4B1TA

Structure of the factor xa-like trypsin variant triple-ala (ta) in complex with eglin c
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDAGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords CATIONIC TRYPSIN
publication title Thermodynamic signatures in macromolecular interactions involving conformational flexibility.
pubmed doi rcsb
source organism Bos taurus
total genus 55
structure length 223
sequence length 223
chains with identical sequence C
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2012-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4b1tA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4b1tA02
4DCDA 3P17H 5EODA 4TWYA 3M7QA 3ZZ9A 4CH8B 1LQEA 1GG6C 1UTLM 4ABEA 2QXJA 2TGTA 1W14U 3QN7A 1WTHD 4YT7H 2ZC9H 1GBLA 4IN1A 5BPEA 6GCHF 1P04A 4IC6A 1FN8A 1G37A 2JH0D 2AGGX 5HGGA 1BHXB 1BMNH 1CQQA 3BF6H 3N7OA 4X8UH 4THNH 2TRMA 1O2OA 1NFXA 3ZVDA 3RU4E 5C1XA 4BTIB 4DURA 1LPZB 4HTCH 2WPJS 1K22H 1K1LA 2GTBA 1YF4A 1GDUA 1SVPA 1HAZB 3VB7A 2YNAA 1GBAA 1OS8A 2PUXB 1MZAA 3M5MA 2F9OA 2P3FH 3SI3H 3MU8A 1V2JT 4VGCB 2PHBA 4AYVB 1O34A 1LHEH 1DSTA 1SQTA 1IQHA 1QFKH 1C2GA 3TJUA 1ESBA 1T8LA 3M37A 1C2JA 1UCYK 3F9EA 5DP6A 2FI5E 1GJ8B 4A5TS 2ZU1A 1O3AA 1O36A 1L1GA 1K1PA 2ZIQH 3H7TA 2Z9JA 4X6NA 2HNTC 1TA6A 1S6FA 1IQEA 3BEUA 1BITA 1RTKA 2SFAA 1P2KA 1KLTA 1KTSB 3RDZA 1IQLA 1MD8A 4Y79A 1BIOA 3UIRA 1EP6A 1DY9A 1GI6A 1ACBE 1ETSH 1SGYE 5CHAC 1F0UA 1V2MT 4MQAA 4ABFA 3U8OH 1TPAE 3O8BA 3I77A 1Y8TA 1C2FA 3OU0A 1IOEA 1GBFA 3BN9A 1P2MA 1ABIH 4H6TA 4Y10E 2Y7ZA 1C2HA 1W11U 4ZH8A 3A7YA 4HI3A 1O0DH 4HGCA 3ZZ5A 3TJNA 2XYAA 4ZKSU 1A61H 2VIOA 4DJZB 5LGOA 1AB9C 1GI7B 3ZZ6A 3TH4H 2O8MA 1Y3XA 1HAGE 1Z6EA 3P92A 1FDPA 1GHWH 2EA3A 1TPOA 5A0BA 2UUFB 1FY8E 2HNTF 3SUFA 3SNEA 1P2JA 1HAHH 3SJ9A 1A3BH 4CBOA 1EQ9A 2A7JA 1TRMA 5DKMA 1C5VA 3RXTA 2EI7A 3EE0B 1P9SA 3R0FA 5SGAE 1FY4A 5CMXH 2ZFQH 1D9IA 1MAXA 4X6PA 4XSKU 2SNWA 1C1PA 1CVWH 4AOQA 3NUMA 1QQUA 1DWDH 1CT0E 1IQMA 1C1TA 2G55A 1LKAA 1GJCB 1MQ5A 4FXGH 1FY5A 1ELDE 2ZU5A 5IYTA 1SSXA 3TNSA 1K1NA 2VB0A 1YCPH 3KQCA 1THRH 1WYKA 4NGAH 1XKBC 3SU6A 3MH6A 2A2QH 4NZQA 3KQBA 3MO3A 3G01A 3DUXH 4NSVA 2VWMA 4K3JA 2LPRA 3TPIZ 5F8TA 1DDJA 1C1MA 3BEIB 1GMDF 1HB0B 2OQ5A 3U9AH 1C5LH 3KQDA 2PV9B 2VGCB 1O38A 1OWDA 3NK8A 4F4OC 4FUGA 1PQ5A 3KF2A 3KIDU 4YTAA 1TWXB 4A1XA 3M7UA 3RXRA 4MPXA 1HAXB 1C2MA 1WCZA 1Z8IB 4JZFH 3TH2H 3LC5A 4Q2KA 1V6DA 2LNCA 2NU3E 1PPEE 1KTTB 2ZEBA 4ZROA 1GHAG 1HUTH 1E36B 2B7DH 1SMFE 1UTKA 3OYPA 2FP7B 1QB6A 1N8OB 2IPHA 1P02A 3DFJA 2ZHFH 3PLPA 1NS3A 2JETC 2BDIA 3URCA 4ZAEA 2FI4E 1A46H 1HJ8A 1GI5A 3E16B 5EXMA 3W95A 3SV9A 1BTYA 1IQIA 3LU9B 1PQAA 1MCTA 2UWLA 2FS9A 1C5PA 1GBCA 2ZP0H 3MU1A 4AG1A 3D49H 3UNRA 1E0FD 2BDHA 4AGJA 1TNLA 2AFQB 1HJ9A 2FPZA 4XFQA 5DPAA 4CRCA 3F6UH 1YPHC 4WWYA 2D26C 4B76A 1DANH 1TPSA 1OXGA 2ZGXH 1OOKB 1NFYA 1O5BB 2R0LA 3OY6U 1ZPBA 2BY8X 1NFUA 1VITH 1NRRH 3MHWU 1O3OA 2ASUB 2ZQ2A 1GI9B 4UONA 4ZHLU 1NRSH 1UTJA 1TBQH 3BTDE 1VJAU 5H4IB 4MPUA 2HNTE 1RIWC 2W26A 2ANKH 1GL1A 2OXSA 1P57B 3ZV9A 1ZTKA 1V2UT 3TH3H 2G4TA 4UE7H 3RC5A 1RXPA 1H8DH 1SR5C 1GBBA 1XUHA 3NKKA 3V0XA 1OYTH 2O9QA 3GY4A 1CHOF 1P2IA 1AI8H 4A1TA 1FIWA 1BMAA 3UY9A 2AGEX 1XUFA 2OP9A 3LKWA 1IQGA 2ZQ1A 1GMCF 3O8RA 2RA3A 2ZU3A 3K65B 1P3EA 2QXIA 3MMGA 5JB9S 3F1SB 1T8OA 1TA2A 2H6MA 1F92A 5TCCA 4K2YA 1ZTLA 2V6NA 2VH0A 2XBYA 3SHCH 2G81E 5IDKA 2Z9IA 1CT4E 2VWNA 1P09A 2G8TA 1PPHE 2BOHB 1EAXA 1XMNB 4RSPA 2PKAB 1SGPE 1MD7A 1OPHB 1A3EH 2BDGA 2QXHA 1H4WA 4B1TA 4JYUH 1AO5A 1BHXF 1O2NA 1WTGH 4RN6A 4UFEH 1MTWA 1LVMA 3A84A 1CHGA 1XX9A 3D62A 1D6WA 4BXWA 3P70B 3NXPA 4I8KA 1B0FA 2ZNKH 3SU2A 4F49A 5JYIA 1BBRE 3BTTE 1J16A 4JMYA 1BDAA 2XTTB 1ZR0A 2PR3A 8ESTE 3O8DA 2RCEA 4MNYA 3SORA 3KL6A 4B74A 1UO6A 4K8YA 1WU1A 3TITA 1KXDA 1P0SH 3NWUA 6GCHG 1YPLH 2ZDKA 3GY5A 4U01A 1EZSC 4CR9A 4TY6A 3A8DA 1TGBA 4YO9A 5E0JA 2V3HH 2ZTYA 1J15A 5TJXA 7LPRA 4BTTB 5DP5A 3C1KA 4DY7B 3ZZCA 3EA7A 5GJ4B 3P8OA 1C1RA 3RXLA 1QQ4A 3S9CA 4X2WA 3IG6B 3E0PB 3UFAA 1O3FA 4D7GA 2J2UA 4U32A 3T27A 2PKAA 1TAWA 5EXLA 1HAIH 3EGKH 1HBTH 3MU5A 3SGAE 4O9VA 4MNVA 3GY8A 4MTBA 1AIXH 2TPIZ 2FWWA 1NT1A 2FESH 3LT3A 4O03A 4OGXA 2BOKA 2ZU2A 1SGTA 5CHAB 3F68H 3L33A 4JZIA 2NU4E 2C4FH 5AVDA 1FZZA 1TNJA 1EOJA 4FUCA 3S69A 1PPGE 1GBIA 2AYWA 4I7YH 4H6SB 2HALA 3SUEA 5HXFA 4MPWA 2K1QA 4UFFH 1F0TA 1GJ5H 2VJ1A 2P8OC 1S0QA 5TCAA 1T8NA 2XC4A 1KDQB 3S0NA 1GGDC 5FBIA 1ZTJA 2A32A 1CGIE 2A1DB 1C4Y2 1YPHE 3HGNA 2XBWA 1AWHB 2ZHEH 1K1OA 3OTJE 2I6SA 2P59A 1AB9B 2GCTC 1VJ9U 3E91A 1BRUP 4X8TH 1W0YH 2F9BH 1GI3A 3MO6A 1LMWB 1LVBA 2OBQA 1SQAA 1BA8B 1G30B 1W0ZU 3BTHE 3T26A 1V2LT 5F03A 1IQFA 2H2ZA 2ZF0H 1O3KA 2B9LA 2A4QA 1GL0E 1OWHA 3GCTF 3KHVA 4E06H 1O2JA 4X6OA 3A80A 1Z7KA 1DS2E 2OLGA 5E0HA 3RXPA 4GSOA 1C1QA 1EZQA 3FVFB 4BXSA 4AFZA 1IAUA 3M7TA 2BD3A 1P8VC 4Q7YA 3TK6A 4KKDA 3GCNA 2XXLA 1CGHA 3RC4A 1GVLA 1NY22 1SGDE 1OP2A 4I33A 3MNSA 1LO6A 1EZUC 4NFFA 4NG9H 1ZHMA 3T5FH 3OSYA 5FCRA 2BX4A 1QB9A 1PPCE 1IQKA 1EASA 5JB8S 1PQ7A 5A09A 2Y6TA 1QBVH 3UTUH 2HWLB 1P11E 1D3PB 1AMHA 4NIYA 3RM0H 1G3DA 4WMEA 4Y7AA 3MWIU 3P95A 5GPIB 3VXEH 3ATKA 1GBDA 1KDQA 1LPGB 1T8MA 1EP5A 4X2VA 3A88A 3I78A 5HYOA 1D6RA 6ESTA 2ODYB 3F9FA 3VGCC 1ELEE 1HJAC 1QL7A 5DGJA 1MBQA 1C5OH 3HK3B 1EUFA 3BG8A 3GYMA 1RTFB 4AFQA 1YCPM 1CA0B 3LGTA 3SNDA 1RFNA 1MTNC 3S7HB 1O3BA 3UUZA 1ZYOA 1GMDG 2ZDVH 3ZVEA 1AVXA 3VB3A 1FY1A 3ZV8A 1BBRK 3S7KB 5DJ7A 3B8JA 5JBCS 1PPBH 4B73A 1C4U2 1NRNH 1D3QB 2QAAA 1AZZA 5A2MH 1WV7H 1E35B 1FQ3A 2JETB 1DITH 3B23B 2ODPA 1Z8RA 4M7GA 4YLQH 3PB1E 4MDSA 1RRKA 2QXGA 1TIOA 2FOGA 2P94A 1AHTH 2B0FA 3A87A 1ANDA 1NRPH 2W3KA 1EJAA 1FY3A 1ELVA 1QIXB 1B0EA 1HRTH 2QYIA 2QF3A 5DP8A 4D8NA 5K7RA 3BTME 1ETRH 4B71A 2BB4A 1BTPA 3SI4H 2EI8A 2DE9A 1B7XB 3SJIA 1PPFE 2ZHWH 1ZPCA 5F8ZA 2BDBA 2Y5HA 3HK6B 1ZSJA 1AFEH 2BY9X 1HAPH 2FOHA 2OCVB 1ZZZA 2G00A 3QZRA 4DG4A 1KXEA 3M35A 4RKOB 4X8VH 3GY3A 1L2EA 4MNWA 1SFQB 4ASHA 1BRAA 1BB0B 1BRBE 1V2KT 1TGSZ 1Z8GA 2WPMS 1YC0A 5FX6A 1TBRH 1PYTD 1K1IA 3KQEA 5GWZA 2GZ8A 1BUIA 3M5LA 1BCUH 4JYVH 1ELCA 2NU1E 1EPTC 1C1NA 1KXFA 3BTEE 3ATIA 3K9XB 1EB2A 1NU9A 1O3DA 1DM4B 4WH8A 2H9HA 1QCPA 1HAYB 2WINI 1C2EA 2XBVA 1KLIH 2TIOA 4NIWA 1LKBA 1YLDA 5EQSA 3BV9B 1SOTA 1YPGH 3SV7A 5T6FA 2W3IA 1GI4A 1CBWC 1VCQA 4A1VA 1O2HA 2H9EH 1SGQE 2RA0A 3T62A 1CHOG 3L3TA 1DE7H 4K1TA 4JZEH 4ABGA 4FUHA 2A31A 1FV9A 3DT0H 5C1YA 5GCHF 3ZZBA 3RXEA 1GMCG 4E05H 3SOSA 8GCHF 1D4PB 3LOXA 1P2NA 1HLTH 3OX7U 1DVAH 3P8GA 1O2GH 2PGBB 2CXVA 3EYDA 4YESB 4INHA 4LK4A 1Y3VA 3PM3A 1VGCB 1ZSLA 1G32B 2Z9LA 1FUJA 1F0RA 1L4DA 1C5RA 2H1UA 2UUKB 4B75A 1GBKA 3SO3A 2GCHF 1BOQA 4I31A 1F0SA 3HKJB 5JBTA 1JRTA 1HCGA 2XBXA 4NSYA 3UQVA 4MPVA 1YPMH 4FVBA 2WPKS 5DP4A 3P8FA 3WY8A 3QTVH 1QL8A 2THFB 4I8GA 4WJG2 4XBBA 1YLCA 2JH5D 2BLOA 1TRNA 5A0AE 3Q76A 1DUAA 3GY6A 3PLBA 1A0JA 2FX4A 1WSSH 2AH4X 2UWPA 1PPZA 1SGIB 4Q7XA 4Z6AH 1EX3A 2C90B 1OWJA 2Z94A 2CHAC 5ETXA 3E8LA 1GBHA 2A4RA 3BTWE 4KTCA 5DP3A 2FMJA 1WUNH 3TNTA 4WMFA 2FOAA 1NTPA 4JYTA 3T28A 2PFEA 4ZKRU 1TOCB 1V2TT 4I8JA 3FP7E 3NCLA 3L6PA 2BLWA 1KYNA 4IBLH 1GCTC 2ZPSA 4BAMB 1GJDB 1O2UA 1O3NA 1EB1H 1C2IA 1YP9A 2ZCKP 2PTNA 3SJ8A 2FI3E 1KLJH 4ABDA 1Y3UA 5EPNA 3T29A 1H8IH 1AUJA 3MNCA 2AIPA 2QIQA 1MTSA 1UMAH 1YGCH 3BTKE 3ZZ7A 2WUBA 3SU1A 2FM2A 2A5KA 1AWFH 1RJXB 1FIZA 1Z1JA 2FLRH 1LCYA 2P8OB 2BD5A 2ULLA 2ZECA 1V2WT 1A5HA 1T7CA 5L2ZH 1AFQC 1GGDB 4Y6DA 2ZFPH 1V2PT 1XVOA 3ZZ8A 1A0HB 1O3PB 1TGCA 1ELTA 1AUTC 2VIPA 3D23A 1CA8B 3OY5U 1BMMH 2A45B 2BVXH 1OP0A 3SU5A 1TQ0B 4K69A 3PV4A 2WPLS 1K9OE 4X2YA 1GDNA 1L1NA 1ZMLA 4KGAA 3Q3KA 3M3VA 3PTNA 1FPHH 1O2YA 1YBWA 2WV5A 4LZ1H 3RXOA 3A7XA 3O8CA 1H9IE 2UUYA 2ZDMA 2TGAA 4BOHA 1S83A 4K60A 4CRBA 2F9VA 3EA8A 1LHFH 5FCKA 2VINA 1QURH 2KAIA 3DFLA 1C5WB 1IQNA 1TQ7B 3UR6A 3H5CB 2WPHS 2PSXA 2IOTA 3P6ZB 4A7IB 4D7FA 3TIUA 1MQ6A 1UTPA 2A5AA 1OKXA 5C3NA 1NESE 5LPEA 4UFDH 3GCTG 5ABWA 2O8UA 1NRQH 1NM6A 1W7XH 2GD4B 1GDQA 2ZZUH 4MG3A 3ITIA 2VVVA 1ANBA 5K0HA 2ZDLA 1SI5H 1K1JA 3GDUA 4Q80A 3MU0A 1ZSKA 2PLXA 2R3YA 3E3TA 4XBCA 1QGFA 2BDAA 5DK1A 3T2NA 1T31A 1O5EH 3HATH 2GT8A 3P8NA 2XCNA 1H9HE 4ZKNU 1F2SE 2OINA 1AU8A 2CN0H 3ZYEA 1BZXE 3VGCB 1HJAB 1HFDA 2GMTC 1C4V2 4DGJA 4X1NU 1CU1A 4YOJA 1PFXC 5JBBS 1TNHA 1BMLA 5G4BA 3RXBA 2Z3EA 2FYRA 1MKXH 4I32A 1CGJE 3TGJE 1DLEA 1DXWA 2UUJB 3RXVA 3ATLA 1RGQA 1N6YA 3M5OA 1UHBB 1VITF 4FUFA 3PMAB 3VEQB 4WXIA 1SC8U 1W12U 3VB6A 3VB4A 1AE5A 2HVXA 2WUCA 2BZ6H 1GJ6A 1HYLA 4ABIA 5GXPA 3ZZDA 2FODA 1UVTH 4ISIH 3EQ0H 2Y81A 1HAVB 2A5IA 1T4UH 1BJVA 4NFEA 4OS1A 3RXCA 3PMJA 2Y82A 4A92A 4BAQB 2PSYA 1O5DH 3LIWA 2BXTH 5FHTA 1WQSA 1NC6A 2F9UA 1IQJA 2C8WB 4TPIZ 3ESTA 2AMDA 1AQ7A 1E38B 1P2OA 1INCA 5LH8A 1Y5BT 2VH6A 1O2WA 3BG4C 3U69H 3SW2B 3SGBE 1RD3B 1THPB 1YKTA 4X1QU 5C2ZA 4TYDA 2YNBA 1GI2A 5A0CA 2PGQB 1IHTH 3K6ZA 2Y5GA 3RP2A 1GG6B 3PO1C 1O33A 2BYAX 4X8SH 1ZPZA 2ZFTA 4Q7ZA 1WBGB 1SPJA 1YPEH 4ESTE 5I46H 1V2QT 1P10A 3A82A 1SGCA 1KXCA 1J14A 2GGVB 4MLFB 4ISLA 1UHBA 1QNJA 5DG6A 4R8TB 4ABJA 2XC0A 4NWLA 4UD9H 1UJ1A 3SV6A 3QX5H 1SLXB 2BXUH 2UWOA 1LHGH 2V0BA 1JIRA 3MYWA 1C1UH 1W13U 1GHVH 1GJ9B 2VU8E 2J94A 4WF8A 1ANEA 1Y3WA 1GJBB 1HAVA 4IN2A 2QCYA 4ZUHA 1O32A 1UVOA 1O5FH 1AZ8A 2OC1A 4BANB 3DHKH 5C5NA 3E0NB 3DA9B 1UVPA 1A1RA 1GJAB 2A4GA 2J34A 1TX8A 3UQOA 2BLVA 3RXHA 2J38A 3U1JB 4IGDA 1M9UA 2C8ZB 1QRWA 3SU4A 1LHCH 2ZGBH 1Q31A 2BQ7B 1O3LA 2OUAA 2HPQH 1FONA 1UTOA 2FOMB 2ZI2H 3A83A 5AHGH 5GCHG 1A5IA 2PUQH 4MVNA 3T25A 1OX1A 4X1PU 1QL9A 8GCHG 3K2UA 2GDEH 4RKJB 1QRZA 4CBNA 1IHSH 2A0QB 4I8HA 1OP8A 2XNIA 2H5CA 1HNEE 3MI4A 1QBOA 1TMUH 4K8BA 3ZZ3A 1EPTA 1MAYA 5HM9A 3V12A 2Q1JA 1DPOA 4O3TA 1E34B 3AVZA 3QK1A 3A81A 5JDUB 2GCHG 2VIQA 2VNTA 4FUBA 4WY3A 4X6MA 2Z9GA 1GBTA 1UTMA 2PKSC 1JIMA 3ZZAA 3FP6E 1QRXA 3GY2A 1L4ZA 2ALVA 2CHAB 4JZ1A 2WV4A 1ARBA 1NO9H 4K1SA 3U8RH 2BD9A 1GHZA 4AORA 3RU4T 5L2YH 2B5TB 1K21H 1K1MA 1TYNA 1S85A 1QJ1B 1UVUH 1GI0A 2J9NA 2ZFFH 1OWEA 1W2KH 4WMDA 3SUGA 2ZGJA 3A8CA 2ZWLH 3ODFA 3GOVB 3RXDA 3PLKA 4BAOB 3SNAA 2OC8A 3RXMA 2QC2A 2STAE 2GVFA 2A2XH 3MO9A 3SV2H 4E7NA 2BDYA 3I29A 2FTMA 3GISB 1A7SA 3VFEA 3Q77A 1QBNA 5C20A 1DSUA 1TNKA 2P16A 5EQRA 1AKSB 5FPYA 2AERH 2P95A 2Z6BD 1C5MD 1MTVA 1S81A 4SGAE 4IMZA 1DLKB 1TX6A 3QO6A 1HV7A 2G5NA 3VB5A 1KY9A 1QHRB 4Y7BA 1J9CH 1Y5UT 1ABJH 1GVZA 4YLUA 1HAOH 2GV6A 1RS0A 3V7TA 1LVOA 4GLYA 1O5AB 1AFQB 2C93B 2WPIS 1LVYA 3RXFA 1F5RA 3ZVBA 4PROA 1C5SA 3KGPA 3UWIA 2A7CA 1YCPK 1GBJA 3M36A 2VIVA 2J95A 1S82A 4JK6A 4OS5A 2VIWA 3GCOA 1O3JA 1ANCA 1FI8A 2FTLE 4LXBH 3ELAH 1D3TB 3LONA 1B5GH 1TBZH 1BTZA 3C27B 3E1XB 5DP7A 5A8ZA 3MU4A 1O2XA 1K2I1 4LZ4B 5GIBA 2BLQA 1O2ZA 3KCGH 2BY6X 4ZHMU 1SOZA 5T6GA 2FOCA 3PWCA 3V3MA 2HLCA 4GCHF 1Q2WA 3K6YA 1ZHRA 2NU2E 3RXAA 3LDXH 1P3CA 1Z71A 2QN5T 2RG3A 2TGDA 4OS4A 3GY7A 1MZDA 1O39A 4IS5A 5E8EH 5F6MA 1AGJA 5CE1A 2ZPRA 2BD4A 1AKSA 2EI6A 4CR5A 3GCHC 2PTCE 3GYLB 4H42U 2C3SA 4UFGH 4DW2U 1SGNE 4FUIA 2Z3CA 3QTOH 4CRAA 3JZ2B 1ESTA 2BVSH 3MOCA 4KP0A 2VWLA 2J92A 3ZVCA 1ZMJA 4J1YA 2G52A 1ZOMA 3BTQE 2AMPA 2AMQA 2ANMH 2BY5X 4DIHH 2B8OH 2BY7X 2ZDAH 1GHBF 4ABBA 3EDXB 2O8WA 3BEFB 1O5CB 1O2IA 1Q3XA 1T4VH 5T6DA 4Y0ZE 5EOKA 3KN2A 3LH3A 2ZTXA 3A86A 3NPSA 4NIVA 3U98H 4E7RG 1PYTC 4NA8A 3F9HA 2FOFA 1O2SA 1RIWB 3W94A 2PW8H 1C5QA 1MH0A 3IITA 3KNXA 2CJIA 5GDSH 4FU7A 3FZDA 4U30A 2XW9A 2Z3DA 3VXFH 1SBWA 1DWCH 1O2QA 1Z6JH 1PJPA 4ABHA 1XUGA 2F9NA 1CSOE 1MKXK 2IN2A 1HIAB 4Y76A 2BHGA 1XKAC 4K5ZA 2W7UA 4ZXYH 4BAHB 1VITG 2ZKSA 1EAIA 2OQUA 5L30H 1G9IE 1UK2A 1GI8B 2OTVA 2Q6DA 3UOUA 3AW0A 3QGJA 1AN1E 5PTPA 2BQ6B 2GT7A 4XE4A 6CHAC 3QGNB 1ZGIA 1GJ7B 4TY7A 1W10U 3BG4B 1DUEA 9ESTA 2BVRH 3SNBA 1GBMA 3TGKE 1TRYA 1L0ZA 1O5GH 4AG2A 4CHAC 3QUMP 4FU9A 1ARCA 2Y5FA 4NA9H 4AN7A 4ZHAA 3IWMA 3PO1B 2O8LA 1SGEE 1FNIA 4YZUA 9LPRA 2O8TA 3NZIA 3RXJA 2ZA5A 3AAVA 1UVSH 2TGPZ 4OS7A 1UTQA 1AD8H 1EXFA 1JRSA 3SU0A 2FXRA 3ZZ4A 3A7TA 4NA7A 1BJUA 3ZVGA 7KMEH 2BMGB 3UREA 1AY6H 5BRRE 1F5KU 1HXFH 4TPYA 1GHXH 5FPSA 2VVUA 1TMBH 3RXSA 1HIAA 5FPTA 1P03A 2DE8A 4OS6A 4IMQA 3LGVA 1ELGA 2A7HA 1V2ST 1TPPA 3A85A 4WH6A 3M61U 3TK5A 7ESTE 1T32A 1ORFA 2C8XB 2SNVA 4DT7B 3PROA 4AGKA 2BZAA 7GCHF 4JK5A 1G2MA 3M3TA 5C5OA 4Y8ZA 2FLBH 1FAXA 2AEIH 1FAKH 1ZMNA 1QA7A 1TONA 2I6QA 4GHQA 4QT8C 2V35A 4AX9H 3MH4A 1H1BA 3PWBA 1HGTH 4XOJA 2G51A 2KAIB 3M5NA 4HFPB 4IC5A 5DO4H 1QJ7B 1QA0A 2HOBA 2ZHDA 1DX5M 1V2NT 4AYYB 4X1RU 2Y7XA 1P2QA 4H4FA 3U8TH 1J17T 3FAOA 1V2OT 1O2MA 4INLA 2ZTZA 1G36A 1SGRE 2F91A 4FUJA 2W5EA 1BRCE 1ZGVA 5EW1H 2FOBA 4Z0KA 1HPGA 1NFWA 1O37A 3LC3A 2FYQA 2ESTE 3AW1A 3MTYA 1P05A 1QTFA 4GUXA 1O3EA 1GVKB 3LPRA 3UR9A 2FDAA 1K28D 2PKSB 2YOLA 5EQQA 1ELBA 3A8AA 1DWEH 2GCTB 3TJOA 1DICA 1GJ4H 1ID5H 4TWWA 2CF9H 3SNCA 1VCWA 5EU8A 1G2LA 1WOFA 1GMHF 1HXEH 1L1JA 4Y8XA 2XC5A 5EG4A 3TU7H 1BBRH 1SFIA 2R2WU 3FP8E 3SGQE 5B6OA 2VWOA 1XUJA 1G3BA 3CS0A 2ZFSA 4BAKB 4D9QA 1CA0C 2BD7A 1QY6A 3ZYDA 1JWTA 1X7AC 1O2PA 2XRCA 5A8YA 4JCNA 1D3DB 1A2CH 3ENSB 4OGYA 3RLYH 2P93A 8KME2 1TB6H 2EC9H 1LDTT 2ZO3H 1DFPA 1XXDA 2VIDA 1J8AA 3D65E 2ODQA 3MH5A 2AGIX 3LGWA 1A5GH 1VCPA 1DOJA 3MNBA 4AZ2B 4SGBE 4ZMAH 1OYQA 4ZKOU 2JH6D 1YPJH 5C67A 4KTUA 1MKWH 3RXIA 3MH7A 1AE8H 3AASA 2CMYA 2ZPQA 2WYJA 3S9BA 2CF8H 1DY8A 3SZNA 2R3UA 1O2KA 4KTSA 3A89A 4XBDA 2ZGHA 3RXUA 1MTNB 4AFSA 3ZVFA 1HDTH 1V3XA 5EW2H 1O3MA 3RM2H 3TVJB 1C1SA 1YYY1 3UNQA 1NU7B 3A8BA 3PMBB 1NROH 3EA9A 1YPKH 4IW4E 4AFUA 3SBKA 1O3CA 2D2DA 1ELFA 1MUEB 2SGEE 1P9UA 1CE5A 2XWBI 3PMHB 1Z1IA 1BTXA 4ISHH 3A7WA 3H7OA 3BSQA 1N6XA 4GCHG 1CT2E 2BQWB 3SQHE 5E2OA 1GPZA 1OSSA 1S6HA 3GCHB 2Q6GA 3E90B 1OWKA 2CV3A 4INKA 8LPRA 3QZQA 4I8LA 3CENA 3RXGA 1N1LA 3SU3A 1O2LA 3TK9A 2Q6FA 1C5TA 1O3GA 1O31A 1UCYH 4K1EA 1VZQH 1XVMA 1XXFA 2QY0B 3RC6A 2ZCHP 1O3HA 5JBAS 1S5SA 2DUCA 4Y11E 4VGCC 2BD2A 4GAWA 1C1VH 3EAJA 3KEEA 1BTUA 2F9PA 5EGMA 2ANWA 3MFJA 1DXPA 2GP9B 3FANA 2C8YB 2FX6A 5FBEA 3A7ZA 5T3HA 2SGQE 1GHBG 1THSH 1C1WH 5AF9H 5C1UA 1AVWA 2BDCA 4ZXXH 1NZQH 4YOGA 1MU8B 2RDLA 2M5TA 3SV8A 1Y59T 3RMMH 5ESTE 1EPTB 2H9TH 1C5XB 1O2TA 1MCVA 1VGCC 4ABAA 3GDSA 1QR3E 1DWBH 3CP7A 1C2LA 1TFXA 2TBSA 1EATA 2AS9A 1SLUB 2BD8A 3STIA 3GDVA 4AB9A 1UK3A 4Y8YA 1LHDH 1WAYB 3DD2H 5L6NH 1XM1A 1OWIA 1Y5AT 3RXQA 4DOQA 3FZZA 4X1SU 1CBWB 1W8BH 1KXAA 4GPGA 2G5VA 2BM2A 4MNXA 6CHAB 2FIRH 4XDEA 1BTWA 4HZHA 1LTOA 1TNGA 1TNIA 5E0GA 4CRFA 2QV1A 4YOIA 1F7ZA 4Y0YE 4NIXA 1H9LB 4ISOA 1FN6A 2R9PA 4X2XA 1LPKB 3QDZB 1C2DA 2AIQA 2FEQH 1V2RT 2ZG0H 2ZCLP 1NN6A 1PQ8A 4FUDA 2XWAA 2VVCA 4CHAB 1G3EA 3U1IB 2Z7FE 2ANYA 2ALPA 4FU8A 1W7GH 3LGIA 1KSNA 2NWNA 1FXYA 1XUIA 1SB1H 2D1JA 3LGYA 2HRVA 5F8XA 1S0RA 1Y3YA 5A8XA 2EEKA 3GICB 5EPYA 4GVUA 2P3UB 3RXKA 4YM9A 2HPPH 1C9PA 5FXLA 1UTNA 3B9FH 1JBUH 3AAUA 3V13A 2GKVE 2G4UA 1C5NH 4J2YB 1EJNA 5J4SA 4YT6H 5JPMH 1TMTH 3RU4D 3SJKA 1GWAA 1C9TA 2J4IA 3SJOA 1S84A 2QGRA 3ATWA 5ESBA 2FO9A 4B2CA 1TX7A 3HGPA 1CO7E 1EOLA 1SLWB 3PTBA 4AB8A 1TE0A 3LJOA 1A4WH 3HKIB 2NU0E 5FX5A 2VGCC 1YM0A 4U2WA 1GHAF 2SGFE 1C5UA 1P06A 3SQEE 1MMJN 2QF0A 3SUDA 5E2PA 1G3CA 3ATMA 3BIVH 4GHTA 1TOMH 1SG8B 3R3GB 1GCTB 3RUOA 2SGPE 4JZDH 1EZXC 4WXVA 7GCHG 4NCYA 1UCYE 5AFZH 1ETTH 3RLWH 2R0KA 3MNXA 1TGNA 3URDA 1FJSA 1N8OC 1E37B 4CH2B 1ZJDA 2V3OH 2XCFA 1NPMA 5AFYH 3S9AA 4LOYH 5FAHA 1MBMA 4D9RA 1O2RA 4CREA 5LPFA 1RTLA 6LPRA 2QA9E 1O3IA 3Q3XA 2CGAA 2A4OA 3M3SA 1SLVB 1O2VA 1C2KA 4B2AA 3JZ1B 3Q00A 1FMGA 4A6LA 1TABE 4WVPE 4X0WU 2Z9KA 3A7VA 2FZZA 1FPCH 1TGTA 4DVAU 3RMOH 2OC7A 2HGTH 4B2BA 1BTHH 1C5YB 3TJVA 2IJOB 4CRDA 5HMAA 2FS8A 2F3CE 3ODDA 3UWJH 1ZHPA 1BT7A 2Y80A 3SN8A 3F9GA 1UK4A 1ZJKA 2W7SA 3UPEA 1GI1A 1GCDA 1SHHB 2F83A 1EJMA 2JKHA 1MU6B 2GX4A 1LQDB 4KELA 1SL3A 3BIUH 4FUEA 2ZGCA 1SHYA 4OS2A 3ZVAA 5I25A 1P12E 1JOUB 3LH1A 1C5ZB 1A0LA 1FLEE 2PWXA 1VR1H 2ZDNA 1GMHG 3E6PH 3QWCH 4NWKA 1DT2A 3LGUA 4FVDA 4ISNA 2SGDE 4D76A 1KIGH 2GDDA 3TGIE 2D8WA 4UEHH 1F5LA 1BQYA 2FOEA 2GZ7A 1KXBA 1XUKA 1ZRKA 1TALA 1SGFA 2ZFRH 3SHAH 1SGFG 2SGAA 4UDWH 1MTUA 1GHYH 1Z8JB 1GBEA 1O35A 4O97A 3RMNH 1W3CA 1EAUA 2GZ9A 1V2VT 2WYGA 3RMLH 4BTUB 1EKBB 3CS7A 1QB1A 1EAWA 2BTCE 4Y71A 2ZHQH 2P3TB 3FFGA 4DIIH 4BNRA 3LJJA 1SQOA 2GMTB 5J4QA 3QLPH 3UOPA 5EXNA 1O30A 2ILNA 2OC0A 1ZRBA 1JMOH 3TLOA 1ESAA 1C1OA 1ELAA 4O3UA 1TLDA 2OD3B 2OBOA 1AVGH 3BTFE 1QJ6B 3BTGE 5DP9A 3HPTB 3Q3YA 2ZU4A 1JXPA 3STJA 3VPKA 5HM2A 4CRGA 1ZLRA 2GV7A 2STBE 1U6QA 1MKWK 1P01A 4R0IA 3PYHA 1WQVH 5LPRA 3UNSA 2H5DA 2BX3A 4NZLA 2R2MB
chains in the Genus database with same CATH superfamily
4DCDA 3P17H 5EODA 4TWYA 3M7QA 3ZZ9A 4CH8B 1LQEA 1GG6C 1UTLM 3SYJA 2QXJA 2TGTA 4ABEA 1W14U 3QN7A 1WTHD 4YT7H 2ZC9H 1GBLA 4IN1A 5BPEA 6GCHF 1P04A 4IC6A 2K8IA 1FN8A 1G37A 2JH0D 2AGGX 5HGGA 1BHXB 1BMNH 1CQQA 3BF6H 3N7OA 4X8UH 4THNH 2TRMA 1O2OA 1NFXA 3ZVDA 3RU4E 5C1XA 4BTIB 4DURA 1LPZB 2XNDD 4HTCH 2WPJS 1K22H 1K1LA 2GTBA 1YF4A 1GDUA 1SVPA 1HAZB 1E1RD 3VB7A 2YNAA 1GBAA 1OS8A 2PUXB 1MZAA 3M5MA 2F9OA 2P3FH 3SI3H 3MU8A 1V2JT 4VGCB 2PHBA 4AYVB 1O34A 1LHEH 1DSTA 1SQTA 1IQHA 1QFKH 1C2GA 3TJUA 1ESBA 1T8LA 3M37A 1C2JA 1UCYK 3F9EA 5DP6A 2FI5E 1GJ8B 4A5TS 2ZU1A 1O3AA 1O36A 1L1GA 1K1PA 2ZIQH 3H7TA 2Z9JA 4X6NA 2HNTC 1TA6A 1S6FA 1IQEA 3BEUA 1BITA 1RTKA 2SFAA 1P2KA 1KLTA 1KTSB 2OK5A 1IQLA 1MD8A 3RDZA 4Y79A 1BIOA 3UIRA 1EP6A 1DY9A 1GI6A 1ACBE 1ETSH 1SGYE 2L6OA 5CHAC 1F0UA 1V2MT 4MQAA 4ABFA 3U8OH 1TPAE 3O8BA 3I77A 1Y8TA 1C2FA 3OU0A 1IOEA 1GBFA 3BN9A 1P2MA 1ABIH 4H6TA 4Y10E 2Y7ZA 1C2HA 1W11U 4ZH8A 3A7YA 4HI3A 1O0DH 4HGCA 3ZZ5A 3TJNA 2XYAA 4ZKSU 1A61H 2VIOA 4DJZB 5LGOA 1AB9C 1GI7B 3ZZ6A 3TH4H 2O8MA 1Y3XA 1HAGE 1Z6EA 3P92A 1FDPA 1BMFD 3DSOA 1GHWH 2EA3A 1TPOA 5A0BA 2UUFB 1FY8E 2HNTF 3SUFA 3SNEA 1P2JA 1HAHH 3SJ9A 1A3BH 4CBOA 1EQ9A 2A7JA 1TRMA 2KX4A 5DKMA 1C5VA 3RXTA 2EI7A 3EE0B 1P9SA 3R0FA 5SGAE 1FY4A 5CMXH 2ZFQH 1D9IA 1MAXA 4X6PA 4XSKU 3FO8D 2SNWA 1C1PA 1CVWH 4AOQA 3NUMA 1QQUA 1DWDH 1CT0E 1IQMA 1C1TA 2G55A 1LKAA 1GJCB 1MQ5A 4FXGH 1FY5A 1ELDE 2ZU5A 5IYTA 1SSXA 3TNSA 2LELA 2YMSB 1K1NA 2VB0A 1YCPH 3KQCA 1THRH 1WYKA 4NGAH 1XKBC 3SU6A 2RDEA 3MH6A 2A2QH 4NZQA 3KQBA 3MO3A 3G01A 3DUXH 4NSVA 2VWMA 4K3JA 2LPRA 3TPIZ 5F8TA 1DDJA 1C1MA 3BEIB 1GMDF 1HB0B 2OQ5A 3U9AH 1C5LH 3KQDA 2PV9B 2VGCB 1O38A 1OWDA 3NK8A 4F4OC 4FUGA 1PQ5A 3KF2A 3KIDU 4YTAA 1TWXB 4A1XA 3M7UA 3RXRA 4MPXA 1HAXB 1C2MA 1WCZA 1Z8IB 4JZFH 3TH2H 3LC5A 4Q2KA 1V6DA 2LNCA 2NU3E 1PPEE 1KTTB 2ZEBA 4ZROA 1GHAG 1HUTH 1E36B 2B7DH 1SMFE 1UTKA 3OYPA 2FP7B 1QB6A 1N8OB 2IPHA 1P02A 3DFJA 2ZHFH 3PLPA 1NS3A 2JETC 2BDIA 3URCA 4ZAEA 2FI4E 1A46H 1HJ8A 1GI5A 3E16B 5EXMA 3W95A 3SV9A 1BTYA 2IPQX 5HIZA 5C17A 1IQIA 4Q63A 3LU9B 1PQAA 1MCTA 2HVYB 2UWLA 2FS9A 1C5PA 1GBCA 2ZP0H 3DCLA 3MU1A 4AG1A 3D49H 3UNRA 1E0FD 2BDHA 4AGJA 1TNLA 2AFQB 2WPDD 1HJ9A 2FPZA 4XFQA 5DPAA 4CRCA 3F6UH 1YPHC 5DSFA 4WWYA 2D26C 4B76A 1DANH 1TPSA 1OXGA 2ZGXH 1OOKB 3DSGA 3N7EA 1NFYA 1O5BB 2R0LA 3OY6U 1ZPBA 2BY8X 1NFUA 1VITH 1NRRH 3MHWU 1O3OA 2ASUB 2ZQ2A 1GI9B 4UONA 4ZHLU 1NRSH 1UTJA 1TBQH 3BTDE 1VJAU 5H4IB 4MPUA 2HNTE 1RIWC 2W26A 2ANKH 1GL1A 2OXSA 1P57B 3ZV9A 1ZTKA 1V2UT 3TH3H 2G4TA 4UE7H 3RC5A 1RXPA 1H8DH 1SR5C 1GBBA 1XUHA 3NKKA 5T1VA 2WHXA 3V0XA 1OYTH 2O9QA 3GY4A 1CHOF 1P2IA 2AHME 1AI8H 4A1TA 1FIWA 1BMAA 3UY9A 2AGEX 1XUFA 2OP9A 3LKWA 1IQGA 2ZQ1A 1GMCF 2JJ1D 3O8RA 2RA3A 2ZU3A 3K65B 1P3EA 2QXIA 3MMGA 5JB9S 3F0PA 3F1SB 1T8OA 1TA2A 2H6MA 1F92A 5TCCA 4K2YA 1ZTLA 2KR7A 2V6NA 2VH0A 2XBYA 3SHCH 2G81E 5IDKA 2Z9IA 3EE7A 1CT4E 2VWNA 1P09A 2G8TA 1PPHE 2BOHB 1EAXA 1XMNB 4RSPA 2PKAB 1SGPE 1MD7A 1OPHB 1A3EH 2BDGA 2QXHA 1H4WA 2KCAA 4JYUH 4B1TA 1AO5A 1BHXF 1O2NA 4HG6A 1WTGH 4RN6A 4UFEH 1MTWA 1LVMA 3A84A 1CHGA 1XX9A 3D62A 1D6WA 1E1QD 3H09A 4BXWA 3P70B 3NXPA 4I8KA 1B0FA 2ZNKH 3SU2A 4F49A 5JYIA 1BBRE 3BTTE 1J16A 4JMYA 1BDAA 2XTTB 1ZR0A 2PR3A 8ESTE 3O8DA 2LP6A 2KCPA 2RCEA 4MNYA 3SORA 3KL6A 4B74A 1UO6A 4K8YA 1WU1A 3TITA 1KXDA 1P0SH 3NWUA 6GCHG 1YPLH 2RFKC 2ZDKA 3GY5A 4U01A 1EZSC 4CR9A 4TY6A 3A8DA 1TGBA 4YO9A 5E0JA 2V3HH 2ZTYA 1J15A 5TJXA 7LPRA 4BTTB 5DP5A 3C1KA 4DY7B 3ZZCA 3EA7A 5GJ4B 3P8OA 1C1RA 3RXLA 1QQ4A 3S9CA 4X2WA 3IG6B 3E0PB 3UFAA 1O3FA 4D7GA 2J2UA 4U32A 3T27A 3MQKC 2PKAA 1TAWA 5EXLA 1HAIH 3EGKH 1HBTH 3MU5A 3SGAE 4O9VA 4MNVA 3GY8A 4MTBA 1AIXH 2TPIZ 2FWWA 1NT1A 2FESH 3LT3A 4O03A 4OGXA 2BOKA 2ZU2A 1SGTA 5CHAB 3F68H 3L33A 4JZIA 2NU4E 2C4FH 5AVDA 1FZZA 1TNJA 1EOJA 4FUCA 3S69A 1PPGE 1GBIA 2AYWA 4I7YH 4H6SB 2HALA 3SUEA 5HXFA 4MPWA 2K1QA 4UFFH 1F0TA 1GJ5H 2VJ1A 2P8OC 1S0QA 5TCAA 1T8NA 2XC4A 3FKSD 1KDQB 3S0NA 1GGDC 5FBIA 1ZTJA 2A32A 1CGIE 2A1DB 1C4Y2 1YPHE 3HGNA 2XBWA 1AWHB 2ZHEH 1K1OA 3OTJE 2I6SA 2P59A 1AB9B 2GCTC 1VJ9U 3E91A 1BRUP 4X8TH 1W0YH 2F9BH 1GI3A 3MO6A 1LMWB 1LVBA 2OBQA 1SQAA 1W0KD 1BA8B 2CK3D 1G30B 1W0ZU 3BTHE 3T26A 1V2LT 5F03A 1IQFA 2H2ZA 2ZF0H 1O3KA 2B9LA 2A4QA 1GL0E 1OWHA 3GCTF 3KHVA 4E06H 1O2JA 4X6OA 3A80A 1Z7KA 1DS2E 2OLGA 3F2GA 5E0HA 4GSOA 1C1QA 3RXPA 1EZQA 3FVFB 4BXSA 3UAIC 4AFZA 1IAUA 3M7TA 2BD3A 1P8VC 4Q7YA 3TK6A 4KKDA 3GCNA 2XXLA 1CGHA 3RC4A 1GVLA 1NY22 1SGDE 1OP2A 4I33A 3MNSA 1LO6A 1EZUC 4NFFA 4NG9H 1ZHMA 3T5FH 3OSYA 5FCRA 2BX4A 1QB9A 1PPCE 1IQKA 1EASA 1NBMD 5JB8S 4YXWD 1PQ7A 5A09A 2Y6TA 1QBVH 3UTUH 2HWLB 1P11E 1D3PB 1AMHA 4NIYA 3RM0H 1G3DA 4WMEA 4Y7AA 3MWIU 3P95A 5GPIB 3VXEH 3ATKA 1GBDA 1KDQA 1LPGB 1T8MA 1EP5A 4X2VA 3A88A 3I78A 5HYOA 1D6RA 6ESTA 2ODYB 3F9FA 3VGCC 1ELEE 1HJAC 1QL7A 5DGJA 1MBQA 1C5OH 3HK3B 2J98B 1EUFA 3BG8A 3GYMA 1RTFB 4AFQA 1YCPM 1CA0B 3LGTA 3SNDA 1RFNA 1MTNC 3S7HB 1O3BA 3UUZA 1ZYOA 1GMDG 2ZDVH 3ZVEA 1AVXA 3VB3A 2KZ4A 1FY1A 3ZV8A 1BBRK 3S7KB 5DJ7A 3B8JA 5JBCS 1PPBH 4B73A 1C4U2 1NRNH 1D3QB 2QAAA 1AZZA 5A2MH 1WV7H 2IJD1 1E35B 1FQ3A 2JETB 1DITH 3B23B 2ODPA 1Z8RA 4M7GA 4YLQH 3PB1E 4MDSA 1RRKA 2QXGA 1TIOA 2FOGA 2P94A 1AHTH 2B0FA 3A87A 1ANDA 1NRPH 2W3KA 1EJAA 1FY3A 1ELVA 1QIXB 1B0EA 1HRTH 2QYIA 2QF3A 5DP8A 4D8NA 5K7RA 3BTME 1ETRH 1MABB 2BB4A 4B71A 1BTPA 2WV9A 3SI4H 2EI8A 2DE9A 1B7XB 1H8HD 3SJIA 1PPFE 2ZHWH 1ZPCA 5F8ZA 2BDBA 2Y5HA 3HK6B 1ZSJA 1AFEH 2BY9X 1HAPH 2FOHA 2OCVB 1ZZZA 2G00A 3QZRA 2J98A 4DG4A 1KXEA 3M35A 4RKOB 4X8VH 3GY3A 1L2EA 4MNWA 1SFQB 3OEED 4ASHA 1BRAA 1WDIA 1BB0B 1BRBE 1V2KT 1TGSZ 1Z8GA 2WPMS 1YC0A 5FX6A 1TBRH 1PYTD 4DT4A 3UB0A 1K1IA 3KQEA 5GWZA 2GZ8A 1BUIA 3M5LA 1BCUH 4JYVH 1ELCA 2NU1E 1EPTC 1C1NA 1KXFA 3BTEE 3ATIA 3K9XB 1EB2A 1NU9A 1O3DA 1DM4B 4WH8A 2H9HA 1QCPA 1HAYB 2WINI 1C2EA 2XBVA 1KLIH 2TIOA 4NIWA 1LKBA 1YLDA 5EQSA 5KECA 2L74A 3BV9B 1SOTA 1YPGH 3SV7A 5T6FA 2W3IA 1GI4A 1CBWC 1VCQA 4A1VA 1O2HA 2H9EH 1SGQE 2RA0A 3T62A 1CHOG 3L3TA 1DE7H 4K1TA 4JZEH 4ABGA 4XD7D 4FUHA 2A31A 1FV9A 3DT0H 5C1YA 5GCHF 3ZZBA 3RXEA 1GMCG 4E05H 3SOSA 8GCHF 1D4PB 3LOXA 1P2NA 1HLTH 3OX7U 1DVAH 3P8GA 1O2GH 2PGBB 2CXVA 3EYDA 4YESB 4INHA 4LK4A 1Y3VA 2EY4C 3PM3A 1VGCB 1ZSLA 1G32B 1SQRA 1FUJA 2Z9LA 1F0RA 1L4DA 1C5RA 2H1UA 2UUKB 4B75A 1GBKA 3SO3A 2GCHF 1BOQA 4I31A 1F0SA 3HKJB 5JBTA 1JRTA 1HCGA 2XBXA 4NSYA 4B6EA 3UQVA 4MPVA 1YPMH 4FVBA 2WPKS 5DP4A 3P8FA 3WY8A 3QTVH 1QL8A 2THFB 4I8GA 4WJG2 4XBBA 1YLCA 2JH5D 2BLOA 1TRNA 5A0AE 3Q76A 1DUAA 3GY6A 3PLBA 5EIYA 1A0JA 2FX4A 1WSSH 2AH4X 2UWPA 1PPZA 1SGIB 4Q7XA 4Z6AH 1EX3A 2C90B 1H8ED 1OWJA 2Z94A 2CHAC 5ETXA 3E8LA 1GBHA 2A4RA 3BTWE 4KTCA 5DP3A 2FMJA 1WUNH 3TNTA 4WMFA 2FOAA 1NTPA 5GNDA 4JYTA 3T28A 2PFEA 3VG8A 5DN6D 4ZKRU 1TOCB 1V2TT 4I8JA 3FP7E 3NCLA 3L6PA 2BLWA 1KYNA 4IBLH 1GCTC 2ZPSA 4BAMB 1GJDB 1O2UA 1O3NA 1EB1H 1C2IA 1YP9A 3F0OA 2ZCKP 2PTNA 3SJ8A 2PP6A 2FI3E 1KLJH 4ABDA 1Y3UA 5EPNA 3T29A 1H8IH 2F4LA 1AUJA 3MNCA 2AIPA 2QIQA 1MTSA 1UMAH 1OHHD 1YGCH 3BTKE 3ZZ7A 2WUBA 3SU1A 2FM2A 1YY3A 2A5KA 1AWFH 1RJXB 1FIZA 1Z1JA 5EJZA 2FLRH 4M9FA 1LCYA 2P8OB 2BD5A 2ULLA 2ZECA 1V2WT 1A5HA 1T7CA 5L2ZH 1AFQC 1GGDB 4Y6DA 2XOKD 2ZFPH 1V2PT 1XVOA 3ZZ8A 1A0HB 1O3PB 1TGCA 1ELTA 1AUTC 2VIPA 3D23A 1CA8B 3OY5U 1BMMH 2A45B 2BVXH 1OP0A 3SU5A 1TQ0B 4K69A 3PV4A 2WPLS 1K9OE 4X2YA 1GDNA 1L1NA 1ZMLA 4KGAA 3Q3KA 3M3VA 3PTNA 1FPHH 1O2YA 1YBWA 2WV5A 4LZ1H 3RXOA 3A7XA 2QF4A 3O8CA 1H9IE 2UUYA 2ZDMA 2TGAA 4BOHA 1S83A 4K60A 4CRBA 2F9VA 3EA8A 1LHFH 5FCKA 2VINA 1QURH 2KAIA 3DFLA 1C5WB 1IQNA 1TQ7B 3UR6A 3H5CB 2WPHS 2PSXA 2IOTA 3P6ZB 4A7IB 4D7FA 3TIUA 1MQ6A 1UTPA 2A5AA 1OKXA 5C3NA 1NESE 5LPEA 4UFDH 3GCTG 5ABWA 2O8UA 1NRQH 1NM6A 1W7XH 2GD4B 1GDQA 2ZZUH 4MG3A 3ITIA 2VVVA 1ANBA 5K0HA 2ZDLA 1SI5H 1K1JA 3GDUA 4Q80A 3MU0A 1ZSKA 2PLXA 2R3YA 3E3TA 4XBCA 1QGFA 2BDAA 5DK1A 3T2NA 1T31A 1O5EH 3U28C 3HATH 2GT8A 3P8NA 2XCNA 1H9HE 4ZKNU 1F2SE 2OINA 1AU8A 2CN0H 3ZYEA 1BZXE 3VGCB 1HJAB 3KYFA 1HFDA 2GMTC 1C4V2 4DGJA 4X1NU 1CU1A 4YOJA 1PFXC 5JBBS 1TNHA 1BMLA 5G4BA 3RXBA 2Z3EA 2J5UA 2FYRA 1MKXH 4I32A 1CGJE 3TGJE 1DLEA 3GS9A 1S6LA 1DXWA 2UUJB 3F2HA 2JDID 3RXVA 3ATLA 1RGQA 1N6YA 3M5OA 1UHBB 1VITF 4FUFA 3PMAB 3VEQB 4WXIA 3F3BA 1SC8U 1W12U 3VB6A 3VB4A 1AE5A 2HVXA 4F48B 2WUCA 2BZ6H 1GJ6A 1HYLA 4ABIA 5GXPA 3ZZDA 2FODA 1UVTH 4ISIH 3EQ0H 2Y81A 1HAVB 2A5IA 1T4UH 1BJVA 4NFEA 4OS1A 3RXCA 2GJGA 3PMJA 2Y82A 4A92A 4BAQB 2PSYA 1O5DH 3LIWA 2BXTH 5FHTA 1WQSA 1NC6A 2F9UA 4OM9A 1IQJA 2C8WB 4TPIZ 3ESTA 2AMDA 1AQ7A 1E38B 1P2OA 1INCA 5LH8A 1Y5BT 2VH6A 1O2WA 3BG4C 3U69H 3SW2B 3SGBE 1RD3B 1THPB 4RT0A 1YKTA 4X1QU 5C2ZA 4TYDA 2YNBA 3F2FA 1GI2A 5A0CA 2PGQB 1IHTH 3K6ZA 2Y5GA 3RP2A 1GG6B 3PO1C 2M2AA 1O33A 2BYAX 4X8SH 1ZPZA 2ZFTA 4Q7ZA 1WBGB 1SPJA 1YPEH 4ESTE 5I46H 1V2QT 1P10A 3A82A 1SGCA 1KXCA 1J14A 2GGVB 4MLFB 4ISLA 1UHBA 1QNJA 5DG6A 4R8TB 4ABJA 2JJ2D 2XC0A 4NWLA 4UD9H 1UJ1A 3SV6A 3QX5H 1SLXB 2BXUH 2UWOA 1LHGH 2V0BA 1JIRA 3MYWA 1C1UH 1W13U 1GHVH 1GJ9B 2VU8E 2J94A 4WF8A 1ANEA 1Y3WA 1GJBB 1HAVA 4IN2A 2QCYA 4ZUHA 1O32A 1UVOA 1O5FH 1AZ8A 2OC1A 4BANB 3DHKH 5C5NA 3E0NB 3DA9B 1UVPA 1A1RA 1GJAB 2A4GA 2J34A 1TX8A 3UQOA 3W1EA 2BLVA 3RXHA 2KCYA 2J38A 3U1JB 4IGDA 1M9UA 2C8ZB 1QRWA 3SU4A 1LHCH 2ZGBH 1Q31A 2BQ7B 2WZQA 4ACBA 1O3LA 5FL7D 2OUAA 1FX0B 2HPQH 1FONA 1UTOA 2FOMB 2ZI2H 3A83A 5AHGH 5GCHG 1A5IA 2PUQH 4MVNA 3T25A 3PV2A 1OX1A 4X1PU 1QL9A 8GCHG 3K2UA 2GDEH 4RKJB 1QRZA 4CBNA 1IHSH 3CNRA 2A0QB 4I8HA 1OP8A 2XNIA 2H5CA 1HNEE 3MI4A 1QBOA 1TMUH 4K8BA 3ZZ3A 1EPTA 1MAYA 5HM9A 3V12A 2Q1JA 1DPOA 4O3TA 1E34B 3AVZA 3QK1A 3A81A 5JDUB 2GCHG 2VIQA 2VNTA 2YMSC 4FUBA 4WY3A 4X6MA 2Z9GA 4AC9A 1GBTA 1UTMA 2PKSC 2YMSD 1JIMA 3ZZAA 3FP6E 1QRXA 3GY2A 1L4ZA 2ALVA 2CHAB 4JZ1A 2WV4A 1ARBA 1NO9H 4K1SA 3U8RH 2BD9A 1GHZA 4AORA 3RU4T 5CHBA 5L2YH 2B5TB 1K21H 1K1MA 1TYNA 1S85A 1QJ1B 1K0HA 4ACAA 1UVUH 1GI0A 2J9NA 2ZFFH 1OWEA 1W2KH 4WMDA 3SUGA 2ZGJA 3A8CA 2ZWLH 3ODFA 3GOVB 4ZCNA 3RXDA 3PLKA 4BAOB 3SNAA 2OC8A 3RXMA 2QC2A 2W6JD 2STAE 2GVFA 2A2XH 3MO9A 3SV2H 4E7NA 2BDYA 3I29A 2FTMA 3GISB 1A7SA 3VFEA 3Q77A 1QBNA 5C20A 1DSUA 1TNKA 2P16A 5EQRA 1AKSB 5FPYA 2AERH 2P95A 2Z6BD 1C5MD 4I86A 1MTVA 1S81A 4SGAE 4IMZA 1DLKB 1TX6A 3QO6A 1HV7A 2G5NA 3VB5A 1KY9A 1QHRB 4Y7BA 1J9CH 1Y5UT 1ABJH 1GVZA 4YLUA 1HAOH 2GV6A 1RS0A 3OFND 3V7TA 1LVOA 4GLYA 1O5AB 1AFQB 2C93B 2WPIS 1LVYA 3RXFA 1F5RA 3ZVBA 4PROA 1C5SA 4Q4LA 3KGPA 3UWIA 2A7CA 1YCPK 4P00A 1GBJA 3M36A 2VIVA 2J95A 1S82A 4JK6A 4OS5A 2VIWA 3GCOA 1O3JA 1ANCA 1FI8A 2FTLE 4LXBH 3ELAH 3SZEA 1D3TB 4F55A 3LONA 3WWFA 1B5GH 1TBZH 1BTZA 3C27B 3E1XB 5DP7A 5A8ZA 3MU4A 1O2XA 1K2I1 4LZ4B 4FETA 3PRBA 4FOUC 5GIBA 2BLQA 1O2ZA 3KCGH 2BY6X 3PV5A 4ZHMU 1SOZA 5KGOA 5T6GA 2FOCA 3PWCA 3V3MA 2HLCA 4GCHF 1Q2WA 2WSSD 3K6YA 1ZHRA 2NU2E 3RXAA 3LDXH 1P3CA 1Z71A 2QN5T 2RG3A 2TGDA 4OS4A 3GY7A 1MZDA 1O39A 4IS5A 5E8EH 5F6MA 1AGJA 5CE1A 2ZPRA 2BD4A 1AKSA 2EI6A 4CR5A 3GCHC 4B6FA 2PTCE 3GYLB 4H42U 2C3SA 4UFGH 4DW2U 1SGNE 4FUIA 2Z3CA 5EJ1A 3QTOH 4CRAA 3JZ2B 1ESTA 2BVSH 3N99A 3MOCA 4KP0A 2VWLA 2J92A 3ZVCA 1ZMJA 4J1YA 2G52A 1ZOMA 3BTQE 2AMPA 2AMQA 2ANMH 2BY5X 4DIHH 2B8OH 2BY7X 2ZDAH 1GHBF 4ABBA 3EDXB 2O8WA 3BEFB 1O5CB 1O2IA 1Q3XA 1T4VH 5T6DA 4ASUD 4Y0ZE 5EOKA 3KN2A 3LH3A 2ZTXA 3A86A 3NPSA 4NIVA 3U98H 4E7RG 1PYTC 4NA8A 1E79D 3F9HA 2FOFA 1O2SA 1RIWB 3W94A 2PW8H 1YWUA 1C5QA 1MH0A 3IITA 3KNXA 2CJIA 5GDSH 4FU7A 3FZDA 4U30A 2XW9A 2Z3DA 3VXFH 1SBWA 1DWCH 1O2QA 1Z6JH 1PJPA 4ABHA 1XUGA 2F9NA 1CSOE 1MKXK 2KCOA 1SKYE 2IN2A 1HIAB 4Y76A 2BHGA 1XKAC 4K5ZA 2W7UA 4ZXYH 4BAHB 2QF5A 1VITG 2ZKSA 1EAIA 2OQUA 3AK5A 5L30H 5HIYA 1G9IE 1UK2A 1GI8B 2OTVA 2Q6DA 3UOUA 3AW0A 3QGJA 1AN1E 5PTPA 2BQ6B 2GT7A 4XE4A 6CHAC 3QGNB 1ZGIA 1GJ7B 4TY7A 5KEDA 1W10U 3BG4B 1DUEA 9ESTA 2BVRH 5C0TA 1QZ8A 3SNBA 1GBMA 3TGKE 3KQ5A 1TRYA 2KFWA 1L0ZA 1O5GH 4AG2A 4CHAC 3QUMP 4FU9A 1ARCA 2Y5FA 4NA9H 4AN7A 4ZHAA 3IWMA 3PO1B 2O8LA 1SGEE 1FNIA 4P02A 4YZUA 3FN8A 9LPRA 2O8TA 3NZIA 3RXJA 2ZA5A 3AAVA 1UVSH 2TGPZ 4OS7A 1VKYA 1UTQA 1AD8H 1EXFA 1JRSA 3SU0A 2FXRA 3ZZ4A 3A7TA 4NA7A 1BJUA 3ZVGA 7KMEH 2BMGB 5EJLA 3UREA 1NBME 1AY6H 5BRRE 1F5KU 2J97A 1HXFH 4TPYA 1GHXH 5FPSA 2VVUA 1TMBH 3RXSA 1HIAA 5FPTA 1P03A 2DE8A 4OS6A 3OTPA 4IMQA 3LGVA 1ELGA 2A7HA 1V2ST 1TPPA 3A85A 4WH6A 3M61U 3TK5A 7ESTE 1T32A 1ORFA 2C8XB 5C94A 2SNVA 4DT7B 3PROA 4AGKA 2BZAA 7GCHF 4JK5A 1G2MA 3M3TA 5C5OA 4Y8ZA 2FLBH 1FAXA 2AEIH 1FAKH 1ZMNA 1QA7A 1TONA 2I6QA 4GHQA 4QT8C 2V35A 4AX9H 3MH4A 1H1BA 3PWBA 1HGTH 4XOJA 2G51A 2KAIB 3M5NA 4HFPB 4IC5A 5DO4H 1QJ7B 1QA0A 2HOBA 2ZHDA 1DX5M 1V2NT 4TT3D 4AYYB 4X1RU 2Y7XA 1P2QA 4H4FA 3U8TH 1J17T 3FAOA 1V2OT 1O2MA 4INLA 2ZTZA 1G36A 1SGRE 2F91A 4FUJA 2W5EA 1BRCE 5HKKD 1ZGVA 5EW1H 2FOBA 4Z0KA 1HPGA 1NFWA 1O37A 3LC3A 2FYQA 2ESTE 2K0QA 3AW1A 3MTYA 1P05A 1QTFA 4GUXA 1O3EA 1GVKB 3LPRA 3UR9A 2FDAA 1K28D 2PKSB 2YOLA 5EQQA 1ELBA 3A8AA 1DWEH 2GCTB 3TJOA 1DICA 1GJ4H 1ID5H 4TWWA 2CF9H 3SNCA 1VCWA 5CDFE 5EU8A 1G2LA 1WOFA 1GMHF 1HXEH 1L1JA 4Y8XA 2XC5A 5EG4A 3TU7H 1BBRH 1SFIA 2R2WU 3FP8E 3SGQE 5B6OA 2VWOA 3WWBA 2W6ID 1XUJA 1G3BA 3CS0A 2ZFSA 4BAKB 4D9QA 1CA0C 2BD7A 1QY6A 2EQNA 3ZYDA 1JWTA 1X7AC 1O2PA 2XRCA 5A8YA 4JCNA 1D3DB 1A2CH 3ENSB 4OGYA 3RLYH 2P93A 8KME2 1TB6H 1EFRD 2EC9H 1LDTT 2ZO3H 1DFPA 1XXDA 2VIDA 1J8AA 3D65E 2ODQA 3MH5A 4RT1A 2AGIX 3LGWA 1A5GH 1VCPA 1DOJA 3ZIAD 1COWD 3MNBA 4AZ2B 4SGBE 4ZMAH 1OYQA 4ZKOU 2JH6D 1YPJH 5C67A 4KTUA 1MKWH 3RXIA 5IK2D 3MH7A 1AE8H 3AASA 2CMYA 2ZPQA 2WYJA 3S9BA 2CF8H 1DY8A 3SZNA 2R3UA 1O2KA 4KTSA 3A89A 4XBDA 2ZGHA 3RXUA 1MTNB 4AFSA 3ZVFA 1HDTH 2JIZD 1V3XA 5EW2H 1O3MA 3RM2H 3TVJB 1C1SA 1YYY1 3UNQA 1NU7B 3A8BA 3PMBB 1NROH 4XRNA 3EA9A 1YPKH 4IW4E 4AFUA 3SBKA 1O3CA 2D2DA 1ELFA 1MUEB 2HLDD 2SGEE 1P9UA 1CE5A 2XWBI 3PMHB 1Z1IA 1BTXA 4ISHH 3A7WA 3H7OA 3BSQA 1N6XA 4GCHG 1CT2E 2BQWB 3SQHE 5E2OA 1GPZA 1OSSA 1S6HA 3GCHB 2Q6GA 3E90B 1OWKA 2CV3A 4INKA 8LPRA 3QZQA 4I8LA 3CENA 3RXGA 1N1LA 3SU3A 1O2LA 3TK9A 2Q6FA 1C5TA 1O3GA 1O31A 1UCYH 4K1EA 1VZQH 1XVMA 1XXFA 2QY0B 3RC6A 2ZCHP 1O3HA 5JBAS 1S5SA 2DUCA 4Y11E 4VGCC 2BD2A 4GAWA 4RI0A 1C1VH 3EAJA 3KEEA 1BTUA 2F9PA 5EGMA 2ANWA 3MFJA 3N7DA 1DXPA 2GP9B 3PRDA 3FANA 2C8YB 2FX6A 5FBEA 3A7ZA 5T3HA 2SGQE 1GHBG 1THSH 1C1WH 5AF9H 5C1UA 1AVWA 2BDCA 4ZXXH 1NZQH 4YOGA 1MU8B 2RDLA 2M5TA 3SV8A 1Y59T 3RMMH 5ESTE 1EPTB 2H9TH 1C5XB 1O2TA 1MCVA 1VGCC 4ABAA 3GDSA 1QR3E 1DWBH 3CP7A 1C2LA 1TFXA 2TBSA 1EATA 2AS9A 1SLUB 2BD8A 3STIA 3GDVA 4AB9A 1UK3A 4Y8YA 1LHDH 1WAYB 3DD2H 5L6NH 1XM1A 1OWIA 1Y5AT 4TSFD 3RXQA 4DOQA 3FZZA 4X1SU 1CBWB 1KMHB 1UW7A 1W8BH 1KXAA 4GPGA 2G5VA 2BM2A 4MNXA 6CHAB 2FIRH 4XDEA 1BTWA 4HZHA 1LTOA 1TNGA 1TNIA 5E0GA 4CRFA 2QV1A 4YOIA 1F7ZA 4Y0YE 4NIXA 1H9LB 4ISOA 1FN6A 2R9PA 4X2XA 1LPKB 3QDZB 1C2DA 2AIQA 2FEQH 1V2RT 2ZG0H 2ZCLP 1NN6A 3KYGA 1PQ8A 4FUDA 2XWAA 2VVCA 4CHAB 1G3EA 3U1IB 2Z7FE 2ANYA 2ALPA 4FU8A 1W7GH 3LGIA 1KSNA 2NWNA 1FXYA 2KM0A 1XUIA 1SB1H 2D1JA 3LGYA 2HRVA 5F8XA 3WW7A 1S0RA 1Y3YA 5A8XA 2EEKA 3GICB 5EPYA 4GVUA 2P3UB 3RXKA 4YM9A 2HPPH 1C9PA 5FXLA 1UTNA 3B9FH 1JBUH 3AAUA 3V13A 2GKVE 2G4UA 1C5NH 4J2YB 1EJNA 5J4SA 4YT6H 5JPMH 1TMTH 3RU4D 3SJKA 1GWAA 1C9TA 2J4IA 3SJOA 1S84A 2QGRA 3ATWA 5ESBA 2FO9A 4B2CA 1TX7A 3HGPA 1CO7E 1EOLA 1SLWB 3PTBA 4AB8A 1TE0A 3LJOA 1A4WH 3HKIB 2NU0E 2VBCA 5FX5A 2VGCC 1YM0A 4U2WA 1GHAF 2SGFE 1C5UA 1P06A 3SQEE 1MMJN 2QF0A 3SUDA 5E2PA 1G3CA 3ATMA 2QE7D 3BIVH 4GHTA 1TOMH 1SG8B 3R3GB 1GCTB 3RUOA 2SGPE 4JZDH 1EZXC 4WXVA 7GCHG 4NCYA 1UCYE 5AFZH 1ETTH 3RLWH 2R0KA 3MNXA 1TGNA 3URDA 1FJSA 1N8OC 1E37B 4CH2B 1ZJDA 2V3OH 5F53A 2XCFA 1NPMA 5AFYH 3S9AA 4LOYH 5FAHA 3FOAA 1MBMA 4D9RA 1O2RA 4CREA 5LPFA 1RTLA 6LPRA 2QA9E 1O3IA 3Q3XA 2CGAA 2A4OA 3M3SA 1SLVB 1O2VA 1C2KA 4B2AA 3JZ1B 3Q00A 1FMGA 4A6LA 1TABE 4WVPE 4X0WU 2Z9KA 3A7VA 2FZZA 1FPCH 1TGTA 4DVAU 3RMOH 2OC7A 2HGTH 4B2BA 1BTHH 1C5YB 3TJVA 2IJOB 4CRDA 5HMAA 2FS8A 2F3CE 3ODDA 3UWJH 1ZHPA 1BT7A 2Y80A 3SN8A 3F9GA 3OAAD 1UK4A 1ZJKA 2W7SA 3UPEA 1YLNA 1WXRA 1GI1A 1GCDA 1SHHB 2F83A 1EJMA 2JKHA 1MU6B 2GX4A 1LQDB 4KELA 1SL3A 3BIUH 4FUEA 2ZGCA 1SHYA 4OS2A 3ZVAA 5I25A 1P12E 1JOUB 3LH1A 1C5ZB 1A0LA 1FLEE 2PWXA 1VR1H 2ZDNA 4Z1MD 1W0JD 1GMHG 3E6PH 3QWCH 4NWKA 1DT2A 3LGUA 4FVDA 4ISNA 2SGDE 4D76A 1KIGH 2GDDA 3TGIE 2D8WA 4UEHH 3NRLA 1F5LA 1BQYA 2FOEA 2GZ7A 1KXBA 1XUKA 1ZRKA 1TALA 1SGFA 2ZFRH 3SHAH 1SGFG 2SGAA 4UDWH 1MTUA 1GHYH 1Z8JB 1GBEA 1O35A 3OEHD 4O97A 1W3CA 1EAUA 3RMNH 2V7QD 2GZ9A 1V2VT 2WYGA 3RMLH 4BTUB 1EKBB 3CS7A 1QB1A 1EAWA 2BTCE 4Y71A 2ZHQH 3OE7D 2P3TB 3FFGA 4DIIH 4BNRA 3LJJA 1SQOA 2GMTB 5J4QA 3QLPH 3UOPA 5EXNA 1O30A 2ILNA 2OC0A 1ZRBA 1JMOH 3TLOA 1ESAA 1C1OA 1ELAA 4O3UA 1TLDA 2OD3B 2OBOA 1AVGH 3BTFE 1QJ6B 3BTGE 5DP9A 3HPTB 3Q3YA 2F43B 2V3MA 1JXPA 2ZU4A 3STJA 3VPKA 5HM2A 4CRGA 1ZLRA 2GV7A 2STBE 5B6LA 5C0UA 1U6QA 1MKWK 1P01A 4R0IA 3PYHA 1WQVH 3DSPA 5LPRA 3UNSA 2H5DA 2BX3A 4NZLA 2R2MB
chains in the Genus database with same CATH topology
4DCDA 3P17H 5EODA 4TWYA 3M7QA 3ZZ9A 4CH8B 1LQEA 1GG6C 1UTLM 4ABEA 2QXJA 2TGTA 1W14U 3QN7A 1WTHD 4YT7H 2ZC9H 1GBLA 4IN1A 5BPEA 6GCHF 1P04A 4IC6A 1FN8A 1G37A 2JH0D 2AGGX 5HGGA 1BHXB 1BMNH 1CQQA 3BF6H 3N7OA 4X8UH 4THNH 2TRMA 1O2OA 1NFXA 3ZVDA 3RU4E 5C1XA 4BTIB 4DURA 1LPZB 4HTCH 2WPJS 1K22H 1K1LA 2GTBA 1YF4A 1GDUA 1SVPA 1HAZB 3VB7A 2YNAA 1GBAA 1OS8A 2PUXB 1MZAA 3M5MA 2F9OA 2P3FH 3SI3H 3MU8A 1V2JT 4VGCB 2PHBA 4AYVB 1O34A 1LHEH 1DSTA 1SQTA 1IQHA 1QFKH 1C2GA 3TJUA 1ESBA 1T8LA 3M37A 1C2JA 1UCYK 3F9EA 5DP6A 2FI5E 1GJ8B 4A5TS 2ZU1A 1O3AA 1O36A 1L1GA 1K1PA 2ZIQH 3H7TA 2Z9JA 4X6NA 2HNTC 1TA6A 1S6FA 1IQEA 3BEUA 1BITA 1RTKA 2SFAA 1P2KA 1KLTA 1KTSB 3RDZA 1IQLA 1MD8A 4Y79A 1BIOA 3UIRA 1EP6A 1DY9A 1GI6A 1ACBE 1ETSH 1SGYE 5CHAC 1F0UA 1V2MT 4MQAA 4ABFA 3U8OH 1TPAE 3O8BA 3I77A 1Y8TA 1C2FA 3OU0A 1IOEA 1GBFA 3BN9A 1P2MA 1ABIH 4H6TA 4Y10E 2Y7ZA 1C2HA 1W11U 4ZH8A 3A7YA 4HI3A 1O0DH 4HGCA 3ZZ5A 3TJNA 2XYAA 4ZKSU 1A61H 2VIOA 4DJZB 5LGOA 1AB9C 1GI7B 3ZZ6A 3TH4H 2O8MA 1Y3XA 1HAGE 1Z6EA 3P92A 1FDPA 1GHWH 2EA3A 1TPOA 5A0BA 2UUFB 1FY8E 2HNTF 3SUFA 3SNEA 1P2JA 1HAHH 3SJ9A 1A3BH 4CBOA 1EQ9A 2A7JA 1TRMA 5DKMA 1C5VA 3RXTA 2EI7A 3EE0B 1P9SA 3R0FA 5SGAE 1FY4A 5CMXH 2ZFQH 1D9IA 1MAXA 4X6PA 4XSKU 2SNWA 1C1PA 1CVWH 4AOQA 3NUMA 1QQUA 1DWDH 1CT0E 1IQMA 1C1TA 2G55A 1LKAA 1GJCB 1MQ5A 4FXGH 1FY5A 1ELDE 2ZU5A 5IYTA 1SSXA 3TNSA 1K1NA 2VB0A 1YCPH 3KQCA 1THRH 1WYKA 4NGAH 1XKBC 3SU6A 3MH6A 2A2QH 4NZQA 3KQBA 3MO3A 3G01A 3DUXH 4NSVA 2VWMA 4K3JA 2LPRA 3TPIZ 5F8TA 1DDJA 1C1MA 3BEIB 1GMDF 1HB0B 2OQ5A 3U9AH 1C5LH 3KQDA 2PV9B 2VGCB 1O38A 1OWDA 3NK8A 4F4OC 4FUGA 1PQ5A 3KF2A 3KIDU 4YTAA 1TWXB 4A1XA 3M7UA 3RXRA 4MPXA 1HAXB 1C2MA 1WCZA 1Z8IB 4JZFH 3TH2H 3LC5A 4Q2KA 1V6DA 2LNCA 2NU3E 1PPEE 1KTTB 2ZEBA 4ZROA 1GHAG 1HUTH 1E36B 2B7DH 1SMFE 1UTKA 3OYPA 2FP7B 1QB6A 1N8OB 2IPHA 1P02A 3DFJA 2ZHFH 3PLPA 1NS3A 2JETC 2BDIA 3URCA 4ZAEA 2FI4E 1A46H 1HJ8A 1GI5A 3E16B 5EXMA 3W95A 3SV9A 1BTYA 1IQIA 3LU9B 1PQAA 1MCTA 2UWLA 2FS9A 1C5PA 1GBCA 2ZP0H 3MU1A 4AG1A 3D49H 3UNRA 1E0FD 2BDHA 4AGJA 1TNLA 2AFQB 1HJ9A 2FPZA 4XFQA 5DPAA 4CRCA 3F6UH 1YPHC 4WWYA 2D26C 4B76A 1DANH 1TPSA 1OXGA 2ZGXH 1OOKB 1NFYA 1O5BB 2R0LA 3OY6U 1ZPBA 2BY8X 1NFUA 1VITH 1NRRH 3MHWU 1O3OA 2ASUB 2ZQ2A 1GI9B 4UONA 4ZHLU 1NRSH 1UTJA 1TBQH 3BTDE 1VJAU 5H4IB 4MPUA 2HNTE 1RIWC 2W26A 2ANKH 1GL1A 2OXSA 1P57B 3ZV9A 1ZTKA 1V2UT 3TH3H 2G4TA 4UE7H 3RC5A 1RXPA 1H8DH 1SR5C 1GBBA 1XUHA 3NKKA 3V0XA 1OYTH 2O9QA 3GY4A 1CHOF 1P2IA 1AI8H 4A1TA 1FIWA 1BMAA 3UY9A 2AGEX 1XUFA 2OP9A 3LKWA 1IQGA 2ZQ1A 1GMCF 3O8RA 2RA3A 2ZU3A 3K65B 1P3EA 2QXIA 3MMGA 5JB9S 3F1SB 1T8OA 1TA2A 2H6MA 1F92A 5TCCA 4K2YA 1ZTLA 2V6NA 2VH0A 2XBYA 3SHCH 2G81E 5IDKA 2Z9IA 1CT4E 2VWNA 1P09A 2G8TA 1PPHE 2BOHB 1EAXA 1XMNB 4RSPA 2PKAB 1SGPE 1MD7A 1OPHB 1A3EH 2BDGA 2QXHA 1H4WA 4B1TA 4JYUH 1AO5A 1BHXF 1O2NA 1WTGH 4RN6A 4UFEH 1MTWA 1LVMA 3A84A 1CHGA 1XX9A 3D62A 1D6WA 4BXWA 3P70B 3NXPA 4I8KA 1B0FA 2ZNKH 3SU2A 4F49A 5JYIA 1BBRE 3BTTE 1J16A 4JMYA 1BDAA 2XTTB 1ZR0A 2PR3A 8ESTE 3O8DA 2RCEA 4MNYA 3SORA 3KL6A 4B74A 1UO6A 4K8YA 1WU1A 3TITA 1KXDA 1P0SH 3NWUA 6GCHG 1YPLH 2ZDKA 3GY5A 4U01A 1EZSC 4CR9A 4TY6A 3A8DA 1TGBA 4YO9A 5E0JA 2V3HH 2ZTYA 1J15A 5TJXA 7LPRA 4BTTB 5DP5A 3C1KA 4DY7B 3ZZCA 3EA7A 5GJ4B 3P8OA 1C1RA 3RXLA 1QQ4A 3S9CA 4X2WA 3IG6B 3E0PB 3UFAA 1O3FA 4D7GA 2J2UA 4U32A 3T27A 2PKAA 1TAWA 5EXLA 1HAIH 3EGKH 1HBTH 3MU5A 3SGAE 4O9VA 4MNVA 3GY8A 4MTBA 1AIXH 2TPIZ 2FWWA 1NT1A 2FESH 3LT3A 4O03A 4OGXA 2BOKA 2ZU2A 1SGTA 5CHAB 3F68H 3L33A 4JZIA 2NU4E 2C4FH 5AVDA 1FZZA 1TNJA 1EOJA 4FUCA 3S69A 1PPGE 1GBIA 2AYWA 4I7YH 4H6SB 2HALA 3SUEA 5HXFA 4MPWA 2K1QA 4UFFH 1F0TA 1GJ5H 2VJ1A 2P8OC 1S0QA 5TCAA 1T8NA 2XC4A 1KDQB 3S0NA 1GGDC 5FBIA 1ZTJA 2A32A 1CGIE 2A1DB 1C4Y2 1YPHE 3HGNA 2XBWA 1AWHB 2ZHEH 1K1OA 3OTJE 2I6SA 2P59A 1AB9B 2GCTC 1VJ9U 3E91A 1BRUP 4X8TH 1W0YH 2F9BH 1GI3A 3MO6A 1LMWB 1LVBA 2OBQA 1SQAA 1BA8B 1G30B 1W0ZU 3BTHE 3T26A 1V2LT 5F03A 1IQFA 2H2ZA 2ZF0H 1O3KA 2B9LA 2A4QA 1GL0E 1OWHA 3GCTF 3KHVA 4E06H 1O2JA 4X6OA 3A80A 1Z7KA 1DS2E 2OLGA 5E0HA 3RXPA 4GSOA 1C1QA 1EZQA 3FVFB 4BXSA 4AFZA 1IAUA 3M7TA 2BD3A 1P8VC 4Q7YA 3TK6A 4KKDA 3GCNA 2XXLA 1CGHA 3RC4A 1GVLA 1NY22 1SGDE 1OP2A 4I33A 3MNSA 1LO6A 1EZUC 4NFFA 4NG9H 1ZHMA 3T5FH 3OSYA 5FCRA 2BX4A 1QB9A 1PPCE 1IQKA 1EASA 5JB8S 1PQ7A 5A09A 2Y6TA 1QBVH 3UTUH 2HWLB 1P11E 1D3PB 1AMHA 4NIYA 3RM0H 1G3DA 4WMEA 4Y7AA 3MWIU 3P95A 5GPIB 3VXEH 3ATKA 1GBDA 1KDQA 1LPGB 1T8MA 1EP5A 4X2VA 3A88A 3I78A 5HYOA 1D6RA 6ESTA 2ODYB 3F9FA 3VGCC 1ELEE 1HJAC 1QL7A 5DGJA 1MBQA 1C5OH 3HK3B 1EUFA 3BG8A 3GYMA 1RTFB 4AFQA 1YCPM 1CA0B 3LGTA 3SNDA 1RFNA 1MTNC 3S7HB 1O3BA 3UUZA 1ZYOA 1GMDG 2ZDVH 3ZVEA 1AVXA 3VB3A 1FY1A 3ZV8A 1BBRK 3S7KB 5DJ7A 3B8JA 5JBCS 1PPBH 4B73A 1C4U2 1NRNH 1D3QB 2QAAA 1AZZA 5A2MH 1WV7H 1E35B 1FQ3A 2JETB 1DITH 3B23B 2ODPA 1Z8RA 4M7GA 4YLQH 3PB1E 4MDSA 1RRKA 2QXGA 1TIOA 2FOGA 2P94A 1AHTH 2B0FA 3A87A 1ANDA 1NRPH 2W3KA 1EJAA 1FY3A 1ELVA 1QIXB 1B0EA 1HRTH 2QYIA 2QF3A 5DP8A 4D8NA 5K7RA 3BTME 1ETRH 4B71A 2BB4A 1BTPA 3SI4H 2EI8A 2DE9A 1B7XB 3SJIA 1PPFE 2ZHWH 1ZPCA 5F8ZA 2BDBA 2Y5HA 3HK6B 1ZSJA 1AFEH 2BY9X 1HAPH 2FOHA 2OCVB 1ZZZA 2G00A 3QZRA 4DG4A 1KXEA 3M35A 4RKOB 4X8VH 3GY3A 1L2EA 4MNWA 1SFQB 4ASHA 1BRAA 1BB0B 1BRBE 1V2KT 1TGSZ 1Z8GA 2WPMS 1YC0A 5FX6A 1TBRH 1PYTD 1K1IA 3KQEA 5GWZA 2GZ8A 1BUIA 3M5LA 1BCUH 4JYVH 1ELCA 2NU1E 1EPTC 1C1NA 1KXFA 3BTEE 3ATIA 3K9XB 1EB2A 1NU9A 1O3DA 1DM4B 4WH8A 2H9HA 1QCPA 1HAYB 2WINI 1C2EA 2XBVA 1KLIH 2TIOA 4NIWA 1LKBA 1YLDA 5EQSA 3BV9B 1SOTA 1YPGH 3SV7A 5T6FA 2W3IA 1GI4A 1CBWC 1VCQA 4A1VA 1O2HA 2H9EH 1SGQE 2RA0A 3T62A 1CHOG 3L3TA 1DE7H 4K1TA 4JZEH 4ABGA 4FUHA 2A31A 1FV9A 3DT0H 5C1YA 5GCHF 3ZZBA 3RXEA 1GMCG 4E05H 3SOSA 8GCHF 1D4PB 3LOXA 1P2NA 1HLTH 3OX7U 1DVAH 3P8GA 1O2GH 2PGBB 2CXVA 3EYDA 4YESB 4INHA 4LK4A 1Y3VA 3PM3A 1VGCB 1ZSLA 1G32B 2Z9LA 1FUJA 1F0RA 1L4DA 1C5RA 2H1UA 2UUKB 4B75A 1GBKA 3SO3A 2GCHF 1BOQA 4I31A 1F0SA 3HKJB 5JBTA 1JRTA 1HCGA 2XBXA 4NSYA 3UQVA 4MPVA 1YPMH 4FVBA 2WPKS 5DP4A 3P8FA 3WY8A 3QTVH 1QL8A 2THFB 4I8GA 4WJG2 4XBBA 1YLCA 2JH5D 2BLOA 1TRNA 5A0AE 3Q76A 1DUAA 3GY6A 3PLBA 1A0JA 2FX4A 1WSSH 2AH4X 2UWPA 1PPZA 1SGIB 4Q7XA 4Z6AH 1EX3A 2C90B 1OWJA 2Z94A 2CHAC 5ETXA 3E8LA 1GBHA 2A4RA 3BTWE 4KTCA 5DP3A 2FMJA 1WUNH 3TNTA 4WMFA 2FOAA 1NTPA 4JYTA 3T28A 2PFEA 4ZKRU 1TOCB 1V2TT 4I8JA 3FP7E 3NCLA 3L6PA 2BLWA 1KYNA 4IBLH 1GCTC 2ZPSA 4BAMB 1GJDB 1O2UA 1O3NA 1EB1H 1C2IA 1YP9A 2ZCKP 2PTNA 3SJ8A 2FI3E 1KLJH 4ABDA 1Y3UA 5EPNA 3T29A 1H8IH 1AUJA 3MNCA 2AIPA 2QIQA 1MTSA 1UMAH 1YGCH 3BTKE 3ZZ7A 2WUBA 3SU1A 2FM2A 2A5KA 1AWFH 1RJXB 1FIZA 1Z1JA 2FLRH 1LCYA 2P8OB 2BD5A 2ULLA 2ZECA 1V2WT 1A5HA 1T7CA 5L2ZH 1AFQC 1GGDB 4Y6DA 2ZFPH 1V2PT 1XVOA 3ZZ8A 1A0HB 1O3PB 1TGCA 1ELTA 1AUTC 2VIPA 3D23A 1CA8B 3OY5U 1BMMH 2A45B 2BVXH 1OP0A 3SU5A 1TQ0B 4K69A 3PV4A 2WPLS 1K9OE 4X2YA 1GDNA 1L1NA 1ZMLA 4KGAA 3Q3KA 3M3VA 3PTNA 1FPHH 1O2YA 1YBWA 2WV5A 4LZ1H 3RXOA 3A7XA 3O8CA 1H9IE 2UUYA 2ZDMA 2TGAA 4BOHA 1S83A 4K60A 4CRBA 2F9VA 3EA8A 1LHFH 5FCKA 2VINA 1QURH 2KAIA 3DFLA 1C5WB 1IQNA 1TQ7B 3UR6A 3H5CB 2WPHS 2PSXA 2IOTA 3P6ZB 4A7IB 4D7FA 3TIUA 1MQ6A 1UTPA 2A5AA 1OKXA 5C3NA 1NESE 5LPEA 4UFDH 3GCTG 5ABWA 2O8UA 1NRQH 1NM6A 1W7XH 2GD4B 1GDQA 2ZZUH 4MG3A 3ITIA 2VVVA 1ANBA 5K0HA 2ZDLA 1SI5H 1K1JA 3GDUA 4Q80A 3MU0A 1ZSKA 2PLXA 2R3YA 3E3TA 4XBCA 1QGFA 2BDAA 5DK1A 3T2NA 1T31A 1O5EH 3HATH 2GT8A 3P8NA 2XCNA 1H9HE 4ZKNU 1F2SE 2OINA 1AU8A 2CN0H 3ZYEA 1BZXE 3VGCB 1HJAB 1HFDA 2GMTC 1C4V2 4DGJA 4X1NU 1CU1A 4YOJA 1PFXC 5JBBS 1TNHA 1BMLA 5G4BA 3RXBA 2Z3EA 2FYRA 1MKXH 4I32A 1CGJE 3TGJE 1DLEA 1DXWA 2UUJB 3RXVA 3ATLA 1RGQA 1N6YA 3M5OA 1UHBB 1VITF 4FUFA 3PMAB 3VEQB 4WXIA 1SC8U 1W12U 3VB6A 3VB4A 1AE5A 2HVXA 2WUCA 2BZ6H 1GJ6A 1HYLA 4ABIA 5GXPA 3ZZDA 2FODA 1UVTH 4ISIH 3EQ0H 2Y81A 1HAVB 2A5IA 1T4UH 1BJVA 4NFEA 4OS1A 3RXCA 3PMJA 2Y82A 4A92A 4BAQB 2PSYA 1O5DH 3LIWA 2BXTH 5FHTA 1WQSA 1NC6A 2F9UA 1IQJA 2C8WB 4TPIZ 3ESTA 2AMDA 1AQ7A 1E38B