2SGPE

Pro 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b at ph 6.5
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
185
structure length
185
Chain Sequence
b'ISGGDAIYSSTGRCSLGFNVRSGSTYYFLTAGHCTDGATTWWANSARTTVLGTTSGSSFPNNDYGIVRYTNTTIPKDGTVGGQDITSAANATVGMAVTRRGSTTGTHSGSVTALNATVNYGGGDVVYGMIRTNVCAEPGDSGGPLYSGTRAIGLTSGGSGNCSSGGTTFFQPVTEALSAYGVSVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEINASE B
publication title Contribution of peptide bonds to inhibitor-protease binding: crystal structures of the turkey ovomucoid third domain backbone variants OMTKY3-Pro18I and OMTKY3-psi[COO]-Leu18I in complex with Streptomyces griseus proteinase B (SGPB) and the structure of the free inhibitor, OMTKY-3-psi[CH2NH2+]-Asp19I
pubmed doi rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase/inhibitor
total genus 49
structure length 185
sequence length 185
ec nomenclature ec 3.4.21.81: Streptogrisin B.
pdb deposition date 1999-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2sgpE02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2sgpE01
1CHOG 1MD7A 2F83A 2ZU4A 4J1YA 3U8OH 3RDZA 4KTUA 2V3HH 4U01A 1EPTB 5AF9H 1ZHMA 3RXAA 1EAIA 3UOUA 1MZAA 1HFDA 1MKWK 1Q3XA 1SLVB 2WPIS 3IITA 2HOBA 2IN2A 2WV4A 1NTPA 1OSSA 1VJ9U 2BYAX 2PR3A 4ABIA 1HAHH 2Y80A 1LPGB 4FU9A 1AZ8A 1KLJH 2ZNKH 4OGXA 2OC0A 1SGRE 1K1MA 1YLCA 1HIAA 5EOKA 4WVPE 1Z8RA 1MBQA 4DY7B 3C1KA 2FOFA 1O2SA 2A45B 3UR9A 9LPRA 3QK1A 2Y6TA 4TPIZ 4U32A 3ZVGA 1TGTA 1FIWA 3GCTF 2BDAA 3Q77A 1GDNA 1O2IA 2GZ7A 1GBLA 1K1IA 2F9NA 1WV7H 2H9EH 3BN9A 3LT3A 3JZ2B 3RU4E 2SGFE 1KXDA 2XBYA 1NU9A 1J9CH 4UD9H 3SU0A 2ILNA 3TVJB 4INKA 1HDTH 2Q6DA 1GGDB 2Z9IA 3ZYDA 3ZZ4A 1CSOE 2R2MB 3UR6A 2BD5A 1W7XH 4ABAA 1DSUA 3QTOH 4FUJA 1P04A 3TJUA 4BTIB 5EU8A 5I25A 3T5FH 3SBKA 5FX5A 2WUCA 1QA0A 1NFWA 3C27B 5JDUB 1F92A 3TGIE 1UCYE 4GSOA 3DUXH 3MH4A 1ELVA 4VGCC 2C90B 2F9PA 3GY7A 4RN6A 3SQEE 1GL1A 3DHKH 4IN2A 3ZV8A 1GMDF 5FX6A 1V2MT 2ZGHA 4OS2A 1G3CA 3ZZ9A 1RXPA 2GMTC 2W5EA 4ASHA 3RXEA 1QRZA 3STJA 1DWDH 3KIDU 1EASA 5GIBA 2GCTC 2XRCA 1BHXF 1ANBA 1O3PB 2A7CA 2XCFA 4FU7A 4A92A 1QJ1B 2GZ8A 3UNQA 2ZC9H 4XDEA 1UTKA 2BDYA 1V2VT 1NS3A 1OS8A 3E8LA 4MPUA 3V7TA 1OWHA 3LJJA 2QGRA 5GJ4B 2ALPA 3TJNA 2PSXA 3A83A 1YPMH 3NPSA 1BTPA 3VXFH 6GCHF 3RP2A 4MVNA 3G01A 1A5GH 2FOEA 3JZ1B 2TIOA 3D23A 3GY8A 1C2IA 2EI7A 2JETB 1BUIA 1ZRBA 3LH3A 3F9GA 2GT7A 3S7HB 1PFXC 2UUKB 2BXTH 1GI8B 1XUKA 1O5GH 8LPRA 2STBE 2RG3A 4DGJA 2O8UA 1WU1A 2FXRA 2PUXB 1A2CH 1L1GA 2ZIQH 4OS4A 1IOEA 2BQWB 5AVDA 1LHFH 5FPYA 3P8OA 3UFAA 1CGHA 5FAHA 3P8GA 1B0FA 3FZZA 4INHA 1SL3A 4MNWA 3MH7A 4D9RA 5TCAA 1FDPA 1KXCA 2ZCKP 1GBTA 4Y8YA 1UTPA 2GKVE 3BEUA 1BMMH 4IMZA 4X6NA 5A0BA 4NA7A 2GGVB 1TPSA 1P01A 2TRMA 1EAWA 1GBBA 1O2UA 1TNIA 4IN1A 2UWOA 3MNSA 1ACBE 1BTZA 1FUJA 1W13U 5JB8S 2BZ6H 3OTJE 1TRYA 1JOUB 3UWIA 1EB2A 1O5FH 1QY6A 1YPGH 3S69A 4LZ4B 4Y0ZE 1O39A 2JH6D 2OBQA 3S9BA 3B9FH 7KMEH 3SJIA 1M9UA 2PTCE 3N7OA 1O3DA 4AB8A 4WMFA 2BD8A 6CHAC 2QXJA 4YT6H 3MO3A 1UTOA 4YM9A 1C1QA 2OINA 1O2GH 1ELAA 2W3KA 1EPTC 1SHHB 5GXPA 2ZDKA 4X6MA 2JH0D 4O97A 2O9QA 1IQKA 3L33A 3O8DA 1K2I1 3GYMA 2Q6FA 1HAIH 1ZZZA 5E2PA 5LH8A 2ANWA 3OX7U 4JYTA 1O2OA 3ZYEA 3S9AA 2VH0A 1SQTA 1SGPE 2Y7ZA 1AE8H 4OS1A 1A7SA 2D26C 1GVKB 4NIYA 2SGDE 2W3IA 1T8LA 2PUQH 1EPTA 1NT1A 1Y3UA 1NRNH 4B74A 4U30A 3QX5H 2VNTA 5GCHF 1C1SA 1Z6EA 1OPHB 2XC0A 1MKWH 1AVXA 3FFGA 5EXNA 1BMAA 1CA8B 5EG4A 3HK3B 4FUHA 1P12E 5ESBA 3T26A 2JKHA 1B5GH 4JZDH 3KNXA 5L2YH 1Y5UT 1MQ6A 5A8YA 2ZGCA 1BZXE 3A7VA 1W12U 4Y71A 1E38B 2OBOA 1P2QA 1FAXA 4X1QU 2ZDMA 1CT2E 3RXRA 3KEEA 1PQ8A 3F1SB 4MQAA 1QURH 3U8TH 3RXHA 1FXYA 4YT7H 1SC8U 3BSQA 2UUYA 3UPEA 1GPZA 3TNSA 2ZKSA 1FNIA 1SGDE 4FUDA 1MCVA 1PQ5A 1QJ7B 1RRKA 1V2UT 4B73A 1YPEH 4B2CA 1PPHE 2BB4A 2J9NA 1O2HA 2F91A 3OU0A 3MTYA 5JBCS 1HAPH 1AB9B 1ANCA 1V2JT 1V2QT 2H1UA 5DP5A 1V2PT 2B7DH 1C5PA 3UQVA 1TONA 3LU9B 1PPBH 2V3OH 1C2LA 4ZKRU 1SOTA 3SNDA 4B2BA 3A7ZA 5C1XA 4XE4A 1YPKH 1T7CA 3F9FA 4IS5A 1RTKA 3T25A 2A4RA 1C5NH 3ATKA 1P3CA 1C1VH 2ZDLA 4BAOB 3UIRA 2QXHA 5TCCA 2R9PA 1OYTH 1L4DA 2QXIA 4B71A 1VCWA 3AAVA 4JK6A 2G55A 1QL9A 1GBDA 1GHWH 4J2YB 1GHVH 3K2UA 1XMNB 3E91A 1ZTKA 3H7OA 1ZSJA 1UK2A 2PWXA 1C2DA 4FU8A 2JETC 2FPZA 4O3TA 1OP2A 1GBCA 5DO4H 1O2TA 1BTWA 2ZPSA 4A6LA 3M5LA 3RXOA 1FI8A 1HGTH 4XBBA 4UE7H 2ZEBA 2OC1A 3DA9B 1P09A 4IC6A 1PQAA 4A1TA 1BTUA 3RXSA 1TALA 3A8CA 1DT2A 4NSYA 3U8RH 2DUCA 3GDVA 4ZKNU 1AKSB 1VITG 5ESTE 2WPJS 4GHTA 3RXPA 1VJAU 5DG6A 4SGAE 4NSVA 2VIQA 3RXQA 2CHAB 5DP8A 1GJCB 2YNAA 1CHOF 3EYDA 1C5UA 1DVAH 1LDTT 3A80A 5TJXA 4KTSA 8GCHG 1CU1A 1QQ4A 2V35A 4X8UH 3ZVBA 3E1XB 1GHAG 1CBWB 2XNIA 1V3XA 5EXMA 1FIZA 4WY3A 1TQ0B 3TIUA 1O5CB 3M7TA 2PFEA 1Z1JA 4NA8A 4ZHLU 4B75A 3KHVA 1LTOA 2ZDVH 1G2LA 2P8OB 1BDAA 1EZQA 1W0ZU 1SGNE 1GCTB 1V2NT 2QAAA 1SGQE 3VB5A 4AB9A 5L6NH 2B9LA 4GCHG 4BTTB 2AH4X 2A31A 4JZIA 4O03A 1GJDB 1DLEA 2AERH 3LOXA 1A0HB 1VCQA 2ZQ2A 1HNEE 4Y6DA 1F5RA 3BG4B 1C1WH 4DT7B 1KXEA 1GI2A 1E34B 2BVRH 1THRH 5IDKA 1E35B 1Y3VA 3CP7A 3M7UA 3A87A 5AFYH 2CJIA 4X6PA 2ZFTA 3BTHE 1GCDA 2HPQH 4FUCA 2FMJA 1GI4A 4WF8A 1GG6B 1AO5A 4BAKB 1ZRKA 4Q80A 2BHGA 1NY22 3MU1A 2O8LA 3ELAH 4F4OC 1J16A 4O3UA 1GJAB 2GT8A 1L4ZA 4HFPB 3SU4A 2XWAA 3MHWU 5C67A 4XBDA 3T27A 2GZ9A 1MMJN 1EJNA 3R0FA 2ZFPH 1DM4B 4D76A 1SLUB 5E0GA 1SPJA 4HZHA 1GBAA 4ABGA 2QC2A 3NCLA 1T4UH 2ODPA 2BLVA 1WSSH 3T2NA 3TJOA 4K2YA 1ZGVA 4I32A 1J14A 2G51A 5DJ7A 4Q7YA 2UUFB 3TH2H 1C2MA 1D3PB 4ISLA 5LPFA 3RXLA 1GHXH 4GLYA 3CS7A 3UUZA 2XWBI 2TGPZ 2GDEH 4HGCA 2G5VA 4JZEH 2AIPA 1HJ9A 5GWZA 1A4WH 4ZMAH 3LKWA 2W7SA 3BTDE 4JZ1A 2TGAA 3A8AA 1A46H 4Y11E 4TYDA 1O2PA 2FI4E 1DWBH 2OP9A 4KGAA 1TBQH 2QIQA 3LIWA 3MI4A 1BA8B 2B0FA 3KCGH 1C5OH 2QYIA 1ARBA 4KTCA 1C1RA 4RSPA 4FUEA 1AB9C 1FMGA 2A1DB 2RA0A 3PTBA 4D7FA 5JYIA 3ZZCA 1CT4E 3RXGA 1O36A 4WWYA 3GY4A 1T31A 1NU7B 1TOMH 4UDWH 1ZHRA 5FHTA 2OUAA 4ZXXH 4H6SB 4K1TA 3M61U 2FX6A 2EC9H 3LGYA 2FLBH 3EAJA 5LGOA 7GCHG 1OWJA 1AVGH 2D8WA 1HUTH 1P8VC 2G5NA 1O2LA 1TWXB 1NZQH 1O5DH 1FPHH 1Z6JH 3QDZB 1ZMNA 2ASUB 1QFKH 2PV9B 3U69H 1LHCH 3QLPH 2PW8H 1V2WT 4ZKSU 1QB1A 1WAYB 4JK5A 5F6MA 2FI5E 1ETSH 1SVPA 3HKJB 2OC7A 3TNTA 2WPMS 3K6YA 4TY6A 1HJAB 3H7TA 3GICB 1JRTA 4GAWA 1SOZA 2SGEE 1EJMA 3SN8A 2CHAC 2NU4E 3GOVB 2ODQA 3SV2H 1XUHA 1N1LA 2J95A 2HGTH 5DKMA 4NZLA 2Z94A 1F0RA 3EDXB 2FDAA 2NU0E 1AN1E 1S5SA 5E8EH 4ABFA 1CBWC 3P17H 3A8BA 3KN2A 4WMEA 3SI4H 1BTYA 4YLUA 1P3EA 1TAWA 4NZQA 1EQ9A 4A1VA 4D7GA 1AKSA 1ELGA 3TPIZ 2FP7B 2IJOB 1S85A 2P8OC 4XSKU 5SGAE 4BXWA 1GCTC 1UTMA 1UVPA 4I31A 2GDDA 3S7KB 2R0LA 1QBOA 3IG6B 3KGPA 1J17T 1Q2WA 1FV9A 2XBWA 1TNKA 1TMBH 3M5MA 1ELCA 3BG4C 3RC6A 1ID5H 1G37A 3P8FA 3BTGE 4K69A 2QF0A 4CHAB 3D49H 2G4UA 3UTUH 5CE1A 1TE0A 3P95A 3RC4A 3ZZ5A 4DOQA 1BBRK 1KIGH 3TGKE 3QGJA 2XYAA 1GG6C 1TA6A 1DY9A 2F9VA 2HALA 1BMLA 1S6HA 2WV5A 3A88A 1IQIA 4OS5A 3E3TA 2F9UA 3PO1C 1TMUH 4F49A 5A8XA 2BM2A 2VU8E 2XW9A 3O8CA 1O3KA 1QCPA 1SR5C 1P10A 1TGCA 1Z8GA 1W0YH 2D1JA 1MH0A 5JPMH 1O3EA 4AYVB 5A0AE 4OGYA 2BVXH 3K6ZA 3TLOA 4MDSA 1IQEA 1CO7E 1Z8IB 2QV1A 1G32B 2V6NA 4K60A 3LGWA 3NXPA 2VGCB 2CMYA 3SUFA 1IHSH 2ZFRH 3PMHB 4MNVA 1NROH 2GVFA 1YPLH 3BTQE 4E05H 1NFXA 1JXPA 4ZHAA 1DUAA 3GY2A 1IQMA 4XOJA 3FP8E 5B6OA 1MTSA 4MPVA 1HXEH 3OSYA 2FOMB 3LGIA 1G3BA 4WXVA 3F9EA 1N8OB 1LQEA 4A7IB 2QN5T 2Y5FA 3MMGA 1VGCC 3QN7A 3Q76A 3SORA 1EKBB 1T8MA 4YTAA 5F8XA 1BTXA 3WY8A 1PPFE 2FX4A 1WYKA 1WBGB 2SNVA 1ELBA 1RIWB 2BX4A 1HRTH 1DE7H 4H6TA 1GBHA 2AMPA 1BJUA 2P16A 2VIWA 4X1SU 4WJG2 4Y76A 4JCNA 4ZAEA 3RMNH 3VPKA 1HBTH 3SNBA 3H5CB 2EI6A 4CRAA 1ZYOA 1TNJA 1A1RA 1MTVA 1AZZA 1O3GA 1QBVH 5FPTA 2SGQE 3M37A 3SU5A 2FYQA 2EEKA 1CGJE 1H1BA 3BTKE 1PYTD 2PSYA 3I29A 3SGBE 3RC5A 1EOLA 3ESTA 3NKKA 1NN6A 1FY4A 1RS0A 1GMCF 1GJ6A 1QB9A 2PKAB 2OD3B 3Q00A 1QIXB 3AASA 5G4BA 2ALVA 2Z9KA 3QUMP 1T8OA 2BOKA 4ZHMU 2A7JA 1H8IH 1IAUA 3UREA 3KQEA 4I8HA 3B23B 4NG9H 1RJXB 4X6OA 1O34A 1ZPBA 1S84A 2FYRA 3I78A 2UWPA 2TPIZ 2AGIX 4GPGA 2UWLA 1DITH 1GHYH 1AWHB 1PQ7A 4Y79A 5FPSA 2BVSH 3F68H 1AUTC 2WPKS 3RLYH 1EATA 1SLWB 2OTVA 1IQLA 4UEHH 1TNLA 4INLA 4ZXYH 3A89A 2YOLA 2Q1JA 1RGQA 4GCHF 5HM2A 5EODA 2M5TA 3URDA 1ZMJA 4BANB 3B8JA 1GJBB 1IHTH 1NC6A 1O2QA 3KL6A 8KME2 2WPHS 5EQQA 3BV9B 3SU1A 1K9OE 2SGPE 1LHEH 1UO6A 4X2YA 1GMHF 5GPIB 1FJSA 2BTCE 3MNXA 2BLWA 1H8DH 2A4QA 2FS8A 3GCTG 1XVMA 4TWWA 2BD2A 4UONA 1O31A 2BD4A 3NUMA 1BITA 1GBIA 2STAE 4O9VA 1YF4A 1DFPA 1P2KA 2WUBA 4I8GA 4X2VA 4Q2KA 1C9TA 3UWJH 1DPOA 1PYTC 2ZWLH 5DK1A 1DXWA 4Y8ZA 2FO9A 1E37B 1GGDC 2F9OA 3ODFA 2GV7A 3NWUA 4FVDA 2VIDA 3FVFB 3M35A 4CHAC 5AHGH 1P2JA 2TGDA 1TPAE 3ITIA 3SOSA 3ZZAA 5A8ZA 1HAZB 3BEIB 2HNTE 1TX7A 4XFQA 1ELFA 2Y82A 2NU3E 1V2TT 3A7YA 2BOHB 1IQJA 1TGSZ 4ZKOU 2AFQB 3RXKA 3LGUA 4PROA 1GVZA 3D62A 4LZ1H 1SB1H 1TPPA 2BLQA 3MH5A 1E36B 1P2OA 1V2OT 1ANDA 1CQQA 1GI3A 2FOAA 5DPAA 2H6MA 1OWEA 1SSXA 3BTTE 3PLBA 1AHTH 1C2KA 1FN8A 4NFFA 1TIOA 2BY8X 5K0HA 3W94A 2TGTA 2VWMA 1OWIA 1QHRB 1UK4A 1TNGA 4JZFH 1AY6H 3D65E 1JIMA 4IC5A 2HNTC 2IPHA 1DY8A 1C5SA 3M36A 2VGCC 1BBRH 3F6UH 1K28D 2HRVA 6LPRA 1MTWA 4D9QA 3URCA 1C4U2 2Z9LA 1CA0B 4YZUA 4X8VH 1AQ7A 1IQFA 2A2XH 2BDHA 2FTMA 3A82A 3E0NB 3GCOA 5GDSH 3SU3A 1UHBB 1C2EA 1YLDA 1WQVH 1ZHPA 2I6SA 1ZTJA 5C5OA 1L2EA 1C2FA 2ZU1A 1IQNA 2VVVA 4YOGA 6GCHG 3DFJA 1N8OC 2Z9GA 4X0WU 3MNCA 1IQHA 1BOQA 2XTTB 1BIOA 1XKAC 1O3NA 1YBWA 3CS0A 3LONA 3SHAH 4FUGA 2GD4B 4IBLH 3ZZ6A 1F0SA 3MYWA 1TRNA 1Y5AT 3TK9A 3A7TA 1KYNA 1G2MA 3PMAB 1RIWC 1SBWA 4Z6AH 1KXFA 7GCHF 1ESAA 2HVXA 4CR5A 2F9BH 4X2WA 4NFEA 2A2QH 1Z8JB 1ZJKA 1F5LA 2J92A 1RTFB 2FEQH 2A32A 2B5TB 1W10U 1YCPH 1E0FD 2R3YA 1HPGA 1UMAH 1W7GH 1CHGA 1UVUH 1G36A 4AORA 5H4IB 1GJ7B 3RXVA 2G00A 1EP6A 1J15A 1C5TA 2PKSB 1ETTH 5C3NA 4MNXA 4FXGH 2ZGXH 3IWMA 1BRAA 1NRPH 1O5BB 4ZH8A 2BY9X 2H5CA 4GUXA 1OP8A 1DXPA 3RXCA 3TU7H 3RXMA 2AYWA 2IOTA 3U1IB 2QA9E 1KXAA 2BD7A 1SGYE 2EA3A 1S82A 1DWEH 1JBUH 1LKAA 3K65B 1ELTA 1XXDA 1N6XA 3KQCA 2FOBA 1O3CA 1FONA 1SI5H 2BDBA 3PB1E 4ESTE 5EQRA 5HXFA 1AGJA 2P3TB 3PYHA 2ZGBH 3QGNB 1Y5BT 1GJ5H 1O3MA 1TGNA 1LCYA 3UNSA 5FCRA 3R3GB 3GY6A 1ANEA 2PKAA 1OOKB 3T29A 1LVMA 4CRBA 1FY5A 4K3JA 1O30A 2Z3CA 1D6RA 4I8JA 4NIWA 3SZNA 3TJVA 1AFEH 4E06H 4WXIA 1C2HA 1ZSLA 3TH3H 1A3BH 4I7YH 2Z6BD 4FUBA 4Z0KA 1O32A 3SNAA 1NRSH 5HM9A 3AW0A 2ZHFH 3HK6B 2TBSA 2QCYA 1O2ZA 2XC4A 1D4PB 3P8NA 1V2ST 2OLGA 2OXSA 2ZGJA 3RXDA 3ATIA 5EW1H 1OWDA 3SUDA 1O3HA 3SU2A 2H9TH 2FLRH 3ATLA 2ZF0H 1PPEE 4KP0A 3SU6A 3M3SA 4FUFA 1FY8E 2H2ZA 5C5NA 1FN6A 1UVTH 3PWCA 5GCHG 2ZDAH 2Y81A 1EUFA 1O2RA 1O2MA 1DX5M 4AFZA 2KAIB 4X8SH 3U98H 2ZFSA 3ZZ8A 4UFEH 4CH2B 3EQ0H 1EOJA 1AWFH 1LMWB 1ZTLA 4YLQH 1ZMLA 2THFB 4ISOA 2RA3A 5ABWA 1G3EA 1OXGA 1GBFA 1HCGA 2VWLA 5AFZH 5F8ZA 4MPXA 1UCYK 4JMYA 4KELA 1KLIH 4BXSA 3EA9A 4R8TB 3S9CA 3TGJE 1S0QA 2NWNA 3QWCH 2G4TA 2WYJA 2ZG0H 1VCPA 1TRMA 8ESTE 2G8TA 7LPRA 1BT7A 3MWIU 1OWKA 4TPYA 3TK5A 1GJ8B 2Y5HA 1H9IE 1O37A 5CMXH 1O3FA 7ESTE 1SGIB 2CGAA 3PM3A 3V0XA 3PLPA 4WH6A 3NK8A 1C5RA 4ISHH 1ZLRA 2NU1E 3P6ZB 1Y3WA 1THPB 3ZV9A 4X1NU 1ZGIA 1SLXB 1JMOH 2FODA 1YKTA 1HAOH 2BXUH 4ISIH 2Q6GA 4DW2U 1XM1A 2BZAA 1Z1IA 3MO9A 2ANKH 2XBXA 1S6FA 1C5XB 1CA0C 4ABDA 3ZVAA 1P57B 3SI3H 2A7HA 3LGVA 3HPTB 3ATMA 2ZO3H 1D3DB 1GJ4H 3ZVFA 2LNCA 1J8AA 1H4WA 1DSTA 1O2NA 4Y0YE 2AEIH 1GI9B 2QXGA 1GI5A 4GHQA 2NU2E 4Y7BA 1C5QA 1X7AC 2GTBA 2VIVA 3SNEA 2ANYA 2G81E 3KQDA 3SV7A 3BTME 2XBVA 4Y10E 1MAXA 4BNRA 1O3AA 3KF2A 5F03A 1UHBA 3FP7E 1S83A 1EJAA 5L30H 1MD8A 1ZOMA 3MU4A 3RUOA 4RKOB 5C1YA 1FQ3A 1OX1A 4I8KA 6ESTA 3RU4D 1LQDB 1MKXH 4LOYH 3LC3A 4U2WA 4AFQA 3PROA 4AGJA 1GI0A 3Q3YA 2PLXA 1Y3YA 1TQ7B 1ABIH 3GDSA 2VJ1A 3RU4T 1UVSH 2PKSC 4MNYA 1GDQA 2W7UA 3FZDA 3VGCB 1GBKA 1L1NA 1UTLM 1GHZA 1EB1H 1TX8A 1C2GA 1FY1A 3M3TA 1F2SE 5EPNA 2ZFFH 2A5KA 4JYUH 1XXFA 1YM0A 3RXBA 3AAUA 3MO6A 1MQ5A 1AIXH 5T6DA 1XUIA 4DVAU 4YOIA 1C5MD 3SQHE 4YOJA 1IQGA 2YNBA 1PJPA 4M7GA 1BHXB 5J4SA 3V12A 1NRQH 2C3SA 3E6PH 3HGPA 1CE5A 1P0SH 1A3EH 2BY5X 2EI8A 1A5IA 1O3OA 2FOCA 4UFFH 3MNBA 2V0BA 2VH6A 1HJ8A 5J4QA 1V2KT 4QT8C 1F0TA 2BY6X 2OCVB 1MTNB 1TFXA 3BTFE 3SNCA 2VIPA 1F0UA 1TOCB 1C1TA 2C8WB 2FOHA 3GISB 2H5DA 1VZQH 2Z7FE 2ZZUH 1W11U 1MCTA 2B8OH 1Y3XA 1DS2E 1GDUA 5DP3A 5T6FA 1GHBG 4K8YA 1RFNA 2Z9JA 4WMDA 5C20A 3SGQE 1FZZA 1O35A 1P02A 2VWNA 1V2RT 3ZZ7A 4AZ2B 1UVOA 2BDCA 1F7ZA 1AFQB 1QNJA 4TWYA 3SO3A 3T62A 4YO9A 1LHGH 1BB0B 2RCEA 1SHYA 2ULLA 1JWTA 1S0RA 1NM6A 4MG3A 1TGBA 3SUGA 3I77A 1DOJA 1SMFE 1L1JA 4BTUB 1ZPZA 1ZR0A 1A0LA 1LVOA 3LH1A 2VIOA 4CBOA 2AS9A 4Y7AA 5CHAB 4BAHB 2P59A 3ZZ3A 5EW2H 1B7XB 4KKDA 3RMLH 3SV9A 5JBTA 3GY3A 4Q7XA 4MTBA 3VFEA 1O2VA 4WH8A 1KSNA 4B2AA 2CXVA 3STIA 3SV8A 1DWCH 1D3QB 4R0IA 5HGGA 1YCPK 4UFGH 3BIVH 4JYVH 2FWWA 3SW2B 3O8BA 1G9IE 1GL0E 1HV7A 1LPKB 3VEQB 1HXFH 4OS6A 1EXFA 2PGBB 1C9PA 3A8DA 1W3CA 2KAIA 4CBNA 1SQOA 1EAXA 3MFJA 3MOCA 1TMTH 4AYYB 1F5KU 2R3UA 5I46H 4Y8XA 1TNHA 2DE8A 1SGTA 1K1NA 5C1UA 2HLCA 1C1OA 1THSH 4NWLA 1UCYH 5C2ZA 4CREA 1O5AB 1YP9A 1N6YA 2ZHEH 3A86A 2H9HA 4SGBE 2GP9B 5FXLA 2PHBA 1NESE 3ZZBA 4HI3A 1OP0A 4X1PU 3VB4A 1JRSA 1TX6A 1P05A 2J34A 3U9AH 3Q3XA 1GBMA 1XVOA 3RMMH 1ELDE 5FCKA 1G3DA 1GWAA 3AVZA 2O8TA 2ZTXA 3RXIA 2HNTF 5DGJA 1VITF 1KDQB 2BQ6B 2AMDA 1ETRH 3DT0H 1HAYB 4NIXA 2GCHG 1O2JA 4RKJB 1LPZB 1T32A 4BOHA 5LPRA 4CRDA 2ZHQH 1W14U 8GCHF 3PV4A 4K1EA 4CH8B 3A85A 1GHAF 2ZPRA 4AX9H 1QGFA 1PPGE 3HGNA 1BRCE 3W95A 4THNH 1GI7B 1RD3B 2R0KA 1WQSA 2FESH 1HJAC 3EE0B 1SGCA 3SHCH 4DJZB 3O8RA 3BEFB 1QQUA 1QL7A 1FY3A 2HPPH 2BLOA 1P2NA 2ZU2A 1O2XA 2BD3A 3K9XB 2AGEX 3SUEA 3RXJA 5FBIA 1FPCH 4X8TH 1W2KH 3BF6H 1C1UH 1MBMA 3GYLB 3VGCC 3AW1A 1C5WB 2JH5D 1YC0A 1ZSKA 1WOFA 1P9SA 4AFSA 1EZXC 4CRCA 2AGGX 2FZZA 2OQUA 4CR9A 1ELEE 1NPMA 2ZFQH 3GY5A 2WPLS 1YPJH 2Z3DA 1Q31A 1YGCH 4ABJA 2C4FH 1ARCA 4OS7A 2C8YB 4D8NA 5A09A 2P3UB 4H42U 3BIUH 3RXTA 1MAYA 4I8LA 1BRBE 2GV6A 4X2XA 1O0DH 2FS9A 4AOQA 1BBRE 3P92A 2GX4A 4AFUA 1KY9A 1C1PA 2A5IA 1Z71A 1SGEE 2P94A 3ZZDA 1TBRH 1TB6H 1TPOA 1MTNC 3ZVEA 4X1RU 1O2KA 3ENSB 2ZDNA 1H9LB 3VXEH 2W26A 3SJ8A 1P9UA 2J2UA 3VB6A 3EA8A 5DP6A 1GBJA 3TITA 1BQYA 3A7XA 2UUJB 1YCPM 3L6PA 1WCZA 3OYPA 3PWBA 5FBEA 1O3JA 1K1PA 1TYNA 2PGQB 1SFQB 1WTGH 1SFIA 2ZTYA 3A81A 1UTJA 4H4FA 1KTSB 1AFQC 1UK3A 1GMDG 2CF8H 2ZU5A 1GJ9B 1BJVA 4CRFA 4E7NA 1KLTA 4LXBH 1C5VA 5E0JA 3SJKA 4GVUA 1WUNH 3M5OA 1XUFA 2XCNA 3LPRA 5CHAC 2J94A 3ATWA 3T28A 5BPEA 3VB7A 4K5ZA 2ANMH 1UJ1A 3KQBA 5HMAA 1QL8A 1P11E 1O3BA 3PMBB 4DG4A 1HAVB 1O3LA 1A5HA 3E0PB 1O5EH 3A84A 4ABEA 2BX3A 1MKXK 2Y5GA 4AGKA 2ZQ1A 4TY7A 4ISNA 2D2DA 1UTQA 1LVBA 4BAQB 4E7RG 1QR3E 5EGMA 2QF3A 4I33A 5A0CA 1RTLA 3ZVCA 2CV3A 1GBEA 3GDUA 1VR1H 1T8NA 2SGAA 2CN0H 1VITH 1P06A 1DICA 1EZUC 3M5NA 1O3IA 1A61H 3UOPA 3OY6U 2O8WA 5JBAS 3P70B 4FUIA 2ZECA 5LPEA 5E2OA 5T3HA 1HB0B 2PTNA 2A4GA 1INCA 3GCHB 3M3VA 4B1TA 2ZU3A 5DP7A 2A4OA 3SJOA 4CRGA 1HIAB 2XXLA 3RM2H 1C4V2 1D6WA 3VB3A 4AN7A 1O2YA 4DIIH 1HAXB 2ZCHP 2ZTZA 1DLKB 2OC8A 5T6GA 5JBBS 1TABE 4XBCA 1GMCG 2SNWA 1QB6A 3LDXH 3ZVDA 2RDLA 3FP6E 1SG8B 1O2WA 1C5ZB 1DDJA 1QTFA 1EZSC 2J4IA 4AG1A 1AE5A 2O8MA 1Z7KA 4DCDA 2VVUA 4FVBA 1C1NA 2VWOA 4NA9H 1MU6B 4A5TS 2FM2A 4IMQA 2BY7X 1HAGE 2AIQA 1PPCE 5L2ZH 5ETXA 2ESTE 2WINI 1BMNH 1KDQA 1C4Y2 1LKBA 2C8XB 3MU5A 1HYLA 2ODYB 1K22H 1Y8TA 3MU0A 3OY5U 1YYY1 1B0EA 1KXBA 1K21H 2R2WU 4NCYA 2P93A 1NFYA 2F3CE 1QA7A 1QRWA 1ESBA 1TBZH 1D3TB 1CVWH 1GI6A 1LVYA 1C2JA 3DD2H 3A7WA 1OKXA 2VB0A 1ZJDA 2FIRH 3NZIA 4DURA 3TK6A 1P2MA 2ZCLP 1K1LA 3SGAE 1H9HE 3RM0H 1UTNA 3LGTA 5DP4A 3QO6A 1ESTA 1GMHG 2P95A 3PMJA 2ZI2H 2BMGB 3L3TA 3EA7A 3UNRA 1MTUA 1HLTH 3V13A 2ZP0H 4ABHA 4NIVA 1S81A 2BD9A 2C93B 2A5AA 4ZROA 3BG8A 3E16B 1GHBF 9ESTA 4VGCB 3PO1B 3M7QA 4B76A 2ZPQA 2BQ7B 2ZHWH 4IW4E 3MH6A 1GI1A 5EPYA 3U1JB 1AUJA 4UFDH 3PLKA 2K1QA 3FAOA 2GMTB 3HATH 5DP9A 2ZHDA 1T4VH 2I6QA 1XKBC 4HTCH 2GCTB 5F8TA 1DANH 3GCNA 2G52A 3Q3KA 2A0QB 5EXLA 4AG2A 3LC5A 1QJ6B 1O33A 1AI8H 1P2IA 1XUJA 4K8BA 3RLWH 3TH4H 4MLFB 1V2LT 1ABJH 1EX3A 1P03A 4YESB 1EAUA 1LHDH 1BTHH 2AMQA 5PTPA 4A1XA 1BRUP 3F9HA 3RMOH 2FTLE 2J38A 3SV6A 1AVWA 1GVLA 4DIHH 1ZPCA 4NGAH 1PPZA 1C5LH 1AMHA 3V3MA 1VGCB 4K1SA 1V6DA 1XX9A 1YPHE 1DUEA 4ZUHA 2XC5A 4BAMB 1QRXA 3QTVH 5E0HA 1OYQA 1SQAA 2FI3E 1A0JA 5BRRE 3RXFA 3UQOA 3DFLA 2C8ZB 2HWLB 1MU8B 1SGFA 1L0ZA 5IYTA 1Y59T 1K1JA 1WTHD 3MU8A 5A2MH 5HYOA 3CENA 1BCUH 3FANA 3PTNA 1KTTB 2VINA 2QY0B 3HKIB 3ODDA 3SJ9A 3QZQA 2BDIA 3EGKH 1G30B 4IGDA 2BDGA 1MZDA 1YPHC 1U6QA 1C5YB 3RXUA 2FOGA 1MUEB 4MPWA 3UY9A 1C1MA 1XUGA 1AU8A 1AD8H 3S0NA 1SGFG 2ZA5A 1FLEE 1TLDA 1NRRH 1D9IA 4LK4A 1CGIE 5K7RA 3LJOA 1HAVA 4Q7ZA 3BTWE 1FAKH 2OQ5A 4NWKA 1LO6A 1O38A 2GCHF 1K1OA 5EQSA 3BTEE 1TA2A 1W8BH 3GCHC 3E90B 5JB9S 2VVCA 1NO9H 2Z3EA 1NFUA 3QZRA 1ORFA 2LPRA 2P3FH 6CHAB 1JIRA 2SFAA 1EP5A 2DE9A 2Y7XA 2CF9H 2WYGA 1QBNA 1CT0E 4ABBA
chains in the Genus database with same CATH superfamily
1CHOG 2V3MA 1MD7A 2F83A 2ZU4A 4J1YA 3U8OH 3RDZA 4KTUA 2V3HH 4U01A 1EPTB 5AF9H 1ZHMA 3RXAA 1EAIA 3UOUA 1MZAA 1HFDA 1MKWK 1Q3XA 1SLVB 2WPIS 3IITA 2HOBA 2IN2A 2WV4A 1NTPA 1OSSA 1VJ9U 2BYAX 2PR3A 4ABIA 1HAHH 2Y80A 1LPGB 4FU9A 1AZ8A 1KLJH 2ZNKH 4OGXA 2OC0A 1SGRE 1K1MA 1YLCA 1HIAA 5EOKA 4WVPE 1Z8RA 1MBQA 4DY7B 3C1KA 2FOFA 1O2SA 2A45B 3UR9A 9LPRA 3QK1A 2Y6TA 4TPIZ 4U32A 3ZVGA 1TGTA 1FIWA 3GCTF 2W6ID 1KMHB 2BDAA 1OHHD 3Q77A 1GDNA 1O2IA 2GZ7A 1GBLA 1K1IA 2F9NA 1WV7H 2H9EH 3BN9A 3LT3A 3JZ2B 3RU4E 2SGFE 1KXDA 2XBYA 1NU9A 1J9CH 4UD9H 3SU0A 2ILNA 4RI0A 3TVJB 4INKA 1HDTH 2Q6DA 1GGDB 2Z9IA 3ZYDA 3ZZ4A 1CSOE 2R2MB 3OEHD 3UR6A 2BD5A 1W7XH 4ABAA 3KQ5A 1DSUA 3QTOH 2KM0A 4FUJA 1P04A 3TJUA 4BTIB 5EU8A 2OK5A 5CDFE 5I25A 3T5FH 3SBKA 2LP6A 5FX5A 2WUCA 1QA0A 1NFWA 5EJ1A 3C27B 5JDUB 1F92A 3TGIE 1UCYE 4GSOA 3DUXH 3MH4A 1ELVA 4VGCC 2C90B 2F9PA 3GY7A 4RN6A 3SQEE 2KCPA 1GL1A 2L6OA 3DHKH 4IN2A 3ZV8A 5C17A 1GMDF 5FX6A 1V2MT 2ZGHA 4OS2A 1G3CA 3ZZ9A 1RXPA 2GMTC 2W5EA 4ASHA 3RXEA 3F0PA 1QRZA 3STJA 1DWDH 3KIDU 1EASA 5GIBA 2GCTC 2XRCA 3KYFA 1BHXF 1ANBA 1O3PB 2A7CA 2XCFA 4FU7A 4A92A 1QJ1B 2GZ8A 2F4LA 3UNQA 2ZC9H 4XDEA 1UTKA 2BDYA 1V2VT 1NS3A 1OS8A 4XD7D 3E8LA 4MPUA 3V7TA 1OWHA 3LJJA 2QGRA 5GJ4B 2ALPA 3TJNA 4TSFD 2PSXA 3A83A 1YPMH 3NPSA 1BTPA 3VXFH 6GCHF 3RP2A 2VBCA 4MVNA 3G01A 1A5GH 2FOEA 3JZ1B 2TIOA 3D23A 3GY8A 1C2IA 2EI7A 2JETB 1BUIA 1ZRBA 3LH3A 3F9GA 2GT7A 3S7HB 1PFXC 2UUKB 2BXTH 1GI8B 3WWBA 1XUKA 1O5GH 8LPRA 2STBE 2RG3A 4DGJA 2O8UA 1WU1A 2FXRA 2PUXB 1A2CH 1L1GA 2ZIQH 4OS4A 1IOEA 2BQWB 5AVDA 1LHFH 5FPYA 3P8OA 3UFAA 1CGHA 5FAHA 3P8GA 1B0FA 3FZZA 4INHA 1SL3A 4MNWA 3F3BA 3MH7A 4D9RA 5TCAA 1FDPA 1KXCA 2ZCKP 1GBTA 3CNRA 4Y8YA 1UTPA 2GKVE 2KCOA 3BEUA 1BMMH 4IMZA 4X6NA 5A0BA 4NA7A 2GGVB 1TPSA 2K8IA 1P01A 2TRMA 1EAWA 1GBBA 1O2UA 1TNIA 4IN1A 2UWOA 3MNSA 1ACBE 1BTZA 1FUJA 1W13U 5JB8S 2BZ6H 3OTJE 1TRYA 1JOUB 3UWIA 1EB2A 1O5FH 3UAIC 1QY6A 1YPGH 3S69A 4LZ4B 4Y0ZE 1O39A 2JH6D 2OBQA 3S9BA 3B9FH 7KMEH 3SJIA 1M9UA 2PTCE 3N7OA 1O3DA 2IPQX 4WMFA 4AB8A 2BD8A 6CHAC 2QXJA 4YT6H 3MO3A 1UTOA 4YM9A 3KYGA 1C1QA 2OINA 2F43B 1O2GH 1ELAA 2W3KA 1EPTC 1SHHB 5GXPA 2ZDKA 4X6MA 2JH0D 4O97A 2O9QA 1IQKA 3L33A 3O8DA 1K2I1 3GYMA 2Q6FA 1HAIH 1ZZZA 5E2PA 5LH8A 2WHXA 2ANWA 3OX7U 4JYTA 1O2OA 3ZYEA 3S9AA 2VH0A 1SQTA 1SGPE 2Y7ZA 1AE8H 4OS1A 1A7SA 2D26C 1GVKB 4NIYA 2SGDE 2W3IA 1T8LA 2PUQH 3UB0A 1EPTA 1NT1A 1Y3UA 1NRNH 4B74A 4U30A 3QX5H 2VNTA 5GCHF 1C1SA 1Z6EA 1OPHB 2XC0A 1MKWH 1AVXA 3FFGA 5EXNA 1BMAA 1CA8B 5EG4A 3HK3B 4FUHA 1P12E 5ESBA 3T26A 2JKHA 1B5GH 4JZDH 3KNXA 5L2YH 1Y5UT 1MQ6A 5A8YA 2ZGCA 1BZXE 3A7VA 1W12U 4Y71A 1E38B 2OBOA 1P2QA 1FAXA 5GNDA 4X1QU 2HVYB 2ZDMA 1CT2E 3RXRA 3KEEA 1PQ8A 3F1SB 4MQAA 1QURH 3U8TH 3RXHA 1FXYA 4YT7H 1SC8U 3BSQA 2UUYA 3UPEA 1GPZA 3TNSA 2ZKSA 1FNIA 1SGDE 4FUDA 1MCVA 1PQ5A 1QJ7B 1RRKA 1V2UT 4B73A 5HIYA 1YPEH 4B6EA 4B2CA 3OTPA 1PPHE 2BB4A 2J9NA 1O2HA 2F91A 3OU0A 3MTYA 5JBCS 1HAPH 1AB9B 1ANCA 1V2JT 1V2QT 2H1UA 5DP5A 1V2PT 2B7DH 1C5PA 3UQVA 1TONA 3OFND 3LU9B 1PPBH 2V3OH 1C2LA 4ZKRU 1SOTA 3SNDA 4B2BA 3A7ZA 5C1XA 4XE4A 1YPKH 1T7CA 3F9FA 4IS5A 1RTKA 3T25A 2A4RA 1C5NH 3ATKA 1P3CA 1C1VH 2ZDLA 4BAOB 3UIRA 2QXHA 3H09A 5TCCA 2R9PA 1OYTH 1L4DA 2QXIA 4B71A 1VCWA 3AAVA 4JK6A 2G55A 1QL9A 1GBDA 1GHWH 4J2YB 1GHVH 3K2UA 1XMNB 4ZCNA 3E91A 1ZTKA 3H7OA 1ZSJA 1UK2A 2PWXA 1C2DA 4FU8A 2JETC 2FPZA 4O3TA 1OP2A 1GBCA 5DO4H 1O2TA 1BTWA 2ZPSA 4A6LA 2EQNA 3M5LA 3RXOA 1FI8A 1HGTH 4XBBA 4UE7H 2ZEBA 2OC1A 3DA9B 1P09A 4IC6A 2WV9A 1PQAA 4A1TA 1BTUA 3RXSA 1TALA 3A8CA 3OEED 3N7DA 1DT2A 4NSYA 3U8RH 2DUCA 3GDVA 4ZKNU 1AKSB 1VITG 5ESTE 2WPJS 4GHTA 3RXPA 1VJAU 5DG6A 4SGAE 4NSVA 2VIQA 3RXQA 2CHAB 5DP8A 1GJCB 2YNAA 1CHOF 3EYDA 1C5UA 1DVAH 1LDTT 3A80A 5TJXA 4KTSA 8GCHG 1CU1A 1QQ4A 2V35A 4X8UH 3ZVBA 3E1XB 1GHAG 1CBWB 2XNIA 1V3XA 5EXMA 1FIZA 4WY3A 4ASUD 1TQ0B 3TIUA 1O5CB 3M7TA 2PFEA 1Z1JA 4NA8A 4ZHLU 4I86A 4B75A 3KHVA 1LTOA 2ZDVH 1G2LA 2P8OB 1BDAA 1EZQA 1W0ZU 1SGNE 1GCTB 1V2NT 2QAAA 1SGQE 3VB5A 4AB9A 5L6NH 2B9LA 5KEDA 4GCHG 4BTTB 2AH4X 2A31A 4JZIA 4O03A 1GJDB 1DLEA 2AERH 3LOXA 1A0HB 1VCQA 2ZQ2A 1HNEE 4Y6DA 1F5RA 3BG4B 1C1WH 4DT7B 1KXEA 1GI2A 1E34B 2BVRH 1THRH 5IDKA 1E35B 3WWFA 2HLDD 1Y3VA 3CP7A 3M7UA 3ZIAD 3A87A 5AFYH 2CJIA 4X6PA 2ZFTA 3BTHE 1GCDA 2HPQH 4FUCA 2FMJA 1GI4A 4WF8A 1GG6B 1AO5A 4BAKB 1ZRKA 4Q80A 2BHGA 1NY22 3MU1A 2O8LA 3ELAH 4F4OC 1J16A 4O3UA 1GJAB 2GT8A 2L74A 1L4ZA 4HFPB 3SU4A 2XWAA 3MHWU 5C67A 4XBDA 3T27A 2GZ9A 1MMJN 1EJNA 3R0FA 2ZFPH 1DM4B 4D76A 1SLUB 5E0GA 1SPJA 4HZHA 1GBAA 4ABGA 2QC2A 3NCLA 1T4UH 2ODPA 2BLVA 1WSSH 3T2NA 3TJOA 4K2YA 1ZGVA 4I32A 1J14A 2G51A 5DJ7A 4Q7YA 3DSOA 2UUFB 3TH2H 1C2MA 1D3PB 4ISLA 5LPFA 3RXLA 1GHXH 4GLYA 3CS7A 3UUZA 2XWBI 2TGPZ 2GDEH 4HGCA 2G5VA 4JZEH 2AIPA 1HJ9A 5GWZA 1A4WH 4ZMAH 3LKWA 2W7SA 3BTDE 4JZ1A 2TGAA 3A8AA 1A46H 4Y11E 1W0JD 4TYDA 1O2PA 2FI4E 1DWBH 2OP9A 4KGAA 1TBQH 2QIQA 3LIWA 3MI4A 1BA8B 2B0FA 3KCGH 1C5OH 2QYIA 1ARBA 4KTCA 1C1RA 4RSPA 4FUEA 1AB9C 1FMGA 2A1DB 2RA0A 2K0QA 3PTBA 5KGOA 4D7FA 5JYIA 3ZZCA 1CT4E 3RXGA 1O36A 4WWYA 3GY4A 1T31A 1NU7B 1TOMH 4UDWH 1ZHRA 5FHTA 2OUAA 4ZXXH 4H6SB 4K1TA 3M61U 2FX6A 4XRNA 2EC9H 3LGYA 2FLBH 2JJ1D 3EAJA 5LGOA 7GCHG 1OWJA 2IJD1 1AVGH 2D8WA 1HUTH 1P8VC 2G5NA 1O2LA 1TWXB 1NZQH 1O5DH 1FPHH 1Z6JH 3QDZB 1ZMNA 2ASUB 1QFKH 2PV9B 3U69H 1LHCH 3QLPH 2PW8H 1V2WT 4ZKSU 1QB1A 1WAYB 4JK5A 5F6MA 3FN8A 2FI5E 1ETSH 1SVPA 3HKJB 2OC7A 3TNTA 2WPMS 3K6YA 4TY6A 1HJAB 3H7TA 5HIZA 3GICB 1JRTA 4GAWA 1SOZA 2SGEE 1EJMA 3SN8A 2CHAC 2NU4E 3GOVB 2ODQA 3SV2H 1XUHA 1N1LA 2J95A 2HGTH 5DKMA 4NZLA 2Z94A 1F0RA 3EDXB 2FDAA 1WXRA 2NU0E 1AN1E 1S5SA 5E8EH 3SYJA 4ABFA 1CBWC 3P17H 3A8BA 3KN2A 4WMEA 3SI4H 1BTYA 4YLUA 1P3EA 1TAWA 4NZQA 1EQ9A 4A1VA 4D7GA 1AKSA 1ELGA 3TPIZ 2FP7B 2IJOB 1S85A 2JJ2D 2P8OC 4XSKU 5SGAE 4BXWA 1GCTC 1UTMA 1UVPA 4I31A 2GDDA 3S7KB 2R0LA 1QBOA 3IG6B 3KGPA 1J17T 1Q2WA 1FV9A 2XBWA 1YY3A 1TNKA 1TMBH 3M5MA 1ELCA 3BG4C 3RC6A 1FX0B 1ID5H 1G37A 3P8FA 3BTGE 4K69A 2QF0A 4CHAB 3D49H 2G4UA 3UTUH 3W1EA 5CE1A 1TE0A 3P95A 3RC4A 3ZZ5A 4DOQA 1BBRK 1KIGH 3TGKE 3QGJA 2XYAA 1GG6C 1TA6A 1DY9A 2F9VA 2HALA 1BMLA 1S6HA 2WV5A 3A88A 2J98B 1IQIA 4OS5A 3E3TA 2F9UA 3PO1C 1TMUH 4F49A 5A8XA 2BM2A 2VU8E 2XW9A 3O8CA 1O3KA 1QCPA 1SR5C 1P10A 1TGCA 1Z8GA 1W0YH 2D1JA 1MH0A 5JPMH 2CK3D 1O3EA 4TT3D 4AYVB 5A0AE 4OGYA 2BVXH 3K6ZA 3TLOA 4MDSA 1IQEA 1CO7E 1Z8IB 2QV1A 1G32B 2V6NA 4K60A 3LGWA 3NXPA 4B6FA 2VGCB 4M9FA 2CMYA 3SUFA 1IHSH 2ZFRH 2QF5A 3PMHB 4HG6A 4MNVA 1NROH 2GVFA 1YPLH 3BTQE 4E05H 1NFXA 1JXPA 4ZHAA 1DUAA 3GY2A 1IQMA 4XOJA 3FP8E 2WZQA 5B6OA 1MTSA 4MPVA 1HXEH 3OSYA 2FOMB 3LGIA 1G3BA 4WXVA 3F9EA 1N8OB 1LQEA 4A7IB 2QN5T 2Y5FA 3MMGA 1VGCC 3QN7A 3Q76A 3SORA 1EKBB 1T8MA 4YTAA 5F8XA 1BTXA 2W6JD 3WY8A 1PPFE 2FX4A 1WYKA 1WBGB 2SNVA 1ELBA 1RIWB 2BX4A 5DSFA 1HRTH 1DE7H 4H6TA 1GBHA 2AMPA 1BJUA 2P16A 2VIWA 4X1SU 4WJG2 4RT1A 4Y76A 4JCNA 4ZAEA 3RMNH 3VPKA 1HBTH 3SNBA 3H5CB 2EI6A 4CRAA 1ZYOA 1TNJA 1A1RA 1MTVA 1AZZA 1O3GA 1QBVH 5FPTA 2SGQE 3M37A 3PRBA 3SU5A 2FYQA 2EEKA 1CGJE 1H1BA 3BTKE 1PYTD 2PSYA 3I29A 4F55A 3SGBE 3RC5A 1EOLA 4F48B 3ESTA 3NKKA 1NN6A 1FY4A 5B6LA 1RS0A 1GMCF 3F2HA 1GJ6A 1QB9A 2PKAB 2OD3B 3Q00A 1QIXB 1H8ED 3AASA 5G4BA 2ALVA 2Z9KA 3QUMP 1T8OA 2BOKA 4ZHMU 2A7JA 1H8IH 1IAUA 3UREA 3KQEA 4I8HA 3B23B 4NG9H 1RJXB 4X6OA 1O34A 1ZPBA 1S84A 2FYRA 3I78A 2UWPA 2TPIZ 2AGIX 4GPGA 2UWLA 1DITH 1GHYH 1AWHB 1PQ7A 4Y79A 5FPSA 2BVSH 3F68H 1AUTC 2WPKS 3RLYH 1EATA 1SLWB 2OTVA 1IQLA 4UEHH 1TNLA 4INLA 4ZXYH 3A89A 2XOKD 2YOLA 2Q1JA 1YWUA 1RGQA 4GCHF 5HM2A 5EODA 2M5TA 3URDA 1ZMJA 5C94A 4BANB 3B8JA 1GJBB 1IHTH 1NC6A 1O2QA 3KL6A 3AK5A 8KME2 2WPHS 5EQQA 3BV9B 3SU1A 1K9OE 2SGPE 1LHEH 1SQRA 1UO6A 2QE7D 4X2YA 1GMHF 5GPIB 1FJSA 2BTCE 3MNXA 2BLWA 1H8DH 2A4QA 2FS8A 3GCTG 1XVMA 4TWWA 2BD2A 4UONA 1O31A 2BD4A 3NUMA 1BITA 1GBIA 2STAE 4O9VA 1YF4A 1DFPA 1P2KA 2WUBA 4I8GA 4X2VA 4Q2KA 1C9TA 1BMFD 3UWJH 1DPOA 1PYTC 2ZWLH 5DK1A 1DXWA 4Y8ZA 2FO9A 1E37B 1GGDC 2F9OA 3ODFA 2GV7A 4ACBA 3NWUA 4FVDA 2VIDA 3FVFB 3M35A 4CHAC 5AHGH 1P2JA 2TGDA 1TPAE 3ITIA 3SOSA 5EJZA 3ZZAA 5A8ZA 1HAZB 3BEIB 2HNTE 1TX7A 4XFQA 1ELFA 2Y82A 2NU3E 1V2TT 3A7YA 2BOHB 4OM9A 1IQJA 1TGSZ 4ZKOU 2AFQB 3RXKA 3LGUA 4PROA 1GVZA 3D62A 4LZ1H 1SB1H 1TPPA 2BLQA 3MH5A 1E36B 1P2OA 1V2OT 2JIZD 1ANDA 2J97A 1CQQA 1GI3A 2FOAA 3MQKC 5DPAA 2H6MA 1OWEA 1SSXA 3BTTE 3PLBA 1AHTH 1C2KA 1FN8A 4NFFA 1TIOA 2BY8X 5K0HA 3W94A 2TGTA 2VWMA 1OWIA 1QHRB 1UK4A 1TNGA 4JZFH 1AY6H 3D65E 1JIMA 4IC5A 2HNTC 2IPHA 1DY8A 1C5SA 3M36A 2VGCC 1BBRH 3F6UH 1K28D 2HRVA 6LPRA 1MTWA 4D9QA 2J98A 3URCA 1C4U2 2Z9LA 1CA0B 3PV5A 4YZUA 4X8VH 1AQ7A 1IQFA 2A2XH 2BDHA 2FTMA 3A82A 3E0NB 3GCOA 5GDSH 3SU3A 1UHBB 1C2EA 1YLDA 1WQVH 1ZHPA 2I6SA 1ZTJA 5C5OA 1L2EA 1C2FA 2ZU1A 1IQNA 3PV2A 2VVVA 4YOGA 6GCHG 2EY4C 3DFJA 1N8OC 2Z9GA 4FETA 4X0WU 3MNCA 1IQHA 1BOQA 2XTTB 1BIOA 1XKAC 1O3NA 1YBWA 3CS0A 3LONA 3SHAH 3GS9A 4FUGA 2GD4B 4IBLH 3ZZ6A 1F0SA 3MYWA 3SZEA 1TRNA 1Y5AT 3TK9A 3A7TA 1KYNA 1G2MA 2KFWA 3PMAB 1RIWC 3U28C 1SBWA 4Z6AH 4DT4A 1KXFA 7GCHF 1ESAA 2HVXA 4CR5A 2F9BH 4X2WA 4NFEA 2A2QH 1Z8JB 1ZJKA 1F5LA 2J92A 1RTFB 2FEQH 4Z1MD 2A32A 2B5TB 3OAAD 1W10U 1YCPH 1E0FD 2R3YA 1HPGA 1UMAH 1W7GH 1CHGA 1UVUH 1G36A 4AORA 5H4IB 5C0TA 1GJ7B 3RXVA 2G00A 1EP6A 1J15A 1C5TA 2PKSB 1ETTH 5C3NA 4MNXA 4FXGH 2ZGXH 3IWMA 1BRAA 3OE7D 1NRPH 2LELA 1O5BB 4ZH8A 3N7EA 2BY9X 2H5CA 4GUXA 1OP8A 1DXPA 3RXCA 3TU7H 3RXMA 2AYWA 2IOTA 3U1IB 2QA9E 1KXAA 2BD7A 1SGYE 3FO8D 2EA3A 1S82A 1DWEH 1JBUH 1LKAA 3K65B 1ELTA 1XXDA 1N6XA 3KQCA 2FOBA 1O3CA 1FONA 1SI5H 2BDBA 3PB1E 4ESTE 5EQRA 5HXFA 1AGJA 2P3TB 3PYHA 2ZGBH 3QGNB 1Y5BT 1GJ5H 1UW7A 2WPDD 1O3MA 1TGNA 1LCYA 3UNSA 5FCRA 3R3GB 3GY6A 1ANEA 2PKAA 3NRLA 1OOKB 3T29A 2M2AA 1LVMA 4CRBA 1FY5A 4K3JA 1O30A 2Z3CA 1D6RA 4I8JA 4NIWA 3SZNA 3TJVA 3WW7A 1AFEH 4E06H 4WXIA 1C2HA 1ZSLA 3TH3H 1A3BH 4I7YH 2Z6BD 1COWD 4FUBA 4Z0KA 1O32A 3SNAA 1NRSH 5HM9A 3AW0A 2ZHFH 3HK6B 4RT0A 2TBSA 2QCYA 1O2ZA 2XC4A 1D4PB 3P8NA 1V2ST 2OLGA 2OXSA 2ZGJA 3RXDA 3ATIA 5EW1H 1OWDA 3SUDA 1O3HA 3SU2A 2H9TH 2FLRH 3ATLA 2ZF0H 1PPEE 4KP0A 3SU6A 3M3SA 4FUFA 1FY8E 2H2ZA 5C5NA 1FN6A 1UVTH 3PWCA 5GCHG 2ZDAH 2Y81A 1EUFA 3DSPA 2GJGA 1O2RA 1O2MA 1VKYA 1DX5M 4AFZA 2KAIB 4X8SH 3U98H 2ZFSA 3ZZ8A 4UFEH 4CH2B 3EQ0H 1EOJA 1AWFH 1LMWB 1ZTLA 4YLQH 1ZMLA 2THFB 4ISOA 2RA3A 5ABWA 1G3EA 1OXGA 1GBFA 1HCGA 2VWLA 5AFZH 5F8ZA 4MPXA 1UCYK 4JMYA 4KELA 1KLIH 4BXSA 3EA9A 4R8TB 3S9CA 3TGJE 1S0QA 2NWNA 3DSGA 3QWCH 2G4TA 2WYJA 2ZG0H 1VCPA 1TRMA 8ESTE 2G8TA 7LPRA 1BT7A 3MWIU 1OWKA 4TPYA 3TK5A 1GJ8B 2Y5HA 1H9IE 1O37A 5CMXH 1O3FA 7ESTE 1SGIB 2CGAA 3PM3A 3V0XA 3PLPA 4WH6A 3NK8A 1C5RA 4ISHH 1ZLRA 2NU1E 3P6ZB 1Y3WA 1THPB 3ZV9A 4X1NU 1ZGIA 1SLXB 1JMOH 2FODA 1YKTA 1HAOH 2BXUH 4ISIH 2KZ4A 2Q6GA 1XM1A 2BZAA 4DW2U 1Z1IA 3MO9A 2KCYA 2ANKH 2XBXA 3DCLA 1S6FA 5EJLA 1C5XB 1CA0C 4ABDA 3ZVAA 1P57B 3SI3H 2A7HA 3LGVA 3HPTB 5DN6D 3ATMA 2ZO3H 1D3DB 1GJ4H 3ZVFA 2LNCA 1J8AA 1H4WA 1DSTA 1O2NA 4Y0YE 2AEIH 1GI9B 2QXGA 1GI5A 4GHQA 2NU2E 4Y7BA 1C5QA 1X7AC 2GTBA 2VIVA 3SNEA 2ANYA 2G81E 3KQDA 3SV7A 3BTME 2XBVA 4Y10E 1MAXA 4BNRA 1O3AA 3KF2A 5F03A 1UHBA 3FP7E 1S83A 1EJAA 5L30H 1MD8A 1ZOMA 1EFRD 3MU4A 3RUOA 4RKOB 5C1YA 1FQ3A 1OX1A 4I8KA 6ESTA 3RU4D 1LQDB 1MKXH 4LOYH 3LC3A 4U2WA 4AFQA 3PROA 4AGJA 1GI0A 3Q3YA 2PLXA 1Y3YA 1TQ7B 1ABIH 3GDSA 2VJ1A 3RU4T 1UVSH 2PKSC 4MNYA 1GDQA 2W7UA 3FZDA 3VGCB 1GBKA 1L1NA 1UTLM 1GHZA 1EB1H 1TX8A 1C2GA 1FY1A 3M3TA 1F2SE 5EPNA 2ZFFH 2A5KA 4JYUH 1XXFA 1YM0A 3RXBA 3AAUA 3MO6A 1MQ5A 1AIXH 5T6DA 1XUIA 4DVAU 4YOIA 1C5MD 3SQHE 4YOJA 1IQGA 2YNBA 3EE7A 1PJPA 4M7GA 1BHXB 5J4SA 1YLNA 1NRQH 2C3SA 3V12A 4P02A 3E6PH 3HGPA 1CE5A 1P0SH 1A3EH 2BY5X 2EI8A 1A5IA 1O3OA 2FOCA 3F2FA 4UFFH 3MNBA 2V0BA 2VH6A 1HJ8A 5J4QA 1V2KT 4QT8C 1F0TA 2BY6X 2OCVB 1MTNB 1TFXA 3BTFE 3SNCA 2VIPA 1F0UA 1TOCB 1C1TA 2C8WB 2FOHA 3GISB 2H5DA 1VZQH 2Z7FE 2ZZUH 1W11U 5HKKD 1MCTA 2B8OH 1Y3XA 1DS2E 1GDUA 1E1QD 5DP3A 5T6FA 1GHBG 4K8YA 1RFNA 2Z9JA 4WMDA 3VG8A 5C20A 3SGQE 1FZZA 1O35A 1P02A 2VWNA 1V2RT 3ZZ7A 4AZ2B 1UVOA 2BDCA 1F7ZA 1AFQB 1QNJA 4TWYA 3SO3A 3T62A 4YO9A 1LHGH 1BB0B 2RCEA 1SHYA 2ULLA 1JWTA 1S0RA 1NM6A 4MG3A 1TGBA 3SUGA 3I77A 1DOJA 1SMFE 1L1JA 4BTUB 1ZPZA 1ZR0A 1A0LA 1LVOA 3LH1A 2VIOA 4CBOA 2AS9A 4Y7AA 5CHAB 4BAHB 2P59A 3ZZ3A 5EW2H 1B7XB 4KKDA 3RMLH 3SV9A 5JBTA 3GY3A 4Q7XA 4MTBA 3VFEA 1O2VA 4WH8A 1KSNA 4B2AA 2CXVA 3STIA 3SV8A 1DWCH 1D3QB 4R0IA 5HGGA 1YCPK 4UFGH 3BIVH 4JYVH 2FWWA 3SW2B 3O8BA 1G9IE 1GL0E 1HV7A 1LPKB 3VEQB 1HXFH 4OS6A 1EXFA 2PGBB 1C9PA 3A8DA 1W3CA 2KAIA 4CBNA 1SQOA 1EAXA 3MFJA 3MOCA 1NBMD 1TMTH 4AYYB 1F5KU 2R3UA 5I46H 4Y8XA 1TNHA 2DE8A 1SGTA 1K1NA 5C1UA 2HLCA 2QF4A 2RFKC 1C1OA 1THSH 4NWLA 1UCYH 5FL7D 5C2ZA 4CREA 1O5AB 1YP9A 1N6YA 2ZHEH 3A86A 2H9HA 4SGBE 2GP9B 5FXLA 2PHBA 4Q4LA 1NESE 3ZZBA 4HI3A 1OP0A 4X1PU 3VB4A 1JRSA 1TX6A 1P05A 2J34A 3U9AH 4ACAA 3Q3XA 1GBMA 1XVOA 3RMMH 1ELDE 2V7QD 5FCKA 1G3DA 1GWAA 3AVZA 5CHBA 2O8TA 2ZTXA 1E79D 3RXIA 5IK2D 2HNTF 5DGJA 1VITF 1KDQB 2BQ6B 2AMDA 1ETRH 3DT0H 1HAYB 4NIXA 2GCHG 1O2JA 4RKJB 1LPZB 1T32A 4BOHA 5LPRA 4CRDA 2ZHQH 1W14U 8GCHF 3PV4A 4K1EA 4CH8B 1NBME 3A85A 1GHAF 2ZPRA 4AX9H 1QGFA 1PPGE 3HGNA 1BRCE 3W95A 4THNH 2KR7A 1GI7B 1RD3B 2R0KA 1WQSA 3PRDA 2FESH 1HJAC 3EE0B 1SGCA 3SHCH 4DJZB 3O8RA 3BEFB 1QQUA 1QL7A 4YXWD 1FY3A 2HPPH 2BLOA 1P2NA 2ZU2A 1O2XA 2BD3A 3K9XB 2AGEX 3SUEA 3RXJA 5FBIA 1FPCH 4X8TH 1W2KH 3BF6H 1C1UH 1MBMA 3GYLB 3VGCC 3AW1A 1C5WB 2JH5D 1YC0A 2JDID 1ZSKA 1WOFA 1P9SA 4AFSA 1EZXC 4CRCA 2AGGX 2FZZA 2OQUA 4CR9A 1ELEE 1NPMA 2ZFQH 3GY5A 2WPLS 1YPJH 2Z3DA 1Q31A 1YGCH 4ABJA 2C4FH 1ARCA 4OS7A 2C8YB 4D8NA 5A09A 2P3UB 4H42U 3BIUH 3RXTA 1MAYA 4I8LA 1BRBE 2GV6A 4X2XA 1O0DH 2FS9A 4AOQA 1BBRE 3P92A 2GX4A 4AFUA 1KY9A 4FOUC 1C1PA 2A5IA 1Z71A 1SGEE 2P94A 3ZZDA 1TBRH 1TB6H 1TPOA 1MTNC 3ZVEA 4X1RU 1O2KA 3ENSB 2YMSB 2ZDNA 1H9LB 3VXEH 2W26A 3SJ8A 1P9UA 2J2UA 3VB6A 2J5UA 3EA8A 5DP6A 1GBJA 3TITA 1BQYA 3A7XA 2UUJB 1YCPM 3L6PA 1WCZA 3OYPA 3PWBA 5FBEA 3FKSD 1O3JA 1K1PA 1TYNA 2PGQB 1SFQB 1WTGH 1SFIA 2ZTYA 3A81A 1UTJA 3FOAA 4H4FA 1KTSB 1AFQC 1UK3A 1GMDG 2CF8H 2ZU5A 1GJ9B 1BJVA 4CRFA 4E7NA 1KLTA 4LXBH 1C5VA 5E0JA 3SJKA 4GVUA 1WUNH 3M5OA 1XUFA 2XCNA 3LPRA 5CHAC 2J94A 3ATWA 3T28A 5BPEA 3VB7A 4K5ZA 2ANMH 1UJ1A 3KQBA 5HMAA 1QL8A 5T1VA 2WSSD 1P11E 1O3BA 3PMBB 4DG4A 1HAVB 1O3LA 1A5HA 3E0PB 1O5EH 3A84A 4ABEA 2BX3A 1MKXK 2Y5GA 4AGKA 2ZQ1A 4TY7A 4ISNA 2D2DA 1UTQA 1LVBA 4BAQB 4E7RG 1QR3E 5EGMA 2QF3A 4I33A 5A0CA 1RTLA 3ZVCA 2CV3A 1GBEA 3GDUA 1VR1H 1T8NA 3N99A 2SGAA 2CN0H 1VITH 1P06A 1DICA 1E1RD 1EZUC 3M5NA 1O3IA 1A61H 3UOPA 3OY6U 2O8WA 5JBAS 3P70B 4FUIA 2ZECA 5LPEA 5E2OA 5T3HA 1HB0B 2PTNA 2A4GA 1INCA 1WDIA 3GCHB 3M3VA 4B1TA 2ZU3A 5DP7A 2A4OA 3SJOA 1W0KD 4CRGA 1HIAB 2XXLA 3RM2H 1C4V2 1D6WA 3VB3A 4AN7A 1O2YA 4DIIH 1HAXB 2ZCHP 2ZTZA 4Q63A 1DLKB 2OC8A 5T6GA 5JBBS 1TABE 4XBCA 1GMCG 2SNWA 1QB6A 2KX4A 3LDXH 3F0OA 3ZVDA 2RDLA 2YMSD 3FP6E 1SG8B 1O2WA 1C5ZB 1DDJA 4P00A 1QTFA 1EZSC 2J4IA 4AG1A 1AE5A 1S6LA 1Z7KA 2O8MA 4DCDA 2VVUA 4FVBA 1MABB 1C1NA 2VWOA 2XNDD 4NA9H 1MU6B 2KCAA 4A5TS 2FM2A 4IMQA 2BY7X 1HAGE 2AIQA 1PPCE 5L2ZH 5ETXA 2ESTE 2WINI 1BMNH 1KDQA 1C4Y2 1LKBA 1QZ8A 2C8XB 3MU5A 1HYLA 2ODYB 1K22H 1Y8TA 3MU0A 3OY5U 1YYY1 1B0EA 1KXBA 1K21H 2RDEA 2R2WU 4NCYA 2P93A 1NFYA 2F3CE 1QA7A 1QRWA 1ESBA 1TBZH 1D3TB 1CVWH 1GI6A 1LVYA 1C2JA 3DD2H 3A7WA 1OKXA 2VB0A 1ZJDA 2FIRH 3NZIA 4DURA 3TK6A 1P2MA 2ZCLP 1K1LA 3SGAE 1H9HE 3RM0H 1UTNA 3LGTA 5DP4A 3QO6A 1ESTA 1GMHG 2P95A 3PMJA 2ZI2H 2BMGB 3L3TA 3EA7A 3UNRA 1MTUA 1HLTH 3V13A 2ZP0H 4ABHA 4NIVA 1S81A 2BD9A 2C93B 2A5AA 4ZROA 3BG8A 3E16B 1GHBF 9ESTA 4VGCB 3PO1B 3M7QA 5KECA 4B76A 2ZPQA 2BQ7B 2ZHWH 4IW4E 3MH6A 1GI1A 5EPYA 3U1JB 1AUJA 4UFDH 3PLKA 2K1QA 3FAOA 2GMTB 3HATH 5DP9A 2ZHDA 1T4VH 2I6QA 1H8HD 1XKBC 4HTCH 2GCTB 5F8TA 1DANH 2YMSC 3GCNA 2G52A 3Q3KA 2A0QB 5EXLA 4AG2A 3LC5A 1QJ6B 1O33A 1AI8H 1P2IA 1XUJA 4K8BA 3RLWH 3TH4H 4MLFB 2PP6A 1V2LT 1ABJH 1EX3A 1P03A 4YESB 1EAUA 1LHDH 1BTHH 2AMQA 5PTPA 4A1XA 1BRUP 3F9HA 3RMOH 2FTLE 2J38A 3SV6A 1AVWA 1GVLA 4DIHH 1ZPCA 4NGAH 1PPZA 1C5LH 1AMHA 3V3MA 1VGCB 4K1SA 1V6DA 1XX9A 1YPHE 2AHME 1DUEA 4ZUHA 2XC5A 4BAMB 1QRXA 3QTVH 5E0HA 1OYQA 1SQAA 2FI3E 1A0JA 5BRRE 3RXFA 3UQOA 3DFLA 2C8ZB 2HWLB 3F2GA 1MU8B 1SGFA 1L0ZA 1K0HA 5IYTA 1Y59T 1K1JA 1WTHD 3MU8A 5F53A 5A2MH 5HYOA 3CENA 1BCUH 3FANA 3PTNA 4AC9A 1KTTB 2VINA 2QY0B 3HKIB 3ODDA 3SJ9A 3QZQA 2BDIA 3EGKH 1G30B 4IGDA 2BDGA 1MZDA 1YPHC 1U6QA 1C5YB 3RXUA 2FOGA 1MUEB 4MPWA 3UY9A 5EIYA 1C1MA 1XUGA 1AU8A 1AD8H 3S0NA 1SGFG 5C0UA 2ZA5A 1FLEE 1TLDA 1NRRH 1D9IA 4LK4A 1CGIE 5K7RA 3LJOA 1HAVA 4Q7ZA 3BTWE 1FAKH 2OQ5A 4NWKA 1LO6A 1O38A 2GCHF 1K1OA 5EQSA 3BTEE 1TA2A 1W8BH 1SKYE 3GCHC 3E90B 5JB9S 2VVCA 1NO9H 2Z3EA 1NFUA 3QZRA 1ORFA 2LPRA 2P3FH 6CHAB 1JIRA 2SFAA 1EP5A 2DE9A 2Y7XA 2CF9H 2WYGA 1QBNA 1CT0E 4ABBA
chains in the Genus database with same CATH topology
1CHOG 1MD7A 2F83A 2ZU4A 4J1YA 3U8OH 3RDZA 4KTUA 2V3HH 4U01A 1EPTB 5AF9H 1ZHMA 3RXAA 1EAIA 3UOUA 1MZAA 1HFDA 1MKWK 1Q3XA 1SLVB 2WPIS 3IITA 2HOBA 2IN2A 2WV4A 1NTPA 1OSSA 1VJ9U 2BYAX 2PR3A 4ABIA 1HAHH 2Y80A 1LPGB 4FU9A 1AZ8A 1KLJH 2ZNKH 4OGXA 2OC0A 1SGRE 1K1MA 1YLCA 1HIAA 5EOKA 4WVPE 1Z8RA 1MBQA 4DY7B 3C1KA 2FOFA 1O2SA 2A45B 3UR9A 9LPRA 3QK1A 2Y6TA 4TPIZ 4U32A 3ZVGA 1TGTA 1FIWA 3GCTF 2BDAA 3Q77A 1GDNA 1O2IA 2GZ7A 1GBLA 1K1IA 2F9NA 1WV7H 2H9EH 3BN9A 3LT3A 3JZ2B 3RU4E 2SGFE 1KXDA 2XBYA 1NU9A 1J9CH 4UD9H 3SU0A 2ILNA 3TVJB 4INKA 1HDTH 2Q6DA 1GGDB 2Z9IA 3ZYDA 3ZZ4A 1CSOE 2R2MB 3UR6A 2BD5A 1W7XH 4ABAA 1DSUA 3QTOH 4FUJA 1P04A 3TJUA 4BTIB 5EU8A 5I25A 3T5FH 3SBKA 5FX5A 2WUCA 1QA0A 1NFWA 3C27B 5JDUB 1F92A 3TGIE 1UCYE 4GSOA 3DUXH 3MH4A 1ELVA 4VGCC 2C90B 2F9PA 3GY7A 4RN6A 3SQEE 1GL1A 3DHKH 4IN2A 3ZV8A 1GMDF 5FX6A 1V2MT 2ZGHA 4OS2A 1G3CA 3ZZ9A 1RXPA 2GMTC 2W5EA 4ASHA 3RXEA 1QRZA 3STJA 1DWDH 3KIDU 1EASA 5GIBA 2GCTC 2XRCA 1BHXF 1ANBA 1O3PB 2A7CA 2XCFA 4FU7A 4A92A 1QJ1B 2GZ8A 3UNQA 2ZC9H 4XDEA 1UTKA 2BDYA 1V2VT 1NS3A 1OS8A 3E8LA 4MPUA 3V7TA 1OWHA 3LJJA 2QGRA 5GJ4B 2ALPA 3TJNA 2PSXA 3A83A 1YPMH 3NPSA 1BTPA 3VXFH 6GCHF 3RP2A 4MVNA 3G01A 1A5GH 2FOEA 3JZ1B 2TIOA 3D23A 3GY8A 1C2IA 2EI7A 2JETB 1BUIA 1ZRBA 3LH3A 3F9GA 2GT7A 3S7HB 1PFXC 2UUKB 2BXTH 1GI8B 1XUKA 1O5GH 8LPRA 2STBE 2RG3A 4DGJA 2O8UA 1WU1A 2FXRA 2PUXB 1A2CH 1L1GA 2ZIQH 4OS4A 1IOEA 2BQWB 5AVDA 1LHFH 5FPYA 3P8OA 3UFAA 1CGHA 5FAHA 3P8GA 1B0FA 3FZZA 4INHA 1SL3A 4MNWA 3MH7A 4D9RA 5TCAA 1FDPA 1KXCA 2ZCKP 1GBTA 4Y8YA 1UTPA 2GKVE 3BEUA 1BMMH 4IMZA 4X6NA 5A0BA 4NA7A 2GGVB 1TPSA 1P01A 2TRMA 1EAWA 1GBBA 1O2UA 1TNIA 4IN1A 2UWOA 3MNSA 1ACBE 1BTZA 1FUJA 1W13U 5JB8S 2BZ6H 3OTJE 1TRYA 1JOUB 3UWIA 1EB2A 1O5FH 1QY6A 1YPGH 3S69A 4LZ4B 4Y0ZE 1O39A 2JH6D 2OBQA 3S9BA 3B9FH 7KMEH 3SJIA 1M9UA 2PTCE 3N7OA 1O3DA 4AB8A 4WMFA 2BD8A 6CHAC 2QXJA 4YT6H 3MO3A 1UTOA 4YM9A 1C1QA 2OINA 1O2GH 1ELAA 2W3KA 1EPTC 1SHHB 5GXPA 2ZDKA 4X6MA 2JH0D 4O97A 2O9QA 1IQKA 3L33A 3O8DA 1K2I1 3GYMA 2Q6FA 1HAIH 1ZZZA 5E2PA 5LH8A 2ANWA 3OX7U 4JYTA 1O2OA 3ZYEA 3S9AA 2VH0A 1SQTA 1SGPE 2Y7ZA 1AE8H 4OS1A 1A7SA 2D26C 1GVKB 4NIYA 2SGDE 2W3IA 1T8LA 2PUQH 1EPTA 1NT1A 1Y3UA 1NRNH 4B74A 4U30A 3QX5H 2VNTA 5GCHF 1C1SA 1Z6EA 1OPHB 2XC0A 1MKWH 1AVXA 3FFGA 5EXNA 1BMAA 1CA8B 5EG4A 3HK3B 4FUHA 1P12E 5ESBA 3T26A 2JKHA 1B5GH 4JZDH 3KNXA 5L2YH 1Y5UT 1MQ6A 5A8YA 2ZGCA 1BZXE 3A7VA 1W12U 4Y71A 1E38B 2OBOA 1P2QA 1FAXA 4X1QU 2ZDMA 1CT2E 3RXRA 3KEEA 1PQ8A 3F1SB 4MQAA 1QURH 3U8TH 3RXHA 1FXYA 4YT7H 1SC8U 3BSQA 2UUYA 3UPEA 1GPZA 3TNSA 2ZKSA 1FNIA 1SGDE 4FUDA 1MCVA 1PQ5A 1QJ7B 1RRKA 1V2UT 4B73A 1YPEH 4B2CA 1PPHE 2BB4A 2J9NA 1O2HA 2F91A 3OU0A 3MTYA 5JBCS 1HAPH 1AB9B 1ANCA 1V2JT 1V2QT 2H1UA 5DP5A 1V2PT 2B7DH 1C5PA 3UQVA 1TONA 3LU9B 1PPBH 2V3OH 1C2LA 4ZKRU 1SOTA 3SNDA 4B2BA 3A7ZA 5C1XA 4XE4A 1YPKH 1T7CA 3F9FA 4IS5A 1RTKA 3T25A 2A4RA 1C5NH 3ATKA 1P3CA 1C1VH 2ZDLA 4BAOB 3UIRA 2QXHA 5TCCA 2R9PA 1OYTH 1L4DA 2QXIA 4B71A 1VCWA 3AAVA 4JK6A 2G55A 1QL9A 1GBDA 1GHWH 4J2YB 1GHVH 3K2UA 1XMNB 3E91A 1ZTKA 3H7OA 1ZSJA 1UK2A 2PWXA 1C2DA 4FU8A 2JETC 2FPZA 4O3TA 1OP2A 1GBCA 5DO4H 1O2TA 1BTWA 2ZPSA 4A6LA 3M5LA 3RXOA 1FI8A 1HGTH 4XBBA 4UE7H 2ZEBA 2OC1A 3DA9B 1P09A 4IC6A 1PQAA 4A1TA 1BTUA 3RXSA 1TALA 3A8CA 1DT2A 4NSYA 3U8RH 2DUCA 3GDVA 4ZKNU 1AKSB 1VITG 5ESTE 2WPJS 4GHTA 3RXPA 1VJAU 5DG6A 4SGAE 4NSVA 2VIQA 3RXQA 2CHAB 5DP8A 1GJCB 2YNAA 1CHOF 3EYDA 1C5UA 1DVAH 1LDTT 3A80A 5TJXA 4KTSA 8GCHG 1CU1A 1QQ4A 2V35A 4X8UH 3ZVBA 3E1XB 1GHAG 1CBWB 2XNIA 1V3XA 5EXMA 1FIZA 4WY3A 1TQ0B 3TIUA 1O5CB 3M7TA 2PFEA 1Z1JA 4NA8A 4ZHLU 4B75A 3KHVA 1LTOA 2ZDVH 1G2LA 2P8OB 1BDAA 1EZQA 1W0ZU 1SGNE 1GCTB 1V2NT 2QAAA 1SGQE 3VB5A 4AB9A 5L6NH 2B9LA 4GCHG 4BTTB 2AH4X 2A31A 4JZIA 4O03A 1GJDB 1DLEA 2AERH 3LOXA 1A0HB 1VCQA 2ZQ2A 1HNEE 4Y6DA 1F5RA 3BG4B 1C1WH 4DT7B 1KXEA 1GI2A 1E34B 2BVRH 1THRH 5IDKA 1E35B 1Y3VA 3CP7A 3M7UA 3A87A 5AFYH 2CJIA 4X6PA 2ZFTA 3BTHE 1GCDA 2HPQH 4FUCA 2FMJA 1GI4A 4WF8A 1GG6B 1AO5A 4BAKB 1ZRKA 4Q80A 2BHGA 1NY22 3MU1A 2O8LA 3ELAH 4F4OC 1J16A 4O3UA 1GJAB 2GT8A 1L4ZA 4HFPB 3SU4A 2XWAA 3MHWU 5C67A 4XBDA 3T27A 2GZ9A 1MMJN 1EJNA 3R0FA 2ZFPH 1DM4B 4D76A 1SLUB 5E0GA 1SPJA 4HZHA 1GBAA 4ABGA 2QC2A 3NCLA 1T4UH 2ODPA 2BLVA 1WSSH 3T2NA 3TJOA 4K2YA 1ZGVA 4I32A 1J14A 2G51A 5DJ7A 4Q7YA 2UUFB 3TH2H 1C2MA 1D3PB 4ISLA 5LPFA 3RXLA 1GHXH 4GLYA 3CS7A 3UUZA 2XWBI 2TGPZ 2GDEH 4HGCA 2G5VA 4JZEH 2AIPA 1HJ9A 5GWZA 1A4WH 4ZMAH 3LKWA 2W7SA 3BTDE 4JZ1A 2TGAA 3A8AA 1A46H 4Y11E 4TYDA 1O2PA 2FI4E 1DWBH 2OP9A 4KGAA 1TBQH 2QIQA 3LIWA 3MI4A 1BA8B 2B0FA 3KCGH 1C5OH 2QYIA 1ARBA 4KTCA 1C1RA 4RSPA 4FUEA 1AB9C 1FMGA 2A1DB 2RA0A 3PTBA 4D7FA 5JYIA 3ZZCA 1CT4E 3RXGA 1O36A 4WWYA 3GY4A 1T31A 1NU7B 1TOMH 4UDWH 1ZHRA 5FHTA 2OUAA 4ZXXH 4H6SB 4K1TA 3M61U 2FX6A 2EC9H 3LGYA 2FLBH 3EAJA 5LGOA 7GCHG 1OWJA 1AVGH 2D8WA 1HUTH 1P8VC 2G5NA 1O2LA 1TWXB 1NZQH 1O5DH 1FPHH 1Z6JH 3QDZB 1ZMNA 2ASUB 1QFKH 2PV9B 3U69H 1LHCH 3QLPH 2PW8H 1V2WT 4ZKSU 1QB1A 1WAYB 4JK5A 5F6MA 2FI5E 1ETSH 1SVPA 3HKJB 2OC7A 3TNTA 2WPMS 3K6YA 4TY6A 1HJAB 3H7TA 3GICB 1JRTA 4GAWA 1SOZA 2SGEE 1EJMA 3SN8A 2CHAC 2NU4E 3GOVB 2ODQA 3SV2H 1XUHA 1N1LA 2J95A 2HGTH 5DKMA 4NZLA 2Z94A 1F0RA 3EDXB 2FDAA 2NU0E 1AN1E 1S5SA 5E8EH 4ABFA 1CBWC 3P17H 3A8BA 3KN2A 4WMEA 3SI4H 1BTYA 4YLUA 1P3EA 1TAWA 4NZQA 1EQ9A 4A1VA 4D7GA 1AKSA 1ELGA 3TPIZ 2FP7B 2IJOB 1S85A 2P8OC 4XSKU 5SGAE 4BXWA 1GCTC 1UTMA 1UVPA 4I31A 2GDDA 3S7KB 2R0LA 1QBOA 3IG6B 3KGPA 1J17T 1Q2WA 1FV9A 2XBWA 1TNKA 1TMBH 3M5MA 1ELCA 3BG4C 3RC6A 1ID5H 1G37A 3P8FA 3BTGE 4K69A 2QF0A 4CHAB 3D49H 2G4UA 3UTUH 5CE1A 1TE0A 3P95A 3RC4A 3ZZ5A 4DOQA 1BBRK 1KIGH 3TGKE 3QGJA 2XYAA 1GG6C 1TA6A 1DY9A 2F9VA 2HALA 1BMLA 1S6HA 2WV5A 3A88A 1IQIA 4OS5A 3E3TA 2F9UA 3PO1C 1TMUH 4F49A 5A8XA 2BM2A 2VU8E 2XW9A 3O8CA 1O3KA 1QCPA 1SR5C 1P10A 1TGCA 1Z8GA 1W0YH 2D1JA 1MH0A 5JPMH 1O3EA 4AYVB 5A0AE 4OGYA 2BVXH 3K6ZA 3TLOA 4MDSA 1IQEA 1CO7E 1Z8IB 2QV1A 1G32B 2V6NA 4K60A 3LGWA 3NXPA 2VGCB 2CMYA 3SUFA 1IHSH 2ZFRH 3PMHB 4MNVA 1NROH 2GVFA 1YPLH 3BTQE 4E05H 1NFXA 1JXPA 4ZHAA 1DUAA 3GY2A 1IQMA 4XOJA 3FP8E 5B6OA 1MTSA 4MPVA 1HXEH 3OSYA 2FOMB 3LGIA 1G3BA 4WXVA 3F9EA 1N8OB 1LQEA 4A7IB 2QN5T 2Y5FA 3MMGA 1VGCC 3QN7A 3Q76A 3SORA 1EKBB 1T8MA 4YTAA 5F8XA 1BTXA 3WY8A 1PPFE 2FX4A 1WYKA 1WBGB 2SNVA 1ELBA 1RIWB 2BX4A 1HRTH 1DE7H 4H6TA 1GBHA 2AMPA 1BJUA 2P16A 2VIWA 4X1SU 4WJG2 4Y76A 4JCNA 4ZAEA 3RMNH 3VPKA 1HBTH 3SNBA 3H5CB 2EI6A 4CRAA 1ZYOA 1TNJA 1A1RA 1MTVA 1AZZA 1O3GA 1QBVH 5FPTA 2SGQE 3M37A 3SU5A 2FYQA 2EEKA 1CGJE 1H1BA 3BTKE 1PYTD 2PSYA 3I29A 3SGBE 3RC5A 1EOLA 3ESTA 3NKKA 1NN6A 1FY4A 1RS0A 1GMCF 1GJ6A 1QB9A 2PKAB 2OD3B 3Q00A 1QIXB 3AASA 5G4BA 2ALVA 2Z9KA 3QUMP 1T8OA 2BOKA 4ZHMU 2A7JA 1H8IH 1IAUA 3UREA 3KQEA 4I8HA 3B23B 4NG9H 1RJXB 4X6OA 1O34A 1ZPBA 1S84A 2FYRA 3I78A 2UWPA 2TPIZ 2AGIX 4GPGA 2UWLA 1DITH 1GHYH 1AWHB 1PQ7A 4Y79A 5FPSA 2BVSH 3F68H 1AUTC 2WPKS 3RLYH 1EATA 1SLWB 2OTVA 1IQLA 4UEHH 1TNLA 4INLA 4ZXYH 3A89A 2YOLA 2Q1JA 1RGQA 4GCHF 5HM2A 5EODA 2M5TA 3URDA 1ZMJA 4BANB 3B8JA 1GJBB 1IHTH 1NC6A 1O2QA 3KL6A 8KME2 2WPHS 5EQQA 3BV9B 3SU1A 1K9OE 2SGPE 1LHEH 1UO6A 4X2YA 1GMHF 5GPIB 1FJSA 2BTCE 3MNXA 2BLWA 1H8DH 2A4QA 2FS8A 3GCTG 1XVMA 4TWWA 2BD2A 4UONA 1O31A 2BD4A 3NUMA 1BITA 1GBIA 2STAE 4O9VA 1YF4A 1DFPA 1P2KA 2WUBA 4I8GA 4X2VA 4Q2KA 1C9TA 3UWJH 1DPOA 1PYTC 2ZWLH 5DK1A 1DXWA 4Y8ZA 2FO9A 1E37B 1GGDC 2F9OA 3ODFA 2GV7A 3NWUA 4FVDA 2VIDA 3FVFB 3M35A 4CHAC 5AHGH 1P2JA 2TGDA 1TPAE 3ITIA 3SOSA 3ZZAA 5A8ZA 1HAZB 3BEIB 2HNTE 1TX7A 4XFQA 1ELFA 2Y82A 2NU3E 1V2TT 3A7YA 2BOHB 1IQJA 1TGSZ 4ZKOU 2AFQB 3RXKA 3LGUA 4PROA 1GVZA 3D62A 4LZ1H 1SB1H 1TPPA 2BLQA 3MH5A 1E36B 1P2OA 1V2OT 1ANDA 1CQQA 1GI3A 2FOAA 5DPAA 2H6MA 1OWEA 1SSXA 3BTTE 3PLBA 1AHTH 1C2KA 1FN8A 4NFFA 1TIOA 2BY8X 5K0HA 3W94A 2TGTA 2VWMA 1OWIA 1QHRB 1UK4A 1TNGA 4JZFH 1AY6H 3D65E 1JIMA 4IC5A 2HNTC 2IPHA 1DY8A 1C5SA 3M36A 2VGCC 1BBRH 3F6UH 1K28D 2HRVA 6LPRA 1MTWA 4D9QA 3URCA 1C4U2 2Z9LA