3VEQB

A binary complex betwwen bovine pancreatic trypsin and a engineered mutant trypsin inhibitor
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASVSLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCAGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Role of remote scaffolding residues in the inhibitory loop pre-organization, flexibility, rigidification and enzyme inhibition of serine protease inhibitors
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 52
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2012-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3veqB01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3veqB02
1FIZA 4IN1A 1O3HA 1SGTA 2A0QB 3DA9B 3NWUA 1OP0A 1C1VH 1GCTC 4YT7H 1HIAA 4A1XA 3W94A 3A84A 3FVFB 4NIWA 3SU4A 5JBAS 1YCPK 1ZJKA 1INCA 3TJVA 1DUEA 4WMFA 2VU8E 5K7RA 5DP6A 2A7CA 1OP8A 3M37A 3RXIA 2ILNA 2BY5X 2ZU4A 4Q7XA 3SBKA 1SB1H 2TBSA 1TRMA 1P2JA 1GJAB 1A4WH 2K1QA 1AHTH 3SHAH 5L2ZH 1TRYA 3A83A 2Q6FA 1VCQA 1OSSA 6CHAB 1W3CA 3KQBA 1O35A 1CBWB 3RXDA 3ZVGA 1A46H 4UFEH 3MYWA 1SLVB 2ZGJA 1GMDF 1CT4E 1JWTA 4MTBA 1K1MA 1HJAC 3TNTA 7KMEH 1FUJA 4K3JA 1C1PA 2P3TB 4CREA 2SNWA 2FDAA 3HK3B 4ZAEA 2FI4E 1D9IA 2ZFFH 1XKBC 1XUFA 1ZGIA 2ZO3H 3LH1A 4Y71A 1UTMA 2PUXB 2D2DA 1QB6A 1XUHA 1JIMA 1W8BH 1AFQB 1ZSKA 4GAWA 3HGPA 3L3TA 3E90B 3GDSA 1GBMA 2ZTZA 1LCYA 2HVXA 3EGKH 5LPEA 2ZNKH 1GI4A 1GJ5H 1LO6A 1HB0B 1HDTH 1TX8A 5CHAB 1V2QT 3ZYEA 1XUIA 3EA9A 1Y3VA 4K2YA 1FY5A 2GP9B 1TA6A 1C1QA 2QIQA 3H5CB 2PSYA 2F91A 3F9EA 2TGAA 2O8LA 1PYTC 1MKWK 1QBVH 1O2ZA 3NZIA 4D7GA 2W5EA 1BRUP 3KGPA 1H8IH 1HAVA 1O5CB 5GXPA 3SUFA 1FXYA 1UVTH 5LGOA 1HJ8A 4Q7YA 4U30A 2G81E 3A8BA 2HALA 3BIUH 1FAXA 1HXEH 1UVOA 1FAKH 2I6QA 3F68H 1KDQA 3Q00A 1V2VT 5K0HA 2O8TA 4DT7B 3OY6U 4NA7A 1ELCA 2XXLA 1A5GH 1SOTA 1GBAA 2ZKSA 5DPAA 2NU2E 3P8OA 3S9CA 1C2IA 2O8WA 4Y11E 1ARCA 1EPTB 1O31A 3TJNA 5FCKA 3LC5A 2EI7A 3EAJA 3HPTB 2FOFA 2C8YB 1F0RA 3Q3YA 1B5GH 2GV7A 2HNTE 1UVUH 1DWBH 3M7QA 4O3UA 1MAXA 1O3IA 2CV3A 1D3PB 1DUAA 1SLUB 1XVOA 3E8LA 3Q76A 2SGQE 3SI3H 4MPVA 5T3HA 4H4FA 1Y3XA 2EEKA 5E0HA 4E7RG 1DSTA 2AGEX 1AY6H 2ODQA 3TITA 1RS0A 3UQOA 1ANCA 1Q3XA 1SGRE 4JYVH 2FOAA 3SJKA 1O3AA 1KXAA 1BZXE 1ETRH 1IQEA 4JYTA 1CBWC 3MTYA 1MCVA 2G00A 4CR9A 2F3CE 3DUXH 1GI0A 2LPRA 4XSKU 1EB1H 2GVFA 4AFSA 3LOXA 5ABWA 1TAWA 1IQIA 1NRPH 1QNJA 1V2PT 3SQEE 2KAIA 1IQHA 5F8ZA 3W95A 8ESTE 4AORA 3LKWA 3K65B 3RMMH 3KF2A 1WU1A 1XKAC 3CS0A 4ISOA 1JIRA 1P09A 3HATH 2V0BA 3B9FH 1GHBG 3E0PB 1NY22 1FN8A 3ZZCA 4K1TA 4X6NA 1GG6B 1UMAH 2F9OA 1GI8B 2BMGB 5F03A 4JK6A 1SVPA 5EW2H 3SGAE 1F0TA 3R3GB 1FMGA 1O3GA 1OWEA 1QQ4A 4B71A 1BUIA 1UTOA 4A92A 1CT0E 5GWZA 2Z9IA 2BDBA 4NZQA 1UCYK 1O3PB 2GMTC 2TPIZ 1WUNH 5CHAC 2AMPA 2SGAA 3PTBA 2Z3CA 1D3TB 1S82A 2FI3E 1P2IA 1LHEH 2FMJA 5HMAA 1AKSA 2VNTA 2BZAA 2G5VA 1QURH 2OBQA 1YGCH 4JZ1A 3UIRA 1F92A 1Z8GA 3P95A 3LONA 3VB5A 1VJAU 3SOSA 1Y5UT 3RXFA 1BTZA 4GCHF 3OX7U 3EE0B 1O3EA 4M7GA 1GJDB 1UTPA 1SGPE 4Y7AA 1WTGH 4KKDA 4ZH8A 1TYNA 1O2NA 2FYQA 3P8FA 1BB0B 3AW1A 1G2LA 3FP8E 4DCDA 3S9BA 3LH3A 1A1RA 1AMHA 2GD4B 1TGBA 1TQ7B 1ZMJA 1BBRK 1O3LA 1TGCA 4WH8A 1MTUA 1T4VH 3SJOA 2WPLS 1G32B 4ZMAH 1F5LA 2ZDLA 2ZTYA 1YC0A 4MLFB 4Z0KA 1MCTA 3M5MA 1C1SA 2G4UA 3RLWH 3SUGA 2CJIA 2IJOB 1YPHE 3S0NA 4Y6DA 2BDAA 1GJBB 1C9TA 1O5EH 2ZCLP 4ISNA 1B0EA 3MU5A 2XC5A 3GCOA 1UK3A 1W13U 3S7HB 3F9FA 1NPMA 2QY0B 1QJ1B 4X6MA 2EA3A 3LJOA 3IITA 2PGQB 4A5TS 2BOKA 3PROA 2XBVA 5F8XA 4MPXA 1OP2A 4XBDA 5HM9A 1P01A 1UTJA 4K8YA 3NUMA 2V3OH 3UNSA 4Y7BA 2BDHA 1TPPA 2B5TB 2DE9A 1NFUA 1O2WA 2FLBH 1K2I1 5GCHF 1AFEH 1NFYA 2ZC9H 2ZFSA 1YCPM 2JH6D 1DE7H 1GG6C 1GDQA 4YTAA 1TNKA 4X1RU 4SGBE 3MNCA 3BIVH 4LOYH 3BTDE 2TGPZ 2VWLA 2SGEE 3ENSB 1FDPA 2WINI 1ZHPA 1AB9B 3F1SB 2ZDKA 1FI8A 2G8TA 4NG9H 4JZFH 4E06H 4ABDA 1O3MA 2Q6DA 5EQRA 3A80A 1K1JA 2B9LA 1UVSH 3KEEA 1CA0B 3SU3A 2GZ7A 3ZZ4A 3SN8A 3BEIB 3LGWA 1FIWA 3O8RA 4WF8A 2WPHS 3A8CA 2OQUA 1O2MA 1NFXA 2FP7B 4DOQA 1PFXC 1FJSA 1RTLA 4NSYA 4ZROA 3GY6A 4Y10E 1W0ZU 1ELGA 1V2RT 1NN6A 3V12A 1C2GA 3TGJE 4JZIA 1K1PA 2BZ6H 2NU1E 1GBLA 4NIVA 5T6GA 1Q31A 1IQJA 3TH2H 2PTCE 3QLPH 1V2KT 3PWBA 1QL9A 1X7AC 1DY9A 1EJMA 1AVXA 1N1LA 1RTFB 3GDUA 1OKXA 2GT7A 2BB4A 1MTSA 1FPHH 1ETTH 1O2YA 2A2XH 2BLOA 4FUDA 1NTPA 1O3NA 4FU8A 2C90B 3SJIA 1V2ST 4AYYB 4K69A 4XBCA 1NS3A 1GBHA 1JXPA 3T25A 4ZKRU 1TIOA 1GI6A 1VITH 1P3CA 2GT8A 1TNJA 1GCDA 2ALVA 1TGTA 2AS9A 2ZFPH 1DDJA 4A7IB 4NFEA 2ZDMA 2G51A 1CGHA 1S5SA 2RG3A 2BHGA 2HRVA 1BIOA 2W3IA 3HK6B 3PMAB 1QBOA 1CSOE 5C1UA 1D6RA 4WXIA 3SNEA 1ELTA 2R0LA 1HAPH 3OSYA 1GBKA 1TA2A 3SV8A 2F9NA 4YM9A 3UTUH 2J92A 4CR5A 6GCHG 4UE7H 2ZA5A 3V0XA 2TRMA 1K1IA 5DK1A 3QDZB 3MU8A 5E0GA 1XVMA 1EUFA 2TGTA 1SGIB 1GCTB 1P0SH 2FOHA 1SR5C 1Y8TA 4D8NA 3B8JA 1RFNA 2PV9B 4NCYA 2FOMB 5I25A 5FCRA 2AGIX 1THRH 2AGGX 3RM0H 3D23A 1AB9C 1U6QA 2O8UA 2AIQA 2R0KA 3KQCA 1FY3A 3UUZA 1L1NA 2ZI2H 3SUEA 2BY7X 3WY8A 3PYHA 1GJ4H 1CA0C 4E05H 1ELEE 1DM4B 3RXJA 3GISB 4BAQB 4B76A 4DW2U 2ZPSA 1QHRB 1GDNA 4B74A 2Z9GA 4LZ1H 1TMBH 3GCTG 1ZPBA 5C2ZA 4KELA 5ESTE 4YLUA 5PTPA 3OU0A 4UFFH 2ZPQA 1SL3A 4OS4A 3LT3A 1XUGA 2ZGHA 4GLYA 2J94A 4B2AA 1HJAB 3NCLA 1DSUA 1YPMH 4IGDA 3MWIU 4FUEA 1WTHD 4BAMB 1Y59T 2YOLA 3ZV9A 1EOJA 1H9IE 1F2SE 1EP6A 4LK4A 1CU1A 1W12U 5FX6A 2Z9JA 4X1NU 3A7YA 5EGMA 8LPRA 3BG4B 4U2WA 1ESBA 3TIUA 1P9UA 1TOCB 1H8DH 1ZYOA 3M61U 1EZUC 4X8UH 5DP5A 1TX7A 4UONA 3SNAA 1C2DA 1E34B 1O2PA 1O2GH 1QJ6B 4GVUA 1O3CA 1Z8IB 3F6UH 3OYPA 4Y0ZE 2GZ8A 4HFPB 2F9VA 1Z8JB 2JETB 3U8OH 2OBOA 3TJUA 1ZPCA 1SPJA 1QRXA 3LIWA 2XRCA 1YLDA 3BEUA 1GI1A 1ZZZA 3RXUA 2UWOA 1NRQH 1O37A 2G55A 2ANYA 4F4OC 1NT1A 2VWOA 2ZQ2A 4K1EA 1ABJH 1C5NH 3K9XB 4OS7A 2SGFE 4X6PA 5HM2A 2I6SA 1VITG 4X0WU 4HTCH 1GBFA 1O5GH 1QY6A 4KTUA 1O2OA 4I8GA 5A2MH 3I29A 1HIAB 5FPSA 2B8OH 1AO5A 2BY8X 3GY8A 3ZZ6A 4H42U 3AASA 5EPYA 3URDA 4ISIH 4JZDH 1OWIA 3BTWE 3P92A 4FUBA 3SNDA 3A7TA 1C5UA 1GJ8B 4BTUB 4B1TA 1EZSC 3UNQA 1SMFE 5LPFA 2XW9A 1YP9A 1UVPA 4WJG2 1O33A 3U8TH 5F6MA 2H5CA 1QRWA 2GGVB 3A87A 4BANB 2FM2A 2QA9E 1IQLA 2WYGA 1GHZA 3ZVCA 1AUJA 2EC9H 3C1KA 4LZ4B 1HCGA 4R8TB 1WBGB 1JMOH 1EB2A 6GCHF 3MU0A 2VVCA 1WQSA 3BG8A 1TRNA 3STJA 1AUTC 4Z6AH 1BTUA 1C1WH 1F7ZA 1A2CH 3DFJA 5DP4A 2C3SA 3JZ1B 3A82A 2PGBB 1XMNB 4SGAE 3PO1B 3T26A 1F5KU 1C5WB 2PFEA 2FS8A 3R0FA 1P2OA 2AFQB 3VB7A 3RUOA 1TLDA 1ZPZA 1IHSH 5HYOA 1EJNA 2GCTB 5TCAA 2W7SA 1OOKB 1S0QA 1GGDC 1KLIH 1C5SA 5EW1H 3NKKA 3A89A 1SI5H 4KGAA 1D4PB 1GL1A 1NRSH 3GCTF 1T8OA 4Q7ZA 1T7CA 3BSQA 4KTSA 4BAHB 2XYAA 5C5OA 4I31A 3TJOA 1QL7A 1K22H 3BG4C 3UFAA 1GJCB 2AYWA 2PWXA 1PPCE 4DY7B 3M5NA 2BLVA 2ZEBA 1GHWH 2ZCKP 3BTGE 2BXTH 3RXPA 4E7NA 2UUKB 4X8SH 2Y5HA 1FV9A 2FTMA 1SSXA 3M7TA 3GY2A 4FU9A 1E0FD 1Y3YA 2JETC 1YPEH 5AFYH 1IQMA 1ELDE 1L4DA 4ZXYH 1C5QA 2GMTB 1HAVB 1O2LA 4ABGA 4X2VA 1DOJA 3IWMA 3CP7A 4K60A 3SGQE 3Q77A 1EP5A 5EXNA 1DWCH 3FZDA 4MG3A 2ANKH 1NU9A 1UHBA 2A32A 4IC6A 4ZHMU 4X2WA 3MO6A 1TPAE 5DP8A 1KDQB 1Z6JH 4IMZA 1Q2WA 3UREA 1ABIH 3TLOA 1MQ6A 7GCHG 2FX6A 1TNLA 2XCNA 1O34A 1EJAA 1BHXF 1GHVH 4A1VA 5JBCS 4B73A 2ZTXA 2CMYA 4IW4E 5BRRE 1GHYH 2BD3A 1ETSH 1HYLA 1DPOA 3SNCA 2FIRH 3LJJA 1HAZB 1BRCE 1C2MA 4X1SU 3RXLA 3HKIB 3VXEH 3KN2A 1VITF 1ZMNA 1AE5A 1QCPA 4TPYA 3RXVA 4DIIH 2ZHEH 5DO4H 4TWYA 2ZGXH 1TGSZ 1QIXB 3MU4A 2FS9A 2HPPH 3T5FH 2CXVA 5C5NA 1Z6EA 1YBWA 3UR6A 1EQ9A 2OCVB 3PO1C 1XUJA 5C1XA 2H5DA 1HPGA 5E2PA 5CMXH 5H4IB 2HLCA 3VB6A 3UY9A 3RC4A 3SO3A 3TH3H 1UK2A 1SQTA 2ZU3A 3GCHC 1ELAA 2CHAC 1TE0A 4X8VH 2GCTC 2C8WB 1Z1IA 4D7FA 2KAIB 2GX4A 1ZMLA 1OPHB 2FTLE 2EI6A 1GI9B 1P3EA 5ESBA 1V2TT 1MH0A 3HGNA 4D9QA 1TNHA 4U01A 1NU7B 5L30H 1PQ7A 5I46H 5E8EH 2ZHWH 3Q3KA 1V2NT 4UFDH 2QGRA 5A0BA 1EASA 3QN7A 2ZHFH 3S69A 1A0HB 5HGGA 1Y3WA 1LHCH 2QXJA 1Z1JA 2WUBA 1P03A 1KTSB 4UFGH 1ID5H 1SFIA 3BTTE 4ZKNU 3A7XA 1K1OA 2VIPA 1K1LA 1MTWA 1ZHRA 3KQDA 1AKSB 1LMWB 1AD8H 1C1MA 2FPZA 3L6PA 4UDWH 2WPMS 3FFGA 1ESAA 1DWDH 1CVWH 2ODPA 3A88A 5EQQA 3RXTA 1G3BA 3OY5U 4RKJB 2FI5E 3E0NB 4DVAU 3A81A 4O9VA 3KL6A 1AIXH 1BRAA 1JRSA 1W7XH 2Y82A 4NIYA 1P2QA 1J17T 1THSH 2FWWA 1K1NA 2BDGA 2TGDA 1VJ9U 4K1SA 4OGXA 1T8NA 2QXHA 3H7OA 3MNSA 4JYUH 3T28A 1TBRH 3L33A 4OGYA 2FLRH 1HRTH 3BTEE 2OTVA 1A5HA 4ABBA 2WPKS 1A5IA 2FOBA 1GBTA 4RKOB 1BTPA 1Y3UA 1JOUB 4J2YB 4D9RA 1L0ZA 1HXFH 4R0IA 2XBYA 3A86A 1BTXA 5A8ZA 2BVXH 1BQYA 2XC4A 2Z3DA 2DE8A 5DGJA 3DHKH 4I32A 5EQSA 3SUDA 5GIBA 2QC2A 5DG6A 1LKAA 1LDTT 2OLGA 1D6WA 5DKMA 1GDUA 2OQ5A 1C5OH 1L1JA 5DJ7A 1MTVA 2OC7A 4X2XA 1ZTLA 2H9EH 1XM1A 3RXKA 5A8XA 1WCZA 1A7SA 2BX3A 4NA8A 1WYKA 1C2LA 3QUMP 3VGCB 1GBIA 2A1DB 1BITA 1V2LT 1RIWB 4VGCB 1TMTH 1XX9A 1GVZA 1UK4A 1FZZA 2J38A 4IC5A 1E35B 2AH4X 2FXRA 5DP3A 4I33A 1T32A 3NPSA 4NWKA 1NRNH 3P8NA 4FUFA 1ELFA 1KXEA 2VH0A 3VPKA 1NZQH 1F5RA 1LHGH 2ZFRH 3EA7A 2STBE 4INLA 4NA9H 2Y7ZA 1HUTH 3RXQA 3VB3A 3ZVBA 3MU1A 1SHHB 2XWAA 1C2EA 3PLKA 2XWBI 1UCYE 1MKWH 3T2NA 2GDDA 3RLYH 1GMCG 1KLTA 1SOZA 1P57B 2A5IA 1GI7B 2OC8A 2BQ6B 2XCFA 2ZCHP 3QZQA 5FHTA 2BD2A 2F9UA 2QF0A 3TNSA 1TBQH 3M3SA 3GY4A 4ISLA 4NIXA 4WMEA 3RXEA 2XNIA 2A5AA 7LPRA 1GHBF 3ZV8A 4D76A 4IS5A 1VGCC 3RXSA 1MBQA 1SLWB 3RP2A 1OXGA 1O2TA 1SGDE 3E91A 1DVAH 2ESTE 1V6DA 4TY6A 3LGYA 2Y7XA 1KIGH 4ASHA 3UOUA 1OWJA 5L2YH 1GMHG 2BD7A 1ANBA 3GYLB 1WOFA 3EYDA 1KXCA 1O3DA 1B7XB 1GHAG 2Q1JA 3QGNB 1S85A 4H6TA 1CE5A 5C67A 2SGPE 5JB8S 3SU2A 2VVUA 4B75A 2UUYA 3PM3A 1YPJH 1CA8B 1UTKA 1B0FA 2P59A 1ELVA 3C27B 5JB9S 3KIDU 3JZ2B 3LDXH 2D8WA 3PLBA 4JCNA 2ZPRA 4TWWA 4FVBA 3RXAA 1XXFA 1AWHB 2BD4A 1IQGA 1O3KA 4WWYA 2ZU1A 1V3XA 4IN2A 1T8LA 2PR3A 1O32A 1QL8A 2PKAA 4GPGA 4ZUHA 4BXSA 1GI3A 1AU8A 4NGAH 1PPZA 2D26C 3E1XB 2FODA 5EODA 2A7JA 4MPUA 1GJ9B 3VGCC 1AVGH 1P11E 4O3TA 1SBWA 1SGFG 2J9NA 2VIOA 2VWNA 2ZIQH 1RIWC 1AN1E 2W26A 3FAOA 4VGCC 1FONA 2D1JA 2P16A 4DIHH 5FPYA 3KCGH 2P3FH 2P95A 1SGNE 2BD5A 3PWCA 3F9HA 1AGJA 4MNXA 2JKHA 3SU1A 5EG4A 3ZZ8A 2VIDA 1P10A 1YPGH 1Y5AT 1G36A 3CENA 5EXLA 4JMYA 5EU8A 1NESE 1T4UH 2NU0E 3TK5A 1MAYA 3TGKE 3D65E 2ZECA 3MNXA 2Q6GA 1H1BA 2JH5D 3STIA 2ZHQH 1AI8H 3UWJH 2JH0D 2FOGA 1EAWA 1ESTA 2FESH 2SNVA 1ORFA 1VZQH 3EQ0H 1SQOA 5E2OA 2R2WU 1C1RA 1GVLA 4RN6A 4ZKOU 1MQ5A 1O2UA 1IAUA 1J8AA 1AWFH 2H1UA 2V35A 2QF3A 1GWAA 2H9HA 3GY3A 1J9CH 2C8ZB 1LQEA 3ESTA 2NWNA 3FANA 2XTTB 1TBZH 3ATMA 3BTHE 5A8YA 3SU0A 1UO6A 3CS7A 4ABFA 1G3CA 1IQNA 2AERH 1O3OA 2QXGA 1O5FH 1P04A 2OD3B 3UNRA 5AHGH 1ZSLA 1GGDB 4CRBA 1MTNC 1LHFH 1QR3E 1CO7E 2OC0A 3DFLA 1SG8B 1TFXA 4K8BA 4FXGH 4CBNA 1E38B 1GMHF 1FLEE 3RXMA 3TU7H 4TY7A 2J34A 3GOVB 2THFB 1N6XA 1GHAF 1NFWA 2Y80A 5AVDA 4U32A 2ZQ1A 4Y79A 1MZAA 1P06A 1G37A 1C2KA 1KTTB 4WY3A 1W11U 3I78A 2WYJA 1N8OC 3SU5A 4ZKSU 3SGBE 3V7TA 2ASUB 4DURA 5FX5A 4X1QU 1XUKA 2Z3EA 2QV1A 4TYDA 1GBCA 4I8KA 3SZNA 1J14A 2BDYA 1ZGVA 1LPKB 1EKBB 3M7UA 3RM2H 3ZZ3A 3ZVFA 4X1PU 3ZZ7A 2HNTF 4Y0YE 3RU4E 2A2QH 4INHA 4DJZB 1IQFA 1O5BB 2ZFTA 3MOCA 2A4RA 4X6OA 2GKVE 4CRAA 5AF9H 3RC6A 1BTWA 1MD7A 3K2UA 3D62A 3SU6A 3T27A 1YLCA 3BTKE 3A8AA 5FBIA 2PSXA 1MZDA 1OWHA 3ODFA 4A6LA 2GCHG 2ZDNA 1ZHMA 1RTKA 4J1YA 1DITH 3AAVA 4CHAC 3DD2H 4BXWA 4DGJA 1MD8A 1LPZB 1G9IE 2A5KA 1GBEA 3O8BA 4AN7A 3ITIA 1GVKB 3SV9A 2CF8H 2VGCB 3QTOH 1OS8A 3QO6A 3ATKA 1C5LH 1O30A 1CGJE 1F0UA 2Z9KA 1ZLRA 4WMDA 1VR1H 2EI8A 1HAGE 3FP7E 1HAOH 1WQVH 4B2BA 3RDZA 2J4IA 1O5AB 3SJ9A 1GBDA 2F83A 3M35A 3M5OA 1EAXA 1A61H 1HAXB 3FZZA 1FNIA 3M3TA 1K28D 1ZRKA 1KYNA 3SW2B 5L6NH 1DY8A 1EOLA 1KXDA 3LGUA 1C4Y2 1AZZA 2CHAB 3GCHB 1NO9H 1MBMA 1W2KH 2M5TA 4CRCA 5C20A 1C2JA 1P12E 1RXPA 2GZ9A 1MKXH 3PTNA 1C5YB 1V2MT 2FEQH 1ZTKA 2BY6X 6ESTA 1KLJH 5FXLA 5F8TA 4Y76A 4AFZA 4MQAA 2ANMH 2V3HH 2ZZUH 3MMGA 2A45B 1BTHH 1HAIH 2YNAA 1YPKH 4ABHA 3KQEA 2BOHB 2P8OC 2HNTC 2R3UA 1H4WA 3PB1E 1PYTD 3PMBB 2BD9A 3N7OA 4ABJA 1UHBB 1SHYA 1ACBE 1A3EH 5FBEA 1O2XA 2CF9H 3GICB 1W14U 5A09A 4OS6A 2B0FA 1BHXB 4LXBH 9ESTA 4THNH 3RMOH 1AQ7A 3TH4H 4BAOB 1UTLM 5A0CA 4XFQA 3QK1A 2VIWA 1O2HA 1C5XB 4AZ2B 5TCCA 4RSPA 5CE1A 2WPJS 4GCHG 3GDVA 1BOQA 2QCYA 3F9GA 4Y8XA 3NK8A 1C5PA 3GYMA 1MU8B 2WV4A 2FYRA 3AW0A 4AFUA 4NFFA 5JYIA 1PQAA 1CHGA 1V2OT 1EATA 4FUIA 3D49H 4I8HA 5T6FA 1T31A 3TK6A 3EA8A 1C1TA 3QWCH 2VWMA 1S0RA 4AX9H 1FPCH 4XOJA 3P6ZB 4BOHA 5IDKA 4BNRA 2C8XB 1P8VC 1Z7KA 1EXFA 2VGCC 1DLKB 3O8CA 1FY4A 4H6SB 1O2SA 2P3UB 2GCHF 1LTOA 5G4BA 1LKBA 1C4V2 4FUCA 1IQKA 1RGQA 2AEIH 3MH6A 2GDEH 1TPSA 1IOEA 1QB1A 1M9UA 1GBJA 2C93B 1UTQA 4WXVA 1J15A 1TOMH 3BF6H 4I8JA 1LVMA 2A4OA 1BA8B 3VEQB 1V2JT 3U9AH 3QTVH 1EZQA 1QRZA 1PPBH 1HAYB 4BTTB 1N6YA 3A8DA 3MO9A 1EPTA 2Z6BD 3ZZ9A 3GY7A 4CBOA 3S9AA 1O36A 1LPGB 1AVWA 1EZXC 3IG6B 4HI3A 4O97A 5GCHG 3TVJB 3U8RH 1QBNA 3P8GA 6CHAC 1DWEH 2Y5GA 1OX1A 3MH5A 4CRFA 1H9HE 4ABEA 2VIQA 2CN0H 5JBBS 4MVNA 3T29A 2LNCA 3LPRA 3SV6A 1C2HA 4IBLH 2J95A 3G01A 1SLXB 1RRKA 3TPIZ 1NM6A 3BV9B 3A7ZA 2VVVA 1OWKA 1TB6H 4I7YH 1SC8U 3MO3A 2HPQH 1TNIA 5LPRA 1QTFA 2IN2A 4FUHA 1YPHC 5AFZH 2ZP0H 3UWIA 1ZSJA 3MH4A 1O2VA 1BJUA 1BTYA 2J2UA 3ZZDA 3KNXA 3P17H 5EOKA 1AFQC 1VGCB 2R3YA 1L4ZA 1H9LB 4BAKB 5C1YA 3SV7A 5SGAE 1YCPH 4WH6A 1XXDA 2Y5FA 3BN9A 3SORA 2ZFQH 3M5LA 4XBBA 1NC6A 1A3BH 1DX5M 1EAUA 2RA0A 4K5ZA 3RXOA 1OYTH 2P93A 2PKSB 4B2CA 2BQ7B 3A85A 4OS1A 1O3FA 1ZJDA 2H6MA 1QA0A 5JBTA 4MPWA 5GDSH 1O5DH 1P2MA 3DT0H 3URCA 1AZ8A 1W10U 1GI2A 2VJ1A 1DXPA 2CGAA 2BLWA 2OP9A 2G5NA 4YO9A 4GUXA 3SI4H 1HLTH 1YKTA 2ZGBH 5J4SA 3ZVDA 1RJXB 2IOTA 2R9PA 7GCHF 2OC1A 4HZHA 1S6FA 3ATIA 3U98H 1ZTJA 4CH2B 8KME2 4MDSA 1HBTH 3ZVAA 1Z8RA 4NWLA 2UWLA 2F9BH 2FZZA 2A31A 1TNGA 1HV7A 1EPTC 2R2MB 3AVZA 1LHDH 2UWPA 1OWDA 1BJVA 3QZRA 3ZZAA 1NROH 1CGIE 3ATLA 1LQDB 3E6PH 1TWXB 3QX5H 4AG1A 4HGCA 4JK5A 1TX6A 1YYY1 8GCHG 5EXMA 1JRTA 3AAUA 2PHBA 3TGIE 4AOQA 1W0YH 2FX4A 1PQ8A 1JBUH 1DANH 3PLPA 3UPEA 2VIVA 1P05A 1K21H 1SGEE 2XC0A 3V13A 5A0AE 2NU3E 1HFDA 1WV7H 2BLQA 2WV5A 2BX4A 1BDAA 5EPNA 2ODYB 4FUJA 2FOCA 4WVPE 1GPZA 3ODDA 1V2UT 2W7UA 1PJPA 4Y8YA 1S84A 1THPB 1GHXH 1C5ZB 2BXUH 4CH8B 1TPOA 4YOIA 2Z7FE 2ANWA 5IYTA 3K6ZA 3RXGA 4YLQH 2ZU5A 2ZWLH 4FVDA 1MUEB 5JDUB 3OTJE 4A1TA 4KTCA 2HOBA 1S6HA 3P70B 1DT2A 1Y5BT 1C5RA 1PPHE 2PLXA 1O38A 1C1OA 2ZHDA 3V3MA 1BRBE 3NXPA 1BMMH 4ISHH 3ZYDA 1DLEA 1O2RA 2BTCE 3RMLH 4I8LA 3KHVA 1C5TA 1YPLH 4O03A 3UR9A 5C3NA 3RMNH 2PKSC 1BBRE 4Q80A 3SHCH 1SGQE 3MFJA 2Y6TA 1HJ9A 4CRGA 3E16B 5BPEA 2A7HA 1BMAA 1A0LA 3E3TA 4XDEA 1QA7A 2HGTH 1MTNB 2SGDE 1TONA 2ALPA 1O2QA 1SFQB 1TMUH 1QFKH 3H7TA 3LC3A 1P2NA 4YT6H 1SGCA 4AG2A 4AYVB 3PMJA 1GJ7B 2BY9X 1DFPA 2PKAB 1AE8H 4YOGA 1FN6A 3SQHE 1E36B 4GHQA 1DS2E 2QN5T 2ZU2A 2G4TA 1MU6B 3SV2H 1DICA 2XBXA 4ZHAA 1PPGE 1GBBA 5DP9A 3BTME 1IHTH 2C4FH 4ZHLU 4ABAA 1C5MD 5JPMH 1J16A 1N8OB 2BYAX 2BQWB 1CHOG 1C1UH 3GY5A 3RXHA 1E37B 6LPRA 2PW8H 2FO9A 2ZGCA 3ELAH 2A4GA 1C1NA 1NRRH 1TGNA 3SNBA 3BEFB 1ZRBA 1DXWA 4GHTA 9LPRA 4FU7A 1C5VA 2RDLA 1O3JA 4OS2A 4UEHH 1UCYH 3BTQE 2VH6A 1Z71A 2H2ZA 4NZLA 1QB9A 1FQ3A 3VXFH 1MKXK 4DG4A 1UJ1A 4ABIA 4YOJA 2BVRH 2A4QA 1CT2E 4YESB 1SQAA 3ZVEA 2HWLB 4X8TH 1TQ0B 4KP0A 2GV6A 3RU4D 3ZZBA 5E0JA 1LVYA 1G3EA 2PTNA 3TK9A 8GCHF 2PUQH 2XBWA 3MI4A 1S83A 4ESTE 3QGJA 4AGKA 4CHAB 3ZZ5A 1TABE 1G3DA 2ZDAH 2BVSH 2WUCA 5DP7A 1KXBA 3UOPA 5T6DA 4QT8C 2ZF0H 3PV4A 5B6OA 4X2YA 1EX3A 5J4QA 1HAHH 1A0JA 1S81A 5GJ4B 5FPTA 1P2KA 1BBRH 1O39A 1GMCF 3U1JB 2WPIS 1CQQA 1P9SA 2RCEA 1LVBA 4JZEH 1T8MA 2Z9LA 4MNYA 5GPIB 1FY8E 3I77A 5FAHA 1P02A 4MNWA 3K6YA 1GL0E 3U1IB 1RD3B 4AB9A 2ZG0H 2RA3A 3LGVA 4OS5A 3RC5A 4AGJA 3Q3XA 1ZOMA 1GMDG 2O8MA 4Y8ZA 1WAYB 2O9QA 1GJ6A 3RU4T 1KY9A 1FY1A 1W7GH 4INKA 2VINA 1BMNH 1D3DB 2IPHA 2YNBA 3VB4A 3GCNA 3RXCA 3O8DA 2G52A 3HKJB 1PPFE 2AIPA 1C9PA 2GTBA 3T62A 1O2IA 1VCWA 5HXFA 1GI5A 2H9TH 1PPEE 3LGIA 3FP6E 1YF4A 2F9PA 4PROA 4FUGA 1KSNA 1BT7A 1C4U2 2P8OB 1BCUH 1K9OE 1O3BA 3SJ8A 4CRDA 4NSVA 5TJXA 3A7WA 3BTFE 2BDCA 2BM2A 2QXIA 4BTIB 3UQVA 2BDIA 2UUFB 1O2JA 3RXBA 2VB0A 2Z94A 4AB8A 2V6NA 4XE4A 1YM0A 2AMQA 2OINA 1ANEA 4Q2KA 1G2MA 2UUJB 1L2EA 1V2WT 1O0DH 1EAIA 1F0SA 4F49A 2OXSA 3PMHB 3M36A 4AFQA 1G30B 1BMLA 1SGFA 4ZXXH 3EDXB 1QQUA 2ZDVH 5ETXA 4IMQA 4YZUA 2ULLA 2W3KA 1CHOF 3ATWA 1C2FA 2SFAA 4TPIZ 2OUAA 1UTNA 2DUCA 4MNVA 1ANDA 3M3VA 5LH8A 1HNEE 1SGYE 2STAE 1ELBA 2FOEA 1PQ5A 1MMJN 1ZR0A 1WSSH 3LU9B 1LVOA 2B7DH 3B23B 3LGTA 3MH7A 1TALA 1ARBA 1QJ7B 2QYIA 3U69H 4GSOA 2NU4E 3RXRA 1L1GA 3MHWU 4UD9H 1VCPA 1QGFA 2QAAA 7ESTE 3VFEA 1OYQA 2P94A 2Y81A 2TIOA 3S7KB 2AMDA 1KXFA 2BD8A 1HGTH 3A7VA 3MNBA 1D3QB 1O2KA
chains in the Genus database with same CATH superfamily
1FIZA 2F43B 4IN1A 1O3HA 1SGTA 2A0QB 3DA9B 3NWUA 4ASUD 1OP0A 1C1VH 1GCTC 4YT7H 1HIAA 4A1XA 3W94A 3A84A 2QF4A 3FVFB 4NIWA 3SU4A 5JBAS 3PV5A 1YCPK 1ZJKA 1INCA 3TJVA 1DUEA 4WMFA 2VU8E 3KYGA 5DP6A 2A7CA 5K7RA 1OP8A 3M37A 3RXIA 2ILNA 2BY5X 2ZU4A 4Q7XA 3SBKA 1SB1H 2TBSA 2VBCA 1TRMA 1P2JA 1GJAB 1A4WH 2K1QA 1AHTH 3SHAH 5L2ZH 1TRYA 3A83A 2Q6FA 1VCQA 1OSSA 6CHAB 1W3CA 3KQBA 1O35A 1CBWB 3RXDA 3ZVGA 1A46H 4UFEH 3MYWA 1SLVB 2ZGJA 1GMDF 1CT4E 1JWTA 4MTBA 1K1MA 1HJAC 3TNTA 7KMEH 1FUJA 4K3JA 1C1PA 2P3TB 4CREA 2SNWA 2FDAA 3HK3B 4ZAEA 2FI4E 1D9IA 2ZFFH 1XKBC 1XUFA 1ZGIA 2ZO3H 3LH1A 4Y71A 1UTMA 5C17A 2PUXB 2D2DA 4XRNA 1QB6A 1XUHA 1JIMA 1W8BH 1AFQB 1ZSKA 4GAWA 3HGPA 3L3TA 3E90B 3GDSA 1GBMA 2ZTZA 1LCYA 2HVXA 3EGKH 5LPEA 2HVYB 2ZNKH 1GI4A 1GJ5H 5C94A 1LO6A 1HB0B 1HDTH 1TX8A 5CHAB 1V2QT 3ZYEA 1XUIA 3EA9A 1Y3VA 4K2YA 1FY5A 2GP9B 1TA6A 1C1QA 2QIQA 3H5CB 2PSYA 2F91A 3F9EA 2TGAA 2O8LA 1PYTC 4B6EA 1MKWK 1QBVH 1O2ZA 3NZIA 4D7GA 2W5EA 1BRUP 3KGPA 1H8IH 1HAVA 1O5CB 5GXPA 3SUFA 1FXYA 1UVTH 5LGOA 1HJ8A 4Q7YA 4U30A 2G81E 3A8BA 1W0KD 2HALA 3BIUH 1FAXA 1HXEH 1UVOA 1FAKH 2I6QA 3F68H 1KDQA 3Q00A 1V2VT 5K0HA 2O8TA 4DT7B 3OY6U 4NA7A 1ELCA 2XXLA 1A5GH 1SOTA 1GBAA 2ZKSA 5DPAA 2NU2E 3P8OA 3S9CA 1KMHB 1C2IA 2O8WA 4Y11E 1ARCA 1EPTB 1O31A 3TJNA 5FCKA 3LC5A 2EI7A 3EAJA 3HPTB 2FOFA 2C8YB 1F0RA 3Q3YA 1B5GH 2GV7A 2HNTE 1UVUH 1DWBH 2J97A 3M7QA 5B6LA 4O3UA 1MAXA 1O3IA 2CV3A 1D3PB 1DUAA 1SLUB 1XVOA 3E8LA 3Q76A 2SGQE 3SI3H 4MPVA 5T3HA 4H4FA 1Y3XA 2EEKA 5E0HA 4E7RG 1DSTA 2AGEX 1AY6H 2ODQA 3TITA 1RS0A 3UQOA 1ANCA 1Q3XA 1SGRE 4JYVH 2FOAA 3SJKA 1O3AA 1KXAA 1BZXE 1ETRH 1IQEA 4JYTA 1CBWC 3MTYA 1MCVA 1COWD 2G00A 4CR9A 2F3CE 3DUXH 1GI0A 2LPRA 4XSKU 1EB1H 2GVFA 2IJD1 3LOXA 4AFSA 5ABWA 1TAWA 1IQIA 1NRPH 1QNJA 1V2PT 2QE7D 3SQEE 2KAIA 1IQHA 5F8ZA 3W95A 8ESTE 4AORA 3LKWA 3K65B 3RMMH 3KF2A 1WU1A 1XKAC 3CS0A 4ISOA 1JIRA 1P09A 3HATH 2V0BA 3B9FH 1GHBG 3E0PB 3F3BA 1NY22 1FN8A 3ZZCA 4K1TA 4X6NA 1GG6B 1UMAH 2F9OA 1GI8B 2BMGB 5F03A 4JK6A 1SVPA 5EW2H 3SGAE 1F0TA 3R3GB 1FMGA 1O3GA 1OWEA 1QQ4A 4B71A 1BUIA 3AK5A 1UTOA 4A92A 4DT4A 1CT0E 5GWZA 2Z9IA 2BDBA 4NZQA 1UCYK 1O3PB 1YWUA 2GMTC 2TPIZ 1WUNH 5CHAC 2AMPA 2SGAA 3PTBA 2Z3CA 1D3TB 1S82A 3ZIAD 2FI3E 1P2IA 1E1QD 1LHEH 2FMJA 5HMAA 1AKSA 2VNTA 2BZAA 2G5VA 1QURH 2OBQA 1YGCH 4JZ1A 3UIRA 1F92A 1Z8GA 3P95A 3LONA 3VB5A 1VJAU 3SOSA 1Y5UT 3RXFA 1BTZA 4GCHF 3OX7U 1VKYA 3EE0B 1O3EA 4M7GA 1GJDB 1UTPA 1SGPE 4Y7AA 1WTGH 4KKDA 4ZH8A 1TYNA 1NBMD 2FYQA 1O2NA 2RDEA 4FETA 3P8FA 1BB0B 3AW1A 1G2LA 3FP8E 3PRDA 4DCDA 4ACBA 3S9BA 3LH3A 1A1RA 1AMHA 1E1RD 2GD4B 1TGBA 5CHBA 1TQ7B 1ZMJA 1BBRK 1O3LA 1TGCA 4WH8A 1MTUA 1T4VH 3SJOA 2WPLS 1G32B 4ZMAH 1F5LA 2ZDLA 2ZTYA 4OM9A 1YC0A 4MLFB 3WWBA 5EIYA 4Z0KA 1MCTA 1WDIA 3M5MA 1C1SA 2G4UA 3RLWH 3SUGA 2CJIA 2IJOB 1YPHE 3S0NA 4Y6DA 2BDAA 1GJBB 1C9TA 2RFKC 1O5EH 2ZCLP 4ISNA 1B0EA 3MU5A 2XC5A 3GCOA 1UK3A 1W13U 3S7HB 3F9FA 1NPMA 5EJZA 2QY0B 1QJ1B 4X6MA 2EA3A 3LJOA 3IITA 3U28C 2PGQB 3GS9A 4A5TS 2BOKA 3PROA 2XBVA 5F8XA 4MPXA 1OP2A 4XBDA 5HM9A 1P01A 2WV9A 1UTJA 4K8YA 3NUMA 2V3OH 3UNSA 4Y7BA 2KX4A 2BDHA 1TPPA 4P00A 4F48B 2B5TB 2DE9A 1NFUA 1O2WA 2FLBH 1K2I1 5GCHF 1AFEH 1NFYA 2ZC9H 2ZFSA 1YCPM 2JH6D 1DE7H 2EQNA 1GG6C 1GDQA 4YTAA 1TNKA 4X1RU 4SGBE 3MNCA 3BIVH 4LOYH 3BTDE 2TGPZ 2VWLA 2SGEE 3ENSB 1FDPA 2WINI 1ZHPA 1AB9B 3F1SB 2ZDKA 1FI8A 2G8TA 4NG9H 4JZFH 4E06H 4ABDA 1O3MA 2Q6DA 5EQRA 3A80A 1K1JA 2B9LA 1UVSH 3KEEA 1CA0B 3SU3A 2GZ7A 3ZZ4A 3SN8A 3BEIB 3LGWA 2KCAA 1FIWA 1SQRA 3O8RA 4WF8A 2WPHS 2EY4C 2OQUA 3A8CA 3N7DA 1O2MA 1NFXA 2FP7B 4DOQA 2L74A 1PFXC 1FJSA 1RTLA 4NSYA 4ZROA 3GY6A 4Y10E 1W0ZU 1ELGA 1V2RT 5F53A 1NN6A 3V12A 1C2GA 3TGJE 4JZIA 1K1PA 2BZ6H 2NU1E 1GBLA 4NIVA 5T6GA 1Q31A 1IQJA 3TH2H 2PTCE 3QLPH 1V2KT 3PWBA 1QL9A 1X7AC 1DY9A 1EJMA 1AVXA 1N1LA 1RTFB 3GDUA 1OKXA 2GT7A 2BB4A 1MTSA 1FPHH 1ETTH 1O2YA 2A2XH 2BLOA 4FUDA 1NTPA 1O3NA 2KR7A 4FU8A 2C90B 3SJIA 1V2ST 4AYYB 4K69A 4XBCA 1NS3A 1GBHA 1JXPA 3T25A 4ZKRU 1TIOA 1GI6A 1VITH 1P3CA 2GT8A 1TNJA 1GCDA 2ALVA 1TGTA 2AS9A 2ZFPH 1DDJA 4A7IB 4NFEA 2ZDMA 3FO8D 2G51A 1CGHA 1S5SA 2RG3A 2BHGA 2HRVA 1BIOA 2W3IA 3HK6B 3PMAB 1QBOA 5HIZA 1CSOE 5C1UA 1D6RA 4WXIA 3SNEA 1ELTA 2R0LA 1HAPH 3OSYA 1GBKA 1TA2A 3SV8A 2F9NA 4YM9A 3UTUH 2J92A 4CR5A 6GCHG 4UE7H 2ZA5A 3V0XA 2TRMA 1K1IA 5DK1A 3QDZB 3MU8A 3DSGA 5E0GA 4TT3D 1XVMA 1EUFA 2TGTA 1SGIB 1GCTB 2JJ2D 1P0SH 2FOHA 1SR5C 1Y8TA 4D8NA 3B8JA 1RFNA 2PV9B 4NCYA 2FOMB 5I25A 5FCRA 2AGIX 1THRH 2AGGX 3RM0H 3D23A 1AB9C 1U6QA 2O8UA 2AIQA 2R0KA 3KQCA 1FY3A 3UUZA 1L1NA 2ZI2H 3SUEA 2BY7X 3WY8A 3PYHA 1GJ4H 1CA0C 4E05H 1ELEE 2J98B 1DM4B 3RXJA 3GISB 4BAQB 4B76A 4DW2U 2ZPSA 1QHRB 1GDNA 4B74A 2Z9GA 4LZ1H 1TMBH 3GCTG 1ZPBA 3OE7D 5C2ZA 4KELA 5ESTE 3DSOA 4YLUA 2YMSB 5PTPA 3OU0A 4UFFH 2ZPQA 1SL3A 4OS4A 3LT3A 1XUGA 2ZGHA 4GLYA 2J94A 4B2AA 1HJAB 3NCLA 1DSUA 1YPMH 4IGDA 3MWIU 4FUEA 2JIZD 1WTHD 4BAMB 1Y59T 2YOLA 3ZV9A 1EOJA 1H9IE 5FL7D 1F2SE 1EP6A 4LK4A 1CU1A 1W12U 5FX6A 2Z9JA 4X1NU 3A7YA 5EGMA 8LPRA 3BG4B 4U2WA 1ESBA 4HG6A 3TIUA 1P9UA 1TOCB 1H8DH 1ZYOA 3M61U 1EZUC 4X8UH 5DP5A 1TX7A 4UONA 3SNAA 1C2DA 1E34B 1O2PA 1O2GH 2WZQA 1QJ6B 4GVUA 1O3CA 1Z8IB 3F6UH 3OYPA 4Y0ZE 2GZ8A 4HFPB 2F9VA 1Z8JB 2JETB 1H8ED 3U8OH 2OBOA 3TJUA 1ZPCA 1SPJA 1QRXA 3LIWA 2XRCA 1YLDA 3BEUA 1GI1A 1ZZZA 3RXUA 2UWOA 1NRQH 1O37A 2G55A 2ANYA 4F4OC 1NT1A 2VWOA 2ZQ2A 4K1EA 1ABJH 1C5NH 3K9XB 4OS7A 2SGFE 4X6PA 5HM2A 2I6SA 1VITG 4X0WU 4HTCH 1GBFA 1O5GH 1QY6A 3F0OA 4KTUA 1O2OA 4I8GA 5A2MH 3I29A 1HIAB 5FPSA 2B8OH 1AO5A 2BY8X 1MABB 3GY8A 3ZZ6A 4H42U 3AASA 5EPYA 3URDA 4ISIH 4JZDH 1OWIA 3BTWE 3P92A 4FUBA 3SNDA 3A7TA 1C5UA 1GJ8B 4BTUB 4B1TA 1EZSC 3UNQA 1SMFE 5LPFA 2V7QD 2XW9A 1YP9A 1UVPA 4WJG2 1O33A 3U8TH 5F6MA 2H5CA 1QRWA 2GGVB 3A87A 1H8HD 4BANB 2FM2A 2QA9E 1IQLA 2WYGA 1GHZA 3ZVCA 1AUJA 1OHHD 2EC9H 3C1KA 4LZ4B 1HCGA 4R8TB 1WBGB 1JMOH 1EB2A 6GCHF 3MU0A 3OEED 2VVCA 1WQSA 3BG8A 1TRNA 3STJA 1AUTC 4Z6AH 1BTUA 1C1WH 1F7ZA 1A2CH 3DFJA 5DP4A 2C3SA 3JZ1B 3A82A 2PGBB 4Q63A 1XMNB 3WWFA 4SGAE 3PO1B 3T26A 1F5KU 1C5WB 2PFEA 5DSFA 2FS8A 3R0FA 1P2OA 2YMSC 2AFQB 1SKYE 2XNDD 2JDID 3RUOA 3VB7A 1TLDA 1ZPZA 1IHSH 5HYOA 1EJNA 2GCTB 5TCAA 5DN6D 3F2HA 2W7SA 1OOKB 1S0QA 1GGDC 1KLIH 1C5SA 3FOAA 5EW1H 3NKKA 3A89A 1SI5H 4KGAA 1D4PB 1GL1A 1NRSH 3GCTF 1T8OA 4Q7ZA 1T7CA 4P02A 3BSQA 4KTSA 4BAHB 2XYAA 5C5OA 4I31A 3TJOA 1QL7A 1K22H 3BG4C 3UFAA 1GJCB 2AYWA 2PWXA 1PPCE 4DY7B 3M5NA 2BLVA 2ZEBA 1GHWH 2ZCKP 3BTGE 2BXTH 5GNDA 3RXPA 4E7NA 2UUKB 4X8SH 2Y5HA 4RT0A 1FV9A 2FTMA 1SSXA 3M7TA 3GY2A 4FU9A 1E0FD 1Y3YA 2JETC 1YPEH 5AFYH 1IQMA 1ELDE 1L4DA 4ZXYH 1C5QA 2GMTB 1HAVB 1O2LA 4ABGA 4X2VA 1DOJA 3IWMA 3CP7A 4K60A 5IK2D 3SGQE 3Q77A 1EP5A 5EXNA 1DWCH 3FZDA 4MG3A 2ANKH 1NU9A 1UHBA 1UW7A 2A32A 4IC6A 4ZHMU 4X2WA 3MO6A 1TPAE 5DP8A 4FOUC 1KDQB 1Z6JH 3FKSD 4IMZA 1Q2WA 3UREA 1ABIH 3TLOA 1MQ6A 7GCHG 2FX6A 1TNLA 2XCNA 1O34A 1EJAA 1BHXF 1GHVH 4A1VA 5JBCS 4B73A 2ZTXA 2CMYA 4IW4E 5BRRE 1GHYH 2BD3A 1ETSH 1HYLA 1DPOA 3SNCA 2FIRH 3LJJA 1HAZB 1BRCE 1C2MA 4X1SU 3RXLA 3HKIB 3VXEH 3KN2A 1VITF 1ZMNA 1AE5A 1QCPA 4TPYA 5KEDA 3RXVA 4DIIH 2ZHEH 5DO4H 4TWYA 2ZGXH 1TGSZ 1QIXB 3MU4A 2FS9A 2HPPH 3T5FH 2CXVA 5C5NA 1Z6EA 1YBWA 3UR6A 1EQ9A 2OCVB 3PO1C 1XUJA 4B6FA 5C1XA 2H5DA 1HPGA 5E2PA 5CMXH 5H4IB 2HLCA 3VB6A 3UY9A 3RC4A 3SO3A 3TH3H 1UK2A 1SQTA 2ZU3A 3GCHC 1ELAA 2CHAC 1TE0A 4X8VH 2GCTC 2C8WB 1Z1IA 4D7FA 2KAIB 2GX4A 1ZMLA 1OPHB 2FTLE 2EI6A 1GI9B 1P3EA 5ESBA 3H09A 1V2TT 1MH0A 3HGNA 4D9QA 1TNHA 4U01A 1NU7B 5L30H 1PQ7A 3EE7A 5I46H 5E8EH 2ZHWH 3Q3KA 1V2NT 4UFDH 2QGRA 5A0BA 1EASA 3QN7A 2ZHFH 2GJGA 3S69A 1A0HB 5HGGA 1Y3WA 1LHCH 2QXJA 1Z1JA 2WUBA 1P03A 1KTSB 4UFGH 1ID5H 1SFIA 3BTTE 4ZKNU 3A7XA 1K1OA 2VIPA 1K1LA 1MTWA 1ZHRA 3KQDA 1AKSB 2QF5A 5EJ1A 3NRLA 1LMWB 1AD8H 1C1MA 2FPZA 3L6PA 4UDWH 2WPMS 3FFGA 1ESAA 2K8IA 1DWDH 1CVWH 2ODPA 3A88A 5EQQA 3RXTA 1G3BA 3OY5U 4RKJB 2FI5E 3E0NB 4DVAU 3A81A 4O9VA 3F2GA 3KL6A 1AIXH 1BRAA 1JRSA 1W7XH 2Y82A 1FX0B 1YLNA 4NIYA 1BMFD 1P2QA 1J17T 1THSH 2FWWA 1K1NA 2BDGA 2TGDA 1VJ9U 4K1SA 4OGXA 1T8NA 2QXHA 3H7OA 3MNSA 4JYUH 3T28A 1TBRH 3L33A 4OGYA 2FLRH 1HRTH 3BTEE 2OTVA 1A5HA 4ABBA 2WPKS 1A5IA 2FOBA 1GBTA 4RKOB 1BTPA 1Y3UA 1JOUB 4J2YB 4D9RA 1L0ZA 1HXFH 4R0IA 2XBYA 3A86A 1BTXA 4YXWD 5A8ZA 4Z1MD 2BVXH 1BQYA 2XC4A 4RI0A 2Z3DA 2DE8A 5DGJA 3DHKH 4I32A 2AHME 5EQSA 3SUDA 5GIBA 2QC2A 2KCOA 5DG6A 1LKAA 1LDTT 2OLGA 1D6WA 5DKMA 1GDUA 2OQ5A 1C5OH 1L1JA 5DJ7A 1MTVA 2OC7A 4X2XA 1ZTLA 2H9EH 1XM1A 3RXKA 5A8XA 1WCZA 1A7SA 2BX3A 4NA8A 1WYKA 1C2LA 3DSPA 1W0JD 3QUMP 3VGCB 1GBIA 2A1DB 1BITA 1V2LT 2CK3D 1RIWB 4VGCB 1TMTH 1XX9A 1GVZA 1UK4A 1FZZA 4TSFD 2J38A 4IC5A 1E35B 2AH4X 2FXRA 5DP3A 4I33A 1T32A 3NPSA 4NWKA 1NRNH 3P8NA 4FUFA 1ELFA 1KXEA 2VH0A 3VPKA 1NZQH 1F5RA 1LHGH 2ZFRH 3EA7A 2STBE 4INLA 4NA9H 2Y7ZA 1HUTH 3RXQA 3VB3A 3ZVBA 3MU1A 1SHHB 2XWAA 1C2EA 3PLKA 2XWBI 1UCYE 1MKWH 3T2NA 2GDDA 3RLYH 1GMCG 2IPQX 1KLTA 1K0HA 1SOZA 1P57B 2A5IA 1GI7B 2OC8A 2BQ6B 2XCFA 2ZCHP 3QZQA 5FHTA 2BD2A 2F9UA 5HKKD 2QF0A 3TNSA 1TBQH 3M3SA 3GY4A 4ISLA 4NIXA 4WMEA 3RXEA 2XNIA 2A5AA 7LPRA 1GHBF 3ZV8A 4D76A 4IS5A 1VGCC 3RXSA 1MBQA 1SLWB 3RP2A 1OXGA 1O2TA 1SGDE 3E91A 1DVAH 2ESTE 1V6DA 4TY6A 3LGYA 2Y7XA 1KIGH 4ASHA 3UOUA 1OWJA 5L2YH 1GMHG 2BD7A 1ANBA 3GYLB 1WOFA 3EYDA 1KXCA 1O3DA 1B7XB 1GHAG 2Q1JA 3QGNB 1S85A 4H6TA 1CE5A 5C67A 2SGPE 5JB8S 3SU2A 2VVUA 4B75A 2UUYA 3PM3A 1YPJH 1CA8B 1UTKA 1B0FA 2P59A 1ELVA 3C27B 5JB9S 3KIDU 3JZ2B 3LDXH 2D8WA 3PLBA 4JCNA 2ZPRA 4TWWA 4FVBA 3RXAA 1XXFA 1AWHB 2BD4A 1IQGA 1O3KA 4WWYA 2ZU1A 1V3XA 4IN2A 1T8LA 2PR3A 1E79D 1O32A 1QL8A 2PKAA 4GPGA 4ZUHA 4BXSA 1GI3A 1AU8A 4NGAH 1PPZA 2D26C 3E1XB 2FODA 5EODA 2A7JA 4MPUA 1GJ9B 3VGCC 1AVGH 1P11E 4O3TA 3F0PA 1SBWA 1SGFG 2J9NA 2VIOA 2VWNA 2ZIQH 1RIWC 1AN1E 2W26A 3FAOA 4VGCC 1FONA 2D1JA 2P16A 4DIHH 5FPYA 3KCGH 2P3FH 2P95A 1SGNE 2BD5A 3PWCA 3F9HA 1AGJA 4MNXA 2JKHA 3SU1A 5EG4A 1YY3A 3ZZ8A 3UAIC 2VIDA 2KCYA 1P10A 1YPGH 1Y5AT 1G36A 5KGOA 3CENA 5EXLA 5C0TA 4JMYA 5EU8A 1NESE 1T4UH 2NU0E 3TK5A 1MAYA 3TGKE 3D65E 2ZECA 3MNXA 2Q6GA 1H1BA 2JH5D 3STIA 2ZHQH 1AI8H 3UWJH 2JH0D 2FOGA 1EAWA 1ESTA 2FESH 2SNVA 1ORFA 1VZQH 3EQ0H 1SQOA 5E2OA 2R2WU 1C1RA 1GVLA 4RN6A 4ZKOU 1MQ5A 1O2UA 1IAUA 1J8AA 1AWFH 2H1UA 2V35A 2QF3A 1GWAA 2H9HA 3GY3A 3FN8A 1J9CH 2C8ZB 4F55A 1LQEA 3ESTA 2NWNA 2OK5A 3FANA 2XTTB 1TBZH 3ATMA 3BTHE 5A8YA 3SU0A 1UO6A 3CS7A 4ABFA 1G3CA 1IQNA 2AERH 2XOKD 1O3OA 2QXGA 1O5FH 1P04A 2OD3B 3UNRA 5AHGH 1ZSLA 1GGDB 4CRBA 1MTNC 1LHFH 1QR3E 1CO7E 2OC0A 3DFLA 1SG8B 1TFXA 4K8BA 3F2FA 4FXGH 4CBNA 1E38B 1GMHF 1FLEE 3UB0A 3RXMA 3TU7H 4TY7A 2J34A 3GOVB 2THFB 1N6XA 1GHAF 1NFWA 2Y80A 5AVDA 4U32A 2ZQ1A 3CNRA 4Y79A 1MZAA 1P06A 1G37A 1C2KA 1KTTB 4WY3A 1W11U 3I78A 2WYJA 5HIYA 1N8OC 3OTPA 3SU5A 4ZKSU 3SGBE 3V7TA 4ZCNA 2ASUB 4DURA 5FX5A 4X1QU 1XUKA 2Z3EA 2QV1A 4TYDA 1GBCA 4I8KA 3SZNA 1J14A 2BDYA 1ZGVA 1LPKB 1EKBB 2PP6A 3M7UA 3RM2H 3ZZ3A 3ZVFA 4X1PU 3ZZ7A 2HNTF 4Y0YE 3RU4E 2A2QH 4INHA 4DJZB 1IQFA 1O5BB 2ZFTA 3MOCA 2A4RA 4X6OA 2GKVE 4CRAA 5AF9H 3RC6A 1BTWA 1MD7A 3K2UA 3D62A 3SU6A 3T27A 1YLCA 3BTKE 3A8AA 5FBIA 2PSXA 1MZDA 1OWHA 3ODFA 4A6LA 2GCHG 2ZDNA 1ZHMA 1RTKA 4J1YA 1DITH 3AAVA 4CHAC 3DD2H 4BXWA 4DGJA 1MD8A 1LPZB 1G9IE 2A5KA 1GBEA 3O8BA 4AN7A 3ITIA 1GVKB 3SV9A 2CF8H 2VGCB 3QTOH 1OS8A 3QO6A 3ATKA 1C5LH 1O30A 1CGJE 1F0UA 2Z9KA 2HLDD 1ZLRA 4WMDA 3N99A 1VR1H 2EI8A 1HAGE 3OEHD 3FP7E 1HAOH 1WQVH 4B2BA 4M9FA 3RDZA 3W1EA 2J4IA 1O5AB 3SJ9A 1GBDA 2F83A 3M35A 3M5OA 1EAXA 1A61H 1HAXB 3FZZA 1FNIA 2WSSD 3M3TA 1K28D 1ZRKA 1KYNA 3SW2B 5L6NH 1DY8A 1EOLA 1KXDA 3LGUA 1C4Y2 1AZZA 2CHAB 3GCHB 1NO9H 1MBMA 1W2KH 2M5TA 4CRCA 5C20A 1C2JA 1P12E 2M2AA 1RXPA 2GZ9A 1MKXH 3PTNA 1C5YB 3MQKC 1V2MT 2FEQH 1ZTKA 2BY6X 6ESTA 1KLJH 5FXLA 5F8TA 4Y76A 4AFZA 3PRBA 4MQAA 2ANMH 2V3HH 2ZZUH 3MMGA 2A45B 1BTHH 1HAIH 2YNAA 1YPKH 4ABHA 3KQEA 2LP6A 2BOHB 2P8OC 2HNTC 2R3UA 1QZ8A 1H4WA 3PB1E 1PYTD 3PMBB 2BD9A 3N7OA 4ABJA 1UHBB 1SHYA 1ACBE 1A3EH 5FBEA 1O2XA 2CF9H 3GICB 1W14U 5A09A 4OS6A 2B0FA 1BHXB 4LXBH 9ESTA 4THNH 3RMOH 1AQ7A 3TH4H 4BAOB 1UTLM 5A0CA 4XFQA 3QK1A 2VIWA 1O2HA 1C5XB 4AZ2B 5TCCA 4RSPA 5CE1A 2WPJS 4GCHG 3GDVA 4Q4LA 1BOQA 2KCPA 2QCYA 3F9GA 3OFND 4Y8XA 3NK8A 1C5PA 3GYMA 3N7EA 1MU8B 3SZEA 2WV4A 2FYRA 3AW0A 4AFUA 4NFFA 5JYIA 1PQAA 1CHGA 1V2OT 1EATA 4FUIA 3D49H 4I8HA 5T6FA 1T31A 3TK6A 3EA8A 1C1TA 3QWCH 2VWMA 1S0RA 4AX9H 1FPCH 4XOJA 3P6ZB 4BOHA 5IDKA 4BNRA 2C8XB 1P8VC 1Z7KA 1EXFA 2VGCC 1DLKB 3O8CA 1FY4A 4H6SB 1O2SA 2P3UB 2GCHF 1LTOA 5G4BA 1LKBA 1C4V2 4FUCA 1IQKA 1RGQA 2AEIH 3MH6A 2GDEH 1TPSA 1IOEA 1QB1A 1M9UA 1S6LA 1GBJA 2C93B 1UTQA 4WXVA 1J15A 1TOMH 3BF6H 4I8JA 1LVMA 3KYFA 2A4OA 2J5UA 1BA8B 3VEQB 1V2JT 5C0UA 3U9AH 4I86A 3QTVH 1EZQA 1QRZA 1PPBH 1HAYB 4BTTB 1N6YA 3A8DA 3MO9A 1EPTA 2Z6BD 3ZZ9A 3GY7A 4CBOA 3S9AA 1O36A 1LPGB 1AVWA 1EZXC 3IG6B 4HI3A 4O97A 5GCHG 3TVJB 3U8RH 1QBNA 3P8GA 6CHAC 1DWEH 2Y5GA 1OX1A 3MH5A 4CRFA 1H9HE 2L6OA 4ABEA 2VIQA 2CN0H 5JBBS 4MVNA 3T29A 2LNCA 3LPRA 3SV6A 1C2HA 4IBLH 2J95A 3G01A 1SLXB 1RRKA 3TPIZ 1NM6A 3BV9B 3A7ZA 2VVVA 1OWKA 1TB6H 4I7YH 1SC8U 3MO3A 2HPQH 1TNIA 5LPRA 1QTFA 2IN2A 4FUHA 1YPHC 5AFZH 2ZP0H 3UWIA 1ZSJA 3MH4A 2WHXA 1O2VA 1BJUA 1BTYA 2J2UA 3ZZDA 3KNXA 3P17H 5EOKA 1AFQC 1VGCB 2R3YA 1L4ZA 3DCLA 1H9LB 4BAKB 5C1YA 3SV7A 5SGAE 1YCPH 4WH6A 1XXDA 2Y5FA 3BN9A 3SORA 2ZFQH 3M5LA 4XBBA 1NC6A 1A3BH 1DX5M 1EAUA 2RA0A 4K5ZA 3RXOA 1OYTH 2P93A 2PKSB 4B2CA 2BQ7B 3A85A 4OS1A 1O3FA 1ZJDA 2H6MA 1QA0A 5JBTA 4MPWA 5GDSH 1O5DH 1P2MA 3DT0H 3URCA 1AZ8A 1W10U 1GI2A 2VJ1A 1DXPA 2CGAA 2BLWA 2OP9A 2G5NA 4YO9A 4GUXA 3SI4H 1HLTH 1YKTA 2ZGBH 5J4SA 3ZVDA 1RJXB 2IOTA 2R9PA 7GCHF 2OC1A 4HZHA 1S6FA 3ATIA 3U98H 1ZTJA 4CH2B 8KME2 4MDSA 1HBTH 3ZVAA 1Z8RA 4NWLA 2UWLA 2F9BH 2FZZA 2A31A 1TNGA 1HV7A 1EPTC 2R2MB 3AVZA 1LHDH 2UWPA 1OWDA 1BJVA 3QZRA 3ZZAA 1NROH 1CGIE 3ATLA 1LQDB 3E6PH 1TWXB 3QX5H 4AG1A 4HGCA 4JK5A 1TX6A 1YYY1 8GCHG 5EXMA 1JRTA 3AAUA 2PHBA 3TGIE 4AOQA 1W0YH 2FX4A 1PQ8A 1JBUH 3WW7A 1DANH 3PLPA 3UPEA 2VIVA 1P05A 1K21H 1SGEE 2XC0A 3V13A 5A0AE 3OAAD 2NU3E 1HFDA 1WV7H 2BLQA 2WV5A 2BX4A 2F4LA 1BDAA 5EPNA 2ODYB 4FUJA 2FOCA 4WVPE 1GPZA 3ODDA 1V2UT 2W6ID 2W7UA 1PJPA 4Y8YA 1S84A 1THPB 1GHXH 1C5ZB 2BXUH 4CH8B 1TPOA 4YOIA 2Z7FE 2ANWA 5IYTA 3K6ZA 3RXGA 4YLQH 2JJ1D 3VG8A 2ZU5A 2ZWLH 4FVDA 1MUEB 5JDUB 3OTJE 4A1TA 4AC9A 4KTCA 2HOBA 2KFWA 1S6HA 3P70B 1DT2A 1Y5BT 1C5RA 1PPHE 2PLXA 1O38A 1C1OA 2ZHDA 3V3MA 1BRBE 3NXPA 1BMMH 4ISHH 3ZYDA 1DLEA 1O2RA 2BTCE 3RMLH 4I8LA 3KHVA 1C5TA 1YPLH 4O03A 3UR9A 5C3NA 3RMNH 2PKSC 2W6JD 1BBRE 4Q80A 3SHCH 1SGQE 3MFJA 2Y6TA 1HJ9A 4CRGA 3E16B 5BPEA 2A7HA 1BMAA 1A0LA 3E3TA 4XDEA 1QA7A 2HGTH 5T1VA 1MTNB 2SGDE 1NBME 1TONA 2ALPA 1O2QA 1SFQB 1TMUH 1QFKH 3H7TA 3LC3A 1P2NA 4YT6H 1SGCA 4AG2A 4AYVB 3PMJA 1GJ7B 2BY9X 1DFPA 2PKAB 1AE8H 4YOGA 1FN6A 3SQHE 1E36B 4GHQA 1DS2E 2QN5T 2ZU2A 2G4TA 1MU6B 3SV2H 1DICA 2XBXA 4ZHAA 1PPGE 1GBBA 5DP9A 3BTME 1WXRA 5EJLA 1IHTH 2C4FH 4ZHLU 4ABAA 1C5MD 5JPMH 1J16A 1N8OB 2BYAX 2BQWB 1CHOG 1C1UH 3GY5A 3RXHA 1E37B 6LPRA 2PW8H 2FO9A 2ZGCA 3ELAH 2A4GA 1C1NA 1NRRH 1TGNA 3SNBA 3BEFB 1ZRBA 1DXWA 4GHTA 9LPRA 4FU7A 3KQ5A 1C5VA 2RDLA 1O3JA 3PV2A 4OS2A 4UEHH 1UCYH 3BTQE 2VH6A 1Z71A 2H2ZA 4NZLA 1QB9A 1FQ3A 3VXFH 1MKXK 4DG4A 1UJ1A 4ABIA 4YOJA 2BVRH 2A4QA 1CT2E 4YESB 1SQAA 3ZVEA 2HWLB 4ACAA 4X8TH 1TQ0B 4KP0A 5KECA 2GV6A 3RU4D 3ZZBA 3SYJA 5E0JA 1LVYA 1G3EA 2PTNA 3TK9A 8GCHF 2PUQH 2XBWA 3MI4A 1S83A 1EFRD 4ESTE 3QGJA 4AGKA 4CHAB 3ZZ5A 1TABE 1G3DA 2ZDAH 2BVSH 2WUCA 5DP7A 1KXBA 3UOPA 5T6DA 4QT8C 2ZF0H 3PV4A 5B6OA 4X2YA 2K0QA 1EX3A 5J4QA 1HAHH 1A0JA 1S81A 5GJ4B 5FPTA 1P2KA 1BBRH 2WPDD 1O39A 1GMCF 3U1JB 2WPIS 1CQQA 1P9SA 2RCEA 1LVBA 4JZEH 1T8MA 2Z9LA 4MNYA 4RT1A 5GPIB 1FY8E 3I77A 5FAHA 1P02A 4MNWA 3K6YA 1GL0E 2LELA 3U1IB 1RD3B 4AB9A 2ZG0H 2RA3A 3LGVA 4OS5A 3RC5A 4AGJA 3Q3XA 1ZOMA 1GMDG 2O8MA 4Y8ZA 1WAYB 2O9QA 1GJ6A 3RU4T 1KY9A 1FY1A 1W7GH 4INKA 2VINA 1BMNH 1D3DB 2IPHA 2YNBA 3VB4A 3GCNA 3RXCA 2J98A 3O8DA 2G52A 3HKJB 1PPFE 2KZ4A 2AIPA 1C9PA 2GTBA 3T62A 1O2IA 1VCWA 5HXFA 1GI5A 2H9TH 1PPEE 3LGIA 3FP6E 1YF4A 2F9PA 4PROA 4FUGA 1KSNA 1BT7A 1C4U2 2P8OB 1BCUH 1K9OE 1O3BA 3SJ8A 4CRDA 4NSVA 5TJXA 3A7WA 3BTFE 2BDCA 2BM2A 2QXIA 4BTIB 3UQVA 2BDIA 2UUFB 1O2JA 3RXBA 2VB0A 2Z94A 4AB8A 2KM0A 2V6NA 4XE4A 1YM0A 2AMQA 2OINA 1ANEA 4Q2KA 1G2MA 2UUJB 1L2EA 1V2WT 1O0DH 1EAIA 1F0SA 4F49A 2OXSA 3PMHB 5CDFE 3M36A 2V3MA 4AFQA 1G30B 1BMLA 1SGFA 4ZXXH 3EDXB 1QQUA 2ZDVH 5ETXA 4IMQA 4YZUA 2ULLA 2W3KA 1CHOF 3ATWA 1C2FA 2SFAA 4TPIZ 2OUAA 1UTNA 2DUCA 4XD7D 4MNVA 1ANDA 3M3VA 5LH8A 1HNEE 1SGYE 2STAE 1ELBA 2FOEA 1PQ5A 1MMJN 1ZR0A 1WSSH 3LU9B 1LVOA 2B7DH 3B23B 3LGTA 3MH7A 1TALA 1ARBA 1QJ7B 2QYIA 3U69H 4GSOA 2NU4E 3RXRA 1L1GA 3MHWU 4UD9H 1VCPA 1QGFA 2QAAA 7ESTE 3VFEA 1OYQA 2P94A 2Y81A 2TIOA 3S7KB 2AMDA 1KXFA 2BD8A 1HGTH 3A7VA 3MNBA 1D3QB 1O2KA 2YMSD
chains in the Genus database with same CATH topology
1FIZA 4IN1A 1O3HA 1SGTA 2A0QB 3DA9B 3NWUA 1OP0A 1C1VH 1GCTC 4YT7H 1HIAA 4A1XA 3W94A 3A84A 3FVFB 4NIWA 3SU4A 5JBAS 1YCPK 1ZJKA 1INCA 3TJVA 1DUEA 4WMFA 2VU8E 5K7RA 5DP6A 2A7CA 1OP8A 3M37A 3RXIA 2ILNA 2BY5X 2ZU4A 4Q7XA 3SBKA 1SB1H 2TBSA 1TRMA 1P2JA 1GJAB 1A4WH 2K1QA 1AHTH 3SHAH 5L2ZH 1TRYA 3A83A 2Q6FA 1VCQA 1OSSA 6CHAB 1W3CA 3KQBA 1O35A 1CBWB 3RXDA 3ZVGA 1A46H 4UFEH 3MYWA 1SLVB 2ZGJA 1GMDF 1CT4E 1JWTA 4MTBA 1K1MA 1HJAC 3TNTA 7KMEH 1FUJA 4K3JA 1C1PA 2P3TB 4CREA 2SNWA 2FDAA 3HK3B 4ZAEA 2FI4E 1D9IA 2ZFFH 1XKBC 1XUFA 1ZGIA 2ZO3H 3LH1A 4Y71A 1UTMA 2PUXB 2D2DA 1QB6A 1XUHA 1JIMA 1W8BH 1AFQB 1ZSKA 4GAWA 3HGPA 3L3TA 3E90B 3GDSA 1GBMA 2ZTZA 1LCYA 2HVXA 3EGKH 5LPEA 2ZNKH 1GI4A 1GJ5H 1LO6A 1HB0B 1HDTH 1TX8A 5CHAB 1V2QT 3ZYEA 1XUIA 3EA9A 1Y3VA 4K2YA 1FY5A 2GP9B 1TA6A 1C1QA 2QIQA 3H5CB 2PSYA 2F91A 3F9EA 2TGAA 2O8LA 1PYTC 1MKWK 1QBVH 1O2ZA 3NZIA 4D7GA 2W5EA 1BRUP 3KGPA 1H8IH 1HAVA 1O5CB 5GXPA 3SUFA 1FXYA 1UVTH 5LGOA 1HJ8A 4Q7YA 4U30A 2G81E 3A8BA 2HALA 3BIUH 1FAXA 1HXEH 1UVOA 1FAKH 2I6QA 3F68H 1KDQA 3Q00A 1V2VT 5K0HA 2O8TA 4DT7B 3OY6U 4NA7A 1ELCA 2XXLA 1A5GH 1SOTA 1GBAA 2ZKSA 5DPAA 2NU2E 3P8OA 3S9CA 1C2IA 2O8WA 4Y11E 1ARCA 1EPTB 1O31A 3TJNA 5FCKA 3LC5A 2EI7A 3EAJA 3HPTB 2FOFA 2C8YB 1F0RA 3Q3YA 1B5GH 2GV7A 2HNTE 1UVUH 1DWBH 3M7QA 4O3UA 1MAXA 1O3IA 2CV3A 1D3PB 1DUAA 1SLUB 1XVOA 3E8LA 3Q76A 2SGQE 3SI3H 4MPVA 5T3HA 4H4FA 1Y3XA 2EEKA 5E0HA 4E7RG 1DSTA 2AGEX 1AY6H 2ODQA 3TITA 1RS0A 3UQOA 1ANCA 1Q3XA 1SGRE 4JYVH 2FOAA 3SJKA 1O3AA 1KXAA 1BZXE 1ETRH 1IQEA 4JYTA 1CBWC 3MTYA 1MCVA 2G00A 4CR9A 2F3CE 3DUXH 1GI0A 2LPRA 4XSKU 1EB1H 2GVFA 4AFSA 3LOXA 5ABWA 1TAWA 1IQIA 1NRPH 1QNJA 1V2PT 3SQEE 2KAIA 1IQHA 5F8ZA 3W95A 8ESTE 4AORA 3LKWA 3K65B 3RMMH 3KF2A 1WU1A 1XKAC 3CS0A 4ISOA 1JIRA 1P09A 3HATH 2V0BA 3B9FH 1GHBG 3E0PB 1NY22 1FN8A 3ZZCA 4K1TA 4X6NA 1GG6B 1UMAH 2F9OA 1GI8B 2BMGB 5F03A 4JK6A 1SVPA 5EW2H 3SGAE 1F0TA 3R3GB 1FMGA 1O3GA 1OWEA 1QQ4A 4B71A 1BUIA 1UTOA 4A92A 1CT0E 5GWZA 2Z9IA 2BDBA 4NZQA 1UCYK 1O3PB 2GMTC 2TPIZ 1WUNH 5CHAC 2AMPA 2SGAA 3PTBA 2Z3CA 1D3TB 1S82A 2FI3E 1P2IA 1LHEH 2FMJA 5HMAA 1AKSA 2VNTA 2BZAA 2G5VA 1QURH 2OBQA 1YGCH 4JZ1A 3UIRA 1F92A 1Z8GA 3P95A 3LONA 3VB5A 1VJAU 3SOSA 1Y5UT 3RXFA 1BTZA 4GCHF 3OX7U 3EE0B 1O3EA 4M7GA 1GJDB 1UTPA 1SGPE 4Y7AA 1WTGH 4KKDA 4ZH8A 1TYNA 1O2NA 2FYQA 3P8FA 1BB0B 3AW1A 1G2LA 3FP8E 4DCDA 3S9BA 3LH3A 1A1RA 1AMHA 2GD4B 1TGBA 1TQ7B 1ZMJA 1BBRK 1O3LA 1TGCA 4WH8A 1MTUA 1T4VH 3SJOA 2WPLS 1G32B 4ZMAH 1F5LA 2ZDLA 2ZTYA 1YC0A 4MLFB 4Z0KA 1MCTA 3M5MA 1C1SA 2G4UA 3RLWH 3SUGA 2CJIA 2IJOB 1YPHE 3S0NA 4Y6DA 2BDAA 1GJBB 1C9TA 1O5EH 2ZCLP 4ISNA 1B0EA 3MU5A 2XC5A 3GCOA 1UK3A 1W13U 3S7HB 3F9FA 1NPMA 2QY0B 1QJ1B 4X6MA 2EA3A 3LJOA 3IITA 2PGQB 4A5TS 2BOKA 3PROA 2XBVA 5F8XA 4MPXA 1OP2A 4XBDA 5HM9A 1P01A 1UTJA 4K8YA 3NUMA 2V3OH 3UNSA 4Y7BA 2BDHA 1TPPA 2B5TB 2DE9A 1NFUA 1O2WA 2FLBH 1K2I1 5GCHF 1AFEH 1NFYA 2ZC9H 2ZFSA 1YCPM 2JH6D 1DE7H 1GG6C 1GDQA 4YTAA 1TNKA 4X1RU 4SGBE 3MNCA 3BIVH 4LOYH 3BTDE 2TGPZ 2VWLA 2SGEE 3ENSB 1FDPA 2WINI 1ZHPA 1AB9B 3F1SB 2ZDKA 1FI8A 2G8TA 4NG9H 4JZFH 4E06H 4ABDA 1O3MA 2Q6DA 5EQRA 3A80A 1K1JA 2B9LA 1UVSH 3KEEA 1CA0B 3SU3A 2GZ7A 3ZZ4A 3SN8A 3BEIB 3LGWA 1FIWA 3O8RA 4WF8A 2WPHS 3A8CA 2OQUA 1O2MA 1NFXA 2FP7B 4DOQA 1PFXC 1FJSA 1RTLA 4NSYA 4ZROA 3GY6A 4Y10E 1W0ZU 1ELGA 1V2RT 1NN6A 3V12A 1C2GA 3TGJE 4JZIA 1K1PA 2BZ6H 2NU1E 1GBLA 4NIVA 5T6GA 1Q31A 1IQJA 3TH2H 2PTCE 3QLPH 1V2KT 3PWBA 1QL9A 1X7AC 1DY9A 1EJMA 1AVXA 1N1LA 1RTFB 3GDUA 1OKXA 2GT7A 2BB4A 1MTSA 1FPHH 1ETTH 1O2YA 2A2XH 2BLOA 4FUDA 1NTPA 1O3NA 4FU8A 2C90B 3SJIA 1V2ST 4AYYB 4K69A 4XBCA 1NS3A 1GBHA 1JXPA 3T25A 4ZKRU 1TIOA 1GI6A 1VITH 1P3CA 2GT8A 1TNJA 1GCDA 2ALVA 1TGTA 2AS9A 2ZFPH 1DDJA 4A7IB 4NFEA 2ZDMA 2G51A 1CGHA 1S5SA 2RG3A 2BHGA 2HRVA 1BIOA 2W3IA 3HK6B 3PMAB 1QBOA 1CSOE 5C1UA 1D6RA 4WXIA 3SNEA 1ELTA 2R0LA 1HAPH 3OSYA 1GBKA 1TA2A 3SV8A 2F9NA 4YM9A 3UTUH 2J92A 4CR5A 6GCHG 4UE7H 2ZA5A 3V0XA 2TRMA 1K1IA 5DK1A 3QDZB 3MU8A 5E0GA 1XVMA 1EUFA 2TGTA 1SGIB 1GCTB 1P0SH 2FOHA 1SR5C 1Y8TA 4D8NA 3B8JA 1RFNA 2PV9B 4NCYA 2FOMB 5I25A 5FCRA 2AGIX 1THRH 2AGGX 3RM0H 3D23A 1AB9C 1U6QA 2O8UA 2AIQA 2R0KA 3KQCA 1FY3A 3UUZA 1L1NA 2ZI2H 3SUEA 2BY7X 3WY8A 3PYHA 1GJ4H 1CA0C 4E05H 1ELEE 1DM4B 3RXJA 3GISB 4BAQB 4B76A 4DW2U 2ZPSA 1QHRB 1GDNA 4B74A 2Z9GA 4LZ1H 1TMBH 3GCTG 1ZPBA 5C2ZA 4KELA 5ESTE 4YLUA 5PTPA 3OU0A 4UFFH 2ZPQA 1SL3A 4OS4A 3LT3A 1XUGA 2ZGHA 4GLYA 2J94A 4B2AA 1HJAB 3NCLA 1DSUA 1YPMH 4IGDA 3MWIU 4FUEA 1WTHD 4BAMB 1Y59T 2YOLA 3ZV9A 1EOJA 1H9IE 1F2SE 1EP6A 4LK4A 1CU1A 1W12U 5FX6A 2Z9JA 4X1NU 3A7YA 5EGMA 8LPRA 3BG4B 4U2WA 1ESBA 3TIUA 1P9UA 1TOCB 1H8DH 1ZYOA 3M61U 1EZUC 4X8UH 5DP5A 1TX7A 4UONA 3SNAA 1C2DA 1E34B 1O2PA 1O2GH 1QJ6B 4GVUA 1O3CA 1Z8IB 3F6UH 3OYPA 4Y0ZE 2GZ8A 4HFPB 2F9VA 1Z8JB 2JETB 3U8OH 2OBOA 3TJUA 1ZPCA 1SPJA 1QRXA 3LIWA 2XRCA 1YLDA 3BEUA 1GI1A 1ZZZA 3RXUA 2UWOA 1NRQH 1O37A 2G55A 2ANYA 4F4OC 1NT1A 2VWOA 2ZQ2A 4K1EA 1ABJH 1C5NH 3K9XB 4OS7A 2SGFE 4X6PA 5HM2A 2I6SA 1VITG 4X0WU 4HTCH 1GBFA 1O5GH 1QY6A 4KTUA 1O2OA 4I8GA 5A2MH 3I29A 1HIAB 5FPSA 2B8OH 1AO5A 2BY8X 3GY8A 3ZZ6A 4H42U 3AASA 5EPYA 3URDA 4ISIH 4JZDH 1OWIA 3BTWE 3P92A 4FUBA 3SNDA 3A7TA 1C5UA 1GJ8B 4BTUB 4B1TA 1EZSC 3UNQA 1SMFE 5LPFA 2XW9A 1YP9A 1UVPA 4WJG2 1O33A 3U8TH 5F6MA 2H5CA 1QRWA 2GGVB 3A87A 4BANB 2FM2A 2QA9E 1IQLA 2WYGA 1GHZA 3ZVCA 1AUJA 2EC9H 3C1KA 4LZ4B 1HCGA 4R8TB 1WBGB 1JMOH 1EB2A 6GCHF 3MU0A 2VVCA 1WQSA 3BG8A 1TRNA 3STJA 1AUTC 4Z6AH 1BTUA 1C1WH 1F7ZA 1A2CH 3DFJA 5DP4A 2C3SA 3JZ1B 3A82A 2PGBB 1XMNB 4SGAE 3PO1B 3T26A 1F5KU 1C5WB 2PFEA 2FS8A 3R0FA 1P2OA 2AFQB 3VB7A 3RUOA 1TLDA 1ZPZA 1IHSH 5HYOA 1EJNA 2GCTB 5TCAA 2W7SA 1OOKB 1S0QA 1GGDC 1KLIH 1C5SA 5EW1H 3NKKA 3A89A 1SI5H 4KGAA 1D4PB 1GL1A 1NRSH 3GCTF 1T8OA 4Q7ZA 1T7CA 3BSQA 4KTSA 4BAHB 2XYAA 5C5OA 4I31A 3TJOA 1QL7A 1K22H 3BG4C 3UFAA 1GJCB 2AYWA 2PWXA 1PPCE 4DY7B 3M5NA 2BLVA 2ZEBA 1GHWH 2ZCKP 3BTGE 2BXTH 3RXPA 4E7NA 2UUKB 4X8SH 2Y5HA 1FV9A 2FTMA 1SSXA 3M7TA 3GY2A 4FU9A 1E0FD 1Y3YA 2JETC 1YPEH 5AFYH 1IQMA 1ELDE 1L4DA 4ZXYH 1C5QA 2GMTB 1HAVB 1O2LA 4ABGA 4X2VA 1DOJA 3IWMA 3CP7A 4K60A 3SGQE 3Q77A 1EP5A 5EXNA 1DWCH 3FZDA 4MG3A 2ANKH 1NU9A 1UHBA 2A32A 4IC6A 4ZHMU 4X2WA 3MO6A 1TPAE 5DP8A 1KDQB 1Z6JH 4IMZA 1Q2WA 3UREA 1ABIH 3TLOA 1MQ6A 7GCHG 2FX6A 1TNLA 2XCNA 1O34A 1EJAA 1BHXF 1GHVH 4A1VA 5JBCS 4B73A 2ZTXA 2CMYA 4IW4E 5BRRE 1GHYH 2BD3A 1ETSH 1HYLA 1DPOA 3SNCA 2FIRH 3LJJA 1HAZB 1BRCE 1C2MA 4X1SU 3RXLA 3HKIB 3VXEH 3KN2A 1VITF 1ZMNA 1AE5A 1QCPA 4TPYA 3RXVA 4DIIH 2ZHEH 5DO4H 4TWYA 2ZGXH 1TGSZ 1QIXB 3MU4A 2FS9A 2HPPH 3T5FH 2CXVA 5C5NA 1Z6EA 1YBWA 3UR6A 1EQ9A 2OCVB 3PO1C 1XUJA 5C1XA 2H5DA 1HPGA 5E2PA 5CMXH 5H4IB 2HLCA 3VB6A 3UY9A 3RC4A 3SO3A 3TH3H 1UK2A 1SQTA 2ZU3A 3GCHC 1ELAA 2CHAC 1TE0A 4X8VH 2GCTC 2C8WB 1Z1IA 4D7FA 2KAIB 2GX4A 1ZMLA 1OPHB 2FTLE 2EI6A 1GI9B 1P3EA 5ESBA 1V2TT 1MH0A 3HGNA 4D9QA 1TNHA 4U01A 1NU7B 5L30H 1PQ7A 5I46H 5E8EH 2ZHWH 3Q3KA 1V2NT 4UFDH 2QGRA 5A0BA 1EASA 3QN7A 2ZHFH 3S69A 1A0HB 5HGGA 1Y3WA 1LHCH 2QXJA 1Z1JA 2WUBA 1P03A 1KTSB 4UFGH 1ID5H 1SFIA 3BTTE 4ZKNU 3A7XA 1K1OA 2VIPA 1K1LA 1MTWA 1ZHRA 3KQDA 1AKSB 1LMWB 1AD8H 1C1MA 2FPZA 3L6PA 4UDWH 2WPMS 3FFGA 1ESAA 1DWDH 1CVWH 2ODPA 3A88A 5EQQA 3RXTA 1G3BA 3OY5U 4RKJB 2FI5E 3E0NB 4DVAU 3A81A 4O9VA 3KL6A 1AIXH 1BRAA 1JRSA 1W7XH 2Y82A 4NIYA 1P2QA 1J17T 1THSH 2FWWA 1K1NA 2BDGA 2TGDA 1VJ9U 4K1SA 4OGXA 1T8NA 2QXHA 3H7OA 3MNSA 4JYUH 3T28A 1TBRH 3L33A 4OGYA 2FLRH 1HRTH 3BTEE 2OTVA 1A5HA 4ABBA 2WPKS 1A5IA 2FOBA 1GBTA 4RKOB 1BTPA 1Y3UA 1JOUB 4J2YB 4D9RA 1L0ZA 1HXFH 4R0IA 2XBYA 3A86A 1BTXA 5A8ZA 2BVXH 1BQYA 2XC4A 2Z3DA 2DE8A 5DGJA 3DHKH 4I32A 5EQSA 3SUDA 5GIBA 2QC2A 5DG6A 1LKAA 1LDTT 2OLGA 1D6WA 5DKMA 1GDUA 2OQ5A 1C5OH 1L1JA 5DJ7A 1MTVA 2OC7A 4X2XA 1ZTLA 2H9EH 1XM1A 3RXKA 5A8XA 1WCZA 1A7SA 2BX3A 4NA8A 1WYKA 1C2LA 3QUMP 3VGCB 1GBIA 2A1DB 1BITA 1V2LT 1RIWB 4VGCB 1TMTH 1XX9A 1GVZA 1UK4A 1FZZA 2J38A 4IC5A 1E35B 2AH4X 2FXRA 5DP3A 4I33A 1T32A 3NPSA 4NWKA