4B1TA

Structure of the factor xa-like trypsin variant triple-ala (ta) in complex with eglin c
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDAGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Thermodynamic signatures in macromolecular interactions involving conformational flexibility.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords CATIONIC TRYPSIN
total genus 55
structure length 223
sequence length 223
chains with identical sequence C
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2012-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4b1tA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4b1tA02
2BXTH 2A4RA 1FJSA 1DE7H 4K5ZA 1IQHA 1XUIA 1JIMA 4GAWA 3A84A 1JMOH 1GHZA 3A83A 3ENSB 4A1TA 1OPHB 1GI9B 4FUFA 3TU7H 1O2IA 1D3DB 5JB8S 4DGJA 1O5DH 3F9GA 1L1GA 1TABE 1K21H 2Z6BD 4YLUA 3RXIA 3U98H 4X8TH 4RKJB 2PW8H 4FUIA 1P02A 1WQVH 1TPSA 3ATWA 4NA8A 2XNIA 1C1RA 3S0NA 4NIVA 3RMLH 1XKAC 5AFYH 1MTSA 5FAHA 1SLWB 1OP8A 1VCPA 2CXVA 3D65E 2HPPH 1V6DA 4AFQA 3KGPA 2FDAA 2XCFA 4KP0A 1P06A 2FS8A 8LPRA 1H4WA 2XC0A 1OOKB 3ZVEA 2A7CA 4IMQA 1Y5AT 1GVKB 1ETTH 2BD7A 3A8CA 1NROH 5I46H 1T8MA 3RXRA 2BD2A 1L4DA 3Q77A 3GICB 2P3UB 4FUBA 2P94A 2G8TA 2ZDLA 4I8GA 3W94A 4TPYA 3BSQA 1AE8H 1FY8E 1K1IA 4DURA 2AMDA 2O8TA 4JYUH 2QXJA 3RXOA 1EZUC 2ZPQA 1OYQA 4XBBA 1Z7KA 2XWAA 4JZIA 4MLFB 3PTNA 1O3IA 2F9UA 3SJKA 1BMAA 1W0YH 3P8FA 1Q3XA 3U9AH 3BV9B 4X1NU 3LC5A 1SGTA 4Q80A 3SHAH 1HFDA 1O31A 2BD4A 4ZKNU 2GT8A 2FOEA 2FOHA 1BIOA 3V12A 1FPCH 2OC0A 3RXBA 1NS3A 3SI4H 1MTWA 2FWWA 1C1UH 2P93A 4OS4A 2VH0A 4I8KA 4MNYA 1JOUB 1AVXA 2NU1E 5JPMH 1O3OA 2PKSC 3UOPA 1GG6B 3SUEA 2Z9IA 4IBLH 1UTOA 1P05A 3V13A 1TLDA 4X6PA 1SGFA 1C4V2 1V2KT 2RA3A 3MTYA 7GCHF 1WTGH 1RIWB 3RXCA 1UO6A 2ZTXA 3HK6B 4GPGA 2FOGA 5L6NH 1AKSB 3LGIA 2BVSH 1C4U2 2D26C 1E0FD 1SMFE 1HXEH 1P9SA 4X2XA 1O5BB 4KTSA 2F9VA 1W12U 4I7YH 4MNWA 3SV9A 2ZECA 2B0FA 4TPIZ 1EPTC 5EXMA 5A0AE 3B23B 1OKXA 3BTQE 1C5OH 1MH0A 1NESE 3SNCA 1RXPA 5FHTA 1EJAA 1NO9H 1P2OA 3GYMA 3UUZA 3PO1B 1DWDH 2B8OH 1P57B 3ZZ9A 1O5AB 1IQLA 2SFAA 3S9AA 4ISOA 2A4OA 1D3PB 1FONA 1MTUA 4DY7B 1OYTH 2H9TH 1TWXB 3U8RH 2Y80A 3K6YA 1C2FA 5T6GA 4ABJA 4MNXA 1AO5A 4LK4A 5FBIA 4GHTA 2V0BA 1LMWB 5FXLA 1ZZZA 1W8BH 1O2WA 1UVPA 2VIDA 3KN2A 1T31A 2O8WA 4CR5A 2GVFA 1QL9A 2QA9E 3MO3A 1ELBA 3S9BA 1WBGB 1O38A 3BF6H 4FUHA 4X2WA 2FZZA 1ZHRA 1TALA 5HXFA 1PPBH 1PYTD 3SU0A 3URDA 1ORFA 3A86A 5DPAA 5DP5A 4X8SH 4I8LA 2ANMH 1T8OA 4GUXA 3O8CA 1IQEA 1MZAA 2HLCA 1FQ3A 1C1WH 5LH8A 1SSXA 1HB0B 5ESBA 5E0GA 1GBLA 4H6SB 3BTGE 1ABIH 1CT2E 1UVTH 2ODYB 4ISIH 2A5KA 1CT4E 4IGDA 3RXKA 1Z71A 4BAQB 1BRAA 1QBNA 2ZU1A 3DA9B 2ZIQH 1O37A 2W7SA 2VIVA 1XVOA 1N8OB 3HK3B 4ABFA 2A7JA 4F49A 5ESTE 3O8BA 4CRAA 3MYWA 3F68H 3IG6B 4ZKSU 1SQAA 1ANCA 1AY6H 1O36A 3BTFE 5DJ7A 1AGJA 1QB1A 2J38A 1TGTA 4KKDA 3ODFA 1V2RT 1GI4A 1O5FH 2ANYA 3F9HA 5EQQA 1VITG 2CHAB 1UCYK 1DWBH 3LJJA 2BD8A 3LGTA 4MPWA 3KL6A 1P03A 1SLXB 3PMJA 2BY6X 1G2LA 1P2QA 2P8OB 1HYLA 1MAYA 2STBE 3SUDA 4WH6A 1TMTH 1V2PT 2GX4A 1O3BA 1YPHC 5EXLA 3NCLA 8KME2 2ZHQH 3EA9A 1QL7A 3VB7A 1CHGA 1NPMA 1AUJA 5E0HA 2JH6D 1RTLA 1AB9B 2BTCE 4ISNA 1HAHH 1EXFA 1P2IA 4DOQA 3SBKA 1FY5A 2XBXA 5GJ4B 2GV7A 1C5QA 1XMNB 2VWNA 5TJXA 1WV7H 2FOMB 1T7CA 1NZQH 3A7ZA 4XSKU 4YOGA 4VGCB 2FX6A 5E2OA 1HAVB 2PHBA 2Z3EA 1GG6C 1TX8A 1CU1A 5TCCA 1FN6A 1CA0B 1LO6A 3HKJB 1C5TA 1C9PA 1CE5A 4LZ1H 1CSOE 2CV3A 1GI5A 3SGBE 3D49H 2JH5D 2HVXA 2V3OH 1NU9A 3BTME 2FESH 2CN0H 5FX6A 1Z8JB 3UFAA 3K6ZA 1PFXC 4OGYA 1A3EH 1PPFE 4O97A 1KXEA 4ABAA 4JMYA 1YPMH 2GZ7A 3VFEA 4Z6AH 3MOCA 1MZDA 1O2QA 1D6WA 2ZFRH 1OS8A 1F5KU 5L30H 2XBVA 1C5XB 2D8WA 1W10U 4ZHAA 1UK4A 1SC8U 1UVUH 2ZFPH 4K2YA 4WMFA 2ZGJA 1HRTH 2QXGA 1DFPA 1NRPH 4AB8A 1GCTB 1K1LA 2ZGXH 1SGIB 4KTUA 1C5PA 4ZHLU 1FY1A 2R0KA 2A32A 3PLBA 5DP6A 1OXGA 1O35A 3JZ1B 4AFUA 3HATH 1CQQA 3QZQA 3TJOA 2ZHDA 4FVDA 5EW1H 2DUCA 4HFPB 1C5UA 3KEEA 2GP9B 2ZI2H 2BDGA 3QUMP 4BTTB 1BMLA 3EE0B 4DJZB 2AH4X 2XYAA 1Y8TA 1GJ6A 1O2GH 4OGXA 1ZPCA 2WPHS 1WSSH 1GJ7B 4NG9H 5E8EH 5HMAA 3I78A 1ZPBA 1THSH 1T8LA 1GJ9B 3LGUA 1JBUH 1CT0E 1Q31A 1B5GH 2GCTB 3KQEA 3SQEE 5TCAA 2HWLB 3MI4A 1KXAA 1TNLA 3QO6A 1IAUA 1MTNB 2OXSA 2AGEX 1HAIH 5F03A 1E38B 1QNJA 4X1PU 2AFQB 3T29A 1ZHMA 1GGDB 1TRMA 2XTTB 1J9CH 1M9UA 2BY9X 4X2VA 1NT1A 1LQDB 3B9FH 1BA8B 1BZXE 1QA0A 2FOAA 4BTIB 3E91A 1GJAB 3E6PH 3OY5U 3MH5A 2ZU3A 3TK6A 4ZKOU 4NIWA 1XKBC 1ZSKA 3S9CA 2D2DA 2UUJB 4A6LA 1DXWA 1V2QT 3MU5A 3SV7A 4Y7AA 5BPEA 1ANBA 5A8ZA 1GI7B 3GCNA 4ESTE 4D9RA 1TRNA 3A88A 1UCYH 2G00A 1GMHG 1MCVA 1C5RA 5T3HA 4WMEA 1VCQA 7KMEH 2BOKA 3OU0A 2UWLA 4MG3A 3SUFA 1PQ8A 6LPRA 1S6HA 1SQTA 4WMDA 1NRRH 2ZA5A 5T6DA 1BBRE 1GI0A 3R0FA 1XUJA 3ATKA 3RXJA 1DXPA 2CHAC 1HAGE 3L3TA 2GMTC 2HPQH 3TGJE 1QQ4A 1TX6A 2WPIS 1UTQA 2P8OC 3PWBA 3FZDA 3AW1A 2HOBA 3RLYH 1TOCB 5H4IB 3PLKA 2FTMA 1C5SA 3ZZ5A 3EQ0H 2EI6A 2FMJA 3U1JB 1ZR0A 4ABBA 4GHQA 1AZ8A 2FI4E 3KQCA 1GWAA 3SU5A 3ZYDA 1ELGA 3QK1A 1QRXA 3MO6A 2ZHFH 4PROA 1FMGA 2OTVA 2O8LA 1NFXA 5FPYA 3UOUA 1Y3YA 2OQ5A 1EB2A 4IN2A 5IYTA 1QURH 1C1VH 1E37B 1EQ9A 1SHHB 1O2HA 4UONA 4MQAA 2IN2A 3UR9A 1JRSA 1NM6A 1E34B 3RXLA 1LHDH 3N7OA 1HGTH 4MPUA 3PO1C 3EA7A 1DWEH 2A45B 1BQYA 1FY3A 1T32A 1C2LA 3UNQA 1CA0C 3BG8A 2VH6A 4AOQA 3PYHA 5DKMA 3MNCA 1D9IA 3T28A 2TIOA 2BDCA 1MD7A 3M35A 2B7DH 4LZ4B 1F5RA 5F8ZA 4ZUHA 1J16A 4AYYB 4UE7H 1SI5H 2GZ8A 5EXNA 1F2SE 1OX1A 5C3NA 1V3XA 1T4VH 3TGIE 1GVZA 4JK6A 1RS0A 1C1QA 1SBWA 3BG4B 3AVZA 1VJAU 3ZV9A 3BTKE 1AMHA 2J2UA 5EGMA 3BTWE 3QWCH 3A82A 3ZVGA 4INKA 5SGAE 1SHYA 1CO7E 4K8BA 1G30B 4K1SA 1V2UT 5C5OA 1FDPA 2AEIH 4ZAEA 1N6XA 2PSYA 3P6ZB 1ZMLA 4Q7ZA 1GBJA 1LVOA 3SO3A 2EC9H 4Y11E 1MD8A 1RFNA 2FS9A 1MU8B 1P3EA 1K1NA 2GDEH 5JBCS 3UQVA 2C4FH 3PLPA 1ELCA 3QTOH 3QLPH 3QX5H 1TNIA 3SU1A 3ZZ6A 2VGCB 2QC2A 2FODA 3M5OA 3TGKE 1J15A 5EODA 2TPIZ 2BDBA 4JK5A 3RU4T 3VXFH 1X7AC 3M3VA 1TX7A 1HDTH 1QY6A 1BTPA 4MNVA 1GDUA 4O3TA 1H9IE 5FPSA 2Y5HA 3SGQE 2BQWB 1SR5C 2VIPA 1AD8H 1B0EA 1KDQB 3CS7A 1C2EA 3TVJB 3GISB 4J2YB 1F5LA 2QV1A 2B5TB 4IMZA 2NU3E 2R2MB 4FUJA 1AWFH 3QGNB 1GGDC 1G9IE 1ANEA 2F9NA 5CHAC 2PUQH 4OS1A 1K22H 4I33A 1G2MA 4K1EA 1O2LA 1EP5A 2PGBB 1CHOF 2FOCA 4X8VH 1YCPM 1PPCE 4O3UA 1HAOH 2ZTYA 2OP9A 1VGCB 4CBOA 1XXDA 5K0HA 1ZGVA 1HJ9A 2ZQ2A 5GCHF 1EX3A 3ITIA 1BBRK 4R8TB 1GBEA 2TGAA 1GJ4H 1QA7A 3PM3A 1GHAG 1O5CB 3P95A 2FM2A 2AERH 3ZZ3A 2D1JA 1QRZA 1W0ZU 4AGKA 2GDDA 1Z1IA 1ZYOA 4NGAH 2BDYA 1O2ZA 1P9UA 1SGQE 1GDQA 2AMPA 1GMDG 1O3CA 1PJPA 2GZ9A 3GDVA 4DG4A 1IQNA 4TY7A 1ETSH 2EEKA 4E05H 1GBKA 4DT7B 1GMCF 1Y3UA 3H7TA 2AIQA 4B75A 2VIWA 1CGIE 1BJVA 3NKKA 3AAUA 4ZXXH 3PROA 1GBBA 1GHVH 2SGQE 5F8TA 2J4IA 1BITA 2ZZUH 2QCYA 1SOTA 3LT3A 2ZNKH 3ZYEA 4ZXYH 4U01A 3SNBA 3T62A 5DO4H 4RKOB 4IC6A 1LVMA 3TJNA 3P8GA 1UTPA 2XW9A 2ZC9H 3LJOA 3UWJH 2ZGHA 3NWUA 1V2ST 1NC6A 4X6MA 1EZQA 3SQHE 2FLRH 2DE8A 6GCHG 2BDAA 2PTCE 3PMBB 1YPGH 1H8DH 2Y7ZA 5JBBS 2P16A 1BRBE 1F0UA 4AG2A 1A5IA 3STJA 3D23A 2BQ7B 6CHAB 1INCA 1GI1A 1V2WT 1IQMA 3NXPA 1TYNA 2FLBH 4NIYA 1ELEE 1S0RA 1ABJH 1Z6EA 1SOZA 3UY9A 3VGCB 3QZRA 1RTFB 2JETC 1GBDA 3ZVDA 4A1XA 3EA8A 3SNAA 1UCYE 1TNKA 4JZFH 2BXUH 3P92A 4Y0YE 1BHXF 1N6YA 1KLJH 4Y8YA 1P2MA 1WOFA 1D3TB 2R3UA 3TITA 3V7TA 5DP4A 3FANA 4CRBA 2BD5A 3DHKH 1G3CA 2NU0E 2XRCA 4YT7H 3D62A 2W5EA 2ZQ1A 1KXCA 1UTLM 3VXEH 1GHWH 1K28D 5GCHG 1GL0E 8GCHF 3FP7E 3P70B 3UR6A 1GPZA 1NN6A 3TNTA 3BIUH 5EW2H 3A7YA 3RXEA 1GHBF 1MKWH 5HM9A 3LC3A 3CP7A 4BAOB 3LU9B 1GVLA 1O5EH 5A0BA 6GCHF 2HGTH 1HJ8A 4ZKRU 2G55A 1GBFA 1P0SH 2BLQA 3RMOH 1EZSC 1ESAA 3P8NA 4JZDH 1SLUB 2GCHF 4Y6DA 1S85A 4E06H 1FLEE 1K1PA 2PUXB 3RXFA 2I6SA 3R3GB 4ZMAH 1GJ8B 4DVAU 4B73A 4IS5A 3E0NB 2GKVE 3A8BA 2ZG0H 1C5VA 2FP7B 3MO9A 2BMGB 1SGCA 1NRSH 2AIPA 3M3SA 5J4QA 3SV2H 1AWHB 1JRTA 2WUCA 1GJCB 1EASA 2TRMA 1HIAB 1C1MA 1D4PB 3M36A 3RC5A 2H5CA 1Z8IB 4R0IA 2BM2A 4UFEH 2ZU2A 5ABWA 1DSUA 2ZWLH 1HAZB 1FN8A 2ZF0H 4UFGH 1FIZA 4Y10E 3AAVA 4OS6A 4Y8XA 2Y5FA 1AVWA 4ABDA 2ZDVH 2QF3A 2WUBA 1GHBG 2NWNA 5HM2A 2ZCKP 4WJG2 2V6NA 2A0QB 3JZ2B 2XC4A 1AHTH 2BD9A 1MCTA 2GMTB 3AASA 1KY9A 4U30A 4HGCA 3TNSA 3G01A 3MU0A 1C1TA 3I77A 3HGNA 2Q6DA 3RXGA 1VR1H 1ZLRA 4AG1A 2I6QA 4MPVA 2Y81A 5JDUB 1WTHD 5EU8A 4X6NA 2LNCA 1TMUH 2G5NA 1LHFH 3RU4D 1C2HA 1HUTH 1PYTC 1YC0A 2Z9GA 2H6MA 3FZZA 1S81A 1NY22 3K9XB 3STIA 1ELFA 2F3CE 3RLWH 1DS2E 5EQRA 2R2WU 2ODQA 2QN5T 4JYTA 3Q00A 1TQ7B 2IJOB 2J95A 1RD3B 3RP2A 2BVXH 1J14A 2STAE 1UVSH 1A5HA 1N1LA 3U8OH 5C5NA 1UHBB 1T4UH 1HPGA 4Z0KA 1O3PB 3RXTA 4D9QA 2A4QA 3VPKA 1GBHA 4MPXA 3LOXA 1TMBH 1XUHA 3T27A 3UPEA 5T6FA 4BXSA 1F0TA 2PKAA 4K3JA 4UFDH 5CMXH 1DWCH 3TH3H 1ZRKA 3BTTE 4XBDA 5A8YA 3SW2B 1GBCA 4WY3A 4XDEA 1ZJDA 3S7HB 1C2DA 3W95A 2G4UA 1UTKA 2A31A 2EA3A 2JH0D 2HNTE 1O2PA 1DLKB 3BG4C 3TH2H 1GJDB 2SNWA 3A81A 1Y3WA 2VVUA 1MMJN 4FU7A 2G81E 3FVFB 1TONA 3K2UA 3GDUA 5DG6A 1O2MA 1QRWA 1KYNA 4YT6H 1K1JA 2ZU4A 2FOFA 5F6MA 1A4WH 4A1VA 1K9OE 3A7VA 1AB9C 4CREA 4Y76A 1KDQA 3ZVCA 1O3AA 3GY6A 1QQUA 1A0LA 1TA2A 4A7IB 1YF4A 1KSNA 1GMDF 4UEHH 4X1SU 5DP7A 4FUDA 1YCPH 2B9LA 1TPAE 2XC5A 1L4ZA 3VB5A 1FNIA 5LGOA 2VJ1A 2UUFB 4AN7A 4I8JA 1A46H 4X1QU 1LPKB 1WU1A 4D7GA 1GHAF 1ID5H 1GMCG 1BDAA 2BLVA 2Z9JA 1VCWA 3E1XB 1HJAB 3E3TA 2C8WB 2PSXA 3UQOA 1C2IA 3A7XA 3UREA 1BBRH 3DFJA 1GBTA 1EATA 4X2YA 4D76A 2BHGA 3T25A 1E36B 3M5MA 2FXRA 1JWTA 3PTBA 1O3FA 1IQIA 2Z94A 4CHAB 1FI8A 2FTLE 1KLTA 3TPIZ 3PMHB 4JCNA 2NU4E 1OWEA 1V2LT 1FY4A 4ZROA 1O2NA 1AUTC 1HIAA 1PPGE 4U2WA 3RM0H 1O2JA 1O2RA 3ZZ4A 1C5MD 1QB9A 1P2JA 1ZPZA 4OS2A 3BTEE 2HALA 3ZZAA 1SVPA 1TGBA 1HV7A 3GY2A 4UD9H 1P04A 3FP8E 1KIGH 1O33A 1ZMNA 1TA6A 1YM0A 1EUFA 3PMAB 2OCVB 2SGFE 1O3DA 4H42U 1Y5BT 3AW0A 3RXPA 2V3HH 3KQDA 3Q76A 2CMYA 1PQ7A 1DLEA 2XWBI 1W14U 1QJ6B 3QDZB 4ABIA 1AIXH 4O9VA 5ETXA 1P01A 3TH4H 2Z3DA 2OC1A 2Q6FA 1N8OC 3ESTA 3GCTF 3HPTB 3ZVAA 4YM9A 1W2KH 2C8YB 1V2VT 2BZAA 4K1TA 2G51A 1QIXB 1MTVA 3ZZDA 3GCOA 1EB1H 2XXLA 5IDKA 3T26A 5GPIB 3RXQA 5DGJA 4A92A 3EGKH 3SU3A 2TBSA 4I31A 2FYRA 1RIWC 1A5GH 3E8LA 1NFWA 1QHRB 3FP6E 1O2YA 3M5LA 4FVBA 1SFQB 1TPPA 3UIRA 2BQ6B 1DM4B 2J34A 3VEQB 1F92A 1Y5UT 1OWKA 1AFQB 1BTZA 1ARBA 5C1UA 1NU7B 3RXAA 3SN8A 3F6UH 1QFKH 5K7RA 1NRNH 3OSYA 3OTJE 4BXWA 1C1NA 3NK8A 3GYLB 1YKTA 2ASUB 2C90B 3C1KA 2IPHA 3FFGA 5F8XA 6CHAC 5EOKA 2P59A 1UTMA 4AYVB 2BD3A 4AFZA 1V2NT 1BTXA 2J9NA 3ZZBA 4NSYA 5B6OA 1O3KA 2ANWA 4CBNA 1UK3A 2W3IA 4I32A 1UTNA 2AYWA 1TNGA 2Q1JA 1V2JT 1LHGH 3A8DA 1OWIA 4OS7A 1C9TA 2J94A 5DK1A 3URCA 4CRGA 3GCHC 2VVVA 1EZXC 1O3NA 2RG3A 2SGEE 2ZGCA 4Y79A 2OD3B 1Q2WA 1V2OT 1BT7A 1TGNA 1Z8GA 4KGAA 1LVBA 1BCUH 2ZFQH 1FPHH 4Q2KA 2ZDAH 3MMGA 3Q3XA 4AORA 4TWWA 1KXDA 3M7TA 4B1TA 1V2TT 4WXVA 5C1XA 1DT2A 1O34A 1C2JA 3TK5A 4X8UH 1P2NA 1EAIA 4H4FA 3SV6A 1DY9A 4WF8A 1TNHA 5CE1A 4INHA 1BTHH 3NPSA 3SNDA 2ZGBH 1SGDE 1DDJA 1GI6A 2LPRA 3S69A 5L2YH 2XCNA 1BTYA 4Q7YA 1LKAA 2BOHB 3QGJA 1DY8A 4NIXA 5GIBA 3SJ9A 3GY3A 3ZZCA 1QB6A 3VB3A 1EAUA 4D7FA 6ESTA 1S83A 1UJ1A 2FX4A 1S84A 4GCHF 1O3HA 4B2AA 1O2UA 1S82A 1FAKH 3OX7U 3OYPA 4JYVH 4JZ1A 4K60A 2Z7FE 5AHGH 3UTUH 1J17T 4BANB 1AQ7A 3T5FH 4U32A 3MU4A 5LPEA 5EQSA 1ZRBA 1KTTB 3RU4E 3SHCH 2F9BH 3H5CB 1TNJA 5DP3A 1TOMH 4NA7A 2BVRH 1EJMA 1FXYA 2PWXA 3LH3A 3DFLA 1YGCH 2P3TB 3U8TH 2ZP0H 1W13U 3GOVB 1IQGA 3EDXB 1QGFA 1DUEA 3ZV8A 9ESTA 1XM1A 3ATLA 3RXMA 8GCHG 3RXDA 1CHOG 3KCGH 3Q3YA 1XX9A 1BB0B 1CVWH 1OP0A 3DUXH 5E2PA 1ZTKA 1BJUA 1AI8H 2BZ6H 2Z9KA 2ZTZA 3MU8A 1H1BA 1RTKA 4JZEH 4RSPA 1IHTH 1GJBB 3RXVA 1EPTA 1UMAH 1Y59T 1OP2A 1YYY1 2GCTC 3M3TA 2A7HA 2A5IA 3OY6U 4B76A 1G3DA 1W3CA 3SU4A 3I29A 2FYQA 2OBQA 2QIQA 3GY5A 4CRFA 1SGRE 3ZZ8A 4LOYH 3O8DA 1ESBA 2PFEA 1THPB 2G52A 4YO9A 1SG8B 1AU8A 2KAIA 2Y7XA 5JB9S 1YPKH 5JBTA 1GHXH 1C2MA 1KXFA 2OC7A 2VINA 2ZO3H 3CENA 1BMNH 2AS9A 3RDZA 4GVUA 2VIOA 2VU8E 1UHBA 1JIRA 2OQUA 4NWLA 4TYDA 1FZZA 2G4TA 5AFZH 1PPEE 1EKBB 2A5AA 1S5SA 2CJIA 1BOQA 1AFEH 3E16B 3V0XA 5FCKA 1ZTJA 1GI2A 1IQJA 2M5TA 1P09A 4CRDA 2XBWA 1MQ6A 2EI8A 1O0DH 1H8IH 3SI3H 1QCPA 1YPLH 2WV4A 1P2KA 3MWIU 3RM2H 5EPYA 1DSTA 4J1YA 2DE9A 4Q7XA 2WPJS 1FIWA 5LPFA 2AGGX 2R9PA 2ZCLP 1LPZB 2A1DB 3MH4A 3BEFB 2BYAX 1U6QA 3ATIA 4HTCH 2SGAA 1O2VA 1G3BA 1HCGA 2C93B 1GMHF 3TLOA 3TIUA 1CGHA 1YBWA 2ZPSA 2F91A 5FX5A 2Y5GA 1G32B 2SNVA 3T2NA 1DPOA 1TRYA 1UVOA 5GXPA 2CF8H 4ZH8A 2PLXA 2ZDNA 1ZHPA 4B2CA 4E7NA 3E0PB 4E7RG 5C2ZA 2FPZA 1K1OA 1FAXA 2UUYA 1ETRH 2WPKS 4D8NA 3PWCA 1DITH 2GV6A 1HBTH 4IW4E 1SGFG 5LPRA 1CA8B 1C2KA 3GCHB 1LVYA 5GWZA 1F0RA 1QTFA 2ULLA 2QXIA 3RXHA 4SGAE 2VWLA 3GCTG 3UNRA 2WYJA 5A8XA 2ZDMA 1IQKA 2RCEA 3A85A 4FUEA 3Q3KA 4Y0ZE 2H5DA 1GBMA 3LGVA 1LKBA 8ESTE 1ARCA 1GBIA 2HNTC 1Z8RA 3KQBA 1OWDA 1B7XB 5AVDA 3BEUA 1P10A 3HKIB 1RRKA 1FV9A 3A8AA 2BDHA 2VWMA 1GI8B 1WUNH 1ZSLA 2H1UA 4AFSA 4ASHA 4CHAC 2H9EH 4XE4A 1SB1H 1WCZA 3RXUA 4AGJA 2NU2E 5GDSH 4KELA 1BRUP 4YESB 3P17H 1PPZA 4B71A 4XOJA 1Z1JA 1VITF 3K65B 4DIHH 1YCPK 1PQ5A 3NUMA 1CBWC 2VWOA 1O2SA 3MU1A 1MKXH 2BY7X 2BB4A 5HYOA 4GSOA 3BEIB 4YOIA 4B74A 2ZFFH 2BDIA 5EPNA 5A2MH 1WQSA 3MNXA 2OUAA 1VZQH 2R3YA 3ZVBA 9LPRA 1ELTA 4SGBE 2H2ZA 2ODPA 2PKAB 1ZOMA 2QAAA 4AB9A 1O5GH 1QL8A 4FUGA 2VNTA 2QXHA 4NFFA 3ODDA 4BAHB 3FAOA 3M61U 2W7UA 1TFXA 4QT8C 1SPJA 1SFIA 3F1SB 1A2CH 2EI7A 1HNEE 3V3MA 1C4Y2 2GT7A 3HGPA 2W3KA 4ISHH 3SV8A 3LGWA 2Y82A 4YZUA 4Y8ZA 1HAPH 3EAJA 1AVGH 1NFYA 4WWYA 1W7XH 1OWJA 3ZZ7A 4M7GA 2VIQA 3DD2H 1D3QB 4VGCC 2ESTE 1O2KA 4BAMB 1SLVB 1LDTT 5DP8A 4FUCA 1EAWA 3SNEA 3M37A 3TK9A 4UFFH 1UK2A 2CGAA 1SGPE 1O3EA 3GY4A 1MU6B 4X6OA 1BTWA 1ZSJA 1O3GA 1BHXB 2R0LA 4K69A 2GD4B 2JKHA 4MDSA 1VGCC 1V2MT 1DVAH 3GY7A 1GDNA 1AFQC 1J8AA 4CRCA 5JBAS 5L2ZH 1O3LA 2OC8A 2ZEBA 2Q6GA 1QJ7B 4TY6A 2FI3E 3BIVH 4ABHA 5A09A 1O2TA 5FBEA 2QF0A 3ZVFA 1OWHA 1TGSZ 2O8MA 2YOLA 4A5TS 1Y3XA 1WAYB 2QY0B 1LHCH 1HXFH 3L33A 4INLA 2WPMS 3GY8A 1H9HE 3MNSA 3LPRA 4OS5A 2O8UA 1QBOA 4RN6A 3MH7A 4DIIH 1BRCE 1G37A 2OINA 3RMMH 3LONA 2FI5E 1GBAA 3RUOA 2F9OA 3B8JA 2GTBA 2ZFTA 1C5NH 2ZU5A 1KLIH 1ZTLA 2GCHG 1HAXB 1P12E 3MH6A 1C1OA 1K2I1 1AE5A 1L0ZA 2F9PA 1G36A 2TGPZ 2A2QH 1TBRH 5EG4A 4IN1A 2P3FH 3KIDU 2A4GA 1YLCA 4UDWH 1O2OA 5HGGA 1BMMH 1QBVH 4B2BA 3RXSA 1Z6JH 7ESTE 3F9FA 4HZHA 1EJNA 1ZJKA 1DX5M 1KTSB 2PR3A 1YPJH 4NFEA 1O3MA 1P11E 1MTNC 1O3JA 3TJUA 1A0HB 1SL3A 2YNBA 3SZNA 1QR3E 1A7SA 5A0CA 1GJ5H 1UTJA 2G5VA 1TAWA 1MKXK 3M5NA 5J4SA 3GDSA 1EPTB 2PTNA 4WVPE 2THFB 3SU2A 1AN1E 5C1YA 2ALPA 1FUJA 2FEQH 1L2EA 1MBMA 2QGRA 1YPEH 3BN9A 3UWIA 2KAIB 3TJVA 2ZFSA 5C67A 3H7OA 4TWYA 2ZHEH 1CGJE 4AX9H 2GGVB 1THRH 1S6FA 3LDXH 3A89A 1C5LH 1A1RA 4NSVA 3F9EA 2CF9H 3BTHE 1TQ0B 4AZ2B 4K8YA 1DUAA 1O30A 3M7QA 3EYDA 4LXBH 1A3BH 1ELVA 2Z9LA 3KF2A 4BNRA 5BRRE 1HLTH 1TPOA 5C20A 4BTUB 1NRQH 4O03A 4ABEA 1BTUA 1C2GA 1B0FA 2HNTF 2ZPRA 4WH8A 1GHYH 2BLWA 2UWOA 3UNSA 1KXBA 1JXPA 3MFJA 1ZGIA 2UWPA 3LGYA 1L1NA 5G4BA 2PV9B 2SGDE 3L6PA 5E0JA 1P8VC 1YLDA 1TBZH 2ANKH 3ATMA 2TGDA 2BX4A 3PB1E 2F83A 4Y71A 1SGEE 1XVMA 1HAYB 1S0QA 1C1PA 2ZKSA 1Y3VA 1WYKA 4FU9A 5JYIA 1LTOA 1VITH 1HJAC 2BLOA 2P95A 1YPHE 3M7UA 5FCRA 5DP9A 3PV4A 1ELAA 1A61H 2WINI 1XUGA 1YP9A 2BY8X 3IWMA 4YOJA 1MUEB 3VB6A 4NWKA 1EOLA 1ESTA 4DW2U 1O2XA 2XBYA 3QTVH 1A0JA 2J92A 4ZHMU 1K1MA 1GL1A 3E90B 2H9HA 3SOSA 1TB6H 3KHVA 3WY8A 2ILNA 2A2XH 3A80A 1BUIA 3BTDE 3RC6A 4KTCA 2RDLA 1P3CA 3DT0H 1MBQA 4GLYA 4MTBA 4BOHA 3LIWA 3SU6A 1EP6A 3LKWA 2ZDKA 4THNH 1OSSA 1TE0A 2C3SA 1LCYA 3CS0A 4ISLA 1O32A 3SJIA 1SQOA 7LPRA 1NTPA 4YTAA 4NZQA 2W26A 1DANH 1W7GH 1RJXB 3O8RA 3SJ8A 1IOEA 1ACBE 1EOJA 3C27B 2ZHWH 2UUKB 3A7TA 1MAXA 1SGYE 3U1IB 4YLQH 2FO9A 2PKSB 1F7ZA 1PQAA 1NFUA 2Z3CA 1DICA 3S7KB 4CH8B 2O9QA 4MVNA 2TGTA 1ANDA 2C8XB 1DOJA 2ALVA 4H6TA 4FU8A 1VJ9U 3SUGA 4BAKB 4F4OC 1IHSH 4IC5A 2VB0A 5PTPA 4NCYA 4GCHG 4I8HA 2FIRH 3RMNH 2AGIX 1L1JA 2IOTA 1EAXA 1O39A 3A87A 2QYIA 3VGCC 1TIOA 1ZMJA 2YNAA 4HI3A 1SGNE 2JETB 1C5WB 1T8NA 2HRVA 1AKSA 2WYGA 2ZCHP 1MKWK 4XFQA 1W11U 1D6RA 2V35A 2AMQA 1G3EA 1LQEA 3IITA 2VGCC 4X0WU 2BY5X 3MNBA 5AF9H 3U69H 2SGPE 1GI3A 1C1SA 4Y7BA 4CH2B 7GCHG 1C5YB 2Y6TA 2OLGA 2WV5A 2PGQB 5FPTA 4X1RU 3NZIA 4FXGH 1C5ZB 3KNXA 1MQ5A 1IQFA 3LH1A 3SORA 1E35B 4NA9H 4NZLA 1XUKA 2BX3A 2K1QA 3MHWU 1ELDE 2FOBA 5CHAB 1XXFA 4DCDA 1XUFA 1LHEH 2WPLS 1CBWB 1LPGB 2VVCA 3SGAE 4CR9A 1GCDA 1F0SA 1HAVA 2OBOA 3P8OA 5I25A 3RC4A 3ELAH 3QN7A 1AZZA 1GCTC 4XBCA 1H9LB 2RA0A 3SJOA 1PPHE 3VB4A 4WXIA 1RGQA 4ABGA 3A7WA 2C8ZB 1TBQH 1QJ1B 1TGCA
chains in the Genus database with same CATH superfamily
2BXTH 3OAAD 2A4RA 1FJSA 1DE7H 4K5ZA 1IQHA 1XUIA 1JIMA 4GAWA 3A84A 1JMOH 1GHZA 3A83A 3ENSB 4A1TA 1OPHB 1GI9B 4FUFA 3TU7H 1O2IA 1D3DB 5JB8S 4DGJA 1O5DH 3F9GA 1L1GA 1TABE 3FO8D 1K21H 2Z6BD 4YLUA 3RXIA 3U98H 4X8TH 4RKJB 2PW8H 4FUIA 1P02A 1WQVH 1TPSA 3ATWA 4NA8A 2XNIA 1C1RA 3S0NA 4NIVA 3RMLH 1XKAC 5AFYH 1MTSA 5FAHA 5EJ1A 1SLWB 1SQRA 1OP8A 1VCPA 2CXVA 3D65E 2HPPH 1V6DA 4AFQA 3KGPA 2FDAA 2XCFA 4KP0A 1P06A 2FS8A 8LPRA 1H4WA 2XC0A 1OOKB 3ZVEA 2A7CA 2V3MA 4IMQA 1Y5AT 1GVKB 1ETTH 2BD7A 3A8CA 1NROH 5I46H 1T8MA 3RXRA 2BD2A 1L4DA 3Q77A 3GICB 4OM9A 2P3UB 4FUBA 2P94A 2G8TA 2ZDLA 2J5UA 4I8GA 3W94A 3OTPA 4TPYA 3BSQA 1AE8H 1FY8E 1K1IA 4DURA 2AMDA 2O8TA 4JYUH 2QXJA 3RXOA 1EZUC 2ZPQA 1OYQA 4XBBA 1Z7KA 2XWAA 4JZIA 4MLFB 3PTNA 1O3IA 2F9UA 3SJKA 1BMAA 1W0YH 4RT0A 4B6FA 3P8FA 1Q3XA 3U9AH 3BV9B 3WWBA 3VG8A 3KYGA 4X1NU 3LC5A 1SGTA 4Q80A 3SHAH 1HFDA 1O31A 2BD4A 4ZKNU 4XRNA 2GT8A 2FOEA 2FOHA 1BIOA 3V12A 1FPCH 2OC0A 4Q4LA 3RXBA 1NS3A 3SI4H 1MTWA 2FWWA 1C1UH 2P93A 4OS4A 2VH0A 4I8KA 4P00A 4MNYA 1JOUB 1AVXA 2NU1E 5JPMH 1O3OA 2PKSC 3UOPA 1GG6B 3SUEA 2Z9IA 4IBLH 1SKYE 1P05A 2L6OA 1UTOA 1TLDA 3V13A 4X6PA 1SGFA 1C4V2 1V2KT 2RA3A 3MTYA 7GCHF 1WTGH 1RIWB 3RXCA 1E1RD 1UO6A 2ZTXA 3HK6B 4GPGA 2FOGA 5L6NH 1AKSB 3LGIA 2BVSH 1C4U2 2D26C 1E0FD 1SMFE 1HXEH 1P9SA 4X2XA 1O5BB 4KTSA 2F9VA 1W12U 4I7YH 4MNWA 3SV9A 2ZECA 2B0FA 4TPIZ 1EPTC 5EXMA 5A0AE 3B23B 1OKXA 3BTQE 1C5OH 1MH0A 1NESE 3SNCA 1RXPA 5FHTA 1EJAA 1NO9H 1P2OA 3GYMA 3UUZA 3PO1B 1DWDH 3OFND 2B8OH 1P57B 3ZZ9A 1O5AB 1IQLA 2SFAA 3S9AA 4ISOA 5GNDA 2A4OA 3UB0A 1D3PB 1FONA 1MTUA 4DY7B 4M9FA 1OYTH 2H9TH 1TWXB 3U8RH 1UW7A 2Y80A 3K6YA 1C2FA 5T6GA 4ABJA 4MNXA 1AO5A 4LK4A 5FBIA 4GHTA 1YLNA 2V0BA 3F0PA 1LMWB 5FXLA 1ZZZA 1W8BH 1O2WA 1UVPA 2VIDA 3KN2A 1T31A 2O8WA 5C0UA 4CR5A 5EJZA 2HVYB 1COWD 2GVFA 1QL9A 2QA9E 3MO3A 1ELBA 3S9BA 1WBGB 1O38A 1H8HD 3BF6H 4FUHA 4X2WA 2FZZA 1ZHRA 1TALA 5HXFA 1PPBH 1PYTD 3SU0A 3URDA 1ORFA 3A86A 2YMSD 5DPAA 5DP5A 4X8SH 4I8LA 2ANMH 1T8OA 4GUXA 3O8CA 1IQEA 1MZAA 2HLCA 1FQ3A 1C1WH 5LH8A 1SSXA 1HB0B 5ESBA 5E0GA 1GBLA 4H6SB 3BTGE 1ABIH 1WXRA 1CT2E 1UVTH 2ODYB 4ISIH 2A5KA 1CT4E 4IGDA 3RXKA 1Z71A 4BAQB 1BRAA 1QBNA 2ZU1A 3DA9B 2ZIQH 1O37A 1KMHB 2W7SA 2VIVA 1XVOA 1N8OB 3HK3B 4ABFA 2A7JA 4F49A 5ESTE 3O8BA 4CRAA 3MYWA 3F68H 3IG6B 4ZKSU 1SQAA 1ANCA 1AY6H 1W0JD 3PRDA 1O36A 3BTFE 5DJ7A 1AGJA 1QB1A 2J38A 1TGTA 4KKDA 3ODFA 1V2RT 1GI4A 1O5FH 2ANYA 3F9HA 3PV5A 1VITG 5EQQA 2CHAB 1UCYK 1DWBH 3LJJA 2BD8A 3LGTA 4MPWA 3KL6A 1P03A 1SLXB 3PMJA 2BY6X 1G2LA 1P2QA 2P8OB 1HYLA 1MAYA 2STBE 3SUDA 4WH6A 1TMTH 1V2PT 2GX4A 1O3BA 1YPHC 5EXLA 3NCLA 5F53A 8KME2 2ZHQH 3EA9A 1QL7A 3VB7A 1CHGA 2F43B 1NPMA 3AK5A 1AUJA 5E0HA 2JH6D 1RTLA 1AB9B 2BTCE 4ISNA 1HAHH 1EXFA 1P2IA 4DOQA 2J98B 3SBKA 1FY5A 2XBXA 5GJ4B 2GV7A 1C5QA 1XMNB 2VWNA 5TJXA 1WV7H 2FOMB 1T7CA 1NZQH 3A7ZA 4XSKU 4FOUC 4YOGA 4VGCB 2FX6A 5E2OA 1HAVB 2PHBA 2Z3EA 1GG6C 1TX8A 1CU1A 5TCCA 1FN6A 1CA0B 1LO6A 3HKJB 1C5TA 1C9PA 1CE5A 4LZ1H 1CSOE 2CV3A 2W6JD 1GI5A 2XNDD 3SGBE 3D49H 2JH5D 2HVXA 1S6LA 2V3OH 2JJ2D 3N99A 1NU9A 3BTME 2FESH 2CN0H 5FX6A 1Z8JB 3UFAA 3K6ZA 1PFXC 4ZCNA 4OGYA 1A3EH 1PPFE 4O97A 1KXEA 1QZ8A 4ABAA 4JMYA 1YPMH 2GZ7A 3VFEA 2RFKC 4Z6AH 3MOCA 1MZDA 1O2QA 1D6WA 2ZFRH 1OS8A 1F5KU 5L30H 2XBVA 1C5XB 2D8WA 1W10U 4ZHAA 1UK4A 1SC8U 1UVUH 2ZFPH 2XOKD 4K2YA 2ZGJA 4WMFA 1HRTH 2QXGA 1DFPA 2QE7D 1NRPH 4AB8A 1GCTB 1K1LA 2ZGXH 1SGIB 2L74A 4KTUA 1C5PA 4ZHLU 1FY1A 2R0KA 2A32A 3PLBA 5DP6A 1OXGA 5C17A 1O35A 3JZ1B 4AFUA 3HATH 1CQQA 3QZQA 3TJOA 2ZHDA 4FVDA 5EW1H 2DUCA 4HFPB 1C5UA 3KEEA 3N7DA 2GP9B 2CK3D 2BDGA 2ZI2H 3OE7D 3QUMP 4BTTB 1BMLA 3EE0B 4DJZB 2AH4X 2XYAA 4RI0A 1Y8TA 1GJ6A 1O2GH 4OGXA 1ZPCA 2WPHS 1WSSH 1GJ7B 4NG9H 5E8EH 5HMAA 2JJ1D 3I78A 1ZPBA 1THSH 1T8LA 1GJ9B 3LGUA 1JBUH 1CT0E 1Q31A 1B5GH 2GCTB 3KQEA 3SQEE 4I86A 5TCAA 2HWLB 3MI4A 1KXAA 1TNLA 3QO6A 1IAUA 3KQ5A 1MTNB 2OXSA 2AGEX 1HAIH 5F03A 1E38B 1QNJA 4X1PU 2AFQB 3T29A 1ZHMA 1GGDB 1TRMA 2XTTB 1J9CH 1M9UA 2BY9X 4X2VA 1NT1A 1LQDB 3B9FH 1BA8B 1BZXE 1QA0A 2FOAA 4BTIB 3E91A 1GJAB 3E6PH 3OY5U 3MH5A 2LP6A 2ZU3A 3TK6A 4ZKOU 4NIWA 1XKBC 1ZSKA 3S9CA 2D2DA 2UUJB 4A6LA 5FL7D 1DXWA 1V2QT 3MU5A 3SV7A 4Y7AA 5BPEA 1ANBA 5A8ZA 1GI7B 3GCNA 4ESTE 4D9RA 1TRNA 3A88A 1UCYH 2G00A 1GMHG 1MCVA 1C5RA 5T3HA 4WMEA 1VCQA 2WHXA 3WWFA 7KMEH 2BOKA 3OU0A 2UWLA 4MG3A 3SUFA 1PQ8A 6LPRA 1S6HA 1SQTA 4WMDA 1NRRH 2ZA5A 5T6DA 1BBRE 1GI0A 3R0FA 1XUJA 3ATKA 3RXJA 1DXPA 2CHAC 1HAGE 3L3TA 2GMTC 2HPQH 3TGJE 3EE7A 1QQ4A 1TX6A 2WPIS 1UTQA 3DSPA 2P8OC 3PWBA 3FZDA 3AW1A 2HOBA 3RLYH 2J98A 1TOCB 5H4IB 3PLKA 2FTMA 3F2FA 1C5SA 3ZZ5A 3EQ0H 2EI6A 2FMJA 3U1JB 1ZR0A 4ABBA 4GHQA 1AZ8A 2FI4E 2KZ4A 3KQCA 1GWAA 3SU5A 3ZYDA 1ELGA 3QK1A 1QRXA 3MO6A 2ZHFH 4PROA 1FMGA 2OTVA 2O8LA 1NFXA 5FPYA 3UOUA 1Y3YA 2OQ5A 4ASUD 1EB2A 4IN2A 5IYTA 1QURH 1C1VH 1E37B 1EQ9A 1SHHB 1O2HA 4UONA 4MQAA 2IN2A 3UR9A 1JRSA 1NM6A 1E34B 3RXLA 1LHDH 3N7OA 1HGTH 4MPUA 3PO1C 3EA7A 1DWEH 2A45B 1BQYA 1FY3A 1T32A 1C2LA 3UNQA 1CA0C 3BG8A 2VH6A 4AOQA 4TSFD 3PYHA 5DKMA 3H09A 3MNCA 1D9IA 3T28A 2TIOA 2BDCA 1MD7A 3M35A 2B7DH 4LZ4B 1F5RA 5F8ZA 4ZUHA 1J16A 4AYYB 1YY3A 5HKKD 4UE7H 1SI5H 2GZ8A 5EXNA 1F2SE 1OX1A 5C3NA 1V3XA 1T4VH 3TGIE 1GVZA 4JK6A 1RS0A 1C1QA 1SBWA 3BG4B 3AVZA 1VJAU 3ZV9A 3BTKE 1AMHA 2J2UA 5EGMA 5KECA 4AC9A 3DCLA 4YXWD 3BTWE 3QWCH 3A82A 3ZVGA 4INKA 5SGAE 1SHYA 1CO7E 4K8BA 1G30B 4K1SA 1V2UT 5C5OA 1FDPA 2AEIH 4ZAEA 1N6XA 2PSYA 3P6ZB 1ZMLA 4Q7ZA 1GBJA 1LVOA 3SO3A 2EC9H 4Y11E 1MD8A 1RFNA 2FS9A 1MU8B 1P3EA 1K1NA 2GDEH 5JBCS 3UQVA 2C4FH 3PLPA 1ELCA 3QTOH 3U28C 3QLPH 3QX5H 1TNIA 3SU1A 3ZZ6A 2VGCB 2QC2A 2FODA 3PRBA 3M5OA 3TGKE 1J15A 5EODA 2TPIZ 2BDBA 4JK5A 3RU4T 3VXFH 1X7AC 3M3VA 1TX7A 1HDTH 1QY6A 1BTPA 2GJGA 4MNVA 1GDUA 4O3TA 1H9IE 5FPSA 2Y5HA 3SGQE 2BQWB 1SR5C 2VIPA 1AD8H 1B0EA 1KDQB 3CS7A 1C2EA 3TVJB 3GISB 4J2YB 2QV1A 1F5LA 2B5TB 4IMZA 2NU3E 2R2MB 4FUJA 1AWFH 3QGNB 1GGDC 1G9IE 1ANEA 2F9NA 5CHAC 2PUQH 4OS1A 3CNRA 1K22H 4I33A 1G2MA 4K1EA 1O2LA 1EP5A 2PGBB 1CHOF 2FOCA 4X8VH 1YCPM 1PPCE 4O3UA 1HAOH 2ZTYA 2OP9A 1VGCB 4CBOA 1XXDA 5K0HA 1ZGVA 1HJ9A 2ZQ2A 5GCHF 1EX3A 3ITIA 1BBRK 4R8TB 1GBEA 2TGAA 1GJ4H 1QA7A 3PM3A 1GHAG 1O5CB 3P95A 2FM2A 2AERH 4HG6A 2D1JA 3ZZ3A 1QRZA 1W0ZU 4AGKA 2GDDA 1Z1IA 1ZYOA 4NGAH 2BDYA 1O2ZA 1P9UA 1SGQE 1GDQA 2AMPA 1GMDG 1O3CA 2YMSB 1PJPA 1MABB 2GZ9A 3GDVA 4DG4A 1IQNA 4TY7A 1ETSH 2EEKA 4E05H 3SZEA 1GBKA 4DT7B 1GMCF 4RT1A 1Y3UA 3H7TA 2AIQA 4B75A 2VIWA 1CGIE 1BJVA 3NKKA 3AAUA 4ZXXH 3PROA 1GBBA 1GHVH 2SGQE 5F8TA 2J4IA 2RDEA 1BITA 2ZZUH 4F55A 2QCYA 1SOTA 3LT3A 5C94A 2ZNKH 3ZYEA 4ZXYH 4U01A 3SNBA 3T62A 5DO4H 4RKOB 4IC6A 1LVMA 3TJNA 3P8GA 1UTPA 2XW9A 2ZC9H 3LJOA 3UWJH 2ZGHA 3NWUA 2J97A 5KGOA 1V2ST 1NC6A 4X6MA 1EZQA 3SQHE 1K0HA 2FLRH 2DE8A 6GCHG 2BDAA 2PTCE 3PMBB 1YPGH 1H8DH 2Y7ZA 5JBBS 3W1EA 2P16A 1BRBE 1F0UA 4AG2A 2VBCA 1A5IA 3STJA 3D23A 2BQ7B 6CHAB 1INCA 1GI1A 1V2WT 1IQMA 3NXPA 1TYNA 2FLBH 4NIYA 1ELEE 1S0RA 1ABJH 1Z6EA 1SOZA 3UY9A 3VGCB 5KEDA 3QZRA 1RTFB 4XD7D 2JETC 1GBDA 3ZVDA 4A1XA 3FKSD 3EA8A 3SNAA 1UCYE 1TNKA 4JZFH 2BXUH 3P92A 4Y0YE 1BHXF 1N6YA 5B6LA 1KLJH 4Y8YA 1P2MA 1WOFA 1D3TB 2R3UA 3TITA 3V7TA 5DP4A 1E79D 2WV9A 3FANA 4CRBA 2BD5A 3DHKH 1G3CA 2NU0E 2XRCA 4YT7H 3D62A 2W5EA 2ZQ1A 1KXCA 1UTLM 3VXEH 1GHWH 1K28D 5GCHG 1GL0E 8GCHF 3FP7E 3P70B 3UR6A 1GPZA 1NN6A 3TNTA 3BIUH 5EW2H 3A7YA 3RXEA 1GHBF 1MKWH 5HM9A 3LC3A 3CP7A 4BAOB 3LU9B 1GVLA 1O5EH 5A0BA 6GCHF 2HGTH 1HJ8A 4ZKRU 2G55A 1GBFA 1P0SH 2BLQA 3RMOH 2EY4C 1EZSC 3MQKC 1ESAA 3P8NA 4JZDH 2OK5A 1SLUB 2GCHF 4Y6DA 1S85A 4E06H 1FLEE 1K1PA 2PUXB 2PP6A 3RXFA 1W0KD 2I6SA 3R3GB 4ZMAH 1GJ8B 4DVAU 4B73A 4IS5A 3E0NB 2GKVE 3A8BA 2ZG0H 1C5VA 2FP7B 3MO9A 2BMGB 1SGCA 1NRSH 2AIPA 3M3SA 5J4QA 3SV2H 1AWHB 1JRTA 2WUCA 1GJCB 1EASA 3KYFA 2TRMA 1HIAB 1C1MA 1D4PB 3M36A 3RC5A 2H5CA 1Z8IB 4R0IA 2BM2A 4UFEH 2ZU2A 5ABWA 1DSUA 2ZWLH 1HAZB 1FN8A 2ZF0H 4UFGH 1FIZA 4Y10E 3AAVA 2K8IA 4OS6A 4Y8XA 2Y5FA 1AVWA 4ABDA 2ZDVH 2QF3A 2WUBA 1GHBG 2NWNA 5HM2A 2ZCKP 4WJG2 2V6NA 2A0QB 3JZ2B 2XC4A 1AHTH 2BD9A 1MCTA 2GMTB 3AASA 1KY9A 4U30A 4HGCA 3TNSA 3G01A 3MU0A 1C1TA 3I77A 3HGNA 2Q6DA 3RXGA 1VR1H 1ZLRA 4AG1A 2I6QA 4MPVA 2Y81A 5JDUB 1WTHD 4Q63A 5EU8A 4X6NA 2LNCA 1TMUH 2G5NA 1LHFH 3F3BA 3RU4D 1C2HA 1HUTH 1PYTC 1YC0A 2Z9GA 2H6MA 3FZZA 1S81A 1NY22 3K9XB 3STIA 1ELFA 2F3CE 3RLWH 1DS2E 5EQRA 2R2WU 2ODQA 2QN5T 4JYTA 3Q00A 1TQ7B 2IJOB 2J95A 1RD3B 3RP2A 2BVXH 1J14A 2STAE 1UVSH 1A5HA 1N1LA 3U8OH 5C5NA 2JDID 1UHBB 1T4UH 1HPGA 4Z0KA 2AHME 1O3PB 3RXTA 4D9QA 2A4QA 3VPKA 1GBHA 4MPXA 3LOXA 1TMBH 1XUHA 3T27A 3UPEA 5T6FA 4BXSA 1F0TA 2PKAA 4K3JA 4UFDH 5CMXH 1DWCH 3TH3H 1ZRKA 3BTTE 4XBDA 5A8YA 3SW2B 1GBCA 4WY3A 4XDEA 1ZJDA 3S7HB 1C2DA 3W95A 2G4UA 1UTKA 2A31A 2EA3A 1NBME 2JH0D 2HNTE 1O2PA 1DLKB 3BG4C 3TH2H 1GJDB 2SNWA 3A81A 1Y3WA 1WDIA 2VVUA 1MMJN 4FU7A 2G81E 3FVFB 1TONA 3K2UA 3GDUA 5DG6A 1O2MA 1QRWA 1KYNA 4YT6H 1K1JA 2ZU4A 2FOFA 5F6MA 1A4WH 2KCPA 4A1VA 1K9OE 3A7VA 1AB9C 4CREA 4Y76A 1KDQA 3ZVCA 1O3AA 3GY6A 1QQUA 1A0LA 1TA2A 4A7IB 1YF4A 1KSNA 1GMDF 4UEHH 4X1SU 5DP7A 1OHHD 4FUDA 1YCPH 2B9LA 1TPAE 2XC5A 5CHBA 1L4ZA 3VB5A 1FNIA 5LGOA 2VJ1A 2UUFB 4AN7A 4I8JA 1A46H 4X1QU 1LPKB 1WU1A 4D7GA 1GHAF 1ID5H 1GMCG 1BDAA 2BLVA 2Z9JA 1VCWA 3E1XB 1HJAB 3E3TA 2C8WB 2PSXA 3UQOA 1C2IA 3A7XA 3UREA 1BBRH 4F48B 5CDFE 3DFJA 1GBTA 1EATA 4X2YA 2HLDD 4D76A 2BHGA 3T25A 1E36B 3M5MA 2FXRA 1JWTA 3PTBA 1O3FA 1IQIA 2Z94A 4CHAB 1FI8A 2FTLE 1KLTA 3TPIZ 3PMHB 4JCNA 2NU4E 1OWEA 1V2LT 1FY4A 4ZROA 1O2NA 2KCYA 2QF5A 1AUTC 1HIAA 1PPGE 4U2WA 3RM0H 1O2JA 1O2RA 3F0OA 3ZZ4A 1C5MD 1QB9A 1P2JA 1ZPZA 4OS2A 3BTEE 2HALA 2F4LA 3ZZAA 1SVPA 1TGBA 1HV7A 3GY2A 4UD9H 1P04A 3FP8E 1KIGH 1O33A 1ZMNA 1TA6A 1YM0A 1EUFA 3PMAB 2OCVB 2SGFE 1O3DA 4H42U 1Y5BT 3AW0A 3RXPA 2V3HH 3KQDA 3Q76A 2CMYA 1PQ7A 1DLEA 2XWBI 4ACBA 1W14U 1QJ6B 3QDZB 4ABIA 1AIXH 4O9VA 5ETXA 1P01A 3OEHD 3TH4H 2Z3DA 2Q6FA 2OC1A 1N8OC 3ESTA 3GCTF 3HPTB 3ZVAA 4YM9A 1W2KH 2C8YB 1V2VT 2BZAA 4K1TA 2G51A 1QIXB 1MTVA 3ZZDA 3GCOA 1EB1H 2XXLA 5IDKA 3T26A 5GPIB 3RXQA 5DGJA 4A92A 3EGKH 3SU3A 2TBSA 4I31A 2FYRA 1RIWC 1A5GH 3E8LA 1NFWA 1QHRB 2QF4A 3FP6E 1O2YA 3M5LA 4FVBA 1SFQB 1TPPA 3UIRA 2BQ6B 1DM4B 2J34A 3VEQB 1VKYA 1F92A 1Y5UT 1OWKA 1AFQB 1BTZA 1ARBA 5C1UA 1NU7B 3RXAA 3SN8A 3F6UH 1QFKH 5K7RA 4P02A 1NRNH 3OSYA 3OTJE 4BXWA 1C1NA 3NK8A 3GYLB 1YKTA 2ASUB 2C90B 3C1KA 2IPHA 3FFGA 5F8XA 6CHAC 5EOKA 2P59A 1UTMA 4AYVB 2BD3A 4AFZA 1V2NT 5HIYA 1BTXA 2J9NA 3ZZBA 4NSYA 5B6OA 1O3KA 2ANWA 4CBNA 1UK3A 2W3IA 4I32A 1UTNA 2AYWA 1TNGA 2Q1JA 1V2JT 1LHGH 3A8DA 1OWIA 4OS7A 1C9TA 2J94A 5DK1A 3URCA 4CRGA 3GCHC 2VVVA 1EZXC 1O3NA 2RG3A 2SGEE 2ZGCA 4Y79A 2OD3B 1Q2WA 1V2OT 1BT7A 1TGNA 1Z8GA 5DN6D 4KGAA 1LVBA 1BCUH 2ZFQH 1FPHH 4Q2KA 2ZDAH 3MMGA 3Q3XA 4AORA 4TWWA 4ACAA 1KXDA 3M7TA 4B1TA 1V2TT 4WXVA 5C1XA 1DT2A 1O34A 1C2JA 3TK5A 2IJD1 4X8UH 1P2NA 1EAIA 4H4FA 3SV6A 1DY9A 4WF8A 1TNHA 5CE1A 2W6ID 4INHA 1BTHH 3NPSA 3SNDA 2WPDD 2ZGBH 1SGDE 1DDJA 1GI6A 2LPRA 3S69A 5L2YH 2XCNA 1BTYA 4Q7YA 1LKAA 2BOHB 3QGJA 1DY8A 4NIXA 5GIBA 3SJ9A 3GY3A 3ZZCA 1QB6A 3VB3A 1EAUA 4D7FA 6ESTA 1S83A 1UJ1A 4DT4A 2FX4A 1S84A 4GCHF 1O3HA 4B2AA 1O2UA 1S82A 1FAKH 3OX7U 3OYPA 4JYVH 4JZ1A 4K60A 2Z7FE 5AHGH 3UTUH 1J17T 2KCAA 4BANB 1AQ7A 3T5FH 4U32A 3MU4A 5LPEA 5EQSA 1ZRBA 1KTTB 3RU4E 3SHCH 2F9BH 3H5CB 3PV2A 1TNJA 5DP3A 1TOMH 4NA7A 2BVRH 2KFWA 1EJMA 1FXYA 2PWXA 3LH3A 3DFLA 1YGCH 2P3TB 3U8TH 2ZP0H 1W13U 3GOVB 1IQGA 3EDXB 1QGFA 1DUEA 3UAIC 3ZV8A 9ESTA 1XM1A 3ATLA 3RXMA 8GCHG 3RXDA 1CHOG 3KCGH 3Q3YA 1XX9A 1BB0B 1CVWH 1OP0A 3DUXH 5E2PA 1ZTKA 1BJUA 1AI8H 2BZ6H 2Z9KA 2ZTZA 3MU8A 1H1BA 1RTKA 4JZEH 4RSPA 1IHTH 1GJBB 4Z1MD 3RXVA 1EPTA 1UMAH 1Y59T 1OP2A 1YYY1 2GCTC 3M3TA 2A7HA 2A5IA 3OY6U 4B76A 1G3DA 1W3CA 3SU4A 3I29A 2FYQA 2OBQA 2QIQA 3GY5A 4CRFA 1SGRE 3ZZ8A 4LOYH 3O8DA 1ESBA 2PFEA 1THPB 2G52A 4YO9A 1SG8B 1AU8A 2KAIA 5DSFA 2Y7XA 5JB9S 1YPKH 5JBTA 1GHXH 1C2MA 1KXFA 2OC7A 2VINA 2ZO3H 3CENA 1BMNH 2AS9A 3RDZA 4GVUA 2VIOA 2VU8E 1UHBA 1JIRA 2OQUA 4NWLA 4TYDA 1FZZA 2G4TA 5AFZH 1PPEE 1EKBB 2A5AA 1S5SA 2CJIA 1BOQA 1AFEH 3E16B 3V0XA 5FCKA 1ZTJA 1GI2A 1IQJA 2M5TA 5C0TA 1P09A 4CRDA 2XBWA 1MQ6A 2EI8A 1O0DH 1H8IH 3SI3H 1QCPA 1YPLH 2WV4A 1P2KA 2LELA 3MWIU 3RM2H 5EPYA 1DSTA 4J1YA 2DE9A 4Q7XA 2WPJS 1FIWA 5LPFA 2AGGX 2R9PA 2ZCLP 1LPZB 2A1DB 3MH4A 3BEFB 2BYAX 1U6QA 3ATIA 4HTCH 2SGAA 1O2VA 1G3BA 1HCGA 2C93B 1GMHF 3TLOA 3TIUA 1CGHA 1YBWA 2ZPSA 2F91A 5FX5A 2Y5GA 1G32B 2SNVA 3DSOA 3T2NA 1DPOA 1TRYA 1UVOA 5GXPA 2CF8H 4ZH8A 2PLXA 2ZDNA 1ZHPA 4B2CA 4E7NA 3E0PB 4E7RG 5C2ZA 2FPZA 2YMSC 1K1OA 1FAXA 2UUYA 1ETRH 2WPKS 5T1VA 3PWCA 1DITH 4D8NA 2GV6A 1HBTH 4IW4E 1SGFG 5LPRA 1CA8B 1C2KA 3GCHB 1LVYA 5GWZA 1F0RA 1QTFA 2ULLA 2QXIA 3RXHA 4SGAE 3NRLA 2VWLA 3GCTG 3UNRA 2WYJA 5A8XA 2ZDMA 1IQKA 2RCEA 3A85A 4FUEA 3Q3KA 4Y0ZE 2H5DA 1GBMA 3LGVA 1LKBA 8ESTE 1ARCA 1GBIA 2HNTC 1Z8RA 3KQBA 1OWDA 1B7XB 5AVDA 3BEUA 1P10A 3HKIB 1RRKA 1FV9A 3A8AA 5IK2D 2BDHA 2VWMA 1GI8B 1WUNH 1ZSLA 2H1UA 4AFSA 4ASHA 4CHAC 2H9EH 4XE4A 1SB1H 1WCZA 3RXUA 4AGJA 2NU2E 5GDSH 4KELA 1BRUP 4YESB 3P17H 1PPZA 4B71A 4XOJA 1Z1JA 1VITF 3K65B 4DIHH 1YCPK 1PQ5A 3NUMA 1CBWC 3FN8A 2VWOA 1O2SA 3MU1A 1MKXH 2BY7X 2BB4A 5HYOA 4GSOA 3BEIB 4YOIA 4B74A 2ZFFH 2BDIA 5EPNA 5A2MH 1WQSA 3MNXA 2OUAA 1VZQH 2R3YA 3ZVBA 9LPRA 1ELTA 4SGBE 2H2ZA 2ODPA 2PKAB 1ZOMA 2QAAA 4AB9A 1O5GH 1QL8A 4FUGA 2VNTA 2QXHA 4NFFA 3ODDA 4BAHB 3FAOA 3M61U 2W7UA 1TFXA 4QT8C 1SPJA 1SFIA 3F1SB 1A2CH 2EI7A 1HNEE 3V3MA 1C4Y2 2GT7A 1EFRD 3HGPA 2W3KA 4ISHH 3SV8A 3LGWA 2Y82A 3GS9A 4Y8ZA 4YZUA 1HAPH 3EAJA 1AVGH 1NFYA 4WWYA 1W7XH 1OWJA 3ZZ7A 4M7GA 2VIQA 3DD2H 1D3QB 4VGCC 2ESTE 1O2KA 4BAMB 5EJLA 1SLVB 1LDTT 2WZQA 5DP8A 4FUCA 1EAWA 3SNEA 3M37A 3TK9A 4UFFH 1UK2A 2CGAA 1SGPE 1O3EA 3GY4A 1MU6B 3OEED 4X6OA 1BTWA 1ZSJA 1O3GA 1BHXB 2R0LA 4K69A 2GD4B 2JKHA 4MDSA 2WSSD 1VGCC 1V2MT 1DVAH 3GY7A 1GDNA 1AFQC 1J8AA 4CRCA 5JBAS 5L2ZH 1O3LA 2OC8A 2KCOA 2ZEBA 2Q6GA 1QJ7B 1H8ED 4TY6A 2FI3E 3BIVH 4ABHA 5A09A 1O2TA 5FBEA 2QF0A 3ZVFA 1OWHA 1TGSZ 2O8MA 2YOLA 4A5TS 1Y3XA 1WAYB 2QY0B 1LHCH 1HXFH 3L33A 4INLA 2WPMS 3GY8A 1H9HE 3MNSA 3LPRA 4OS5A 2O8UA 1QBOA 4RN6A 3MH7A 4DIIH 1BRCE 1G37A 2OINA 3RMMH 3LONA 2FI5E 1GBAA 3RUOA 2F9OA 3B8JA 2GTBA 2ZFTA 1C5NH 2ZU5A 1KLIH 1ZTLA 2GCHG 1HAXB 1P12E 3MH6A 1C1OA 1K2I1 1AE5A 1L0ZA 2F9PA 1G36A 2TGPZ 2A2QH 2EQNA 1TBRH 5EG4A 3WW7A 4IN1A 2P3FH 3KIDU 2A4GA 1YLCA 4UDWH 1O2OA 5HGGA 1BMMH 1QBVH 4B2BA 3RXSA 1Z6JH 7ESTE 3F9FA 4HZHA 1EJNA 1ZJKA 1DX5M 1KTSB 2PR3A 1YPJH 4NFEA 1O3MA 1P11E 1MTNC 1O3JA 3TJUA 1A0HB 1SL3A 2YNBA 3SZNA 1QR3E 1A7SA 5A0CA 1GJ5H 1UTJA 2G5VA 1TAWA 1MKXK 3M5NA 5J4SA 3F2HA 3GDSA 1EPTB 2PTNA 2KR7A 4WVPE 2THFB 3SU2A 1AN1E 5C1YA 2ALPA 1FUJA 2FEQH 1L2EA 1MBMA 2QGRA 1YPEH 3BN9A 3UWIA 2KAIB 3FOAA 3TJVA 2ZFSA 5C67A 3H7OA 4TWYA 2ZHEH 1CGJE 4AX9H 2GGVB 1THRH 1S6FA 3LDXH 3A89A 1C5LH 1A1RA 4NSVA 3F9EA 2V7QD 2CF9H 3BTHE 1TQ0B 3N7EA 4AZ2B 4K8YA 1DUAA 1O30A 3M7QA 3EYDA 4LXBH 1A3BH 1ELVA 2Z9LA 3KF2A 4BNRA 5BRRE 1HLTH 1TPOA 5C20A 4BTUB 1NRQH 4O03A 4ABEA 1BTUA 1C2GA 1B0FA 2HNTF 4FETA 2ZPRA 4WH8A 1GHYH 1FX0B 2BLWA 2UWOA 3UNSA 1KXBA 1JXPA 3MFJA 1ZGIA 2UWPA 3LGYA 1L1NA 5G4BA 2PV9B 2SGDE 3L6PA 5E0JA 1BMFD 1P8VC 1YLDA 1TBZH 2ANKH 3ATMA 2TGDA 2BX4A 3PB1E 2F83A 4Y71A 1SGEE 1XVMA 1HAYB 1S0QA 1C1PA 2ZKSA 1Y3VA 1WYKA 4FU9A 5JYIA 2M2AA 1LTOA 5HIZA 1VITH 1HJAC 4TT3D 2BLOA 2P95A 1YPHE 3M7UA 5FCRA 5DP9A 3PV4A 1ELAA 1A61H 2WINI 1XUGA 1YP9A 2BY8X 3IWMA 1E1QD 4YOJA 1MUEB 3VB6A 4NWKA 1EOLA 1ESTA 4DW2U 1O2XA 2XBYA 3SYJA 3QTVH 1A0JA 2J92A 4ZHMU 1K1MA 1GL1A 3E90B 2H9HA 3SOSA 4B6EA 1TB6H 3KHVA 3WY8A 2ILNA 2A2XH 3A80A 1BUIA 3BTDE 3RC6A 3DSGA 4KTCA 2RDLA 1P3CA 3DT0H 1MBQA 1YWUA 4GLYA 4MTBA 4BOHA 3LIWA 3SU6A 1EP6A 3LKWA 2ZDKA 4THNH 1OSSA 1TE0A 2C3SA 1LCYA 3CS0A 4ISLA 1O32A 3SJIA 1SQOA 7LPRA 1NTPA 4YTAA 4NZQA 2W26A 1DANH 1W7GH 1RJXB 3O8RA 3SJ8A 1IOEA 1ACBE 1EOJA 3C27B 2ZHWH 2UUKB 3A7TA 1MAXA 1SGYE 3U1IB 4YLQH 2FO9A 2PKSB 1F7ZA 1PQAA 1NFUA 2Z3CA 1DICA 3S7KB 4CH8B 2O9QA 4MVNA 2TGTA 1ANDA 2C8XB 1DOJA 2ALVA 4H6TA 4FU8A 1VJ9U 3SUGA 4BAKB 4F4OC 2IPQX 1IHSH 4IC5A 2VB0A 5PTPA 4NCYA 4GCHG 4I8HA 2FIRH 3RMNH 2AGIX 1L1JA 2IOTA 1EAXA 1O39A 3A87A 2QYIA 3VGCC 1TIOA 1ZMJA 2YNAA 4HI3A 1SGNE 2JETB 1C5WB 1T8NA 2HRVA 1AKSA 2WYGA 2ZCHP 1MKWK 4XFQA 1W11U 1D6RA 2V35A 2AMQA 1G3EA 1LQEA 3IITA 2VGCC 4X0WU 2BY5X 3MNBA 5AF9H 3U69H 2SGPE 1GI3A 1C1SA 4Y7BA 4CH2B 7GCHG 1C5YB 2Y6TA 2OLGA 2WV5A 2PGQB 5FPTA 4X1RU 3NZIA 4FXGH 1C5ZB 3KNXA 1MQ5A 1IQFA 3LH1A 3SORA 1E35B 4NA9H 4NZLA 1XUKA 2BX3A 2K1QA 1NBMD 3MHWU 1ELDE 2FOBA 5CHAB 1XXFA 4DCDA 1XUFA 1LHEH 2K0QA 2WPLS 1CBWB 1LPGB 2VVCA 3SGAE 4CR9A 2KX4A 1GCDA 1F0SA 1HAVA 2OBOA 3P8OA 5EIYA 5I25A 3RC4A 3ELAH 3F2GA 3QN7A 1AZZA 1GCTC 4XBCA 1H9LB 2JIZD 2RA0A 3SJOA 1PPHE 3VB4A 2KM0A 4WXIA 1RGQA 3ZIAD 4ABGA 3A7WA 2C8ZB 1TBQH 1QJ1B 1TGCA
chains in the Genus database with same CATH topology
2BXTH 2A4RA 1FJSA 1DE7H 4K5ZA 1IQHA 1XUIA 1JIMA 4GAWA 3A84A 1JMOH 1GHZA 3A83A 3ENSB 4A1TA 1OPHB 1GI9B 4FUFA 3TU7H 1O2IA 1D3DB 5JB8S 4DGJA 1O5DH 3F9GA 1L1GA 1TABE 1K21H 2Z6BD 4YLUA 3RXIA 3U98H 4X8TH 4RKJB 2PW8H 4FUIA 1P02A 1WQVH 1TPSA 3ATWA 4NA8A 2XNIA 1C1RA 3S0NA 4NIVA 3RMLH 1XKAC 5AFYH 1MTSA 5FAHA 1SLWB 1OP8A 1VCPA 2CXVA 3D65E 2HPPH 1V6DA 4AFQA 3KGPA 2FDAA 2XCFA 4KP0A 1P06A 2FS8A 8LPRA 1H4WA 2XC0A 1OOKB 3ZVEA 2A7CA 4IMQA 1Y5AT 1GVKB 1ETTH 2BD7A 3A8CA 1NROH 5I46H 1T8MA 3RXRA 2BD2A 1L4DA 3Q77A 3GICB 2P3UB 4FUBA 2P94A 2G8TA 2ZDLA 4I8GA 3W94A 4TPYA 3BSQA 1AE8H 1FY8E 1K1IA 4DURA 2AMDA 2O8TA 4JYUH 2QXJA 3RXOA 1EZUC 2ZPQA 1OYQA 4XBBA 1Z7KA 2XWAA 4JZIA 4MLFB 3PTNA 1O3IA 2F9UA 3SJKA 1BMAA 1W0YH 3P8FA 1Q3XA 3U9AH 3BV9B 4X1NU 3LC5A 1SGTA 4Q80A 3SHAH 1HFDA 1O31A 2BD4A 4ZKNU 2GT8A 2FOEA 2FOHA 1BIOA 3V12A 1FPCH 2OC0A 3RXBA 1NS3A 3SI4H 1MTWA 2FWWA 1C1UH 2P93A 4OS4A 2VH0A 4I8KA 4MNYA 1JOUB 1AVXA 2NU1E 5JPMH 1O3OA 2PKSC 3UOPA 1GG6B 3SUEA 2Z9IA 4IBLH 1UTOA 1P05A 3V13A 1TLDA 4X6PA 1SGFA 1C4V2 1V2KT 2RA3A 3MTYA 7GCHF 1WTGH 1RIWB 3RXCA 1UO6A 2ZTXA 3HK6B 4GPGA 2FOGA 5L6NH 1AKSB 3LGIA 2BVSH 1C4U2 2D26C 1E0FD 1SMFE 1HXEH 1P9SA 4X2XA 1O5BB 4KTSA 2F9VA 1W12U 4I7YH 4MNWA 3SV9A 2ZECA 2B0FA 4TPIZ 1EPTC 5EXMA 5A0AE 3B23B 1OKXA 3BTQE 1C5OH 1MH0A 1NESE 3SNCA 1RXPA 5FHTA 1EJAA 1NO9H 1P2OA 3GYMA 3UUZA 3PO1B 1DWDH 2B8OH 1P57B 3ZZ9A 1O5AB 1IQLA 2SFAA 3S9AA 4ISOA 2A4OA 1D3PB 1FONA 1MTUA 4DY7B 1OYTH 2H9TH 1TWXB 3U8RH 2Y80A 3K6YA 1C2FA 5T6GA 4ABJA 4MNXA 1AO5A 4LK4A 5FBIA 4GHTA 2V0BA 1LMWB 5FXLA 1ZZZA 1W8BH 1O2WA 1UVPA 2VIDA 3KN2A 1T31A 2O8WA 4CR5A 2GVFA 1QL9A 2QA9E 3MO3A 1ELBA 3S9BA 1WBGB 1O38A 3BF6H 4FUHA 4X2WA 2FZZA 1ZHRA 1TALA 5HXFA 1PPBH 1PYTD 3SU0A 3URDA 1ORFA 3A86A 5DPAA 5DP5A 4X8SH 4I8LA 2ANMH 1T8OA 4GUXA 3O8CA 1IQEA 1MZAA 2HLCA 1FQ3A 1C1WH 5LH8A 1SSXA 1HB0B 5ESBA 5E0GA 1GBLA 4H6SB 3BTGE 1ABIH 1CT2E 1UVTH 2ODYB 4ISIH 2A5KA 1CT4E 4IGDA 3RXKA 1Z71A 4BAQB 1BRAA 1QBNA 2ZU1A 3DA9B 2ZIQH 1O37A 2W7SA 2VIVA 1XVOA 1N8OB 3HK3B 4ABFA 2A7JA 4F49A 5ESTE 3O8BA 4CRAA 3MYWA 3F68H 3IG6B 4ZKSU 1SQAA 1ANCA 1AY6H 1O36A 3BTFE 5DJ7A 1AGJA 1QB1A 2J38A 1TGTA 4KKDA 3ODFA 1V2RT 1GI4A 1O5FH 2ANYA 3F9HA 5EQQA 1VITG 2CHAB 1UCYK 1DWBH 3LJJA 2BD8A 3LGTA 4MPWA 3KL6A 1P03A 1SLXB 3PMJA 2BY6X 1G2LA 1P2QA 2P8OB 1HYLA 1MAYA 2STBE 3SUDA 4WH6A 1TMTH 1V2PT 2GX4A 1O3BA 1YPHC 5EXLA 3NCLA 8KME2 2ZHQH 3EA9A 1QL7A 3VB7A 1CHGA 1NPMA 1AUJA 5E0HA 2JH6D 1RTLA 1AB9B 2BTCE 4ISNA 1HAHH 1EXFA 1P2IA 4DOQA 3SBKA 1FY5A 2XBXA 5GJ4B 2GV7A 1C5QA 1XMNB 2VWNA 5TJXA 1WV7H 2FOMB 1T7CA 1NZQH 3A7ZA 4XSKU 4YOGA 4VGCB 2FX6A 5E2OA 1HAVB 2PHBA 2Z3EA 1GG6C 1TX8A 1CU1A 5TCCA 1FN6A 1CA0B 1LO6A 3HKJB 1C5TA 1C9PA 1CE5A 4LZ1H 1CSOE 2CV3A 1GI5A 3SGBE 3D49H 2JH5D 2HVXA 2V3OH 1NU9A 3BTME 2FESH 2CN0H 5FX6A 1Z8JB 3UFAA 3K6ZA 1PFXC 4OGYA 1A3EH 1PPFE 4O97A 1KXEA 4ABAA 4JMYA 1YPMH 2GZ7A 3VFEA 4Z6AH 3MOCA 1MZDA 1O2QA 1D6WA 2ZFRH 1OS8A 1F5KU 5L30H 2XBVA 1C5XB 2D8WA 1W10U 4ZHAA 1UK4A 1SC8U 1UVUH 2ZFPH 4K2YA 4WMFA 2ZGJA 1HRTH 2QXGA 1DFPA 1NRPH 4AB8A 1GCTB 1K1LA 2ZGXH 1SGIB 4KTUA 1C5PA 4ZHLU 1FY1A 2R0KA 2A32A 3PLBA 5DP6A 1OXGA 1O35A 3JZ1B 4AFUA 3HATH 1CQQA 3QZQA 3TJOA 2ZHDA 4FVDA 5EW1H 2DUCA 4HFPB 1C5UA 3KEEA 2GP9B 2ZI2H 2BDGA 3QUMP 4BTTB 1BMLA 3EE0B 4DJZB 2AH4X 2XYAA 1Y8TA 1GJ6A 1O2GH 4OGXA 1ZPCA 2WPHS 1WSSH 1GJ7B 4NG9H 5E8EH 5HMAA 3I78A 1ZPBA 1THSH 1T8LA 1GJ9B 3LGUA 1JBUH 1CT0E 1Q31A 1B5GH 2GCTB 3KQEA 3SQEE 5TCAA 2HWLB 3MI4A 1KXAA 1TNLA 3QO6A 1IAUA 1MTNB 2OXSA 2AGEX 1HAIH 5F03A 1E38B 1QNJA 4X1PU 2AFQB 3T29A 1ZHMA 1GGDB 1TRMA 2XTTB 1J9CH 1M9UA 2BY9X 4X2VA 1NT1A 1LQDB 3B9FH 1BA8B 1BZXE 1QA0A 2FOAA 4BTIB 3E91A 1GJAB 3E6PH 3OY5U 3MH5A 2ZU3A 3TK6A 4ZKOU 4NIWA 1XKBC 1ZSKA 3S9CA 2D2DA 2UUJB 4A6LA 1DXWA 1V2QT 3MU5A 3SV7A 4Y7AA 5BPEA 1ANBA 5A8ZA 1GI7B 3GCNA 4ESTE 4D9RA 1TRNA 3A88A 1UCYH 2G00A 1GMHG 1MCVA 1C5RA 5T3HA 4WMEA 1VCQA 7KMEH 2BOKA 3OU0A 2UWLA 4MG3A 3SUFA 1PQ8A 6LPRA 1S6HA 1SQTA 4WMDA 1NRRH 2ZA5A 5T6DA 1BBRE 1GI0A 3R0FA 1XUJA 3ATKA 3RXJA 1DXPA 2CHAC 1HAGE 3L3TA 2GMTC 2HPQH 3TGJE 1QQ4A 1TX6A 2WPIS 1UTQA 2P8OC 3PWBA 3FZDA 3AW1A 2HOBA 3RLYH 1TOCB 5H4IB 3PLKA 2FTMA 1C5SA 3ZZ5A 3EQ0H 2EI6A 2FMJA 3U1JB 1ZR0A 4ABBA 4GHQA 1AZ8A 2FI4E 3KQCA 1GWAA 3SU5A 3ZYDA 1ELGA 3QK1A 1QRXA 3MO6A 2ZHFH 4PROA 1FMGA 2OTVA 2O8LA 1NFXA 5FPYA 3UOUA 1Y3YA 2OQ5A 1EB2A 4IN2A 5IYTA 1QURH 1C1VH 1E37B 1EQ9A 1SHHB 1O2HA 4UONA 4MQAA 2IN2A 3UR9A 1JRSA 1NM6A 1E34B 3RXLA 1LHDH 3N7OA 1HGTH 4MPUA 3PO1C 3EA7A 1DWEH 2A45B 1BQYA 1FY3A 1T32A 1C2LA 3UNQA 1CA0C 3BG8A 2VH6A 4AOQA 3PYHA 5DKMA 3MNCA 1D9IA 3T28A 2TIOA 2BDCA 1MD7A 3M35A 2B7DH 4LZ4B 1F5RA 5F8ZA 4ZUHA 1J16A 4AYYB 4UE7H 1SI5H 2GZ8A 5EXNA 1F2SE 1OX1A 5C3NA 1V3XA 1T4VH 3TGIE 1GVZA 4JK6A 1RS0A 1C1QA 1SBWA 3BG4B 3AVZA 1VJAU 3ZV9A 3BTKE 1AMHA 2J2UA 5EGMA 3BTWE 3QWCH 3A82A 3ZVGA 4INKA 5SGAE 1SHYA 1CO7E 4K8BA 1G30B 4K1SA 1V2UT 5C5OA 1FDPA 2AEIH 4ZAEA 1N6XA 2PSYA 3P6ZB 1ZMLA 4Q7ZA 1GBJA 1LVOA 3SO3A 2EC9H 4Y11E 1MD8A 1RFNA 2FS9A 1MU8B 1P3EA 1K1NA 2GDEH 5JBCS 3UQVA 2C4FH 3PLPA 1ELCA 3QTOH 3QLPH 3QX5H 1TNIA 3SU1A 3ZZ6A 2VGCB 2QC2A 2FODA 3M5OA 3TGKE 1J15A 5EODA 2TPIZ 2BDBA 4JK5A 3RU4T 3VXFH 1X7AC 3M3VA 1TX7A 1HDTH 1QY6A 1BTPA 4MNVA 1GDUA 4O3TA 1H9IE 5FPSA 2Y5HA 3SGQE 2BQWB 1SR5C 2VIPA 1AD8H 1B0EA 1KDQB 3CS7A 1C2EA 3TVJB 3GISB 4J2YB 1F5LA 2QV1A 2B5TB 4IMZA 2NU3E 2R2MB 4FUJA 1AWFH 3QGNB 1GGDC 1G9IE 1ANEA 2F9NA 5CHAC 2PUQH 4OS1A 1K22H 4I33A 1G2MA 4K1EA 1O2LA 1EP5A 2PGBB 1CHOF 2FOCA 4X8VH 1YCPM 1PPCE 4O3UA 1HAOH 2ZTYA 2OP9A 1VGCB 4CBOA 1XXDA 5K0HA 1ZGVA 1HJ9A 2ZQ2A 5GCHF 1EX3A 3ITIA 1BBRK 4R8TB 1GBEA 2TGAA 1GJ4H 1QA7A 3PM3A 1GHAG 1O5CB 3P95A 2FM2A 2AERH 3ZZ3A 2D1JA 1QRZA 1W0ZU 4AGKA 2GDDA 1Z1IA 1ZYOA 4NGAH 2BDYA 1O2ZA 1P9UA 1SGQE 1GDQA 2AMPA 1GMDG 1O3CA 1PJPA 2GZ9A 3GDVA 4DG4A 1IQNA 4TY7A 1ETSH 2EEKA 4E05H 1GBKA 4DT7B 1GMCF 1Y3UA 3H7TA 2AIQA 4B75A 2VIWA 1CGIE 1BJVA 3NKKA 3AAUA 4ZXXH 3PROA 1GBBA 1GHVH 2SGQE 5F8TA 2J4IA 1BITA 2ZZUH 2QCYA 1SOTA 3LT3A 2ZNKH 3ZYEA 4ZXYH 4U01A 3SNBA 3T62A 5DO4H 4RKOB 4IC6A 1LVMA 3TJNA 3P8GA 1UTPA 2XW9A 2ZC9H 3LJOA 3UWJH 2ZGHA 3NWUA 1V2ST 1NC6A 4X6MA 1EZQA 3SQHE 2FLRH 2DE8A 6GCHG 2BDAA 2PTCE 3PMBB 1YPGH 1H8DH 2Y7ZA 5JBBS 2P16A 1BRBE 1F0UA 4AG2A 1A5IA 3STJA 3D23A 2BQ7B 6CHAB 1INCA 1GI1A 1V2WT 1IQMA 3NXPA 1TYNA 2FLBH 4NIYA 1ELEE 1S0RA 1ABJH 1Z6EA 1SOZA 3UY9A 3VGCB 3QZRA 1RTFB 2JETC 1GBDA 3ZVDA 4A1XA 3EA8A 3SNAA 1UCYE 1TNKA 4JZFH 2BXUH 3P92A 4Y0YE 1BHXF 1N6YA 1KLJH 4Y8YA 1P2MA 1WOFA 1D3TB 2R3UA 3TITA 3V7TA 5DP4A 3FANA 4CRBA 2BD5A 3DHKH 1G3CA 2NU0E 2XRCA 4YT7H 3D62A 2W5EA 2ZQ1A 1KXCA 1UTLM 3VXEH 1GHWH 1K28D 5GCHG 1GL0E 8GCHF 3FP7E 3P70B 3UR6A 1GPZA 1NN6A 3TNTA 3BIUH 5EW2H 3A7YA 3RXEA 1GHBF 1MKWH 5HM9A 3LC3A 3CP7A 4BAOB 3LU9B 1GVLA 1O5EH 5A0BA 6GCHF 2HGTH 1HJ8A 4ZKRU 2G55A 1GBFA 1P0SH 2BLQA 3RMOH 1EZSC 1ESAA 3P8NA 4JZDH 1SLUB 2GCHF 4Y6DA 1S85A 4E06H 1FLEE 1K1PA 2PUXB 3RXFA 2I6SA 3R3GB 4ZMAH 1GJ8B 4DVAU 4B73A 4IS5A 3E0NB 2GKVE 3A8BA 2ZG0H 1C5VA 2FP7B 3MO9A 2BMGB 1SGCA 1NRSH 2AIPA 3M3SA 5J4QA 3SV2H 1AWHB 1JRTA 2WUCA 1GJCB 1EASA 2TRMA 1HIAB 1C1MA 1D4PB 3M36A 3RC5A 2H5CA 1Z8IB 4R0IA 2BM2A 4UFEH 2ZU2A 5ABWA 1DSUA 2ZWLH 1HAZB 1FN8A 2ZF0H 4UFGH 1FIZA 4Y10E 3AAVA 4OS6A 4Y8XA 2Y5FA 1AVWA 4ABDA 2ZDVH 2QF3A 2WUBA 1GHBG 2NWNA 5HM2A 2ZCKP 4WJG2 2V6NA 2A0QB 3JZ2B 2XC4A 1AHTH 2BD9A 1MCTA 2GMTB 3AASA 1KY9A 4U30A 4HGCA 3TNSA 3G01A 3MU0A 1C1TA 3I77A 3HGNA 2Q6DA 3RXGA 1VR1H 1ZLRA 4AG1A 2I6QA 4MPVA 2Y81A 5JDUB 1WTHD 5EU8A 4X6NA 2LNCA 1TMUH 2G5NA 1LHFH 3RU4D 1C2HA 1HUTH 1PYTC 1YC0A 2Z9GA 2H6MA 3FZZA 1S81A 1NY22 3K9XB 3STIA 1ELFA 2F3CE 3RLWH 1DS2E 5EQRA 2R2WU 2ODQA 2QN5T 4JYTA 3Q00A 1TQ7B 2IJOB 2J95A 1RD3B 3RP2A 2BVXH 1J14A 2STAE 1UVSH 1A5HA 1N1LA 3U8OH 5C5NA 1UHBB 1T4UH 1HPGA 4Z0KA 1O3PB 3RXTA 4D9QA 2A4QA 3VPKA 1GBHA 4MPXA 3LOXA 1TMBH 1XUHA 3T27A 3UPEA 5T6FA 4BXSA 1F0TA 2PKAA 4K3JA 4UFDH 5CMXH 1DWCH 3TH3H 1ZRKA 3BTTE 4XBDA 5A8YA 3SW2B 1GBCA 4WY3A 4XDEA