 2YNBA 3OX7U 4B76A 4DCDA 3FP8E 1MTVA 4WMFA 2NU2E 2BZAA 2SNWA 1DXWA 1DWDH 1SVPA 1GI6A 5JYIA 3GCOA 5HMAA 3UY9A 1AZZA 4JK6A 4Y79A 1FJSA 2QIQA 1HDTH 2B7DH 1N1LA 2ZDVH 3ITIA 1O31A 3PTNA 4TWYA 1OWHA 1PPHE 4CRGA 1G30B 2OQUA 3SJ9A 5EOKA 1BCUH 1MKXH 2ILNA 2WUCA 1GBKA 5A2MH 4ZKOU 2AEIH 1FUJA 4GLYA 4OGYA 1TPAE 2BLOA 5DP7A 4A5TS 2ZP0H 2PKAA 3BTEE 4K1TA 3GDSA 1GBIA 2A2XH 1Y8TA 2FP7B 3E1XB 3LC3A 3OU0A 3KL6A 2JH6D 1FXYA 3RXPA 3UIRA 4CREA 2PGBB 3S7HB 1H9HE 1C1VH 1HB0B 1QL8A 4CH2B 2SNVA 4X8SH 1HLTH 2AGEX 4X8VH 1C1TA 3DA9B 1GBMA 4AGKA 1AE8H 2A4QA 4K8BA 4BAHB 1C5QA 1BTYA 3H7OA 1NFWA 1HJ8A 1JRSA 1DDJA 1W0YH 5FCRA 3VB7A 1CT0E 1PQAA 1F5KU 5LPFA 1YC0A 2AMDA 2Y5HA 3T5FH 2GCHF 3E0PB 1ZTKA 4MLFB 1QJ7B 1HAVB 3GY5A 4BAKB 1BJVA 3SHCH 3ESTA 3SU0A 3BTGE 1MU6B 1OX1A 1JRTA 1NRPH 1V2UT 4Q7ZA 2RDLA 1AD8H 2ZFSA 2VINA 3RC4A 3VFEA 1EPTC 2BVSH 2A7JA 4JZDH 5J4QA 5FPSA 6ESTA 1AFQB 2OC1A 1MKWH 3OYPA 5GCHF 1EOLA 1M9UA 1HAOH 2NWNA 2XYAA 2Y82A 1SQOA 3M5LA 4K1SA 2SGDE 2BZ6H 1BTPA 3BEFB 4O9VA 5EXLA 1OWKA 1A7SA 1SMFE 2HNTE 4X0WU 1QBOA 1KDQA 2STAE 1O5GH 3M36A 2Y5FA 5JB9S 1KXCA 1AUTC 1SGTA 3TGIE 5DPAA 1V2TT 3CENA 1TMUH 2BLVA 1ZGIA 1VCPA 1C2LA 2VIWA 3GCHB 3BEUA 1GMCF 3MO6A 1IQNA 2J34A 2ZQ2A 1TPSA 5E2OA 1C1OA 4OGXA 1VJAU 1DWEH 1AFEH 1QB9A 3VB4A 3R0FA 5FBEA 1KXFA 1EB2A 2WPHS 4E05H 1Y59T 1SQTA 1A46H 5A0CA 2W5EA 3M5MA 1HRTH 1KYNA 2PKSB 3V0XA 2Z3EA 1K9OE 2PTNA 4AYYB 2XW9A 2FESH 3VPKA 6GCHF 1SGIB 1WQVH 2JKHA 2GKVE 5FPTA 4YTAA 3S69A 1ELCA 3VEQB 1CSOE 4NIWA 4Y71A 1OS8A 3UNSA 1GI9B 5C3NA 2SGEE 3LPRA 3PM3A 2BLWA 2TPIZ 1GMDG 1S0RA 3SNCA 2Y6TA 1L4DA 1IQLA 3LKWA 1QFKH 1QY6A 3K65B 2GCTC 4IBLH 3H7TA 4JZIA 4ISOA 4AB8A 1MTSA 4ABAA 2BD7A 4B2CA 1QHRB 3PLKA 3MU4A 1GJ9B 1ZSJA 3A8BA 5L2YH 2VVVA 3ZYDA 2FEQH 1BIOA 1EAXA 1O2RA 1BT7A 1A5IA 1XUHA 3MH6A 1SGYE 3EAJA 1TPOA 1A0LA 2ZDAH 1UCYE 1LPKB 2ANMH 1YPKH 4CBNA 1D6RA 4AG1A 2Y5GA 4FXGH 4Y7BA 2ZU4A 1RIWC 4X6PA 3KN2A 1QL7A 1GHWH 3SV7A 2BXUH 1BTHH 2R9PA 2FOHA 2RA3A 2AGGX 3TNSA 4X1RU 2I6SA 1SGRE 2DE8A 4ESTE 1CGIE 2OD3B 3K6YA 1C1NA 2ZFTA 2BDIA 1A4WH 2G00A 2XWBI 4JYUH 1HXEH 1QQUA 3V7TA 3DHKH 3VB5A 4A1TA 1C5YB 1O34A 2PV9B 3LGUA 1GBTA 2C93B 1O2TA 1CU1A 2AMPA 1AB9B 2F9NA 3RXJA 4GUXA 4SGBE 4X6OA 1MAXA 3IG6B 3VGCB 1GJDB 3KQCA 1N6XA 1GHZA 3A7WA 5C1UA 3EQ0H 4NGAH 4O3TA 3RXRA 2GZ7A 2ULLA 2Z7FE 3SJIA 2PSYA 4AFSA 4MPVA 3BIUH 2OC8A 3MWIU 4AN7A 1GJ8B 2P16A 2G55A 2AFQB 2GDDA 3F9EA 1TYNA 4MPUA 3B8JA 1CHOF 4YM9A 3ZZ3A 1XXDA 3AW1A 4F49A 5C5NA 1S85A 7GCHG 1HAXB 1V2ST 2FXRA 3NZIA 2Y7ZA 1GJ5H 1P57B 1C5NH 3NKKA 1RRKA 1YCPH 2QN5T 4J2YB 2RA0A 1AIXH 5ESTE 3RXVA 1GHAG 1HAZB 3A80A 2Y81A 1ZMNA 2PTCE 9ESTA 2WPKS 3S9AA 1SGQE 4ZHMU 2J9NA 1AWFH 1XM1A 4GPGA 3A86A 1ABIH 1AO5A 1UTJA 3SQEE 4CH8B 1G37A 3D23A 1GI5A 1IQHA 3RDZA 2CHAB 2GVFA 3SNAA 2TBSA 2CMYA 1BJUA 1BRUP 1DSTA 4AG2A 1MTUA 4TY6A 4MNWA 1S6HA 4X2VA 3SNDA 1UVUH 2FDAA 2ZHWH 4VGCC 2CJIA 3SU4A 2EI6A 2JETB 5EQSA 1TABE 4BOHA 3M7UA 2AIPA 5TJXA 1G3EA 3U9AH 1O2WA 4WY3A 3MU5A 4AB9A 1V2RT 2A4OA 1GBCA 4AFZA 1CE5A 3SU3A 4WXVA 1SL3A 4LXBH 2AYWA 1O3LA 3M3SA
chains in the Genus database with same CATH superfamily
4FUIA 4BXSA 3EGKH 1O3MA 2BB4A 5DGJA 2VBCA 5DG6A 2BD9A 1ESTA 1FY8E 1C5PA 2KCOA 1G32B 4ABGA 1MU8B 1W0KD 2RDEA 1UJ1A 2W7UA 4NIYA 1OWEA 3SUFA 1RGQA 1S6FA 5HIZA 5JB8S 5EJ1A 2YOLA 1Q2WA 5AHGH 3W1EA 4CHAC 1Z1JA 1O3BA 1Z6JH 1S81A 1C9TA 1JIMA 1MKXK 2DE9A 3RC6A 4XSKU 2ZFFH 4BAQB 1JMOH 2OK5A 3K9XB 1C1MA 2A5IA 1T8NA 1C1WH 4RKJB 2EA3A 5E2PA 3P17H 2ZWLH 2G52A 3UQOA 3BTTE 2BDBA 1ARCA 4LOYH 5JBTA 2QGRA 2UWPA 4I33A 1GMHF 3UFAA 3RMOH 2VGCC 3MU8A 4NZQA 1LO6A 3V3MA 2EEKA 1K28D 1EP5A 3A89A 3MU1A 3MTYA 2LPRA 2OC0A 1Y5UT 3SV2H 1K0HA 3LGIA 2R3YA 3NUMA 1A3BH 2BY8X 2BD5A 5A8ZA 5C67A 3WY8A 3O8BA 2A0QB 2K8IA 5EQRA 1P9UA 1SGNE 2GZ9A 2OC7A 5AF9H 2F83A 4KTSA 2G51A 2CXVA 1NT1A 1O3EA 5TCAA 1P12E 2V0BA 1L2EA 5EODA 4ZXXH 4AFUA 5LPEA 1GBJA 4NWKA 1GGDB 1Y3VA 2THFB 1MKWK 2Y7XA 5EW1H 1UVSH 2FS9A 1GJ6A 5IDKA 2PUQH 3UQVA 1LKBA 1PQ8A 1DANH 4AZ2B 1O2JA 1HJAB 4ISIH 3MU0A 3ZZAA 1WYKA 1TMBH 4ACBA 4KGAA 1BRCE 1LCYA 5EIYA 1EJNA 2FI5E 3MFJA 3FKSD 3LU9B 3LH3A 1CVWH 1FI8A 3URCA 1W13U 1O3OA 1SGFG 1GG6B 1Y3WA 1KXDA 3A85A 1YYY1 4XE4A 1N8OC 5EPYA 3SGBE 2QXIA 4MPXA 1ZRKA 1UO6A 4MQAA 1UTMA 1B0EA 1HIAA 1ZHPA 1IQMA 4FU9A 1C2DA 2BDYA 5C0TA 2BTCE 1O2MA 1P11E 2FOEA 1J17T 2ZGJA 1EPTA 4WJG2 3PWCA 1OWIA 4AYVB 3KQ5A 2F9UA 1AE5A 1TNHA 3URDA 1CA0C 3RU4T 1V2JT 1C5RA 2QV1A 4FUGA 4WMEA 2YNAA 2ZZUH 2AGIX 1OKXA 1BDAA 3LOXA 1K1PA 1LPGB 5GDSH 1EZSC 4MG3A 1BZXE 1D3QB 1AY6H 1NROH 1LTOA 3D65E 2FWWA 5LGOA 2H9EH 1O0DH 2C90B 2QAAA 2OUAA 4X8UH 3QUMP 3E6PH 3CS0A 3SW2B 3P8NA 3UAIC 5TCCA 1BMNH 1GBAA 4ISNA 4YLUA 5T6FA 1WAYB 4D76A 4ZXYH 1ZGVA 3NCLA 5DK1A 3UR6A 1ESAA 1BTZA 4IN1A 4SGAE 2VVUA 2GP9B 2P8OB 1H8HD 1QA0A 3SJKA 5B6LA 1V2WT 3N7OA 5FCKA 1C4V2 1EAWA 2WPIS 1NFYA 1ZZZA 1MQ5A 3LH1A 2J94A 1TOMH 2CK3D 3RXTA 3P8FA 5BRRE 3HK6B 1D6WA 1NBMD 2HPQH 2CF8H 4K1EA 3U98H 5B6OA 1JXPA 2BX4A 4YZUA 3TITA 1YPJH 3RC5A 2BOKA 3RXLA 3SYJA 4B2BA 2CGAA 1YPHC 1GHBF 1K1MA 3A82A 2XC5A 3DUXH 3EA8A 2HVXA 3TNTA 3DD2H 4A1XA 4DIIH 1OYTH 1DWBH 5JDUB 1QRZA 1BMLA 1OP2A 1ELVA 1IQKA 2OQ5A 1T32A 1JWTA 4B71A 2ZU5A 1TAWA 1KIGH 1H8IH 1FAXA 1NC6A 1E38B 1C2JA 4FU7A 2QXGA 1C5LH 1RTLA 3L6PA 2A2QH 1T4VH 2BM2A 2QF4A 5KGOA 2R0KA 1A5HA 1NPMA 3F68H 1LHFH 4DIHH 1MCVA 3NXPA 4WH6A 1NY22 3PRBA 3VG8A 5EJZA 3BG8A 3UTUH 1XVOA 1NU9A 2VIOA 1DM4B 3ATMA 5ESBA 5F53A 1TGNA 1ELBA 2D8WA 4YT7H 1WCZA 3O8RA 3Q3XA 1YWUA 1AQ7A 3U1IB 5DO4H 1TBQH 3ZZ9A 8GCHG 4MNYA 1BITA 1TPPA 1AI8H 2P3TB 4ZROA 1WDIA 2A32A 1P2IA 3MNXA 1UTLM 3TK6A 1TONA 2ZCLP 1XXFA 3FOAA 4DGJA 1O37A 1A1RA 3A84A 4Q7YA 4HFPB 1N6YA 1GL0E 3EA7A 3HPTB 2ZHQH 1BTXA 5F03A 5GWZA 1T7CA 4GVUA 1PQ7A 3BG4C 1BBRH 2F9PA 2TIOA 2HPPH 3M3VA 1AZ8A 1EFRD 2Y80A 1W0ZU 1H8ED 1ZJKA 2VU8E 1LHGH 2XOKD 2P3UB 1EOJA 1P09A 3QWCH 1LDTT 1GI7B 2ZNKH 4MNVA 1P05A 1UK4A 1WUNH 3HK3B 2EQNA 1GI4A 1GBHA 2KCAA 3LGTA 1CBWB 1ZR0A 2VH6A 4U32A 2RCEA 1GHYH 1MD8A 1G2LA 1P02A 3FP6E 4GAWA 1T8MA 1UK2A 1PYTC 1RD3B 2WYGA 4B6FA 1VGCC 1FNIA 3ZVAA 3TK5A 1UCYK 2M2AA 1O3AA 1DPOA 2GX4A 3PO1C 2R3UA 1KLIH 1C2MA 1NRQH 1CT4E 1IHTH 2OINA 4TSFD 3SQHE 1O2NA 1FY3A 3ATLA 3SUGA 2ZIQH 4QT8C 1BHXF 5L6NH 4X1NU 4NSYA 1O3HA 5ABWA 1C2KA 2J95A 4F4OC 2BOHB 1O5CB 4Y11E 3M5OA 3P8OA 2A1DB 1F7ZA 3F3BA 2ZU1A 4AOQA 3SI4H 3F0OA 4UONA 3N7EA 5EU8A 2A5AA 1Y5BT 1NU7B 1QBVH 1AN1E 2H6MA 1B0FA 1BTUA 1W7GH 4AGJA 4U30A 1O32A 4K5ZA 1KLJH 2BQWB 4ZAEA 3ZZ6A 1C1PA 1MABB 3QTOH 4IGDA 2M5TA 1QGFA 4WMDA 4INKA 1WU1A 1SR5C 2PWXA 1O2LA 1GBEA 5C1YA 3R3GB 3SV6A 1B5GH 5DP5A 5BPEA 3TIUA 5A0AE 3PLPA 3MQKC 5GPIB 1PPGE 2GD4B 1O30A 5EGMA 1G36A 2FZZA 1S83A 2BY9X 4RI0A 2ZPSA 4R8TB 3QTVH 2KAIA 2BYAX 4ABHA 4GCHG 1YLCA 4F48B 1NESE 3BF6H 3U1JB 1SLWB 2GCTB 2W7SA 1TRNA 4B2AA 1LHEH 1GCTC 3RXUA 1E36B 1C5MD 1QA7A 3E8LA 1LVBA 4IW4E 1DVAH 4JYTA 2J92A 5FL7D 1HAPH 2QF3A 3AVZA 2XCNA 4TPYA 1PJPA 2V6NA 3A81A 3RXFA 8ESTE 2FS8A 1NO9H 4ABEA 3BIVH 3DSPA 3K6ZA 1L1GA 3SI3H 1AFQC 4BTIB 3F9FA 4X2YA 2ZGBH 2Z94A 1EXFA 3ZVFA 3F9HA 1P2NA 2B8OH 1H4WA 3ODDA 3GCTF 1W12U 1CT2E 1L4ZA 3M35A 2W3IA 2PLXA 2ZPQA 4YXWD 4R0IA 1Y3UA 2R2WU 3RXSA 3TJUA 2P59A 1ETTH 5F8ZA 4I8LA 1JBUH 1OWDA 1P10A 1Y3YA 5HKKD 5I25A 1J16A 3KQBA 3KEEA 1O2GH 4X1PU 2K1QA 2VJ1A 4FUJA 1O5DH 4MDSA 2ZDLA 3ZVCA 3TGJE 2WV5A 3TJNA 1YGCH 1D3PB 4XBDA 2WPJS 1O3GA 4YT6H 4ABBA 1YPLH 1MD7A 2XWAA 2RFKC 4BNRA 2ZDMA 1O3IA 3QK1A 1FLEE 3TPIZ 1BB0B 4KKDA 1NFUA 1CGHA 3TJOA 2BDHA 1UVOA 1SFQB 1P2QA 3QLPH 1YY3A 1NZQH 3LJJA 5SGAE 1UVPA 2ANWA 1KXBA 2PKSC 2VVCA 2A5KA 2BDGA 2FLRH 1A0JA 5AFZH 3F9GA 3OEHD 1RTKA 1O5FH 2GV6A 2LNCA 4GHQA 2PKAB 3UB0A 1O2QA 2ODQA 2HLCA 1Z8GA 1BOQA 2IJOB 1HAYB 3AAVA 4FUFA 2DUCA 1RFNA 1EKBB 3F6UH 1O3NA 5I46H 4MPWA 2ZDKA 1S82A 4OS1A 4FUDA 4X1QU 5JPMH 2KFWA 2HRVA 1KY9A 3SUDA 3LT3A 1XUFA 4E06H 3P8GA 3PB1E 4ABDA 2HALA 1SPJA 3DCLA 3HGPA 1ZPBA 2VWLA 4XDEA 2EI7A 3F2GA 1G9IE 1C5VA 1SSXA 4NIVA 1ZMLA 5F8TA 2NU1E 2GCHG 3ZZ4A 3KCGH 3SORA 2C3SA 2FM2A 3EYDA 4Q80A 1O36A 2Q6FA 2TGTA 2TGPZ 1C1SA 3F2FA 4CBOA 1THPB 5FX5A 1K1JA 3MYWA 1GBFA 1TGCA 4VGCB 3D62A 4X2WA 1GVKB 5EPNA 3GICB 2ANYA 5GCHG 1J15A 1ESBA 1DUEA 5FHTA 3ATIA 1O5AB 1KDQB 4P00A 2FI4E 1WV7H 4DT7B 3AAUA 5LPRA 1W8BH 3A8AA 2ZHFH 3SU6A 2XNDD 1QQ4A 3DFLA 1KXAA 2O8TA 1GJ4H 3V13A 2J38A 1OOKB 2AHME 2QXHA 3BTQE 1DITH 3OSYA 5PTPA 4AORA 2HNTC 2KX4A 2ZGHA 1XUKA 1GMCG 2JDID 4I8JA 2KAIB 4XBCA 1YLNA 3KQEA 4BTUB 1ETRH 3ZVEA 4H4FA 1CHGA 2D1JA 3TVJB 2G4TA 2OBQA 2C8WB 2EY4C 2GMTB 3QZQA 4CHAB 3GYMA 1C5OH 5C0UA 3A87A 1GI3A 1O2IA 3F1SB 1ZHMA 3Q76A 4X6MA 2WPDD 3STJA 3SZNA 3TH2H 1P01A 1DE7H 1YPGH 1HAGE 1JIRA 4WVPE 1HGTH 2V3HH 2ALPA 1T8OA 6GCHG 1MMJN 4TPIZ 1HV7A 3P95A 4Q7XA 1ELAA 1YP9A 2GGVB 1AVWA 5C5OA 4AC9A 3RP2A 1Z8JB 1A3EH 2F43B 2VGCB 3Q77A 2R2MB 4F55A 1A2CH 4ABIA 4P02A 1ELDE 2A45B 2ZQ1A 1FY1A 1QJ1B 1EAIA 1G3CA 3PTBA 1MH0A 4U01A 3ZZ7A 1A5GH 4YOGA 1GVZA 3RLYH 5HXFA 1P9SA 5JBAS 1V2PT 4CRCA 2FMJA 3OAAD 2ZTYA 4A6LA 1NRSH 3GY3A 4THNH 5E8EH 4Z1MD 1WBGB 4LZ1H 2G4UA 1HAIH 1PPEE 5IK2D 3PMAB 1V3XA 2JH5D 5C2ZA 1GBBA 1P2MA 1TFXA 2CHAC 3KYGA 2ZKSA 1C5UA 1AGJA 3MO3A 1S6LA 4BAMB 4CR5A 1O3FA 5K0HA 3UPEA 1GBLA 1ABJH 3L3TA 1UTQA 2H1UA 1E1QD 2EC9H 2C8ZB 1ZLRA 1SLVB 3UNQA 1C1QA 4Y7AA 3OTJE 1VITF 4I8GA 5CE1A 2FOBA 3I78A 3SV8A 1DFPA 4UFFH 2FIRH 1ZSLA 1FDPA 1GJ7B 1O3JA 3KQDA 1C1UH 3LDXH 1N8OB 2GZ8A 2XNIA 1GI2A 2OTVA 1Z8RA 1HYLA 5E0GA 3GDVA 1LHDH 3A88A 1X7AC 2W6JD 5IYTA 1THSH 4TT3D 4ZUHA 3NPSA 1WOFA 3A7YA 1ANEA 2FOAA 2ZU3A 2ZTXA 2XBVA 2UWOA 1EZXC 2SFAA 2FYRA 1HFDA 1SGEE 1PPCE 4A92A 1ZPZA 3RM0H 1CA0B 2O8UA 1H8DH 1FY5A 3ENSB 3UWJH 3BTFE 2BHGA 7LPRA 3FAOA 4Z0KA 4HGCA 3JZ1B 1SI5H 3RXCA 2QCYA 4UFDH 1CHOG 3FZDA 3B9FH 1W2KH 1K2I1 2GTBA 1C2GA 2IPHA 5DKMA 9LPRA 1O3KA 1ANCA 1P3CA 3UNRA 2OXSA 5A09A 1Z8IB 2PFEA 3O8CA 1O2VA 1IHSH 2FTLE 3ODFA 4OS7A 4WWYA 2XBXA 3SJOA 1VR1H 1OPHB 1V2MT 1EAUA 3N99A 4ISHH 1DWCH 3M61U 1RS0A 1FN8A 1LVMA 4FOUC 4FUHA 2ZPRA 4ABFA 6CHAB 4NCYA 2FX6A 1AMHA 1P2KA 1UVTH 2BD8A 2Q6DA 1XVMA 1O2PA 2A4RA 4YESB 3P92A 1EZUC 1WQSA 1NS3A 3OFND 1TB6H 1QURH 2XBWA 1ELTA 2O8MA 4I31A 1ELGA 1P03A 3E16B 2ZECA 1UK3A 3TJVA 1E0FD 2V3OH 4RN6A 1BBRE 4ASHA 3ZZBA 3SU1A 3GISB 1TBZH 1DSUA 4XOJA 3VB6A 1D4PB 2W3KA 1H9LB 4O03A 2Q6GA 1QB1A 1FIZA 3GS9A 1OP8A 3RU4D 1NBME 3W94A 1O5EH 2V3MA 1F92A 3PLBA 3T25A 1C2IA 3C27B 2QYIA 3DT0H 3O8DA 3RXEA 1P2JA 4NA8A 1IOEA 1ZJDA 4DG4A 3DSGA 3QGNB 1VZQH 1Z6EA 2FPZA 3OY5U 1B7XB 1GJBB 4K3JA 1XX9A 3UWIA 4U2WA 4XD7D 1MCTA 3UR9A 5DP4A 1T4UH 1BUIA 3HATH 4BXWA 3SV9A 1VITH 5AFYH 3UREA 2O8LA 3SJ8A 1IQJA 3HKIB 3RXDA 5EQQA 1IQGA 1PPBH 2P95A 3EE7A 1U6QA 1YLDA 5CHAB 3AASA 4ZKRU 3MH4A 3RXGA 2PGQB 2VIDA 1O5BB 4FUEA 1FONA 5KEDA 3HGNA 4IMZA 1HPGA 1TQ7B 3A7VA 1GMHG 2FLBH 5T1VA 3PROA 2FO9A 1AHTH 1FPCH 1YM0A 3PMHB 1D3TB 1F0SA 3ZVGA 1GWAA 1ZHRA 5FBIA 3RXQA 2QY0B 1O2KA 4Y10E 5HM2A 4Y6DA 5E0JA 2VH0A 1FY4A 2BD3A 3QN7A 3TH4H 4ZKNU 3STIA 3RXIA 3BG4B 1BMFD 1MTWA 2WPMS 4INHA 5EW2H 1UHBA 1K21H 1L0ZA 2P8OC 3SNEA 1BMMH 3FFGA 3SBKA 1YCPM 2ZEBA 1G3BA 3LONA 5C94A 2F3CE 1K1OA 5L30H 4KTUA 3GY6A 1F2SE 1TWXB 1KTSB 4ZHLU 3PV5A 1WTHD 2BY6X 2QE7D 1S84A 1XUIA 2J5UA 4JYVH 3W95A 4K2YA 2QC2A 1V2VT 3TGKE 1KXEA 1GMDF 3LGVA 1VGCB 1C4Y2 1F0UA 2UUYA 1YCPK 3CNRA 3MNBA 1DLKB 2VIPA 3PO1B 1TNLA 5T6GA 2Z9GA 1PFXC 2AH4X 1ZPCA 1MTNC 3UOPA 3SGAE 1DLEA 1ZOMA 4LZ4B 1SGPE 1QBNA 4DURA 1IQFA 1HIAB 1WXRA 1O2XA 1DY8A 3S0NA 5GNDA 4FVDA 3ZIAD 1ETSH 1EPTB 2JJ1D 2XRCA 1LPZB 1RJXB 1W11U 3PV4A 4YO9A 3WWFA 4A7IB 3ATWA 2WV4A 1XMNB 4FUCA 4Q2KA 3AK5A 2F9OA 3MH7A 1QB6A 2J2UA 2ZCKP 4NWLA 1TA6A 3BTWE 3K2UA 1PPZA 5EXMA 4CR9A 2WSSD 1F5LA 3VXEH 1TIOA 1BQYA 1DOJA 3H5CB 3U8RH 2V35A 4BANB 4Z6AH 5DP8A 1V2KT 1BTWA 3M7QA 1LQEA 4UDWH 2FOFA 5HGGA 1AKSA 3F0PA 5DP9A 1T8LA 2HOBA 1BRBE 1TX8A 2F4LA 1SHHB 1K22H 3ZYEA 5H4IB 2L74A 3LGYA 4OS2A 2F91A 4Q4LA 4Y8ZA 1O33A 1C5WB 2UUKB 5DP6A 3BV9B 1QCPA 1GCTB 1ZRBA 3KGPA 2ZCHP 3SUEA 4Y0YE 1VCWA 3KNXA 1EASA 2JH0D 1OHHD 4ZHAA 4Y76A 4BTTB 1SOTA 3SZEA 1ELEE 1E35B 4CRAA 2VWOA 3RUOA 1CQQA 1UTOA 2ZC9H 1MBMA 1XKAC 2HNTF 2H5CA 3LIWA 5ETXA 3T26A 3P6ZB 1CBWC 4AFQA 7GCHF 1C5SA 1QR3E 3JZ2B 2UUFB 3EA9A 1Y3XA 1GJCB 3GYLB 4X8TH 5FXLA 1HCGA 1QIXB 3T29A 3FZZA 4D7FA 2VB0A 2ZU2A 3IWMA 5A0BA 1GHBG 1TNJA 3MI4A 4J1YA 1GHAF 4UFGH 2P3FH 3RXHA 3PYHA 3LJOA 2CV3A 1TQ0B 3RXBA 1TNGA 1ZYOA 1FAKH 2BMGB 1EP6A 2BQ7B 2Z9KA 5EG4A 2OLGA 2Z3DA 5T6DA 1LMWB 3I77A 4E7RG 1FV9A 3T28A 1GDQA 3Q3KA 1SLXB 3TH3H 1C2FA 3KF2A 2YMSC 1NRRH 3KIDU 1WSSH 1QL9A 1JOUB 5FAHA 2V7QD 3AW0A 1GDNA 1UHBB 4IMQA 1O2OA 4HTCH 2BY5X 4JZ1A 1RIWB 5K7RA 2HVYB 2SGAA 4XFQA 4NA9H 1GHVH 4Q63A 3VB3A 1O39A 5T3HA 1BMAA 3CS7A 3N7DA 2FOGA 2J4IA 2AMQA 1TRYA 7ESTE 2VNTA 2H5DA 1TNKA 1O35A 2Z9IA 1EQ9A 2XC0A 4I7YH 3RLWH 2GT8A 1FIWA 2BVXH 2BY7X 2Z9JA 5F8XA 5GIBA 3KYFA 3GCHC 3ZV9A 1P04A 3Q3YA 2PW8H 1IQIA 1ELFA 2ZGXH 5DP3A 2ZF0H 2FODA 1C4U2 1V2NT 2KZ4A 2F9BH 2ZFRH 1IAUA 2UWLA 1PPFE 1MZAA 2GT7A 3WWBA 1T31A 1FMGA 1O3CA 1MQ6A 4DW2U 2F9VA 3NWUA 3U69H 4TY7A 1HBTH 2P94A 6LPRA 2H9TH 1TALA 1BHXB 4I8KA 4FUBA 2ALVA 1GPZA 2ZFQH 5CMXH 3F2HA 2BDCA 4RSPA 1J14A 1DS2E 3BSQA 5HIYA 4I32A 2D26C 2XTTB 2B0FA 4X2XA 1ORFA 3PMBB 3BEIB 1UMAH 3OEED 3QGJA 1GI1A 2O8WA 5G4BA 3SU2A 3WW7A 3RMLH 4DOQA 1KMHB 1YPEH 2OBOA 2OP9A 4IC5A 3BN9A 1SB1H 4NA7A 4H42U 1SLUB 2J97A 4K8YA 1AKSB 2IOTA 1CO7E 4D9QA 3TLOA 4JZEH 1ARBA 4GSOA 1TGSZ 1SGFA 3TK9A 4KP0A 1TNIA 3MNSA 4D8NA 1W14U 4MNXA 4E7NA 3PWBA 1GL1A 4M7GA 4CRDA 1GI8B 3B23B 1AWHB 2TRMA 1ZTLA 1H1BA 2FI3E 1RTFB 4UFEH 2WZQA 3A8DA 2FYQA 1HXFH 3UOUA 1D9IA 1G3DA 3QDZB 1LKAA 3ZZ5A 2JIZD 2WUBA 5E0HA 1OXGA 4YLQH 1ZSKA 3FP7E 3E91A 3A7TA 3M5NA 1FN6A 3ZVDA 1QNJA 1UTKA 1THRH 1VKYA 3S7KB 4B74A 1L1JA 2STBE 1O38A 3SN8A 3T2NA 2B9LA 2HGTH 1K1IA 4RT1A 2ZTZA 1D3DB 1SFIA 3SU5A 3RXMA 4WF8A 4DJZB 1AB9C 3PMJA 1GBDA 3D49H 2BD4A 3LGWA 4TYDA 2PUXB 1DY9A 3VGCC 5JBBS 1NM6A 2H2ZA 3C1KA 1OSSA 4IS5A 4MTBA 1GDUA 1QJ6B 2ODYB 3BTDE 3QO6A 3NRLA 3CP7A 1EUFA 3A7ZA 1V2LT 1E34B 3MOCA 1F0TA 2O9QA 5FPYA 1GJAB 1K1LA 3ZVBA 4NG9H 2ZI2H 2A7CA 3KHVA 2GDEH 2W26A 2VIQA 3GOVB 1P0SH 1QZ8A 5KECA 1TMTH 2GV7A 1P8VC 4JMYA 5CDFE 5L2ZH 2PSXA 4UE7H 3GCNA 1F0RA 1XKBC 4KTCA 1UCYH 3GCTG 2ESTE 1TX6A 5AVDA 3GY8A 1Z7KA 2C4FH 4INLA 1BBRK 2BX3A 3PV2A 2Z9LA 1C2EA 3FVFB 2Q1JA 4D7GA 1VCQA 2WPLS 2BD2A 5GJ4B 1A0HB 2FOCA 3OTPA 4RKOB 1LHCH 2LELA 1BRAA 4UEHH 2I6QA 3E3TA 2B5TB 1YPHE 1AVXA 2OCVB 5FX6A 4X1SU 5F6MA 1HUTH 2LP6A 1GCDA 2GMTC 1WTGH 1O2ZA 2SGPE 2JETC 3S9CA 3MH5A 4OS6A 1LVYA 2ODPA 1V2QT 2BDAA 1KTTB 1J8AA 1SHYA 5HYOA 3M7TA 3QX5H 4WH8A 1O3DA 2ZFPH 2QF5A 3IITA 4NSVA 2C8XB 5EJLA 2ANKH 4YOIA 3SO3A 4TWWA 2XXLA 2BVRH 3G01A 1VJ9U 1DT2A 4DVAU 1EJAA 3FANA 2ZHEH 4I8HA 1EX3A 1Q31A 7KMEH 2Z6BD 3SNBA 1E37B 1TA2A 4XBBA 4ACAA 3SGQE 1YF4A 2GJGA 4DT4A 1Y5AT 3SOSA 3GY4A 1Q3XA 2UUJB 4JK5A 3EE0B 4D9RA 1TGTA 4DY7B 1S5SA 2D2DA 4X6NA 3H09A 2BLQA 1O2SA 1LQDB 4RT0A 3LC5A 3RXOA 1QRXA 4O97A 2WINI 5C20A 2CN0H 1CGJE 2XBYA 5A8XA 1L1NA 2ZHDA 1FZZA 3BTKE 8GCHF 2BXTH 2G81E 3M3TA 1F5RA 3RMNH 3T27A 8LPRA 1P06A 4NIXA 1QTFA 1BA8B 4B75A 1MUEB 4ZKSU 1SBWA 2VWMA 4H6SB 1OYQA 1YKTA 2ZGCA 3U8OH 1NN6A 2RG3A 1RXPA 4HZHA 4ZH8A 2R0LA 2G5NA 3UUZA 2ZDNA 3ZV8A 1YBWA 3BTME 1SC8U 4IC6A 1UTPA 1J9CH 4FU8A 3TU7H 3GY7A 3RM2H 4MVNA 3NK8A 3M37A 3T62A 3ZZ8A 3Q00A 4B73A 1AUJA 4AX9H 1GVLA 1Z71A 4XRNA 1NFXA 2G5VA 1EJMA 2TGAA 1TGBA 1ANBA 4K69A 4PROA 3RU4E 2CF9H 1C5XB 2AS9A 3EDXB 3QZRA 1SOZA 2G8TA 4LK4A 3A83A 2C8YB 1GGDC 3I29A 3E0NB 3SHAH 1A61H 1P3EA 2H9HA 4UD9H 1HAHH 3OY6U 5EXNA 1OP0A 1HJAC 2IN2A 4CRBA 4B6EA 4ISLA 2ZG0H 2EI8A 1OWJA 1PYTD 2QXJA 3GY2A 4FVBA 4IN2A 5A8YA 1DUAA 4OS4A 4O3UA 1SQAA 1UTNA 1GG6C 1TBRH 1ACBE 1SGCA 3HKJB 4NFEA 3V12A 5C1XA 3BTHE 3MNCA 3RXKA 1HAVA 1O2HA 3ATKA 2SGFE 1S0QA 1SGDE 4A1VA 1YPMH 1CA8B 2XCFA 2ZA5A 3MMGA 2TGDA 1ZTJA 3ZZDA 4NFFA 3E90B 5DJ7A 1KSNA 1MBQA 2QA9E 3ZZCA 1GHXH 2QF0A 1DICA 4K60A 1LVOA 2PHBA 1AVGH 5JBCS 4BAOB 2ASUB 1W3CA 1FPHH 2HWLB 6CHAC 1INCA 5LH8A 1TLDA 4OM9A 3MO9A 1FX0B 1W10U 4OS5A 4H6TA 3DFJA 2FX4A 3VXFH 1Z1IA 1NRNH 1P2OA 4NZLA 4B1TA 1MZDA 1XUJA 1C1RA 2SGQE 2VWNA 1C5ZB 2A31A 3ELAH 1O3PB 2NU3E 1KLTA 1AU8A 1V2OT 1SG8B 2Z3CA 1GI0A 3MHWU 1QRWA 4GCHF 2BQ6B 5J4SA 4KELA 2XC4A 5HM9A 1C2HA 4Y0ZE 3A8CA 1TRMA 1VITG 3P70B 1MTNB 4JCNA 4WXIA 3U8TH 1MAYA 1XUGA 1G2MA 2FTMA 2NU0E 1TX7A 1IQEA 2J98A 1O2UA 2A4GA 1K1NA 3RMMH 2A7HA 2WYJA 1DXPA 1EZQA 1NTPA 2ZO3H 4GHTA 8KME2 1C9PA 1EATA 1W7XH 2AIQA 3A7XA 4YOJA 1C5TA 1DX5M 2PR3A 1HJ9A 3RXAA 2P93A 2NU4E 1O2YA 4HI3A 1TOCB 4ZMAH 1ZMJA 4ABJA 1ID5H 2FOMB 4Y8YA 2YMSD 1V6DA 5CHAC 4JZFH 1PQ5A 2AERH 3GDUA 4M9FA 5GXPA 1EB1H 3L33A 4CRFA 2VIVA 1TE0A 1HNEE 1ANDA 1FQ3A 1H9IE 3S9BA 4Y8XA 2YNBA 3OX7U 4B76A 4DCDA 3FP8E 1MTVA 2W6ID 4WMFA 2NU2E 2BZAA 2SNWA 1DXWA 1DWDH 1SVPA 1GI6A 5JYIA 3GCOA 5HMAA 3UY9A 1AZZA 4JK6A 4Y79A 1FJSA 2QIQA 1HDTH 2KR7A 2B7DH 1N1LA 2ZDVH 3ITIA 1O31A 3PTNA 4TWYA 1OWHA 1PPHE 4CRGA 1G30B 2WV9A 2OQUA 2L6OA 3SJ9A 5EOKA 1BCUH 1MKXH 2ILNA 2WUCA 1GBKA 5A2MH 4ZKOU 2AEIH 1FUJA 4GLYA 4OGYA 5CHBA 1TPAE 2BLOA 5DP7A 4A5TS 2ZP0H 2PKAA 4FETA 3BTEE 4K1TA 3GDSA 1GBIA 2A2XH 1Y8TA 2FP7B 3DSOA 3E1XB 3LC3A 3OU0A 2KM0A 3KL6A 2JH6D 1FXYA 3RXPA 3UIRA 4CREA 2PGBB 3S7HB 1H9HE 1C1VH 1HB0B 1QL8A 2PP6A 4CH2B 2SNVA 4X8SH 5DN6D 1HLTH 1E1RD 2AGEX 4X8VH 1C1TA 3DA9B 1GBMA 4AGKA 1AE8H 2A4QA 4K8BA 2WHXA 3FN8A 3PRDA 4BAHB 1C5QA 1BTYA 3H7OA 1NFWA 1HJ8A 1JRSA 1DDJA 1W0YH 5FCRA 3VB7A 1CT0E 1PQAA 1F5KU 5LPFA 1YC0A 2AMDA 2Y5HA 3T5FH 2GCHF 3E0PB 1ZTKA 4MLFB 1QJ7B 1HAVB 3GY5A 4BAKB 1BJVA 3SHCH 3ESTA 3SU0A 1E79D 3BTGE 1MU6B 1OX1A 1JRTA 1NRPH 1V2UT 4Q7ZA 2RDLA 1AD8H 2ZFSA 2VINA 3RC4A 3VFEA 1EPTC 2BVSH 2A7JA 2YMSB 4JZDH 5J4QA 5FPSA 6ESTA 1AFQB 2OC1A 1MKWH 3OYPA 5GCHF 1EOLA 1M9UA 1HAOH 2NWNA 2JJ2D 2XYAA 2Y82A 1SQOA 3M5LA 4K1SA 2SGDE 2BZ6H 1BTPA 3BEFB 4O9VA 5EXLA 1OWKA 1A7SA 1SMFE 2HNTE 4X0WU 1QBOA 1KDQA 2STAE 1O5GH 3M36A 2Y5FA 5JB9S 1KXCA 1AUTC 1SGTA 3TGIE 5DPAA 1V2TT 3CENA 1TMUH 2BLVA 1ZGIA 1VCPA 1C2LA 2VIWA 3GCHB 3BEUA 1GMCF 1SKYE 3MO6A 4ZCNA 1IQNA 2J34A 2ZQ2A 1TPSA 5E2OA 1C1OA 4OGXA 1VJAU 2KCYA 1DWEH 1AFEH 1QB9A 3VB4A 3R0FA 5FBEA 1KXFA 1EB2A 2WPHS 4E05H 1Y59T 1SQTA 1A46H 5A0CA 2W5EA 3M5MA 2J98B 1HRTH 1KYNA 2PKSB 3V0XA 2Z3EA 1K9OE 2PTNA 4AYYB 2XW9A 2FESH 3VPKA 6GCHF 1SGIB 2HLDD 1WQVH 2JKHA 2GKVE 4I86A 5FPTA 4YTAA 3S69A 1ELCA 3VEQB 1CSOE 4NIWA 4Y71A 1OS8A 3UNSA 1SQRA 1GI9B 5C3NA 2SGEE 3LPRA 3PM3A 2BLWA 2TPIZ 1GMDG 1S0RA 3SNCA 2Y6TA 1L4DA 1IQLA 3LKWA 1QFKH 1QY6A 3K65B 2GCTC 4IBLH 3H7TA 4JZIA 4ISOA 4AB8A 1MTSA 4ABAA 2BD7A 4B2CA 1QHRB 3PLKA 3MU4A 1GJ9B 1ZSJA 3A8BA 5L2YH 2VVVA 3ZYDA 2FEQH 1BIOA 1EAXA 1O2RA 1BT7A 1A5IA 1XUHA 3MH6A 1SGYE 3EAJA 1TPOA 1A0LA 2ZDAH 1UCYE 1LPKB 2ANMH 1YPKH 4CBNA 1D6RA 4AG1A 2Y5GA 4FXGH 4Y7BA 2ZU4A 1RIWC 4X6PA 3KN2A 1QL7A 1GHWH 2IPQX 3SV7A 2BXUH 1BTHH 2R9PA 2FOHA 2RA3A 2AGGX 3TNSA 3OE7D 4X1RU 2I6SA 1SGRE 2DE8A 4ESTE 1CGIE 2OD3B 3K6YA 1C1NA 2ZFTA 2BDIA 1A4WH 2G00A 2XWBI 4JYUH 1HXEH 2KCPA 1QQUA 3V7TA 3DHKH 3VB5A 4A1TA 1C5YB 1O34A 1UW7A 2PV9B 3LGUA 1GBTA 2C93B 1O2TA 1CU1A 1COWD 2AMPA 1AB9B 2F9NA 3RXJA 4GUXA 4SGBE 4X6OA 1MAXA 3IG6B 3VGCB 1GJDB 3KQCA 1N6XA 1GHZA 3A7WA 5C1UA 3EQ0H 4NGAH 4O3TA 3RXRA 2GZ7A 2ULLA 3FO8D 2Z7FE 3SJIA 2PSYA 2K0QA 4AFSA 4MPVA 3BIUH 2OC8A 3MWIU 4AN7A 1GJ8B 2P16A 2G55A 2AFQB 2GDDA 3F9EA 1TYNA 4MPUA 3B8JA 1CHOF 4YM9A 3ZZ3A 1XXDA 3AW1A 4F49A 2IJD1 5C5NA 1S85A 7GCHG 1HAXB 1V2ST 2FXRA 3NZIA 2Y7ZA 1GJ5H 1P57B 1C5NH 3NKKA 1RRKA 1YCPH 2QN5T 4J2YB 2RA0A 1AIXH 5ESTE 3RXVA 1GHAG 1HAZB 3A80A 2Y81A 1ZMNA 2PTCE 9ESTA 2WPKS 3S9AA 1SGQE 4ZHMU 2J9NA 5C17A 1AWFH 1XM1A 4HG6A 4GPGA 3U28C 3A86A 1ABIH 1AO5A 1UTJA 3SQEE 4CH8B 1G37A 3D23A 1GI5A 1IQHA 3RDZA 2CHAB 2GVFA 3SNAA 2TBSA 2CMYA 1BJUA 1BRUP 1DSTA 4AG2A 1MTUA 4TY6A 4ASUD 4MNWA 1S6HA 4X2VA 3SNDA 1UVUH 2FDAA 2ZHWH 4VGCC 2CJIA 3SU4A 2EI6A 2JETB 5EQSA 1TABE 4BOHA 3M7UA 2AIPA 5TJXA 1G3EA 3U9AH 1O2WA 4WY3A 3MU5A 4AB9A 1V2RT 2A4OA 1GBCA 4AFZA 1CE5A 1W0JD 4WXVA 3SU3A 1SL3A 4LXBH 2AYWA 1O3LA 5DSFA 3M3SA
chains in the Genus database with same CATH topology
4FUIA 4BXSA 3EGKH 1O3MA 2BB4A 5DGJA 5DG6A 2BD9A 1ESTA 1FY8E 1C5PA 1G32B 4ABGA 1MU8B 1UJ1A 2W7UA 4NIYA 1OWEA 3SUFA 1RGQA 1S6FA 5JB8S 2YOLA 1Q2WA 5AHGH 4CHAC 1Z1JA 1O3BA 1Z6JH 1S81A 1C9TA 1JIMA 1MKXK 2DE9A 3RC6A 4XSKU 2ZFFH 4BAQB 1JMOH 3K9XB 1C1MA 2A5IA 1T8NA 1C1WH 4RKJB 2EA3A 5E2PA 3P17H 2ZWLH 2G52A 3UQOA 3BTTE 2BDBA 1ARCA 4LOYH 5JBTA 2QGRA 2UWPA 4I33A 1GMHF 3UFAA 3RMOH 2VGCC 3MU8A 4NZQA 1LO6A 3V3MA 2EEKA 1K28D 1EP5A 3A89A 3MU1A 3MTYA 2LPRA 2OC0A 1Y5UT 3SV2H 3LGIA 2R3YA 3NUMA 1A3BH 2BY8X 2BD5A 5A8ZA 5C67A 3WY8A 3O8BA 2A0QB 5EQRA 1P9UA 1SGNE 2GZ9A 2OC7A 5AF9H 2F83A 4KTSA 2G51A 2CXVA 1NT1A 1O3EA 5TCAA 1P12E 2V0BA 1L2EA 5EODA 4ZXXH 4AFUA 5LPEA 1GBJA 4NWKA 1GGDB 1Y3VA 2THFB 1MKWK 2Y7XA 5EW1H 1UVSH 2FS9A 1GJ6A 5IDKA 2PUQH 3UQVA 1LKBA 1PQ8A 1DANH 4AZ2B 1O2JA 1HJAB 4ISIH 3MU0A 3ZZAA 1WYKA 1TMBH 4KGAA 1BRCE 1LCYA 1EJNA 2FI5E 3MFJA 3LU9B 3LH3A 1CVWH 1FI8A 3URCA 1W13U 1O3OA 1SGFG 1GG6B 1Y3WA 1KXDA 3A85A 1YYY1 4XE4A 1N8OC 5EPYA 3SGBE 2QXIA 4MPXA 1ZRKA 1UO6A 4MQAA 1UTMA 1B0EA 1HIAA 1ZHPA 1IQMA 4FU9A 1C2DA 2BDYA 2BTCE 1O2MA 1P11E 2FOEA 1J17T 2ZGJA 1EPTA 4WJG2 3PWCA 1OWIA 4AYVB 2F9UA 1AE5A 1TNHA 3URDA 1CA0C 3RU4T 1V2JT 1C5RA 2QV1A 4FUGA 4WMEA 2YNAA 2ZZUH 2AGIX 1OKXA 1BDAA 3LOXA 1K1PA 1LPGB 5GDSH 1EZSC 4MG3A 1BZXE 1D3QB 1AY6H 1NROH 1LTOA 3D65E 2FWWA 5LGOA 2H9EH 1O0DH 2C90B 2QAAA 2OUAA 4X8UH 3QUMP 3E6PH 3CS0A 3SW2B 3P8NA 5TCCA 1BMNH 1GBAA 4ISNA 4YLUA 5T6FA 1WAYB 4D76A 4ZXYH 1ZGVA 3NCLA 5DK1A 3UR6A 1ESAA 1BTZA 4IN1A 4SGAE 2VVUA 2GP9B 2P8OB 1QA0A 3SJKA 1V2WT 3N7OA 5FCKA 1C4V2 1EAWA 2WPIS 1NFYA 1ZZZA 1MQ5A 3LH1A 2J94A 1TOMH 3RXTA 3P8FA 5BRRE 3HK6B 1D6WA 2HPQH 2CF8H 4K1EA 3U98H 5B6OA 1JXPA 2BX4A 4YZUA 3TITA 1YPJH 3RC5A 2BOKA 3RXLA 4B2BA 2CGAA 1YPHC 1GHBF 1K1MA 3A82A 2XC5A 3DUXH 3EA8A 2HVXA 3TNTA 3DD2H 4A1XA 4DIIH 1OYTH 1DWBH 5JDUB 1QRZA 1BMLA 1OP2A 1ELVA 1IQKA 2OQ5A 1T32A 1JWTA 4B71A 2ZU5A 1TAWA 1KIGH 1H8IH 1FAXA 1NC6A 1E38B 1C2JA 4FU7A 2QXGA 1C5LH 1RTLA 3L6PA 2A2QH 1T4VH 2BM2A 2R0KA 1A5HA 1NPMA 3F68H 1LHFH 4DIHH 1MCVA 3NXPA 4WH6A 1NY22 3BG8A 3UTUH 1XVOA 1NU9A 2VIOA 1DM4B 3ATMA 5ESBA 1TGNA 1ELBA 2D8WA 4YT7H 1WCZA 3O8RA 3Q3XA 3U1IB 1AQ7A 5DO4H 1TBQH 3ZZ9A 8GCHG 4MNYA 1BITA 1TPPA 1AI8H 2P3TB 4ZROA 2A32A 1P2IA 3MNXA 1UTLM 3TK6A 1TONA 2ZCLP 1XXFA 4DGJA 1O37A 1A1RA 3A84A 4Q7YA 4HFPB 1N6YA 1GL0E 3EA7A 3HPTB 2ZHQH 1BTXA 5F03A 5GWZA 1T7CA 4GVUA 1PQ7A 3BG4C 1BBRH 2F9PA 2TIOA 2HPPH 3M3VA 1AZ8A 2Y80A 1W0ZU 1ZJKA 2VU8E 1LHGH 2P3UB 1EOJA 1P09A 3QWCH 1LDTT 1GI7B 2ZNKH 4MNVA 1P05A 1UK4A 1WUNH 3HK3B 1GI4A 1GBHA 3LGTA 1CBWB 1ZR0A 2VH6A 4U32A 2RCEA 1GHYH 1MD8A 1G2LA 1P02A 3FP6E 4GAWA 1T8MA 1UK2A 1PYTC 1RD3B 2WYGA 1VGCC 1FNIA 3ZVAA 3TK5A 1UCYK 1O3AA 1DPOA 2GX4A 3PO1C 2R3UA 1KLIH 1C2MA 1NRQH 1CT4E 1IHTH 2OINA 3SQHE 1O2NA 1FY3A 3ATLA 3SUGA 2ZIQH 4QT8C 1BHXF 5L6NH 4X1NU 4NSYA 1O3HA 5ABWA 1C2KA 2J95A 4F4OC 2BOHB 1O5CB 4Y11E 3M5OA 3P8OA 2A1DB 1F7ZA 2ZU1A 4AOQA 3SI4H 4UONA 5EU8A 2A5AA 1Y5BT 1NU7B 1QBVH 1AN1E 2H6MA 1B0FA 1BTUA 1W7GH 4AGJA 4U30A 1O32A 4K5ZA 1KLJH 2BQWB 4ZAEA 3ZZ6A 1C1PA 3QTOH 4IGDA 2M5TA 1QGFA 4WMDA 4INKA 1WU1A 1SR5C 2PWXA 1O2LA 1GBEA 5C1YA 3R3GB 3SV6A 1B5GH 5DP5A 5BPEA 3TIUA 5A0AE 3PLPA 5GPIB 1PPGE 2GD4B 1O30A 5EGMA 1G36A 2FZZA 1S83A 2BY9X 2ZPSA 4R8TB 3QTVH 2KAIA 2BYAX 4ABHA 4GCHG 1YLCA 1NESE 3BF6H 3U1JB 1SLWB 2GCTB 2W7SA 1TRNA 4B2AA 1LHEH 1GCTC 3RXUA 1E36B 1C5MD 1QA7A 3E8LA 1LVBA 4IW4E 1DVAH 4JYTA 2J92A 1HAPH 2QF3A 3AVZA 2XCNA 4TPYA 1PJPA 2V6NA 3A81A 3RXFA 8ESTE 2FS8A 1NO9H 4ABEA 3BIVH 3K6ZA 1L1GA 3SI3H 1AFQC 4BTIB 3F9FA 4X2YA 2ZGBH 2Z94A 1EXFA 3ZVFA 3F9HA 1P2NA 2B8OH 1H4WA 3ODDA 3GCTF 1W12U 1CT2E 1L4ZA 3M35A 2W3IA 2PLXA 2ZPQA 4R0IA 1Y3UA 2R2WU 3RXSA 3TJUA 2P59A 1ETTH 5F8ZA 4I8LA 1JBUH 1OWDA 1P10A 1Y3YA 5I25A 1J16A 3KQBA 3KEEA 1O2GH 4X1PU 2K1QA 2VJ1A 4FUJA 1O5DH 4MDSA 2ZDLA 3ZVCA 3TGJE 2WV5A 3TJNA 1YGCH 1D3PB 4XBDA 2WPJS 1O3GA 4YT6H 4ABBA 1YPLH 1MD7A 2XWAA 4BNRA 2ZDMA 1O3IA 3QK1A 1FLEE 3TPIZ 1BB0B 4KKDA 1NFUA 1CGHA 3TJOA 2BDHA 1UVOA 1SFQB 1P2QA 3QLPH 3LJJA 1NZQH 5SGAE 1UVPA 2ANWA 1KXBA 2PKSC 2VVCA 2A5KA 2BDGA 2FLRH 1A0JA 5AFZH 3F9GA 1RTKA 1O5FH 2GV6A 2LNCA 4GHQA 2PKAB 1O2QA 2ODQA 2HLCA 1Z8GA 1BOQA 2IJOB 1HAYB 3AAVA 4FUFA 2DUCA 1RFNA 1EKBB 3F6UH 1O3NA 5I46H 4MPWA 2ZDKA 1S82A 4OS1A 4FUDA 4X1QU 5JPMH 2HRVA 1KY9A 3SUDA 3LT3A 1XUFA 4E06H 3P8GA 3PB1E 4ABDA 2HALA 1SPJA 3HGPA 1ZPBA 2VWLA 4XDEA 2EI7A 1G9IE 1C5VA 1SSXA 4NIVA 1ZMLA 5F8TA 2NU1E 2GCHG 3ZZ4A 3KCGH 3SORA 2C3SA 2FM2A 3EYDA 4Q80A 1O36A 2Q6FA 2TGTA 2TGPZ 1C1SA 4CBOA 1THPB 5FX5A 1K1JA 3MYWA 1GBFA 1TGCA 4VGCB 3D62A 4X2WA 1GVKB 5EPNA 3GICB 2ANYA 5GCHG 1J15A 1ESBA 1DUEA 5FHTA 3ATIA 1O5AB 1KDQB 2FI4E 1WV7H 4DT7B 3AAUA 5LPRA 1W8BH 3A8AA 2ZHFH 3SU6A 1QQ4A 3DFLA 1KXAA 2O8TA 1GJ4H 3V13A 2J38A 1OOKB 2QXHA 3BTQE 4AORA 1DITH 3OSYA 5PTPA 2HNTC 2ZGHA 1XUKA 1GMCG 4I8JA 2KAIB 4XBCA 3KQEA 4BTUB 1ETRH 3ZVEA 4H4FA 1CHGA 2D1JA 3TVJB 2G4TA 2OBQA 2C8WB 2GMTB 3QZQA 4CHAB 3GYMA 1C5OH 3A87A 1GI3A 1O2IA 3F1SB 1ZHMA 3Q76A 4X6MA 3STJA 3SZNA 3TH2H 1P01A 1DE7H 1YPGH 1HAGE 1JIRA 4WVPE 1HGTH 2V3HH 2ALPA 1T8OA 6GCHG 1MMJN 4TPIZ 1HV7A 3P95A 4Q7XA 1ELAA 1YP9A 2GGVB 1AVWA 5C5OA 3RP2A 1Z8JB 1A3EH 2VGCB 3Q77A 2R2MB 1A2CH 4ABIA 1ELDE 2A45B 2ZQ1A 1FY1A 1QJ1B 1EAIA 1G3CA 3PTBA 1MH0A 4U01A 3ZZ7A 1A5GH 4YOGA 1GVZA 3RLYH 5HXFA 1P9SA 5JBAS 1V2PT 4CRCA 2FMJA 4A6LA 2ZTYA 1NRSH 3GY3A 4THNH 5E8EH 1WBGB 4LZ1H 2G4UA 1HAIH 1PPEE 3PMAB 1V3XA 2JH5D 5C2ZA 1GBBA 1P2MA 1TFXA 2CHAC 2ZKSA 1C5UA 1AGJA 3MO3A 4BAMB 4CR5A 1O3FA 5K0HA 3UPEA 1GBLA 1ABJH 3L3TA 1UTQA 2H1UA 2EC9H 2C8ZB 1ZLRA 1SLVB 3UNQA 1C1QA 4Y7AA 3OTJE 1VITF 4I8GA 5CE1A 2FOBA 3I78A 3SV8A 1DFPA 4UFFH 2FIRH 1ZSLA 1FDPA 1GJ7B 1O3JA 3KQDA 1C1UH 3LDXH 1N8OB 2GZ8A 2XNIA 1GI2A 2OTVA 1Z8RA 1HYLA 5E0GA 3GDVA 1LHDH 3A88A 1X7AC 5IYTA 1THSH 4ZUHA 3NPSA 1WOFA 3A7YA 1ANEA 2FOAA 2ZU3A 2ZTXA 2XBVA 2UWOA 1EZXC 2SFAA 2FYRA 1HFDA 1SGEE 1PPCE 4A92A 1ZPZA 3RM0H 1CA0B 2O8UA 1H8DH 1FY5A 3ENSB 3UWJH 3BTFE 2BHGA 7LPRA 3FAOA 4Z0KA 4HGCA 3JZ1B 1SI5H 3RXCA 2QCYA 4UFDH 1CHOG 3FZDA 3B9FH 1W2KH 1K2I1 2GTBA 1C2GA 2IPHA 5DKMA 9LPRA 1O3KA 1ANCA 1P3CA 3UNRA 2OXSA 5A09A 1Z8IB 2PFEA 3O8CA 1O2VA 1IHSH 2FTLE 3ODFA 4OS7A 4WWYA 2XBXA 3SJOA 1VR1H 1OPHB 1V2MT 1EAUA 4ISHH 1DWCH 3M61U 1RS0A 1FN8A 1LVMA 4FUHA 2ZPRA 4ABFA 6CHAB 4NCYA 2FX6A 1AMHA 1P2KA 1UVTH 2BD8A 2Q6DA 1XVMA 1O2PA 2A4RA 4YESB 3P92A 1EZUC 1WQSA 1NS3A 1TB6H 1QURH 2XBWA 1ELTA 2O8MA 4I31A 1ELGA 1P03A 3E16B 2ZECA 1UK3A 3TJVA 1E0FD 2V3OH 4RN6A 1BBRE 4ASHA 3ZZBA 3SU1A 3GISB 1TBZH 1DSUA 4XOJA 3VB6A 1D4PB 2W3KA 1H9LB 4O03A 2Q6GA 1QB1A 1FIZA 1OP8A 3RU4D 3W94A 1O5EH 3T25A 1F92A 3PLBA 1C2IA 3C27B 2QYIA 3DT0H 3O8DA 3RXEA 1P2JA 4NA8A 1IOEA 1ZJDA 4DG4A 3QGNB 1VZQH 1Z6EA 2FPZA 3OY5U 1B7XB 1GJBB 4K3JA 1XX9A 3UWIA 4U2WA 1MCTA 3UR9A 5DP4A 1T4UH 1BUIA 3HATH 4BXWA 3SV9A 1VITH 5AFYH 3UREA 2O8LA 3SJ8A 1IQJA 3HKIB 3RXDA 5EQQA 1IQGA 1PPBH 2P95A 1U6QA 1YLDA 5CHAB 3AASA 4ZKRU 3MH4A 3RXGA 2PGQB 2VIDA 1O5BB 4FUEA 1FONA 3HGNA 4IMZA 1HPGA 1TQ7B 3A7VA 1GMHG 2FLBH 3PROA 2FO9A 1AHTH 1FPCH 1YM0A 3PMHB 1D3TB 1F0SA 3ZVGA 1GWAA 1ZHRA 5FBIA 3RXQA 2QY0B 1O2KA 4Y10E 5HM2A 4Y6DA 5E0JA 2VH0A 1FY4A 2BD3A 3QN7A 3TH4H 4ZKNU 3STIA 3RXIA 3BG4B 1MTWA 2WPMS 4INHA 5EW2H 1UHBA 1K21H 1L0ZA 2P8OC 3SNEA 1BMMH 3FFGA 3SBKA 1YCPM 2ZEBA 1G3BA 3LONA 2F3CE 1K1OA 5L30H 4KTUA 3GY6A 1F2SE 1TWXB 1KTSB 4ZHLU 1WTHD 2BY6X 1S84A 1XUIA 4JYVH 3W95A 4K2YA 2QC2A 1V2VT 3TGKE 1KXEA 1GMDF 3LGVA 1VGCB 1C4Y2 1F0UA 2UUYA 1YCPK 3MNBA 1DLKB 2VIPA 3PO1B 1TNLA 5T6GA 2Z9GA 1PFXC 2AH4X 1ZPCA 1MTNC 3UOPA 3SGAE 1DLEA 1ZOMA 4LZ4B 1SGPE 1QBNA 4DURA 1IQFA 1HIAB 1O2XA 1DY8A 3S0NA 4FVDA 1ETSH 1EPTB 2XRCA 1LPZB 1RJXB 1W11U 3PV4A 4YO9A 4A7IB 3ATWA 2WV4A 1XMNB 4FUCA 4Q2KA 2F9OA 3MH7A 1QB6A 2J2UA 2ZCKP 4NWLA 1TA6A 3BTWE 3K2UA 1PPZA 5EXMA 4CR9A 1F5LA 3VXEH 1TIOA 1BQYA 1DOJA 3H5CB 3U8RH 2V35A 4BANB 4Z6AH 5DP8A 1V2KT 1BTWA 3M7QA 1LQEA 4UDWH 2FOFA 5HGGA 1AKSA 5DP9A 1T8LA 2HOBA 1BRBE 1TX8A 1SHHB 1K22H 3ZYEA 5H4IB 3LGYA