3VEQB

A binary complex betwwen bovine pancreatic trypsin and a engineered mutant trypsin inhibitor
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASVSLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCAGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Role of remote scaffolding residues in the inhibitory loop pre-organization, flexibility, rigidification and enzyme inhibition of serine protease inhibitors
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 52
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2012-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3veqB01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3veqB02
4XBCA 1JXPA 3H7TA 1SGRE 2XCFA 3FAOA 1C4V2 4Z0KA 3RU4D 1P03A 3ZZAA 1UMAH 2V3OH 1KIGH 4MPXA 2GZ8A 5EXNA 7ESTE 4AZ2B 1THSH 2QN5T 1HYLA 2VIPA 4WJG2 2NU2E 3MHWU 2F83A 1CBWB 3FP8E 3RXLA 1UTNA 1SGQE 3NPSA 1V2NT 2J92A 4MTBA 1Z6EA 4BAMB 4K1TA 1DXPA 3QTOH 3FZZA 2A5KA 2A7JA 3OYPA 4IC6A 2P16A 3M3VA 4TWWA 1TNGA 1LQEA 1P9UA 1UTLM 4HGCA 1C1RA 5FPTA 2GMTC 4I7YH 1UVPA 3KQEA 1OKXA 1P09A 5HM9A 1QBVH 3URCA 1AY6H 3LGVA 4NIVA 1G2LA 2FS9A 3OSYA 1BIOA 4FUJA 1GI9B 2A1DB 4NIWA 3D49H 1XX9A 4JYTA 4NA7A 2ZTZA 1O2VA 5FX6A 3EE0B 4B76A 2ANWA 2C8YB 2OXSA 1CQQA 1TA6A 4E05H 3P95A 2OC1A 1RRKA 3TH3H 5L2ZH 3BTEE 5DK1A 4UFEH 4O3UA 3STIA 2BY9X 2NU4E 1PPGE 2W3IA 2GX4A 3GY6A 5C1XA 1TGNA 1C5LH 1K21H 1YPGH 2Y80A 2VINA 1TYNA 2BD8A 3PV4A 5EQQA 1TBZH 2FI4E 1HJ9A 1ZSLA 7GCHF 4XOJA 1BT7A 4GSOA 2ZGHA 1O3CA 1MKWH 4AB8A 3O8CA 4LZ1H 3MFJA 1HFDA 1SMFE 4LK4A 1GMDG 1RGQA 3OU0A 2FZZA 2BTCE 2TRMA 1ZPZA 5C5OA 1ZPCA 4MNYA 2ZQ1A 8KME2 1H9IE 2PW8H 1DLEA 4D76A 2ALPA 1FUJA 4M7GA 1U6QA 1Z6JH 4KTSA 3M5NA 3UWJH 1CT2E 2FI5E 1XKBC 4FUCA 5BPEA 4CH8B 5GCHG 1SSXA 3W94A 2XCNA 2A2QH 3KQCA 1QB1A 1GGDB 2J38A 3R3GB 3RC5A 1UTJA 2HALA 1YPLH 1K1MA 1TPAE 4AGJA 3GY7A 1C5YB 3L33A 1BQYA 1GHBF 2ZDKA 3KQDA 4ZAEA 1PQ7A 4D9QA 3RXJA 1N6YA 2ODYB 5E0GA 4RKOB 3ZZ9A 4K8BA 4Y6DA 4ZXXH 1HRTH 1T4VH 1VJAU 5F03A 4WWYA 5T6FA 1C2EA 1C5XB 2ZQ2A 1PPFE 2VH0A 1V2RT 2CF9H 1AVXA 5DP4A 1HAHH 4X6NA 3TJOA 3VGCC 3M35A 5A09A 1DUEA 3U1IB 3UR9A 1BMAA 1V2VT 4ABHA 2GDEH 1YGCH 2Z3EA 5J4SA 5EG4A 1GI2A 4BAHB 3F9GA 1G37A 3TIUA 4D7GA 2TIOA 3MH5A 4AN7A 3ODFA 4KKDA 5JB9S 1WUNH 1DY8A 1OWJA 3OX7U 3SU1A 3T26A 3LGYA 1V2OT 4ISLA 1C1SA 4NIXA 2FX6A 1A5HA 1F5LA 3RXFA 1ZLRA 1O2YA 1XUFA 4BANB 3EA7A 1UK2A 1SQAA 5E8EH 3PMJA 1HJ8A 1W7XH 2OP9A 3TH2H 2RG3A 3BTME 1SGFA 3NUMA 5GJ4B 1O2TA 2ZHFH 1YC0A 3SHAH 1GI6A 2H2ZA 3U8TH 3H7OA 1KDQB 2VWLA 4YLQH 1O3MA 3ZVGA 1AUJA 2VWNA 2ASUB 1XUHA 1IQHA 1PPZA 3K6ZA 2ZKSA 4FUHA 1EZXC 3PTBA 2ZDMA 5EXMA 1XUJA 1GBIA 2THFB 2ODQA 2SNVA 2TPIZ 2IJOB 4B71A 1GGDC 1O3DA 2OBOA 5DPAA 4IS5A 1GHAF 4B73A 1P06A 1H9HE 4LOYH 5A8XA 1K9OE 2G4UA 2ZGCA 2Y5HA 1X7AC 4A1TA 2PGQB 1RIWB 3ZVDA 1LHGH 1V2JT 3TGKE 1P0SH 1AWHB 2HNTC 1O33A 2FOGA 2WPIS 4A92A 3Q00A 3E3TA 1H9LB 2JH6D 2GCTB 3BF6H 3KIDU 1W2KH 2VIWA 1P11E 5JBTA 4JYVH 3SJOA 1ZRBA 1GBJA 2OD3B 2ZHWH 3PLPA 1T4UH 1KYNA 2SGQE 3VB6A 1O5AB 3SORA 2FLBH 2VH6A 1SBWA 3W95A 1FQ3A 1M9UA 2WYGA 2F91A 4ZHMU 3F6UH 3P8GA 1A5GH 1ZJKA 1BRCE 1C5RA 3E0PB 2AGEX 3U8OH 1NRRH 2G4TA 2GV7A 3LPRA 4FU7A 2QA9E 1P2KA 1GG6B 1BITA 1D9IA 1AUTC 2NU0E 1EATA 1IQMA 4WH8A 1O2XA 1Y5BT 2NU1E 1IQIA 5A0CA 1Y3XA 3TK5A 1BOQA 4NSVA 5DP9A 3KQBA 2ZFSA 1TGTA 2ZNKH 2BDCA 1Y3UA 4RSPA 1BMLA 3FVFB 1CHOG 5FPYA 4ABEA 3I29A 5SGAE 5JPMH 1NT1A 3AASA 1SL3A 1BDAA 1Y8TA 3BEFB 4X2WA 1L0ZA 1ARCA 1FZZA 1ZOMA 4ASHA 2B5TB 1PPHE 4YO9A 3BTKE 3LGTA 1MTNB 2A32A 2GD4B 1OWHA 4UD9H 6GCHF 1G2MA 1C5NH 3C1KA 1WQSA 5EPYA 1UTKA 1KSNA 2GT7A 1P01A 4Y8XA 3HK3B 4DIIH 2VJ1A 4X1QU 4B2AA 4X8UH 4IW4E 3NCLA 3VB7A 1RIWC 5EU8A 3TGIE 1TBRH 3MU1A 4YLUA 1ACBE 1HXFH 3Q76A 5K7RA 1AVWA 1O34A 3QTVH 3TLOA 1O3LA 3MNBA 4ZHLU 1V2KT 1GJ4H 1HGTH 1BUIA 1GMCF 2GCTC 4INLA 2ZPRA 1VGCC 1HAGE 1YM0A 1P05A 2XBYA 1NU7B 3MTYA 5E2PA 2TGDA 4DY7B 1Q2WA 5GIBA 1QCPA 2BX4A 2BD2A 1XXFA 4ZXYH 3EYDA 1C5MD 2BQ6B 5LPFA 1O2QA 5TCCA 1TAWA 1ETTH 3CS0A 1A7SA 3RXBA 2UWLA 2F9OA 1HAYB 1VCWA 3A89A 1NTPA 1SQTA 2FMJA 4JMYA 3SJKA 1P3EA 4ABGA 1PQAA 1F0SA 1S0RA 1XXDA 2VIQA 4AX9H 4BXSA 5GXPA 1RXPA 1E36B 4Y8ZA 5T6DA 1EJAA 1GG6C 1NROH 2FXRA 5ESTE 5JB8S 3TJUA 1QR3E 1QA0A 4HFPB 3ZZ7A 2ZPQA 3ODDA 1C5WB 5K0HA 2GVFA 2XBXA 4MPUA 4RKJB 2PUQH 2UWPA 3A80A 2BOKA 1O5DH 1ZTJA 3P8NA 2Y7XA 1HBTH 2OUAA 1P02A 3B8JA 1P57B 1O5BB 4A6LA 1V2WT 2ZA5A 1XM1A 1IAUA 3GY3A 1ZYOA 3PWBA 4AB9A 4ZKRU 1NRPH 1TX6A 2HPPH 3RXHA 2P3TB 2B9LA 1TPPA 1B7XB 1IHTH 2VWOA 3ZVBA 1C1QA 1QURH 3ATIA 5C20A 1MTNC 1JRSA 2Z7FE 3M5MA 3UREA 1NM6A 3UQOA 1C2DA 2YNAA 1OWKA 4GAWA 4NWLA 3EDXB 4X1PU 1W14U 3MU8A 4UEHH 3ZZ8A 3VB3A 3ZV9A 4Y10E 1ELCA 1HV7A 1SLUB 1O2LA 1XVMA 3SV9A 2J9NA 1DICA 3NXPA 4DOQA 2ZF0H 2GT8A 1O36A 5TCAA 2DE9A 3JZ1B 3SBKA 4ABDA 2OCVB 3RUOA 4DURA 1EAUA 3T28A 1CT4E 4X0WU 2NWNA 2UUJB 1E0FD 3MO6A 1GCTB 1QB9A 1ZGVA 4K1SA 3SO3A 1UCYE 3LGWA 1ELDE 1MUEB 1VZQH 3BG4B 5FX5A 1P3CA 5TJXA 3ZZ4A 4Y0ZE 4HZHA 3TPIZ 1VITH 3MNSA 3T25A 3GICB 1HAOH 1ZMJA 2HLCA 1YBWA 2QXGA 5HMAA 3SU4A 1CT0E 3Q77A 4U32A 4JK5A 2O8WA 1LTOA 1WQVH 2ZHDA 4TPYA 5DJ7A 4B1TA 2HNTF 2V3HH 1BJUA 4FUEA 1FJSA 3RM2H 3UWIA 2YNBA 1UK4A 4FU8A 1SOTA 3UR6A 1ZHMA 2BDYA 4D8NA 2ZFTA 2RDLA 1AKSA 1TRNA 1BZXE 1CGJE 4NZLA 3A8DA 1WU1A 4GUXA 1ELFA 1O3AA 1V2ST 4TYDA 5JBBS 1C5TA 1DWDH 1VR1H 1ZRKA 2ZDAH 1FY5A 2FOAA 2TGPZ 2HNTE 2PGBB 2BB4A 5DKMA 3GOVB 1JIMA 1EOLA 2BLWA 1OWEA 4IN2A 1ELVA 3UIRA 3BTWE 3QGJA 2ZU3A 1XKAC 2XTTB 7GCHG 4Z6AH 1QRWA 1MU6B 3E16B 2C8XB 2O8TA 2VGCB 2BY8X 4XBDA 1CA0B 3VEQB 2D26C 1FIWA 3OY5U 1ELGA 3D62A 3Q3KA 5BRRE 2PHBA 1KLIH 3BEIB 2BM2A 3FANA 5HYOA 3M7UA 4BAQB 5JBAS 1EJNA 1ABJH 1W8BH 1KLTA 3RDZA 1L1GA 1GBLA 2B8OH 1OP8A 1EXFA 7LPRA 5EGMA 3HGNA 1LVBA 2BOHB 3PLKA 1YCPK 2ZGXH 2PTNA 1DITH 9LPRA 1GCTC 1TOMH 1S6FA 1SGFG 1O5GH 3BIUH 1ZTLA 3NK8A 1INCA 3SQHE 1C5PA 1AE5A 3HGPA 3BG4C 5AFZH 2A2XH 4YESB 1QHRB 1MBQA 2LNCA 1MH0A 1UTPA 4B2BA 2ZGBH 3MMGA 1THRH 2ALVA 1AZZA 4GPGA 2XBVA 1C1OA 2I6SA 5A0AE 3TK6A 1GHBG 4O9VA 1L1JA 1QBNA 2FOBA 2ZFQH 1YCPH 3SJ9A 2A31A 1GHVH 1UHBB 3OTJE 1AMHA 4WMFA 1YYY1 1WAYB 1F5KU 1KXEA 1NRSH 1SG8B 1DOJA 1DY9A 2C90B 1FN6A 2HGTH 3QZRA 2EI7A 2WUBA 3UPEA 2AYWA 5DP6A 3S9AA 3STJA 3PTNA 1THPB 3P8FA 1XVOA 2PKAB 4GHTA 3SGQE 2W26A 1FN8A 3ELAH 3NKKA 1O2JA 1SI5H 4X8TH 2M5TA 3BV9B 1AU8A 5EPNA 4GCHF 4X6PA 3F9HA 1A2CH 1EPTA 4H6TA 1FNIA 3TGJE 4ZUHA 3P6ZB 3TNTA 3M7TA 1KDQA 1OYTH 2P3FH 1MU8B 1DWEH 1C2FA 2BD5A 3ESTA 1DWCH 2WPMS 1JBUH 5CHAB 5EW1H 2VGCC 1OSSA 1KXFA 1CA0C 4OGYA 1MAXA 4Y7BA 2C3SA 8LPRA 1P2NA 2D1JA 5EOKA 3DD2H 4Y0YE 4J1YA 4DW2U 4AORA 1HAZB 1UCYK 3E0NB 2FODA 4XDEA 1P2MA 3LU9B 4XE4A 2PSYA 2ZZUH 3KGPA 3GDVA 3CENA 1UTQA 5J4QA 2Q1JA 1H8DH 1ELAA 1O37A 4TY7A 1FY4A 3VPKA 6CHAC 1IQKA 8GCHF 2ANMH 4BNRA 1C2IA 3EAJA 3GY5A 3SUEA 1S0QA 4X8SH 1ZMLA 3P70B 1GHAG 1VITG 2HWLB 1G3CA 4BXWA 1LPKB 1AO5A 5DGJA 1UTOA 3LOXA 1GBAA 1PPEE 1UCYH 1OP0A 3S9BA 4LXBH 3U8RH 1B5GH 1AD8H 4ABAA 5ABWA 2WINI 3LGIA 2Y5GA 4AGKA 1CBWC 1VCQA 3FP7E 1LVYA 1Q3XA 1PQ8A 3MU0A 4X2YA 3SU2A 2ZO3H 3V12A 1O3JA 1S83A 1TWXB 4K69A 1H8IH 3PMHB 3BEUA 2A0QB 1ZZZA 4MLFB 2AMPA 5HGGA 1DSTA 1P10A 2SGPE 1DE7H 2BD3A 2YOLA 4UFFH 5C2ZA 4TWYA 3EGKH 1HAIH 3MNXA 4I31A 3RXMA 1CSOE 1BCUH 1K28D 1YLDA 2XNIA 1CGHA 6LPRA 1A3BH 4TY6A 3HKIB 3EA8A 1SGIB 3SNBA 1A4WH 4A1VA 3BN9A 1FV9A 1O2HA 1BRUP 1DUAA 1RTKA 2WPKS 1RD3B 2J34A 3RXUA 4H6SB 3D23A 1C2GA 1AB9B 1TRMA 4U2WA 1T32A 2J94A 2ZGJA 2ZU2A 2FOHA 4I8KA 2CHAB 4UE7H 1DM4B 1K1PA 2BY6X 2Z3CA 5CHAC 2ZPSA 1P2IA 1A3EH 3SNCA 1G32B 1ELTA 1C4U2 1S84A 1TBQH 2ILNA 1QL9A 4IBLH 1O5FH 4NFFA 2JH5D 1G36A 4R8TB 3U9AH 1CA8B 3GY2A 3FP6E 4H4FA 3TK9A 1C2MA 1DVAH 3RLWH 4Q7XA 3AW1A 1O39A 2Z3DA 1ID5H 1D3TB 2V35A 3MH6A 1GI0A 3ZV8A 2F9UA 3SI4H 1WV7H 3F68H 1GDQA 2F9PA 1SLVB 1GBMA 1C1MA 3SW2B 1C1WH 4VGCB 2BD7A 2G55A 1EZSC 2G81E 4CBNA 3RXIA 1QRZA 1TIOA 1AIXH 4OS7A 2PWXA 4O03A 1PYTD 1O2RA 1G3EA 2W7UA 1QQ4A 1GI5A 2P3UB 3LONA 1MQ6A 1GMCG 1PYTC 2QCYA 5EQSA 4MVNA 2WYJA 2BZ6H 2VVUA 1FONA 3A86A 2B0FA 1Z1JA 1FPHH 1OXGA 1DX5M 1O3OA 1GMDF 1S81A 2G8TA 3RMOH 1EOJA 3LH3A 1XUGA 3MI4A 1GL0E 3HATH 1TA2A 4K1EA 1E38B 1FY3A 1N6XA 3ZYDA 4GVUA 1AB9C 1SHYA 2WV4A 3E1XB 2CHAC 6ESTA 4X6OA 1BB0B 2VWMA 2C8WB 1GMHF 3F1SB 1BJVA 1XUIA 2H5CA 5EODA 3PLBA 1Z1IA 1AHTH 3SV6A 1ZHPA 2FX4A 1V3XA 1SGEE 2QV1A 1E35B 1GHWH 4YOIA 2PR3A 3BSQA 3MYWA 1AN1E 1SFQB 2A4RA 4BTTB 3RU4E 1PFXC 9ESTA 2PFEA 1LPZB 5FHTA 4JCNA 1T8NA 1HXEH 1T8MA 4Q80A 1CO7E 5A0BA 4VGCC 3A7ZA 1WOFA 2J95A 1ABIH 4HI3A 3RXPA 1GI1A 1HAVB 4Y76A 1JIRA 1UVOA 1FXYA 1N1LA 4Y8YA 1IQEA 5JDUB 1W13U 3UNSA 1Y5AT 2ZFRH 1GBHA 3DT0H 1EQ9A 5LPEA 4A5TS 1E34B 2DUCA 1SHHB 2Z9LA 3LC3A 1Z8RA 1C5ZB 3E90B 1QFKH 1HJAB 5I25A 4K8YA 1O3HA 4MNVA 4X6MA 4MPVA 3S7KB 2ZCHP 4XBBA 3M3SA 1SVPA 4IGDA 5I46H 1GBKA 1HLTH 4Q2KA 2CMYA 1XUKA 1GBBA 2RCEA 4PROA 1TQ7B 2Z9KA 1EAWA 1O3PB 1KXBA 5GPIB 1OS8A 1ESBA 1QGFA 2O9QA 2BVRH 3ZYEA 3SU0A 4ABIA 2UUFB 4UFGH 4DJZB 4LZ4B 1W0ZU 1AWFH 1QJ1B 4X2XA 4THNH 2VNTA 1O35A 2FOMB 3AAUA 2GTBA 5L6NH 4D7FA 1GPZA 1BBRK 3UTUH 4ZROA 1F0RA 4ZH8A 2F9VA 1GVKB 2W7SA 1ZTKA 4Y11E 3QX5H 3RMLH 3SGBE 1T8LA 1SFIA 2BDIA 1YPEH 5IDKA 3SN8A 1F0TA 5FPSA 2A45B 3GCOA 2H9HA 1TLDA 5F8TA 3LKWA 1SGDE 5C67A 1MTSA 1P04A 2GDDA 3LT3A 1C5UA 2BY7X 1BTXA 1EASA 2ZHQH 1AGJA 8ESTE 3K65B 2F3CE 1HCGA 1TX8A 1OWDA 1DS2E 1EP5A 1PJPA 2QXHA 4MNXA 3RXRA 3SUFA 3PMBB 1OPHB 1ZMNA 1WTHD 1LHFH 4ZMAH 4AFZA 2R3UA 2STBE 3QWCH 1O2IA 1T8OA 4I8HA 1DT2A 2R9PA 1SGPE 4O97A 4NA9H 4WY3A 1NPMA 4B2CA 1NN6A 1V2PT 4BOHA 1EX3A 4FUBA 3V7TA 4X1RU 2GGVB 3SU5A 1D6RA 1HUTH 3UUZA 1EUFA 3T27A 2OTVA 3GCTF 2DE8A 2XBWA 2BMGB 3T62A 1XMNB 3O8BA 3FZDA 4ZHAA 2FTMA 4X2VA 1Z8IB 1K1JA 4I32A 4H42U 1RFNA 3RMMH 4UONA 1MTVA 3VB5A 3BTHE 1FI8A 4AYYB 2BY5X 4DG4A 1LO6A 3A88A 4Q7YA 3A8BA 4WVPE 1KXDA 1Y5UT 1FAKH 1K1NA 3QK1A 4BTUB 3F9EA 3SUDA 1TNIA 2XC5A 1UHBA 3WY8A 4Y71A 2AS9A 1MBMA 1O2KA 1LCYA 2FOCA 2PLXA 1GHYH 1GJ5H 1LMWB 4OGXA 1FY1A 1K1OA 2PKAA 1HIAB 2Z9GA 2ZHEH 1BTUA 5IYTA 2CJIA 2W5EA 2QIQA 2Y7ZA 4YT7H 1C4Y2 4F4OC 4I8JA 1DPOA 3U1JB 4YT6H 2CV3A 1EZQA 1HAPH 2TGTA 1IQLA 1EB2A 1W12U 3RXDA 1OP2A 2Z9JA 2PV9B 1LVMA 1MMJN 1YCPM 1GBFA 5T6GA 3GY8A 4K5ZA 2QAAA 1MKXK 3RXCA 1GI3A 2AMDA 5ESBA 3GYMA 1PQ5A 3ZVEA 4KP0A 3A7WA 5A2MH 1WCZA 1FY8E 1EJMA 4GCHG 3KEEA 2Q6DA 3LGUA 1C1UH 1TE0A 4SGBE 3QGNB 1TMUH 4BAOB 3BTGE 5H4IB 1Y3YA 1A1RA 1TNJA 3SU6A 3PO1B 3IITA 4OS2A 2BLOA 1YPHC 1A0LA 1NO9H 1BMMH 1ZR0A 3VB4A 2FP7B 3A81A 1SC8U 4AFUA 3A82A 4U30A 1WTGH 2FM2A 1MKXH 1O3BA 1QL7A 3ZVFA 1J15A 4CH2B 1F92A 4ZKOU 1GJ7B 5C3NA 1P2JA 4WH6A 1O0DH 1B0FA 3GISB 2FIRH 1AVGH 1PPCE 3U69H 2ZI2H 1Z8JB 1V2MT 2A5AA 3GY4A 4RN6A 4MPWA 1DLKB 5LGOA 8GCHG 5AFYH 4NG9H 3RLYH 4NIYA 5B6OA 2J2UA 1FLEE 3M7QA 3ZZ3A 5CMXH 1GJ6A 1Y3VA 4UDWH 3RXKA 3A8AA 3TH4H 3A7YA 3ZZBA 2NU3E 4WXVA 1IQFA 1O2WA 2G5VA 4OS1A 1IQJA 2SGAA 1ANBA 2XRCA 3URDA 2P59A 1EZUC 1WYKA 5DO4H 1GBTA 1YPJH 4SGAE 2GZ7A 1YF4A 3MWIU 1GVLA 2Y82A 1OX1A 2OQUA 2C93B 4X1NU 5HXFA 1HB0B 2HOBA 3ATKA 2GCHF 3HK6B 1ZPBA 3NWUA 4FVDA 1V6DA 3B23B 1C5VA 4CHAB 1F2SE 3RP2A 1IHSH 2WV5A 4FXGH 3LIWA 4CBOA 2BXUH 1SQOA 4NA8A 1TGCA 1O3NA 3SHCH 2FS8A 2ODPA 2TGAA 2WPHS 1O2ZA 5T3HA 1GL1A 1P2QA 1W10U 5DP7A 4KELA 2EEKA 1D4PB 3A84A 3B9FH 4MG3A 4FVBA 4ABFA 3MH7A 4I8GA 2BDGA 1GHZA 2KAIB 3P8OA 3PO1C 3CP7A 1NFXA 2HVXA 2FPZA 3GDSA 4YM9A 2ANYA 3V3MA 3TNSA 2HPQH 2G5NA 2OC8A 4YOGA 1DSUA 1C9TA 4ZKNU 3S0NA 1EAIA 1TQ0B 4JZEH 3GCHB 3VXEH 4WMDA 1TPOA 2PKSB 4FUFA 1A46H 1RS0A 1BTPA 1OOKB 3A87A 1FAXA 7KMEH 1TPSA 2J4IA 2SGEE 1LQDB 1W0YH 3JZ2B 3M61U 4FUDA 2SFAA 2CF8H 3I77A 1MKWK 1JMOH 2PSXA 4I8LA 1UVSH 3SV7A 4BTIB 1S85A 2EI8A 2HRVA 2BDHA 2ZTYA 2WUCA 3M37A 1GJDB 1QTFA 3DFJA 3VGCB 4CRAA 1G9IE 1C2KA 5A8YA 4NSYA 5AVDA 3LC5A 1KY9A 1UO6A 1O3FA 2AEIH 4KGAA 2FDAA 2Z94A 1K2I1 1DANH 1O2GH 3ZVAA 1HPGA 1YLCA 1BTZA 1AKSB 3TITA 3C27B 2AMQA 4DGJA 1K1LA 3SZNA 4CHAC 1O30A 1GHXH 1RJXB 1CVWH 1IOEA 2BD4A 1QNJA 4OS4A 3SI3H 3MOCA 5E2OA 3UOPA 2QXIA 4IN1A 2EA3A 1NU9A 2VIOA 4HTCH 1ANDA 3MU4A 2UUKB 1C1NA 1S5SA 1H4WA 1ZSJA 1AFEH 4DT7B 3GDUA 1A0JA 4KTUA 2H9EH 1C5OH 5DP8A 4YOJA 1CGIE 3MNCA 1ETRH 2QGRA 5AF9H 1QA7A 5ETXA 1LHDH 4A1XA 1J8AA 2GV6A 1UVUH 2Z6BD 2ZDLA 3ATMA 1T7CA 3UNRA 1GWAA 1GMHG 3MO9A 1MTWA 1SGCA 3I78A 4NFEA 3MH4A 2RA0A 3KHVA 4A7IB 4U01A 3GCHC 3SNDA 3SJ8A 1J16A 1L2EA 2H6MA 2XWAA 2PKSC 3SGAE 3QO6A 1BA8B 1O38A 4AFQA 2VVVA 4AFSA 1HAVA 4E7RG 5FAHA 1TABE 2R3YA 1BHXB 1Y3WA 3PB1E 3SNEA 2FI3E 5GDSH 2FOEA 2EI6A 4OS5A 2JETB 3L3TA 1BBRE 2CN0H 5EXLA 3PMAB 4JZDH 1GI8B 2RA3A 1ESTA 2ZFPH 5FCRA 1Z7KA 1YPKH 4I33A 3KL6A 1QJ7B 3EA9A 3ZZDA 2VB0A 1YPMH 3R0FA 1LHEH 1GBDA 2VU8E 3A8CA 2BHGA 1ANCA 4INHA 3ATWA 1GDUA 2BQWB 4WXIA 6GCHG 1GI4A 1DFPA 3GYLB 1HNEE 1MZAA 3SV2H 2AFQB 5L30H 1K22H 1UTMA 3V0XA 3TJVA 1YPHE 3E6PH 2STAE 3ATLA 2H9TH 1F7ZA 1TONA 3M3TA 1EP6A 1TNLA 3BTFE 1TX7A 1J17T 3RXOA 3ZZ6A 1YP9A 3S7HB 4ESTE 4Y79A 1EPTB 2R2MB 1MCVA 3CS7A 1LHCH 2FEQH 1N8OB 2K1QA 4IMZA 1W3CA 2O8MA 1OWIA 4DVAU 2OC0A 2BVXH 3S9CA 1B0EA 1ESAA 1Z71A 5DP3A 1ELEE 1CE5A 3KN2A 1TMBH 1QY6A 3LJOA 1FMGA 3D65E 2PUXB 3A7XA 3SV8A 3VXFH 4K2YA 1C2HA 2AGGX 2IN2A 1D6WA 2ZDVH 1F0UA 2FYRA 2R0LA 1QQUA 2UUYA 1FIZA 4AG1A 3RXEA 1KLJH 1VITF 3BG8A 1T31A 1O3KA 3KF2A 5C5NA 1MCTA 2ZFFH 1GCDA 1JOUB 1L1NA 2Y81A 2OLGA 1AFQB 4OS6A 3DFLA 1EB1H 1RTLA 5F8XA 1NRQH 2V6NA 1DXWA 1GBCA 2A5IA 5GCHF 1C9PA 1LPGB 4FUIA 4ISOA 5FCKA 1QB6A 1V2TT 2H1UA 4B75A 1MQ5A 4R0IA 1NFYA 2XC4A 2PTCE 1VGCB 1K1IA 3M5LA 2JETC 4JYUH 3H5CB 2QF3A 3TJNA 3PM3A 1HDTH 1GBEA 3ITIA 3SU3A 1O5CB 3M36A 4GHQA 3UQVA 1ZSKA 4CR9A 1WSSH 5E0JA 3A7VA 1OYQA 3GCTG 2F9NA 4YZUA 1NY22 5C1UA 4CRGA 1SOZA 1FDPA 1NRNH 3IG6B 1KTSB 2ZECA 2FOFA 1AQ7A 2P8OB 1BTWA 4BAKB 2BYAX 1AI8H 3Q3YA 1SGYE 2VIVA 5A8ZA 1MAYA 1C2JA 3AAVA 2G51A 1YKTA 3LJJA 2P95A 4MDSA 1TALA 3PROA 3DA9B 1NFUA 1HIAA 1ZHRA 4O3TA 1UVTH 2BXTH 3P92A 2XC0A 1RTFB 1EPTC 1IQGA 1V2QT 5L2YH 2ESTE 1ZGIA 1GJCB 1N8OC 4X1SU 3PYHA 2H5DA 1BRBE 3UNQA 1NS3A 3T2NA 2UWOA 1QRXA 2XWBI 4ISIH 1W11U 5JBCS 5JYIA 2WPLS 1MD7A 4K3JA 3ZVCA 1QIXB 3RXVA 3K6YA 4Y7AA 1BRAA 1KXCA 2G00A 3HKJB 3T29A 5GWZA 4ABJA 1O31A 1H1BA 1C1TA 1NC6A 1GJAB 3AVZA 4CRCA 3RXSA 3K2UA 5HM2A 3RXQA 2XXLA 1AFQC 2A7HA 4CRBA 2OC7A 3M5OA 2CXVA 1IQNA 4MQAA 4AOQA 2Q6GA 2OINA 1ANEA 3E8LA 4IMQA 1CU1A 2F9BH 1O2NA 2ZDNA 1A61H 3KNXA 4NGAH 1MTUA 1J14A 4WMEA 1G3BA 4NZQA 2W3KA 3QLPH 1ELBA 3EQ0H 2XYAA 1MZDA 1C1PA 3G01A 3QUMP 1TB6H 3A85A 1EKBB 1PPBH 3SQEE 1TOCB 4F49A 3MO3A 4JK6A 4YTAA 2D2DA 2OBQA 2ZG0H 4INKA 4FU9A 4DIHH 2ZC9H 3KCGH 2WPJS 1SR5C 4NCYA 3RXGA 3QN7A 1A0HB 3RU4T 3BTQE 1BBRH 1W7GH 1SGTA 3PWCA 2P8OC 2QC2A 1Y59T 2AIQA 5F6MA 4JZ1A 1O3IA 2IOTA 1O2MA 2IPHA 2ZCLP 3NZIA 4E7NA 3ZZCA 1TRYA 1J9CH 1S6HA 2LPRA 2BLQA 1GI7B 2ZIQH 3A7TA 5FBEA 2AIPA 4ZKSU 1P8VC 3ZZ5A 4NWKA 3RC4A 1KXAA 1BTYA 1QJ6B 2XW9A 5EQRA 4AG2A 1O32A 1NFWA 1L4DA 3QZQA 1SLXB 2BQ7B 1HJAC 1C5SA 2TBSA 2QXJA 1AE8H 2C4FH 1F5RA 3LDXH 2ZTXA 2GKVE 4CR5A 2GP9B 2SNWA 2ULLA 1LDTT 1GJBB 3Q3XA 2CGAA 1A5IA 1V2UT 3FFGA 2GCHG 5FBIA 3S69A 2SGFE 2Y6TA 2P93A 2FTLE 1UJ1A 1E37B 2O8LA 1DWBH 2JKHA 3P17H 4B74A 5LPRA 1O5EH 4K60A 3F9FA 2VVCA 1CHOF 3DHKH 3OY6U 5C1YA 2KAIA 2R0KA 2ZP0H 1FPCH 1C2LA 3V13A 3SJIA 1O2PA 1D3DB 1AZ8A 1LKBA 2ANKH 1O2OA 4MNWA 1LVOA 3QDZB 5F8ZA 1ZJDA 1ORFA 1GVZA 2GZ9A 4CREA 3T5FH 2BVSH 1P12E 1O2UA 1SPJA 4J2YB 1V2LT 3O8DA 1Z8GA 1TMTH 2VIDA 1TGSZ 4ISNA 2A4GA 4Q7ZA 2BLVA 3E91A 2BDBA 3RC6A 3VFEA 1UK3A 4JZFH 1L4ZA 5E0HA 2AH4X 2BX3A 1C1VH 1P9SA 5DP5A 1CHGA 5FXLA 4KTCA 1WBGB 2ZU4A 5DG6A 3BTDE 1GDNA 2I6QA 3O8RA 1DDJA 4UFDH 2QF0A 2A7CA 1SGNE 2O8UA 2ZWLH 1BHXF 4TPIZ 1QBOA 1GJ9B 1BTHH 1NZQH 2Y5FA 2B7DH 1P2OA 1MD8A 1VCPA 3N7OA 1NESE 5LH8A 4QT8C 1S82A 3UFAA 2BZAA 1O2SA 3AW0A 3DUXH 2P94A 3SOSA 1GJ8B 1BMNH 2C8ZB 2GMTB 1JWTA 1KTTB 1JRTA 2AERH 2FLRH 3TVJB 5EW2H 5CE1A 4GLYA 3TU7H 4XSKU 1O3EA 2QY0B 3K9XB 3SUGA 3RXAA 1O3GA 2AGIX 4FUGA 2FESH 3UOUA 4IC5A 1Q31A 4AYVB 3UY9A 4D9RA 3BIVH 1G3DA 1TNKA 5AHGH 4ABBA 2V0BA 1LKAA 2QYIA 1VJ9U 5PTPA 2A4QA 2D8WA 3RXTA 2OQ5A 2SGDE 1EAXA 3SNAA 3BTTE 3MU5A 1C5QA 3L6PA 2JH0D 1D3QB 2Z9IA 2FWWA 3ENSB 1SB1H 4DCDA 1SLWB 2A4OA 4JZIA 1ARBA 2ZU5A 2BDAA 1QL8A 2EC9H 2FYQA 4XFQA 1TFXA 1ETSH 2ZCKP 1D3PB 3IWMA 2ZU1A 4WF8A 2FO9A 5G4BA 3U98H 2BD9A 4CRDA 1TNHA 2G52A 6CHAB 2ZEBA 3RM0H 1TGBA 3RMNH 3HPTB 1HAXB 2Q6FA 4X8VH 3GCNA 4CRFA 3LH1A 3A83A 4E06H 1G30B 2R2WU 4ISHH
chains in the Genus database with same CATH superfamily
4XBCA 1JXPA 3H7TA 1SGRE 2XCFA 3FAOA 1C4V2 4Z0KA 3RU4D 1P03A 3ZZAA 1UMAH 2V3OH 1KIGH 4MPXA 2GZ8A 5EXNA 7ESTE 4AZ2B 1THSH 2QN5T 1HYLA 2VIPA 4WJG2 2NU2E 1W0JD 3MHWU 2F83A 2J97A 1CBWB 3FP8E 3RXLA 1UTNA 1SGQE 3NPSA 4Q4LA 1V2NT 2J92A 4MTBA 1Z6EA 4BAMB 4K1TA 1DXPA 2XOKD 3QTOH 3FZZA 2A5KA 2A7JA 2HLDD 3OYPA 4IC6A 2P16A 3M3VA 4TWWA 1TNGA 1LQEA 1P9UA 1UTLM 4HGCA 1C1RA 5FPTA 2GMTC 4I7YH 1UVPA 3FO8D 2QF5A 1OKXA 3KQEA 1P09A 5HM9A 1QBVH 3URCA 1AY6H 3LGVA 4NIVA 1G2LA 2FS9A 3OSYA 1BIOA 4FUJA 1GI9B 2A1DB 4NIWA 3D49H 1XX9A 4JYTA 4NA7A 2ZTZA 1O2VA 5FX6A 3EE0B 4B76A 2ANWA 2C8YB 2OXSA 1CQQA 1TA6A 4E05H 3P95A 2OC1A 1RRKA 3TH3H 5L2ZH 3BTEE 5DK1A 4UFEH 2WHXA 4O3UA 3STIA 2BY9X 2NU4E 1PPGE 2W3IA 2GX4A 3GY6A 5C1XA 1TGNA 1C5LH 1K21H 1YPGH 2Y80A 2VINA 1TYNA 2BD8A 3PV4A 5EQQA 1TBZH 2FI4E 1HJ9A 1ZSLA 7GCHF 4XOJA 1BT7A 4GSOA 2ZGHA 1O3CA 1MKWH 4AB8A 3O8CA 4LZ1H 3MFJA 1HFDA 1SMFE 4LK4A 1GMDG 1RGQA 3OU0A 3F2HA 2FZZA 2BTCE 2TRMA 1ZPZA 5C5OA 1ZPCA 4MNYA 2ZQ1A 8KME2 1H9IE 2WPDD 2PW8H 1DLEA 4D76A 2ALPA 1FUJA 4M7GA 1U6QA 1Z6JH 4KTSA 3M5NA 3UWJH 5GNDA 2XNDD 1CT2E 2KM0A 2FI5E 1XKBC 4FUCA 5BPEA 4ASUD 4CH8B 5GCHG 1SSXA 3W94A 2XCNA 2A2QH 3KQCA 1QB1A 2KZ4A 1GGDB 2J38A 3R3GB 3RC5A 1UTJA 2HALA 1YPLH 1K1MA 1TPAE 4AGJA 1K0HA 3GY7A 1C5YB 3L33A 1BQYA 1GHBF 2ZDKA 3KQDA 4ZAEA 1PQ7A 4D9QA 3RXJA 1N6YA 2ODYB 5E0GA 4RKOB 3ZZ9A 4K8BA 4Y6DA 4ZXXH 1HRTH 2EY4C 1T4VH 1VJAU 5F03A 4WWYA 5T6FA 1C2EA 1C5XB 2ZQ2A 1PPFE 2VH0A 1V2RT 2CF9H 1AVXA 5DP4A 1HAHH 4X6NA 3TJOA 3VGCC 3M35A 5A09A 1DUEA 3U1IB 3UR9A 1BMAA 1V2VT 4ABHA 2GDEH 1YGCH 3AK5A 1BMFD 2Z3EA 5J4SA 5EG4A 1GI2A 4BAHB 3F9GA 1G37A 3TIUA 4D7GA 2TIOA 3MH5A 4AN7A 3ODFA 4KKDA 2KCOA 5JB9S 1WUNH 1DY8A 1OWJA 3OX7U 3SU1A 3T26A 3LGYA 1V2OT 4ISLA 1C1SA 4NIXA 2FX6A 1A5HA 1F5LA 3RXFA 1ZLRA 1O2YA 1XUFA 4BANB 3EA7A 1UK2A 1SQAA 5E8EH 3PMJA 1HJ8A 1W7XH 2OP9A 3TH2H 2RG3A 3BTME 1SGFA 3NUMA 5GJ4B 1O2TA 2ZHFH 1YC0A 3SHAH 1GI6A 2H2ZA 3U8TH 3H7OA 1KDQB 2VWLA 4YLQH 5C94A 1O3MA 3ZVGA 1AUJA 2VWNA 2ASUB 1XUHA 1IQHA 1PPZA 3K6ZA 2ZKSA 4FUHA 1EZXC 3PTBA 2ZDMA 5EXMA 1XUJA 1GBIA 2THFB 2ODQA 2SNVA 2TPIZ 2IJOB 4B71A 1GGDC 1O3DA 2OBOA 5DPAA 4IS5A 1GHAF 4B73A 1P06A 1H9HE 4LOYH 2WV9A 5A8XA 1K9OE 2G4UA 2ZGCA 2Y5HA 1X7AC 4A1TA 2PGQB 1RIWB 3ZVDA 1LHGH 1V2JT 3TGKE 1P0SH 1AWHB 2HNTC 1O33A 2FOGA 2WPIS 4A92A 3Q00A 3E3TA 1H9LB 2JH6D 2GCTB 3BF6H 3KIDU 1W2KH 2VIWA 1P11E 5JBTA 4JYVH 3GS9A 3SJOA 1ZRBA 1GBJA 2OD3B 5DN6D 2ZHWH 3PLPA 1T4UH 1KYNA 2SGQE 3VB6A 1O5AB 2QF4A 3SORA 2FLBH 2VH6A 1SBWA 3W95A 1FQ3A 1M9UA 2JJ2D 2F91A 2WYGA 4ZHMU 4TSFD 3F6UH 3P8GA 1A5GH 1ZJKA 1WDIA 1BRCE 1C5RA 3E0PB 2AGEX 3U8OH 1NRRH 2G4TA 2GV7A 3LPRA 4FU7A 2QA9E 1P2KA 1GG6B 1BITA 1D9IA 1AUTC 2NU0E 3WWBA 1EATA 1IQMA 4WH8A 1O2XA 1Y5BT 2NU1E 1IQIA 5A0CA 1Y3XA 3TK5A 1BOQA 4NSVA 3OFND 5DP9A 3KQBA 2ZFSA 1TGTA 2ZNKH 2BDCA 1Y3UA 4RSPA 1BMLA 3FVFB 1CHOG 5FPYA 4ABEA 3I29A 5SGAE 5JPMH 1NT1A 3AASA 1SL3A 1BDAA 1Y8TA 3BEFB 4X2WA 1L0ZA 1ARCA 2HVYB 1FZZA 1ZOMA 4ASHA 2B5TB 1PPHE 4YO9A 3BTKE 3LGTA 1MTNB 2A32A 2GD4B 1OWHA 4UD9H 6GCHF 1G2MA 1C5NH 3C1KA 1WQSA 5EPYA 1UTKA 4AC9A 1KSNA 2GT7A 1P01A 4Y8XA 2RDEA 3HK3B 4DIIH 2VJ1A 4X1QU 4B2AA 4X8UH 1S6LA 3NCLA 4IW4E 3VB7A 1RIWC 5EU8A 3TGIE 1TBRH 3MU1A 4YLUA 1ACBE 1HXFH 3Q76A 5K7RA 1AVWA 1O34A 3QTVH 3TLOA 1O3LA 3MNBA 3U28C 4ZHLU 1V2KT 1GJ4H 1HGTH 1BUIA 1GMCF 2GCTC 4INLA 2ZPRA 1VGCC 1HAGE 1YM0A 1P05A 2XBYA 1NU7B 3MTYA 5E2PA 2TGDA 4DY7B 1Q2WA 5GIBA 1QCPA 2BX4A 2BD2A 1XXFA 2IPQX 3EYDA 4ZXYH 1C5MD 2BQ6B 5LPFA 1O2QA 5TCCA 3DSOA 1TAWA 1ETTH 3CS0A 1A7SA 3RXBA 2UWLA 3OEED 2F9OA 5CDFE 1HAYB 1VCWA 3A89A 1NTPA 1SQTA 2FMJA 4JMYA 3SJKA 1P3EA 4ABGA 1PQAA 1F0SA 1S0RA 1XXDA 2VIQA 4AX9H 4BXSA 5GXPA 1RXPA 1E36B 4Y8ZA 5T6DA 1EJAA 1GG6C 1NROH 2FXRA 5ESTE 5JB8S 1E1QD 3TJUA 1QR3E 1QA0A 4HFPB 2KCYA 3ZZ7A 2ZPQA 3ODDA 1C5WB 5K0HA 2GVFA 2XBXA 4MPUA 4RKJB 2PUQH 2UWPA 3A80A 2BOKA 1O5DH 1ZTJA 3P8NA 2Y7XA 1HBTH 1MABB 1P02A 2OUAA 1P57B 1O5BB 3B8JA 1V2WT 4A6LA 2ZA5A 1XM1A 1IAUA 3GY3A 1ZYOA 3PWBA 4AB9A 4ZKRU 1NRPH 1TX6A 2HPPH 3RXHA 2P3TB 2B9LA 1TPPA 1B7XB 1IHTH 2VWOA 3ZVBA 1C1QA 1QURH 3ATIA 5C20A 1MTNC 1JRSA 2Z7FE 3M5MA 3UREA 1NM6A 3UQOA 1C2DA 2YNAA 1OWKA 4GAWA 4NWLA 3EDXB 4X1PU 1W14U 3MU8A 3DCLA 4UEHH 3ZZ8A 3VB3A 3ZV9A 4Y10E 1ELCA 1HV7A 1SLUB 1O2LA 1XVMA 3SV9A 2J9NA 1DICA 3NXPA 4DOQA 2ZF0H 2GT8A 1O36A 5TCAA 2F4LA 4B6FA 2DE9A 3JZ1B 3SBKA 4ABDA 2OCVB 3RUOA 4DURA 1EAUA 3T28A 1CT4E 4X0WU 2NWNA 2M2AA 2W6ID 2UUJB 1E0FD 3MO6A 1GCTB 3PRDA 1QB9A 1ZGVA 2KCPA 3CNRA 4K1SA 3SO3A 1UCYE 3LGWA 1ELDE 1MUEB 1VZQH 3KYFA 3BG4B 5FX5A 1P3CA 1FX0B 5TJXA 3ZZ4A 4Y0ZE 4HZHA 3TPIZ 1VITH 3MNSA 3T25A 3GICB 1HAOH 1ZMJA 2HLCA 1YBWA 2QXGA 5HMAA 3SU4A 1CT0E 3Q77A 4U32A 4JK5A 2O8WA 1LTOA 1WQVH 2ZHDA 2CK3D 4TPYA 5DJ7A 4B1TA 2HNTF 2V3HH 1BJUA 4FUEA 1FJSA 3RM2H 3UWIA 2YNBA 1UK4A 4FU8A 1SOTA 3UR6A 1ZHMA 2BDYA 4D8NA 2ZFTA 2RDLA 1AKSA 1TRNA 1BZXE 1CGJE 4NZLA 3A8DA 1WU1A 4GUXA 1ELFA 4M9FA 1O3AA 1V2ST 4TYDA 5JBBS 1C5TA 1DWDH 1VR1H 1ZRKA 2ZDAH 1FY5A 2FOAA 2TGPZ 2HNTE 2PGBB 2BB4A 5DKMA 3GOVB 1JIMA 1EOLA 2BLWA 1OWEA 4IN2A 1ELVA 3UIRA 3BTWE 3QGJA 2ZU3A 1XKAC 4P00A 2XTTB 7GCHG 4Z6AH 1QRWA 1MU6B 3E16B 2C8XB 2O8TA 2VGCB 2BY8X 4XBDA 1CA0B 3VEQB 2D26C 5KEDA 1FIWA 3OY5U 1ELGA 3D62A 3Q3KA 5BRRE 2PHBA 1KLIH 3BEIB 2BM2A 3FANA 5HYOA 3M7UA 4BAQB 5JBAS 1EJNA 1ABJH 1W8BH 1KLTA 3RDZA 1L1GA 1GBLA 2B8OH 1OP8A 1EXFA 7LPRA 5EGMA 3HGNA 1LVBA 2BOHB 3PLKA 1YCPK 2ZGXH 2PTNA 1DITH 9LPRA 1GCTC 1TOMH 1S6FA 2JJ1D 1SGFG 1O5GH 3BIUH 1ZTLA 3NK8A 1INCA 3SQHE 1C5PA 1AE5A 3HGPA 3BG4C 5AFZH 2A2XH 4YESB 1QHRB 1MBQA 2LNCA 1MH0A 3F0OA 1UTPA 4B2BA 2ZGBH 3MMGA 1THRH 2ALVA 1AZZA 4GPGA 2XBVA 1C1OA 2I6SA 3FOAA 5A0AE 3TK6A 1GHBG 2L74A 4O9VA 1L1JA 1QBNA 2FOBA 2ZFQH 1YCPH 3SJ9A 1WXRA 2A31A 1GHVH 1UHBB 3OTJE 1AMHA 4WMFA 1YYY1 1WAYB 1F5KU 1KXEA 1NRSH 1SG8B 1DOJA 1DY9A 2C90B 1FN6A 2HGTH 3QZRA 2EI7A 2WUBA 1SKYE 3UPEA 2AYWA 5DP6A 3S9AA 3STJA 3PTNA 4Q63A 1THPB 3P8FA 1XVOA 2PKAB 4GHTA 3SGQE 2W26A 1FN8A 3ELAH 3NKKA 1O2JA 1SI5H 4X8TH 2M5TA 3BV9B 1AU8A 5EPNA 2WSSD 4GCHF 4X6PA 3F9HA 1A2CH 1EPTA 4H6TA 2K0QA 5DSFA 4YXWD 5B6LA 1FNIA 3TGJE 4ZUHA 3P6ZB 3TNTA 3KQ5A 4RT1A 4FOUC 3M7TA 1KDQA 1OYTH 5C0UA 2P3FH 1MU8B 1DWEH 1C2FA 2BD5A 3ESTA 1DWCH 2WPMS 1JBUH 5CHAB 5EW1H 2VGCC 1OSSA 1KXFA 1CA0C 4OGYA 1MAXA 4Y7BA 3UAIC 2C3SA 8LPRA 1P2NA 2D1JA 5EOKA 3DD2H 4Y0YE 4J1YA 4DW2U 4AORA 1HAZB 4Z1MD 1UCYK 2J5UA 3E0NB 1NBMD 2FODA 4XDEA 1P2MA 3LU9B 4XE4A 2PSYA 2ZZUH 3KGPA 3GDVA 3CENA 1UTQA 5J4QA 2Q1JA 1H8DH 1ELAA 1O37A 4TY7A 1FY4A 3VPKA 6CHAC 1IQKA 8GCHF 1QZ8A 2ANMH 2AHME 4BNRA 1C2IA 3EAJA 3GY5A 3SUEA 1S0QA 4X8SH 1ZMLA 3P70B 1GHAG 1VITG 2HWLB 1G3CA 4BXWA 1LPKB 1AO5A 5DGJA 1UTOA 3LOXA 1GBAA 1PPEE 2JDID 1UCYH 1OP0A 3S9BA 4LXBH 3U8RH 1B5GH 1AD8H 4ABAA 5ABWA 2WINI 3LGIA 2Y5GA 4AGKA 1CBWC 1VCQA 3FP7E 1LVYA 1Q3XA 1PQ8A 3MU0A 4X2YA 3SU2A 2ZO3H 3V12A 3PRBA 1O3JA 5HIZA 1S83A 1TWXB 4K69A 1H8IH 3PMHB 3BEUA 2A0QB 1ZZZA 4MLFB 2AMPA 5HGGA 1DSTA 1P10A 3VG8A 2SGPE 1DE7H 1VKYA 2BD3A 2YOLA 4UFFH 5C2ZA 4TWYA 4OM9A 3EGKH 1HAIH 3MNXA 4I31A 3RXMA 1CSOE 1BCUH 1K28D 1YLDA 3N7EA 2XNIA 1CGHA 6LPRA 1A3BH 4TY6A 3HKIB 3EA8A 1SGIB 3SNBA 1A4WH 4A1VA 3BN9A 1FV9A 1O2HA 1BRUP 1DUAA 1RTKA 2WPKS 5EJLA 1RD3B 2J34A 3RXUA 4H6SB 3D23A 1C2GA 1AB9B 1TRMA 4U2WA 1T32A 2J94A 2ZGJA 2ZU2A 2FOHA 4I8KA 2CHAB 4UE7H 1DM4B 1K1PA 2BY6X 2Z3CA 2KFWA 2ZPSA 5CHAC 1P2IA 2WZQA 1A3EH 3SNCA 5C0TA 1G32B 1ELTA 1C4U2 1S84A 1TBQH 2ILNA 1QL9A 4IBLH 1O5FH 4NFFA 2JH5D 1G36A 4R8TB 3U9AH 1CA8B 3GY2A 3FP6E 3PV5A 4H4FA 3TK9A 1C2MA 1DVAH 3RLWH 4Q7XA 3AW1A 1O39A 2Z3DA 1ID5H 1D3TB 2V35A 3MH6A 1GI0A 3ZV8A 2F9UA 3SI4H 2L6OA 1WV7H 3F68H 1GDQA 2F9PA 1SLVB 1GBMA 1C1MA 3SW2B 1C1WH 4VGCB 2BD7A 2G55A 1EZSC 2G81E 4CBNA 3RXIA 1QRZA 1TIOA 1AIXH 4OS7A 2PWXA 4O03A 1PYTD 1O2RA 1G3EA 2W7UA 1OHHD 1QQ4A 1GI5A 2P3UB 3LONA 1MQ6A 1GMCG 1PYTC 2QCYA 5EQSA 4MVNA 2WYJA 3N99A 2BZ6H 2VVUA 1FONA 3A86A 2B0FA 1Z1JA 1FPHH 1OXGA 1DX5M 1O3OA 4B6EA 1GMDF 1S81A 2G8TA 3RMOH 1EOJA 3LH3A 1XUGA 3MI4A 1GL0E 3HATH 1TA2A 4K1EA 1E38B 1FY3A 1N6XA 3ZYDA 4GVUA 1AB9C 1SHYA 2WV4A 3E1XB 2CHAC 6ESTA 4X6OA 1BB0B 2VWMA 2C8WB 4ZCNA 1GMHF 3F1SB 1BJVA 1XUIA 2H5CA 5EJ1A 5EODA 3PLBA 1Z1IA 1AHTH 3SV6A 1ZHPA 2FX4A 1V3XA 1SGEE 2QV1A 1E35B 2KCAA 1GHWH 4YOIA 4DT4A 2PR3A 3BSQA 3MYWA 1AN1E 1SFQB 2A4RA 4BTTB 3RU4E 1PFXC 9ESTA 2PFEA 2F43B 1LPZB 3PV2A 5FHTA 4JCNA 1T8NA 1HXEH 1T8MA 4Q80A 5EIYA 1CO7E 5A0BA 4VGCC 3A7ZA 1WOFA 2J95A 1ABIH 4HI3A 3RXPA 1GI1A 1HAVB 4Y76A 1JIRA 1UVOA 1FXYA 2OK5A 5F53A 1N1LA 4Y8YA 1IQEA 5JDUB 1W13U 3UNSA 5CHBA 1Y5AT 2ZFRH 1GBHA 4F48B 3DT0H 1EQ9A 5LPEA 4A5TS 1E34B 2DUCA 1SHHB 2Z9LA 3LC3A 1Z8RA 1C5ZB 3E90B 3FKSD 1QFKH 1HJAB 5I25A 4K8YA 1O3HA 4MNVA 4X6MA 4MPVA 3S7KB 2ZCHP 4XBBA 3M3SA 1SVPA 4IGDA 5I46H 1GBKA 1HLTH 4Q2KA 2CMYA 1XUKA 1GBBA 2RCEA 4PROA 1TQ7B 2Z9KA 1EAWA 1O3PB 1KXBA 2RFKC 5GPIB 1OS8A 1ESBA 1QGFA 2LELA 2O9QA 2BVRH 3ZYEA 3SU0A 4ABIA 2UUFB 4UFGH 4DJZB 4LZ4B 1W0ZU 1AWFH 1QJ1B 4X2XA 4THNH 3N7DA 2VNTA 1O35A 2FOMB 3AAUA 2GTBA 5L6NH 3F2FA 4D7FA 1GPZA 1BBRK 3UTUH 4ZROA 1F0RA 4ZH8A 2F9VA 1GVKB 2W7SA 1ZTKA 4Y11E 3QX5H 3RMLH 3SGBE 1T8LA 1SFIA 2BDIA 1YPEH 5IDKA 3SN8A 1F0TA 5FPSA 2A45B 3GCOA 2H9HA 1TLDA 4XD7D 3LKWA 1SGDE 1H8ED 5F8TA 5C67A 1MTSA 1P04A 2GDDA 3LT3A 1C5UA 2BY7X 1BTXA 1EASA 2ZHQH 1AGJA 8ESTE 3K65B 3OEHD 1H8HD 2F3CE 4RT0A 1HCGA 1TX8A 1OWDA 1DS2E 1EP5A 1PJPA 2QXHA 2YMSD 4MNXA 3MQKC 3RXRA 3SUFA 3PMBB 1OPHB 1ZMNA 1WTHD 1LHFH 4ZMAH 4AFZA 2R3UA 2STBE 3QWCH 1O2IA 1T8OA 4I8HA 1DT2A 2R9PA 1SGPE 4O97A 4NA9H 4WY3A 1NPMA 4B2CA 1NN6A 1V2PT 4BOHA 1EX3A 4FUBA 3V7TA 4X1RU 2GGVB 3SU5A 1D6RA 1HUTH 3UUZA 1EUFA 3T27A 2OTVA 3F0PA 3GCTF 2DE8A 2XBWA 2BMGB 3T62A 1XMNB 3O8BA 1W0KD 3EE7A 3FZDA 4ZHAA 2FTMA 4X2VA 1Z8IB 1K1JA 4I32A 4H42U 1RFNA 3RMMH 4UONA 1MTVA 3VB5A 3BTHE 1FI8A 4AYYB 2BY5X 4DG4A 1LO6A 3A88A 4Q7YA 3A8BA 4WVPE 1KXDA 1Y5UT 1FAKH 1K1NA 3QK1A 4BTUB 3F9EA 3SUDA 1TNIA 3WW7A 2XC5A 1UHBA 3WY8A 4Y71A 2AS9A 1MBMA 1O2KA 1LCYA 2FOCA 2PLXA 1GHYH 1GJ5H 1LMWB 3OAAD 4OGXA 1FY1A 1K1OA 1HIAB 2PKAA 2Z9GA 2ZHEH 4ACBA 1BTUA 5IYTA 2CJIA 2W5EA 2QIQA 2Y7ZA 4YT7H 1C4Y2 4F4OC 4I8JA 1DPOA 3U1JB 4YT6H 2CV3A 1EZQA 1HAPH 2TGTA 3W1EA 1IQLA 1EB2A 1W12U 3RXDA 2J98B 1OP2A 2Z9JA 2PV9B 1LVMA 1MMJN 1YCPM 1GBFA 5T6GA 3GY8A 4K5ZA 2QAAA 1MKXK 3RXCA 1GI3A 2AMDA 5ESBA 3GYMA 1PQ5A 3ZVEA 4KP0A 4FETA 3A7WA 5A2MH 1WCZA 1FY8E 4HG6A 1EJMA 4GCHG 3KEEA 2Q6DA 3LGUA 1C1UH 1TE0A 4SGBE 3QGNB 1TMUH 4BAOB 3BTGE 5H4IB 1Y3YA 1A1RA 1TNJA 3SU6A 3PO1B 3IITA 4OS2A 3UB0A 2BLOA 1YPHC 1A0LA 1NO9H 1BMMH 1ZR0A 3VB4A 2FP7B 3A81A 1SC8U 4AFUA 3A82A 4U30A 1WTGH 2FM2A 1MKXH 1O3BA 1QL7A 3ZVFA 1J15A 4CH2B 1F92A 4ZKOU 1GJ7B 5C3NA 1P2JA 4WH6A 1O0DH 1B0FA 3GISB 2FIRH 5IK2D 1AVGH 1PPCE 3U69H 2ZI2H 1Z8JB 1V2MT 2A5AA 3GY4A 4RN6A 4MPWA 1DLKB 5LGOA 2K8IA 8GCHG 5AFYH 4NG9H 3RLYH 4NIYA 5B6OA 2J2UA 1FLEE 3M7QA 3ZZ3A 5CMXH 1GJ6A 1Y3VA 4UDWH 3RXKA 3A8AA 3TH4H 3A7YA 3ZZBA 2NU3E 4WXVA 1IQFA 1O2WA 2G5VA 4OS1A 1IQJA 2SGAA 1ANBA 2XRCA 3URDA 2P59A 1EZUC 1WYKA 5DO4H 1GBTA 1YPJH 4SGAE 2GZ7A 1YF4A 3MWIU 1GVLA 2Y82A 1OX1A 2OQUA 2C93B 4X1NU 5HXFA 1HB0B 2HOBA 3ATKA 2GCHF 3HK6B 1ZPBA 3NWUA 4FVDA 1V6DA 3B23B 1C5VA 4CHAB 1F2SE 3RP2A 1IHSH 2WV5A 4FXGH 3LIWA 5FL7D 4CBOA 2BXUH 4F55A 1SQOA 4NA8A 1TGCA 1O3NA 3SHCH 2FS8A 2ODPA 2TGAA 2WPHS 1O2ZA 5T3HA 1GL1A 1P2QA 1W10U 5DP7A 4KELA 3WWFA 1YWUA 2EEKA 1D4PB 3A84A 3B9FH 4MG3A 4FVBA 4ABFA 3MH7A 4I8GA 2BDGA 1GHZA 2KAIB 3P8OA 3PO1C 3CP7A 1NFXA 2HVXA 2FPZA 3GDSA 4YM9A 3OTPA 2ANYA 3V3MA 3TNSA 2HPQH 2G5NA 2OC8A 4YOGA 1DSUA 4RI0A 1C9TA 4ZKNU 3S0NA 1EAIA 5HKKD 1TQ0B 4JZEH 3GCHB 3VXEH 2KR7A 4WMDA 1TPOA 2PKSB 4FUFA 1A46H 1RS0A 1BTPA 1OOKB 3A87A 1FAXA 7KMEH 1TPSA 2J4IA 2SGEE 1LQDB 1W0YH 3JZ2B 3M61U 4FUDA 2SFAA 2CF8H 3KYGA 3I77A 1MKWK 1JMOH 2PSXA 4I8LA 1UVSH 3SV7A 4BTIB 1S85A 2EI8A 2HRVA 2BDHA 2ZTYA 2WUCA 3M37A 1GJDB 1QTFA 3DFJA 3VGCB 4CRAA 1G9IE 1C2KA 5A8YA 4NSYA 3DSPA 5AVDA 3LC5A 1KY9A 1UO6A 1O3FA 2AEIH 4KGAA 2FDAA 2Z94A 1K2I1 1DANH 1O2GH 3ZVAA 1HPGA 1YLCA 1BTZA 1AKSB 3TITA 3C27B 2AMQA 4DGJA 1K1LA 3SZNA 4CHAC 1O30A 1GHXH 1RJXB 1CVWH 1IOEA 2BD4A 1QNJA 4OS4A 3SI3H 3MOCA 5E2OA 3UOPA 2QXIA 4IN1A 2EA3A 1NU9A 2VIOA 4HTCH 1E1RD 1ANDA 3MU4A 2JIZD 1C1NA 2UUKB 1S5SA 1H4WA 1ZSJA 1AFEH 4DT7B 3GDUA 1A0JA 4KTUA 2H9EH 1C5OH 5DP8A 4YOJA 1CGIE 3MNCA 1ETRH 2QGRA 5AF9H 1QA7A 5ETXA 1LHDH 4A1XA 1J8AA 2GV6A 1UVUH 2Z6BD 2ZDLA 3ATMA 1T7CA 3UNRA 1GWAA 1GMHG 3MO9A 3SZEA 1MTWA 1SGCA 3I78A 4NFEA 3MH4A 2RA0A 3DSGA 3KHVA 4A7IB 4U01A 3GCHC 3SNDA 3SJ8A 1J16A 1EFRD 1L2EA 4ACAA 2H6MA 2XWAA 2PKSC 3SGAE 3QO6A 1BA8B 1O38A 4AFQA 2VVVA 4AFSA 1HAVA 4E7RG 5FAHA 2EQNA 1TABE 2R3YA 1BHXB 1Y3WA 3PB1E 3SNEA 2FI3E 5GDSH 2FOEA 2EI6A 4OS5A 2JETB 3L3TA 5HIYA 1BBRE 2CN0H 5EXLA 3PMAB 4JZDH 5EJZA 1GI8B 2RA3A 1E79D 1ESTA 3FN8A 2ZFPH 5FCRA 1Z7KA 1YPKH 4I33A 4I86A 3KL6A 1QJ7B 3EA9A 3ZZDA 2KX4A 1YPMH 2VB0A 1LHEH 1GBDA 3H09A 3R0FA 2VU8E 3A8CA 2BHGA 1ANCA 4INHA 3ATWA 1GDUA 2BQWB 4WXIA 6GCHG 1GI4A 1DFPA 3GYLB 1HNEE 1MZAA 3SV2H 2AFQB 5L30H 1K22H 1UTMA 3V0XA 3TJVA 1YPHE 3E6PH 2STAE 3ATLA 2H9TH 1SQRA 1F7ZA 1TONA 3M3TA 1EP6A 1TNLA 3BTFE 1TX7A 1J17T 3RXOA 3ZZ6A 1YP9A 3S7HB 4ESTE 4Y79A 1EPTB 2R2MB 1MCVA 3CS7A 1LHCH 2FEQH 1N8OB 2K1QA 4IMZA 1W3CA 2O8MA 3F2GA 1OWIA 4DVAU 2OC0A 2BVXH 3S9CA 1B0EA 1ESAA 1Z71A 5DP3A 1ELEE 1CE5A 3KN2A 1TMBH 1QY6A 2W6JD 3LJOA 1UW7A 1FMGA 3D65E 2V3MA 2PUXB 3A7XA 3SV8A 3VXFH 4K2YA 1C2HA 2AGGX 2IN2A 1D6WA 2ZDVH 1F0UA 2FYRA 2R0LA 1QQUA 2UUYA 1FIZA 4AG1A 3RXEA 1KLJH 1VITF 3BG8A 1T31A 1O3KA 3KF2A 5C5NA 2V7QD 1MCTA 2ZFFH 1GCDA 1JOUB 1L1NA 2Y81A 2OLGA 1AFQB 4OS6A 3DFLA 1EB1H 1RTLA 5F8XA 1NRQH 2V6NA 1DXWA 1GBCA 2A5IA 5GCHF 1C9PA 1LPGB 4FUIA 4ISOA 5FCKA 2IJD1 5C17A 1QB6A 1V2TT 2H1UA 4B75A 1MQ5A 4R0IA 1NFYA 2XC4A 2PTCE 1VGCB 1K1IA 3M5LA 2JETC 4JYUH 3H5CB 2QF3A 3TJNA 3PM3A 1HDTH 1GBEA 3ITIA 3SU3A 1O5CB 3M36A 4GHQA 3UQVA 1ZSKA 4CR9A 1WSSH 5E0JA 3A7VA 4P02A 1OYQA 3GCTG 2F9NA 4YZUA 1NY22 2VBCA 5C1UA 4CRGA 1SOZA 1FDPA 1NRNH 3IG6B 1KTSB 2ZECA 2FOFA 1AQ7A 2YMSB 2P8OB 1BTWA 2LP6A 4BAKB 2BYAX 1AI8H 3Q3YA 1SGYE 2VIVA 5A8ZA 1MAYA 1C2JA 3AAVA 2G51A 1YKTA 1YY3A 2P95A 3LJJA 4MDSA 1TALA 3PROA 3DA9B 1NFUA 1HIAA 1ZHRA 4O3TA 1UVTH 2BXTH 3P92A 2XC0A 1RTFB 1EPTC 1IQGA 1V2QT 5L2YH 2ESTE 1ZGIA 1GJCB 1N8OC 4X1SU 3PYHA 2H5DA 1BRBE 3UNQA 2J98A 1NS3A 5KECA 5KGOA 3T2NA 2UWOA 1QRXA 2XWBI 4ISIH 1W11U 5JBCS 5JYIA 2WPLS 1MD7A 4K3JA 3ZVCA 1QIXB 3RXVA 3K6YA 4Y7AA 1BRAA 1KXCA 2G00A 3HKJB 3T29A 5GWZA 4ABJA 1O31A 1H1BA 1C1TA 1NC6A 1GJAB 3AVZA 4CRCA 3RXSA 3K2UA 5HM2A 3RXQA 2XXLA 1AFQC 2A7HA 4CRBA 1NBME 4XRNA 2OC7A 3M5OA 2CXVA 1IQNA 4MQAA 4AOQA 2Q6GA 2OINA 1ANEA 3E8LA 4IMQA 1CU1A 2F9BH 1O2NA 2ZDNA 3ZIAD 1A61H 3KNXA 4NGAH 1MTUA 1J14A 4WMEA 1G3BA 4NZQA 2W3KA 3QLPH 1ELBA 3EQ0H 2XYAA 1MZDA 1C1PA 3G01A 3QUMP 1TB6H 3A85A 1EKBB 1PPBH 3SQEE 1TOCB 4F49A 3MO3A 4JK6A 4YTAA 2D2DA 2OBQA 2ZG0H 4INKA 4FU9A 4DIHH 2ZC9H 3KCGH 2WPJS 1SR5C 4NCYA 3RXGA 3QN7A 1A0HB 3RU4T 3BTQE 1BBRH 1W7GH 1KMHB 1SGTA 3PWCA 4TT3D 2YMSC 2P8OC 2QC2A 1Y59T 2AIQA 5F6MA 4JZ1A 1O3IA 2IOTA 1O2MA 2IPHA 2ZCLP 2QE7D 3NZIA 4E7NA 3ZZCA 1TRYA 1J9CH 1S6HA 2LPRA 2BLQA 1GI7B 2ZIQH 3A7TA 5FBEA 2AIPA 4ZKSU 1P8VC 3ZZ5A 4NWKA 3RC4A 1KXAA 1BTYA 1QJ6B 2XW9A 5EQRA 4AG2A 1O32A 1NFWA 3F3BA 1L4DA 3QZQA 1SLXB 2BQ7B 1HJAC 1C5SA 2TBSA 1YLNA 2QXJA 1AE8H 2C4FH 1F5RA 3LDXH 2ZTXA 2GKVE 4CR5A 2GP9B 2SNWA 2ULLA 1LDTT 1GJBB 3Q3XA 2CGAA 1A5IA 1V2UT 3FFGA 2GCHG 5FBIA 3S69A 2SGFE 2Y6TA 2P93A 2FTLE 1UJ1A 1E37B 2O8LA 1DWBH 2JKHA 3P17H 4B74A 5LPRA 1O5EH 4K60A 3F9FA 2VVCA 1CHOF 3DHKH 3OY6U 5C1YA 2KAIA 2R0KA 2ZP0H 1FPCH 1C2LA 3V13A 3SJIA 1O2PA 1D3DB 1AZ8A 1LKBA 2ANKH 1O2OA 4MNWA 1LVOA 3QDZB 5F8ZA 1ZJDA 1ORFA 1GVZA 2GZ9A 4CREA 3T5FH 2BVSH 1P12E 1O2UA 1SPJA 4J2YB 1V2LT 3O8DA 1Z8GA 1TMTH 2VIDA 1TGSZ 4ISNA 2A4GA 4Q7ZA 2BLVA 3E91A 2BDBA 3RC6A 3VFEA 1UK3A 4JZFH 1L4ZA 5E0HA 2AH4X 2BX3A 1C1VH 1P9SA 5DP5A 1CHGA 5FXLA 1COWD 4KTCA 1WBGB 2ZU4A 5DG6A 3BTDE 1GDNA 2I6QA 3SYJA 1DDJA 4UFDH 3O8RA 2QF0A 2A7CA 1SGNE 2O8UA 2ZWLH 1BHXF 4TPIZ 1QBOA 1GJ9B 1BTHH 1NZQH 2Y5FA 2B7DH 1P2OA 1MD8A 1VCPA 3N7OA 1NESE 5LH8A 4QT8C 1S82A 3UFAA 2BZAA 1O2SA 3AW0A 3DUXH 2P94A 3SOSA 1GJ8B 1BMNH 2C8ZB 2GMTB 5T1VA 1JWTA 1KTTB 1JRTA 2AERH 2FLRH 3TVJB 5EW2H 5CE1A 4GLYA 2GJGA 3TU7H 4XSKU 1O3EA 2QY0B 3K9XB 3SUGA 3RXAA 1O3GA 2AGIX 4FUGA 2FESH 3UOUA 4IC5A 1Q31A 4AYVB 3UY9A 4D9RA 3BIVH 1G3DA 1TNKA 5AHGH 4ABBA 2V0BA 1LKAA 2QYIA 1VJ9U 5PTPA 2A4QA 2D8WA 3RXTA 2OQ5A 2PP6A 1EAXA 2SGDE 3SNAA 3BTTE 3MU5A 1C5QA 3L6PA 2JH0D 1D3QB 2Z9IA 2FWWA 3ENSB 1SB1H 4DCDA 1SLWB 2A4OA 4JZIA 1ARBA 2ZU5A 2BDAA 3OE7D 1QL8A 2EC9H 2FYQA 4XFQA 1TFXA 1ETSH 2ZCKP 1D3PB 3IWMA 2ZU1A 4WF8A 2FO9A 5G4BA 3U98H 2BD9A 3NRLA 1TNHA 2G52A 4CRDA 2ZEBA 3RM0H 6CHAB 1TGBA 3RMNH 3HPTB 1HAXB 2Q6FA 4X8VH 3GCNA 4CRFA 3LH1A 3A83A 4E06H 1G30B 2R2WU 4ISHH
chains in the Genus database with same CATH topology
4XBCA 1JXPA 3H7TA 1SGRE 2XCFA 3FAOA 1C4V2 4Z0KA 3RU4D 1P03A 3ZZAA 1UMAH 2V3OH 1KIGH 4MPXA 2GZ8A 5EXNA 7ESTE 4AZ2B 1THSH 2QN5T 1HYLA 2VIPA 4WJG2 2NU2E 3MHWU 2F83A 1CBWB 3FP8E 3RXLA 1UTNA 1SGQE 3NPSA 1V2NT 2J92A 4MTBA 1Z6EA 4BAMB 4K1TA 1DXPA 3QTOH 3FZZA 2A5KA 2A7JA 3OYPA 4IC6A 2P16A 3M3VA 4TWWA 1TNGA 1LQEA 1P9UA 1UTLM 4HGCA 1C1RA 5FPTA 2GMTC 4I7YH 1UVPA 3KQEA 1OKXA 1P09A 5HM9A 1QBVH 3URCA 1AY6H 3LGVA 4NIVA 1G2LA 2FS9A 3OSYA 1BIOA 4FUJA 1GI9B 2A1DB 4NIWA 3D49H 1XX9A 4JYTA 4NA7A 2ZTZA 1O2VA 5FX6A 3EE0B 4B76A 2ANWA 2C8YB 2OXSA 1CQQA 1TA6A 4E05H 3P95A 2OC1A 1RRKA 3TH3H 5L2ZH 3BTEE 5DK1A 4UFEH 4O3UA 3STIA 2BY9X 2NU4E 1PPGE 2W3IA 2GX4A 3GY6A 5C1XA 1TGNA 1C5LH 1K21H 1YPGH 2Y80A 2VINA 1TYNA 2BD8A 3PV4A 5EQQA 1TBZH 2FI4E 1HJ9A 1ZSLA 7GCHF 4XOJA 1BT7A 4GSOA 2ZGHA 1O3CA 1MKWH 4AB8A 3O8CA 4LZ1H 3MFJA 1HFDA 1SMFE 4LK4A 1GMDG 1RGQA 3OU0A 2FZZA 2BTCE 2TRMA 1ZPZA 5C5OA 1ZPCA 4MNYA 2ZQ1A 8KME2 1H9IE 2PW8H 1DLEA 4D76A 2ALPA 1FUJA 4M7GA 1U6QA 1Z6JH 4KTSA 3M5NA 3UWJH 1CT2E 2FI5E 1XKBC 4FUCA 5BPEA 4CH8B 5GCHG 1SSXA 3W94A 2XCNA 2A2QH 3KQCA 1QB1A 1GGDB 2J38A 3R3GB 3RC5A 1UTJA 2HALA 1YPLH 1K1MA 1TPAE 4AGJA 3GY7A 1C5YB 3L33A 1BQYA 1GHBF 2ZDKA 3KQDA 4ZAEA 1PQ7A 4D9QA 3RXJA 1N6YA 2ODYB 5E0GA 4RKOB 3ZZ9A 4K8BA 4Y6DA 4ZXXH 1HRTH 1T4VH 1VJAU 5F03A 4WWYA 5T6FA 1C2EA 1C5XB 2ZQ2A 1PPFE 2VH0A 1V2RT 2CF9H 1AVXA 5DP4A 1HAHH 4X6NA 3TJOA 3VGCC 3M35A 5A09A 1DUEA 3U1IB 3UR9A 1BMAA 1V2VT 4ABHA 2GDEH 1YGCH 2Z3EA 5J4SA 5EG4A 1GI2A 4BAHB 3F9GA 1G37A 3TIUA 4D7GA 2TIOA 3MH5A 4AN7A 3ODFA 4KKDA 5JB9S 1WUNH 1DY8A 1OWJA 3OX7U 3SU1A 3T26A 3LGYA 1V2OT 4ISLA 1C1SA 4NIXA 2FX6A 1A5HA 1F5LA 3RXFA 1ZLRA 1O2YA 1XUFA 4BANB 3EA7A 1UK2A 1SQAA 5E8EH 3PMJA 1HJ8A 1W7XH 2OP9A 3TH2H 2RG3A 3BTME 1SGFA 3NUMA 5GJ4B 1O2TA 2ZHFH 1YC0A 3SHAH 1GI6A 2H2ZA 3U8TH 3H7OA 1KDQB 2VWLA 4YLQH 1O3MA 3ZVGA 1AUJA 2VWNA 2ASUB 1XUHA 1IQHA 1PPZA 3K6ZA 2ZKSA 4FUHA 1EZXC 3PTBA 2ZDMA 5EXMA 1XUJA 1GBIA 2THFB 2ODQA 2SNVA 2TPIZ 2IJOB 4B71A 1GGDC 1O3DA 2OBOA 5DPAA 4IS5A 1GHAF 4B73A 1P06A 1H9HE 4LOYH 5A8XA 1K9OE 2G4UA 2ZGCA 2Y5HA 1X7AC 4A1TA 2PGQB 1RIWB 3ZVDA 1LHGH 1V2JT 3TGKE 1P0SH 1AWHB 2HNTC 1O33A 2FOGA 2WPIS 4A92A 3Q00A 3E3TA 1H9LB 2JH6D 2GCTB 3BF6H 3KIDU 1W2KH 2VIWA 1P11E 5JBTA 4JYVH 3SJOA 1ZRBA 1GBJA 2OD3B 2ZHWH 3PLPA 1T4UH 1KYNA 2SGQE 3VB6A 1O5AB 3SORA 2FLBH 2VH6A 1SBWA 3W95A 1FQ3A 1M9UA 2WYGA 2F91A 4ZHMU 3F6UH 3P8GA 1A5GH 1ZJKA 1BRCE 1C5RA 3E0PB 2AGEX 3U8OH 1NRRH 2G4TA 2GV7A 3LPRA 4FU7A 2QA9E 1P2KA 1GG6B 1BITA 1D9IA 1AUTC 2NU0E 1EATA 1IQMA 4WH8A 1O2XA 1Y5BT 2NU1E 1IQIA 5A0CA 1Y3XA 3TK5A 1BOQA 4NSVA 5DP9A 3KQBA 2ZFSA 1TGTA 2ZNKH 2BDCA 1Y3UA 4RSPA 1BMLA 3FVFB 1CHOG 5FPYA 4ABEA 3I29A 5SGAE 5JPMH 1NT1A 3AASA 1SL3A 1BDAA 1Y8TA 3BEFB 4X2WA 1L0ZA 1ARCA 1FZZA 1ZOMA 4ASHA 2B5TB 1PPHE 4YO9A 3BTKE 3LGTA 1MTNB 2A32A 2GD4B 1OWHA 4UD9H 6GCHF 1G2MA 1C5NH 3C1KA 1WQSA 5EPYA 1UTKA 1KSNA 2GT7A 1P01A 4Y8XA 3HK3B 4DIIH 2VJ1A 4X1QU 4B2AA 4X8UH 4IW4E 3NCLA 3VB7A 1RIWC 5EU8A 3TGIE 1TBRH 3MU1A 4YLUA 1ACBE 1HXFH 3Q76A 5K7RA 1AVWA 1O34A 3QTVH 3TLOA 1O3LA 3MNBA 4ZHLU 1V2KT 1GJ4H 1HGTH 1BUIA 1GMCF 2GCTC 4INLA 2ZPRA 1VGCC 1HAGE 1YM0A 1P05A 2XBYA 1NU7B 3MTYA 5E2PA 2TGDA 4DY7B 1Q2WA 5GIBA 1QCPA 2BX4A 2BD2A 1XXFA 4ZXYH 3EYDA 1C5MD 2BQ6B 5LPFA 1O2QA 5TCCA 1TAWA 1ETTH 3CS0A 1A7SA 3RXBA 2UWLA 2F9OA 1HAYB 1VCWA 3A89A 1NTPA 1SQTA 2FMJA 4JMYA 3SJKA 1P3EA 4ABGA 1PQAA 1F0SA 1S0RA 1XXDA 2VIQA 4AX9H 4BXSA 5GXPA 1RXPA 1E36B 4Y8ZA 5T6DA 1EJAA 1GG6C 1NROH 2FXRA 5ESTE 5JB8S 3TJUA 1QR3E 1QA0A 4HFPB 3ZZ7A 2ZPQA 3ODDA 1C5WB 5K0HA 2GVFA 2XBXA 4MPUA 4RKJB 2PUQH 2UWPA 3A80A 2BOKA 1O5DH 1ZTJA 3P8NA 2Y7XA 1HBTH 2OUAA 1P02A 3B8JA 1P57B 1O5BB 4A6LA 1V2WT 2ZA5A 1XM1A 1IAUA 3GY3A 1ZYOA 3PWBA 4AB9A 4ZKRU 1NRPH 1TX6A 2HPPH 3RXHA 2P3TB 2B9LA 1TPPA 1B7XB 1IHTH 2VWOA 3ZVBA 1C1QA 1QURH 3ATIA 5C20A 1MTNC 1JRSA 2Z7FE 3M5MA 3UREA 1NM6A 3UQOA 1C2DA 2YNAA 1OWKA 4GAWA 4NWLA 3EDXB 4X1PU 1W14U 3MU8A 4UEHH 3ZZ8A 3VB3A 3ZV9A 4Y10E 1ELCA 1HV7A 1SLUB 1O2LA 1XVMA 3SV9A 2J9NA 1DICA 3NXPA 4DOQA 2ZF0H 2GT8A 1O36A 5TCAA 2DE9A 3JZ1B 3SBKA 4ABDA 2OCVB 3RUOA 4DURA 1EAUA 3T28A 1CT4E 4X0WU 2NWNA 2UUJB 1E0FD 3MO6A 1GCTB 1QB9A 1ZGVA 4K1SA 3SO3A 1UCYE 3LGWA 1ELDE 1MUEB 1VZQH 3BG4B 5FX5A 1P3CA 5TJXA 3ZZ4A 4Y0ZE 4HZHA 3TPIZ 1VITH 3MNSA 3T25A 3GICB 1HAOH 1ZMJA 2HLCA 1YBWA 2QXGA 5HMAA 3SU4A 1CT0E 3Q77A 4U32A 4JK5A 2O8WA 1LTOA 1WQVH 2ZHDA 4TPYA 5DJ7A 4B1TA 2HNTF 2V3HH 1BJUA 4FUEA 1FJSA 3RM2H 3UWIA 2YNBA 1UK4A 4FU8A 1SOTA 3UR6A 1ZHMA 2BDYA 4D8NA 2ZFTA 2RDLA 1AKSA 1TRNA 1BZXE 1CGJE 4NZLA 3A8DA 1WU1A 4GUXA 1ELFA 1O3AA 1V2ST 4TYDA 5JBBS 1C5TA 1DWDH 1VR1H 1ZRKA 2ZDAH 1FY5A 2FOAA 2TGPZ 2HNTE 2PGBB 2BB4A 5DKMA 3GOVB 1JIMA 1EOLA 2BLWA 1OWEA 4IN2A 1ELVA 3UIRA 3BTWE 3QGJA 2ZU3A 1XKAC 2XTTB 7GCHG 4Z6AH 1QRWA 1MU6B 3E16B 2C8XB 2O8TA 2VGCB 2BY8X 4XBDA 1CA0B 3VEQB 2D26C 1FIWA 3OY5U 1ELGA 3D62A 3Q3KA 5BRRE 2PHBA 1KLIH 3BEIB 2BM2A 3FANA 5HYOA 3M7UA 4BAQB 5JBAS 1EJNA 1ABJH 1W8BH 1KLTA 3RDZA 1L1GA 1GBLA 2B8OH 1OP8A 1EXFA 7LPRA 5EGMA 3HGNA 1LVBA 2BOHB 3PLKA 1YCPK 2ZGXH 2PTNA 1DITH 9LPRA 1GCTC 1TOMH 1S6FA 1SGFG 1O5GH 3BIUH 1ZTLA 3NK8A 1INCA 3SQHE 1C5PA 1AE5A 3HGPA 3BG4C 5AFZH 2A2XH 4YESB 1QHRB 1MBQA 2LNCA 1MH0A 1UTPA 4B2BA 2ZGBH 3MMGA 1THRH 2ALVA 1AZZA 4GPGA 2XBVA 1C1OA 2I6SA 5A0AE 3TK6A 1GHBG 4O9VA 1L1JA 1QBNA 2FOBA 2ZFQH 1YCPH 3SJ9A 2A31A 1GHVH 1UHBB 3OTJE 1AMHA 4WMFA 1YYY1 1WAYB 1F5KU 1KXEA 1NRSH 1SG8B 1DOJA 1DY9A 2C90B 1FN6A 2HGTH 3QZRA 2EI7A 2WUBA 3UPEA 2AYWA 5DP6A 3S9AA 3STJA 3PTNA 1THPB 3P8FA 1XVOA 2PKAB 4GHTA 3SGQE 2W26A 1FN8A 3ELAH 3NKKA 1O2JA 1SI5H 4X8TH 2M5TA 3BV9B 1AU8A 5EPNA 4GCHF 4X6PA 3F9HA 1A2CH 1EPTA 4H6TA 1FNIA 3TGJE 4ZUHA 3P6ZB 3TNTA 3M7TA 1KDQA 1OYTH 2P3FH 1MU8B 1DWEH 1C2FA 2BD5A 3ESTA 1DWCH 2WPMS 1JBUH 5CHAB 5EW1H 2VGCC 1OSSA 1KXFA 1CA0C 4OGYA 1MAXA 4Y7BA 2C3SA 8LPRA 1P2NA 2D1JA 5EOKA 3DD2H 4Y0YE 4J1YA 4DW2U 4AORA 1HAZB 1UCYK 3E0NB 2FODA 4XDEA 1P2MA 3LU9B 4XE4A 2PSYA 2ZZUH 3KGPA 3GDVA 3CENA 1UTQA 5J4QA 2Q1JA 1H8DH 1ELAA 1O37A 4TY7A 1FY4A 3VPKA 6CHAC 1IQKA 8GCHF 2ANMH 4BNRA 1C2IA 3EAJA 3GY5A 3SUEA 1S0QA 4X8SH 1ZMLA 3P70B 1GHAG 1VITG 2HWLB 1G3CA 4BXWA 1LPKB 1AO5A 5DGJA 1UTOA 3LOXA 1GBAA 1PPEE 1UCYH 1OP0A 3S9BA 4LXBH 3U8RH 1B5GH 1AD8H 4ABAA 5ABWA 2WINI 3LGIA 2Y5GA 4AGKA 1CBWC 1VCQA 3FP7E 1LVYA 1Q3XA 1PQ8A 3MU0A 4X2YA 3SU2A 2ZO3H 3V12A 1O3JA 1S83A 1TWXB 4K69A 1H8IH 3PMHB 3BEUA 2A0QB 1ZZZA 4MLFB 2AMPA 5HGGA 1DSTA 1P10A 2SGPE 1DE7H 2BD3A 2YOLA 4UFFH 5C2ZA 4TWYA 3EGKH 1HAIH 3MNXA 4I31A 3RXMA 1CSOE 1BCUH 1K28D 1YLDA 2XNIA 1CGHA 6LPRA 1A3BH 4TY6A 3HKIB 3EA8A 1SGIB 3SNBA 1A4WH 4A1VA 3BN9A 1FV9A 1O2HA 1BRUP 1DUAA 1RTKA 2WPKS 1RD3B 2J34A 3RXUA 4H6SB 3D23A 1C2GA 1AB9B 1TRMA 4U2WA 1T32A 2J94A 2ZGJA 2ZU2A 2FOHA 4I8KA 2CHAB 4UE7H 1DM4B 1K1PA 2BY6X 2Z3CA 5CHAC 2ZPSA 1P2IA 1A3EH 3SNCA 1G32B 1ELTA 1C4U2 1S84A 1TBQH 2ILNA 1QL9A 4IBLH 1O5FH 4NFFA 2JH5D 1G36A 4R8TB 3U9AH 1CA8B 3GY2A 3FP6E 4H4FA 3TK9A 1C2MA 1DVAH 3RLWH 4Q7XA 3AW1A 1O39A 2Z3DA 1ID5H 1D3TB 2V35A 3MH6A 1GI0A 3ZV8A 2F9UA 3SI4H 1WV7H 3F68H 1GDQA 2F9PA 1SLVB 1GBMA 1C1MA 3SW2B 1C1WH 4VGCB 2BD7A 2G55A 1EZSC 2G81E 4CBNA 3RXIA 1QRZA 1TIOA 1AIXH 4OS7A 2PWXA 4O03A 1PYTD 1O2RA 1G3EA 2W7UA 1QQ4A 1GI5A 2P3UB 3LONA 1MQ6A 1GMCG 1PYTC 2QCYA 5EQSA 4MVNA 2WYJA 2BZ6H 2VVUA 1FONA 3A86A 2B0FA 1Z1JA 1FPHH 1OXGA 1DX5M 1O3OA 1GMDF 1S81A 2G8TA 3RMOH 1EOJA 3LH3A 1XUGA 3MI4A 1GL0E 3HATH 1TA2A 4K1EA 1E38B 1FY3A 1N6XA 3ZYDA 4GVUA 1AB9C 1SHYA 2WV4A 3E1XB 2CHAC 6ESTA 4X6OA 1BB0B 2VWMA 2C8WB 1GMHF 3F1SB 1BJVA 1XUIA 2H5CA 5EODA 3PLBA 1Z1IA 1AHTH 3SV6A 1ZHPA 2FX4A 1V3XA 1SGEE 2QV1A 1E35B 1GHWH 4YOIA 2PR3A 3BSQA 3MYWA 1AN1E 1SFQB 2A4RA 4BTTB 3RU4E 1PFXC 9ESTA 2PFEA 1LPZB 5FHTA 4JCNA 1T8NA 1HXEH 1T8MA 4Q80A 1CO7E 5A0BA 4VGCC 3A7ZA 1WOFA 2J95A 1ABIH 4HI3A 3RXPA 1GI1A 1HAVB 4Y76A 1JIRA 1UVOA 1FXYA 1N1LA 4Y8YA 1IQEA 5JDUB 1W13U 3UNSA 1Y5AT 2ZFRH 1GBHA 3DT0H 1EQ9A 5LPEA 4A5TS 1E34B 2DUCA 1SHHB 2Z9LA 3LC3A 1Z8RA 1C5ZB 3E90B