4MNVA

Crystal structure of bicyclic peptide uk729 bound as an acyl-enzyme intermediate to urokinase-type plasminogen activator (upa)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator chain B
publication title Peptide ligands stabilized by small molecules.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 58
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2013-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4mnvA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4mnvA01
2A7HA 2JETC 1AFQC 1EXFA 3EAJA 1FPHH 1GHAF 1RTKA 3G01A 3UNQA 4UFDH 2V0BA 4RKJB 4E06H 2RA3A 3RXIA 1CT2E 1TABE 1VJ9U 1O2JA 1SR5C 1GJ4H 2VVCA 1ZTJA 4NCYA 1O3HA 5E2OA 2PKAA 1TX6A 3RXOA 1O31A 4X1QU 2Y6TA 2AGEX 3PYHA 4CHAC 3GY4A 3LGYA 2FOMB 2EC9H 3IWMA 1YGCH 2B0FA 4WH6A 3LH3A 3LGWA 5EQRA 1ACBE 4ZKSU 1W10U 4A7IB 1O3GA 1YP9A 4LOYH 1AKSB 1YCPK 3S7HB 4AFUA 4F4OC 3A87A 2Q6FA 1CQQA 4VGCC 3O8RA 1OWHA 4B73A 3SI4H 1NROH 1VCWA 2XTTB 3TGJE 3PV4A 4DT7B 1GCTB 2GZ9A 1QJ1B 1FJSA 1A1RA 1AO5A 3QDZB 1GMDF 1KXDA 1GHWH 2R9PA 1WV7H 1PPCE 5SGAE 1EX3A 5GWZA 4I8KA 5E2PA 4X6MA 3TJOA 2FM2A 5A09A 1GHAG 3ZZBA 4BANB 1LHGH 1YF4A 2BTCE 1ZGVA 2JH6D 1NFWA 2BOHB 1PQ7A 3HKJB 1TONA 1HIAA 2DE9A 3A8CA 2PSYA 1G37A 1MAYA 2A5IA 2FP7B 2HGTH 1FIZA 4JMYA 3MO9A 1BTYA 5C1YA 3RU4E 2QXJA 1IQEA 4X1RU 1SG8B 2GT7A 3V3MA 3SUGA 3D49H 2BX3A 2HOBA 2NU0E 3KIDU 5AFYH 3ZZ4A 3PMJA 4X6PA 1EASA 3RM0H 1EP5A 1EPTB 1S82A 1D3QB 1EKBB 2TGAA 1P2QA 1GDQA 1DM4B 2QYIA 1KXAA 1QJ7B 3UREA 4CRGA 2ODYB 4Y0YE 2CGAA 1Q2WA 2FYQA 4K69A 1RD3B 1XVMA 2F83A 3EDXB 2BDCA 1LO6A 1S83A 1GG6B 4IN2A 3ZVAA 1WSSH 1HYLA 4B76A 2PFEA 1AKSA 5T6FA 1DY8A 3BIUH 1F5LA 1HUTH 1O5EH 1P10A 3A81A 1NU7B 1KLIH 4AZ2B 2F9OA 2H5CA 1GI1A 1MD8A 5ABWA 4I33A 1S5SA 1DLEA 1MTNB 4NFFA 3RXAA 1C5VA 3U8TH 4JZDH 1BRBE 4TPIZ 1S85A 4NWKA 3HK3B 3MNXA 1O2KA 3A89A 3M5LA 1C1OA 2VNTA 2LPRA 4XOJA 1V2KT 1CE5A 1EOLA 1NFYA 1TGCA 3A8AA 2BY7X 2XBWA 1TBZH 2R2MB 2ZHFH 1TA6A 2V3OH 2GCHF 2BD7A 1FAKH 3R3GB 4I7YH 1GBFA 2PUXB 4IBLH 1XUIA 2J95A 5FBEA 1HAVB 1SHHB 4LZ1H 3M61U 5A8YA 1T8LA 3KCGH 1FONA 1GDUA 3T27A 1CHGA 1NTPA 2FOEA 1C1MA 1ZSLA 4ABBA 2TBSA 3P95A 3P70B 3P92A 3MNSA 2ZU2A 3SU1A 4ABFA 1PPFE 2ZU3A 4NG9H 3T28A 5HMAA 3GYMA 2BVSH 2ZQ1A 3QO6A 5EQSA 1LQEA 2WPMS 1GI9B 1TNGA 3DFLA 5HGGA 2UUKB 1P03A 1HAZB 2ZI2H 1HDTH 3A86A 3LT3A 1EPTA 2SGFE 4X1NU 4IC5A 2OINA 1O3CA 4X2YA 5FCKA 3BTME 1QRXA 1JRSA 4MVNA 3M5NA 5ESTE 2OC8A 4ZMAH 2VIWA 2B7DH 1VCPA 5L2YH 3U69H 1B0EA 1CHOF 4FUHA 1GMHF 1CA8B 2ZFFH 1UK4A 4K1SA 5L2ZH 3N7OA 2CHAB 2GV7A 3MMGA 4CRCA 4HGCA 1XUJA 4B2AA 3UQVA 4WF8A 4A6LA 1MZDA 1AVXA 2W26A 1K1LA 2F9UA 4YZUA 2O8UA 4YOGA 2F9PA 1XUFA 1O3FA 7ESTE 5EW1H 1LPKB 1YPHC 2QA9E 2HWLB 3RC6A 1DT2A 1V2JT 1GPZA 2GCHG 2BM2A 1ELAA 4MPUA 1RS0A 3SUFA 1PPBH 1OKXA 1UTJA 2ZEBA 4JCNA 5A0BA 1FV9A 3U98H 2Y5HA 1P04A 4BAQB 1A5HA 2WPJS 1FY5A 1LPGB 5ETXA 2ZPSA 1BTZA 5DP4A 3S0NA 1O3NA 1TOCB 1K1NA 4I8GA 5EU8A 1UTMA 2VIOA 3TVJB 3VXEH 3AW1A 4X6OA 5C3NA 1OWDA 2CV3A 2VB0A 2V35A 2A0QB 1ZTKA 4UFFH 1QA0A 3JZ1B 3URDA 5C67A 3UPEA 4SGAE 1L0ZA 5DP6A 4Y76A 1L4ZA 3FZDA 1HAVA 2WPHS 2G51A 4BOHA 1J14A 1CHOG 3KQBA 1GMHG 3DFJA 1GMCF 4ZUHA 3UQOA 1A4WH 3MFJA 3SBKA 2D2DA 1P2OA 2K1QA 2CMYA 5E0JA 2EI8A 1QBNA 1UVTH 3UNSA 1AB9C 1G2LA 2P3TB 1C5QA 4NWLA 1P06A 2BX4A 2XC0A 4Y7AA 3SNDA 2QGRA 4A92A 1UCYE 4Y10E 4TY7A 2Z9JA 2QIQA 4Y6DA 1OPHB 1IQNA 4KELA 1CGJE 2EI7A 4CH8B 5IYTA 5C1UA 2ZDNA 1JRTA 4FVDA 1ZSJA 1AN1E 3GCNA 3GCHB 4ISOA 1UCYK 3UY9A 1T32A 1E0FD 2HLCA 2YNBA 2J2UA 1RFNA 3MOCA 1ZHMA 5A0CA 4I8HA 2P3UB 2ZPRA 3SUDA 5FPYA 2P95A 1HLTH 4AORA 5C1XA 4NIXA 3PO1B 3Q77A 3M36A 1LHFH 1TWXB 4FUEA 1D3TB 4DURA 4FUBA 3QTVH 4BXWA 5FAHA 1T4UH 1FPCH 2QF3A 3PMHB 1F7ZA 3M3SA 1INCA 2PV9B 1MTWA 2UWOA 3SNAA 1DITH 1GMCG 1YPMH 5LPRA 1DWCH 1PQ8A 3A80A 1LPZB 2I6QA 3T62A 4ABJA 1SLWB 1LVOA 1E37B 1IQGA 5AFZH 1G32B 4F49A 1O2UA 3RP2A 1BRUP 3D62A 2C3SA 3ATLA 4UDWH 4Y0ZE 2IN2A 1F0UA 1WAYB 3UTUH 1TGSZ 3BEIB 1H8IH 3FVFB 3BF6H 5FX6A 1OP8A 3SQEE 2ZCLP 4RKOB 3KQDA 1S84A 1HV7A 3EGKH 3TITA 3MNBA 1BDAA 1RTFB 2ZFSA 2M5TA 1NS3A 2BDHA 4THNH 1OYQA 2AS9A 4AX9H 3TGIE 1QRZA 2OC0A 1IQHA 1K22H 2A32A 4Y11E 1SGPE 1T8MA 4BAHB 2CXVA 3K2UA 3SHAH 1HNEE 2WPLS 5AHGH 6GCHF 1BTWA 4U32A 3FAOA 2TGTA 3T2NA 2A4QA 3U1IB 1TRYA 3F6UH 1ZRBA 1QR3E 3ZZCA 1XX9A 4BNRA 2VINA 4ZROA 3FP7E 3AAVA 5HYOA 1ESTA 1O36A 3U8RH 1K1OA 1BB0B 2XBXA 4NIWA 1TYNA 1KYNA 1P05A 1SGFG 3NXPA 1WTHD 1TLDA 1SGDE 3VB5A 5BPEA 4R8TB 2F91A 2BLVA 3MI4A 4ISHH 1T8NA 3RLWH 3E91A 2FZZA 1F0TA 3L6PA 2BQ6B 1PPGE 4XBCA 5DJ7A 3SGAE 3V0XA 1K1IA 4KKDA 2ZCHP 1K9OE 2JH0D 1MKWH 1O3IA 1W2KH 1ETSH 5E0GA 1YYY1 1TIOA 3MH7A 5JBCS 1IQMA 5GXPA 1GGDB 2NU2E 1EAXA 1O3JA 1C5SA 3M7UA 4B74A 1TQ7B 2AERH 1Q3XA 3DA9B 2GCTB 1C4V2 4AGJA 2FYRA 3GCOA 2C8YB 1G36A 1Z7KA 2A1DB 3GY7A 4XDEA 1A61H 2AMQA 2R0KA 4AB8A 1LHEH 2VGCB 5T3HA 1GI2A 2ZDAH 8KME2 5EXNA 6GCHG 3ZZ8A 5DPAA 4ASHA 4BAKB 5ESBA 3LH1A 3M3VA 3BV9B 1AWHB 4GPGA 1NT1A 2BLOA 4B2BA 1NZQH 1ZMNA 4GLYA 4OGYA 1C5XB 4OS4A 1HBTH 1LCYA 1TGTA 4BAMB 1P57B 1NM6A 2C8XB 4FUDA 4UEHH 3PWBA 2BDYA 5HM9A 1TX8A 1GBHA 2V6NA 2HNTF 2QXHA 1ARCA 1EZUC 1SGNE 2BLQA 1GI3A 4NIVA 2GD4B 1V6DA 1GWAA 3F1SB 1F2SE 3URCA 3ITIA 1DVAH 3GCTF 2YOLA 4AYVB 3M37A 1ELVA 4KTSA 2QF0A 1QQUA 3MWIU 3UIRA 1AY6H 1EAIA 2A45B 2SFAA 2PGQB 1IHSH 3CP7A 2ZDMA 3ZVDA 3E16B 3UUZA 1YKTA 1TBQH 1GCTC 5LGOA 1C5MD 3RXKA 1E36B 1FY4A 3SV9A 4M7GA 7GCHG 1HJAB 3ODDA 4ABAA 2BB4A 1HB0B 1F92A 5IDKA 2A5AA 1QB1A 1RGQA 2B9LA 2GT8A 4K3JA 1TB6H 1HAIH 4I32A 4FVBA 4MNWA 3TK6A 2ZFTA 3RM2H 2G00A 1RJXB 4BTIB 1SGCA 1BBRE 5CMXH 4CR5A 2CJIA 1ZHRA 1QQ4A 4HFPB 4Y71A 1ELEE 2A4OA 1V2MT 3B9FH 4X0WU 2OXSA 3QX5H 1FY8E 1EP6A 5FPTA 2A31A 3TH2H 1U6QA 2SGEE 1BBRK 2RG3A 8ESTE 1NESE 2BD9A 4J2YB 1ZPZA 1KDQB 1G9IE 2H9HA 2Z9IA 3RXBA 1ZPCA 1SL3A 2VJ1A 4ABHA 1C2HA 2GKVE 2ZDLA 1MKXK 1LDTT 1NRPH 1UHBB 3A85A 1VITH 1O5BB 4AFZA 1O2GH 1O2HA 1OWKA 1EPTC 3S9AA 1W11U 3RLYH 4MQAA 5EPYA 1BQYA 5GIBA 3F9GA 3BSQA 1GHZA 3SI3H 4LXBH 4JYVH 1DWEH 2XC5A 4ABGA 2FOFA 1NY22 1THPB 2C8ZB 2UUJB 4GCHF 3UOPA 1OP2A 4WMDA 1GG6C 4GSOA 4TWYA 3A83A 4YESB 1GJ8B 1F5RA 1A2CH 1YPJH 8GCHF 2FEQH 3RXDA 1P2KA 1SOZA 2BZAA 2Z9GA 1W13U 2R3UA 4HZHA 1HGTH 1W12U 4U01A 4YLQH 1W7XH 4INLA 1W14U 4K8BA 1C5NH 1GHVH 1V2QT 1J15A 1NRRH 1O2XA 2BXTH 2XC4A 4FU7A 1BJVA 1TRMA 1SLVB 2OLGA 2G4TA 1DOJA 2AFQB 1EAUA 4D76A 1MTNC 1Q31A 1YPGH 1MTSA 2BQWB 1JMOH 5FX5A 1AFEH 1TA2A 2BDAA 2ZHEH 1ABIH 1A46H 3K6ZA 3BTFE 1AIXH 3GOVB 4FU9A 1C5WB 1PYTC 3TK9A 2Y5FA 2VWOA 5JBBS 2A2QH 2GDDA 1IQFA 1D6WA 1TOMH 1OOKB 2G52A 1PPHE 4IN1A 1NC6A 3E8LA 3JZ2B 1DFPA 2ZCKP 4K8YA 3RDZA 4X2WA 1UVOA 1DY9A 1G2MA 4CRDA 1O2SA 3PWCA 1KY9A 1W8BH 2BY6X 5CHAB 5J4SA 2ALPA 3ENSB 4X1PU 4GCHG 1BMLA 1GI4A 1KDQA 1XXDA 2AIQA 3M7TA 1AE5A 1P01A 2P93A 2A4GA 3DT0H 3SU2A 1KTTB 5JBTA 1V2LT 2STBE 1BCUH 2W5EA 3GY2A 1HCGA 2H2ZA 4A1VA 4U30A 1O5DH 1GI5A 1Z6JH 3A7ZA 8GCHG 1DWBH 1V2TT 1GMDG 2WPIS 3DD2H 1UHBA 3E6PH 1RIWC 1EJNA 2G55A 2P3FH 2Y7ZA 4NFEA 1AU8A 1C5UA 1XXFA 3VB3A 1HXFH 3F9EA 1EOJA 3IITA 3KL6A 2VIQA 1T8OA 2BQ7B 1Z71A 2P8OB 1EAWA 1BRCE 5GJ4B 4BTUB 5A8ZA 1GJ6A 1IAUA 2CHAC 2ESTE 5LH8A 1G30B 1TFXA 1X7AC 5FPSA 3SNBA 1SOTA 4O97A 3ZYEA 3SN8A 1ETRH 4ABEA 3T29A 2AMDA 2ZNKH 1KXFA 1GBMA 1QURH 1QL7A 2ZTXA 3RXJA 4YT6H 3SV6A 2FDAA 3HGNA 1UVSH 1S81A 3V12A 1MH0A 4WVPE 4Y8XA 1JIRA 1CT0E 1SFQB 2PLXA 5AF9H 3VB7A 3H7OA 3LC5A 3BTEE 2A5KA 1ZTLA 2HVXA 1YM0A 4MPWA 1IOEA 4AN7A 1E35B 4XBDA 3RXUA 3PLKA 1ESAA 5C20A 3BTHE 1IQJA 4JK5A 1P2NA 2BMGB 2Y7XA 3LU9B 2FO9A 2HNTE 3ZVCA 5AVDA 3P8FA 2DE8A 3BEFB 1TPPA 3Q3XA 1FMGA 1BTPA 1V2WT 2GV6A 1LMWB 1UTQA 1OWIA 3F9HA 3PMAB 6LPRA 2PTNA 3RXQA 1WUNH 3A7TA 1Z8GA 3Q76A 3E1XB 1H8DH 1SHYA 2PWXA 2A4RA 4O3TA 1OX1A 1IQLA 1YLDA 1Y5AT 2XCFA 1P3CA 1O2QA 1C5LH 3SJIA 1C5YB 2XWBI 2FLRH 1KTSB 1GI8B 2SNWA 5DP3A 2PKSB 4NZLA 3C1KA 2ZWLH 4JZFH 2LNCA 2ZKSA 2ZO3H 2WV4A 3OSYA 4Q7YA 3K6YA 5JYIA 3PMBB 2QCYA 3FFGA 1W3CA 3GY6A 1FDPA 4XBBA 2Y80A 1MUEB 1TPAE 1CA0B 3EA8A 3VGCB 3GDUA 1MD7A 5JB8S 4WMEA 1AGJA 1W0ZU 5HXFA 2J34A 3NPSA 4LZ4B 1O3MA 1C2GA 1EJAA 3RU4D 2FWWA 5E0HA 2ZU4A 1A0LA 4D9QA 3MO3A 3LIWA 1O33A 5FXLA 1ARBA 1Y3VA 3GCHC 3C27B 2C4FH 5EODA 1XKAC 1GBCA 1K28D 1AHTH 2NU1E 5FBIA 2QXIA 1T31A 6CHAB 2PSXA 1OYTH 1ELDE 1E38B 4WY3A 2ZHWH 3PO1C 1M9UA 1N6YA 4DCDA 1KXBA 2WYJA 1KXCA 4CR9A 4WXIA 1K21H 1L2EA 2RA0A 3QWCH 1UCYH 8LPRA 1N8OB 2D8WA 3EYDA 1D3DB 1SGTA 1C2EA 1ID5H 3GICB 2O9QA 4Q80A 1MBQA 5F8TA 1O2IA 1P02A 4IGDA 2BZ6H 2VVVA 1YLCA 5EOKA 3RMOH 4CRFA 2XXLA 3VB4A 2B8OH 3ZZ9A 1HJ8A 1O3BA 1GBIA 1TGBA 2EA3A 3FANA 1HAOH 3KHVA 3MH4A 1C5RA 1O5AB 1C1VH 2BVXH 1UK3A 1LQDB 3PLPA 3LGIA 2FS8A 4K5ZA 3RXGA 1P8VC 1TNIA 4CRAA 2A2XH 1N1LA 1GVZA 1JXPA 2FMJA 3KQEA 2FXRA 2XRCA 1QL8A 3LGUA 4WJG2 1ORFA 1TE0A 4K60A 3RXTA 4FU8A 1F5KU 3SQHE 2VIVA 2XWAA 2BY8X 4WMFA 1Z8RA 1LVYA 5BRRE 1H9IE 4FUFA 4A5TS 3PROA 3TNTA 4ZXXH 1O0DH 4X8UH 2BYAX 3MHWU 3A7WA 1MTUA 1P2MA 1SGRE 1BMNH 2PHBA 4KGAA 4DOQA 2BD2A 2ZG0H 2NU4E 1WBGB 1O35A 1BHXF 4ESTE 1GBBA 2QN5T 2Z7FE 3MU8A 1FQ3A 2WV5A 3SJ9A 1NO9H 3GDVA 5JBAS 2ZP0H 1C1QA 5H4IB 1C5TA 2FTLE 4MPXA 3PLBA 2BHGA 4O03A 1MAXA 4GHTA 1FN8A 1GI0A 1O2LA 2QV1A 1FNIA 1GGDC 2VU8E 3SOSA 1BTHH 4MTBA 3ZVBA 3HGPA 1ANBA 2OTVA 3TLOA 4AFQA 4WWYA 2GCTC 2Z9LA 1WU1A 1P0SH 4DIHH 1ELFA 3BG4B 2O8MA 1S6FA 4Q2KA 5C2ZA 3K65B 4I8LA 3MH5A 4ZKRU 2VGCC 3EA7A 1IQIA 1ELGA 3NCLA 3SV7A 2DUCA 3A88A 1BITA 1SGFA 1HAPH 3TK5A 3VXFH 2H9TH 1XUKA 3RXMA 2J4IA 4MPVA 4HTCH 2ZGBH 2WUCA 1UK2A 1O2YA 1Y3WA 7LPRA 2ZGCA 2FS9A 3HPTB 3E3TA 2VIDA 1VITF 4ZHLU 1CBWB 1DWDH 4H42U 3SV8A 3ATIA 5T6GA 1A5GH 4FUJA 2AYWA 3BTWE 1DANH 4SGBE 4U2WA 4A1XA 1WYKA 1NRQH 5G4BA 1SBWA 4RN6A 3D23A 2VWMA 3HK6B 2XCNA 4A1TA 1O2OA 1JOUB 1UMAH 2GVFA 1C2LA 4NA7A 3SO3A 3SU4A 4XFQA 1VGCB 2GGVB 2W3KA 1ZR0A 2GDEH 4H4FA 2C8WB 3Q3YA 1O2ZA 3BTGE 2Y82A 3SJ8A 5GDSH 3VEQB 3QUMP 1Z1JA 1Y3UA 9LPRA 2BLWA 2PR3A 3MU0A 1ELBA 4OS6A 1BZXE 1FLEE 2OC7A 3QZRA 3L3TA 1HJAC 3H7TA 3AVZA 4MNXA 1NRNH 3OYPA 1TNHA 3SU3A 3BTTE 4ZKNU 2P59A 2FOBA 3MH6A 1LTOA 4E7NA 4CBOA 2ODPA 4K1TA 3TGKE 2WINI 4X2VA 1GHBF 1V2OT 3M7QA 4NSVA 5L6NH 3MU4A 2UUYA 1O2WA 5DK1A 5JDUB 1C1PA 1FY3A 1H9HE 2ASUB 4BTTB 4OS2A 2GX4A 1HPGA 2ANKH 2G4UA 1BTXA 3M3TA 1QL9A 1P9SA 1W0YH 3SNEA 1YCPM 4Z6AH 5C5NA 1CGIE 5F6MA 1Y3XA 4KTCA 2ZHQH 3LPRA 3NZIA 3NK8A 1BBRH 1TMUH 3ATMA 5A8XA 2GZ8A 2ZDVH 1Y5UT 1V2PT 4X1SU 1BTUA 1C2DA 1XKBC 1QCPA 2Q6DA 4WXVA 1DUAA 5GCHF 3DUXH 2QAAA 2TGPZ 3P8OA 1EATA 1B7XB 2ZFRH 1O37A 1UJ1A 1NRSH 1MKXH 1MKWK 1MTVA 4MLFB 5DP8A 1V3XA 1GHXH 2QY0B 2OUAA 1GJBB 4X8TH 3RC4A 3KGPA 1C1SA 4H6SB 1AZZA 1RXPA 1GBEA 1AUJA 2H5DA 3QN7A 1NFXA 3ZVFA 4KTUA 3MYWA 4OS7A 1TRNA 3STIA 1YCPH 2RDLA 3OTJE 3F9FA 2VIPA 1S0RA 4YT7H 3H5CB 3U1JB 5A2MH 4CREA 4AOQA 4FXGH 1O3AA 1QNJA 3QLPH 4MG3A 3SUEA 3A8DA 5EG4A 2Y5GA 3EQ0H 4JYTA 4GVUA 3TPIZ 1PQ5A 2VWNA 1ESBA 2J9NA 2CF9H 3O8DA 4Y8ZA 1GJ9B 1LKAA 3A82A 1ZMJA 1VCQA 4NA9H 1SC8U 1AZ8A 1EZQA 2XBYA 3M5OA 4R0IA 4K2YA 2TGDA 3ZVGA 3RXRA 1GDNA 2ZTZA 3U9AH 3SJOA 1C2MA 2VVUA 3UFAA 2I6SA 3GCTG 5CHAC 2HALA 2THFB 1A0HB 4UE7H 3RXLA 1CSOE 5GCHG 1O2VA 1ZYOA 4AB9A 2KAIB 1JIMA 1TMTH 4MNYA 4JZ1A 1QGFA 1V2UT 5EW2H 1TPSA 2FLBH 1NFUA 2C93B 1KIGH 1YBWA 3GYLB 1O2MA 5T6DA 2R2WU 1L1JA 3IG6B 1OWEA 1O3LA 1NU9A 2HRVA 1L1NA 3ZZDA 4TWWA 1GJAB 1HAYB 1PYTD 3FP8E 3R0FA 1HAHH 2ZQ2A 1JWTA 3SU5A 2P8OC 1S6HA 3SZNA 1LHCH 1VZQH 4UD9H 1AMHA 1FAXA 3RXCA 3QK1A 4TPYA 1LHDH 2IJOB 3SJKA 1THRH 1OXGA 2F9BH 4XE4A 1C2KA 1L4DA 4INKA 2J92A 2R0LA 1SGIB 1GBLA 2GMTB 2WPKS 5LPEA 4Y7BA 3SV2H 4ISLA 3ZV9A 5TCAA 4B71A 3MTYA 1DSUA 2ZPQA 1RTLA 3LGTA 3MU5A 4YOJA 1GI7B 3TIUA 1BMMH 1PPEE 1LVBA 5DG6A 2JKHA 4FUGA 5FCRA 3I77A 1GBAA 2G81E 1G3EA 5J4QA 1YPHE 4ZH8A 3OY6U 4Z0KA 1E34B 4ABIA 1J16A 4DG4A 3FZZA 1ETTH 2JETB 1D6RA 1TBRH 4X8VH 1AFQB 1MMJN 2PUQH 3RUOA 4ZHMU 2OD3B 3SU0A 1ZZZA 1LKBA 4UFEH 2WUBA 5DKMA 2SGDE 3RMLH 2UWPA 4DIIH 3SGQE 1ZGIA 3MO6A 2ZC9H 3PTBA 1WTGH 3QGNB 3W95A 1SI5H 2Z3DA 3GY5A 2PKSC 2XYAA 3ZV8A 5C5OA 1O2TA 1CO7E 1SLXB 1P9UA 1G3DA 1C5OH 1DS2E 1AUTC 3UR9A 2Z9KA 2P94A 2KAIA 3VFEA 4CHAB 1P12E 2AH4X 1O3PB 4E7RG 2ZTYA 2W3IA 1HAGE 2PW8H 1C1UH 2ILNA 1KSNA 1CA0C 2Z3CA 3VGCC 3ELAH 1DX5M 3LONA 4NGAH 1O34A 2F9VA 1WQSA 3HATH 4HI3A 2FIRH 1QBVH 2ZDKA 2Q1JA 4X2XA 1WOFA 1CU1A 2FI5E 3K9XB 2HPQH 1SSXA 2SGAA 4VGCB 3KF2A 4B75A 1Z8IB 1T4VH 1UTNA 3P17H 1C2JA 3BIVH 3GISB 1S0QA 1QY6A 4OS1A 1MZAA 3STJA 2JH5D 2AGIX 4TYDA 2TIOA 6CHAC 1SQTA 3V7TA 1A7SA 5A0AE 3SGBE 1SB1H 4BAOB 5EPNA 4O9VA 1O3OA 3SHCH 1C2IA 1HAXB 1MCVA 1ANCA 1KXEA 3AASA 3QGJA 2GTBA 1GCDA 1O32A 1A0JA 4JK6A 4PROA 1ZSKA 2AIPA 1B5GH 1ZJKA 4IC6A 3RXSA 1N8OC 2EEKA 3I78A 3GDSA 1BJUA 5DP7A 1DXWA 1UTKA 1Z1IA 1EQ9A 1SQOA 1FUJA 2BD4A 3GY3A 4D9RA 1AVWA 4ISIH 1DICA 1GI6A 2BY5X 4JZEH 2OBOA 1QB9A 1HJ9A 1OP0A 5LPFA 1H9LB 2EI6A 1TALA 1TNKA 2D1JA 3CS7A 2SGQE 4YLUA 2ZZUH 4D7FA 1O3DA 1XM1A 1SGEE 1K1MA 1BRAA 1AQ7A 3RXVA 1FI8A 2BY9X 2B5TB 1GBKA 1K1PA 2BDBA 3RU4T 3KN2A 3RMMH 1FIWA 2RCEA 1GBJA 1RIWB 1O2PA 3TJVA 3LKWA 1SPJA 3KNXA 4GAWA 3S9CA 3T25A 1UTLM 2F9NA 3LJOA 3ATKA 4Q7ZA 4E05H 2NWNA 1DLKB 5EXMA 1T7CA 2FX4A 2OQ5A 2ZU1A 3CS0A 1YPKH 1D4PB 4DVAU 3SNCA 3ZZ5A 3LJJA 1MCTA 1ZOMA 3PTNA 4K1EA 3L33A 3P6ZB 1C1RA 1MU8B 5L30H 1J9CH 1YPLH 1SGYE 4NSYA 4I8JA 1UTOA 2ANMH 1Z8JB 4O3UA 2TPIZ 2O8TA 4H6TA 1DPOA 1OWJA 2HPPH 1P2JA 1V2RT 5F8XA 1SLUB 2O8LA 3OY5U 1C9TA 1BHXB 3AAUA 2BVRH 1NN6A 1L1GA 6ESTA 2A7JA 1XMNB 1W7GH 1PQAA 2YNAA 4AFSA 2Q6GA 2ZFQH 1WQVH 2IPHA 1IHTH 1O38A 2FESH 4ZKOU 4AYYB 3RMNH 2BOKA 1O3EA 4FUCA 3BG4C 4YTAA 1P2IA 2FOHA 4TY6A 3F68H 1HXEH 1J8AA 1DXPA 1VJAU 5TJXA 2ANYA 1GBTA 1GHYH 1C9PA 3UWIA 1Y59T 2PTCE 1D9IA 1F0RA 2P16A 3PM3A 1VR1H 2H1UA 1XVOA 1EUFA 1K1JA 4I31A 3LC3A 1THSH 1A5IA 4B1TA 1ABJH 1GJCB 2FODA 3AW0A 2Z94A 1C1TA 1H1BA 3UOUA 1O2RA 3HKIB 4BXSA 1FN6A 4DY7B 1CBWC 2G5NA 2BD3A 1FZZA 3EE0B 1B0FA 4IW4E 4KP0A 1KLTA 2O8WA 2QXGA 1SFIA 4MNVA 1GJ5H 3P8GA 3RXPA 3S9BA 3BG8A 3FP6E 1AD8H 4DW2U 1TGNA 4Y8YA 2VH6A 4AG2A 3ZVEA 2FTMA 1VGCC 2OQUA 2XW9A 2HNTC 2R3YA 2FPZA 2H9EH 1GVKB 4D8NA 9ESTA 1ANDA 1K2I1 1TQ0B 1GL0E 7KMEH 1Y8TA 3BEUA 3S7KB 1PPZA 2WYGA 3BTQE 2VH0A 3NUMA 1FXYA 3M5MA 4AGKA 1AE8H 1CGHA 2GZ7A 4JZIA 2OP9A 4GHQA 1O2NA 1TMBH 1V2ST 4ZHAA 1MQ6A 1P11E 4ZAEA 3ATWA 5TCCA 2PGBB 1JBUH 1UO6A 3RXFA 5JPMH 3A7XA 3RXHA 5K7RA 3E0NB 1BMAA 1FY1A 3A7VA 1BT7A 1V2VT 1UVUH 1MQ5A 4ZXYH 1AWFH 1CVWH 5EQQA 1SQAA 3ZYDA 3Q3KA 3UNRA 5EXLA 1SVPA 3RXEA 2FOCA 1GVLA 3TH4H 2BDIA 2OC1A 4NIYA 3TNSA 3UR6A 4NZQA 4YM9A 2QC2A 1C1WH 2ZF0H 2CN0H 1GBDA 1C4U2 1DUEA 1PFXC 5DGJA 5DP9A 1TX7A 1QB6A 1MU6B 3QZQA 4JYUH 1HRTH 2STAE 1G3BA 1YC0A 2ZECA 2W7UA 2XBVA 3T5FH 1IQKA 1GJ7B 3TU7H 1DDJA 1V2NT 3TJNA 2V3HH 1AB9B 2A7CA 2G8TA 3WY8A 3O8CA 3CENA 4GUXA 4IMQA 1TNLA 1XUHA 5GPIB 3RC5A 3KQCA 1A3BH 3UWJH 1DSTA 5JB9S 1N6XA 2BD8A 3E0PB 4UONA 1QRWA 1GJDB 1HFDA 2W7SA 2FOAA 4J1YA 1NPMA 2BD5A 2Y81A 1QJ6B 3I29A 4IS5A 3NKKA 3V13A 1RRKA 3MU1A 2J94A 3QTOH 1C1NA 4B2CA 1D3PB 2XNIA 2ZIQH 4YOIA 3LGVA 1C5ZB 4QT8C 2BXUH 2ODQA 3DHKH 1ZHPA 5E8EH 3LDXH 2FI3E 2FX6A 1OS8A 4X8SH 5I25A 3BTDE 1DE7H 3LOXA 4FUIA 2TRMA 3O8BA 3A7YA 3A8BA 4WH8A 4CBNA 1O39A 1J17T 1C4Y2 1UVPA 2AGGX 3U8OH 5I46H 2GP9B 1Y5BT 4RSPA 4YO9A 3SORA 2SNVA 3ZZAA 1OSSA 1WCZA 1O5GH 1UTPA 4D7GA 4XSKU 3OX7U 2ZHDA 1BOQA 3SU6A 4ISNA 1EB1H 2CF8H 4X6NA 1VITG 3B23B 3A84A 4MDSA 1AVGH 2Z6BD 3Q00A 4AG1A 1ZJDA 2ZGHA 2UUFB 1P3EA 3ODFA 3OU0A 1O5CB 2NU3E 3S69A 7GCHF 3M35A 1ELTA 2AEIH 3TH3H 1SGQE 1C2FA 1ANEA 1EJMA 1Z6EA 2ZU5A 2PKAB 1PJPA 2VWLA 3BN9A 3E90B 2ZA5A 4CRBA 1H4WA 1ZRKA 4UFGH 1G3CA 2FI4E 2ZGXH 1BIOA 4CH2B 1BUIA 4LK4A 1O30A 2ULLA 1LVMA 4INHA 5F03A 1Y3YA 2C90B 3D65E 3TJUA 4DGJA 3P8NA 3ESTA 2BDGA 5F8ZA 1C5PA 1P09A 1TAWA 2H6MA 1QHRB 5DO4H 3SW2B 2J38A 1TPOA 3MNCA 2G5VA 2D26C 3BTKE 3W94A 1AI8H 1EZSC 2OCVB 3ZZ3A 1ZPBA 2FOGA 5B6OA 5CE1A 1O5FH 1QBOA 2ALVA 1QA7A 1QFKH 2ANWA 1F0SA 3VB6A 2ZFPH 3VPKA 1XUGA 1GHBG 3NWUA 3ZZ6A 1O3KA 3B8JA 3ZZ7A 1EZXC 4NA8A 2GMTC 1MBMA 1QTFA 5FHTA 1TNJA 4Q7XA 2UWLA 1ZLRA 4IMZA 1EB2A 4OGXA 2ZGJA 1ELCA 4ABDA 1QIXB 1A3EH 4OS5A 4DJZB 2OBQA 1ZMLA 3GY8A 4Y79A 2Z3EA 1CT4E 1KLJH 1YPEH 2IOTA 1BA8B 3EA9A 1HIAB 3PB1E 1SMFE 2AMPA 3KEEA 2F3CE 5EGMA 5K0HA 2SGPE 5DP5A 5PTPA 3T26A 1GL1A 5HM2A
chains in the Genus database with same CATH superfamily
2A7HA 2JETC 1AFQC 1EXFA 3EAJA 1FPHH 1GHAF 1RTKA 3G01A 3UNQA 4UFDH 2V0BA 4RKJB 4E06H 2RA3A 3RXIA 1CT2E 1TABE 1VJ9U 1O2JA 1SR5C 1GJ4H 3DSOA 2VVCA 1ZTJA 4NCYA 1O3HA 2KCOA 1TX6A 2PKAA 5E2OA 3RXOA 1O31A 4X1QU 2Y6TA 2AGEX 3PYHA 4CHAC 1WDIA 3GY4A 3LGYA 2FOMB 2EC9H 3IWMA 1YGCH 2B0FA 4WH6A 3LH3A 3LGWA 5EQRA 1ACBE 4ZKSU 1W10U 4A7IB 1O3GA 1YP9A 4LOYH 1AKSB 1YCPK 3S7HB 4M9FA 4AFUA 4F4OC 3A87A 2Q6FA 1CQQA 4VGCC 3O8RA 1OWHA 4B73A 3SI4H 1NROH 1VCWA 2XTTB 3TGJE 3PV4A 4DT7B 1GCTB 2GZ9A 1QJ1B 1FJSA 1A1RA 1AO5A 3QDZB 1GMDF 1KXDA 1GHWH 2R9PA 2RDEA 1WV7H 1PPCE 5SGAE 1EX3A 5GWZA 4I8KA 5E2PA 4X6MA 3TJOA 5C0TA 2FM2A 5A09A 1GHAG 3ZZBA 4BANB 1LHGH 1YF4A 2BTCE 1ZGVA 2JH6D 2YMSD 1NFWA 2BOHB 1PQ7A 3HKJB 1TONA 2KZ4A 1HIAA 2DE9A 3A8CA 2PSYA 4FOUC 3DSPA 1G37A 1MAYA 2A5IA 2FP7B 2HGTH 1FIZA 4JMYA 3MO9A 1BTYA 5C1YA 2IJD1 2QXJA 3RU4E 1IQEA 4X1RU 1SG8B 2GT7A 1W0KD 3V3MA 3SUGA 3D49H 2BX3A 2HOBA 2NU0E 3KIDU 5AFYH 3ZZ4A 3PMJA 4X6PA 1NBMD 1EASA 3RM0H 1EP5A 1EPTB 1S82A 1D3QB 1EKBB 2TGAA 1P2QA 1GDQA 1DM4B 2QYIA 1KXAA 1QJ7B 3UREA 4CRGA 2ODYB 2LELA 4Y0YE 2CGAA 5B6LA 1Q2WA 2FYQA 4K69A 1RD3B 1XVMA 2IPQX 2F83A 3EDXB 2BDCA 1LO6A 1S83A 1GG6B 4IN2A 3ZVAA 1WSSH 1HYLA 4B76A 2PFEA 1AKSA 5T6FA 2K8IA 1DY8A 3BIUH 1F5LA 1HUTH 3OFND 1O5EH 1P10A 3A81A 1NU7B 1KLIH 4AZ2B 2F9OA 2H5CA 1GI1A 2JJ2D 1MD8A 5ABWA 4I33A 1S5SA 3FO8D 1DLEA 1MTNB 4NFFA 3RXAA 1C5VA 3U8TH 4DT4A 4JZDH 1BRBE 4TPIZ 1S85A 4NWKA 3HK3B 3MNXA 1O2KA 3A89A 3M5LA 1C1OA 2VNTA 2K0QA 2LPRA 4XOJA 1V2KT 1CE5A 1EOLA 1NFYA 1TGCA 3A8AA 2BY7X 2XBWA 1TBZH 2R2MB 2ZHFH 1TA6A 2V3OH 2GCHF 2BD7A 1FAKH 3R3GB 4I7YH 1GBFA 2PUXB 4IBLH 1XUIA 2J95A 5FBEA 1HAVB 1SHHB 4LZ1H 3M61U 5A8YA 1T8LA 3KCGH 1FONA 1GDUA 3T27A 1CHGA 1NTPA 2FOEA 1C1MA 1ZSLA 4ABBA 2TBSA 3P95A 3P70B 3P92A 3MNSA 3GS9A 2ZU2A 3SU1A 4ABFA 1PPFE 2ZU3A 4NG9H 3T28A 5HMAA 2OK5A 3GYMA 2BVSH 2ZQ1A 3QO6A 5EQSA 1LQEA 2WPMS 1GI9B 1TNGA 3DFLA 5HGGA 2UUKB 1P03A 1HAZB 2ZI2H 1HDTH 3A86A 3LT3A 1EPTA 2SGFE 4X1NU 4IC5A 2OINA 1O3CA 4X2YA 5FCKA 3BTME 1QRXA 1JRSA 4MVNA 3M5NA 5ESTE 2OC8A 4ZMAH 2VIWA 2B7DH 1VCPA 5EJZA 5L2YH 2V3MA 3U69H 1B0EA 1CHOF 4FUHA 1GMHF 1CA8B 2ZFFH 1UK4A 4K1SA 5L2ZH 3N7OA 2CHAB 2GV7A 3MMGA 4CRCA 4HGCA 1XUJA 4B2AA 3UQVA 4WF8A 4A6LA 1MZDA 1AVXA 2W26A 1K1LA 2F9UA 4YZUA 3F2GA 2O8UA 3KYFA 4YOGA 2F9PA 1XUFA 1O3FA 1S6LA 7ESTE 5EW1H 3FOAA 1LPKB 1YPHC 2QA9E 2HWLB 3RC6A 1DT2A 1V2JT 1GPZA 2GCHG 2GJGA 2BM2A 1ELAA 4MPUA 4B6FA 1RS0A 3SUFA 1PPBH 1OKXA 1UTJA 2ZEBA 4JCNA 5A0BA 1FV9A 3U98H 2Y5HA 1P04A 4BAQB 1A5HA 2WPJS 1FY5A 1LPGB 5ETXA 2ZPSA 1BTZA 5DP4A 3S0NA 1O3NA 1TOCB 1K1NA 4I8GA 5EU8A 1UTMA 2VIOA 3TVJB 3VXEH 3AW1A 4X6OA 5C3NA 1OWDA 2CV3A 2VB0A 2V35A 2A0QB 1ZTKA 4UFFH 1QA0A 3JZ1B 3URDA 5C67A 3UPEA 4SGAE 1L0ZA 5DP6A 4Y76A 1L4ZA 3FZDA 1HAVA 2WPHS 2G51A 4BOHA 1J14A 1CHOG 3KQBA 1GMHG 3DFJA 1GMCF 4ZUHA 3UQOA 1A4WH 3MFJA 3KQ5A 2QE7D 3SBKA 2D2DA 1P2OA 2K1QA 2CMYA 5E0JA 2EI8A 1QBNA 1UVTH 3UNSA 1AB9C 1G2LA 2P3TB 1C5QA 3OAAD 4NWLA 1P06A 2BX4A 2XC0A 4Y7AA 3SNDA 2QGRA 4A92A 1UCYE 4Y10E 2KR7A 4TY7A 2Z9JA 2QIQA 4Y6DA 1OPHB 1IQNA 4KELA 4B6EA 3PRBA 1CGJE 2EI7A 4CH8B 5IYTA 5C1UA 2ZDNA 1JRTA 4FVDA 1ZSJA 1AN1E 3GCNA 3GCHB 4ISOA 1UCYK 2L74A 3DSGA 1T32A 1E0FD 2HLCA 2YNBA 3UY9A 2J2UA 1RFNA 3MOCA 1ZHMA 5A0CA 5C94A 4I8HA 2P3UB 2ZPRA 3SUDA 5FPYA 1COWD 2P95A 1HLTH 4AORA 5C1XA 4NIXA 5F53A 3PO1B 3Q77A 3M36A 2KCAA 1LHFH 1TWXB 3PRDA 1D3TB 4FUEA 4FUBA 4DURA 3QTVH 4BXWA 5FAHA 1T4UH 1FPCH 2QF3A 3PMHB 1F7ZA 3M3SA 1INCA 2PV9B 1MTWA 2UWOA 3SNAA 1DITH 1GMCG 1YPMH 5LPRA 1DWCH 1PQ8A 3A80A 4HG6A 1LPZB 2I6QA 3T62A 4ABJA 1SLWB 1LVOA 1E37B 1IQGA 5AFZH 1G32B 4F49A 1O2UA 3RP2A 1BRUP 2KM0A 2EY4C 3D62A 2C3SA 3ATLA 4UDWH 4Y0ZE 2IN2A 1F0UA 1WAYB 3UTUH 1TGSZ 3BEIB 1H8IH 3FVFB 3BF6H 5FX6A 1OP8A 2WHXA 2ZCLP 4RKOB 3SQEE 3KQDA 1S84A 1HV7A 3EGKH 3TITA 3MNBA 4RT1A 1BDAA 1RTFB 2ZFSA 2M5TA 1NS3A 2BDHA 4THNH 1OYQA 2AS9A 4AX9H 3TGIE 1QRZA 2OC0A 1IQHA 1K22H 2A32A 4Y11E 1SGPE 1T8MA 4BAHB 2CXVA 3K2UA 3SHAH 1HNEE 2WPLS 5AHGH 6GCHF 1BTWA 4U32A 3FAOA 2TGTA 3T2NA 1H8HD 2A4QA 3U1IB 1TRYA 3F6UH 1ZRBA 1QR3E 3ZZCA 1XX9A 4TSFD 4BNRA 2VINA 4ZROA 3FP7E 3AAVA 5HYOA 4Z1MD 1ESTA 1O36A 3U8RH 1K1OA 1BB0B 2XBXA 4NIWA 1TYNA 1KYNA 1P05A 1SGFG 3NXPA 1WTHD 1TLDA 1SGDE 3VB5A 5BPEA 4R8TB 2F91A 2BLVA 4ASUD 3MI4A 4ISHH 1T8NA 3RLWH 3E91A 2FZZA 1F0TA 4YXWD 3L6PA 2BQ6B 1PPGE 4XBCA 5DJ7A 3SGAE 3V0XA 1K1IA 4KKDA 2ZCHP 1K9OE 2JH0D 1MKWH 1O3IA 1W2KH 1ETSH 5E0GA 1YYY1 1TIOA 3MH7A 5JBCS 1IQMA 5GXPA 1GGDB 2NU2E 1EAXA 1O3JA 1C5SA 3M7UA 4B74A 1TQ7B 2AERH 1Q3XA 3DA9B 2GCTB 1C4V2 4AGJA 2FYRA 3GCOA 2C8YB 1G36A 1W0JD 1Z7KA 2A1DB 3GY7A 1YWUA 2KCYA 4XDEA 1A61H 2AMQA 2KFWA 2R0KA 1BMFD 4AB8A 1LHEH 2VGCB 5T3HA 1GI2A 2ZDAH 8KME2 5EXNA 6GCHG 3ZZ8A 3PV5A 5DPAA 2JJ1D 4ASHA 5ESBA 4BAKB 3LH1A 3M3VA 3BV9B 1AWHB 4GPGA 1NT1A 2BLOA 3OEHD 4B2BA 1NZQH 1ZMNA 2J97A 4GLYA 1C5XB 4OGYA 4OS4A 1HBTH 1LCYA 1TGTA 4BAMB 1P57B 1NM6A 2C8XB 4FUDA 4UEHH 3PWBA 2BDYA 5HM9A 1TX8A 1GBHA 2V6NA 2HNTF 2QXHA 1ARCA 1EZUC 1SGNE 5KECA 2BLQA 1GI3A 4NIVA 1K0HA 2GD4B 1V6DA 1GWAA 3F1SB 1F2SE 3URCA 3ITIA 1DVAH 3GCTF 2YOLA 4AYVB 3M37A 1ELVA 4KTSA 2QF0A 1QQUA 3MWIU 3UIRA 1AY6H 1EAIA 2A45B 2SFAA 2PGQB 1IHSH 3CP7A 2ZDMA 3ZVDA 3E16B 3UUZA 1YKTA 4P02A 1TBQH 1GCTC 5LGOA 1C5MD 3RXKA 1E36B 1FY4A 3SV9A 4M7GA 7GCHG 1HJAB 3ODDA 4ABAA 2BB4A 1HB0B 1F92A 5IDKA 2A5AA 1QB1A 1RGQA 2B9LA 2GT8A 4K3JA 1TB6H 1HAIH 4I32A 4FVBA 4MNWA 3TK6A 2ZFTA 3RM2H 2G00A 5DN6D 1RJXB 4BTIB 1SGCA 1BBRE 5CMXH 4CR5A 2CJIA 1ZHRA 1QQ4A 4HFPB 4Y71A 1ELEE 2A4OA 1V2MT 3B9FH 4X0WU 1NBME 2OXSA 3QX5H 1FY8E 3F0PA 1EP6A 5FPTA 2A31A 3TH2H 1U6QA 5EJ1A 4FETA 2SGEE 1BBRK 2RG3A 8ESTE 1NESE 2BD9A 4J2YB 1ZPZA 1KDQB 1G9IE 2H9HA 3ZIAD 2Z9IA 3RXBA 1ZPCA 1SL3A 2VJ1A 4ABHA 1C2HA 2GKVE 2ZDLA 1MKXK 1LDTT 1NRPH 1UHBB 3A85A 1VITH 1O5BB 4AFZA 1O2GH 1O2HA 2HLDD 1OWKA 1EPTC 2WPDD 3S9AA 1W11U 3RLYH 4MQAA 5EPYA 1BQYA 5GIBA 3F9GA 3BSQA 1GHZA 3SI3H 4LXBH 4JYVH 1DWEH 2XC5A 4ABGA 2FOFA 1NY22 1THPB 2C8ZB 2UUJB 4GCHF 3UOPA 1OP2A 4WMDA 1GG6C 3PV2A 4GSOA 4TWYA 3A83A 4YESB 1GJ8B 1YY3A 1F5RA 1A2CH 1YPJH 8GCHF 2FEQH 3RXDA 1P2KA 1SOZA 2BZAA 2Z9GA 1W13U 2R3UA 4HZHA 1HGTH 1W12U 4U01A 4YLQH 1W7XH 4INLA 2W6JD 1W14U 4K8BA 1C5NH 1GHVH 1V2QT 1J15A 1NRRH 1O2XA 2BXTH 2XC4A 4FU7A 1BJVA 1TRMA 1SLVB 2OLGA 2G4TA 1DOJA 1E1QD 1EAUA 2AFQB 4D76A 1MTNC 1Q31A 1YPGH 1MTSA 2BQWB 1JMOH 5FX5A 1AFEH 1TA2A 2BDAA 2ZHEH 1ABIH 1A46H 3K6ZA 3BTFE 1AIXH 3GOVB 4FU9A 1C5WB 1PYTC 3TK9A 2Y5FA 2VWOA 5JBBS 2A2QH 2GDDA 1IQFA 1D6WA 1TOMH 3WW7A 1OOKB 2G52A 1PPHE 4IN1A 1NC6A 3E8LA 3JZ2B 4F55A 1DFPA 2ZCKP 4K8YA 3RDZA 4X2WA 1UVOA 1DY9A 1G2MA 4CRDA 1O2SA 3PWCA 1KY9A 1W8BH 2BY6X 5CHAB 5J4SA 2ALPA 3ENSB 4X1PU 4GCHG 1BMLA 1GI4A 1KDQA 1XXDA 2AIQA 3M7TA 1AE5A 1P01A 2P93A 2A4GA 3DT0H 3SU2A 1KTTB 5JBTA 1V2LT 2STBE 1BCUH 2W5EA 3GY2A 2EQNA 1HCGA 2H2ZA 4A1VA 4U30A 1O5DH 5IK2D 1GI5A 1Z6JH 3A7ZA 3N7DA 8GCHG 1DWBH 1V2TT 1GMDG 2WPIS 3DD2H 1UHBA 3E6PH 1RIWC 1EJNA 2G55A 2P3FH 2Y7ZA 4NFEA 1AU8A 1C5UA 1XXFA 3VB3A 1HXFH 3F9EA 1EOJA 3IITA 3KL6A 2VIQA 1T8OA 2BQ7B 1Z71A 3DCLA 2P8OB 1EAWA 1BRCE 5GJ4B 4BTUB 5A8ZA 1GJ6A 1IAUA 3AK5A 2CHAC 2ESTE 5LH8A 1G30B 1TFXA 1X7AC 5FPSA 3SNBA 1SOTA 3SYJA 4O97A 3ZYEA 3SN8A 1ETRH 4ABEA 3T29A 2AMDA 2ZNKH 1KXFA 3NRLA 1GBMA 1QURH 3SZEA 1QL7A 2ZTXA 3RXJA 4YT6H 3SV6A 2FDAA 3HGNA 1UVSH 1S81A 3V12A 1MH0A 4WVPE 4Y8XA 1JIRA 1CT0E 1SFQB 2PLXA 5AF9H 3VB7A 3H7OA 3LC5A 3BTEE 2A5KA 1ZTLA 2HVXA 1YM0A 4MPWA 1IOEA 4AN7A 1E35B 4XBDA 3RXUA 1H8ED 3PLKA 1ESAA 5C20A 3BTHE 1IQJA 4JK5A 1P2NA 2BMGB 2Y7XA 3LU9B 2FO9A 2HNTE 3ZVCA 5AVDA 3P8FA 2DE8A 3BEFB 1TPPA 3Q3XA 1FMGA 1BTPA 1V2WT 4TT3D 2GV6A 1LMWB 1UTQA 1OWIA 3F9HA 3PMAB 6LPRA 2PTNA 3RXQA 1WUNH 3A7TA 1Z8GA 3Q76A 3E1XB 1H8DH 1SHYA 2PWXA 2A4RA 4O3TA 1OX1A 1IQLA 1YLDA 1Y5AT 2XCFA 1P3CA 1O2QA 1C5LH 3SJIA 1C5YB 2XWBI 2FLRH 1KTSB 1GI8B 2SNWA 5DP3A 2PKSB 4NZLA 3C1KA 2ZWLH 4JZFH 2QF4A 2LNCA 2ZKSA 2ZO3H 2WV4A 3OSYA 4Q7YA 3K6YA 5JYIA 3PMBB 2QCYA 3FFGA 2YMSB 1W3CA 3GY6A 1FDPA 4XBBA 2Y80A 1MUEB 1TPAE 1CA0B 3EA8A 3VGCB 3GDUA 1MD7A 5JB8S 4WMEA 1AGJA 1W0ZU 5HXFA 2J34A 5CDFE 3NPSA 4LZ4B 1O3MA 1C2GA 1EJAA 3RU4D 3N99A 2FWWA 5E0HA 2ZU4A 2RFKC 1A0LA 4D9QA 3MO3A 3LIWA 1O33A 5FXLA 1ARBA 1Y3VA 3GCHC 3C27B 2C4FH 5EODA 1XKAC 1GBCA 5CHBA 1K28D 1AHTH 2NU1E 5FBIA 2QXIA 1T31A 6CHAB 2PSXA 1OYTH 3WWFA 1ELDE 1E38B 4WY3A 2ZHWH 3PO1C 1M9UA 1N6YA 4DCDA 1KXBA 2WYJA 1KXCA 4CR9A 4WXIA 1K21H 1L2EA 2RA0A 3QWCH 1UCYH 8LPRA 1N8OB 2D8WA 3EYDA 1D3DB 1SGTA 1C2EA 1ID5H 3GICB 2O9QA 4Q80A 1UW7A 1MBQA 5F8TA 1O2IA 1P02A 4IGDA 2BZ6H 2VVVA 3UB0A 1YLCA 5EOKA 3RMOH 4CRFA 2XXLA 3VB4A 2B8OH 3ZZ9A 1HJ8A 1O3BA 1GBIA 1TGBA 2EA3A 4P00A 3FANA 1HAOH 3KHVA 3MH4A 1C5RA 1O5AB 1C1VH 2BVXH 1UK3A 1LQDB 3PLPA 3LGIA 2FS8A 4K5ZA 3RXGA 1P8VC 1TNIA 4CRAA 2A2XH 1N1LA 1GVZA 1JXPA 2FMJA 3KQEA 2FXRA 2XRCA 1QL8A 3LGUA 4WJG2 1ORFA 1TE0A 4K60A 3RXTA 4FU8A 1F5KU 3SQHE 2VIVA 2XWAA 2BY8X 4WMFA 1Z8RA 1LVYA 5BRRE 1H9IE 4FUFA 4A5TS 3PROA 3TNTA 4ZXXH 1O0DH 2QF5A 4X8UH 2BYAX 3MHWU 3A7WA 1MTUA 1P2MA 1SGRE 1BMNH 2PHBA 5DSFA 4KGAA 4DOQA 4RI0A 2BD2A 2WZQA 2ZG0H 2NU4E 1WBGB 1O35A 4F48B 5KEDA 1BHXF 4ESTE 1GBBA 2QN5T 2Z7FE 3MU8A 1FQ3A 2WV5A 3SJ9A 1NO9H 3GDVA 5JBAS 2ZP0H 1C1QA 5H4IB 1C5TA 2FTLE 4MPXA 3PLBA 2BHGA 4O03A 1MAXA 4GHTA 1FN8A 1GI0A 1O2LA 2QV1A 1FNIA 1GGDC 2VU8E 3SOSA 3F3BA 1BTHH 4MTBA 3ZVBA 3HGPA 1ANBA 2OTVA 3TLOA 4AFQA 4WWYA 2GCTC 2Z9LA 1WU1A 1P0SH 4DIHH 1ELFA 3BG4B 2O8MA 1S6FA 4Q2KA 5C2ZA 3K65B 4I8LA 3MH5A 4ZKRU 2VGCC 3EA7A 5EJLA 1IQIA 1ELGA 3NCLA 3SV7A 2DUCA 3A88A 2PP6A 1BITA 1SGFA 1HAPH 3MQKC 3TK5A 3VXFH 2H9TH 1XUKA 3RXMA 2J4IA 4MPVA 4HTCH 2ZGBH 2WUCA 1UK2A 1O2YA 1Y3WA 7LPRA 2ZGCA 2FS9A 3HPTB 3E3TA 2VIDA 1VITF 4ZHLU 1CBWB 1DWDH 4H42U 3SV8A 3ATIA 5T6GA 1A5GH 4FUJA 2AYWA 3BTWE 1DANH 4SGBE 4U2WA 4A1XA 1WYKA 1NRQH 5G4BA 1SBWA 4RN6A 3D23A 2VWMA 3HK6B 2XCNA 4A1TA 1O2OA 1JOUB 1UMAH 2GVFA 1C2LA 4NA7A 3SO3A 3SU4A 4XFQA 1VGCB 2GGVB 2W3KA 1ZR0A 2GDEH 4H4FA 3FN8A 2C8WB 4I86A 3Q3YA 1O2ZA 3BTGE 2Y82A 3SJ8A 5GDSH 3VEQB 3QUMP 1Z1JA 1Y3UA 9LPRA 2BLWA 2PR3A 3MU0A 2F43B 1ELBA 4OS6A 1BZXE 1FLEE 2OC7A 3QZRA 3L3TA 1HJAC 3H7TA 3AVZA 4MNXA 2WSSD 1NRNH 4Q4LA 3OYPA 1TNHA 3SU3A 3BTTE 4ZKNU 2P59A 2FOBA 3MH6A 1LTOA 4E7NA 4CBOA 2ODPA 4K1TA 4XD7D 5C0UA 3TGKE 2WINI 4X2VA 1GHBF 3WWBA 1V2OT 3M7QA 4NSVA 5L6NH 3F2HA 3MU4A 2UUYA 1O2WA 3EE7A 5DK1A 3UAIC 4OM9A 5JDUB 1C1PA 1FY3A 2W6ID 1H9HE 2ASUB 4BTTB 4OS2A 2GX4A 2J98B 1HPGA 2ANKH 3OEED 2G4UA 1BTXA 3M3TA 1QL9A 1P9SA 1W0YH 3SNEA 1YCPM 4Z6AH 5C5NA 1CGIE 5HIYA 1Y3XA 5F6MA 4KTCA 2WV9A 2ZHQH 3LPRA 3NZIA 3NK8A 1BBRH 1TMUH 3ATMA 5A8XA 2GZ8A 2ZDVH 1Y5UT 1V2PT 4X1SU 1BTUA 1C2DA 1XKBC 1QCPA 2Q6DA 4WXVA 1DUAA 5GCHF 3DUXH 2QAAA 2TGPZ 3P8OA 1EATA 1B7XB 2ZFRH 1O37A 1UJ1A 1NRSH 1MKXH 1MKWK 1MTVA 4MLFB 5DP8A 1V3XA 1GHXH 2QY0B 2OUAA 1GJBB 2JIZD 4X8TH 3RC4A 3KGPA 1C1SA 4H6SB 1AZZA 1RXPA 1GBEA 1AUJA 2H5DA 3QN7A 1NFXA 3ZVFA 4KTUA 2V7QD 3MYWA 4OS7A 1TRNA 3STIA 1YCPH 2RDLA 3OTJE 3F9FA 2VIPA 1S0RA 4YT7H 3H5CB 4ACBA 3U1JB 5A2MH 4CREA 4AOQA 4FXGH 1O3AA 1QNJA 3QLPH 4MG3A 3SUEA 3A8DA 5EG4A 1OHHD 2Y5GA 3EQ0H 4JYTA 4GVUA 3TPIZ 1PQ5A 2VWNA 1ESBA 2J9NA 2CF9H 5HIZA 3O8DA 4Y8ZA 1YLNA 2XOKD 1GJ9B 1LKAA 3A82A 4ACAA 1ZMJA 1VCQA 4NA9H 1SC8U 1AZ8A 1EZQA 2XBYA 3M5OA 4R0IA 4K2YA 2TGDA 3ZVGA 3RXRA 1GDNA 2ZTZA 3U9AH 5KGOA 3SJOA 1C2MA 2VVUA 3UFAA 2I6SA 3GCTG 5CHAC 2HALA 2THFB 1A0HB 4UE7H 3RXLA 3H09A 1CSOE 5GCHG 1O2VA 1ZYOA 4AB9A 2KAIB 1JIMA 1TMTH 4MNYA 4JZ1A 1QGFA 1V2UT 5EW2H 3N7EA 1TPSA 2FLBH 1NFUA 2C93B 1KIGH 1YBWA 3GYLB 2J98A 1O2MA 5T6DA 2R2WU 1L1JA 3IG6B 1OWEA 1O3LA 1NU9A 1VKYA 2HRVA 1L1NA 3ZZDA 4TWWA 1GJAB 1HAYB 1PYTD 3FP8E 3R0FA 1HAHH 2ZQ2A 1JWTA 3SU5A 2P8OC 1S6HA 3KYGA 3SZNA 1LHCH 1VZQH 4UD9H 1AMHA 2HVYB 1FAXA 3RXCA 3QK1A 4TPYA 1LHDH 2IJOB 3SJKA 1THRH 1OXGA 2F9BH 4XE4A 1C2KA 5C17A 1L4DA 4INKA 2J92A 2R0LA 3OTPA 1SGIB 1GBLA 2GMTB 2WPKS 5LPEA 4Y7BA 3SV2H 4ISLA 5FL7D 3ZV9A 5TCAA 4B71A 3MTYA 1DSUA 2F4LA 2ZPQA 1RTLA 3LGTA 3MU5A 4YOJA 1GI7B 3TIUA 1BMMH 1PPEE 2M2AA 1LVBA 5DG6A 2JKHA 4FUGA 5FCRA 3I77A 1GBAA 2G81E 1G3EA 5J4QA 1YPHE 4ZH8A 3OY6U 4Q63A 4Z0KA 1E34B 4ABIA 1J16A 4DG4A 3FZZA 1ETTH 2JETB 1D6RA 1TBRH 4X8VH 1AFQB 1MMJN 2PUQH 3RUOA 4ZHMU 2OD3B 3SU0A 1ZZZA 1LKBA 4UFEH 2WUBA 5DKMA 2SGDE 3RMLH 2UWPA 4DIIH 3SGQE 1ZGIA 3MO6A 2ZC9H 4ZCNA 3PTBA 1WTGH 3QGNB 3W95A 1SI5H 2Z3DA 3GY5A 2PKSC 2XYAA 3ZV8A 5C5OA 1O2TA 1CO7E 1SLXB 1P9UA 1G3DA 1C5OH 1DS2E 1AUTC 3UR9A 2Z9KA 2P94A 2KAIA 3VFEA 4CHAB 1P12E 2AH4X 1O3PB 2YMSC 2ZTYA 4E7RG 2W3IA 1HAGE 2PW8H 1C1UH 2ILNA 1KSNA 1CA0C 2Z3CA 3VGCC 3ELAH 1DX5M 3LONA 4NGAH 1O34A 2F9VA 1WQSA 3HATH 4HI3A 2FIRH 1QBVH 2ZDKA 2Q1JA 4X2XA 1WOFA 1CU1A 2FI5E 3K9XB 2HPQH 1SSXA 2SGAA 4VGCB 3KF2A 4B75A 1Z8IB 1T4VH 1UTNA 3P17H 1C2JA 3BIVH 3GISB 1S0QA 1QY6A 4OS1A 1MZAA 3STJA 2JH5D 2AGIX 4TYDA 2TIOA 6CHAC 1SQTA 3V7TA 1A7SA 5A0AE 3SGBE 1SB1H 4BAOB 4XRNA 5EPNA 4O9VA 1O3OA 3SHCH 1C2IA 1HAXB 1MCVA 1ANCA 1KXEA 3AASA 3QGJA 2GTBA 1GCDA 1O32A 1A0JA 4JK6A 4PROA 1ZSKA 2AIPA 1B5GH 1ZJKA 4IC6A 3RXSA 1N8OC 2EEKA 3I78A 3GDSA 1BJUA 5DP7A 1DXWA 1UTKA 1Z1IA 1EQ9A 1SQOA 1FUJA 2BD4A 3GY3A 4D9RA 1AVWA 4ISIH 1DICA 1GI6A 2BY5X 4JZEH 2OBOA 1EFRD 1QB9A 1HJ9A 1OP0A 5LPFA 1H9LB 2EI6A 1TALA 1TNKA 2D1JA 3CS7A 2SGQE 4YLUA 2ZZUH 4D7FA 1O3DA 1XM1A 1SGEE 1K1MA 1BRAA 3F2FA 1AQ7A 3RXVA 1FI8A 2BY9X 2B5TB 1GBKA 1K1PA 2BDBA 3RU4T 3KN2A 3RMMH 1FIWA 2RCEA 2VBCA 1GBJA 1RIWB 1O2PA 3TJVA 3LKWA 1SPJA 3KNXA 4GAWA 3S9CA 3T25A 3FKSD 1UTLM 2F9NA 3LJOA 3ATKA 3OE7D 4Q7ZA 4E05H 2NWNA 1DLKB 5EXMA 1T7CA 2FX4A 2OQ5A 2ZU1A 3CS0A 3F0OA 1YPKH 1D4PB 4DVAU 3SNCA 3ZZ5A 3LJJA 1MCTA 1ZOMA 3PTNA 4K1EA 1WXRA 3L33A 3P6ZB 1C1RA 1MU8B 5L30H 1J9CH 1YPLH 1SGYE 4NSYA 4I8JA 1UTOA 2ANMH 1Z8JB 4O3UA 2TPIZ 2O8TA 4H6TA 1DPOA 1OWJA 2HPPH 1P2JA 1V2RT 5F8XA 1SLUB 2O8LA 3OY5U 1C9TA 1BHXB 3AAUA 2BVRH 1NN6A 1L1GA 5HKKD 6ESTA 2A7JA 1XMNB 1W7GH 1PQAA 2YNAA 4AFSA 2Q6GA 2ZFQH 1WQVH 2IPHA 1IHTH 1O38A 2FESH 4ZKOU 4AYYB 3RMNH 2BOKA 1O3EA 4FUCA 3BG4C 4YTAA 1P2IA 2FOHA 4TY6A 3F68H 1HXEH 1J8AA 1DXPA 1VJAU 5TJXA 2ANYA 1GBTA 1GHYH 1C9PA 3UWIA 1Y59T 2PTCE 1D9IA 1F0RA 2P16A 3PM3A 1VR1H 2H1UA 1XVOA 1EUFA 1K1JA 4I31A 3LC3A 1THSH 1A5IA 4B1TA 1ABJH 1GJCB 2FODA 1SKYE 3W1EA 3AW0A 2Z94A 1C1TA 1H1BA 3UOUA 1O2RA 3HKIB 4BXSA 1FN6A 4DY7B 1CBWC 2G5NA 2BD3A 1FZZA 3EE0B 1B0FA 4IW4E 4KP0A 1KLTA 2O8WA 2QXGA 1SFIA 4MNVA 1GJ5H 4RT0A 3P8GA 3RXPA 3S9BA 3BG8A 3FP6E 1AD8H 4DW2U 1TGNA 4Y8YA 2VH6A 4AG2A 3ZVEA 2FTMA 1VGCC 2OQUA 2XW9A 2HNTC 2R3YA 2FPZA 2H9EH 1GVKB 4D8NA 5GNDA 1ANDA 9ESTA 1K2I1 1TQ0B 1GL0E 7KMEH 1Y8TA 3BEUA 3S7KB 1PPZA 2WYGA 3BTQE 2VH0A 3NUMA 1FXYA 3M5MA 4AGKA 1AE8H 1CGHA 2GZ7A 4JZIA 2OP9A 4GHQA 1O2NA 1TMBH 1V2ST 4ZHAA 1MQ6A 1P11E 4ZAEA 3ATWA 5TCCA 2PGBB 1JBUH 1UO6A 3RXFA 5JPMH 3A7XA 3RXHA 5K7RA 3E0NB 1BMAA 1FY1A 3A7VA 1BT7A 1V2VT 1UVUH 1MQ5A 4ZXYH 1AWFH 1CVWH 5EQQA 1SQAA 3ZYDA 3Q3KA 2JDID 3UNRA 5EXLA 1SVPA 3RXEA 2FOCA 1GVLA 2LP6A 3TH4H 2BDIA 2OC1A 4NIYA 3TNSA 3UR6A 4NZQA 5EIYA 4YM9A 2QC2A 1C1WH 2ZF0H 2CN0H 1GBDA 1C4U2 1DUEA 1PFXC 5DGJA 5DP9A 1TX7A 1QB6A 1MU6B 3QZQA 4JYUH 1HRTH 2STAE 1G3BA 1YC0A 2ZECA 2W7UA 2XBVA 3T5FH 1IQKA 1GJ7B 3TU7H 1DDJA 1V2NT 3TJNA 2V3HH 1AB9B 2A7CA 2G8TA 3WY8A 3O8CA 2KX4A 3CENA 4GUXA 4IMQA 1TNLA 1XUHA 5GPIB 3RC5A 3KQCA 1A3BH 3UWJH 1DSTA 5JB9S 1N6XA 2BD8A 3E0PB 4UONA 1QRWA 1GJDB 1HFDA 2W7SA 2FOAA 4J1YA 1NPMA 2BD5A 2Y81A 1QJ6B 3I29A 4IS5A 3NKKA 3V13A 1RRKA 3MU1A 2J94A 3QTOH 1C1NA 3VG8A 1D3PB 2XNIA 4B2CA 2ZIQH 4YOIA 3LGVA 1C5ZB 4QT8C 2BXUH 2KCPA 2ODQA 3DHKH 1ZHPA 5E8EH 3LDXH 2FI3E 2FX6A 1OS8A 4X8SH 5I25A 3BTDE 1DE7H 3LOXA 4FUIA 2TRMA 3O8BA 3A7YA 3A8BA 4WH8A 4CBNA 1O39A 1J17T 1C4Y2 1UVPA 2AGGX 3U8OH 5I46H 2GP9B 1Y5BT 4RSPA 2XNDD 4YO9A 3SORA 1KMHB 2SNVA 3ZZAA 1OSSA 1WCZA 1O5GH 1UTPA 4D7GA 1E79D 3OX7U 4XSKU 2ZHDA 1BOQA 3SU6A 4ISNA 1EB1H 2CF8H 4X6NA 1VITG 3B23B 3A84A 4MDSA 1AVGH 2Z6BD 3Q00A 4AG1A 1ZJDA 2ZGHA 2UUFB 1P3EA 3ODFA 3OU0A 1O5CB 2NU3E 3S69A 7GCHF 3M35A 4AC9A 1ELTA 2AEIH 3TH3H 1SGQE 1C2FA 1ANEA 1EJMA 1Z6EA 2ZU5A 2PKAB 1PJPA 2VWLA 3BN9A 3E90B 2ZA5A 4CRBA 1H4WA 1ZRKA 4UFGH 2CK3D 1G3CA 2FI4E 2ZGXH 1BIOA 4CH2B 1BUIA 4LK4A 1O30A 2ULLA 1LVMA 4INHA 5F03A 1Y3YA 2C90B 3D65E 3TJUA 4DGJA 3P8NA 3ESTA 2BDGA 5F8ZA 1C5PA 1P09A 1TAWA 2H6MA 1QHRB 5DO4H 3SW2B 2J38A 1TPOA 3MNCA 2G5VA 2D26C 3BTKE 1FX0B 3W94A 1AI8H 1EZSC 2OCVB 3ZZ3A 1ZPBA 2FOGA 5B6OA 5CE1A 1O5FH 1QBOA 2ALVA 1QA7A 1QFKH 2ANWA 2L6OA 1F0SA 3VB6A 2ZFPH 3VPKA 1XUGA 3U28C 1GHBG 3NWUA 3ZZ6A 1O3KA 3B8JA 3ZZ7A 1EZXC 4NA8A 2GMTC 1MBMA 1QTFA 5FHTA 1TNJA 4Q7XA 2UWLA 1ZLRA 4IMZA 1EB2A 4OGXA 1E1RD 2ZGJA 2AHME 1ELCA 5T1VA 4ABDA 1QIXB 1A3EH 4OS5A 4DJZB 2OBQA 1ZMLA 3GY8A 4Y79A 2Z3EA 1CT4E 1KLJH 1YPEH 2IOTA 1BA8B 3EA9A 1HIAB 3PB1E 1SMFE 2AMPA 3KEEA 2F3CE 5EGMA 2J5UA 3CNRA 1MABB 5K0HA 2SGPE 5DP5A 5PTPA 3T26A 1GL1A 5HM2A 1QZ8A 1SQRA
chains in the Genus database with same CATH topology
2A7HA 2JETC 1AFQC 1EXFA 3EAJA 1FPHH 1GHAF 1RTKA 3G01A 3UNQA 4UFDH 2V0BA 4RKJB 4E06H 2RA3A 3RXIA 1CT2E 1TABE 1VJ9U 1O2JA 1SR5C 1GJ4H 2VVCA 1ZTJA 4NCYA 1O3HA 5E2OA 2PKAA 1TX6A 3RXOA 1O31A 4X1QU 2Y6TA 2AGEX 3PYHA 4CHAC 3GY4A 3LGYA 2FOMB 2EC9H 3IWMA 1YGCH 2B0FA 4WH6A 3LH3A 3LGWA 5EQRA 1ACBE 4ZKSU 1W10U 4A7IB 1O3GA 1YP9A 4LOYH 1AKSB 1YCPK 3S7HB 4AFUA 4F4OC 3A87A 2Q6FA 1CQQA 4VGCC 3O8RA 1OWHA 4B73A 3SI4H 1NROH 1VCWA 2XTTB 3TGJE 3PV4A 4DT7B 1GCTB 2GZ9A 1QJ1B 1FJSA 1A1RA 1AO5A 3QDZB 1GMDF 1KXDA 1GHWH 2R9PA 1WV7H 1PPCE 5SGAE 1EX3A 5GWZA 4I8KA 5E2PA 4X6MA 3TJOA 2FM2A 5A09A 1GHAG 3ZZBA 4BANB 1LHGH 1YF4A 2BTCE 1ZGVA 2JH6D 1NFWA 2BOHB 1PQ7A 3HKJB 1TONA 1HIAA 2DE9A 3A8CA 2PSYA 1G37A 1MAYA 2A5IA 2FP7B 2HGTH 1FIZA 4JMYA 3MO9A 1BTYA 5C1YA 3RU4E 2QXJA 1IQEA 4X1RU 1SG8B 2GT7A 3V3MA 3SUGA 3D49H 2BX3A 2HOBA 2NU0E 3KIDU 5AFYH 3ZZ4A 3PMJA 4X6PA 1EASA 3RM0H 1EP5A 1EPTB 1S82A 1D3QB 1EKBB 2TGAA 1P2QA 1GDQA 1DM4B 2QYIA 1KXAA 1QJ7B 3UREA 4CRGA 2ODYB 4Y0YE 2CGAA 1Q2WA 2FYQA 4K69A 1RD3B 1XVMA 2F83A 3EDXB 2BDCA 1LO6A 1S83A 1GG6B 4IN2A 3ZVAA 1WSSH 1HYLA 4B76A 2PFEA 1AKSA 5T6FA 1DY8A 3BIUH 1F5LA 1HUTH 1O5EH 1P10A 3A81A 1NU7B 1KLIH 4AZ2B 2F9OA 2H5CA 1GI1A 1MD8A 5ABWA 4I33A 1S5SA 1DLEA 1MTNB 4NFFA 3RXAA 1C5VA 3U8TH 4JZDH 1BRBE 4TPIZ 1S85A 4NWKA 3HK3B 3MNXA 1O2KA 3A89A 3M5LA 1C1OA 2VNTA 2LPRA 4XOJA 1V2KT 1CE5A 1EOLA 1NFYA 1TGCA 3A8AA 2BY7X 2XBWA 1TBZH 2R2MB 2ZHFH 1TA6A 2V3OH 2GCHF 2BD7A 1FAKH 3R3GB 4I7YH 1GBFA 2PUXB 4IBLH 1XUIA 2J95A 5FBEA 1HAVB 1SHHB 4LZ1H 3M61U 5A8YA 1T8LA 3KCGH 1FONA 1GDUA 3T27A 1CHGA 1NTPA 2FOEA 1C1MA 1ZSLA 4ABBA 2TBSA 3P95A 3P70B 3P92A 3MNSA 2ZU2A 3SU1A 4ABFA 1PPFE 2ZU3A 4NG9H 3T28A 5HMAA 3GYMA 2BVSH 2ZQ1A 3QO6A 5EQSA 1LQEA 2WPMS 1GI9B 1TNGA 3DFLA 5HGGA 2UUKB 1P03A 1HAZB 2ZI2H 1HDTH 3A86A 3LT3A 1EPTA 2SGFE 4X1NU 4IC5A 2OINA 1O3CA 4X2YA 5FCKA 3BTME 1QRXA 1JRSA 4MVNA 3M5NA 5ESTE 2OC8A 4ZMAH 2VIWA 2B7DH 1VCPA 5L2YH 3U69H 1B0EA 1CHOF 4FUHA 1GMHF 1CA8B 2ZFFH 1UK4A 4K1SA 5L2ZH 3N7OA 2CHAB 2GV7A 3MMGA 4CRCA 4HGCA 1XUJA 4B2AA 3UQVA 4WF8A 4A6LA 1MZDA 1AVXA 2W26A 1K1LA 2F9UA 4YZUA 2O8UA 4YOGA 2F9PA 1XUFA 1O3FA 7ESTE 5EW1H 1LPKB 1YPHC 2QA9E 2HWLB 3RC6A 1DT2A 1V2JT 1GPZA 2GCHG 2BM2A 1ELAA 4MPUA 1RS0A 3SUFA 1PPBH 1OKXA 1UTJA 2ZEBA 4JCNA 5A0BA 1FV9A 3U98H 2Y5HA 1P04A 4BAQB 1A5HA 2WPJS 1FY5A 1LPGB 5ETXA 2ZPSA 1BTZA 5DP4A 3S0NA 1O3NA 1TOCB 1K1NA 4I8GA 5EU8A 1UTMA 2VIOA 3TVJB 3VXEH 3AW1A 4X6OA 5C3NA 1OWDA 2CV3A 2VB0A 2V35A 2A0QB 1ZTKA 4UFFH 1QA0A 3JZ1B 3URDA 5C67A 3UPEA 4SGAE 1L0ZA 5DP6A 4Y76A 1L4ZA 3FZDA 1HAVA 2WPHS 2G51A 4BOHA 1J14A 1CHOG 3KQBA 1GMHG 3DFJA 1GMCF 4ZUHA 3UQOA 1A4WH 3MFJA 3SBKA 2D2DA 1P2OA 2K1QA 2CMYA 5E0JA 2EI8A 1QBNA 1UVTH 3UNSA 1AB9C 1G2LA 2P3TB 1C5QA 4NWLA 1P06A 2BX4A 2XC0A 4Y7AA 3SNDA 2QGRA 4A92A 1UCYE 4Y10E 4TY7A 2Z9JA 2QIQA 4Y6DA 1OPHB 1IQNA 4KELA 1CGJE 2EI7A 4CH8B 5IYTA 5C1UA 2ZDNA 1JRTA 4FVDA 1ZSJA 1AN1E 3GCNA 3GCHB 4ISOA 1UCYK 3UY9A 1T32A 1E0FD 2HLCA 2YNBA 2J2UA 1RFNA 3MOCA 1ZHMA 5A0CA 4I8HA 2P3UB 2ZPRA 3SUDA 5FPYA 2P95A 1HLTH 4AORA 5C1XA 4NIXA 3PO1B 3Q77A 3M36A 1LHFH 1TWXB 4FUEA 1D3TB 4DURA 4FUBA 3QTVH 4BXWA 5FAHA 1T4UH 1FPCH 2QF3A 3PMHB 1F7ZA 3M3SA 1INCA 2PV9B 1MTWA 2UWOA 3SNAA 1DITH 1GMCG 1YPMH 5LPRA 1DWCH 1PQ8A 3A80A 1LPZB 2I6QA 3T62A 4ABJA 1SLWB 1LVOA 1E37B 1IQGA 5AFZH 1G32B 4F49A 1O2UA 3RP2A 1BRUP 3D62A 2C3SA 3ATLA 4UDWH 4Y0ZE 2IN2A 1F0UA 1WAYB 3UTUH 1TGSZ 3BEIB 1H8IH 3FVFB 3BF6H 5FX6A 1OP8A 3SQEE 2ZCLP 4RKOB 3KQDA 1S84A 1HV7A 3EGKH 3TITA 3MNBA 1BDAA 1RTFB 2ZFSA 2M5TA 1NS3A 2BDHA 4THNH 1OYQA 2AS9A 4AX9H 3TGIE 1QRZA 2OC0A 1IQHA 1K22H 2A32A 4Y11E 1SGPE 1T8MA 4BAHB 2CXVA 3K2UA 3SHAH 1HNEE 2WPLS 5AHGH 6GCHF 1BTWA 4U32A 3FAOA 2TGTA 3T2NA 2A4QA 3U1IB 1TRYA 3F6UH 1ZRBA 1QR3E 3ZZCA 1XX9A 4BNRA 2VINA 4ZROA 3FP7E 3AAVA 5HYOA 1ESTA 1O36A 3U8RH 1K1OA 1BB0B 2XBXA 4NIWA 1TYNA 1KYNA 1P05A 1SGFG 3NXPA 1WTHD 1TLDA 1SGDE 3VB5A 5BPEA 4R8TB 2F91A 2BLVA 3MI4A 4ISHH 1T8NA 3RLWH 3E91A 2FZZA 1F0TA 3L6PA 2BQ6B 1PPGE 4XBCA 5DJ7A 3SGAE 3V0XA 1K1IA 4KKDA 2ZCHP 1K9OE 2JH0D 1MKWH 1O3IA 1W2KH 1ETSH 5E0GA 1YYY1 1TIOA 3MH7A 5JBCS 1IQMA 5GXPA 1GGDB 2NU2E 1EAXA 1O3JA 1C5SA 3M7UA 4B74A 1TQ7B 2AERH 1Q3XA 3DA9B 2GCTB 1C4V2 4AGJA 2FYRA 3GCOA 2C8YB 1G36A 1Z7KA 2A1DB 3GY7A 4XDEA 1A61H 2AMQA 2R0KA 4AB8A 1LHEH 2VGCB 5T3HA 1GI2A 2ZDAH 8KME2 5EXNA 6GCHG 3ZZ8A 5DPAA 4ASHA 4BAKB 5ESBA 3LH1A 3M3VA 3BV9B 1AWHB 4GPGA 1NT1A 2BLOA 4B2BA 1NZQH 1ZMNA 4GLYA 4OGYA 1C5XB 4OS4A 1HBTH 1LCYA 1TGTA 4BAMB 1P57B 1NM6A 2C8XB 4FUDA 4UEHH 3PWBA 2BDYA 5HM9A 1TX8A 1GBHA 2V6NA 2HNTF 2QXHA 1ARCA 1EZUC 1SGNE 2BLQA 1GI3A 4NIVA 2GD4B 1V6DA 1GWAA 3F1SB 1F2SE 3URCA 3ITIA 1DVAH 3GCTF 2YOLA 4AYVB 3M37A 1ELVA 4KTSA 2QF0A 1QQUA 3MWIU 3UIRA 1AY6H 1EAIA 2A45B 2SFAA 2PGQB 1IHSH 3CP7A 2ZDMA 3ZVDA 3E16B 3UUZA 1YKTA 1TBQH 1GCTC 5LGOA 1C5MD 3RXKA 1E36B 1FY4A 3SV9A 4M7GA 7GCHG 1HJAB 3ODDA 4ABAA 2BB4A 1HB0B 1F92A 5IDKA 2A5AA 1QB1A 1RGQA 2B9LA 2GT8A 4K3JA 1TB6H 1HAIH 4I32A 4FVBA 4MNWA 3TK6A 2ZFTA 3RM2H 2G00A 1RJXB 4BTIB 1SGCA 1BBRE 5CMXH 4CR5A 2CJIA 1ZHRA 1QQ4A 4HFPB 4Y71A 1ELEE 2A4OA 1V2MT 3B9FH 4X0WU 2OXSA 3QX5H 1FY8E 1EP6A 5FPTA 2A31A 3TH2H 1U6QA 2SGEE 1BBRK 2RG3A 8ESTE 1NESE 2BD9A 4J2YB 1ZPZA 1KDQB 1G9IE 2H9HA 2Z9IA 3RXBA 1ZPCA 1SL3A 2VJ1A 4ABHA 1C2HA 2GKVE 2ZDLA 1MKXK 1LDTT 1NRPH 1UHBB 3A85A 1VITH 1O5BB 4AFZA 1O2GH 1O2HA 1OWKA 1EPTC 3S9AA 1W11U 3RLYH 4MQAA 5EPYA 1BQYA 5GIBA 3F9GA 3BSQA 1GHZA 3SI3H 4LXBH 4JYVH 1DWEH 2XC5A 4ABGA 2FOFA 1NY22 1THPB 2C8ZB 2UUJB 4GCHF 3UOPA 1OP2A 4WMDA 1GG6C 4GSOA 4TWYA 3A83A 4YESB 1GJ8B 1F5RA 1A2CH 1YPJH 8GCHF 2FEQH 3RXDA 1P2KA 1SOZA 2BZAA 2Z9GA 1W13U 2R3UA 4HZHA 1HGTH 1W12U 4U01A 4YLQH 1W7XH 4INLA 1W14U 4K8BA 1C5NH 1GHVH 1V2QT 1J15A 1NRRH 1O2XA 2BXTH 2XC4A 4FU7A 1BJVA 1TRMA 1SLVB 2OLGA 2G4TA 1DOJA 2AFQB 1EAUA 4D76A 1MTNC 1Q31A 1YPGH 1MTSA 2BQWB 1JMOH 5FX5A 1AFEH 1TA2A 2BDAA 2ZHEH 1ABIH 1A46H 3K6ZA 3BTFE 1AIXH 3GOVB 4FU9A 1C5WB 1PYTC 3TK9A 2Y5FA 2VWOA 5JBBS 2A2QH 2GDDA 1IQFA 1D6WA 1TOMH 1OOKB 2G52A 1PPHE 4IN1A 1NC6A 3E8LA 3JZ2B 1DFPA 2ZCKP 4K8YA 3RDZA 4X2WA 1UVOA 1DY9A 1G2MA 4CRDA 1O2SA 3PWCA 1KY9A 1W8BH 2BY6X 5CHAB 5J4SA 2ALPA 3ENSB 4X1PU 4GCHG 1BMLA 1GI4A 1KDQA 1XXDA 2AIQA 3M7TA 1AE5A 1P01A 2P93A 2A4GA 3DT0H 3SU2A 1KTTB 5JBTA 1V2LT 2STBE 1BCUH 2W5EA 3GY2A 1HCGA 2H2ZA 4A1VA 4U30A 1O5DH 1GI5A 1Z6JH 3A7ZA 8GCHG 1DWBH 1V2TT 1GMDG 2WPIS 3DD2H 1UHBA 3E6PH 1RIWC 1EJNA 2G55A 2P3FH 2Y7ZA 4NFEA 1AU8A 1C5UA 1XXFA 3VB3A 1HXFH 3F9EA 1EOJA 3IITA 3KL6A 2VIQA 1T8OA 2BQ7B 1Z71A 2P8OB 1EAWA 1BRCE 5GJ4B 4BTUB 5A8ZA 1GJ6A 1IAUA 2CHAC 2ESTE 5LH8A 1G30B 1TFXA 1X7AC 5FPSA 3SNBA 1SOTA 4O97A 3ZYEA 3SN8A 1ETRH 4ABEA 3T29A 2AMDA 2ZNKH 1KXFA 1GBMA 1QURH 1QL7A 2ZTXA 3RXJA 4YT6H 3SV6A 2FDAA 3HGNA 1UVSH 1S81A 3V12A 1MH0A 4WVPE 4Y8XA 1JIRA 1CT0E 1SFQB 2PLXA 5AF9H 3VB7A 3H7OA 3LC5A 3BTEE 2A5KA 1ZTLA 2HVXA 1YM0A 4MPWA 1IOEA 4AN7A 1E35B 4XBDA 3RXUA 3PLKA 1ESAA 5C20A 3BTHE 1IQJA 4JK5A 1P2NA 2BMGB 2Y7XA 3LU9B 2FO9A 2HNTE 3ZVCA 5AVDA 3P8FA 2DE8A 3BEFB 1TPPA 3Q3XA 1FMGA 1BTPA 1V2WT 2GV6A 1LMWB 1UTQA 1OWIA 3F9HA 3PMAB 6LPRA 2PTNA 3RXQA 1WUNH 3A7TA 1Z8GA 3Q76A 3E1XB 1H8DH 1SHYA 2PWXA 2A4RA 4O3TA 1OX1A 1IQLA 1YLDA 1Y5AT 2XCFA 1P3CA 1O2QA 1C5LH 3SJIA 1C5YB 2XWBI 2FLRH 1KTSB 1GI8B 2SNWA 5DP3A 2PKSB 4NZLA 3C1KA 2ZWLH 4JZFH 2LNCA 2ZKSA 2ZO3H 2WV4A 3OSYA 4Q7YA 3K6YA 5JYIA 3PMBB 2QCYA 3FFGA 1W3CA 3GY6A 1FDPA 4XBBA 2Y80A 1MUEB 1TPAE 1CA0B 3EA8A 3VGCB 3GDUA 1MD7A 5JB8S 4WMEA 1AGJA 1W0ZU 5HXFA 2J34A 3NPSA 4LZ4B 1O3MA 1C2GA 1EJAA 3RU4D 2FWWA 5E0HA 2ZU4A 1A0LA 4D9QA 3MO3A 3LIWA 1O33A 5FXLA 1ARBA 1Y3VA 3GCHC 3C27B 2C4FH 5EODA 1XKAC 1GBCA 1K28D 1AHTH 2NU1E 5FBIA 2QXIA 1T31A 6CHAB 2PSXA 1OYTH 1ELDE 1E38B 4WY3A 2ZHWH 3PO1C 1M9UA 1N6YA 4DCDA 1KXBA 2WYJA 1KXCA 4CR9A 4WXIA 1K21H 1L2EA 2RA0A 3QWCH 1UCYH 8LPRA 1N8OB 2D8WA 3EYDA 1D3DB 1SGTA 1C2EA 1ID5H 3GICB 2O9QA 4Q80A 1MBQA 5F8TA 1O2IA 1P02A 4IGDA 2BZ6H 2VVVA 1YLCA 5EOKA 3RMOH 4CRFA 2XXLA 3VB4A 2B8OH 3ZZ9A