2SGPE

Pro 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b at ph 6.5
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
185
structure length
185
Chain Sequence
ISGGDAIYSSTGRCSLGFNVRSGSTYYFLTAGHCTDGATTWWANSARTTVLGTTSGSSFPNNDYGIVRYTNTTIPKDGTVGGQDITSAANATVGMAVTRRGSTTGTHSGSVTALNATVNYGGGDVVYGMIRTNVCAEPGDSGGPLYSGTRAIGLTSGGSGNCSSGGTTFFQPVTEALSAYGVSVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/inhibitor
molecule keywords PROTEINASE B
publication title Contribution of peptide bonds to inhibitor-protease binding: crystal structures of the turkey ovomucoid third domain backbone variants OMTKY3-Pro18I and OMTKY3-psi[COO]-Leu18I in complex with Streptomyces griseus proteinase B (SGPB) and the structure of the free inhibitor, OMTKY-3-psi[CH2NH2+]-Asp19I
pubmed doi rcsb
source organism Meleagris gallopavo
total genus 49
structure length 185
sequence length 185
ec nomenclature ec 3.4.21.81: Streptogrisin B.
pdb deposition date 1999-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2sgpE02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2sgpE01
2AS9A 2ZIQH 1Y3WA 1NC6A 2CF8H 2P8OB 2ZQ1A 3KF2A 1O2KA 2OLGA 1FNIA 3UWIA 3GCOA 3MU8A 4Y0YE 1G9IE 1SFIA 2GX4A 4PROA 2ZGHA 2PGQB 2ZU2A 1MTNC 3H5CB 5J4QA 1F0RA 4DGJA 1O5FH 3OY6U 1F5RA 5GPIB 1N1LA 1B7XB 4X0WU 1DWBH 2F9PA 5CMXH 1SHHB 3M5OA 1HRTH 5E2OA 1L1JA 3TJVA 3SV6A 4CBNA 2OQ5A 5F03A 5A0CA 2VIQA 2Z3CA 3FP7E 1E36B 2R3YA 2GV7A 1O2PA 5ESBA 4FU7A 3GCHC 5H4IB 3O8RA 1MTUA 1UCYH 1W0YH 1FIZA 1C5RA 1P06A 2FI5E 2PKSC 3A89A 3LGIA 1TWXB 5DP3A 1DLKB 1RJXB 3ENSB 5TCAA 1ZLRA 1ZJKA 5HM2A 3T62A 3CP7A 3TPIZ 1TFXA 2UUYA 1IQFA 1BTXA 2Z9GA 4FUDA 1C5MD 4J1YA 2Y5GA 1EJAA 1DWCH 2OBOA 1YPEH 2BB4A 1QJ1B 1C2IA 1NY22 3K65B 2FS8A 2GKVE 2KAIB 1FUJA 1C1SA 1XUFA 4ASHA 4LZ4B 3S0NA 2IJOB 1VCWA 1JIRA 3AAUA 4JMYA 1A0JA 1LHEH 1AZZA 2BQWB 2A4QA 2ZDNA 3AW0A 3SNEA 5DP7A 4DG4A 4ZKSU 3SI3H 2RG3A 3ZVAA 3VB3A 3ZYEA 5HXFA 1ID5H 1Z1JA 1QA7A 1FY8E 1KLTA 3EYDA 4KGAA 1P3CA 3TNSA 2CHAC 4B71A 3P6ZB 1EASA 1VITG 4YTAA 3TGIE 5F8TA 2FYQA 1TQ0B 1CA8B 4UONA 3LOXA 2PV9B 8GCHG 2O8UA 1GI3A 1VJ9U 1S0QA 3VFEA 3TH3H 1NS3A 2OC1A 3SO3A 2Q6DA 3BG8A 3PO1B 2ESTE 1O2UA 3LH3A 4U32A 1C1RA 2PKSB 1TALA 4Y7BA 2OC7A 1QBNA 5E0HA 1DWDH 4NCYA 2I6SA 1HNEE 4ABAA 1GBFA 1WV7H 2ZTXA 2PKAA 2ZGCA 1G30B 3LPRA 5JBCS 1QA0A 4BXSA 3RXDA 1SGPE 2W3KA 1LHCH 2EEKA 2HNTE 2EA3A 3SI4H 1WQVH 1BBRH 3F6UH 1E0FD 4CH2B 2BX3A 1VZQH 1AUTC 1C1QA 1ZGVA 3KIDU 2RA3A 1GI0A 1KY9A 4INLA 1IQLA 1LMWB 3Q3XA 6CHAC 1GBDA 4Q80A 3EE0B 1ZSLA 1V2MT 2BVSH 1O3KA 1Z8IB 4WMEA 3SORA 1LVMA 1SVPA 1GBIA 1VCPA 1T8OA 1TBZH 4AORA 2Y5HA 1HCGA 1YCPK 1GPZA 2BDYA 1QCPA 2FM2A 4UEHH 4WH6A 4ZXYH 1P8VC 1L4DA 1O2GH 3DFLA 3BF6H 3QZQA 3T25A 3EDXB 1S84A 5JBAS 2ODYB 2DUCA 3DUXH 3OX7U 2WINI 5C67A 4WVPE 3AAVA 1AVXA 3QTVH 3K2UA 2TRMA 3UFAA 3SU6A 1KXEA 3Q3KA 4ZKOU 4JZ1A 1YF4A 3HGNA 3U69H 1P09A 4UFFH 3LGVA 2HPPH 3LGTA 1W10U 1AKSB 1ETTH 1VR1H 2ZU3A 4F49A 3ZZ8A 1HIAB 2QC2A 1QR3E 3O8CA 2AIPA 1TRMA 1NRRH 1HJAC 4ZROA 4B74A 1AWFH 1XKAC 1GHBG 4BTIB 2OXSA 3D65E 5F6MA 4MG3A 1GI4A 1BIOA 1ELVA 3QWCH 2C90B 1SMFE 5F8ZA 4NZLA 1OOKB 3PYHA 1BTUA 1LKBA 5TCCA 2LPRA 9LPRA 3QO6A 1SGEE 2BVRH 2ZHDA 1GBKA 4NFFA 1O2SA 1C5YB 2C8YB 4XBDA 1DX5M 3MNXA 3LH1A 4CRFA 1GJ7B 1KIGH 2Z7FE 4ZHAA 1TNKA 1XUIA 3SNCA 3HKJB 3T2NA 2G51A 3V0XA 2TGPZ 2XNIA 3L6PA 1D3QB 3GY8A 6CHAB 2GCHG 2XCFA 2BM2A 2VU8E 1ELDE 2XC0A 3ODFA 4K69A 1C4U2 1Z6EA 2BX4A 3A7YA 2C8XB 3RXKA 1SOZA 3A7TA 4YM9A 4A92A 2ODQA 1O3PB 1HAPH 4X2WA 2BDHA 1F0UA 1BOQA 4UFDH 1UVPA 1EZQA 4AZ2B 1GDUA 1FMGA 2W7UA 4O3TA 2CGAA 3A86A 3RXFA 1AI8H 1O5CB 2GP9B 5GCHG 2ZC9H 2ZGBH 2AGGX 3SJIA 2AIQA 3A8BA 2ZPQA 1HXFH 1GMCG 1S82A 1AGJA 4D7GA 2BD3A 3KGPA 2XYAA 3RC5A 4AGKA 3C27B 1V3XA 2QCYA 3TGJE 1P2KA 1HJ9A 1A46H 3CS0A 1D6RA 1HJAB 1KSNA 1TGNA 5T3HA 1GL0E 1XXDA 1UTQA 3D49H 2VNTA 2JH5D 2C8ZB 3A8DA 4CRGA 1S6FA 4K1TA 1C2MA 1GDNA 4D9RA 3MO9A 3TH2H 5L2ZH 5LH8A 1ORFA 1GBEA 3RM0H 4YOGA 3KQEA 4ZKRU 2A32A 1P2JA 2O8LA 1QL8A 1BB0B 3M3SA 3RXSA 1NESE 3T26A 1G2MA 3MWIU 2AGIX 1OKXA 3KHVA 2BD2A 2PWXA 3K6YA 1GHXH 1EAXA 4RKJB 1HAHH 1DLEA 1DS2E 2VB0A 4A7IB 2WPHS 3T27A 3TK6A 2O8WA 1AUJA 1CA0C 3RXJA 4UE7H 2A31A 4U2WA 1V2UT 1O3NA 5CHAB 1TRYA 4RSPA 1YPLH 1GJBB 3OU0A 2QAAA 2QV1A 3M5LA 3QX5H 1GBMA 3L3TA 1GHVH 1FY4A 1YPMH 1O32A 1O3AA 2H2ZA 1SGFA 2BTCE 2QF3A 2ZCHP 1GHAF 1J15A 2P3FH 3QLPH 2XWBI 4YOIA 1GBAA 2OC0A 2Q6FA 3MMGA 3U1JB 3MI4A 2GDEH 2VIVA 2BOKA 3Q76A 3GOVB 4Y10E 4AYVB 4AYYB 2C3SA 2HWLB 3MFJA 1QBOA 2BY6X 3FANA 1V2QT 3TJNA 1YC0A 4MPUA 1C2EA 3PLKA 4H4FA 2A4OA 4X2YA 2HNTC 2Y7ZA 1GI2A 2GT8A 3MTYA 2PR3A 2OINA 2ZI2H 3RXLA 1ZMLA 1VITH 1IQKA 6LPRA 1C2GA 1BTHH 1O3BA 1Z7KA 3IITA 9ESTA 1P57B 1QJ6B 3NXPA 5JPMH 5FPSA 3I29A 1ZMJA 2P3TB 1OWHA 4CRCA 1LQDB 1DT2A 1O2RA 2G4UA 3UR6A 2PSXA 2BVXH 3QZRA 1JIMA 3GY5A 1FXYA 3VGCB 3SV9A 3F9GA 1IQEA 1GGDC 3K6ZA 1TNIA 3LJOA 2FX4A 1C5LH 2ZFSA 5C5NA 3PWCA 1MU6B 1RGQA 3BTME 4LXBH 4D7FA 4SGAE 1AKSA 1A4WH 1IQNA 2QA9E 2Z3EA 3GICB 1CBWC 3O8BA 4X8VH 1N8OC 5AHGH 1QRZA 4ZHMU 2BZ6H 1GHYH 4Y8YA 4B73A 3SN8A 1KLIH 1GI7B 1P2QA 3MU4A 1DUEA 5J4SA 1Z71A 2GDDA 3EA7A 1IHTH 2FOAA 1GJAB 1QJ7B 2BXUH 1UMAH 1VITF 1IHSH 4JZFH 2UWOA 4MDSA 1WTGH 1XVMA 5FBIA 2STBE 2FMJA 2WV5A 1O0DH 8GCHF 2ZO3H 3SNAA 2LNCA 2FTMA 1MAXA 1D4PB 4ABGA 3BTWE 1MU8B 1LVBA 4WXVA 1ELFA 1GCDA 3U8RH 2F91A 4FUFA 1BHXF 3ZZAA 1TBQH 1BRBE 4Y0ZE 2G4TA 5A09A 1FY1A 5K7RA 1UHBB 4OS7A 5T6FA 4ABDA 1EOLA 2Z9IA 1EX3A 1FV9A 1W7XH 5AVDA 3D62A 3F1SB 1NFYA 1UCYE 2NU4E 3UTUH 4M7GA 4A6LA 2ZTYA 1O2VA 2ODPA 3MO3A 1K22H 3RM2H 5FBEA 1DPOA 2CJIA 2SNVA 2GV6A 5DG6A 1V2NT 2ZZUH 4THNH 1AZ8A 1HAYB 1EATA 1F5LA 1RS0A 1KXBA 3HPTB 1TMUH 1CGIE 3KNXA 4GAWA 2I6QA 3P17H 1P2NA 1YPHC 4NA7A 1SBWA 1C1NA 1GJCB 1HAVB 2EI6A 3KQDA 3MU5A 1CBWB 4OS6A 4IC5A 4OS2A 5E8EH 4FVDA 1A0HB 2P8OC 1TPOA 5JB9S 1THPB 3UREA 4NZQA 1F0SA 1AIXH 1DM4B 1NTPA 1SSXA 2B7DH 1AMHA 4AN7A 4I8LA 4UFEH 1TPSA 2FDAA 4GSOA 1BTZA 2D8WA 5HYOA 5EU8A 1BRUP 2PTNA 3BTKE 3M5MA 1TQ7B 2G00A 3GISB 3BEUA 2HPQH 1SGDE 4INKA 3TITA 2F3CE 1D3DB 3FP8E 3TK9A 1GHBF 2P94A 4O97A 4O03A 1DFPA 3F9HA 4TY6A 3FFGA 1O3HA 1HV7A 3LC3A 1GMDG 4MVNA 1SGQE 1S6HA 5HM9A 3UWJH 2FO9A 1T4UH 2VWLA 1ABIH 2AFQB 1ELAA 1PQ5A 2V3OH 3ELAH 2A0QB 1W7GH 2FS9A 3QGJA 1A1RA 2O9QA 2DE9A 3LONA 2VWOA 1YKTA 1TGBA 2ZPRA 2FESH 1SGYE 1WYKA 3UQOA 3U1IB 1N6YA 3RUOA 1V2ST 1SLXB 2G52A 1BHXB 1P10A 3BIVH 1V6DA 1BBRE 2PGBB 1P11E 1WAYB 1YYY1 3SV7A 3E91A 5LPRA 5L2YH 4X6OA 1K1OA 3SV8A 1NRPH 1GI6A 3E16B 3GY3A 1QL7A 2J34A 3E3TA 3ZVFA 2JH0D 1NFXA 1WBGB 1OPHB 1GHAG 1BTWA 5GCHF 1GBJA 1D3PB 3STJA 2PUXB 1OX1A 3SNBA 1BMNH 1YGCH 5DP8A 2R9PA 1GMCF 2TPIZ 2WYGA 4U30A 1F7ZA 1UTJA 2ASUB 1GHZA 3P8OA 3M7TA 4KTSA 3KN2A 2ZA5A 3QN7A 5A8YA 4ABEA 5DP6A 3BTEE 3ZV9A 1S5SA 1MAYA 5DP4A 3ZZ7A 2XWAA 1L1NA 2FLRH 1PPZA 1Z8JB 2P16A 2YNBA 1NU7B 1BITA 1EOJA 1KXFA 2QN5T 5EQRA 3SU1A 2W26A 1NRQH 2R3UA 5GJ4B 3MNCA 3PO1C 4GLYA 1UTMA 3SGQE 3B23B 1O3JA 4IC6A 3MH5A 1O3IA 3RXHA 2J38A 4CH8B 1RD3B 1PPFE 3MU1A 2FWWA 1UTLM 1WTHD 4NIYA 2OP9A 4X1PU 1X7AC 4MNYA 2Z3DA 3V12A 2A5KA 1O2MA 1MQ6A 4ABFA 1ESAA 3BTGE 5GWZA 1AN1E 5GXPA 3M61U 4Y71A 1C1PA 1HB0B 1UCYK 1C1WH 5LPEA 4D76A 1ESBA 2UUJB 1GJ6A 4ISHH 3MH4A 2PUQH 1MD8A 1LTOA 3LU9B 4MTBA 2FI4E 1P0SH 2GMTB 1KYNA 1BDAA 2IPHA 2F9VA 3S7HB 1XM1A 5EOKA 1QTFA 1FI8A 3VB6A 2WPMS 4B2CA 1HXEH 2D1JA 3ZV8A 1UTOA 1TNLA 4K1SA 1K1PA 1CSOE 1QBVH 3UQVA 3M7QA 4AOQA 3ATKA 1GI1A 2CV3A 1BQYA 1ZHRA 3A83A 1FIWA 1G37A 3FZZA 2NWNA 1T7CA 3CS7A 3PM3A 1CO7E 1XUGA 1LVOA 1EP6A 3ODDA 5T6DA 4K1EA 1C5PA 3EA9A 4X8UH 3A85A 3NK8A 4CR5A 2ZGJA 4I8KA 4X6NA 2BOHB 3RXTA 3M7UA 2TGTA 1S83A 1GBCA 4X2VA 1SGCA 1GVLA 1V2LT 3GDUA 3S9CA 2BD4A 1NU9A 2V6NA 1LCYA 2IOTA 2BMGB 1AVWA 3LC5A 3A80A 3PROA 2XBWA 2J95A 3LGUA 4ZAEA 2XCNA 3ATIA 5SGAE 1A61H 5AFYH 3GDSA 2A2QH 1C1VH 2SGQE 5I46H 2G81E 1O2WA 1BTYA 5EPYA 4D8NA 1P2OA 1OWEA 1GBHA 3LKWA 1XMNB 2ZFQH 4MPWA 4IMQA 4BXWA 1AWHB 1LPZB 2VJ1A 2B5TB 1GL1A 1O3MA 3ZVDA 4X1SU 3RU4T 4CHAC 2THFB 3UNSA 1UK4A 2W3IA 1MH0A 1T32A 1DITH 3S9AA 3SNDA 1SB1H 2PW8H 2FOHA 2H6MA 1AE5A 1O39A 3ATWA 3VB4A 4MPXA 2NU3E 1VCQA 1K2I1 3GDVA 1BBRK 3SJOA 1O30A 1RRKA 5EXMA 1ELEE 1TGSZ 3K9XB 5AF9H 2WUBA 1K1MA 4LOYH 1C4Y2 2FOBA 3HATH 1P03A 4FXGH 1GBBA 4TWYA 4CR9A 1TIOA 2BQ7B 3HGPA 1G3BA 1EAUA 3Q3YA 1O2LA 1MCVA 3M3VA 1FONA 1G3DA 2QXHA 3BSQA 2QIQA 2BLQA 1HAZB 4AGJA 1SI5H 2BDIA 4KP0A 4Q2KA 5ESTE 1A0LA 4TYDA 1P3EA 1ANBA 3MU0A 5DP5A 3NWUA 5JBTA 1V2TT 1O5EH 2G5VA 4MNWA 3BTFE 1O5DH 1BUIA 1O2XA 4BAMB 4K5ZA 2GT7A 1UK3A 3ZZ4A 3A7ZA 1JOUB 1SC8U 3RP2A 1TAWA 3A8AA 7KMEH 2B8OH 4B1TA 3GYLB 3C1KA 3UUZA 1OYTH 4CHAB 3UY9A 2ANWA 5DGJA 1G2LA 4AFUA 3UIRA 3T5FH 1QRWA 1C2KA 5CHAC 1J9CH 1KXAA 1O5GH 1VJAU 2W7SA 4IBLH 1NFUA 2RCEA 1CGHA 8LPRA 3WY8A 2SGFE 1C5WB 1YPHE 4I33A 4CRDA 3U8OH 1QFKH 4NWKA 2BD5A 1T31A 4ABIA 2ZNKH 4GPGA 3MH6A 1QQUA 4BANB 1XKBC 5FPYA 1GMHF 1OWDA 1JMOH 1IOEA 1TX7A 1CVWH 1EAIA 1A5HA 2C93B 4X8TH 4I31A 1QNJA 1EZUC 2ZCKP 4SGBE 4JK5A 2H5DA 1W2KH 1RIWC 2AYWA 1TBRH 2R2WU 1ZHMA 2GTBA 3QDZB 1YPKH 3PTBA 1OXGA 5ABWA 1GMDF 2A1DB 1C1MA 1C5QA 1TA2A 1HYLA 2RDLA 1S0RA 1O2QA 5AFZH 1ZPCA 1OP2A 1W14U 4B75A 3A82A 1H8DH 3SUDA 7ESTE 3SJ9A 2KAIA 3VXFH 1C1OA 1AU8A 2XBXA 3P95A 3RU4D 2P3UB 2AH4X 5DPAA 4CBOA 1D3TB 1T8NA 2ZDAH 1LPGB 1TRNA 4X8SH 3GY4A 1RTFB 1B0EA 1PQ7A 3B8JA 3VGCC 5E0JA 5FAHA 1ETRH 1O2TA 1SR5C 1ZR0A 1IQIA 1QGFA 1B5GH 1SPJA 2H5CA 3TU7H 1EP5A 1DWEH 1O2HA 3TVJB 1GCTB 1DUAA 1EAWA 3D23A 1MZDA 2VIPA 4J2YB 2HVXA 2C4FH 2ZP0H 4NIXA 3KL6A 3GYMA 1HLTH 1C1UH 1ZSKA 1PPBH 2BY8X 1P05A 1NFWA 2K1QA 1ZTJA 1QURH 1HGTH 1QIXB 2Y82A 3SW2B 1ELTA 3E90B 4WF8A 1O5AB 1Q31A 1WOFA 2Y7XA 4NIWA 1GBLA 2SNWA 4NIVA 3G01A 1PPCE 1RIWB 2Y80A 3URDA 4AG2A 5C1XA 3P92A 1SLWB 2ZU5A 3TNTA 1DXWA 3SZNA 4TPYA 3JZ2B 3UPEA 3RXCA 5EXNA 1ACBE 1TGTA 3SUFA 3GCNA 4F4OC 3O8DA 1ARCA 1EJNA 2FODA 3AASA 2JH6D 4Q7XA 2AMDA 1ZSJA 1EKBB 4FUBA 3VB5A 4HGCA 3E1XB 2WYJA 1CQQA 1O35A 4WH8A 3T28A 1MKXH 5A0AE 1D9IA 2FOCA 1UVUH 2V35A 3JZ1B 1CT4E 4JYTA 1IQGA 4NSYA 1BCUH 1F92A 1KXCA 2XRCA 1U6QA 5PTPA 2B9LA 1O3FA 3SJKA 4YT6H 4K3JA 1P9SA 1O2YA 2VGCC 4OS1A 3SU2A 4AB9A 2Z9JA 4NWLA 1C5VA 3F9FA 1P04A 2AGEX 1L1GA 1AO5A 2FOMB 2QXGA 3HK3B 3LGYA 4R8TB 1EQ9A 1S81A 1FPCH 1CHOF 1HIAA 1LDTT 1MKWH 1WQSA 1TPAE 2ZPSA 3URCA 2DE8A 4KELA 1EZXC 2IN2A 1A2CH 1LKAA 4K8BA 5LPFA 2ZFFH 1YM0A 3M37A 2EC9H 7LPRA 1ARBA 1B0FA 4NA9H 2CMYA 3RU4E 2ZU4A 1O36A 2NU2E 4OS5A 1H4WA 2ALVA 3RDZA 3BTQE 4WY3A 1UJ1A 4I8JA 3SU3A 1K28D 2TBSA 3DT0H 1OSSA 1FJSA 5EXLA 1GI9B 1KDQB 1GJ8B 1O3DA 3SHAH 5A0BA 4E05H 1MKWK 5B6OA 1DANH 2VVUA 2Z9KA 4DVAU 4X6PA 5IDKA 4ESTE 2ULLA 3M5NA 1W13U 5DK1A 2A5AA 3GY7A 1FAKH 4BOHA 2ZFTA 1YBWA 2TGAA 5TJXA 1M9UA 1OS8A 3S9BA 1TPPA 5HMAA 1G3EA 1UVOA 1KXDA 4JYUH 2ZKSA 2VGCB 2Z6BD 3SBKA 4XBCA 1TNHA 4I32A 3M3TA 3GY6A 1C2FA 2UWLA 2BZAA 1ZZZA 2QYIA 1DOJA 1BMLA 2PLXA 1YLDA 4MNVA 3AVZA 3P8GA 2PKAB 3RXIA 1MMJN 2HRVA 1PYTC 3BG4C 1SGNE 4JYVH 2FP7B 5FPTA 1LHFH 3PLPA 2OC8A 1L0ZA 1NM6A 1WUNH 1L2EA 3EA8A 1MCTA 1F0TA 2SGAA 1A5IA 2VWMA 2ZTZA 2G5NA 1GJDB 2RA0A 1GMHG 3MNBA 2AEIH 2R0KA 3LDXH 4XFQA 2VWNA 3SUGA 1O3CA 1QRXA 3KEEA 2Y81A 2F9BH 1AFQC 1MTSA 2BLWA 1C1TA 2GZ8A 2ANYA 3H7TA 1YPJH 4Y11E 2OQUA 4ISOA 1TLDA 2ZHFH 1NROH 1PFXC 5K0HA 5EW2H 3V3MA 5EG4A 4AFQA 2SFAA 4NA8A 1UVTH 2ILNA 1RXPA 1AD8H 2OUAA 3VXEH 4YT7H 1N6XA 5C1YA 4O9VA 1PQAA 1SLVB 2VVCA 4LK4A 1F5KU 1QL9A 2UUFB 1HBTH 1QB1A 3MOCA 6GCHF 1C5ZB 1HUTH 1ZPZA 1JRTA 2WPLS 2TIOA 1OP0A 2VIOA 4A1VA 4TY7A 1SGRE 3OY5U 1VGCB 3R3GB 2QGRA 3A7XA 4UDWH 3ZVGA 4B76A 3V13A 3BG4B 2ALPA 2GD4B 2GMTC 3A8CA 2JKHA 2XTTB 5C1UA 4X2XA 3RXOA 1H9IE 1JRSA 2ZHWH 4K2YA 3UNRA 3I77A 1QQ4A 1F2SE 3BTHE 3ZVBA 2J9NA 1P12E 1SG8B 1V2WT 1W12U 8KME2 3BTDE 1Y59T 1HDTH 3Q77A 3OYPA 2FPZA 4Z6AH 5FHTA 1P02A 3LIWA 1O33A 3M35A 3DHKH 1C5XB 1KLJH 1AFQB 3MH7A 3ZVEA 2ZDVH 1YLCA 1INCA 5EODA 2HOBA 3TLOA 4MLFB 4FUHA 2VH0A 2FOGA 4Y6DA 3RMNH 5C5OA 1IQJA 2ZFPH 1C5SA 4XOJA 1C4V2 3BN9A 3UNQA 1W3CA 3U9AH 1OWIA 3MHWU 1JBUH 3PMBB 5G4BA 1NPMA 3A87A 1TMTH 3N7OA 4FU9A 3RLWH 1TABE 1BT7A 1GWAA 3LJJA 1K1LA 5JBBS 3RXMA 1Y3YA 4ZXXH 1ZTKA 4ISLA 8ESTE 1ETSH 2A4RA 4XE4A 4ZUHA 3EAJA 4IN1A 3PB1E 3SUEA 4CREA 4X1NU 2VH6A 3SGAE 2J92A 2OCVB 3E6PH 2F9OA 2AMPA 1EPTC 3RXAA 2WUCA 3QGNB 3NCLA 1PPHE 5A8XA 1C9PA 3RMMH 2BY9X 1CHOG 3STIA 2BD8A 4Y79A 1K1IA 4MPVA 2QF0A 3SQHE 1O2JA 1SLUB 4JCNA 2XXLA 1JWTA 2ZDMA 3T29A 4OS4A 1RFNA 1P2IA 1KDQA 4U01A 2VIDA 3BTTE 4JK6A 3DA9B 5L30H 1J8AA 1G3CA 3RXBA 1CT0E 3OTJE 2QXIA 4B2BA 2ZCLP 1MTNB 2PFEA 1XUKA 1P9UA 1UHBA 4IMZA 5FXLA 1MTVA 1QB9A 3FVFB 2WPJS 4DY7B 1V2KT 2ZFRH 1SOTA 3SHCH 2Y6TA 4DCDA 5EPNA 1TX8A 3TIUA 2UUKB 4DJZB 4X1QU 1UVSH 3GCHB 4K60A 1ABJH 2GCTC 3QTOH 1PYTD 1ZRKA 3E0PB 1W8BH 5ETXA 4XDEA 1SL3A 2WV4A 4Y7AA 2P93A 1Y3UA 1HAVA 1YCPH 4GCHF 4CRAA 1XUHA 2GGVB 3DD2H 4ISNA 1PPGE 2FLBH 2ZHEH 1TA6A 2QXJA 2B0FA 3LGWA 4FUJA 1TB6H 1MUEB 2FXRA 3SU5A 1SFQB 1ZOMA 1EPTB 1MTWA 1L4ZA 2VVVA 3L33A 4JZEH 5L6NH 4YZUA 3PV4A 1UTKA 4ABBA 5A2MH 4X1RU 1BMAA 1BRAA 4JZDH 5E0GA 3Q00A 1LHDH 3UR9A 1FLEE 3MYWA 4B2AA 1LHGH 1DE7H 2TGDA 1BZXE 1WSSH 2A45B 5EQSA 4GHQA 1Q3XA 1THRH 2XBVA 4UFGH 3PMAB 5FX6A 1HAOH 2D26C 1CGJE 4DOQA 2Z94A 1DVAH 4A1TA 1GJ5H 4WMDA 4DIIH 4MNXA 3ZYDA 1XX9A 1E34B 3GCTF 1O34A 3ZZ9A 2H9EH 1MZAA 4LZ1H 3RXRA 2ANMH 1ANCA 4RN6A 2CHAB 1UTNA 1TOMH 4I8GA 1Q2WA 2FEQH 3F68H 2GZ7A 4H6TA 3U8TH 4VGCC 3QK1A 1GG6C 5T6GA 4O3UA 3P8FA 4Q7ZA 1FPHH 2GCTB 1DDJA 2JETC 4I7YH 1KTTB 2J94A 3ITIA 5DKMA 2SGEE 4MQAA 1LQEA 1Y5UT 6GCHG 3ZZ6A 1V2RT 2F83A 5DJ7A 3TJOA 4BAQB 1ANDA 1FN6A 3BEIB 3NPSA 1FY5A 1HFDA 1T4VH 4HFPB 1PQ8A 3A7WA 2OBQA 3SV2H 4GUXA 4KTUA 2XBYA 1TMBH 5HGGA 3RMOH 1O2IA 2FZZA 1TOCB 2A2XH 1A3BH 4K8YA 2XC5A 1HAXB 4OGXA 1Z8RA 2EI7A 3A7VA 1LO6A 2HLCA 3VPKA 4E7RG 2FOEA 1GCTC 1T8MA 1DY9A 3RC4A 1XVOA 3RLYH 3DFJA 1LPKB 1QB6A 2CN0H 3P8NA 4BTTB 4INHA 1AQ7A 2FOFA 2OTVA 1CT2E 1C5NH 4Y8ZA 4ABJA 1SGFG 3TK5A 4WMFA 2BDAA 7GCHF 4YOJA 5C20A 4JZIA 1E37B 4CRBA 1QHRB 2ZHQH 3H7OA 1WU1A 1EB2A 4QT8C 1NN6A 2H9HA 2WPKS 1A7SA 1HJ8A 4AB8A 2Y5FA 2F9UA 5IYTA 1ZRBA 2ZF0H 2FTLE 4VGCB 1EUFA 1JXPA 1O2NA 2YNAA 1GG6B 4BAHB 1V2VT 1J17T 1Z1IA 4ZMAH 2JETB 3ZZCA 3PWBA 1P01A 1H1BA 5EGMA 1GVZA 2BHGA 3UOPA 1ESTA 2WPIS 1TNJA 1PJPA 3BEFB 3OSYA 4IS5A 2VINA 4DW2U 1T8LA 1Y5BT 3AW1A 4FVBA 5GDSH 2YOLA 1IQHA 1ZGIA 3TH4H 1SQAA 3PMHB 1EXFA 4WWYA 2SGPE 1C2HA 1OP8A 2CXVA 3FZDA 2PTCE 3MNSA 3M36A 4TPIZ 1P2MA 1YCPM 2A5IA 4NFEA 2M5TA 1D6WA 1V2PT 2STAE 1GDQA 4AFSA 2BD7A 1A5GH 1E38B 6ESTA 2ZQ2A 1O2ZA 2ZDKA 4BNRA 1ELCA 1YPGH 1AVGH 2G55A 2ZWLH 3RXGA 3R0FA 4RKOB 1ZYOA 2ZEBA 1OYQA 1J14A 1TX6A 1THSH 4HI3A 1AY6H 1HAIH 1UTPA 5F8XA 1W0ZU 2AERH 2FYRA 3SQEE 3RXEA 1LVYA 2FI3E 1BTPA 3LT3A 4Y8XA 3B9FH 5JYIA 3CENA 2XC4A 3SU0A 3QUMP 3NKKA 3VB7A 2ZECA 1V2JT 1C2JA 1O3LA 3ZZDA 5A8ZA 3TJUA 1RTKA 2HNTF 1TYNA 2VIWA 4GHTA 4DURA 1O38A 2BQ6B 3HK6B 4Y76A 1C5OH 1GI5A 1HAGE 4YLQH 3PMJA 1NZQH 2Z9LA 1ZJDA 1DXPA 2NU0E 3KQBA 4A5TS 3A88A 1XXFA 3BV9B 1E35B 1Y3XA 3FAOA 3V7TA 4ZHLU 1EPTA 3FP6E 1C2LA 1SGIB 3W94A 2PHBA 1ELBA 5E2PA 1Z8GA 1FZZA 4GCHG 4ABHA 1ANEA 3ATLA 1K9OE 2ANKH 3NUMA 1GI8B 2R0LA 3SJ8A 2O8MA 2UWPA 4YLUA 4HTCH 4I8HA 2BD9A 2BY7X 2SGDE 3EGKH 2NU1E 1OWJA 3S69A 1EB1H 3TGKE 3ESTA 3ZZ3A 1SGTA 3P70B 1A3EH 1CA0B 1MKXK 3KQCA 1MQ5A 4H6SB 5GIBA 1NRSH 3RXVA 3VEQB 2ZDLA 1FN8A 1C9TA 4FUIA 4UD9H 1DY8A 4D9QA 1H8IH 4OGYA 1BJUA 2V0BA 1EJMA 1C5UA 2G8TA 1ZTLA 3SGBE 1O31A 1RTLA 1H9LB 1O37A 2F9NA 3RC6A 1NO9H 1CE5A 5C2ZA 4H42U 3GCTG 2J4IA 5LGOA 1CHGA 2HGTH 3ZZBA 1MBQA 1XUJA 1G32B 1TE0A 2ZU1A 1O2OA 1SHYA 2W5EA 4BAOB 1CU1A 2A4GA 3HKIB 4AX9H 3RXUA 1QY6A 5FCRA 4KKDA 4FU8A 4NGAH 1GVKB 1G36A 1K1NA 1NT1A 2BLOA 2C8WB 3RMLH 1TGCA 1AHTH 3E0NB 2GVFA 3A81A 2BDGA 2H1UA 3SU4A 4A1XA 1W11U 1O3EA 1NRNH 3PLBA 5I25A 5DO4H 3BIUH 1PPEE 5JB8S 4E06H 4HZHA 5FCKA 1UO6A 1V2OT 4IW4E 4Q7YA 3ZVCA 2QY0B 2ZG0H 1VGCC 3S7KB 1FQ3A 1Y3VA 2A7JA 2BYAX 3A84A 1FY3A 2BDCA 1ZMNA 1EZSC 2P95A 1K21H 3NZIA 1O3OA 2D2DA 4NG9H 1SQOA 4IGDA 5EQQA 1GGDB 1GJ4H 2V3HH 2GZ9A 1AB9C 1GHWH 5JDUB 3W95A 1WCZA 1BMMH 3MO6A 1TNGA 1O3GA 5FX5A 1AE8H 1C5TA 3SOSA 4X6MA 7GCHG 1Z6JH 4KTCA 4ZKNU 1K1JA 1N8OB 5EW1H 1C2DA 4WJG2 4GVUA 1BJVA 1GJ9B 1SQTA 2J2UA 3RXPA 3I78A 3ATMA 1UK2A 4AG1A 2A7HA 2FX6A 4XBBA 1ELGA 5C3NA 3E8LA 4Z0KA 4ZH8A 2EI8A 2O8TA 1TONA 1HPGA 1DSUA 3GY2A 5DP9A 1OWKA 1DSTA 3IWMA 4BAKB 3EQ0H 4BTUB 4WXIA 1MD7A 4AFZA 4TWWA 2A7CA 2OD3B 2BY5X 1DICA 2P59A 2FIRH 2H9TH 1FAXA 2XW9A 3F9EA 3RXQA 4R0IA 1AFEH 2BDBA 1S85A 5BRRE 1Y5AT 2AMQA 3ZZ5A 2HALA 2Q1JA 3PTNA 1FDPA 4E7NA 2ZGXH 4NSVA 1IAUA 2PSYA 4DT7B 4IN2A 1IQMA 1ZPBA 4DIHH 5BPEA 1J16A 1Y8TA 2BXTH 3U98H 4FUGA 5CE1A 1YP9A 2GCHF 3UOUA 1H9HE 1BRCE 2R2MB 2BLVA 1BA8B 1AB9B 3KCGH 2CF9H 3IG6B 1KTSB 4ISIH 4YESB 1ZHPA 4FUCA 4FUEA 4YO9A 1O5BB 2Q6GA 1MBMA 1GBTA 4XSKU
chains in the Genus database with same CATH superfamily
2AS9A 2ZIQH 1Y3WA 1NC6A 2CF8H 2P8OB 2ZQ1A 3KF2A 1O2KA 2OLGA 1FNIA 3UWIA 3GCOA 3MU8A 4Y0YE 1G9IE 1SFIA 2GX4A 4PROA 2ZGHA 2PGQB 2ZU2A 1E79D 1MTNC 3H5CB 5J4QA 1F0RA 4DGJA 1O5FH 3OY6U 1F5RA 5GPIB 1N1LA 1B7XB 4X0WU 1DWBH 2F9PA 5CMXH 1SHHB 3M5OA 1HRTH 5E2OA 1WDIA 1L1JA 3TJVA 3SV6A 4CBNA 2OQ5A 5F03A 5A0CA 2VIQA 2Z3CA 3FP7E 1E36B 2R3YA 2GV7A 1O2PA 5ESBA 4FU7A 3GCHC 5H4IB 3O8RA 1MTUA 1UCYH 1W0YH 1FIZA 2QF5A 1C5RA 1P06A 2FI5E 2PKSC 3A89A 3LGIA 1TWXB 5DP3A 1DLKB 1RJXB 3ENSB 5TCAA 1ZLRA 1ZJKA 5HM2A 3T62A 3CP7A 3TPIZ 1TFXA 2UUYA 1IQFA 1BTXA 2GJGA 2Z9GA 4FUDA 1C5MD 4J1YA 2Y5GA 1EJAA 2PP6A 1DWCH 2OBOA 1YPEH 2BB4A 1QJ1B 1C2IA 1NY22 3K65B 2FS8A 2GKVE 2K8IA 2KAIB 1FUJA 1C1SA 1NBME 1XUFA 4ASHA 4LZ4B 3S0NA 2IJOB 1VCWA 1JIRA 3AAUA 4JMYA 1A0JA 1LHEH 1AZZA 2BQWB 2A4QA 2ZDNA 3AW0A 3SNEA 5DP7A 4DG4A 4ZKSU 3SI3H 2RG3A 3ZVAA 3VB3A 3ZYEA 5HXFA 1ID5H 1Z1JA 1QA7A 1FY8E 1KLTA 3EYDA 4KGAA 1P3CA 3TNSA 4RT1A 2CHAC 4B71A 3P6ZB 1EASA 1VITG 4YTAA 3TGIE 5F8TA 2FYQA 1TQ0B 1CA8B 4UONA 3LOXA 2PV9B 8GCHG 2O8UA 1GI3A 1VJ9U 1S0QA 3VFEA 3TH3H 1NS3A 2OC1A 3SO3A 2Q6DA 3BG8A 3PO1B 2ESTE 1O2UA 3LH3A 4U32A 1C1RA 2PKSB 1TALA 4Y7BA 2OC7A 1QBNA 5E0HA 1DWDH 4NCYA 2I6SA 1HNEE 4ABAA 1GBFA 1WV7H 2ZTXA 2PKAA 2ZGCA 1G30B 3LPRA 5JBCS 1QA0A 4BXSA 3RXDA 1SGPE 2W3KA 1LHCH 3U28C 2EEKA 2HNTE 2EA3A 3SI4H 1WQVH 4DT4A 1BBRH 3F6UH 1E0FD 4CH2B 2BX3A 1VZQH 1AUTC 1C1QA 1ZGVA 3KIDU 2RA3A 1GI0A 4XD7D 1KY9A 4INLA 1IQLA 1LMWB 3Q3XA 6CHAC 1GBDA 4Q80A 3EE0B 1ZSLA 1V2MT 2BVSH 1O3KA 1Z8IB 4WMEA 3SORA 1LVMA 1SVPA 1GBIA 1H8HD 1VCPA 1T8OA 1TBZH 4AORA 2Y5HA 1HCGA 1YCPK 1GPZA 2BDYA 1QCPA 2FM2A 4UEHH 4WH6A 4ZXYH 1P8VC 1L4DA 2VBCA 3UAIC 1O2GH 3DFLA 3BF6H 3QZQA 3T25A 3EDXB 1S84A 5JBAS 3WWBA 2ODYB 2DUCA 3DUXH 3OX7U 2WINI 5C67A 4WVPE 3AAVA 1AVXA 3QTVH 3K2UA 2TRMA 3UFAA 3SU6A 1KXEA 3Q3KA 4ZKOU 4JZ1A 1YF4A 3HGNA 3U69H 1P09A 4UFFH 3LGVA 2HPPH 3LGTA 1W10U 1AKSB 1ETTH 1VR1H 2ZU3A 4F49A 3ZZ8A 1HIAB 2QC2A 2RDEA 1QR3E 3O8CA 2AIPA 1TRMA 1NRRH 1HJAC 4ZROA 4B74A 1AWFH 1XKAC 1GHBG 4BTIB 2OXSA 3D65E 5F6MA 2KZ4A 1GI4A 1BIOA 4MG3A 1ELVA 3QWCH 2C90B 1SMFE 5F8ZA 4NZLA 1OOKB 3PYHA 1BTUA 1LKBA 5TCCA 2LPRA 9LPRA 3QO6A 1SGEE 2BVRH 2ZHDA 1GBKA 4NFFA 1O2SA 1C5YB 2C8YB 4XBDA 1DX5M 3MNXA 3LH1A 2J98B 4CRFA 1GJ7B 1KIGH 2Z7FE 4ZHAA 1TNKA 1XUIA 3SNCA 3HKJB 3T2NA 2G51A 3V0XA 2TGPZ 2XNIA 3L6PA 1D3QB 3GY8A 6CHAB 2GCHG 2XCFA 2BM2A 2VU8E 1ELDE 2XC0A 3H09A 3ODFA 4K69A 1C4U2 1Z6EA 2BX4A 3A7YA 2C8XB 3RXKA 1YLNA 1SOZA 3A7TA 4YM9A 4A92A 2ODQA 1O3PB 5IK2D 1HAPH 4X2WA 2BDHA 1F0UA 1BOQA 4UFDH 1UVPA 1EZQA 3GS9A 4AZ2B 1GDUA 3OFND 1FMGA 2W7UA 4O3TA 2CGAA 3A86A 3RXFA 1AI8H 1O5CB 2GP9B 5GCHG 2ZC9H 2ZGBH 2AGGX 3SJIA 2AIQA 3A8BA 2ZPQA 1HXFH 1GMCG 1S82A 1AGJA 4D7GA 2BD3A 3KGPA 2K0QA 2XYAA 3RC5A 4AGKA 3C27B 1V3XA 2QCYA 3TGJE 1P2KA 1HJ9A 1A46H 3CS0A 1D6RA 1HJAB 1KSNA 1TGNA 5T3HA 1GL0E 1XXDA 1UTQA 3D49H 2VNTA 2JH5D 2C8ZB 3A8DA 4CRGA 5EIYA 1S6FA 4K1TA 1C2MA 1GDNA 4D9RA 3MO9A 3TH2H 5L2ZH 5LH8A 1ORFA 1GBEA 3RM0H 3VG8A 4FOUC 3KQEA 4YOGA 4ZKRU 2A32A 1P2JA 2O8LA 1QL8A 1BB0B 3M3SA 3RXSA 1NESE 3T26A 1G2MA 3MWIU 2AGIX 1OKXA 3KHVA 2BD2A 2PWXA 3K6YA 1GHXH 1EAXA 4RKJB 1HAHH 1DLEA 1DS2E 2VB0A 4A7IB 3OEHD 2WPHS 3T27A 1KMHB 3TK6A 2O8WA 1AUJA 1CA0C 3RXJA 4UE7H 2A31A 4U2WA 1V2UT 2KCPA 1O3NA 5CHAB 1TRYA 4RSPA 1YPLH 1GJBB 3OU0A 2QAAA 2LELA 2QV1A 3M5LA 3QX5H 1GBMA 3L3TA 1GHVH 1FY4A 1YPMH 1O32A 1O3AA 2H2ZA 1SGFA 2BTCE 2QF3A 2ZCHP 1GHAF 1J15A 2P3FH 2JDID 3QLPH 1E1RD 2XWBI 4YOIA 4TSFD 1GBAA 2OC0A 2Q6FA 3MMGA 3U1JB 3MI4A 2GDEH 4Q4LA 2VIVA 2BOKA 3Q76A 3GOVB 4Y10E 4AYVB 4AYYB 2C3SA 2HWLB 3MFJA 1QBOA 2BY6X 3FANA 1V2QT 3TJNA 1YC0A 4MPUA 1C2EA 3PLKA 4H4FA 2A4OA 4X2YA 2HNTC 2Y7ZA 1GI2A 2GT8A 3MTYA 2PR3A 3W1EA 2OINA 2ZI2H 3RXLA 1ZMLA 1VITH 1IQKA 6LPRA 1C2GA 5B6LA 1BTHH 1O3BA 1Z7KA 3IITA 9ESTA 1P57B 1QJ6B 3NXPA 5JPMH 5FPSA 5KECA 3I29A 1ZMJA 1OWHA 2P3TB 4CRCA 1LQDB 1DT2A 1O2RA 2G4UA 3UR6A 2PSXA 2BVXH 3QZRA 1JIMA 3GY5A 1FXYA 3VGCB 3SV9A 3F9GA 1IQEA 1GGDC 3K6ZA 4B6FA 1TNIA 3LJOA 4F48B 2FX4A 4OM9A 1C5LH 2ZFSA 5C5NA 3PWCA 1MU6B 1RGQA 3BTME 4LXBH 4D7FA 4SGAE 1AKSA 1A4WH 1IQNA 2QA9E 2Z3EA 3GICB 1CBWC 3O8BA 4X8VH 1N8OC 5AHGH 1QRZA 3F0OA 4ZHMU 2BZ6H 1GHYH 4Y8YA 4B73A 3SN8A 1KLIH 1GI7B 1P2QA 3MU4A 1DUEA 5J4SA 1Z71A 2YMSC 2GDDA 3EA7A 1IHTH 2FOAA 1UMAH 1GJAB 2BXUH 1QJ7B 1VITF 1IHSH 2IPQX 4JZFH 2UWOA 3PV5A 4MDSA 1WTGH 1XVMA 5FBIA 2STBE 2FMJA 2WV5A 1O0DH 8GCHF 2ZO3H 3SNAA 2LNCA 5HKKD 2FTMA 1MAXA 1D4PB 4ABGA 3BTWE 1MU8B 1LVBA 4WXVA 1ELFA 1GCDA 3U8RH 2F91A 4FUFA 1BHXF 3ZZAA 1TBQH 1BRBE 4Y0ZE 2G4TA 5A09A 1FY1A 5K7RA 1UHBB 4OS7A 5T6FA 4ABDA 1EOLA 2Z9IA 5HIZA 1EX3A 1FV9A 1W7XH 5AVDA 3D62A 3PRBA 3F1SB 1NFYA 1UCYE 2NU4E 3UTUH 4M7GA 4A6LA 2ZTYA 1O2VA 2ODPA 3MO3A 1K22H 3RM2H 5DN6D 5FBEA 1DPOA 2CJIA 2SNVA 2GV6A 5DG6A 3FN8A 2WZQA 1V2NT 2ZZUH 4THNH 1AZ8A 1HAYB 1EATA 1F5LA 1RS0A 1KXBA 3HPTB 1TMUH 1CGIE 3KNXA 4GAWA 2I6QA 3P17H 1P2NA 1YPHC 1K0HA 4NA7A 1SBWA 1C1NA 1GJCB 1HAVB 2EI6A 3KQDA 3MU5A 1CBWB 4OS6A 4IC5A 4OS2A 5E8EH 4FVDA 1A0HB 2P8OC 1TPOA 5JB9S 1THPB 3UREA 4NZQA 1F0SA 1AIXH 1DM4B 1NTPA 1SSXA 2B7DH 1AMHA 2YMSB 5CHBA 1W0JD 4AN7A 4I8LA 4UFEH 1TPSA 2FDAA 4GSOA 1BTZA 2D8WA 5HYOA 5EU8A 1BRUP 2PTNA 3BTKE 3M5MA 1TQ7B 2G00A 3GISB 3BEUA 2HPQH 1SGDE 4INKA 3TITA 2F3CE 1D3DB 3FP8E 3TK9A 1GHBF 2P94A 4O97A 4O03A 1DFPA 3F9HA 4TY6A 3FFGA 1O3HA 1HV7A 3LC3A 1GMDG 4MVNA 1SGQE 1S6HA 5HM9A 4F55A 3UWJH 2FO9A 1T4UH 2VWLA 1ABIH 3DSPA 2AFQB 1ELAA 1PQ5A 2V3OH 3ELAH 2A0QB 1W7GH 2FS9A 3QGJA 5EJZA 1A1RA 2O9QA 2DE9A 3LONA 2VWOA 4Z1MD 1YKTA 1TGBA 2ZPRA 2FESH 1SGYE 1WYKA 3UQOA 3U1IB 1N6YA 3RUOA 1V2ST 5GNDA 1SLXB 2G52A 1BHXB 1P10A 3BIVH 1V6DA 1BBRE 2KX4A 2PGBB 1P11E 1WAYB 1YYY1 3SV7A 3E91A 5LPRA 5L2YH 4X6OA 1K1OA 3SV8A 1NRPH 1GI6A 3E16B 3GY3A 1QL7A 2J34A 3E3TA 3ZVFA 2JH0D 1NFXA 1WBGB 1OPHB 1GHAG 1BTWA 5GCHF 1GBJA 1D3PB 3STJA 2PUXB 1OX1A 3SNBA 1BMNH 1YGCH 5DP8A 2R9PA 1GMCF 2TPIZ 2WYGA 4U30A 1F7ZA 1UTJA 2ASUB 1GHZA 3P8OA 3M7TA 4KTSA 3KN2A 2ZA5A 3QN7A 5A8YA 4ABEA 5DP6A 3BTEE 3ZV9A 1S5SA 1MAYA 5DP4A 3ZZ7A 5KEDA 2XWAA 1L1NA 2FLRH 1PPZA 1Z8JB 2P16A 2YNBA 1NU7B 1BITA 1EOJA 1KXFA 2QN5T 5EQRA 3SU1A 2W26A 1E1QD 1NRQH 2R3UA 5GJ4B 3MNCA 3PO1C 4GLYA 1UTMA 3SGQE 3B23B 1O3JA 4IC6A 3MH5A 1O3IA 3RXHA 2JJ1D 2J38A 4CH8B 2JJ2D 1RD3B 1PPFE 3MU1A 2FWWA 1UTLM 1WTHD 5EJLA 4NIYA 2OP9A 4X1PU 1X7AC 4MNYA 1EFRD 2Z3DA 3V12A 2A5KA 3FKSD 1O2MA 1MQ6A 4ABFA 1ESAA 3BTGE 5GWZA 1AN1E 3EE7A 5GXPA 3M61U 4Y71A 2YMSD 1C1PA 1HB0B 2V3MA 1UCYK 1C1WH 5LPEA 4D76A 1ESBA 2UUJB 1GJ6A 4ISHH 3MH4A 2PUQH 1MD8A 3N99A 1LTOA 3LU9B 4MTBA 2FI4E 1P0SH 2GMTB 1KYNA 1BDAA 2IPHA 2F9VA 3S7HB 1XM1A 5EOKA 1QTFA 1FI8A 3VB6A 2WPMS 4B2CA 1HXEH 2D1JA 3ZV8A 1UTOA 1TNLA 4K1SA 1K1PA 1COWD 1CSOE 1QBVH 3UQVA 3M7QA 4AOQA 3ATKA 1GI1A 2CV3A 1BQYA 1ZHRA 3A83A 1FIWA 1G37A 3FZZA 2NWNA 1T7CA 3CS7A 3PM3A 1CO7E 1XUGA 1LVOA 1EP6A 3ODDA 5T6DA 4K1EA 1C5PA 3EA9A 4X8UH 3A85A 3NK8A 3UB0A 4CR5A 2ZGJA 4I8KA 4X6NA 2BOHB 3RXTA 3M7UA 2TGTA 1S83A 1GBCA 4X2VA 1SGCA 1GVLA 1V2LT 3GDUA 3S9CA 2BD4A 1NU9A 2V6NA 1LCYA 2IOTA 2BMGB 1AVWA 3LC5A 3A80A 3PROA 2XBWA 2J95A 5C0TA 3LGUA 4ZAEA 2XCNA 3ATIA 5SGAE 1A61H 5AFYH 4ASUD 3GDSA 2A2QH 2IJD1 1C1VH 2SGQE 5I46H 2G81E 1O2WA 1BTYA 5EPYA 4D8NA 1P2OA 1OWEA 1GBHA 3LKWA 1XMNB 2ZFQH 5EJ1A 4MPWA 4IMQA 4BXWA 1AWHB 1LPZB 2VJ1A 2B5TB 1GL1A 1O3MA 3ZVDA 4X1SU 3RU4T 4CHAC 2THFB 3UNSA 1UK4A 2W3IA 4ACBA 1MH0A 1T32A 1DITH 3S9AA 3SNDA 1SB1H 2PW8H 2FOHA 2H6MA 1AE5A 1O39A 2EQNA 3ATWA 3VB4A 4MPXA 2NU3E 1VCQA 1K2I1 3GDVA 1BBRK 5C94A 3SJOA 1O30A 1RRKA 5EXMA 1ELEE 1TGSZ 3K9XB 5AF9H 2WUBA 1K1MA 4LOYH 1C4Y2 2FOBA 3HATH 1P03A 4FXGH 1GBBA 4TWYA 4CR9A 1TIOA 3NRLA 2BQ7B 3HGPA 1G3BA 1EAUA 3Q3YA 1O2LA 1MCVA 3M3VA 1FONA 1G3DA 1UW7A 2QXHA 3BSQA 2QIQA 2BLQA 1HAZB 4AGJA 1SI5H 2BDIA 4KP0A 4Q2KA 2L74A 5ESTE 1A0LA 4TYDA 1P3EA 1ANBA 3MU0A 5DP5A 3NWUA 5JBTA 1V2TT 1O5EH 2G5VA 3ZIAD 4MNWA 4I86A 3BTFE 5C17A 1O5DH 1BUIA 1O2XA 4BAMB 4K5ZA 2GT7A 1UK3A 3ZZ4A 3A7ZA 1JOUB 1SC8U 3RP2A 1TAWA 3A8AA 7KMEH 2B8OH 4B1TA 3GYLB 3C1KA 3UUZA 1OYTH 4CHAB 3UY9A 3F2FA 2ANWA 5DGJA 1G2LA 4AFUA 3FO8D 3UIRA 3T5FH 1QRWA 1C2KA 5CHAC 1J9CH 1KXAA 1O5GH 1VJAU 2W7SA 4IBLH 1NFUA 2KCOA 2RCEA 1CGHA 8LPRA 3WY8A 2SGFE 1C5WB 1YPHE 4I33A 4CRDA 3U8OH 1QFKH 1WXRA 4NWKA 2BD5A 1T31A 2RFKC 4ABIA 2ZNKH 4GPGA 3MH6A 1QQUA 4BANB 1XKBC 5FPYA 1GMHF 1OWDA 1JMOH 1IOEA 1TX7A 1CVWH 3SYJA 1EAIA 1A5HA 2C93B 4X8TH 4I31A 1QNJA 1EZUC 2ZCKP 4SGBE 4JK5A 2H5DA 1W2KH 1RIWC 2AYWA 1TBRH 2R2WU 1ZHMA 2GTBA 3QDZB 1YPKH 3PTBA 1OXGA 5ABWA 1GMDF 2A1DB 1C1MA 1C5QA 1TA2A 1HYLA 2RDLA 1S0RA 1O2QA 1SQRA 5AFZH 1ZPCA 1OP2A 1W14U 4B75A 3A82A 1H8DH 3SUDA 7ESTE 3SJ9A 2KAIA 3VXFH 1C1OA 1AU8A 2XBXA 3P95A 3RU4D 2P3UB 2AH4X 5DPAA 4CBOA 1D3TB 1T8NA 2ZDAH 1LPGB 1TRNA 4X8SH 3GY4A 1RTFB 1B0EA 1PQ7A 3B8JA 3VGCC 5E0JA 5FAHA 1ETRH 1O2TA 1SR5C 1ZR0A 1IQIA 1QGFA 1B5GH 1SPJA 2H5CA 3TU7H 1EP5A 1DWEH 1O2HA 3TVJB 1GCTB 1DUAA 1EAWA 3F2GA 3D23A 1MZDA 2VIPA 4J2YB 5CDFE 2HVXA 2C4FH 2ZP0H 4NIXA 3KL6A 3GYMA 1HLTH 4B6EA 1C1UH 1ZSKA 1PPBH 2BY8X 1P05A 1NFWA 2K1QA 1ZTJA 1QURH 1HGTH 1QIXB 2Y82A 3SW2B 1VKYA 1ELTA 3E90B 4WF8A 1O5AB 1Q31A 1WOFA 2Y7XA 4NIWA 1GBLA 2SNWA 4NIVA 3G01A 1PPCE 1RIWB 2Y80A 3URDA 4AG2A 5C1XA 3P92A 1SLWB 1QZ8A 2ZU5A 3TNTA 1DXWA 3SZNA 4TPYA 3JZ2B 3UPEA 3RXCA 5EXNA 1ACBE 1TGTA 3SUFA 3GCNA 4F4OC 3O8DA 1ARCA 1EJNA 2FODA 3AASA 2JH6D 4Q7XA 2AMDA 1ZSJA 1EKBB 4FUBA 3VB5A 4HGCA 3E1XB 2WYJA 1CQQA 4ZCNA 1O35A 2W6JD 4WH8A 3T28A 1MKXH 5A0AE 1D9IA 2FOCA 1UVUH 2V35A 3JZ1B 1CT4E 4JYTA 1IQGA 4NSYA 1BCUH 1F92A 1KXCA 2XRCA 1U6QA 5PTPA 2B9LA 1O3FA 3SJKA 4YT6H 4K3JA 1P9SA 1O2YA 2VGCC 4OS1A 3SU2A 4AB9A 2Z9JA 4NWLA 1C5VA 3F9FA 1P04A 2AGEX 5T1VA 1L1GA 1AO5A 2FOMB 2QXGA 3HK3B 3LGYA 4R8TB 1EQ9A 1S81A 1FPCH 1CHOF 1HIAA 1LDTT 1MKWH 1WQSA 1TPAE 2ZPSA 3URCA 2DE8A 4KELA 1EZXC 2IN2A 1A2CH 1LKAA 4K8BA 5LPFA 2ZFFH 1YM0A 3M37A 2EC9H 7LPRA 1ARBA 1B0FA 4NA9H 2CMYA 3RU4E 2ZU4A 1O36A 2NU2E 4OS5A 1H4WA 2ALVA 3RDZA 3BTQE 4WY3A 1UJ1A 4I8JA 3SU3A 1K28D 2TBSA 3DT0H 1OSSA 1FJSA 5EXLA 1GI9B 1KDQB 1GJ8B 1O3DA 2J98A 3SHAH 5A0BA 4E05H 1MKWK 5B6OA 1DANH 2VVUA 3SZEA 2Z9KA 4DVAU 4X6PA 5IDKA 4ESTE 2ULLA 3M5NA 1W13U 5DK1A 2A5AA 3GY7A 1FAKH 4BOHA 2ZFTA 1YBWA 2TGAA 2M2AA 5TJXA 1M9UA 3KYFA 1OS8A 3FOAA 3S9BA 1TPPA 5HMAA 1G3EA 3OTPA 1UVOA 1KXDA 3DCLA 4JYUH 2ZKSA 2VGCB 2Z6BD 3SBKA 4XBCA 1TNHA 4I32A 3M3TA 3GY6A 1C2FA 2UWLA 2BZAA 1ZZZA 2QYIA 1DOJA 1BMLA 2PLXA 1YLDA 4MNVA 3AVZA 3P8GA 2PKAB 3RXIA 1MMJN 2HRVA 1PYTC 3BG4C 1SGNE 4JYVH 2FP7B 5FPTA 1LHFH 3PLPA 2OC8A 1L0ZA 1NM6A 1WUNH 1L2EA 3EA8A 1MCTA 1F0TA 2SGAA 1A5IA 2VWMA 2ZTZA 2G5NA 1GJDB 2RA0A 1GMHG 3MNBA 4YXWD 2AEIH 2R0KA 3LDXH 4XFQA 2VWNA 3SUGA 1O3CA 1QRXA 3KEEA 2EY4C 2Y81A 2F9BH 5C0UA 1AFQC 1MTSA 2BLWA 1C1TA 2GZ8A 2ANYA 3H7TA 1YPJH 4Y11E 2OQUA 4ISOA 1TLDA 2ZHFH 1NROH 1PFXC 5K0HA 5EW2H 3V3MA 5EG4A 4AFQA 2SFAA 4NA8A 1UVTH 2ILNA 1RXPA 1AD8H 2OUAA 3VXEH 4YT7H 1N6XA 5C1YA 4O9VA 1PQAA 1SLVB 2VVCA 4LK4A 1F5KU 1QL9A 2QF4A 2UUFB 4RI0A 1HBTH 1QB1A 3MOCA 6GCHF 3PV2A 4M9FA 1C5ZB 1HUTH 4FETA 1ZPZA 1JRTA 2WPLS 2TIOA 1OP0A 2VIOA 4A1VA 4TY7A 1SGRE 3OY5U 1VGCB 3R3GB 2QGRA 3A7XA 4UDWH 3ZVGA 2JIZD 4B76A 3V13A 3BG4B 3OAAD 2ALPA 2GD4B 2GMTC 3A8CA 2JKHA 2XTTB 5C1UA 4X2XA 3RXOA 1H9IE 1JRSA 2ZHWH 4K2YA 3UNRA 3I77A 1QQ4A 1F2SE 3BTHE 3ZVBA 2J9NA 1P12E 1SG8B 1V2WT 1W12U 8KME2 3BTDE 1Y59T 1HDTH 3Q77A 3OYPA 2FPZA 4Z6AH 2V7QD 5FHTA 1P02A 3LIWA 1O33A 3M35A 3DHKH 1C5XB 1KLJH 1AFQB 3MH7A 3OEED 3ZVEA 2ZDVH 1YLCA 1INCA 5EODA 2HOBA 3TLOA 4MLFB 4FUHA 2VH0A 2FOGA 4Y6DA 3RMNH 5C5OA 1IQJA 2ZFPH 2WPDD 1C5SA 4XOJA 1C4V2 3BN9A 3UNQA 1W3CA 3U9AH 1OWIA 3MHWU 1JBUH 3PMBB 5G4BA 1NPMA 3A87A 1TMTH 3N7OA 4FU9A 3RLWH 1TABE 1BT7A 1GWAA 3LJJA 1K1LA 5JBBS 3RXMA 1Y3YA 4ZXXH 1ZTKA 4ISLA 2KM0A 8ESTE 1ETSH 3N7DA 2A4RA 4XE4A 2QE7D 4ZUHA 3EAJA 4IN1A 3PB1E 3SUEA 4CREA 4X1NU 2VH6A 3SGAE 2J92A 2OCVB 3E6PH 2J97A 2F9OA 2AMPA 1EPTC 3F3BA 3RXAA 2WUCA 3QGNB 3NCLA 1PPHE 5A8XA 1C9PA 3RMMH 2BY9X 1CHOG 3STIA 2BD8A 4Y79A 1K1IA 4MPVA 2QF0A 3SQHE 1O2JA 1SLUB 4JCNA 2XXLA 1JWTA 2ZDMA 3T29A 4OS4A 1RFNA 1P2IA 1KDQA 4U01A 2VIDA 3BTTE 4JK6A 3DA9B 5L30H 1J8AA 1G3CA 3RXBA 1CT0E 3OTJE 2QXIA 4B2BA 2ZCLP 1MTNB 2PFEA 1H8ED 1XUKA 1P9UA 1UHBA 4IMZA 5FXLA 1MTVA 1QB9A 3FVFB 2WPJS 4DY7B 1V2KT 2ZFRH 1SOTA 3SHCH 2Y6TA 4DCDA 5EPNA 1TX8A 3TIUA 2UUKB 4DJZB 4X1QU 1UVSH 3GCHB 4K60A 1ABJH 3DSGA 2GCTC 3QTOH 1PYTD 1ZRKA 5FL7D 3E0PB 1W8BH 5ETXA 4XDEA 1SL3A 2WV4A 4Y7AA 2P93A 1Y3UA 1HAVA 1YCPH 4GCHF 4CRAA 1XUHA 2GGVB 3DD2H 4ISNA 1PPGE 2FLBH 2W6ID 2ZHEH 1TA6A 2QXJA 2B0FA 3LGWA 4FUJA 1TB6H 1MUEB 2FXRA 3SU5A 1SFQB 1ZOMA 1EPTB 1MTWA 1L4ZA 2VVVA 3F2HA 3L33A 4JZEH 5L6NH 4YZUA 3PV4A 2KCAA 1UTKA 4ABBA 5A2MH 4X1RU 1BMAA 1BRAA 4JZDH 5E0GA 3Q00A 1LHDH 3UR9A 1FLEE 3MYWA 4B2AA 1LHGH 1DE7H 2TGDA 1BZXE 1WSSH 2A45B 5EQSA 4GHQA 1Q3XA 1THRH 2XBVA 4UFGH 3PMAB 5FX6A 1HAOH 2D26C 1CGJE 2F4LA 4DOQA 2Z94A 1DVAH 4A1TA 1GJ5H 4WMDA 4DIIH 4MNXA 3ZYDA 1XX9A 1E34B 3GCTF 1O34A 3ZZ9A 2H9EH 1MZAA 4LZ1H 3RXRA 2J5UA 2ANMH 1ANCA 4RN6A 2CHAB 1UTNA 1TOMH 4I8GA 2XNDD 1Q2WA 1YY3A 2FEQH 3F68H 2GZ7A 1OHHD 4H6TA 3U8TH 4VGCC 3QK1A 1GG6C 5F53A 5T6GA 4O3UA 3P8FA 4Q7ZA 1FPHH 2GCTB 1DDJA 2JETC 4I7YH 1KTTB 2J94A 2WSSD 3ITIA 5DKMA 2SGEE 4MQAA 1LQEA 1Y5UT 6GCHG 3ZZ6A 1V2RT 2F83A 5DJ7A 3TJOA 4BAQB 1ANDA 1FN6A 3BEIB 3NPSA 1FY5A 1HFDA 1T4VH 4HFPB 1PQ8A 3A7WA 2OBQA 3SV2H 4GUXA 4KTUA 2XBYA 1TMBH 5HGGA 3OE7D 2KFWA 3RMOH 1O2IA 2FZZA 1TOCB 2A2XH 1A3BH 4K8YA 2XC5A 1HAXB 4OGXA 1Z8RA 2EI7A 3A7VA 1LO6A 2HLCA 3VPKA 4E7RG 2FOEA 1GCTC 1T8MA 1DY9A 3RC4A 1XVOA 3RLYH 3DFJA 1MABB 1LPKB 1QB6A 2CN0H 3P8NA 4BTTB 4INHA 1AQ7A 4ACAA 2FOFA 2OTVA 1CT2E 1C5NH 4Y8ZA 4ABJA 1SGFG 3TK5A 4WMFA 2BDAA 7GCHF 4YOJA 5C20A 4JZIA 1E37B 4CRBA 1QHRB 2ZHQH 3H7OA 1WU1A 3MQKC 1EB2A 4QT8C 1NN6A 2H9HA 2WPKS 1A7SA 1HJ8A 4AB8A 2Y5FA 2F9UA 5IYTA 1ZRBA 2ZF0H 3DSOA 2FTLE 4VGCB 1EUFA 1JXPA 1O2NA 2YNAA 1GG6B 4BAHB 1V2VT 1J17T 1Z1IA 4ZMAH 2JETB 3ZZCA 3PWBA 1P01A 1H1BA 5EGMA 1GVZA 2BHGA 3UOPA 1ESTA 3WW7A 2WPIS 1TNJA 1PJPA 3BEFB 3OSYA 4IS5A 2VINA 4DW2U 1T8LA 1Y5BT 3AW1A 4FVBA 5GDSH 2YOLA 1IQHA 1ZGIA 2XOKD 3TH4H 1SQAA 3PMHB 1EXFA 4WWYA 2SGPE 1C2HA 1OP8A 2CXVA 3FZDA 2PTCE 3MNSA 3M36A 4TPIZ 1P2MA 1YCPM 2A5IA 4NFEA 2M5TA 1D6WA 1V2PT 2STAE 1GDQA 4AFSA 2BD7A 1A5GH 1E38B 6ESTA 2ZQ2A 1O2ZA 2ZDKA 4BNRA 1ELCA 1YPGH 3N7EA 1AVGH 2G55A 2ZWLH 3RXGA 3R0FA 4RKOB 1ZYOA 2ZEBA 1OYQA 1J14A 1TX6A 1THSH 4HI3A 1AY6H 1HAIH 1UTPA 5F8XA 1W0ZU 2AERH 2FYRA 3SQEE 3RXEA 1LVYA 2FI3E 1BTPA 3LT3A 4Y8XA 3B9FH 5JYIA 3CENA 2XC4A 3SU0A 3QUMP 3NKKA 3VB7A 2ZECA 1V2JT 1C2JA 4RT0A 1O3LA 5HIYA 3ZZDA 5A8ZA 3TJUA 1RTKA 2HNTF 1TYNA 2VIWA 2LP6A 4GHTA 2KR7A 1O38A 4P00A 4HG6A 2BQ6B 3HK6B 4Y76A 4DURA 1C5OH 1GI5A 1HAGE 4YLQH 3PMJA 1NZQH 2Z9LA 1ZJDA 1DXPA 2NU0E 3KQBA 4A5TS 3A88A 1XXFA 3BV9B 1E35B 1Y3XA 3FAOA 3V7TA 4ZHLU 1EPTA 3FP6E 3KYGA 1C2LA 1SGIB 3W94A 2PHBA 1ELBA 5E2PA 1Z8GA 2L6OA 1FZZA 4GCHG 4ABHA 1ANEA 3ATLA 1K9OE 2ANKH 4XRNA 3NUMA 1GI8B 1SKYE 2R0LA 3SJ8A 2O8MA 2UWPA 4YLUA 4HTCH 4I8HA 2BD9A 2BY7X 2SGDE 3EGKH 2NU1E 1OWJA 3S69A 1EB1H 3TGKE 3ESTA 3PRDA 3ZZ3A 1SGTA 3P70B 1A3EH 1CA0B 1MKXK 3KQCA 1MQ5A 4H6SB 5GIBA 1NRSH 1S6LA 1YWUA 3RXVA 3VEQB 2ZDLA 1FN8A 2OK5A 1C9TA 4FUIA 4UD9H 1DY8A 4D9QA 1H8IH 4OGYA 1BJUA 2V0BA 1EJMA 1C5UA 2G8TA 1ZTLA 3SGBE 1O31A 1RTLA 1H9LB 1O37A 2F9NA 3RC6A 2WHXA 1NO9H 4TT3D 1CE5A 5C2ZA 4H42U 3GCTG 2J4IA 5LGOA 1CHGA 2HGTH 3ZZBA 2HLDD 1MBQA 1XUJA 1G32B 1TE0A 2ZU1A 1O2OA 1SHYA 2W5EA 4BAOB 1CU1A 2A4GA 3HKIB 4AX9H 3RXUA 1QY6A 5FCRA 4KKDA 4FU8A 4NGAH 1GVKB 1G36A 1K1NA 1NT1A 2BLOA 2C8WB 3RMLH 2F43B 1TGCA 1AHTH 3E0NB 2GVFA 3A81A 1W0KD 2BDGA 2H1UA 3SU4A 4A1XA 1W11U 1O3EA 1NRNH 3PLBA 5I25A 5DO4H 3BIUH 1PPEE 5DSFA 5JB8S 4E06H 4HZHA 5FCKA 1UO6A 1V2OT 3KQ5A 4IW4E 4Q7YA 3ZVCA 2QY0B 2ZG0H 1VGCC 3S7KB 1FQ3A 1Y3VA 2KCYA 2A7JA 3AK5A 2BYAX 3A84A 1FY3A 2BDCA 1ZMNA 3F0PA 1EZSC 2P95A 1K21H 3NZIA 1O3OA 2D2DA 4NG9H 1SQOA 4IGDA 5EQQA 1GGDB 1GJ4H 2V3HH 2GZ9A 1AB9C 1GHWH 5JDUB 3W95A 1WCZA 2WV9A 1BMMH 3MO6A 1TNGA 3CNRA 1O3GA 5FX5A 1AE8H 1C5TA 3SOSA 4X6MA 7GCHG 1Z6JH 4KTCA 4ZKNU 1K1JA 1N8OB 4P02A 5EW1H 1C2DA 4WJG2 4GVUA 1BJVA 1GJ9B 3WWFA 1SQTA 2J2UA 3RXPA 2AHME 3I78A 5KGOA 3ATMA 1UK2A 4AG1A 2A7HA 2HVYB 2FX6A 4XBBA 1ELGA 5C3NA 3E8LA 4Z0KA 4ZH8A 2EI8A 2O8TA 1TONA 1HPGA 1DSUA 3GY2A 5DP9A 1OWKA 1DSTA 3IWMA 4BAKB 3EQ0H 4BTUB 4WXIA 1MD7A 4AFZA 1NBMD 4TWWA 1BMFD 2A7CA 2OD3B 2BY5X 1DICA 2P59A 2FIRH 2H9TH 1FAXA 2XW9A 3F9EA 3RXQA 4R0IA 1AFEH 2BDBA 1S85A 5BRRE 1Y5AT 2AMQA 3ZZ5A 4Q63A 2HALA 2Q1JA 1FX0B 3PTNA 1FDPA 4E7NA 2ZGXH 4NSVA 1IAUA 2PSYA 4DT7B 4IN2A 4AC9A 1IQMA 1ZPBA 4DIHH 5BPEA 1J16A 1Y8TA 2BXTH 3U98H 4FUGA 5CE1A 1YP9A 2GCHF 3UOUA 1H9HE 2CK3D 1BRCE 2R2MB 2BLVA 1BA8B 1AB9B 3KCGH 2CF9H 3IG6B 1KTSB 4ISIH 4YESB 1ZHPA 4FUCA 4FUEA 4YO9A 1O5BB 2Q6GA 1MBMA 1GBTA 4XSKU
chains in the Genus database with same CATH topology
2AS9A 2ZIQH 1Y3WA 1NC6A 2CF8H 2P8OB 2ZQ1A 3KF2A 1O2KA 2OLGA 1FNIA 3UWIA 3GCOA 3MU8A 4Y0YE 1G9IE 1SFIA 2GX4A 4PROA 2ZGHA 2PGQB 2ZU2A 1MTNC 3H5CB 5J4QA 1F0RA 4DGJA 1O5FH 3OY6U 1F5RA 5GPIB 1N1LA 1B7XB 4X0WU 1DWBH 2F9PA 5CMXH 1SHHB 3M5OA 1HRTH 5E2OA 1L1JA 3TJVA 3SV6A 4CBNA 2OQ5A 5F03A 5A0CA 2VIQA 2Z3CA 3FP7E 1E36B 2R3YA 2GV7A 1O2PA 5ESBA 4FU7A 3GCHC 5H4IB 3O8RA 1MTUA 1UCYH 1W0YH 1FIZA 1C5RA 1P06A 2FI5E 2PKSC 3A89A 3LGIA 1TWXB 5DP3A 1DLKB 1RJXB 3ENSB 5TCAA 1ZLRA 1ZJKA 5HM2A 3T62A 3CP7A 3TPIZ 1TFXA 2UUYA 1IQFA 1BTXA 2Z9GA 4FUDA 1C5MD 4J1YA 2Y5GA 1EJAA 1DWCH 2OBOA 1YPEH 2BB4A 1QJ1B 1C2IA 1NY22 3K65B 2FS8A 2GKVE 2KAIB 1FUJA 1C1SA 1XUFA 4ASHA 4LZ4B 3S0NA 2IJOB 1VCWA 1JIRA 3AAUA 4JMYA 1A0JA 1LHEH 1AZZA 2BQWB 2A4QA 2ZDNA 3AW0A 3SNEA 5DP7A 4DG4A 4ZKSU 3SI3H 2RG3A 3ZVAA 3VB3A 3ZYEA 5HXFA 1ID5H 1Z1JA 1QA7A 1FY8E 1KLTA 3EYDA 4KGAA 1P3CA 3TNSA 2CHAC 4B71A 3P6ZB 1EASA 1VITG 4YTAA 3TGIE 5F8TA 2FYQA 1TQ0B 1CA8B 4UONA 3LOXA 2PV9B 8GCHG 2O8UA 1GI3A 1VJ9U 1S0QA 3VFEA 3TH3H 1NS3A 2OC1A 3SO3A 2Q6DA 3BG8A 3PO1B 2ESTE 1O2UA 3LH3A 4U32A 1C1RA 2PKSB 1TALA 4Y7BA 2OC7A 1QBNA 5E0HA 1DWDH 4NCYA 2I6SA 1HNEE 4ABAA 1GBFA 1WV7H 2ZTXA 2PKAA 2ZGCA 1G30B 3LPRA 5JBCS 1QA0A 4BXSA 3RXDA 1SGPE 2W3KA 1LHCH 2EEKA 2HNTE 2EA3A 3SI4H 1WQVH 1BBRH 3F6UH 1E0FD 4CH2B 2BX3A 1VZQH 1AUTC 1C1QA 1ZGVA 3KIDU 2RA3A 1GI0A 1KY9A 4INLA 1IQLA 1LMWB 3Q3XA 6CHAC 1GBDA 4Q80A 3EE0B 1ZSLA 1V2MT 2BVSH 1O3KA 1Z8IB 4WMEA 3SORA 1LVMA 1SVPA 1GBIA 1VCPA 1T8OA 1TBZH 4AORA 2Y5HA 1HCGA 1YCPK 1GPZA 2BDYA 1QCPA 2FM2A 4UEHH 4WH6A 4ZXYH 1P8VC 1L4DA 1O2GH 3DFLA 3BF6H 3QZQA 3T25A 3EDXB 1S84A 5JBAS 2ODYB 2DUCA 3DUXH 3OX7U 2WINI 5C67A 4WVPE 3AAVA 1AVXA 3QTVH 3K2UA 2TRMA 3UFAA 3SU6A 1KXEA 3Q3KA 4ZKOU 4JZ1A 1YF4A 3HGNA 3U69H 1P09A 4UFFH 3LGVA 2HPPH 3LGTA 1W10U 1AKSB 1ETTH 1VR1H 2ZU3A 4F49A 3ZZ8A 1HIAB 2QC2A 1QR3E 3O8CA 2AIPA 1TRMA 1NRRH 1HJAC 4ZROA 4B74A 1AWFH 1XKAC 1GHBG 4BTIB 2OXSA 3D65E 5F6MA 4MG3A 1GI4A 1BIOA 1ELVA 3QWCH 2C90B 1SMFE 5F8ZA 4NZLA 1OOKB 3PYHA 1BTUA 1LKBA 5TCCA 2LPRA 9LPRA 3QO6A 1SGEE 2BVRH 2ZHDA 1GBKA 4NFFA 1O2SA 1C5YB 2C8YB 4XBDA 1DX5M 3MNXA 3LH1A 4CRFA 1GJ7B 1KIGH 2Z7FE 4ZHAA 1TNKA 1XUIA 3SNCA 3HKJB 3T2NA 2G51A 3V0XA 2TGPZ 2XNIA 3L6PA 1D3QB 3GY8A 6CHAB 2GCHG 2XCFA 2BM2A 2VU8E 1ELDE 2XC0A 3ODFA 4K69A 1C4U2 1Z6EA 2BX4A 3A7YA 2C8XB 3RXKA 1SOZA 3A7TA 4YM9A 4A92A 2ODQA 1O3PB 1HAPH 4X2WA 2BDHA 1F0UA 1BOQA 4UFDH 1UVPA 1EZQA 4AZ2B 1GDUA 1FMGA 2W7UA 4O3TA 2CGAA 3A86A 3RXFA 1AI8H 1O5CB 2GP9B 5GCHG 2ZC9H 2ZGBH 2AGGX 3SJIA 2AIQA 3A8BA 2ZPQA 1HXFH 1GMCG 1S82A 1AGJA 4D7GA 2BD3A 3KGPA 2XYAA 3RC5A 4AGKA 3C27B 1V3XA 2QCYA 3TGJE 1P2KA 1HJ9A 1A46H 3CS0A 1D6RA 1HJAB 1KSNA 1TGNA 5T3HA 1GL0E 1XXDA 1UTQA 3D49H 2VNTA 2JH5D 2C8ZB 3A8DA 4CRGA 1S6FA 4K1TA 1C2MA 1GDNA 4D9RA 3MO9A 3TH2H 5L2ZH 5LH8A 1ORFA 1GBEA 3RM0H 4YOGA 3KQEA 4ZKRU 2A32A 1P2JA 2O8LA 1QL8A 1BB0B 3M3SA 3RXSA 1NESE 3T26A 1G2MA 3MWIU 2AGIX 1OKXA 3KHVA 2BD2A 2PWXA 3K6YA 1GHXH 1EAXA 4RKJB 1HAHH 1DLEA 1DS2E 2VB0A 4A7IB 2WPHS 3T27A 3TK6A 2O8WA 1AUJA 1CA0C 3RXJA 4UE7H 2A31A 4U2WA 1V2UT 1O3NA 5CHAB 1TRYA 4RSPA 1YPLH 1GJBB 3OU0A 2QAAA 2QV1A 3M5LA 3QX5H 1GBMA 3L3TA 1GHVH 1FY4A 1YPMH 1O32A 1O3AA 2H2ZA 1SGFA 2BTCE 2QF3A 2ZCHP 1GHAF 1J15A 2P3FH 3QLPH 2XWBI 4YOIA 1GBAA 2OC0A 2Q6FA 3MMGA 3U1JB 3MI4A 2GDEH 2VIVA 2BOKA 3Q76A 3GOVB 4Y10E 4AYVB 4AYYB 2C3SA 2HWLB 3MFJA 1QBOA 2BY6X 3FANA 1V2QT 3TJNA 1YC0A 4MPUA 1C2EA 3PLKA 4H4FA 2A4OA 4X2YA 2HNTC 2Y7ZA 1GI2A 2GT8A 3MTYA 2PR3A 2OINA 2ZI2H 3RXLA 1ZMLA 1VITH 1IQKA 6LPRA 1C2GA 1BTHH 1O3BA 1Z7KA 3IITA 9ESTA 1P57B 1QJ6B 3NXPA 5JPMH 5FPSA 3I29A 1ZMJA 2P3TB 1OWHA 4CRCA 1LQDB 1DT2A 1O2RA 2G4UA 3UR6A 2PSXA 2BVXH 3QZRA 1JIMA 3GY5A 1FXYA 3VGCB 3SV9A 3F9GA 1IQEA 1GGDC 3K6ZA 1TNIA 3LJOA 2FX4A 1C5LH 2ZFSA 5C5NA 3PWCA 1MU6B 1RGQA 3BTME 4LXBH 4D7FA 4SGAE 1AKSA 1A4WH 1IQNA 2QA9E 2Z3EA 3GICB 1CBWC 3O8BA 4X8VH 1N8OC 5AHGH 1QRZA 4ZHMU 2BZ6H 1GHYH 4Y8YA 4B73A 3SN8A 1KLIH 1GI7B 1P2QA 3MU4A 1DUEA 5J4SA 1Z71A 2GDDA 3EA7A 1IHTH 2FOAA 1GJAB 1QJ7B 2BXUH 1UMAH 1VITF 1IHSH 4JZFH 2UWOA 4MDSA 1WTGH 1XVMA 5FBIA 2STBE 2FMJA 2WV5A 1O0DH 8GCHF 2ZO3H 3SNAA 2LNCA 2FTMA 1MAXA 1D4PB 4ABGA 3BTWE 1MU8B 1LVBA 4WXVA 1ELFA 1GCDA 3U8RH 2F91A 4FUFA 1BHXF 3ZZAA 1TBQH 1BRBE 4Y0ZE 2G4TA 5A09A 1FY1A 5K7RA 1UHBB 4OS7A 5T6FA 4ABDA 1EOLA 2Z9IA 1EX3A 1FV9A 1W7XH 5AVDA 3D62A 3F1SB 1NFYA 1UCYE 2NU4E 3UTUH 4M7GA 4A6LA 2ZTYA 1O2VA 2ODPA 3MO3A 1K22H 3RM2H 5FBEA 1DPOA 2CJIA 2SNVA 2GV6A 5DG6A 1V2NT 2ZZUH 4THNH 1AZ8A 1HAYB 1EATA 1F5LA 1RS0A 1KXBA 3HPTB 1TMUH 1CGIE 3KNXA 4GAWA 2I6QA 3P17H 1P2NA 1YPHC 4NA7A 1SBWA 1C1NA 1GJCB 1HAVB 2EI6A 3KQDA 3MU5A 1CBWB 4OS6A 4IC5A 4OS2A 5E8EH 4FVDA 1A0HB 2P8OC 1TPOA 5JB9S 1THPB 3UREA 4NZQA 1F0SA 1AIXH 1DM4B 1NTPA 1SSXA 2B7DH 1AMHA 4AN7A 4I8LA 4UFEH 1TPSA 2FDAA 4GSOA 1BTZA 2D8WA 5HYOA 5EU8A 1BRUP 2PTNA 3BTKE 3M5MA 1TQ7B 2G00A 3GISB 3BEUA 2HPQH 1SGDE 4INKA 3TITA 2F3CE 1D3DB 3FP8E 3TK9A 1GHBF 2P94A 4O97A 4O03A 1DFPA 3F9HA 4TY6A 3FFGA 1O3HA 1HV7A 3LC3A 1GMDG 4MVNA 1SGQE 1S6HA 5HM9A 3UWJH 2FO9A 1T4UH 2VWLA 1ABIH 2AFQB 1ELAA 1PQ5A 2V3OH 3ELAH 2A0QB 1W7GH 2FS9A 3QGJA 1A1RA 2O9QA 2DE9A 3LONA 2VWOA 1YKTA 1TGBA 2ZPRA 2FESH 1SGYE 1WYKA 3UQOA 3U1IB 1N6YA 3RUOA 1V2ST 1SLXB 2G52A 1BHXB 1P10A 3BIVH 1V6DA 1BBRE 2PGBB 1P11E 1WAYB 1YYY1 3SV7A 3E91A 5LPRA 5L2YH 4X6OA 1K1OA 3SV8A 1NRPH 1GI6A 3E16B 3GY3A 1QL7A 2J34A 3E3TA 3ZVFA 2JH0D 1NFXA 1WBGB 1OPHB 1GHAG 1BTWA 5GCHF 1GBJA 1D3PB 3STJA 2PUXB 1OX1A 3SNBA 1BMNH 1YGCH 5DP8A 2R9PA 1GMCF 2TPIZ 2WYGA 4U30A 1F7ZA 1UTJA 2ASUB 1GHZA 3P8OA 3M7TA 4KTSA 3KN2A 2ZA5A 3QN7A 5A8YA 4ABEA 5DP6A 3BTEE 3ZV9A 1S5SA 1MAYA 5DP4A 3ZZ7A 2XWAA 1L1NA 2FLRH 1PPZA 1Z8JB 2P16A 2YNBA 1NU7B 1BITA 1EOJA 1KXFA 2QN5T 5EQRA 3SU1A 2W26A 1NRQH 2R3UA 5GJ4B 3MNCA 3PO1C 4GLYA 1UTMA 3SGQE 3B23B 1O3JA 4IC6A 3MH5A 1O3IA 3RXHA 2J38A 4CH8B 1RD3B 1PPFE 3MU1A 2FWWA 1UTLM 1WTHD 4NIYA 2OP9A 4X1PU 1X7AC 4MNYA 2Z3DA 3V12A 2A5KA 1O2MA 1MQ6A 4ABFA 1ESAA 3BTGE 5GWZA 1AN1E 5GXPA 3M61U 4Y71A 1C1PA 1HB0B 1UCYK 1C1WH 5LPEA 4D76A 1ESBA 2UUJB 1GJ6A 4ISHH 3MH4A 2PUQH 1MD8A 1LTOA 3LU9B 4MTBA 2FI4E 1P0SH 2GMTB 1KYNA 1BDAA 2IPHA 2F9VA 3S7HB 1XM1A 5EOKA 1QTFA 1FI8A 3VB6A 2WPMS 4B2CA 1HXEH 2D1JA 3ZV8A 1UTOA 1TNLA 4K1SA 1K1PA 1CSOE 1QBVH 3UQVA 3M7QA 4AOQA 3ATKA 1GI1A 2CV3A 1BQYA 1ZHRA 3A83A 1FIWA 1G37A 3FZZA 2NWNA 1T7CA 3CS7A 3PM3A 1CO7E 1XUGA 1LVOA 1EP6A 3ODDA 5T6DA 4K1EA 1C5PA 3EA9A 4X8UH 3A85A 3NK8A 4CR5A 2ZGJA 4I8KA 4X6NA 2BOHB 3RXTA 3M7UA 2TGTA 1S83A 1GBCA 4X2VA 1SGCA 1GVLA 1V2LT 3GDUA 3S9CA 2BD4A 1NU9A 2V6NA 1LCYA 2IOTA 2BMGB 1AVWA 3LC5A 3A80A 3PROA 2XBWA 2J95A 3LGUA 4ZAEA 2XCNA 3ATIA 5SGAE 1A61H 5AFYH 3GDSA 2A2QH 1C1VH 2SGQE 5I46H 2G81E 1O2WA 1BTYA 5EPYA 4D8NA 1P2OA 1OWEA 1GBHA 3LKWA 1XMNB 2ZFQH 4MPWA 4IMQA 4BXWA 1AWHB 1LPZB 2VJ1A 2B5TB 1GL1A 1O3MA 3ZVDA 4X1SU 3RU4T 4CHAC 2THFB 3UNSA 1UK4A 2W3IA 1MH0A 1T32A 1DITH 3S9AA 3SNDA 1SB1H 2PW8H 2FOHA 2H6MA 1AE5A 1O39A 3ATWA 3VB4A 4MPXA 2NU3E 1VCQA 1K2I1 3GDVA 1BBRK 3SJOA 1O30A 1RRKA 5EXMA 1ELEE 1TGSZ 3K9XB 5AF9H 2WUBA 1K1MA 4LOYH 1C4Y2 2FOBA 3HATH 1P03A 4FXGH 1GBBA 4TWYA 4CR9A 1TIOA 2BQ7B 3HGPA 1G3BA 1EAUA 3Q3YA 1O2LA 1MCVA 3M3VA 1FONA 1G3DA 2QXHA 3BSQA 2QIQA 2BLQA 1HAZB 4AGJA 1SI5H 2BDIA 4KP0A 4Q2KA 5ESTE 1A0LA 4TYDA 1P3EA 1ANBA 3MU0A 5DP5A 3NWUA 5JBTA 1V2TT 1O5EH 2G5VA 4MNWA 3BTFE 1O5DH 1BUIA 1O2XA 4BAMB 4K5ZA 2GT7A 1UK3A 3ZZ4A 3A7ZA 1JOUB 1SC8U 3RP2A 1TAWA 3A8AA 7KMEH 2B8OH 4B1TA 3GYLB 3C1KA 3UUZA 1OYTH 4CHAB 3UY9A 2ANWA 5DGJA 1G2LA 4AFUA 3UIRA 3T5FH 1QRWA 1C2KA 5CHAC 1J9CH 1KXAA 1O5GH 1VJAU 2W7SA 4IBLH 1NFUA 2RCEA 1CGHA 8LPRA 3WY8A 2SGFE 1C5WB 1YPHE 4I33A 4CRDA 3U8OH 1QFKH 4NWKA 2BD5A 1T31A 4ABIA 2ZNKH 4GPGA 3MH6A 1QQUA 4BANB 1XKBC 5FPYA 1GMHF 1OWDA 1JMOH 1IOEA 1TX7A 1CVWH 1EAIA 1A5HA 2C93B 4X8TH 4I31A 1QNJA 1EZUC 2ZCKP 4SGBE 4JK5A 2H5DA 1W2KH 1RIWC 2AYWA 1TBRH 2R2WU 1ZHMA 2GTBA 3QDZB 1YPKH 3PTBA 1OXGA 5ABWA 1GMDF 2A1DB 1C1MA 1C5QA 1TA2A 1HYLA 2RDLA