3VEQB

A binary complex betwwen bovine pancreatic trypsin and a engineered mutant trypsin inhibitor
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASVSLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCAGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Role of remote scaffolding residues in the inhibitory loop pre-organization, flexibility, rigidification and enzyme inhibition of serine protease inhibitors
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 52
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2012-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3veqB01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3veqB02
4Q7XA 2W26A 1NY22 5L6NH 1X7AC 1KXEA 1DX5M 3L3TA 1P2IA 2QIQA 1G3CA 1W7GH 1RIWB 1UVSH 4JYUH 1SB1H 2VH6A 3GCTF 3A87A 4D9RA 1EAUA 4GCHF 1ZMJA 1VGCB 3PV4A 1P2OA 1HBTH 5C2ZA 2OBOA 1D6RA 1GHYH 1O2HA 2Y5GA 5HGGA 1C4V2 3STJA 2VWOA 1C5LH 3RM0H 2BM2A 4MNXA 4CRFA 3S7HB 3MU5A 3ZVGA 2ZPSA 4X2VA 1IQGA 4Y8XA 3SBKA 2V0BA 1GCTC 3T62A 3FP8E 1ZSLA 3SUDA 4WXVA 2VH0A 2FEQH 2BDBA 2R3YA 2UUKB 2ZG0H 4OS4A 2FOMB 1GHAG 3QTVH 1XXDA 2GKVE 2AS9A 3KNXA 2XBXA 2ZI2H 1OKXA 4WF8A 3I77A 3LOXA 4ZHMU 4NSVA 1V2RT 3ATWA 2ANYA 4YT6H 5EQRA 3TH3H 2BDGA 4TPYA 4B2CA 1V2TT 3P8GA 3OY5U 2QY0B 3A8CA 2ZGCA 1P03A 3LC5A 2SNWA 1ZLRA 5T6FA 3RXHA 4X1PU 2P3UB 3BTTE 2PUQH 1IQHA 3V12A 2HRVA 2WYGA 3AASA 3DUXH 3IG6B 4BXSA 1F0TA 4AG1A 4JZDH 2SGPE 1FNIA 2HPQH 4JK6A 2WPLS 4BTUB 3NXPA 2FLBH 3RXAA 1HJ8A 1TLDA 4GHQA 4O3UA 1OYQA 3O8DA 3PLKA 1KTSB 3GDUA 2VIOA 5I25A 4CBNA 1YKTA 2FI3E 1RFNA 3UR6A 1WUNH 2FM2A 1DS2E 3ENSB 4NCYA 1H9LB 3GY7A 4A1XA 4AN7A 1SFIA 1DOJA 2ZO3H 2GD4B 2ZCKP 4JMYA 3BF6H 3TK6A 1YPLH 2GDEH 4IMQA 5TJXA 1ABIH 1MAXA 4F49A 2O8LA 4DURA 3UUZA 4LZ4B 4K3JA 1Z1JA 2OCVB 4DW2U 2QGRA 1AI8H 1ZJKA 1O2UA 3SQEE 3O8CA 1L4DA 2ZFTA 1GWAA 3CENA 3NCLA 1ANEA 1UMAH 5F6MA 1MKWK 1ACBE 2ULLA 4GCHG 2UUYA 2ZU5A 2IPHA 3SV8A 4ABAA 1T8NA 1C5OH 2A7HA 1Z71A 1FIZA 2UWLA 2R0KA 1FJSA 1C2IA 2ALVA 2CXVA 1H8DH 2PTNA 1C1PA 1KXBA 2Y6TA 2BD2A 1CA8B 4NA7A 3T26A 1C1WH 1FPHH 2BHGA 1GI6A 2IOTA 3UR9A 2VVVA 1BT7A 2XWAA 1L1NA 2TGPZ 1KXAA 1NZQH 2UWPA 5C5NA 4WXIA 1T32A 1MKWH 1YCPK 2ZFPH 4BANB 1C1SA 1LMWB 1VCQA 5FHTA 1O32A 2Z7FE 1CHOF 1GI7B 1BHXB 1MUEB 2D1JA 1P9UA 1E38B 1GBEA 5LPRA 2XBYA 5GIBA 1HXEH 2Y7XA 4OGXA 1C1VH 2P8OB 1O2ZA 1THSH 4ISLA 1C5XB 1MTSA 1LHCH 4I33A 5EQQA 2FOHA 1ZJDA 5DK1A 4IS5A 1LVOA 3QZRA 2VGCC 4ZXXH 1TX7A 4FUEA 4KTCA 1TQ0B 1XUGA 4MPVA 3PMAB 1BMAA 3JZ2B 2AMDA 1GJ8B 4GVUA 4LK4A 2XYAA 1DM4B 1NT1A 2CHAB 4U32A 4DVAU 1D9IA 1O5DH 1O5FH 2CV3A 2UWOA 5DKMA 4ASHA 1NTPA 2ZNKH 3QN7A 1AD8H 1OS8A 2P93A 5FX6A 1H9HE 1EAXA 2FZZA 2QXHA 3ZZ7A 3DHKH 1EQ9A 1F92A 1XUKA 2O8WA 1O3IA 3LGUA 1AO5A 2XXLA 4XBDA 1JOUB 3EA9A 1SGTA 5E0JA 1V2OT 4TWWA 4FVBA 3M5OA 1O3PB 3KL6A 2J92A 1YYY1 5A0AE 3VXFH 1KLTA 4VGCB 2GT7A 1NRNH 3I78A 2FI5E 5E2PA 4WVPE 4ZAEA 5EU8A 2XC0A 2R0LA 3DD2H 3MH6A 1Z8GA 2GGVB 2NU0E 1TA6A 3GDVA 2NU3E 1BBRK 2ZDKA 2Y5FA 4YM9A 1DPOA 2ASUB 1IQNA 4RKJB 4RKOB 2A0QB 3UREA 1MD7A 3MH7A 2BY8X 3EQ0H 3GCHC 4X2WA 4O03A 3IITA 1B7XB 5F03A 3TVJB 5C1XA 1UHBA 4E7RG 2G81E 1L1JA 1JWTA 3CS7A 3Q3YA 1BMNH 2XCFA 4FUBA 4X8UH 4U01A 4RSPA 1XXFA 1V2NT 4H6SB 2GP9B 2JETC 3QDZB 3U98H 1L4ZA 4TY7A 1GCTB 3MH4A 5IDKA 1CHGA 1SLXB 2EI7A 4D8NA 1HUTH 1WV7H 2QA9E 1YPEH 2OC1A 2J95A 4IC5A 1WOFA 1CHOG 3RM2H 1LHGH 4DY7B 4K2YA 1B5GH 2SGEE 3K6YA 5FBEA 4WH6A 1NN6A 1VJ9U 1HAHH 2XBVA 1C5UA 1TGNA 3OTJE 2XTTB 1TPOA 4SGBE 2VVCA 1AMHA 1SLUB 1C5YB 1EZUC 1UTKA 1QA7A 1DLKB 3NZIA 1NPMA 1O3MA 4DIIH 1AWFH 4HGCA 4UFGH 1K1JA 1BMMH 5ETXA 3VPKA 1P06A 2ZECA 3A7WA 1EPTA 3BTKE 3P95A 1MH0A 2FESH 5LH8A 2W3KA 4KKDA 3TGJE 2BD5A 1CBWC 3SHCH 1PJPA 2TGAA 1YPMH 4FUFA 5T6GA 2C93B 1KLIH 5K7RA 1HJAB 3S9AA 3SGBE 2G4TA 1ETTH 3SJIA 4CRCA 2PWXA 1KXCA 1GJ4H 2A7CA 3EAJA 1YF4A 2BY7X 1FMGA 3AAVA 1S0QA 1ELAA 4ZKRU 1C5VA 3VFEA 1QJ1B 1J15A 1O2NA 3KEEA 1KXDA 1ZMLA 4K8YA 3R3GB 1L1GA 3S0NA 4I31A 4ISIH 3TLOA 4DOQA 2WPIS 1XVOA 3HK3B 3QLPH 1BJVA 4AB8A 1EUFA 1SBWA 1XUIA 3GY8A 3FAOA 4YLUA 4UONA 3DFJA 1T31A 3D23A 3T2NA 5GWZA 2VIVA 1Y3VA 1QQ4A 2GT8A 3LJJA 4H4FA 2SNVA 3LDXH 1BRBE 5AFYH 3RXRA 5JDUB 5J4SA 3RC6A 4BNRA 4WH8A 4FU9A 1J14A 2G55A 2P3TB 1SR5C 5EXLA 1WSSH 3SORA 5FAHA 2GZ9A 2ZF0H 4DT7B 2Z9LA 1KDQB 3VXEH 1ZZZA 1TFXA 4TPIZ 4INKA 1UVUH 2H5DA 1LVMA 4KP0A 3EDXB 1F7ZA 3D49H 2UUJB 2VU8E 1GMCF 1CU1A 1YPGH 1NESE 1HXFH 1JRTA 2CMYA 2SFAA 4J1YA 4MDSA 3ZZ5A 4CHAC 2FTMA 1LKAA 3VB3A 1B0EA 2I6QA 5FPTA 4AFSA 1BRAA 2J94A 3ZZBA 1HLTH 2O9QA 1O37A 2ZHWH 4X1SU 5GJ4B 4NIYA 1P12E 1LCYA 4IGDA 1G2LA 1SGPE 3PMHB 1P57B 1VJAU 1CT4E 3LKWA 3BIUH 3A81A 4DGJA 2OP9A 2CGAA 3TH2H 1DUAA 1TNLA 3MU0A 1GBIA 3GY5A 3N7OA 3TNTA 4JK5A 3TPIZ 2ZCHP 3A7YA 3GICB 1FIWA 4CREA 4AORA 3E90B 1GHBF 3M61U 2F91A 3P70B 3PTNA 2Y80A 3SJ8A 3A7TA 2WPKS 1ZOMA 3L33A 3OYPA 1N6YA 3ZZ9A 2R9PA 3HKIB 1ZPBA 1BTXA 1GI5A 1C1OA 1C9PA 1YPKH 3LGTA 1O2YA 1TRYA 4ZKNU 1TAWA 2YNBA 1DXPA 2BY5X 4XOJA 1HAZB 1QL7A 4JYVH 1AGJA 2B8OH 1UTMA 3LGWA 4UFDH 1JIMA 4IW4E 1TMBH 1AZZA 1Y3XA 3QK1A 1Z6EA 3BTQE 1HAVA 3MU1A 3W95A 1S6HA 1GL1A 4MG3A 3OX7U 1V2WT 4X2XA 1HV7A 3S69A 1QBOA 2H2ZA 3GCHB 2P59A 2HVXA 5JBAS 1SGFA 4I7YH 2BVXH 2J2UA 4FUDA 5K0HA 3TJUA 3MNBA 3NK8A 2BXTH 3P17H 1DWEH 2J9NA 3RXKA 4THNH 1GG6C 1BUIA 1Y3YA 1PQ5A 1TB6H 1NM6A 3M7UA 3SJKA 2JETB 5EXMA 1DWBH 1GBTA 1C5NH 1MQ5A 2J38A 1TBZH 1NFXA 1SGYE 3GYMA 3PMJA 1K1NA 4YESB 4ABDA 4OS7A 1MCTA 1YGCH 3GY2A 4GPGA 1EP6A 1GMCG 2V3OH 3GYLB 3BTDE 4HFPB 2ZHFH 1EAIA 5AF9H 1GBCA 3ATIA 1UVPA 1W0ZU 4AFZA 1OOKB 3BEFB 3RC5A 1O3DA 1SQOA 1TIOA 4UFFH 4ZH8A 2ZQ2A 3ODDA 5HM2A 1GI2A 1SHHB 1ZSJA 1G3EA 3Q3KA 1TGSZ 3RXFA 1ELGA 4X8SH 3UQVA 3BSQA 3ZVEA 1W10U 5BRRE 1EASA 1P11E 2FYRA 3VEQB 1MZDA 2EEKA 4Y7BA 2STBE 1RTKA 4FUHA 1SSXA 1BA8B 2G5VA 4TYDA 1QB9A 1MQ6A 4JZFH 2VIWA 1GHBG 1BZXE 1CBWB 2BD4A 3SOSA 1O3OA 2OXSA 1GMDG 1VITH 3A85A 4OS1A 1BB0B 2B9LA 1V2UT 1O2QA 1GBJA 3QX5H 2ZIQH 1LQEA 3B8JA 2WV4A 1VCPA 1C2HA 1EKBB 1TNJA 1YPHE 5FX5A 1HAXB 1J9CH 5DP6A 4UFEH 3SJOA 3E91A 4LZ1H 3SZNA 1KYNA 2AIPA 1YPJH 1TNIA 5GCHF 2VIDA 1N6XA 1O2XA 1O3GA 1Q2WA 5JBCS 3MMGA 1G9IE 2VVUA 4BAHB 1D4PB 3MYWA 3I29A 4GAWA 1GI1A 2F9BH 2FOAA 1MAYA 4ESTE 1RS0A 3ZZ3A 1HJ9A 1XUFA 2AYWA 5B6OA 1TX6A 1F5LA 2WPJS 7ESTE 2EI6A 2Z94A 2A4GA 1TMTH 1W2KH 1O35A 2OUAA 1LQDB 2FTLE 4ABFA 4O97A 2BQWB 3ZVCA 1GJBB 1OWDA 1KXFA 1DANH 3GCOA 2HWLB 1DT2A 4HZHA 1E35B 3RXJA 4BOHA 1OYTH 3LIWA 1T8OA 3SV2H 1T4VH 3T28A 1XMNB 1SFQB 3BN9A 2AERH 2RA3A 7GCHG 4CHAB 1HB0B 3U9AH 1EATA 1UCYK 3A80A 1MD8A 3RLYH 5CMXH 2WUBA 4ABHA 1BTWA 1G2MA 2FIRH 3AW0A 4WJG2 1V6DA 3W94A 3SU1A 3BEUA 3RXTA 1QGFA 4Y7AA 1RTLA 1CT0E 1HIAA 2GZ7A 3LGYA 1ESAA 1TRNA 2C8ZB 1A5GH 1ANDA 1IQLA 4U2WA 5F8XA 3NPSA 1AUTC 1Z1IA 1CGJE 2ZCLP 1FQ3A 1BTPA 4O9VA 3MU4A 2ZU2A 1UTNA 1SI5H 2FO9A 1WQSA 2CF9H 5DP8A 1GJ9B 3M5LA 1F5KU 1O2PA 2SGAA 1P05A 1Y3WA 2ZKSA 2VIPA 1CE5A 1GMHF 4Y71A 1FDPA 1C2FA 1AWHB 2ZU3A 1ANBA 5SGAE 2ZFSA 1RGQA 2BTCE 1EB1H 3SU3A 2A32A 2BDAA 2YNAA 1EB2A 4YTAA 3KN2A 4RN6A 1VR1H 3RXGA 1IQJA 3ZVAA 3V7TA 1S83A 3C27B 1P9SA 1S84A 2QF0A 1C2EA 1HDTH 3E16B 2PSYA 3BIVH 3KQBA 1SPJA 1G37A 3GCTG 2YOLA 2BX4A 3BTHE 1AVWA 5GCHG 1ARCA 3MO3A 1GDQA 1MTVA 1A5IA 3RXSA 4ABGA 1A0JA 2BX3A 3VB6A 2XWBI 3QZQA 2ZGBH 2ZGJA 2ZWLH 2BDIA 1XUJA 1HAIH 1INCA 4FUGA 2A2QH 4MNVA 1AHTH 1SQTA 5FCRA 2C8WB 4K69A 1SGEE 1FY5A 3FANA 1OWHA 1MU8B 9ESTA 1EZXC 1LPGB 5JYIA 3BG8A 3DA9B 3UFAA 2Y81A 1UJ1A 4MPXA 1OWEA 1Y8TA 3RMMH 1OP8A 2BLQA 2FOCA 1RJXB 3SGAE 4YT7H 1E36B 1FI8A 3QGJA 5FCKA 1W13U 4AX9H 3SGQE 2PKAB 3BTGE 4A5TS 1NRSH 2STAE 5EPNA 4BTIB 2IN2A 4B73A 4NSYA 4X6OA 2WYJA 5GPIB 5FPYA 3RXEA 2BB4A 1WU1A 3GDSA 3SU5A 4AG2A 5DP9A 1BRCE 2P94A 1QFKH 1ZR0A 1Y5UT 2Q6GA 3TU7H 2A4QA 3M35A 1YCPH 1DITH 4DJZB 3B23B 2ZDLA 5HMAA 5C67A 2B7DH 2PFEA 1C1TA 3QTOH 2VIQA 4FUJA 3M3TA 4OS6A 1HFDA 3CP7A 4IN2A 3ATKA 1ZTKA 3LC3A 3TJVA 1ANCA 3MHWU 1ZPCA 3QGNB 4CRDA 1DSTA 1O2OA 4D76A 5CHAB 5AVDA 2Q6DA 1GMHG 4Y79A 1XVMA 4YOGA 2M5TA 2OQ5A 3G01A 2DUCA 1AQ7A 5EG4A 1TNKA 1WBGB 4Y6DA 3P6ZB 1O2MA 2LPRA 4B71A 1PYTC 1V2PT 2XRCA 4UD9H 4DCDA 1P2JA 1C1NA 1JXPA 1UK2A 1ZTJA 1PPBH 1UVTH 1O3HA 3LGVA 3RXBA 2FX6A 2TPIZ 4B1TA 1QB1A 2FYQA 1C2LA 1XX9A 4MVNA 3A7ZA 2QAAA 1HRTH 1K1OA 2ZP0H 5JPMH 1QJ6B 4JYTA 4AZ2B 3BEIB 1O2SA 4FU8A 1TPPA 3FZDA 2HGTH 2BD8A 2ZFFH 2C8YB 3OSYA 5I46H 1GI9B 2HOBA 2GZ8A 1EP5A 1N8OC 3S9CA 2ODQA 3Q76A 4XBBA 3LGIA 1BBRH 3A86A 2Z3DA 3HGPA 1GVZA 4D9QA 1FY3A 1M9UA 2NU4E 1T8LA 1PPGE 1XKBC 5C1UA 1GJ5H 1H8IH 4E7NA 1GJ6A 2C4FH 3ITIA 1ORFA 1O5EH 1O5AB 1B0FA 1O2WA 1EOLA 2BLOA 1TPSA 3EE0B 2O8MA 3TGIE 1K1PA 1C1QA 3GOVB 1EXFA 2AFQB 5EPYA 1P02A 1GJDB 1AUJA 1SGNE 3AAUA 1MCVA 2QXJA 1C5PA 5AFZH 3KQDA 4FU7A 1H4WA 3KIDU 1WTGH 1YLCA 3KGPA 1W3CA 1QNJA 1PQ8A 2ESTE 4ABEA 1QB6A 1G3DA 1V2MT 2BZAA 2OTVA 2PGBB 2QCYA 3HK6B 4KTUA 1UTJA 4CRBA 3H7OA 1QA0A 1YCPM 2FP7B 3L6PA 2XC4A 1A3EH 2PR3A 4D7FA 2H6MA 1Z8IB 3V0XA 2TRMA 3BTME 1ZMNA 4BTTB 4XE4A 5DGJA 3UOUA 1MTWA 4NG9H 1O5BB 2A1DB 2ZPQA 1ELCA 1TOCB 4Y0ZE 4Y8ZA 1HYLA 1V2JT 5L30H 1V2VT 1AE8H 3ZZ8A 3ZZCA 3E0NB 3M5MA 1D6WA 2XBWA 3JZ1B 5CE1A 1VITF 2BOKA 1UTQA 1SC8U 1MBQA 3FP6E 3SUEA 1O2LA 1A61H 2Q6FA 1LHEH 1A5HA 1MTNC 4WY3A 1GBBA 1WTHD 1AB9C 2UUFB 6GCHF 2G8TA 3TGKE 1GBAA 7KMEH 3EA8A 2ANMH 2H1UA 3F9FA 3M37A 4AYYB 2JH6D 1GHWH 3RU4T 8ESTE 1NFUA 1O2GH 4XFQA 4NIVA 1DWDH 5HXFA 4M7GA 2F83A 3URDA 3E3TA 2NWNA 1O3KA 1O2RA 1J16A 2Z9GA 5F8TA 4ZXYH 3PWBA 2Z3CA 2WUCA 3V13A 1RXPA 1F5RA 5L2ZH 1C2JA 1BCUH 2H9HA 1OWKA 2GCHF 3PWCA 2A45B 5EQSA 4AGKA 1AIXH 4Q80A 2ZQ1A 1ELTA 4MPWA 3RXIA 3ZYDA 1SGFG 1Y3UA 4X0WU 8GCHF 2Y5HA 4NA9H 1UTOA 4YZUA 1MZAA 1QR3E 4WMEA 2P95A 1CGIE 2VGCB 1EPTC 2FOEA 3OU0A 2ILNA 1GBFA 2ZTXA 1HAPH 1P0SH 1EJAA 2HPPH 1DXWA 1A0HB 4AOQA 3RXLA 1FAXA 5EODA 1GI0A 3S7KB 2SGFE 4WMFA 2TIOA 3EA7A 2HNTE 2FODA 2V6NA 1IAUA 4DIHH 1QHRB 2OQUA 1AFQC 2FOBA 1S81A 1LO6A 1OXGA 3SQHE 2ZDAH 2Z9KA 3SUGA 4B2AA 2BZ6H 2W7SA 1GVKB 1Y59T 1ZGVA 1K21H 5FPSA 3PLPA 1S85A 3UIRA 3VGCC 5TCAA 1P8VC 3PMBB 1QRWA 3TJNA 1ID5H 2NU1E 1BTYA 1VITG 4NFFA 2CJIA 5DP7A 5FXLA 1HAOH 1OPHB 1SL3A 3RDZA 6CHAC 1QBNA 4K8BA 1JIRA 1TBRH 1TYNA 4ABIA 3A82A 3M3SA 3F68H 1FZZA 4JZIA 3P8NA 4ZKOU 1C5RA 3FP7E 5A2MH 1MKXK 4MNWA 3GISB 3A7VA 1LPKB 3PM3A 4ABJA 2TBSA 6GCHG 3Q77A 2VJ1A 3U1IB 1F0UA 3RXOA 1JMOH 3TNSA 1QIXB 1P2KA 1QTFA 2PW8H 3ZYEA 5C1YA 1OP2A 1L2EA 4F4OC 4ZKSU 1ZHMA 3F9GA 2ZHEH 1BQYA 2FLRH 5PTPA 2ZFRH 2BVRH 2D8WA 4AYVB 2PKSC 2WPHS 3GY4A 4YOIA 4AFQA 2AGGX 5TCCA 1K1LA 1QL9A 1GGDC 2QN5T 1G30B 2BYAX 2LNCA 1SQAA 3K65B 8KME2 3RUOA 1GHAF 1TOMH 2A5IA 5EXNA 1FONA 1ZRKA 3P92A 1DVAH 3RMOH 2F9UA 5H4IB 3QWCH 3M36A 1PPCE 1SLVB 5A0BA 2BDHA 3UNQA 4R8TB 2WPMS 1QJ7B 2ZEBA 1KTTB 2BD9A 2FS8A 1EOJA 5A8ZA 2GV6A 3A89A 5HYOA 1S82A 1FN6A 3GCNA 3A84A 2ZPRA 3PYHA 1QBVH 1DY9A 1OWJA 3DT0H 4KTSA 1YM0A 4X8VH 1PPHE 2BD3A 3ESTA 3GY6A 3PO1C 2A5AA 1LDTT 1SGRE 3ATMA 3SNDA 4B2BA 1FLEE 4INHA 1V2ST 2RCEA 4WMDA 8LPRA 2AH4X 2OC8A 2AMQA 3LH1A 1GHXH 4JZEH 3RXPA 4I32A 3Q3XA 1T7CA 1E34B 1WAYB 3E0PB 2TGTA 2PTCE 1TRMA 3A8AA 1YP9A 1UHBB 1ZPZA 3SV6A 4X6PA 1C1RA 2B0FA 4XSKU 3F6UH 5DP4A 1FAKH 2I6SA 2BY6X 4IC6A 2OC7A 4H42U 2GDDA 1LKBA 1MTNB 3B9FH 2O8TA 1WCZA 1AB9B 1GPZA 1NRPH 3ZV8A 2A4RA 1TONA 3SNBA 2OBQA 3MNSA 5E0HA 4FVDA 2BOHB 1XKAC 2WV5A 4A1VA 4O3TA 4E06H 1QURH 3VB4A 1ZGIA 4CR9A 3RXVA 1IQEA 1OX1A 1ZYOA 1C2DA 3BTEE 1O2VA 2PLXA 1K9OE 1O39A 4NZQA 1Y5AT 3UWJH 1UCYE 1NO9H 4NIWA 1RRKA 3RXUA 4CRAA 4JZ1A 1NRQH 1SGQE 1P2NA 1GI8B 1KDQA 3PROA 1BRUP 1W0YH 3Q00A 4OS2A 1P3EA 2Z9JA 2OLGA 1UVOA 5EW2H 1GCDA 1QRZA 2ZFQH 1EPTB 1CSOE 3GY3A 3HPTB 3ELAH 1C1MA 3D62A 4INLA 5GXPA 1P3CA 1BIOA 1GL0E 2WINI 4I8JA 5T3HA 4NGAH 1UCYH 4Y11E 1P04A 3UNRA 4I8HA 1QL8A 1GI3A 1AFQB 3RU4D 5ESTE 2RDLA 4DG4A 1W8BH 3ZZAA 1O3LA 3A83A 1TPAE 5LGOA 1TE0A 1G36A 1HNEE 4ISNA 1HJAC 3PTBA 5JBTA 1O3BA 2EA3A 4SGAE 4LXBH 1V3XA 2ZU4A 3SU0A 3KF2A 1CA0C 2Z3EA 2OINA 3VGCB 4AGJA 1LPZB 2BD7A 1TBQH 1ETSH 2QF3A 2QC2A 4TY6A 2GCTC 1FY1A 1YPHC 1GJAB 1Y5BT 2THFB 2VINA 1KLJH 2ZDVH 4MPUA 6CHAB 3MWIU 3FVFB 1PQAA 1AZ8A 1O2KA 5G4BA 3H7TA 1CVWH 2BLWA 1PQ7A 1K1MA 4BAOB 1FXYA 1FY4A 1TGTA 4MTBA 5ABWA 3TJOA 1GJCB 1LHDH 1P09A 1XM1A 4IMZA 2F9VA 3U8TH 1O31A 1BMLA 1JBUH 1L0ZA 1G32B 1GG6B 4Q2KA 3T29A 3TIUA 1RD3B 1GVLA 1O33A 1IHTH 2FOGA 2AGEX 4CRGA 4K1TA 1SOZA 1SOTA 1IQKA 3O8BA 6ESTA 1C1UH 4ZROA 1QCPA 2B5TB 1KSNA 4Q7ZA 3MTYA 2ZGXH 3ZVFA 4B75A 4LOYH 6LPRA 1E0FD 1P01A 1UTLM 3BG4C 1ELDE 4IBLH 1N1LA 2PKSB 3EYDA 2FOFA 1G3BA 1PFXC 3SN8A 3KQEA 4TWYA 3ZZDA 3SUFA 1GGDB 5F8ZA 1ZRBA 1TALA 4I8KA 1S5SA 1WYKA 1E37B 5JB8S 7LPRA 3MH5A 1NU9A 5JBBS 1TGBA 4NZLA 5J4QA 3FFGA 3M3VA 2JH5D 3LU9B 2R2MB 3F9HA 2ZDNA 5EOKA 1BDAA 1FPCH 1OSSA 2GVFA 2TGDA 4HTCH 2J4IA 1Q3XA 2F9NA 3RXDA 1BTUA 3E8LA 1NS3A 3SI4H 3VB5A 4AFUA 3ZZ4A 2KAIB 3C1KA 1SVPA 2C8XB 2PSXA 4NWKA 3QUMP 4Z0KA 1C5MD 2DE9A 1ABJH 4CR5A 1A3BH 1IOEA 1C2GA 1U6QA 3ATLA 4CBOA 1O3NA 2A4OA 1ZHRA 3UWIA 1C5ZB 4YOJA 2FXRA 2HALA 3PO1B 1NC6A 2EC9H 3SNEA 1BHXF 3E6PH 4A1TA 2ANWA 2ODYB 2CF8H 1BBRE 3CS0A 4R0IA 3SNCA 5JB9S 1HAVB 3RXMA 4QT8C 1TQ7B 3A88A 4ZHLU 2Y7ZA 1IQFA 4ISOA 3K9XB 1UTPA 3BTWE 3E1XB 3HATH 4X2YA 2D2DA 2BDYA 4K1SA 2VWNA 4Y10E 3T25A 4KELA 3M5NA 4Y8YA 1DDJA 2VWLA 2RA0A 3UQOA 1O34A 3VB7A 1MTUA 1DICA 1MBMA 1V2LT 2R2WU 1EJMA 1V2KT 1GHVH 1FN8A 4BAMB 1C2MA 1W14U 3URCA 5C3NA 3P8FA 3NKKA 1BTHH 5BPEA 5DP3A 1UK4A 2P3FH 2HNTF 4ISHH 3U8RH 2PUXB 1NROH 3S9BA 2ANKH 4X1NU 1H1BA 2K1QA 3O8RA 4FXGH 4PROA 2QYIA 5A0CA 1A2CH 1AU8A 4BAQB 3SJ9A 3A8BA 3MOCA 2PV9B 1D3DB 3FZZA 2BQ6B 5DJ7A 1QY6A 1LVBA 1SGIB 1P2MA 1K28D 1AN1E 1DSUA 1C5TA 5ESBA 3K2UA 1AFEH 1NFWA 1BJUA 1AE5A 3UPEA 4A92A 4HI3A 2A7JA 2F9PA 1O3AA 1Z7KA 1C9TA 1TNGA 1C4U2 1ETRH 2W3IA 4Y76A 1K1IA 1SHYA 2VNTA 3MNCA 3V3MA 4CH2B 2H5CA 1W7XH 1AKSB 1FY8E 2VB0A 1O38A 5DPAA 4JCNA 4NFEA 1AVGH 1GHZA 1NRRH 1RTFB 2G4UA 4OS5A 3QO6A 3STIA 1KY9A 2FS9A 1EZSC 4ZUHA 2FPZA 2XW9A 4MQAA 1TA2A 3AW1A 2A31A 2BDCA 2ZGHA 1OWIA 3OY6U 3LH3A 2JKHA 3UTUH 1S0RA 2GMTC 1Z6JH 4D7GA 3UOPA 1GBLA 1W11U 1DE7H 1SGDE 1CT2E 2PGQB 1THRH 3RP2A 3TH4H 1ESBA 1NU7B 4NIXA 1OP0A 3UY9A 4ABBA 1CA0B 1DUEA 1D3PB 1PPZA 2J34A 1H9IE 1V2QT 1BITA 1ELVA 1K22H 4WWYA 2GCTB 1YBWA 2H9EH 3IWMA 4A7IB 1C2KA 3HKJB 5C5OA 4MNYA 1DLEA 4NA8A 1ELEE 2PHBA 3TITA 1RIWC 3MI4A 3MO6A 1K2I1 1QRXA 2C90B 2XCNA 3F1SB 3PB1E 3WY8A 2XC5A 1HCGA 2ALPA 2FI4E 3BTFE 3TK5A 1HPGA 5A09A 1C5SA 1EAWA 1Q31A 1VGCC 2BLVA 2G51A 1AVXA 4AB9A 1EX3A 4X1RU 2AIQA 4KGAA 3RXCA 1PYTD 3LT3A 1GBDA 4GSOA 1O2JA 1O3FA 3SU2A 1Z8JB 1F0SA 9LPRA 4YLQH 3U1JB 1C5QA 1VZQH 3P8OA 5L2YH 4H6TA 2AMPA 2JH0D 3LONA 4GHTA 5LPEA 3RMLH 3KHVA 1TWXB 4K1EA 4Q7YA 2QXIA 3BG4B 1D3QB 1FUJA 4GUXA 4YO9A 1GJ7B 2G52A 2ODPA 2XNIA 4BAKB 3SU6A 1O3EA 1O36A 1T8MA 1C5WB 2BMGB 2QXGA 3SW2B 1HGTH 1SLWB 3RU4E 1HIAB 3R0FA 3RMNH 2FMJA 1T4UH 2A5KA 5A8XA 1J17T 4B74A 3HGNA 5E2OA 2Y82A 1GDNA 1ZSKA 3T27A 1HAYB 1AY6H 2C3SA 1C4Y2 1P10A 2ZZUH 2VWMA 2PKAA 1TMUH 4GLYA 4B76A 1YC0A 1W12U 3M7QA 1VCWA 2SGQE 3KQCA 3U8OH 4UEHH 3M7TA 1MU6B 3DFLA 2ZU1A 4ZMAH 4CH8B 3SHAH 1ELFA 1S6FA 1CQQA 1KIGH 2SGDE 1F2SE 5LPFA 1IQMA 2RG3A 5C20A 2CN0H 3F9EA 2V35A 2ZHDA 2GV7A 1FV9A 1TABE 3RC4A 1DY8A 4FUIA 4X1QU 3ZVDA 3EGKH 1A7SA 3SV9A 5HM9A 2ZDMA 1IQIA 4ZHAA 2O8UA 2G5NA 1JRSA 2FDAA 2EI8A 2BVSH 1A4WH 1P2QA 1THPB 2KAIA 1EJNA 1GMDF 1BTZA 3MO9A 1WQVH 1O2TA 4X6MA 3SV7A 2BQ7B 5A8YA 2D26C 2A2XH 1HAGE 2G00A 1LHFH 2Z6BD 3RLWH 5GDSH 1YLDA 5E0GA 2H9TH 3ZVBA 4Y0YE 4FUCA 3TK9A 4XBCA 3ODFA 1ESTA 2P16A 4I8GA 1LVYA 1TGCA 4A6LA 5FBIA 2IJOB 1ARBA 3AVZA 5EGMA 1SGCA 4Z6AH 1ELBA 1DWCH 1N8OB 2GX4A 4J2YB 5IYTA 3H5CB 1ZTLA 1GBKA 3MNXA 3SI3H 1ZHPA 2BY9X 3PLBA 1MKXH 2GCHG 2ZA5A 3SNAA 1TNHA 1Z8RA 4UE7H 1O2IA 2BXUH 4MLFB 4IN1A 2W7UA 1A1RA 8GCHG 2DE8A 1O3JA 4E05H 4NWLA 4XDEA 2ZTYA 2GTBA 3U69H 5DP5A 3A7XA 1A0LA 2P8OC 2Z9IA 7GCHF 1LTOA 2OC0A 3D65E 1GBHA 4U30A 3SO3A 5EW1H 2Q1JA 5E8EH 1NFYA 1IHSH 3LJOA 2FX4A 3KCGH 1O5GH 4X8TH 1F0RA 1O30A 3ZZ6A 1BOQA 2ZHQH 1GBMA 2QV1A 2F3CE 1J8AA 2R3UA 5DO4H 4K5ZA 2CHAC 5T6DA 4UDWH 2ZC9H 3UNSA 3BV9B 3A8DA 2OD3B 3LPRA 2HLCA 4X6NA 1A46H 1PPFE 1PPEE 3SU4A 3RXQA 1SG8B 2HNTC 1XUHA 1TX8A 1EZQA 1MMJN 4OGYA 1O5CB 3MU8A 1AKSA 1UK3A 3T5FH 2W5EA 2GMTB 2FWWA 3NUMA 3NWUA 4K60A 2AEIH 5CHAC 2ZTZA 1CO7E 4I8LA 5AHGH 5DG6A 1GI4A 1UO6A 1O0DH 1DFPA 2NU2E 1CGHA 1O3CA 3MFJA 2AGIX 4VGCC 2F9OA 2V3HH 3K6ZA 3ZV9A 1GDUA 1SMFE 1QQUA 4BXWA 1D3TB
chains in the Genus database with same CATH superfamily
4Q7XA 2W26A 1NY22 5L6NH 1X7AC 1KXEA 1DX5M 3L3TA 1P2IA 2QIQA 1G3CA 1W7GH 1RIWB 1UVSH 4JYUH 2W6JD 1SB1H 2VH6A 3GCTF 3A87A 2LP6A 4D9RA 1EAUA 4GCHF 1ZMJA 1VGCB 3PV4A 1P2OA 1HBTH 4ACBA 5C2ZA 2OBOA 1D6RA 1GHYH 1O2HA 2Y5GA 5HGGA 3N7DA 1C4V2 3STJA 2VWOA 1C5LH 5GNDA 3RM0H 2BM2A 4MNXA 4CRFA 3S7HB 3MU5A 3ZVGA 4Z1MD 2ZPSA 4X2VA 1IQGA 4Y8XA 3SBKA 2V0BA 1GCTC 3T62A 3FP8E 1ZSLA 3SUDA 4WXVA 2VH0A 2FEQH 2XOKD 2BDBA 2R3YA 2UUKB 2ZG0H 2CK3D 4OS4A 2FOMB 1GHAG 3QTVH 1XXDA 2GKVE 2AS9A 3KNXA 2XBXA 2ZI2H 1OKXA 4WF8A 3I77A 3LOXA 4ZHMU 4NSVA 1V2RT 3KYGA 3ATWA 2ANYA 4YT6H 5EQRA 3TH3H 2BDGA 4TPYA 4B2CA 1V2TT 3P8GA 3OY5U 2QY0B 3A8CA 2ZGCA 1P03A 5KGOA 3LC5A 2SNWA 1ZLRA 5T6FA 3RXHA 4X1PU 2P3UB 3BTTE 2PUQH 1IQHA 3V12A 2HRVA 2WYGA 3AASA 3DUXH 3IG6B 4BXSA 1F0TA 4AG1A 4JZDH 2SGPE 1FNIA 2HPQH 4JK6A 5C94A 4YXWD 2WPLS 4BTUB 3NXPA 2FLBH 3RXAA 1HJ8A 1TLDA 4GHQA 4O3UA 1OYQA 3O8DA 3PLKA 1KTSB 5CDFE 3GDUA 2VIOA 5I25A 4CBNA 1YKTA 2FI3E 1RFNA 3UR6A 1WUNH 2FM2A 1DS2E 3ENSB 4NCYA 1H9LB 3GY7A 4A1XA 4AN7A 1SFIA 1DOJA 2ZO3H 2GD4B 2ZCKP 4JMYA 5KECA 3BF6H 3TK6A 1YPLH 2GDEH 4IMQA 2L6OA 5TJXA 1ABIH 1MAXA 4F49A 2O8LA 4DURA 3UUZA 4LZ4B 4K3JA 1Z1JA 2OCVB 4DW2U 2QGRA 1AI8H 1ZJKA 1O2UA 3SQEE 3O8CA 1L4DA 2ZFTA 1GWAA 1W0JD 3CENA 3NCLA 1UW7A 1ANEA 1UMAH 5F6MA 1MKWK 1ACBE 1SKYE 2ULLA 4GCHG 2UUYA 2ZU5A 2IPHA 3SV8A 4ABAA 1T8NA 1C5OH 2A7HA 1Z71A 1FIZA 2UWLA 2R0KA 1FJSA 1C2IA 2ALVA 2CXVA 1H8DH 2PTNA 1C1PA 1KXBA 2Y6TA 2BD2A 1CA8B 4NA7A 3T26A 1C1WH 1FPHH 2BHGA 1GI6A 2IOTA 3UR9A 2VVVA 1BT7A 2XWAA 3N99A 1L1NA 2TGPZ 1KXAA 1NZQH 2UWPA 5C5NA 4WXIA 1T32A 1MKWH 1YCPK 2ZFPH 4BANB 1C1SA 1LMWB 1VCQA 5FHTA 1O32A 2Z7FE 1CHOF 1GI7B 3U28C 1BHXB 1MUEB 2D1JA 1P9UA 1E38B 1GBEA 5LPRA 2XBYA 1YWUA 1HXEH 2JJ1D 5GIBA 2Y7XA 4OGXA 1C1VH 2P8OB 1O2ZA 1THSH 4ISLA 1C5XB 1MTSA 1LHCH 4I33A 5EQQA 2FOHA 1ZJDA 5DK1A 4IS5A 3DSGA 1LVOA 3QZRA 2VGCC 4ZXXH 1TX7A 4FUEA 4KTCA 1TQ0B 1XUGA 4MPVA 3PMAB 1BMAA 3JZ2B 2AMDA 1GJ8B 4GVUA 4LK4A 2XYAA 1DM4B 1NT1A 2CHAB 4U32A 4XD7D 4DVAU 1D9IA 1O5DH 1O5FH 2J5UA 2CV3A 2UWOA 5DKMA 4ASHA 1NTPA 2ZNKH 3QN7A 1AD8H 1OS8A 2P93A 5FX6A 1H9HE 1EAXA 2FZZA 2QXHA 3ZZ7A 3DHKH 1EQ9A 1F92A 1XUKA 2O8WA 1O3IA 3LGUA 1AO5A 2XXLA 4XBDA 1JOUB 3EA9A 1SGTA 5E0JA 1V2OT 4TWWA 4FVBA 3M5OA 1O3PB 3KL6A 2J92A 1YYY1 5A0AE 3VXFH 1KLTA 4VGCB 2GT7A 1NRNH 3I78A 3WW7A 2FI5E 5E2PA 4WVPE 3CNRA 4ZAEA 5EU8A 2XC0A 2R0LA 3DD2H 3MH6A 1Z8GA 2GGVB 2NU0E 1TA6A 3GDVA 2EQNA 2NU3E 1BBRK 2ZDKA 2Y5FA 4YM9A 1DPOA 2ASUB 1IQNA 2GJGA 4RKJB 4RKOB 2A0QB 3UREA 1MD7A 3MH7A 2BY8X 3EQ0H 3GCHC 3F2GA 4X2WA 4O03A 3IITA 1B7XB 5F03A 3TVJB 5C1XA 1UHBA 4E7RG 2G81E 1L1JA 1JWTA 3CS7A 3Q3YA 1BMNH 5EJLA 2XCFA 4FUBA 4X8UH 4U01A 4RSPA 1MABB 1V2NT 1XXFA 4H6SB 1H8ED 2GP9B 2JETC 3QDZB 3U98H 1L4ZA 4F55A 4TY7A 1GCTB 3MH4A 5IDKA 1CHGA 1SLXB 2EI7A 4D8NA 5EJ1A 1HUTH 1WV7H 2QA9E 1YPEH 2OC1A 2J95A 4IC5A 1WOFA 1CHOG 3RM2H 1LHGH 4DY7B 4K2YA 1B5GH 2SGEE 3K6YA 3PV5A 5FBEA 4WH6A 1NN6A 1VJ9U 1HAHH 2XBVA 1C5UA 1TGNA 3OTJE 2XTTB 1TPOA 2KFWA 2VVCA 1AMHA 4SGBE 1SLUB 1C5YB 1EZUC 1UTKA 2YMSC 1QA7A 1DLKB 3NZIA 1NPMA 1O3MA 4DIIH 1AWFH 3OEHD 4HGCA 4UFGH 1K1JA 1BMMH 5ETXA 3VPKA 1P06A 2ZECA 3A7WA 1EPTA 3BTKE 3P95A 1MH0A 2FESH 5LH8A 2W3KA 4KKDA 3TGJE 2BD5A 1CBWC 3SHCH 1PJPA 2TGAA 1YPMH 1KMHB 4FUFA 5T6GA 2C93B 1KLIH 5K7RA 1HJAB 3S9AA 3SGBE 2G4TA 1ETTH 3SJIA 4CRCA 2PWXA 1KXCA 1GJ4H 2A7CA 3EAJA 3VG8A 1YF4A 2BY7X 1FMGA 3AAVA 1S0QA 1ELAA 4ZKRU 1C5VA 3VFEA 1QJ1B 1J15A 1O2NA 3KEEA 1KXDA 1ZMLA 5HIYA 4K8YA 2LELA 3R3GB 1L1GA 3S0NA 4I31A 4ISIH 3TLOA 4DOQA 2WPIS 1XVOA 3HK3B 3QLPH 1BJVA 3FO8D 4AB8A 1EUFA 1SBWA 1XUIA 3GY8A 3FAOA 4YLUA 4UONA 2J98B 2JIZD 1T31A 3D23A 3DFJA 3T2NA 5GWZA 2VIVA 1Y3VA 1QQ4A 2GT8A 3LJJA 4H4FA 2SNVA 3LDXH 1BRBE 5AFYH 3RXRA 5JDUB 5J4SA 3RC6A 4BNRA 4WH8A 4FU9A 1E1RD 1J14A 2G55A 2P3TB 1SR5C 5EXLA 1WSSH 3SORA 5FAHA 2GZ9A 2ZF0H 4DT7B 2Z9LA 1KDQB 2IPQX 1ZZZA 3VXEH 1TFXA 4TPIZ 4INKA 1UVUH 2H5DA 1LVMA 4KP0A 3EDXB 1F7ZA 1OHHD 3D49H 2UUJB 2VU8E 1GMCF 1CU1A 1YPGH 1NESE 1HXFH 1JRTA 2CMYA 2SFAA 4J1YA 4MDSA 3ZZ5A 4CHAC 2FTMA 1LKAA 3VB3A 1B0EA 2I6QA 5FPTA 4AFSA 4ACAA 3EE7A 1BRAA 3OAAD 2J94A 3ZZBA 1HLTH 2O9QA 1O37A 2ZHWH 4X1SU 5GJ4B 4NIYA 1P12E 1LCYA 4IGDA 1G2LA 1SGPE 3PMHB 1P57B 1VJAU 1CT4E 3LKWA 3BIUH 3A81A 4DGJA 2OP9A 2CGAA 3TH2H 1DUAA 1TNLA 3MU0A 1GBIA 3GY5A 3N7OA 3TNTA 4JK5A 3TPIZ 2ZCHP 3A7YA 3GICB 1FIWA 4CREA 4AORA 3E90B 1GHBF 3M61U 3SZEA 2F91A 3P70B 3PTNA 2Y80A 3NRLA 3SJ8A 3A7TA 2WPKS 1ZOMA 3L33A 3OYPA 1N6YA 3ZZ9A 2R9PA 3HKIB 1ZPBA 4Q4LA 1BTXA 1GI5A 1C1OA 1C9PA 1YPKH 3LGTA 1O2YA 1TRYA 4ZKNU 1TAWA 2YNBA 1DXPA 2BY5X 4XOJA 1HAZB 1QL7A 5T1VA 4JYVH 1AGJA 2B8OH 1UTMA 3LGWA 4UFDH 1JIMA 4IW4E 1TMBH 1AZZA 1Y3XA 3QK1A 1Z6EA 3BTQE 1HAVA 3MU1A 3W95A 1S6HA 1GL1A 1WXRA 4MG3A 3OX7U 1V2WT 4X2XA 1HV7A 3S69A 1QBOA 3KQ5A 2H2ZA 3GCHB 2P59A 2HVXA 5JBAS 1SGFA 4I7YH 2BVXH 2J2UA 4FUDA 5K0HA 3TJUA 3MNBA 3NK8A 2BXTH 5DN6D 3P17H 1DWEH 2J9NA 3RXKA 4THNH 1GG6C 1BUIA 1Y3YA 1PQ5A 1TB6H 1NM6A 3M7UA 2KM0A 1E79D 3SJKA 2JETB 3N7EA 5EXMA 1DWBH 1SQRA 1GBTA 1C5NH 1MQ5A 2J38A 1TBZH 1NFXA 1SGYE 3GYMA 3PMJA 1K1NA 4YESB 4ABDA 4OS7A 1MCTA 1YGCH 3GY2A 4GPGA 1EP6A 1GMCG 2V3OH 3GYLB 3BTDE 4HFPB 2ZHFH 1EAIA 5AF9H 1GBCA 3ATIA 3SYJA 1UVPA 1W0ZU 4AFZA 1OOKB 3BEFB 3RC5A 1O3DA 1SQOA 1TIOA 4UFFH 4ZH8A 2ZQ2A 3ODDA 5FL7D 3DCLA 5HM2A 1GI2A 1SHHB 1ZSJA 2YMSB 1G3EA 3Q3KA 1TGSZ 2QE7D 3RXFA 1ELGA 4X8SH 3UQVA 3BSQA 3ZVEA 1W10U 5BRRE 1EASA 1P11E 2FYRA 3VEQB 1MZDA 2EEKA 4Y7BA 2STBE 1RTKA 4FUHA 1SSXA 1BA8B 2G5VA 4TYDA 1QB9A 1MQ6A 4JZFH 2VIWA 1GHBG 1BZXE 1CBWB 2QF4A 2BD4A 3SOSA 1O3OA 2OXSA 1GMDG 1VITH 3A85A 4OS1A 1BB0B 2B9LA 3ZIAD 4DT4A 1V2UT 1O2QA 1GBJA 3QX5H 2ZIQH 1LQEA 3B8JA 2WV4A 1VCPA 1C2HA 1EKBB 2KCPA 1TNJA 1YPHE 5FX5A 1HAXB 1J9CH 5DP6A 4UFEH 3SJOA 3E91A 4LZ1H 3SZNA 1KYNA 3W1EA 2AIPA 1YPJH 3DSOA 3KYFA 1TNIA 5GCHF 2VIDA 1N6XA 1O2XA 1O3GA 1Q2WA 5JBCS 3MMGA 1G9IE 2VVUA 4BAHB 1D4PB 3MYWA 3I29A 4GAWA 1GI1A 2F9BH 2FOAA 1MAYA 4ESTE 1RS0A 3ZZ3A 1HJ9A 1XUFA 2AYWA 5B6OA 1TX6A 1F5LA 2WPJS 7ESTE 2EI6A 2Z94A 2A4GA 1TMTH 1W2KH 1O35A 2OUAA 1LQDB 2FTLE 4ABFA 4O97A 2BQWB 3ZVCA 1GJBB 1OWDA 1KXFA 1DANH 3GCOA 2HWLB 1DT2A 4HZHA 1E35B 3RXJA 4BOHA 1OYTH 3LIWA 1T8OA 3SV2H 1T4VH 3T28A 1XMNB 1SFQB 3BN9A 2AERH 2RA3A 7GCHG 5C0TA 4CHAB 1HB0B 3U9AH 1EATA 1UCYK 3A80A 1MD8A 3RLYH 5CMXH 2WUBA 4ABHA 5CHBA 1BTWA 1G2MA 2FIRH 3AW0A 4WJG2 1V6DA 4M9FA 3W94A 3SU1A 3BEUA 3RXTA 1QGFA 2F4LA 4Y7AA 1RTLA 1CT0E 1HIAA 2GZ7A 3LGYA 1ESAA 1TRNA 2C8ZB 1A5GH 1ANDA 2WV9A 1IQLA 4U2WA 5F8XA 3NPSA 1AUTC 1Z1IA 1CGJE 2ZCLP 1FQ3A 5HKKD 1BTPA 4O9VA 3MU4A 2ZU2A 1UTNA 1SI5H 2FO9A 3WWFA 1WQSA 2CF9H 5DP8A 1GJ9B 3M5LA 1F5KU 1O2PA 2L74A 2SGAA 1P05A 1Y3WA 2ZKSA 2VIPA 1CE5A 1GMHF 4Y71A 1FDPA 1C2FA 1AWHB 2ZU3A 1ANBA 5SGAE 2ZFSA 1RGQA 2JJ2D 2BTCE 1EB1H 3SU3A 2A32A 2BDAA 2YNAA 1EB2A 4YTAA 3KN2A 4RN6A 1VR1H 3RXGA 1IQJA 3ZVAA 3V7TA 1S83A 3C27B 1P9SA 1S84A 2QF0A 1C2EA 1HDTH 3E16B 2PSYA 3BIVH 3KQBA 1SPJA 1G37A 3GCTG 2YOLA 2BX4A 3BTHE 1AVWA 5GCHG 1ARCA 3MO3A 1GDQA 1MTVA 1A5IA 3RXSA 4ABGA 1A0JA 2BX3A 3VB6A 2XWBI 3QZQA 2ZGBH 2ZGJA 2ZWLH 2BDIA 1XUJA 1HAIH 1INCA 4FUGA 2A2QH 4MNVA 1AHTH 1SQTA 5FCRA 2C8WB 4K69A 2M2AA 1SGEE 1FY5A 3FANA 1OWHA 1MU8B 9ESTA 1EZXC 1LPGB 5JYIA 3BG8A 3DA9B 3UFAA 2Y81A 1UJ1A 4MPXA 2KZ4A 1OWEA 1Y8TA 2PP6A 3RMMH 1OP8A 4XRNA 2BLQA 2FOCA 1RJXB 3SGAE 4YT7H 1E36B 1FI8A 3QGJA 4OM9A 5FCKA 1W13U 4AX9H 3SGQE 2PKAB 3BTGE 4A5TS 1NRSH 2STAE 5EPNA 4BTIB 2IN2A 4B73A 4NSYA 4X6OA 2WYJA 5GPIB 5FPYA 3RXEA 2BB4A 1WU1A 3GDSA 3SU5A 4AG2A 5DP9A 1BRCE 2P94A 1QFKH 1ZR0A 1Y5UT 2Q6GA 3TU7H 2A4QA 3M35A 4P00A 1YCPH 1DITH 5DSFA 4DJZB 3B23B 2ZDLA 5HMAA 5C67A 2B7DH 2PFEA 1C1TA 3QTOH 2VIQA 4P02A 4FUJA 3M3TA 4OS6A 1HFDA 2W6ID 3CP7A 4IN2A 3ATKA 1ZTKA 3LC3A 3TJVA 1ANCA 3MHWU 1ZPCA 3QGNB 4CRDA 1DSTA 1O2OA 4D76A 5CHAB 5AVDA 2Q6DA 1GMHG 4Y79A 1XVMA 4YOGA 2M5TA 2OQ5A 3G01A 2DUCA 1AQ7A 1VKYA 5EG4A 1TNKA 1WBGB 4Y6DA 3P6ZB 1O2MA 2LPRA 4B71A 1PYTC 1V2PT 2XRCA 4UD9H 4DCDA 1P2JA 1C1NA 1JXPA 1UK2A 1ZTJA 1PPBH 1UVTH 1O3HA 3LGVA 3RXBA 2FX6A 2TPIZ 4B1TA 1QB1A 2FYQA 1C2LA 2KCYA 1XX9A 4MVNA 3A7ZA 2QAAA 1HRTH 1K1OA 2ZP0H 5JPMH 1QJ6B 4JYTA 4AZ2B 3BEIB 5C17A 1O2SA 4FU8A 2K8IA 2V3MA 1TPPA 3FZDA 2HGTH 2BD8A 2ZFFH 2C8YB 3OSYA 3GS9A 5I46H 1GI9B 2HOBA 2GZ8A 1EP5A 1N8OC 3S9CA 2ODQA 3Q76A 4XBBA 3LGIA 1BBRH 3A86A 2Z3DA 3HGPA 1GVZA 1QZ8A 4D9QA 1FY3A 1M9UA 2NU4E 1T8LA 1PPGE 1XKBC 5C1UA 1GJ5H 1H8IH 4E7NA 1GJ6A 2C4FH 3ITIA 1ORFA 1O5EH 1O5AB 1B0FA 1O2WA 1EOLA 2BLOA 1TPSA 3EE0B 2O8MA 3TGIE 1K1PA 1C1QA 1YY3A 3GOVB 1EXFA 2AFQB 3H09A 5EPYA 1P02A 1GJDB 1AUJA 1SGNE 3AAUA 1MCVA 2QXJA 1C5PA 5AFZH 3KQDA 4FU7A 1H4WA 3KIDU 1WTGH 1YLCA 3KGPA 1W3CA 1QNJA 1PQ8A 2ESTE 4ABEA 1QB6A 1G3DA 1V2MT 2BZAA 2OTVA 2PGBB 2QCYA 3HK6B 4KTUA 1UTJA 4CRBA 3H7OA 4FOUC 1QA0A 1YCPM 2FP7B 3L6PA 1WDIA 2XC4A 1A3EH 2PR3A 4D7FA 2H6MA 3F2HA 1Z8IB 3V0XA 2TRMA 3BTME 1ZMNA 4BTTB 4XE4A 5DGJA 3UOUA 1MTWA 4NG9H 1O5BB 2A1DB 2ZPQA 1ELCA 1TOCB 4Y0ZE 4Y8ZA 1HYLA 1V2JT 5L30H 1V2VT 1AE8H 3ZZ8A 3ZZCA 5F53A 3E0NB 3M5MA 1D6WA 2XBWA 3JZ1B 5CE1A 1VITF 2BOKA 1UTQA 1SC8U 1MBQA 3FP6E 3SUEA 1O2LA 1A61H 2Q6FA 1LHEH 1A5HA 1MTNC 4WY3A 1GBBA 1WTHD 1AB9C 2UUFB 6GCHF 2G8TA 3TGKE 1GBAA 7KMEH 3EA8A 2ANMH 2H1UA 3F9FA 3M37A 4AYYB 2JH6D 1GHWH 3RU4T 8ESTE 1NFUA 1O2GH 4XFQA 4NIVA 1DWDH 5HXFA 4M7GA 2F83A 3URDA 3E3TA 2NWNA 1O3KA 1O2RA 1J16A 5EJZA 5HIZA 2Z9GA 3FOAA 5F8TA 4ZXYH 3PWBA 2Z3CA 2WUCA 3V13A 1RXPA 1F5RA 5L2ZH 1C2JA 1BCUH 2H9HA 1OWKA 2GCHF 3PWCA 4FETA 2A45B 5EQSA 4AGKA 1AIXH 4Q80A 2ZQ1A 1ELTA 4MPWA 3RXIA 3ZYDA 1SGFG 1Y3UA 4X0WU 8GCHF 2Y5HA 4NA9H 1UTOA 3F3BA 4YZUA 1MZAA 1QR3E 4WMEA 2P95A 4I86A 1CGIE 2VGCB 1EPTC 2FOEA 3OU0A 2ILNA 1GBFA 2ZTXA 1HAPH 1P0SH 1EJAA 2HPPH 1DXWA 1A0HB 2EY4C 4AOQA 3RXLA 1FAXA 5EODA 1GI0A 3S7KB 2SGFE 4WMFA 2TIOA 3EA7A 2HNTE 2FODA 2V6NA 2HLDD 1IAUA 2IJD1 2RFKC 4DIHH 1QHRB 2OQUA 1AFQC 2FOBA 1S81A 1LO6A 1OXGA 3SQHE 2ZDAH 2Z9KA 3OFND 3SUGA 4B2AA 2BZ6H 2W7SA 1GVKB 1Y59T 1ZGVA 1K21H 5FPSA 2YMSD 3PLPA 1S85A 3UB0A 3UIRA 3VGCC 5TCAA 1P8VC 3PMBB 1QRWA 3TJNA 1ID5H 2NU1E 1BTYA 1VITG 4NFFA 2CJIA 5DP7A 5FXLA 1HAOH 1OPHB 1SL3A 3RDZA 6CHAC 1QBNA 4K8BA 1JIRA 1TBRH 1TYNA 4ABIA 3A82A 3M3SA 3AK5A 3F68H 1FZZA 4JZIA 3P8NA 4ZKOU 1C5RA 3FP7E 5A2MH 1MKXK 4MNWA 3GISB 3A7VA 1LPKB 3PM3A 4ABJA 2TBSA 6GCHG 3Q77A 2VJ1A 3U1IB 1F0UA 3RXOA 3WWBA 1JMOH 3TNSA 1QIXB 1P2KA 1QTFA 2PW8H 3ZYEA 5C1YA 1OP2A 1L2EA 4F4OC 4ZKSU 1ZHMA 3F9GA 2ZHEH 1BQYA 2FLRH 5PTPA 2ZFRH 2BVRH 2QF5A 2D8WA 4AYVB 1S6LA 2PKSC 2WPHS 3GY4A 4YOIA 4AFQA 2AGGX 5TCCA 1K1LA 1QL9A 1GGDC 2QN5T 1G30B 2BYAX 2LNCA 1SQAA 3K65B 8KME2 3RUOA 1GHAF 1TOMH 2A5IA 5EXNA 1FONA 1ZRKA 3P92A 1DVAH 3RMOH 2JDID 2F9UA 5H4IB 3QWCH 3M36A 1PPCE 1SLVB 5A0BA 2XNDD 2BDHA 3UNQA 4R8TB 2WPMS 1QJ7B 2ZEBA 5IK2D 1KTTB 2BD9A 2FS8A 1EOJA 5A8ZA 2GV6A 3A89A 5HYOA 1S82A 1FN6A 3GCNA 4ZCNA 3A84A 2ZPRA 3PYHA 1QBVH 1DY9A 1OWJA 3DT0H 4KTSA 1YM0A 4X8VH 1PPHE 2BD3A 3ESTA 3GY6A 3PO1C 2A5AA 1LDTT 1SGRE 3ATMA 3SNDA 4B2BA 1FLEE 4INHA 1V2ST 1FX0B 2RCEA 4WMDA 8LPRA 2AH4X 2OC8A 2AMQA 3FKSD 3LH1A 1GHXH 4JZEH 3RXPA 4I32A 3Q3XA 1T7CA 1E34B 1WAYB 3E0PB 2TGTA 2PTCE 1NBMD 1TRMA 3A8AA 1YP9A 1UHBB 1ZPZA 3SV6A 1YLNA 4X6PA 1C1RA 2B0FA 4XSKU 3F6UH 4ASUD 5DP4A 1FAKH 2I6SA 2BY6X 4IC6A 2OC7A 4H42U 2GDDA 1LKBA 1MTNB 3B9FH 2O8TA 3OEED 1WCZA 1AB9B 4F48B 1GPZA 1NRPH 3ZV8A 2A4RA 1TONA 3SNBA 4TSFD 2OBQA 3MNSA 5E0HA 4FVDA 2BOHB 1XKAC 2WV5A 4A1VA 4O3TA 4E06H 1QURH 3VB4A 1ZGIA 4CR9A 2J98A 3RXVA 1IQEA 1OX1A 1ZYOA 1C2DA 3BTEE 1O2VA 2PLXA 1K9OE 1O39A 4NZQA 1Y5AT 3UWJH 1UCYE 4Q63A 1NO9H 4NIWA 1RRKA 3RXUA 4CRAA 4JZ1A 1NRQH 1SGQE 1P2NA 1GI8B 1KDQA 3PROA 1W0KD 1BRUP 1W0YH 3Q00A 4OS2A 1P3EA 3PV2A 2Z9JA 2OLGA 1UVOA 5EW2H 1GCDA 1QRZA 2ZFQH 1EPTB 1CSOE 3GY3A 3HPTB 3ELAH 1C1MA 3D62A 4INLA 5GXPA 1P3CA 1BIOA 1GL0E 2WINI 4I8JA 5T3HA 4NGAH 1UCYH 4Y11E 1P04A 3UNRA 3FN8A 4I8HA 1QL8A 1K0HA 1GI3A 1AFQB 3RU4D 5ESTE 2RDLA 2WSSD 1W8BH 3ZZAA 1O3LA 3A83A 4DG4A 1TPAE 5LGOA 1TE0A 1G36A 1HNEE 3PRBA 4ISNA 1HJAC 3PTBA 5JBTA 1O3BA 2EA3A 4SGAE 4LXBH 1V3XA 2ZU4A 3SU0A 3KF2A 1CA0C 2Z3EA 2OINA 3VGCB 4AGJA 1LPZB 2BD7A 1TBQH 1ETSH 2QF3A 2QC2A 4TY6A 2GCTC 1FY1A 1YPHC 1GJAB 1Y5BT 2THFB 2VINA 1KLJH 2ZDVH 4MPUA 6CHAB 3MWIU 3FVFB 1PQAA 1AZ8A 1O2KA 5G4BA 3H7TA 1CVWH 2BLWA 1PQ7A 1K1MA 4BAOB 1FXYA 1FY4A 1TGTA 4MTBA 5ABWA 3TJOA 1GJCB 1LHDH 1P09A 1XM1A 4IMZA 2F9VA 3U8TH 1O31A 1BMLA 1JBUH 1L0ZA 1G32B 1GG6B 4Q2KA 3T29A 3TIUA 1RD3B 1GVLA 1O33A 1IHTH 2FOGA 2AGEX 4CRGA 2KCOA 4K1TA 1SOZA 1SOTA 1IQKA 3O8BA 6ESTA 1C1UH 4ZROA 1QCPA 2B5TB 1KSNA 4Q7ZA 3MTYA 2ZGXH 3F0PA 3ZVFA 4LOYH 4B75A 6LPRA 1E0FD 1P01A 1UTLM 3BG4C 1COWD 1ELDE 4IBLH 1N1LA 2PKSB 3EYDA 2FOFA 5EIYA 1G3BA 1PFXC 3SN8A 3KQEA 4RT0A 4TWYA 3ZZDA 3SUFA 1GGDB 5F8ZA 1ZRBA 1TALA 2KX4A 1S5SA 1WYKA 1E37B 4I8KA 5JB8S 7LPRA 3MH5A 1NU9A 5JBBS 1TGBA 4NZLA 5J4QA 3FFGA 3M3VA 2JH5D 3PRDA 3LU9B 2R2MB 3F9HA 2ZDNA 5EOKA 1BDAA 2F43B 4RT1A 1FPCH 1OSSA 2GVFA 2TGDA 4HTCH 2J4IA 1Q3XA 2F9NA 3RXDA 1BTUA 3E8LA 1NS3A 3SI4H 3VB5A 4AFUA 3ZZ4A 2KAIB 3C1KA 1SVPA 2C8XB 2PSXA 4NWKA 3QUMP 4Z0KA 1C5MD 2DE9A 1ABJH 4CR5A 1A3BH 1IOEA 1C2GA 1U6QA 3ATLA 4CBOA 1O3NA 2A4OA 1ZHRA 2HVYB 3UWIA 3MQKC 1C5ZB 4YOJA 2FXRA 2HALA 3PO1B 1NC6A 2EC9H 3SNEA 1BHXF 3E6PH 4A1TA 2J97A 2ANWA 2ODYB 2CF8H 1BBRE 3CS0A 4R0IA 3SNCA 5JB9S 1HAVB 3RXMA 4QT8C 1TQ7B 3A88A 4ZHLU 2Y7ZA 1IQFA 1EFRD 4ISOA 3K9XB 1E1QD 1UTPA 3BTWE 3E1XB 3HATH 4X2YA 2D2DA 2BDYA 4K1SA 2VWNA 4Y10E 3T25A 4KELA 3M5NA 4Y8YA 1DDJA 2VWLA 2RA0A 3UQOA 1O34A 3VB7A 1MTUA 1DICA 1MBMA 1V2LT 2R2WU 1EJMA 1V2KT 1GHVH 1FN8A 4BAMB 1C2MA 1W14U 3URCA 5C3NA 3P8FA 3NKKA 1BTHH 5BPEA 2OK5A 5DP3A 1UK4A 2P3FH 2HNTF 4ISHH 3U8RH 2PUXB 1NROH 3S9BA 2ANKH 4X1NU 1H1BA 2K1QA 3O8RA 4FXGH 4PROA 2QYIA 5A0CA 4RI0A 1A2CH 1AU8A 4BAQB 3SJ9A 3A8BA 3MOCA 2PV9B 1D3DB 3FZZA 2BQ6B 5DJ7A 1QY6A 1LVBA 1SGIB 1P2MA 1K28D 1AN1E 1DSUA 1C5TA 5ESBA 3K2UA 1AFEH 1NFWA 1BJUA 1AE5A 3UPEA 4A92A 4HI3A 2A7JA 2F9PA 4AC9A 1O3AA 1Z7KA 1C9TA 1TNGA 1C4U2 1ETRH 2W3IA 4Y76A 1K1IA 1SHYA 2VNTA 3MNCA 3V3MA 4CH2B 1NBME 3F2FA 2H5CA 1W7XH 1AKSB 1FY8E 2VB0A 1O38A 5DPAA 4JCNA 4NFEA 1AVGH 1GHZA 1NRRH 1RTFB 2G4UA 4OS5A 3QO6A 3STIA 1KY9A 2FS9A 3OTPA 1EZSC 4ZUHA 2FPZA 2XW9A 4MQAA 1TA2A 3AW1A 2A31A 2BDCA 2ZGHA 1OWIA 3OY6U 3LH3A 2JKHA 3UTUH 2KR7A 1S0RA 2GMTC 1Z6JH 4D7GA 3UOPA 1GBLA 1W11U 1DE7H 1SGDE 1CT2E 2WPDD 2AHME 2PGQB 1THRH 3RP2A 3TH4H 1ESBA 1NU7B 4NIXA 1OP0A 3UY9A 4ABBA 1CA0B 1DUEA 1D3PB 1PPZA 2J34A 1H9IE 1V2QT 1BITA 1ELVA 1K22H 3F0OA 4WWYA 2GCTB 1YBWA 2H9EH 3IWMA 4A7IB 1C2KA 3HKJB 5C5OA 2WHXA 4MNYA 1DLEA 4NA8A 1ELEE 2PHBA 3TITA 1RIWC 3MI4A 3MO6A 1K2I1 1QRXA 2C90B 2XCNA 3F1SB 3PB1E 3WY8A 2XC5A 1HCGA 2ALPA 2FI4E 3BTFE 3TK5A 1HPGA 5A09A 1C5SA 1EAWA 1Q31A 1VGCC 2BLVA 2G51A 1AVXA 4AB9A 1EX3A 4X1RU 2AIQA 4KGAA 3RXCA 1PYTD 3LT3A 1GBDA 4GSOA 1O2JA 1O3FA 3SU2A 1Z8JB 1F0SA 9LPRA 4YLQH 3U1JB 1C5QA 1VZQH 3P8OA 5L2YH 4H6TA 2AMPA 2JH0D 3LONA 4GHTA 5LPEA 3RMLH 3KHVA 1TWXB 4K1EA 4Q7YA 2QXIA 3BG4B 1D3QB 1FUJA 4GUXA 4YO9A 1GJ7B 2G52A 2KCAA 2ODPA 2XNIA 3SU6A 4BAKB 1O3EA 1O36A 1T8MA 1C5WB 2BMGB 2QXGA 3SW2B 1H8HD 1HGTH 1SLWB 3RU4E 1HIAB 3R0FA 3RMNH 2FMJA 1T4UH 2A5KA 5A8XA 1J17T 4B74A 3HGNA 5E2OA 2Y82A 1GDNA 1ZSKA 3T27A 1HAYB 1AY6H 2C3SA 1C4Y2 1P10A 2ZZUH 2VWMA 2PKAA 1TMUH 4GLYA 4B76A 1YC0A 1W12U 3M7QA 1VCWA 3DSPA 2SGQE 3KQCA 3U8OH 4UEHH 3M7TA 1MU6B 3DFLA 2ZU1A 4ZMAH 4CH8B 2K0QA 1ELFA 1S6FA 3SHAH 1CQQA 1KIGH 2SGDE 1F2SE 3UAIC 1IQMA 2RG3A 5C20A 5LPFA 4TT3D 2CN0H 3F9EA 2V35A 2ZHDA 2GV7A 1FV9A 1TABE 3RC4A 5B6LA 1DY8A 4FUIA 4X1QU 3ZVDA 3EGKH 1A7SA 3SV9A 5HM9A 5C0UA 2ZDMA 1IQIA 4ZHAA 2O8UA 2G5NA 1JRSA 2FDAA 2EI8A 2BVSH 2V7QD 1A4WH 1P2QA 1THPB 2KAIA 1EJNA 1GMDF 1BTZA 3MO9A 1WQVH 1O2TA 4X6MA 4B6EA 3SV7A 2BQ7B 5A8YA 2D26C 2A2XH 1HAGE 2G00A 1LHFH 2Z6BD 3RLWH 5GDSH 1YLDA 5E0GA 2H9TH 3ZVBA 4Y0YE 4FUCA 3TK9A 4XBCA 3ODFA 2RDEA 1ESTA 2P16A 4I8GA 1LVYA 1TGCA 4A6LA 5FBIA 2IJOB 1ARBA 3AVZA 5EGMA 1SGCA 4Z6AH 1ELBA 1DWCH 1N8OB 2GX4A 4J2YB 5IYTA 3H5CB 1ZTLA 1GBKA 3MNXA 3SI3H 1ZHPA 2BY9X 5KEDA 3PLBA 1MKXH 2GCHG 2ZA5A 3SNAA 1TNHA 1Z8RA 4UE7H 1O2IA 2BXUH 4MLFB 4IN1A 2W7UA 1A1RA 8GCHG 2DE8A 1O3JA 4E05H 4NWLA 4XDEA 2ZTYA 2GTBA 3U69H 5DP5A 3A7XA 1A0LA 2P8OC 2Z9IA 7GCHF 1LTOA 2OC0A 3D65E 1GBHA 4U30A 3SO3A 5EW1H 2Q1JA 1BMFD 5E8EH 1NFYA 1IHSH 3LJOA 2FX4A 3KCGH 1O5GH 4X8TH 1F0RA 1O30A 3ZZ6A 1BOQA 2ZHQH 1GBMA 2QV1A 2F3CE 1J8AA 2R3UA 5DO4H 4K5ZA 2CHAC 5T6DA 4UDWH 2ZC9H 3UNSA 3BV9B 3A8DA 2OD3B 3LPRA 2HLCA 4X6NA 1A46H 1PPFE 1PPEE 3SU4A 3RXQA 1SG8B 2HNTC 1XUHA 1TX8A 1EZQA 1MMJN 4OGYA 1O5CB 3MU8A 3OE7D 1AKSA 1UK3A 3T5FH 2W5EA 2GMTB 2WZQA 2FWWA 3NUMA 3NWUA 4K60A 2AEIH 5CHAC 2VBCA 2ZTZA 1CO7E 4I8LA 5AHGH 5DG6A 1GI4A 1UO6A 1O0DH 1DFPA 2NU2E 1CGHA 1O3CA 3MFJA 2AGIX 4VGCC 2F9OA 2V3HH 3K6ZA 3ZV9A 1GDUA 1SMFE 1QQUA 4B6FA 4HG6A 4BXWA 1D3TB
chains in the Genus database with same CATH topology
4Q7XA 2W26A 1NY22 5L6NH 1X7AC 1KXEA 1DX5M 3L3TA 1P2IA 2QIQA 1G3CA 1W7GH 1RIWB 1UVSH 4JYUH 1SB1H 2VH6A 3GCTF 3A87A 4D9RA 1EAUA 4GCHF 1ZMJA 1VGCB 3PV4A 1P2OA 1HBTH 5C2ZA 2OBOA 1D6RA 1GHYH 1O2HA 2Y5GA 5HGGA 1C4V2 3STJA 2VWOA 1C5LH 3RM0H 2BM2A 4MNXA 4CRFA 3S7HB 3MU5A 3ZVGA 2ZPSA 4X2VA 1IQGA 4Y8XA 3SBKA 2V0BA 1GCTC 3T62A 3FP8E 1ZSLA 3SUDA 4WXVA 2VH0A 2FEQH 2BDBA 2R3YA 2UUKB 2ZG0H 4OS4A 2FOMB 1GHAG 3QTVH 1XXDA 2GKVE 2AS9A 3KNXA 2XBXA 2ZI2H 1OKXA 4WF8A 3I77A 3LOXA 4ZHMU 4NSVA 1V2RT 3ATWA 2ANYA 4YT6H 5EQRA 3TH3H 2BDGA 4TPYA 4B2CA 1V2TT 3P8GA 3OY5U 2QY0B 3A8CA 2ZGCA 1P03A 3LC5A 2SNWA 1ZLRA 5T6FA 3RXHA 4X1PU 2P3UB 3BTTE 2PUQH 1IQHA 3V12A 2HRVA 2WYGA 3AASA 3DUXH 3IG6B 4BXSA 1F0TA 4AG1A 4JZDH 2SGPE 1FNIA 2HPQH 4JK6A 2WPLS 4BTUB 3NXPA 2FLBH 3RXAA 1HJ8A 1TLDA 4GHQA 4O3UA 1OYQA 3O8DA 3PLKA 1KTSB 3GDUA 2VIOA 5I25A 4CBNA 1YKTA 2FI3E 1RFNA 3UR6A 1WUNH 2FM2A 1DS2E 3ENSB 4NCYA 1H9LB 3GY7A 4A1XA 4AN7A 1SFIA 1DOJA 2ZO3H 2GD4B 2ZCKP 4JMYA 3BF6H 3TK6A 1YPLH 2GDEH 4IMQA 5TJXA 1ABIH 1MAXA 4F49A 2O8LA 4DURA 3UUZA 4LZ4B 4K3JA 1Z1JA 2OCVB 4DW2U 2QGRA 1AI8H 1ZJKA 1O2UA 3SQEE 3O8CA 1L4DA 2ZFTA 1GWAA 3CENA 3NCLA 1ANEA 1UMAH 5F6MA 1MKWK 1ACBE 2ULLA 4GCHG 2UUYA 2ZU5A 2IPHA 3SV8A 4ABAA 1T8NA 1C5OH 2A7HA 1Z71A 1FIZA 2UWLA 2R0KA 1FJSA 1C2IA 2ALVA 2CXVA 1H8DH 2PTNA 1C1PA 1KXBA 2Y6TA 2BD2A 1CA8B 4NA7A 3T26A 1C1WH 1FPHH 2BHGA 1GI6A 2IOTA 3UR9A 2VVVA 1BT7A 2XWAA 1L1NA 2TGPZ 1KXAA 1NZQH 2UWPA 5C5NA 4WXIA 1T32A 1MKWH 1YCPK 2ZFPH 4BANB 1C1SA 1LMWB 1VCQA 5FHTA 1O32A 2Z7FE 1CHOF 1GI7B 1BHXB 1MUEB 2D1JA 1P9UA 1E38B 1GBEA 5LPRA 2XBYA 5GIBA 1HXEH 2Y7XA 4OGXA 1C1VH 2P8OB 1O2ZA 1THSH 4ISLA 1C5XB 1MTSA 1LHCH 4I33A 5EQQA 2FOHA 1ZJDA 5DK1A 4IS5A 1LVOA 3QZRA 2VGCC 4ZXXH 1TX7A 4FUEA 4KTCA 1TQ0B 1XUGA 4MPVA 3PMAB 1BMAA 3JZ2B 2AMDA 1GJ8B 4GVUA 4LK4A 2XYAA 1DM4B 1NT1A 2CHAB 4U32A 4DVAU 1D9IA 1O5DH 1O5FH 2CV3A 2UWOA 5DKMA 4ASHA 1NTPA 2ZNKH 3QN7A 1AD8H 1OS8A 2P93A 5FX6A 1H9HE 1EAXA 2FZZA 2QXHA 3ZZ7A 3DHKH 1EQ9A 1F92A 1XUKA 2O8WA 1O3IA 3LGUA 1AO5A 2XXLA 4XBDA 1JOUB 3EA9A 1SGTA 5E0JA 1V2OT 4TWWA 4FVBA 3M5OA 1O3PB 3KL6A 2J92A 1YYY1 5A0AE 3VXFH 1KLTA 4VGCB 2GT7A 1NRNH 3I78A 2FI5E 5E2PA 4WVPE 4ZAEA 5EU8A 2XC0A 2R0LA 3DD2H 3MH6A 1Z8GA 2GGVB 2NU0E 1TA6A 3GDVA 2NU3E 1BBRK 2ZDKA 2Y5FA 4YM9A 1DPOA 2ASUB 1IQNA 4RKJB 4RKOB 2A0QB 3UREA 1MD7A 3MH7A 2BY8X 3EQ0H 3GCHC 4X2WA 4O03A 3IITA 1B7XB 5F03A 3TVJB 5C1XA 1UHBA 4E7RG 2G81E 1L1JA 1JWTA 3CS7A 3Q3YA 1BMNH 2XCFA 4FUBA 4X8UH 4U01A 4RSPA 1XXFA 1V2NT 4H6SB 2GP9B 2JETC 3QDZB 3U98H 1L4ZA 4TY7A 1GCTB 3MH4A 5IDKA 1CHGA 1SLXB 2EI7A 4D8NA 1HUTH 1WV7H 2QA9E 1YPEH 2OC1A 2J95A 4IC5A 1WOFA 1CHOG 3RM2H 1LHGH 4DY7B 4K2YA 1B5GH 2SGEE 3K6YA 5FBEA 4WH6A 1NN6A 1VJ9U 1HAHH 2XBVA 1C5UA 1TGNA 3OTJE 2XTTB 1TPOA 4SGBE 2VVCA 1AMHA 1SLUB 1C5YB 1EZUC 1UTKA 1QA7A 1DLKB 3NZIA 1NPMA 1O3MA 4DIIH 1AWFH 4HGCA 4UFGH 1K1JA 1BMMH 5ETXA 3VPKA 1P06A 2ZECA 3A7WA 1EPTA 3BTKE 3P95A 1MH0A 2FESH 5LH8A 2W3KA 4KKDA 3TGJE 2BD5A 1CBWC 3SHCH 1PJPA 2TGAA 1YPMH 4FUFA 5T6GA 2C93B 1KLIH 5K7RA 1HJAB 3S9AA 3SGBE 2G4TA 1ETTH 3SJIA 4CRCA 2PWXA 1KXCA 1GJ4H 2A7CA 3EAJA 1YF4A 2BY7X 1FMGA 3AAVA 1S0QA 1ELAA 4ZKRU 1C5VA 3VFEA 1QJ1B 1J15A 1O2NA 3KEEA 1KXDA 1ZMLA 4K8YA 3R3GB 1L1GA 3S0NA 4I31A 4ISIH 3TLOA 4DOQA 2WPIS 1XVOA 3HK3B 3QLPH 1BJVA 4AB8A 1EUFA 1SBWA 1XUIA 3GY8A 3FAOA 4YLUA 4UONA 3DFJA 1T31A 3D23A 3T2NA 5GWZA 2VIVA 1Y3VA 1QQ4A 2GT8A 3LJJA 4H4FA 2SNVA 3LDXH 1BRBE 5AFYH 3RXRA 5JDUB 5J4SA 3RC6A 4BNRA 4WH8A 4FU9A 1J14A 2G55A 2P3TB 1SR5C 5EXLA 1WSSH 3SORA 5FAHA 2GZ9A 2ZF0H 4DT7B 2Z9LA 1KDQB 3VXEH 1ZZZA 1TFXA 4TPIZ 4INKA 1UVUH 2H5DA 1LVMA 4KP0A 3EDXB 1F7ZA 3D49H 2UUJB 2VU8E 1GMCF 1CU1A 1YPGH 1NESE 1HXFH 1JRTA 2CMYA 2SFAA 4J1YA 4MDSA 3ZZ5A 4CHAC 2FTMA 1LKAA 3VB3A 1B0EA 2I6QA 5FPTA 4AFSA 1BRAA 2J94A 3ZZBA 1HLTH 2O9QA 1O37A 2ZHWH 4X1SU 5GJ4B 4NIYA 1P12E 1LCYA 4IGDA 1G2LA 1SGPE 3PMHB 1P57B 1VJAU 1CT4E 3LKWA 3BIUH 3A81A 4DGJA 2OP9A 2CGAA 3TH2H 1DUAA 1TNLA 3MU0A 1GBIA 3GY5A 3N7OA 3TNTA 4JK5A 3TPIZ 2ZCHP 3A7YA 3GICB 1FIWA 4CREA 4AORA 3E90B 1GHBF 3M61U 2F91A 3P70B 3PTNA 2Y80A 3SJ8A 3A7TA 2WPKS 1ZOMA 3L33A 3OYPA 1N6YA 3ZZ9A 2R9PA 3HKIB 1ZPBA 1BTXA 1GI5A 1C1OA 1C9PA 1YPKH 3LGTA 1O2YA 1TRYA 4ZKNU 1TAWA 2YNBA 1DXPA 2BY5X 4XOJA 1HAZB 1QL7A 4JYVH 1AGJA 2B8OH 1UTMA 3LGWA 4UFDH 1JIMA 4IW4E 1TMBH 1AZZA 1Y3XA 3QK1A 1Z6EA 3BTQE 1HAVA 3MU1A 3W95A 1S6HA 1GL1A 4MG3A 3OX7U 1V2WT 4X2XA 1HV7A 3S69A 1QBOA 2H2ZA 3GCHB 2P59A 2HVXA 5JBAS 1SGFA 4I7YH 2BVXH 2J2UA 4FUDA 5K0HA 3TJUA 3MNBA 3NK8A 2BXTH 3P17H 1DWEH 2J9NA 3RXKA 4THNH 1GG6C 1BUIA 1Y3YA 1PQ5A 1TB6H 1NM6A 3M7UA 3SJKA 2JETB 5EXMA 1DWBH 1GBTA 1C5NH 1MQ5A 2J38A 1TBZH 1NFXA 1SGYE 3GYMA 3PMJA 1K1NA 4YESB 4ABDA 4OS7A 1MCTA 1YGCH 3GY2A 4GPGA 1EP6A 1GMCG 2V3OH 3GYLB 3BTDE 4HFPB 2ZHFH 1EAIA 5AF9H 1GBCA 3ATIA 1UVPA 1W0ZU 4AFZA 1OOKB 3BEFB 3RC5A 1O3DA 1SQOA 1TIOA 4UFFH 4ZH8A 2ZQ2A 3ODDA 5HM2A 1GI2A 1SHHB 1ZSJA 1G3EA 3Q3KA 1TGSZ 3RXFA 1ELGA 4X8SH 3UQVA 3BSQA 3ZVEA 1W10U 5BRRE 1EASA 1P11E 2FYRA 3VEQB 1MZDA 2EEKA 4Y7BA 2STBE 1RTKA 4FUHA 1SSXA 1BA8B 2G5VA 4TYDA 1QB9A 1MQ6A 4JZFH 2VIWA 1GHBG 1BZXE 1CBWB 2BD4A 3SOSA 1O3OA 2OXSA 1GMDG 1VITH 3A85A 4OS1A 1BB0B 2B9LA 1V2UT 1O2QA 1GBJA 3QX5H 2ZIQH 1LQEA 3B8JA 2WV4A 1VCPA 1C2HA 1EKBB 1TNJA 1YPHE 5FX5A 1HAXB 1J9CH 5DP6A 4UFEH 3SJOA 3E91A 4LZ1H 3SZNA 1KYNA 2AIPA 1YPJH 1TNIA 5GCHF 2VIDA 1N6XA 1O2XA 1O3GA 1Q2WA 5JBCS 3MMGA 1G9IE 2VVUA 4BAHB 1D4PB 3MYWA 3I29A 4GAWA 1GI1A 2F9BH 2FOAA 1MAYA 4ESTE 1RS0A 3ZZ3A 1HJ9A 1XUFA 2AYWA 5B6OA 1TX6A 1F5LA 2WPJS 7ESTE 2EI6A 2Z94A 2A4GA 1TMTH 1W2KH 1O35A 2OUAA 1LQDB 2FTLE 4ABFA 4O97A 2BQWB 3ZVCA 1GJBB 1OWDA 1KXFA 1DANH 3GCOA 2HWLB 1DT2A 4HZHA 1E35B 3RXJA 4BOHA 1OYTH 3LIWA 1T8OA 3SV2H 1T4VH 3T28A 1XMNB 1SFQB 3BN9A 2AERH 2RA3A 7GCHG 4CHAB 1HB0B 3U9AH 1EATA 1UCYK 3A80A 1MD8A 3RLYH 5CMXH 2WUBA 4ABHA 1BTWA 1G2MA 2FIRH 3AW0A 4WJG2 1V6DA 3W94A 3SU1A 3BEUA 3RXTA 1QGFA 4Y7AA 1RTLA 1CT0E 1HIAA 2GZ7A 3LGYA 1ESAA 1TRNA 2C8ZB 1A5GH 1ANDA 1IQLA 4U2WA 5F8XA 3NPSA 1AUTC 1Z1IA 1CGJE 2ZCLP 1FQ3A 1BTPA 4O9VA 3MU4A 2ZU2A 1UTNA 1SI5H 2FO9A 1WQSA 2CF9H 5DP8A 1GJ9B 3M5LA 1F5KU 1O2PA 2SGAA 1P05A 1Y3WA 2ZKSA 2VIPA 1CE5A 1GMHF 4Y71A 1FDPA 1C2FA 1AWHB 2ZU3A 1ANBA 5SGAE 2ZFSA 1RGQA 2BTCE 1EB1H 3SU3A 2A32A 2BDAA 2YNAA 1EB2A 4YTAA 3KN2A 4RN6A 1VR1H 3RXGA 1IQJA 3ZVAA 3V7TA 1S83A 3C27B 1P9SA 1S84A 2QF0A 1C2EA 1HDTH 3E16B 2PSYA 3BIVH 3KQBA 1SPJA 1G37A 3GCTG 2YOLA 2BX4A 3BTHE 1AVWA 5GCHG 1ARCA 3MO3A 1GDQA 1MTVA 1A5IA 3RXSA 4ABGA 1A0JA 2BX3A 3VB6A 2XWBI 3QZQA 2ZGBH 2ZGJA 2ZWLH 2BDIA 1XUJA 1HAIH 1INCA 4FUGA 2A2QH 4MNVA 1AHTH 1SQTA 5FCRA 2C8WB 4K69A 1SGEE 1FY5A 3FANA 1OWHA 1MU8B 9ESTA 1EZXC 1LPGB 5JYIA 3BG8A 3DA9B 3UFAA 2Y81A 1UJ1A 4MPXA 1OWEA 1Y8TA 3RMMH 1OP8A 2BLQA 2FOCA 1RJXB 3SGAE 4YT7H 1E36B 1FI8A 3QGJA 5FCKA 1W13U 4AX9H 3SGQE 2PKAB 3BTGE 4A5TS 1NRSH 2STAE 5EPNA 4BTIB 2IN2A 4B73A 4NSYA 4X6OA 2WYJA 5GPIB 5FPYA 3RXEA 2BB4A 1WU1A 3GDSA 3SU5A 4AG2A 5DP9A 1BRCE 2P94A 1QFKH 1ZR0A 1Y5UT 2Q6GA 3TU7H 2A4QA 3M35A 1YCPH 1DITH 4DJZB 3B23B 2ZDLA 5HMAA 5C67A 2B7DH 2PFEA 1C1TA 3QTOH 2VIQA 4FUJA 3M3TA 4OS6A 1HFDA 3CP7A 4IN2A 3ATKA 1ZTKA 3LC3A 3TJVA 1ANCA 3MHWU 1ZPCA 3QGNB 4CRDA 1DSTA 1O2OA 4D76A 5CHAB 5AVDA 2Q6DA 1GMHG 4Y79A 1XVMA 4YOGA 2M5TA 2OQ5A 3G01A 2DUCA 1AQ7A 5EG4A 1TNKA 1WBGB 4Y6DA 3P6ZB 1O2MA 2LPRA 4B71A 1PYTC 1V2PT 2XRCA 4UD9H 4DCDA 1P2JA 1C1NA 1JXPA 1UK2A 1ZTJA 1PPBH 1UVTH 1O3HA 3LGVA 3RXBA 2FX6A 2TPIZ 4B1TA 1QB1A 2FYQA 1C2LA 1XX9A 4MVNA 3A7ZA 2QAAA 1HRTH 1K1OA 2ZP0H 5JPMH 1QJ6B 4JYTA 4AZ2B 3BEIB 1O2SA 4FU8A 1TPPA 3FZDA 2HGTH 2BD8A 2ZFFH 2C8YB 3OSYA 5I46H 1GI9B 2HOBA 2GZ8A 1EP5A 1N8OC 3S9CA 2ODQA 3Q76A 4XBBA 3LGIA 1BBRH 3A86A 2Z3DA 3HGPA 1GVZA 4D9QA 1FY3A 1M9UA 2NU4E 1T8LA 1PPGE 1XKBC 5C1UA 1GJ5H 1H8IH 4E7NA 1GJ6A 2C4FH 3ITIA 1ORFA 1O5EH 1O5AB 1B0FA 1O2WA 1EOLA 2BLOA 1TPSA 3EE0B 2O8MA 3TGIE 1K1PA 1C1QA 3GOVB 1EXFA 2AFQB 5EPYA 1P02A 1GJDB 1AUJA 1SGNE 3AAUA 1MCVA 2QXJA 1C5PA 5AFZH 3KQDA