4MNVA

Crystal structure of bicyclic peptide uk729 bound as an acyl-enzyme intermediate to urokinase-type plasminogen activator (upa)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Urokinase-type plasminogen activator chain B
publication title Peptide ligands stabilized by small molecules.
pubmed doi rcsb
source organism Homo sapiens
total genus 58
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2013-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4mnvA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4mnvA01
4OGYA 3B23B 3AW0A 4DIHH 1BTYA 3SJKA 1B0EA 5JDUB 5E0HA 1SC8U 3ZYDA 1MKXK 4ZUHA 1EB2A 4IC6A 2TGDA 1UTOA 4X1QU 5G4BA 1T8OA 2D8WA 1PPGE 8ESTE 2VIDA 3U8RH 1V2ST 4AB9A 3FFGA 2ZPQA 4DY7B 4CRBA 1SVPA 2TBSA 3SI4H 2FDAA 1THRH 1SL3A 1UTPA 4WY3A 4ABIA 1NU9A 2GX4A 5LH8A 4JMYA 3MOCA 3IG6B 5EODA 1ABJH 1INCA 4I8KA 3S9AA 1N1LA 1SOTA 1A7SA 3GDVA 3GY3A 4X1RU 1DT2A 4U30A 5EU8A 2R2WU 2J94A 1NC6A 1G3CA 3LC3A 3Q77A 3G01A 1O3MA 1FN8A 4JZDH 4AG2A 1D9IA 2G51A 1A3EH 2B7DH 2Y7ZA 2UWOA 3OSYA 1UCYE 4ESTE 2D26C 3RXDA 1CHOG 1O5DH 4GAWA 4NA9H 1CSOE 2SFAA 1H9IE 2AMDA 1W7GH 2XCNA 1FMGA 6CHAB 1OWKA 2W26A 1DVAH 3T29A 1IQIA 1YBWA 1ZTJA 2HPPH 4QT8C 1BBRH 2Y6TA 5JB8S 1XX9A 1LHCH 3TK5A 3MHWU 1QY6A 1GMHG 1VCPA 2HLCA 2QA9E 2FTMA 4OGXA 4AB8A 3F68H 1GHAG 4CRCA 3TH3H 5JB9S 1JMOH 4FUJA 3SUGA 2OC7A 1C1TA 5LPFA 1CT2E 3A89A 1O2GH 1IQHA 1V2NT 1GI3A 1QGFA 1EB1H 1KXDA 1G2LA 1GBKA 1TGTA 2QXHA 2CF8H 1AGJA 1SQTA 2HOBA 2RA0A 4FU7A 4RKJB 2BVXH 1TNHA 2P16A 4U32A 4YLUA 2PKAB 1O33A 4H6TA 3DA9B 1EAIA 1L0ZA 3PMAB 3GY4A 4IS5A 1DWCH 5HMAA 3ZZ6A 2OC0A 4AGKA 1EOLA 1ZGIA 1FI8A 1C2HA 2P3TB 4BXSA 4X6OA 3QLPH 3TU7H 5T6DA 4ZHLU 3QDZB 2ZDAH 4NGAH 1O3JA 3BV9B 2GMTB 1HIAB 1VGCC 4ABFA 3F9EA 1BTXA 1RIWB 3ZZBA 2BDBA 4YM9A 5DO4H 1Y5UT 3MU1A 3MU5A 1GBCA 1O36A 2H6MA 3OYPA 5LPEA 1HJAB 2PLXA 2WPHS 4WF8A 5A0CA 2EC9H 3KQEA 4E05H 1TOCB 1C1SA 1TBRH 1GI1A 1P3CA 3U1JB 3IITA 3EAJA 4NIVA 1ZYOA 1KLJH 1Z6EA 1GI8B 2GD4B 2ESTE 2W7UA 1C5ZB 1T31A 3SU5A 4MDSA 3BG8A 4XBBA 3SZNA 1OWIA 1C2MA 5DP9A 1UK4A 1ZJDA 1BBRE 2SGAA 1IQMA 1MKXH 3TK9A 3TH4H 1FPCH 1C1NA 1HBTH 1QNJA 1JWTA 4NSYA 4O3UA 1G37A 5GCHF 3BEIB 4AFUA 3T2NA 1VCWA 1O2SA 5AF9H 1YLDA 1PYTD 2F3CE 4YESB 1TABE 2AIPA 5JYIA 3M3TA 3PB1E 1CT4E 1O2TA 2GTBA 3RXSA 1C1RA 1P2JA 1G9IE 2SNWA 1T8LA 1ANCA 1ELBA 4NIXA 3H7TA 3FP6E 1EAWA 4DT7B 3I78A 2ZC9H 3A7WA 1N6YA 3T26A 4ZXYH 4X2VA 4Y0YE 1ZRBA 1F5KU 3K6YA 2CHAC 1YCPK 1D3QB 5DP8A 3LGWA 1BITA 1PQ7A 3O8CA 2XTTB 1SGPE 2A45B 5C67A 1T4UH 1F0UA 4XOJA 3TVJB 2ZGHA 4UFDH 1W14U 1GI0A 1V2PT 1W0YH 5GDSH 1OXGA 4X6PA 1AU8A 5E2PA 5FX6A 3ZVAA 1ELTA 3MTYA 1ZTKA 4I8GA 1DUEA 2HNTC 1O3KA 4D7FA 1DWBH 1KXBA 3MNSA 2YNBA 1JIRA 1YC0A 2O8LA 1HGTH 1ZMJA 4Y8XA 5F03A 3SGBE 1O2RA 3GISB 1GI9B 2F83A 2TRMA 4BTTB 4FUHA 4NZLA 1S83A 2ZPRA 1U6QA 3K9XB 3MNCA 1TBQH 1A0JA 2WYJA 3M35A 1Y5AT 1GGDB 1SGYE 1C5SA 1D6RA 3TNSA 1AO5A 4ISNA 2QF0A 1YYY1 2OTVA 2FODA 1YLCA 5GPIB 4XSKU 2ZU3A 2CMYA 9LPRA 1WQSA 3PROA 4FU8A 1GBJA 2BXTH 2R9PA 3RXOA 1EP5A 1DXPA 2ANYA 1S84A 1LDTT 1Z8RA 3HK3B 2BVRH 4NFFA 5E0JA 3VXFH 1SHHB 4ABHA 2ODYB 2WPJS 1KTSB 1DDJA 2XWBI 4LK4A 3GY5A 3BTQE 2SNVA 4MVNA 2XC0A 1V2VT 1EPTB 3HKJB 3ATLA 3K6ZA 1E34B 1NFYA 3P92A 1XKAC 3UR6A 1V2LT 4ABBA 1C5XB 3ESTA 1NU7B 3SUEA 1ARBA 1EAUA 1O38A 4HTCH 2FLRH 4UE7H 1UVPA 2YOLA 3BTHE 1C5LH 1JBUH 1FDPA 1D4PB 3PWBA 3A8BA 1ZPZA 2QY0B 3GCTF 4NIWA 4INKA 3SBKA 1RXPA 3ATKA 2Y82A 2EA3A 1A5IA 2NU4E 4X2WA 1K1LA 3BG4C 1AFQB 2VWLA 3K65B 3T27A 1BOQA 2STBE 1H8DH 2ZDNA 1O2UA 1ZSLA 1G2MA 1AVXA 3RXMA 1CGHA 1ELCA 1C5WB 2OCVB 3VGCB 1ZOMA 2Y7XA 5CHAB 1EZSC 3A84A 1ZMNA 4OS1A 5HGGA 2ALVA 4K60A 4FVDA 2PGQB 3AASA 1F5LA 5ABWA 2O8TA 1OP8A 4AZ2B 1ID5H 3D62A 3GDUA 3LH3A 2ODQA 1PPFE 1HAGE 1RJXB 4Y76A 1TOMH 4D76A 1O3HA 2V3OH 1TE0A 1O3GA 5EXMA 3VB6A 2JKHA 4TWWA 2GZ7A 2FZZA 2FOAA 1GJ5H 4XBDA 2JH6D 1QB1A 3DFJA 2PUXB 3PMHB 3KHVA 2VWNA 1DWDH 3NCLA 2Y5GA 1N6XA 6LPRA 3SNBA 1TGBA 3E8LA 1OWHA 1KXEA 3O8DA 2HPQH 2JETC 6ESTA 5ETXA 1S0RA 2FX4A 3HATH 2LNCA 3SUFA 3P95A 1OKXA 3M5NA 2J38A 3GY8A 1YCPH 4F4OC 1GDQA 3QTOH 1AQ7A 1IQEA 4Q80A 1NRRH 2FOEA 4X6MA 3M7QA 3RMLH 2GZ9A 5K0HA 1O2OA 4HZHA 3SV8A 3A87A 4H6SB 1TNJA 2C93B 2Z94A 5EOKA 1UVTH 4K1EA 1GMCG 3SGQE 1C5YB 4R0IA 1KXAA 3KEEA 3LGTA 3RXVA 4IN1A 2GCTC 1K1MA 1GBFA 3BTEE 1AKSB 2BZ6H 4CREA 1E37B 1XUIA 2EI7A 1QRWA 1TMUH 1F5RA 4H4FA 1ELAA 1O5FH 5JBBS 3UWIA 1NRQH 1GBEA 3A82A 2BLWA 4GVUA 1CVWH 2PTCE 2QXJA 4MG3A 4WXVA 5T6FA 1T32A 3LGUA 3M61U 2GCHG 2ZWLH 2A4GA 3D49H 1P01A 1RS0A 1MTNC 4WVPE 1MAXA 3AAUA 1UTLM 3LH1A 3RU4E 1MD7A 1P2IA 3P8NA 1THPB 5C1UA 3U8TH 1EJNA 4DIIH 4GLYA 1YPLH 2GV7A 2W5EA 1GBLA 5AHGH 1V2KT 1TPAE 5B6OA 2G4UA 3DFLA 3VB3A 4X8TH 4NG9H 3PLPA 2WV5A 1CU1A 2I6QA 3GY2A 3RDZA 2P95A 3MI4A 2P93A 4B2CA 1LHDH 1V2MT 2GDDA 1O35A 1KLIH 1TNGA 1SPJA 2G5NA 1PQAA 1GDUA 1UO6A 4WH8A 1NTPA 1S81A 1XM1A 5EG4A 3LPRA 2DUCA 4A92A 3SOSA 2FS8A 4UFEH 1TRMA 2VVUA 2AFQB 4BTIB 1Z8GA 1LMWB 2RCEA 2TIOA 2ZG0H 1L1GA 1IQGA 1L1NA 2QCYA 1BMNH 3QGJA 1HV7A 1SBWA 3F1SB 1TGSZ 1FAKH 3MYWA 2SGQE 1W3CA 2A5KA 3CP7A 2ZFFH 4M7GA 1SMFE 5JBCS 5T6GA 3BEUA 5SGAE 2CGAA 2PR3A 4FUCA 1XKBC 1VJ9U 5EQSA 1CA0C 4GHTA 1HRTH 3FP7E 1K1PA 2GP9B 2BY6X 1P05A 3ZZ3A 1C2LA 3BSQA 1NESE 1N8OB 3OU0A 1DICA 4HGCA 1K1JA 4NWKA 1UHBA 2JH5D 2A7HA 3RXRA 3GYLB 1H1BA 1Z8JB 1W8BH 3EA7A 3RXPA 4ZKOU 3RUOA 1ARCA 3SI3H 1OOKB 1KYNA 1AN1E 2PSYA 2XBXA 4TYDA 1AMHA 1WTGH 5GIBA 2SGPE 2QF3A 4I31A 3VB4A 1UVOA 2PTNA 2VB0A 3SNAA 4XFQA 1DLKB 1BRCE 1KDQB 1ETTH 3V3MA 5F6MA 1HAYB 3LGIA 1E35B 4PROA 3OTJE 1BUIA 3DD2H 3TJOA 2G52A 1QRZA 3EDXB 2ZKSA 3Q76A 1TRNA 2ZTYA 1O2NA 4HFPB 1JRTA 2A2QH 2VINA 5EW2H 1HAVA 3SHAH 2G4TA 2VGCC 3S7HB 1ELFA 3UNRA 1BRAA 3GCOA 4OS6A 6GCHF 2WPKS 2GT7A 1KSNA 3UOUA 4I8JA 3SNEA 2BDCA 2Q6DA 1BB0B 3QTVH 4CBNA 7LPRA 3CS7A 1QB6A 3FAOA 5DP5A 3RM0H 3MO3A 3PLBA 2ZGBH 2BM2A 2P94A 1O32A 2VIWA 4Q2KA 1ZTLA 2BD3A 4I8HA 5EQQA 4X2XA 4I8LA 5A0AE 1TAWA 1L2EA 4K69A 3SV6A 1PPHE 2J9NA 1O5GH 3A80A 1TNLA 1AB9C 3BIUH 5DPAA 4YOGA 3ZVGA 1V2UT 5DP6A 1B7XB 1B5GH 1BHXB 2VIOA 4GPGA 1DSUA 3M3SA 1QQ4A 1YPKH 1WU1A 1FNIA 3RMMH 1MQ6A 3OY6U 1ZRKA 1QURH 1ZPBA 1MBQA 1CGIE 1TX8A 1DS2E 1P9SA 4YTAA 2C90B 4DJZB 1VCQA 1ANDA 1D3TB 4A1VA 3EE0B 4TPYA 3TJVA 1QL7A 1SQOA 1DX5M 2HWLB 2QV1A 1C1PA 1CBWC 2ZP0H 4D9RA 4TY6A 1HUTH 2B0FA 1BTUA 4ZH8A 3A86A 1Z7KA 1JXPA 4ZKNU 3RMOH 4AYVB 1DXWA 4IMZA 4NSVA 3WY8A 3SN8A 2UUYA 3ITIA 1BRBE 3PV4A 3MFJA 4YLQH 3BF6H 2GV6A 4VGCC 1MU8B 2K1QA 1RTLA 1K21H 1LPKB 3PO1B 1EASA 4FVBA 4GCHF 1SGQE 1O39A 1WQVH 3FVFB 5AFZH 9ESTA 3LJJA 4RKOB 4X1SU 1V2WT 2C8ZB 2Z9LA 3VB7A 2C8XB 4F49A 3GICB 1A5HA 7GCHG 3BTWE 3QN7A 1DE7H 5FPSA 5E2OA 1XXDA 4GHQA 5HM9A 3DHKH 1TFXA 4YO9A 1PPZA 2PWXA 5EPNA 5EXLA 1SB1H 4JZ1A 1EP6A 1AE5A 1GI6A 2ZZUH 4ASHA 2A4QA 3A8CA 1BTZA 3AAVA 4ISOA 1W7XH 4A7IB 1O31A 3M37A 1C1OA 1FUJA 3VXEH 1AVWA 3M5MA 1GMDF 1HLTH 4UFFH 2H5DA 1FXYA 3RXKA 4K2YA 5EXNA 4INHA 2PSXA 1AIXH 4MPUA 2G8TA 1BTWA 1FQ3A 1PJPA 3E6PH 3O8RA 3BTDE 2HRVA 2BY8X 3RXLA 4XDEA 2PW8H 4Y6DA 1O2QA 3N7OA 3TLOA 2FP7B 2FO9A 2WYGA 2BDIA 1CT0E 2OQUA 2ANMH 2AS9A 1Y8TA 1LVYA 3A7XA 3UIRA 3S69A 1C5MD 2HVXA 2PHBA 3CS0A 1C4V2 2BYAX 2Q6GA 1WSSH 1ZHRA 2OUAA 3ATIA 2BD2A 2PV9B 1QRXA 2VGCB 1EUFA 1ETRH 5T3HA 1GI2A 1HAHH 2BLVA 1ESAA 2HGTH 4NA8A 1T8MA 1O2YA 2BD4A 5J4QA 1GHWH 3GCTG 1QHRB 1O2MA 3RC6A 2FMJA 4IC5A 4Q7YA 3C1KA 4MNXA 4Y7AA 4JYTA 3SU1A 1A3BH 1AUTC 2KAIB 1C5UA 7KMEH 1HAOH 1CHOF 3A7YA 4O97A 1J9CH 1UK2A 2C8YB 2QXIA 2VH0A 1QFKH 3RXBA 2STAE 1L4ZA 2BLOA 3SO3A 1C1MA 1GBDA 4SGAE 4B2AA 1Y3UA 3KGPA 4J1YA 2ZDMA 2OINA 3KQCA 1QJ6B 1BJVA 4WMEA 1A0LA 1HXFH 1TNKA 2BHGA 3NZIA 3SU6A 3W94A 4DGJA 8LPRA 2HNTE 2QXGA 4AGJA 2C8WB 5J4SA 1GHBF 1GHAF 1MUEB 1WCZA 2CXVA 1P2MA 2A4RA 3JZ2B 2PKSC 1OX1A 3BTTE 4X0WU 1BMAA 2BDAA 3MH4A 1HJ8A 4Y10E 2XXLA 1HYLA 1XVOA 1ELGA 2P8OC 1S85A 5BPEA 4X1NU 2TGPZ 2VIPA 2ZPSA 1C5RA 2YNAA 1GDNA 1HXEH 1TQ0B 1LO6A 1RFNA 3M3VA 1ANBA 4IMQA 4ISLA 3LJOA 4E7RG 1AWHB 1O3AA 3LC5A 1Z8IB 4Z6AH 3TJNA 2AMPA 1C5PA 1OWDA 2V3HH 2G5VA 3A88A 3NUMA 4K8BA 3RXFA 2BDYA 4VGCB 3P8OA 2FTLE 2IOTA 1P03A 3RC4A 4AFSA 1HAXB 5DK1A 2CV3A 1YPMH 5HXFA 3L33A 1EOJA 3T28A 3BEFB 1GJAB 1GBBA 1UMAH 2B5TB 3UQOA 5TJXA 1SGDE 3MU0A 1Q31A 1CA8B 4YT6H 4BAHB 1K1IA 1G3DA 4MPXA 4JZIA 1OPHB 1PPCE 1UVSH 3VB5A 3URDA 2B8OH 1GCTC 4JYVH 1O3BA 2Q1JA 3TJUA 1H9HE 2H1UA 4XBCA 2OQ5A 1C2EA 1GJ6A 1DANH 3L3TA 5BRRE 4Y8ZA 3SJIA 3SU4A 1UTJA 1GG6C 4BAMB 1VGCB 1WBGB 3RXGA 1TIOA 3ENSB 4B73A 1GI7B 4ABGA 4JYUH 4UEHH 4ABJA 1F7ZA 3Q3YA 3RP2A 3KQDA 1P57B 2D2DA 2BD7A 2WPMS 3ATMA 1LHEH 2ZDVH 2R0KA 5DG6A 1Y3YA 4FUEA 1S82A 4RSPA 2TPIZ 3E0PB 2ZU2A 1ORFA 1T8NA 3EYDA 4WWYA 5C1XA 1C2JA 2V35A 1AHTH 1O2ZA 3E3TA 5FAHA 1D3DB 2BQ7B 2BZAA 3MO9A 1VR1H 1SHYA 2CJIA 1TNIA 5IYTA 5GXPA 2Q6FA 5I25A 1P12E 4OS2A 2V6NA 3U9AH 4ABEA 2A1DB 1SQAA 2ZFTA 3PMBB 2VVCA 2ANWA 1CO7E 2QN5T 1EX3A 2J2UA 1O34A 4LOYH 3AW1A 3SUDA 4CRDA 2AGGX 2VU8E 1CQQA 2BOHB 4BNRA 2J34A 1GBAA 1GI5A 2H5CA 4INLA 1A2CH 2IN2A 2ZEBA 4LXBH 2THFB 1OP2A 1W12U 3Q00A 1D6WA 4D9QA 1LVMA 2PFEA 1AE8H 2FI5E 1SGRE 1SLXB 4AFZA 1QL8A 1WV7H 4GSOA 1BTPA 1MTSA 2FOHA 2F9OA 1GI4A 3MWIU 4DW2U 4ABDA 2Z3EA 3LU9B 3NXPA 4K5ZA 4ZMAH 1QBOA 1TBZH 2D1JA 2O8MA 3GCNA 4KGAA 1CE5A 2CHAB 3O8BA 2O8UA 2ZTXA 1NFXA 2OP9A 1LHGH 3KL6A 3URCA 1G3EA 4UD9H 5TCCA 3LIWA 3ZVBA 1K28D 1GJDB 3RM2H 1W11U 2VJ1A 7ESTE 1C5NH 1YM0A 1C5TA 4ZKSU 1FAXA 1H4WA 3V7TA 2EI6A 2VIVA 4OS5A 3GOVB 4X8SH 2BY9X 3RMNH 2W7SA 5FBEA 5GWZA 1TLDA 2ZI2H 1C5VA 1YPEH 3E0NB 1C2IA 1FONA 2AERH 2ZGCA 1A46H 1TX7A 4AN7A 1FZZA 1O2JA 1L1JA 1EZQA 1LPZB 3U98H 2EEKA 3PYHA 3RXIA 8GCHG 2FYRA 2NU0E 1GL0E 4YT7H 1DITH 1RRKA 1BZXE 4B2BA 1NFWA 1MCVA 3MU4A 1F92A 4OS7A 3EA8A 3Q3XA 5FCKA 1Y5BT 2ZHFH 6GCHG 1FJSA 1TGCA 5L2ZH 4AX9H 2A5AA 3SQHE 2AMQA 4MTBA 3LOXA 1HJ9A 5JBAS 4NWLA 1TALA 1OWEA 2O9QA 4AYYB 2G81E 2FOFA 4JK5A 5JBTA 1RGQA 3KN2A 3E90B 3HGNA 1NT1A 4MNYA 1XUHA 2G55A 4ZKRU 1AVGH 3HPTB 3L6PA 4IW4E 1AD8H 6CHAC 1P2NA 1H8IH 1P10A 4ZROA 4BOHA 1J15A 3BIVH 5DGJA 2A2XH 1PFXC 3V0XA 1Z1JA 2DE9A 3PTBA 1O2VA 2PKAA 1YPGH 4FUBA 4U2WA 2TGAA 3H5CB 4K1TA 5L2YH 4CBOA 3SHCH 1QJ1B 1YPHE 3A7TA 3OY5U 1LVBA 1UTQA 2AYWA 2FXRA 5FXLA 1VITF 1O2LA 1P06A 3A81A 3BTGE 1EJMA 1QJ7B 1GJCB 2Z9KA 1AZ8A 3BG4B 4I7YH 2XBWA 2ZFPH 1ZHMA 1K1NA 1LKAA 1E38B 1EKBB 1YPHC 2G00A 1HIAA 3ZV9A 3TGIE 3QGNB 1O3DA 4Y8YA 1O3FA 3SV2H 1XUFA 3HK6B 3ZZCA 1DPOA 2VNTA 2R0LA 2FOGA 5AVDA 3QWCH 3MU8A 1PYTC 1P2KA 2Z3DA 2P3UB 2R2MB 2VIQA 2QGRA 2FOBA 4Y0ZE 1FIWA 1SFIA 2FI3E 2GMTC 1ZZZA 1P02A 1V3XA 4WXIA 1RIWC 1Y3VA 5C5OA 1G36A 5DKMA 1GL1A 4GCHG 4CRFA 2BD5A 2ZO3H 3FP8E 2CF9H 4A6LA 2VWOA 1MCTA 1AY6H 3ZZ5A 1HJAC 2JETB 1YKTA 1O3LA 1BJUA 1KY9A 2OC1A 3RXCA 1GJ4H 1NFUA 3E16B 3P70B 2H9EH 1HPGA 3A83A 4MPWA 1HAPH 1XVMA 3M5OA 2TGTA 1QTFA 1ABIH 4NIYA 1K2I1 1Y3WA 2GCHF 2Z9IA 5FPYA 1WAYB 1LTOA 2Y5FA 2XWAA 5C2ZA 3ZZ9A 1K9OE 3PTNA 1GBHA 1GMDG 1O3IA 3M7UA 2R3YA 4GUXA 1Y59T 2ZDLA 1O3CA 2ZFRH 2GCTB 3A8DA 2BXUH 3ZZ4A 1TGNA 4HI3A 3D23A 1UK3A 3SU2A 2H9HA 1YPJH 1SGFA 3ATWA 2BY7X 1BMLA 1NY22 3TITA 3AVZA 4AORA 1DWEH 3A7ZA 4NCYA 1AI8H 2GZ8A 2RG3A 1GHVH 1LKBA 2ZHQH 2ZU1A 2Z7FE 2UUKB 2ZIQH 1ZLRA 4X8UH 3OX7U 1LQDB 2AH4X 1ELEE 2AGEX 3U8OH 4Y7BA 2Z9GA 1C2FA 4Q7ZA 5EQRA 1ANEA 2ZU5A 5DP4A 1GCDA 1O2PA 2F9NA 1C1QA 1J8AA 1OYQA 1MTNB 1KXCA 1IAUA 1RTFB 1YGCH 5FBIA 4K1SA 1QR3E 3SQEE 1ZSKA 2WV4A 3D65E 1FN6A 2SGDE 2BTCE 2XYAA 4LZ4B 1BHXF 5GCHG 3FANA 4THNH 1TQ7B 3TK6A 3E1XB 1GVLA 1J14A 2WINI 1LPGB 1T4VH 5I46H 3UNSA 3B9FH 1UTNA 3ZZ8A 1BQYA 1ZPCA 3SJ8A 1SLWB 1VZQH 2NU1E 1OYTH 3U1IB 1GBIA 1Y3XA 1MZDA 4MNVA 1Z71A 2A31A 1C5QA 2GDEH 1NO9H 4FXGH 3HGPA 1TYNA 1KLTA 1YP9A 1OSSA 2ZDKA 2VVVA 5DJ7A 1LQEA 2FLBH 1T7CA 1SGFG 2BX3A 2CN0H 1TA2A 2ZHWH 3QZRA 4O3TA 1GHBG 1GGDC 3I77A 2BOKA 3SV7A 4DVAU 3GDSA 2FX6A 1HNEE 1DLEA 1EPTA 2ZF0H 1GJBB 2XC4A 1BT7A 4XE4A 3RXQA 1BDAA 3PWCA 4WMFA 1IHSH 1O5BB 2PGBB 3DT0H 1CA0B 4U01A 1P2QA 4DCDA 2H9TH 2ZHDA 1XXFA 1TX6A 3E91A 2JH0D 3PLKA 1SLVB 1G3BA 1XMNB 5CE1A 4MQAA 5C1YA 3RXEA 1O5AB 5IDKA 1P11E 3VEQB 1OP0A 3EA9A 1KIGH 1EPTC 1OS8A 3RU4D 4CH2B 3T62A 3UOPA 2BX4A 4K8YA 1UJ1A 1TMBH 5LGOA 4J2YB 5EPYA 3T5FH 1C9PA 1B0FA 3RLYH 1V2OT 2QAAA 1UHBB 2XW9A 1SOZA 3V13A 2BMGB 3GCHC 3SW2B 3UREA 1EZXC 2F9UA 4BAOB 1AFQC 3MH5A 2FM2A 3EGKH 2BB4A 2OBOA 2QYIA 3ZVFA 1S0QA 1IQFA 1QCPA 3VGCC 4ABAA 5CHAC 1QL9A 4CRGA 1W2KH 4Y71A 4B1TA 3NKKA 4CR5A 2XC5A 5L6NH 3SNCA 2FYQA 2BDHA 3RLWH 4KP0A 1OWJA 1H9LB 2W3KA 3SNDA 2LPRA 1MZAA 1SGTA 3SV9A 1MAYA 5ESBA 4I32A 1C5OH 1O2KA 4B71A 1E0FD 1F0TA 3RU4T 5EGMA 1FY8E 1GHXH 2Z3CA 3NPSA 1HAVB 2XNIA 5A09A 2ODPA 1QBNA 8KME2 1C2DA 1SI5H 3U69H 1O3EA 4DG4A 1EJAA 1O2HA 4E7NA 1O30A 1SGCA 4KTCA 2BQWB 3TH2H 2FIRH 1GJ9B 5FPTA 2ASUB 4CR9A 5F8TA 1HB0B 3DUXH 1V6DA 1VITH 3RXUA 1DY9A 1DOJA 1LCYA 1AB9B 3BTFE 4OS4A 1SGIB 1TB6H 3H7OA 2BD8A 1AKSA 4AG1A 3KNXA 1GMHF 4AOQA 2H2ZA 2OD3B 4Y79A 1A4WH 2F9PA 1MKWK 1THSH 3FZZA 2BD9A 4R8TB 1AZZA 3KIDU 4ZHMU 2GGVB 5TCAA 2I6SA 1V2JT 1X7AC 3GY7A 5AFYH 4BTUB 3T25A 1A1RA 1ELVA 1W13U 2A4OA 1NROH 3ODFA 4TY7A 2FWWA 1O3NA 2A5IA 3PMJA 1LVOA 3MNXA 4I33A 2AEIH 5E8EH 4WJG2 1MD8A 3ZV8A 2ZU4A 7GCHF 4D8NA 1O0DH 1ZGVA 2IJOB 2XBYA 4CRAA 1C2KA 2BLQA 1CBWB 3ZYEA 1GJ8B 3P8FA 1DFPA 1O3PB 2Y80A 3M36A 1GPZA 4DOQA 1ACBE 1IQNA 4SGBE 1TPPA 3MNBA 1SGEE 2OLGA 1D3PB 2V0BA 2UWPA 3LT3A 3STJA 1P09A 5F8ZA 2GKVE 1RD3B 2ULLA 3TPIZ 1MTWA 4BANB 1EATA 4FU9A 1ESTA 2ZCHP 3W95A 2RA3A 3VFEA 1IQJA 1E36B 3A8AA 1P0SH 3TGKE 3R3GB 1FPHH 5FX5A 1S5SA 3MMGA 3SGAE 2B9LA 2HALA 2P3FH 4JZEH 3FZDA 1QA7A 3ZVCA 2OBQA 1P3EA 1GWAA 2NWNA 1C2GA 2F9VA 1QQUA 2Y5HA 1HAIH 3TIUA 3UTUH 2AGIX 5LPRA 1DY8A 3P6ZB 1DUAA 1O3OA 5ESTE 1FV9A 1S6FA 3EQ0H 1IQLA 1GHZA 1GBTA 5DP7A 3ZVEA 3QO6A 5FCRA 1W0ZU 2BDGA 3F9FA 1QB9A 4A1TA 1AUJA 1C4U2 1EZUC 1ZSJA 3MH6A 4WH6A 4IN2A 3UWJH 1NRPH 1PQ8A 4KTSA 4ZAEA 4CH8B 2ZCLP 1MMJN 4E06H 2QIQA 3BTKE 2ZCKP 1FY3A 2GVFA 2VH6A 3KQBA 1S6HA 4LZ1H 3VPKA 1MQ5A 2FOCA 4KTUA 3GCHB 1A61H 2ZA5A 3C27B 1DSTA 1ZJKA 1IOEA 1SG8B 2J95A 1F0SA 1SSXA 1TA6A 3GYMA 4X1PU 2ZTZA 2R3UA 4X6NA 1N8OC 3SU0A 1NRSH 1NN6A 1BTHH 4TWYA 2ZQ2A 1KDQA 4IGDA 4X8VH 5L30H 4B74A 4BAKB 4CHAC 1CHGA 4KELA 1ELDE 1MH0A 2OC8A 5EW1H 2UWLA 2O8WA 1P04A 2FPZA 1C4Y2 1IQKA 1PPEE 2SGEE 3R0FA 4FUFA 1Z1IA 5A0BA 1HFDA 1IHTH 3QK1A 2ALPA 4D7GA 3UUZA 1VITG 1TRYA 1ZR0A 1Q3XA 2Y81A 1ETSH 1NRNH 1V2QT 1VJAU 1A0HB 1LHFH 1FY1A 3V12A 2ZGJA 3UNQA 3QX5H 1P9UA 4Q7XA 1MKWH 3UPEA 1UCYK 4Y11E 1ESBA 4TPIZ 4KKDA 1Q2WA 4UFGH 1NZQH 1MTUA 1W10U 2A0QB 5E0GA 1P2OA 1WOFA 1FIZA 1GJ7B 2ILNA 4YZUA 3K2UA 2VWMA 1FY5A 1QIXB 3TNTA 2PKSB 4FUIA 2ZFQH 1WYKA 1F0RA 1MBMA 2BQ6B 4O9VA 2C3SA 1AWFH 3S9BA 4WMDA 4NZQA 1BRUP 2P8OB 3S0NA 1NM6A 3LDXH 2Z9JA 3UQVA 1SGNE 4X2YA 1CGJE 3M5LA 4A1XA 1ZHPA 1TONA 1MTVA 3UFAA 2QC2A 1QA0A 3ZZDA 2HNTF 3RC5A 5JPMH 1DM4B 2UUFB 1SFQB 1JRSA 3QZQA 4ISIH 3RXHA 5HM2A 1XUKA 2FI4E 1G30B 1NPMA 1C1UH 1TWXB 3I29A 3LKWA 4A5TS 2NU3E 1FLEE 5HYOA 4MPVA 1SR5C 2ANKH 4UONA 3S9CA 1BIOA 1AFEH 1K1OA 1JOUB 1PPBH 1YCPM 1XUGA 3S7KB 3NWUA 2A32A 2BY5X 2ZFSA 2WUCA 3LONA 1BMMH 1L4DA 1C1WH 4NFEA 3BTME 1KTTB 1V2RT 3A85A 1UTMA 2F91A 2FEQH 2XCFA 3RXJA 4AFQA 1SLUB 3BN9A 5K7RA 1O5EH 1GVZA 4ZHAA 4BAQB 4BXWA 3P8GA 4H42U 1GCTB 1O2XA 4JCNA 5A8XA 1K22H 1ZMLA 4NA7A 1J16A 2FOMB 1EQ9A 2XBVA 4YOJA 2NU2E 3LGVA 4Z0KA 2BVSH 2DE8A 5H4IB 1GG6B 5FHTA 3F9HA 3NK8A 1O5CB 1FY4A 2ZGXH 2ZHEH 4MLFB 3SU3A 5C3NA 1G32B 3F9GA 2OXSA 1BBRK 2XRCA 3PO1C 4B76A 1EXFA 2WPIS 3KCGH 3GY6A 4IBLH 5F8XA 5GJ4B 4O03A 5C5NA 3A7VA 4RN6A 5A2MH 2EI8A 1M9UA 1HCGA 2FESH 3PM3A 2J92A 3JZ1B 2SGFE 5A8ZA 3ODDA 3STIA 1HAZB 2AIQA 3TGJE 2IPHA 1GHYH 1TPOA 3QUMP 2W3IA 5PTPA 2C4FH 2ZQ1A 1QBVH 3Q3KA 1TPSA 1NS3A 3UR9A 4B75A 4DURA 3SJOA 1C1VH 2RDLA 3ELAH 1WUNH 3MO6A 4FUDA 2WPLS 1BCUH 2A7CA 3MH7A 2ZECA 2PUQH 4UDWH 3ZZAA 1BA8B 3SORA 2GT8A 1C9TA 1GMCF 1UTKA 3IWMA 5CMXH 4CHAB 1O37A 3M7TA 2A7JA 3RXAA 1TMTH 1A5GH 2WUBA 4JZFH 1HDTH 3KF2A 4FUGA 1KXFA 1PQ5A 4MNWA 3P17H 1UCYH 3ZVDA 1XUJA 1P8VC 3ZZ7A 1J17T 1JIMA 2Z6BD 2F9BH 3LGYA 2ZNKH 1WTHD 4JK6A 2UUJB 4K3JA 5C20A 3RXTA 3CENA 3B8JA 1O2IA 2FS9A 1GBMA 5A8YA 8GCHF 3HKIB 4ISHH 3UY9A 1Z6JH 1O2WA 1YF4A 3SJ9A 1V2TT 4YOIA 1EAXA 1UVUH 3F6UH 1GVKB 5DP3A 4ZXXH 1F2SE 2M5TA 1RTKA 2KAIA 2P59A 1MU6B 2J4IA
chains in the Genus database with same CATH superfamily
3WWBA 1E79D 4OGYA 3B23B 3AW0A 4DIHH 1BTYA 3SJKA 1B0EA 5JDUB 5E0HA 1SC8U 3ZYDA 1MKXK 4ZUHA 1EB2A 4IC6A 2TGDA 1UTOA 4X1QU 5G4BA 1T8OA 2D8WA 1PPGE 8ESTE 2VIDA 3U8RH 1V2ST 4AB9A 3FFGA 2ZPQA 4DY7B 4CRBA 1SVPA 2TBSA 3SI4H 2FDAA 1THRH 1SL3A 1UTPA 3SYJA 4WY3A 4ABIA 1NU9A 2GX4A 5LH8A 4JMYA 3MOCA 3IG6B 5EODA 1ABJH 1INCA 4I8KA 3S9AA 1N1LA 1SOTA 1A7SA 3GDVA 3GY3A 4X1RU 1DT2A 4U30A 5EU8A 2R2WU 2J94A 1NC6A 1G3CA 3LC3A 3Q77A 3G01A 1O3MA 1FN8A 4JZDH 4AG2A 1D9IA 2G51A 1A3EH 2B7DH 2Y7ZA 2UWOA 3OSYA 1UCYE 4ESTE 2D26C 3RXDA 1CHOG 1O5DH 4GAWA 4NA9H 1CSOE 2SFAA 1H9IE 1VKYA 2AMDA 1W7GH 2XCNA 1FMGA 2LELA 6CHAB 1OWKA 2W26A 1DVAH 3T29A 1IQIA 1YBWA 1ZTJA 2HPPH 5C0UA 4QT8C 1BBRH 2Y6TA 5JB8S 1XX9A 1LHCH 3TK5A 3MHWU 1QY6A 1GMHG 1VCPA 2HLCA 2QA9E 2FTMA 4OGXA 4AB8A 3F68H 1GHAG 4CRCA 3TH3H 5JB9S 1JMOH 4FUJA 2QE7D 4RT1A 3SUGA 2OC7A 1C1TA 5LPFA 1CT2E 3A89A 1O2GH 1IQHA 1V2NT 1H8HD 1GI3A 3AK5A 1QGFA 1EB1H 1KXDA 1G2LA 1GBKA 1TGTA 2QXHA 2CF8H 1AGJA 1SQTA 2HOBA 2RA0A 4FU7A 4RKJB 2BVXH 1TNHA 2P16A 4U32A 4YLUA 2PKAB 1O33A 4H6TA 3DA9B 1EAIA 1L0ZA 3PMAB 3GY4A 4IS5A 1DWCH 5HMAA 3ZZ6A 2OC0A 4AGKA 2KM0A 1EOLA 1ZGIA 1FI8A 1C2HA 2P3TB 4BXSA 4X6OA 3QLPH 3TU7H 5T6DA 4ZHLU 3QDZB 2ZDAH 4NGAH 1O3JA 3BV9B 2GMTB 1HIAB 1VGCC 4ABFA 3F9EA 5F53A 1BTXA 1RIWB 3ZZBA 2BDBA 4YM9A 5DO4H 1Y5UT 3MU1A 4P02A 3MU5A 1GBCA 1O36A 2H6MA 3OYPA 5LPEA 1HJAB 2PLXA 2WPHS 4WF8A 5A0CA 2EC9H 3KQEA 4E05H 1TOCB 1C1SA 1TBRH 1GI1A 1P3CA 3U1JB 3IITA 3EAJA 4NIVA 1ZYOA 1KLJH 1Z6EA 3WWFA 1GI8B 2GD4B 2ESTE 2W7UA 1C5ZB 1T31A 3SU5A 4MDSA 3BG8A 4XBBA 3SZNA 1OWIA 1C2MA 5DP9A 1UK4A 1ZJDA 1BBRE 2SGAA 1IQMA 1MKXH 3TK9A 3TH4H 1FPCH 1C1NA 1HBTH 1QNJA 2IJD1 1JWTA 4NSYA 4O3UA 1G37A 5GCHF 3BEIB 4AFUA 3T2NA 1VCWA 1O2SA 5AF9H 1YLDA 1PYTD 2F3CE 4YESB 1TABE 2AIPA 5JYIA 3M3TA 3PB1E 1CT4E 1O2TA 2GTBA 3RXSA 1C1RA 1P2JA 1G9IE 2SNWA 1T8LA 3CNRA 1ANCA 1ELBA 4NIXA 3H7TA 3FP6E 1EAWA 4DT7B 3I78A 2ZC9H 3A7WA 2KZ4A 1N6YA 3T26A 4ZXYH 4X2VA 4Y0YE 1ZRBA 1F5KU 3K6YA 2CHAC 1YCPK 1D3QB 5DP8A 3KYGA 3LGWA 1BITA 1PQ7A 3O8CA 2XTTB 1BMFD 1SGPE 2A45B 5C67A 1T4UH 1F0UA 4XOJA 3F2HA 3TVJB 2ZGHA 4UFDH 1W14U 1GI0A 1V2PT 1W0YH 5GDSH 1OXGA 4X6PA 1AU8A 5E2PA 5FX6A 3ZVAA 1ELTA 3MTYA 1ZTKA 4I8GA 1DUEA 2HNTC 1O3KA 4D7FA 1DWBH 1KXBA 3MNSA 2YNBA 1JIRA 1YC0A 2O8LA 1HGTH 1ZMJA 4Y8XA 5F03A 3SGBE 1O2RA 3GISB 1GI9B 2F83A 2TRMA 2JJ1D 4BTTB 4FUHA 4NZLA 1S83A 2ZPRA 1U6QA 3OTPA 3K9XB 3MNCA 1TBQH 1SQRA 1A0JA 2WYJA 3M35A 1Y5AT 1GGDB 1SGYE 1C5SA 1D6RA 3TNSA 1AO5A 4ISNA 2QF0A 1YYY1 3PRDA 2OTVA 2FODA 1YLCA 5GPIB 4XSKU 2ZU3A 2CMYA 9LPRA 1WQSA 3PROA 4FU8A 1GBJA 2BXTH 2R9PA 3RXOA 1EP5A 1DXPA 2ANYA 1S84A 1LDTT 1Z8RA 2V3MA 3HK3B 2BVRH 3PV5A 4NFFA 5E0JA 3VXFH 1SHHB 4ABHA 2ODYB 2WPJS 1KTSB 1DDJA 2XWBI 4LK4A 3GY5A 3BTQE 2SNVA 4MVNA 2XC0A 1V2VT 1EPTB 3HKJB 3ATLA 3K6ZA 1E34B 1NFYA 3P92A 3DSOA 1XKAC 3UR6A 1V2LT 5EJLA 4ABBA 1C5XB 1W0KD 3ESTA 1NU7B 5CHBA 3SUEA 1ARBA 1EAUA 1O38A 4HTCH 2FLRH 4UE7H 1UVPA 2YOLA 3BTHE 1C5LH 1JBUH 1FDPA 1D4PB 3PWBA 3A8BA 1ZPZA 2QY0B 3GCTF 4NIWA 4INKA 3SBKA 1RXPA 3ATKA 2Y82A 2EA3A 1A5IA 2NU4E 4X2WA 1K1LA 3BG4C 1AFQB 2VWLA 3K65B 3T27A 1BOQA 2STBE 1H8DH 2ZDNA 1O2UA 1ZSLA 5C94A 1G2MA 1AVXA 3RXMA 1CGHA 1ELCA 1C5WB 2OCVB 3VGCB 1ZOMA 2Y7XA 5CHAB 1EZSC 1QZ8A 3A84A 1ZMNA 4OS1A 5HGGA 2ALVA 4K60A 4FVDA 2PGQB 3AASA 1F5LA 5ABWA 2O8TA 1OP8A 2JIZD 4AZ2B 1ID5H 3D62A 3GDUA 3LH3A 4F48B 2ODQA 1PPFE 1HAGE 1RJXB 4Y76A 1TOMH 4D76A 1O3HA 2V3OH 1TE0A 1O3GA 2QF5A 5EXMA 3VB6A 2JKHA 4TWWA 2GZ7A 2FZZA 2FOAA 1GJ5H 4XBDA 2JH6D 1QB1A 3DFJA 2PUXB 3PMHB 3KHVA 2VWNA 1DWDH 3NCLA 2Y5GA 1N6XA 1K0HA 6LPRA 3SNBA 1TGBA 3E8LA 2OK5A 1OWHA 1KXEA 3O8DA 2HPQH 2JETC 6ESTA 5ETXA 1S0RA 2FX4A 3HATH 2LNCA 3SUFA 3P95A 1OKXA 3M5NA 2J38A 3GY8A 1YCPH 4F4OC 1GDQA 3QTOH 1AQ7A 1IQEA 2F43B 4Q80A 1NRRH 2FOEA 3KQ5A 4X6MA 3M7QA 3RMLH 2GZ9A 5K0HA 1O2OA 4HZHA 1NBME 3SV8A 3A87A 4H6SB 1TNJA 2C93B 2Z94A 5EOKA 1UVTH 4K1EA 1GMCG 3SGQE 1C5YB 4R0IA 1KXAA 3KEEA 3LGTA 3RXVA 4IN1A 2GCTC 1K1MA 3OFND 1GBFA 3BTEE 1AKSB 2BZ6H 4CREA 1E37B 1XUIA 2EI7A 1QRWA 1TMUH 1F5RA 4H4FA 1ELAA 1O5FH 5JBBS 3UWIA 1NRQH 1GBEA 3A82A 2BLWA 4GVUA 1CVWH 2PTCE 2QXJA 4MG3A 4WXVA 5T6FA 1T32A 3LGUA 3M61U 2KCOA 2GCHG 2ZWLH 2A4GA 3N7DA 3D49H 1P01A 1RS0A 1MTNC 4WVPE 1MAXA 3AAUA 1UTLM 3LH1A 3RU4E 1MD7A 1P2IA 3P8NA 1THPB 5C1UA 3U8TH 1EJNA 4DIIH 4GLYA 1YPLH 2GV7A 2W5EA 1GBLA 5AHGH 1V2KT 1TPAE 5B6OA 2G4UA 3DFLA 3VB3A 4X8TH 4NG9H 3PLPA 2WV5A 1CU1A 2I6QA 3GY2A 3RDZA 2P95A 3MI4A 2P93A 4B2CA 1LHDH 2HVYB 1V2MT 2GDDA 1O35A 1KLIH 1TNGA 1SPJA 2G5NA 2J97A 3NRLA 1PQAA 1GDUA 1UO6A 4WH8A 4ACAA 1NTPA 1S81A 1XM1A 5EG4A 4Z1MD 3LPRA 5HIYA 2DUCA 4A92A 3SOSA 2FS8A 4UFEH 1TRMA 2IPQX 2VVUA 2AFQB 4BTIB 1Z8GA 1LMWB 2RCEA 5EJZA 2TIOA 2ZG0H 1L1GA 1IQGA 1L1NA 2QCYA 1BMNH 5HKKD 3QGJA 2YMSC 1HV7A 1SBWA 3F1SB 1TGSZ 1FAKH 3MYWA 2SGQE 1W3CA 2A5KA 3CP7A 2ZFFH 4M7GA 1SMFE 5JBCS 5T6GA 3BEUA 5SGAE 2CGAA 2PR3A 4FUCA 1XKBC 1VJ9U 5EQSA 1CA0C 4GHTA 1HRTH 3FP7E 1K1PA 2GP9B 3N7EA 2BY6X 2WSSD 3U28C 2F4LA 1P05A 3ZZ3A 1C2LA 3BSQA 1NESE 1N8OB 3OU0A 2K8IA 1DICA 4HGCA 1K1JA 4NWKA 1UHBA 2JH5D 2A7HA 3RXRA 3GYLB 1H1BA 1Z8JB 1W8BH 3EA7A 3RXPA 4ZKOU 3RUOA 1ARCA 3SI3H 1OOKB 1KYNA 1AN1E 2PSYA 2XBXA 4TYDA 1AMHA 1WTGH 5GIBA 2SGPE 2QF3A 4I31A 3VB4A 1UVOA 2PTNA 2VB0A 3SNAA 4XFQA 1DLKB 1BRCE 1KDQB 1ETTH 3V3MA 5F6MA 5EIYA 1HAYB 3LGIA 1E35B 4PROA 3OTJE 1BUIA 3DD2H 3TJOA 2G52A 1QRZA 3EDXB 2ZKSA 3Q76A 1TRNA 2ZTYA 1O2NA 2KR7A 4HFPB 1JRTA 2A2QH 2VINA 5EW2H 1HAVA 3SHAH 2G4TA 2VGCC 3S7HB 1ELFA 3UNRA 1BRAA 3GCOA 4OS6A 6GCHF 2WPKS 2GT7A 1KSNA 3UOUA 4I8JA 3SNEA 2BDCA 2Q6DA 1BB0B 3QTVH 3W1EA 4CBNA 7LPRA 3CS7A 1QB6A 3FAOA 5DP5A 3RM0H 3MO3A 3PLBA 4B6EA 3OE7D 2ZGBH 2BM2A 2P94A 1O32A 2VIWA 4Q2KA 1ZTLA 2BD3A 4I8HA 5EQQA 4X2XA 4I8LA 5A0AE 1TAWA 1L2EA 4K69A 3SV6A 1PPHE 2J9NA 1O5GH 3A80A 1TNLA 4TSFD 1AB9C 3BIUH 5DPAA 4YOGA 3ZVGA 1V2UT 5DP6A 3FOAA 1B7XB 1B5GH 5C17A 1BHXB 2KCAA 2VIOA 4GPGA 1DSUA 3M3SA 1QQ4A 1YPKH 1WU1A 1FNIA 3RMMH 1MQ6A 3OY6U 1ZRKA 1QURH 1ZPBA 1MBQA 1YWUA 1CGIE 1TX8A 1DS2E 3GS9A 1P9SA 4YTAA 2C90B 4DJZB 1VCQA 1ANDA 1D3TB 4A1VA 3EE0B 4TPYA 3TJVA 1QL7A 1SQOA 2KX4A 1DX5M 2HWLB 2XOKD 2QV1A 1C1PA 1CBWC 2ZP0H 4D9RA 4TY6A 1HUTH 2B0FA 1BTUA 4ZH8A 3A86A 4FETA 1Z7KA 1JXPA 4ZKNU 3RMOH 4AYVB 1DXWA 4IMZA 4NSVA 3WY8A 3SN8A 2UUYA 3ITIA 1BRBE 3PV4A 3MFJA 4YLQH 3BF6H 2GV6A 4VGCC 1MU8B 2J98A 2K1QA 1RTLA 1K21H 1LPKB 3PO1B 1EASA 4FVBA 4GCHF 1SGQE 1O39A 1WQVH 3FVFB 2YMSB 5AFZH 9ESTA 3LJJA 4RKOB 2JDID 4X1SU 1V2WT 2C8ZB 2Z9LA 3VB7A 2C8XB 4F49A 3GICB 1A5HA 1YY3A 7GCHG 3BTWE 3QN7A 1DE7H 5FPSA 5E2OA 1XXDA 4GHQA 5HM9A 3DHKH 1TFXA 4YO9A 1PPZA 2PWXA 5EPNA 5EXLA 5B6LA 1SB1H 4JZ1A 1EP6A 1AE5A 1GI6A 2ZZUH 5KGOA 4ASHA 2A4QA 3WW7A 3A8CA 1BTZA 3AAVA 4ISOA 1W7XH 4A7IB 1O31A 3M37A 1C1OA 1FUJA 3VXEH 1AVWA 3M5MA 1GMDF 1HLTH 3F2GA 4UFFH 2H5DA 1FXYA 3RXKA 4K2YA 5C0TA 5EXNA 4INHA 2PSXA 1AIXH 4MPUA 2G8TA 3DSPA 1BTWA 1FQ3A 1PJPA 3E6PH 3O8RA 3BTDE 2HRVA 2BY8X 3RXLA 4XDEA 2PW8H 4Y6DA 1O2QA 3N7OA 3TLOA 2FP7B 2FO9A 2WYGA 2BDIA 1CT0E 2OQUA 2ANMH 2AS9A 2W6ID 1Y8TA 1LVYA 3A7XA 3UIRA 3S69A 1C5MD 2HVXA 2PHBA 2J5UA 3CS0A 2HLDD 1C4V2 2BYAX 2Q6GA 1WSSH 4OM9A 4XD7D 1ZHRA 2OUAA 3ATIA 2BD2A 2PV9B 1QRXA 2VGCB 1EUFA 4B6FA 1ETRH 5T3HA 1GI2A 1HAHH 2BLVA 1ESAA 2HGTH 4NA8A 1T8MA 1O2YA 2BD4A 5J4QA 1GHWH 3GCTG 1QHRB 1O2MA 3RC6A 2FMJA 4IC5A 4Q7YA 3C1KA 4MNXA 4Y7AA 4JYTA 3SU1A 1A3BH 1AUTC 5HIZA 2KAIB 1C5UA 7KMEH 1HAOH 1CHOF 3A7YA 4O97A 1J9CH 1UK2A 2C8YB 2QXIA 2VH0A 1QFKH 3RXBA 2STAE 1L4ZA 2BLOA 3SO3A 1C1MA 1GBDA 4SGAE 4B2AA 1Y3UA 3KGPA 4J1YA 2ZDMA 2OINA 3KQCA 1QJ6B 1BJVA 4WMEA 1A0LA 1HXFH 1TNKA 2BHGA 3NZIA 3SU6A 3W94A 4DGJA 8LPRA 2HNTE 2QXGA 4AGJA 2C8WB 5J4SA 1GHBF 1GHAF 1MUEB 1WCZA 2CXVA 1P2MA 2A4RA 3JZ2B 2PKSC 1OX1A 3BTTE 4X0WU 1BMAA 2BDAA 3MH4A 1HJ8A 4Y10E 2XXLA 1HYLA 2RFKC 1XVOA 1ELGA 2P8OC 1S85A 5BPEA 4X1NU 2TGPZ 2VIPA 2ZPSA 1C5RA 2YNAA 1GDNA 1HXEH 1TQ0B 1LO6A 1RFNA 3M3VA 1ANBA 4IMQA 4ISLA 3LJOA 4E7RG 1AWHB 1O3AA 3LC5A 3MQKC 1Z8IB 4Z6AH 3TJNA 2AMPA 1C5PA 1OWDA 2V3HH 2G5VA 3A88A 3NUMA 4K8BA 3RXFA 2BDYA 3FKSD 4VGCB 3P8OA 2FTLE 2IOTA 1SKYE 1P03A 3RC4A 4AFSA 1HAXB 5DK1A 2CV3A 1YPMH 5HXFA 3L33A 1EOJA 1OHHD 3T28A 3BEFB 1GJAB 1GBBA 1UMAH 2B5TB 3UQOA 5TJXA 5KEDA 1SGDE 4RT0A 3MU0A 1Q31A 1CA8B 4YT6H 4BAHB 1K1IA 1G3DA 4MPXA 4JZIA 1OPHB 1PPCE 1UVSH 3VB5A 3URDA 2WHXA 2B8OH 1GCTC 2WZQA 4JYVH 1O3BA 2Q1JA 3TJUA 1H9HE 2H1UA 4XBCA 2OQ5A 1C2EA 1GJ6A 1DANH 3L3TA 5BRRE 4Y8ZA 3SJIA 3SU4A 1E1RD 1UTJA 1GG6C 4BAMB 1VGCB 1WBGB 3RXGA 1TIOA 3ENSB 4B73A 1GI7B 4ABGA 4JYUH 4UEHH 4ABJA 1F7ZA 3Q3YA 3RP2A 3KQDA 1P57B 2D2DA 2BD7A 2WPMS 3ATMA 1LHEH 2ZDVH 2R0KA 5DG6A 1Y3YA 4FUEA 1S82A 4RSPA 2TPIZ 3E0PB 2ZU2A 1ORFA 1T8NA 3EYDA 4WWYA 5C1XA 1C2JA 2V35A 1AHTH 1O2ZA 3E3TA 5FAHA 1D3DB 2BQ7B 2BZAA 3MO9A 1VR1H 1SHYA 2CJIA 1TNIA 5IYTA 5GXPA 2Q6FA 5I25A 1P12E 4OS2A 2V6NA 3U9AH 4ABEA 2A1DB 1SQAA 2ZFTA 4HG6A 3PMBB 2VVCA 2ANWA 1CO7E 2QN5T 1EX3A 2J2UA 1O34A 4LOYH 3AW1A 3SUDA 4CRDA 2AGGX 2VU8E 1CQQA 2BOHB 4BNRA 2J34A 1GBAA 1GI5A 2H5CA 4INLA 1A2CH 2IN2A 2ZEBA 4LXBH 2THFB 1OP2A 1W12U 3Q00A 1D6WA 4D9QA 1LVMA 2PFEA 1AE8H 2FI5E 1SGRE 2AHME 1SLXB 4AFZA 1QL8A 1WV7H 4GSOA 1BTPA 1MTSA 2FOHA 2F9OA 1GI4A 3MWIU 3OEHD 4DW2U 4ABDA 2Z3EA 3LU9B 3NXPA 4K5ZA 4ZMAH 1QBOA 1TBZH 2D1JA 2O8MA 3GCNA 4KGAA 1CE5A 2CHAB 3O8BA 2O8UA 2ZTXA 1NFXA 2OP9A 1LHGH 3KL6A 3URCA 1G3EA 4UD9H 5TCCA 3LIWA 3ZVBA 1K28D 1GJDB 3RM2H 1W11U 2VJ1A 7ESTE 1C5NH 1YM0A 1C5TA 4ZKSU 1FAXA 1H4WA 3V7TA 2EI6A 2VBCA 2VIVA 4OS5A 3GOVB 4X8SH 2BY9X 3RMNH 2W7SA 5FBEA 5GWZA 1TLDA 2ZI2H 1C5VA 1YPEH 3E0NB 1C2IA 1FONA 2AERH 2ZGCA 1A46H 1TX7A 4AN7A 1FZZA 1O2JA 1L1JA 1EZQA 1LPZB 3U98H 2EEKA 3PYHA 3RXIA 8GCHG 2FYRA 2NU0E 1GL0E 3F2FA 4YT7H 1DITH 1RRKA 1BZXE 4B2BA 1NFWA 1MABB 1MCVA 3MU4A 1F92A 4OS7A 3EA8A 5DSFA 3Q3XA 5FCKA 1Y5BT 2ZHFH 6GCHG 1FJSA 1TGCA 5L2ZH 4AX9H 2A5AA 1WXRA 3SQHE 2AMQA 4MTBA 3LOXA 1HJ9A 5JBAS 4NWLA 1TALA 1OWEA 2O9QA 4YXWD 4AYYB 2G81E 2FOFA 4JK5A 5JBTA 1RGQA 2K0QA 3KN2A 3E90B 3HGNA 1NT1A 4MNYA 1XUHA 2G55A 4ZKRU 1AVGH 3HPTB 3L6PA 4IW4E 1AD8H 6CHAC 1P2NA 1H8IH 2GJGA 1P10A 4ZROA 4BOHA 1J15A 3BIVH 5DGJA 2A2XH 1PFXC 3V0XA 1Z1JA 2DE9A 3PTBA 1O2VA 2PKAA 1YPGH 4FUBA 4U2WA 2TGAA 3H5CB 4K1TA 5L2YH 4CBOA 1UW7A 3SHCH 1QJ1B 1YPHE 3A7TA 3OY5U 1LVBA 1UTQA 2AYWA 2FXRA 5FXLA 1VITF 1O2LA 1P06A 3A81A 3BTGE 1EJMA 3F3BA 1QJ7B 1GJCB 2Z9KA 1AZ8A 3BG4B 4I7YH 2XBWA 3UAIC 2ZFPH 1ZHMA 1K1NA 1LKAA 1E38B 1EKBB 1YPHC 2G00A 1HIAA 3ZV9A 3TGIE 3QGNB 1O3DA 4Y8YA 1O3FA 3SV2H 1XUFA 3HK6B 3ZZCA 3PRBA 3H09A 1DPOA 2VNTA 2R0LA 2FOGA 5AVDA 3QWCH 3MU8A 1PYTC 1P2KA 2Z3DA 2P3UB 2R2MB 2VIQA 2QGRA 2FOBA 4Y0ZE 1FIWA 1SFIA 2FI3E 2GMTC 1ZZZA 1P02A 1V3XA 4WXIA 1RIWC 1Y3VA 5C5OA 1G36A 5DKMA 1GL1A 4GCHG 4CRFA 2BD5A 2ZO3H 3FP8E 2CF9H 3SZEA 4A6LA 2VWOA 1MCTA 1AY6H 3ZZ5A 1HJAC 2JETB 1YKTA 1O3LA 1BJUA 1KY9A 2OC1A 3RXCA 1GJ4H 1NFUA 3E16B 3P70B 2KCYA 2H9EH 1HPGA 3A83A 4MPWA 1HAPH 1XVMA 3M5OA 2TGTA 1QTFA 1ABIH 4NIYA 1K2I1 1Y3WA 2GCHF 2Z9IA 5FPYA 1WAYB 1LTOA 2Y5FA 2XWAA 5C2ZA 3ZZ9A 1K9OE 3PTNA 1GBHA 1GMDG 1O3IA 3M7UA 2R3YA 4GUXA 1Y59T 1H8ED 2ZDLA 1O3CA 2ZFRH 2GCTB 3A8DA 2BXUH 3ZZ4A 2XNDD 1TGNA 4HI3A 3D23A 1UK3A 3SU2A 2H9HA 1YPJH 1SGFA 3ATWA 2BY7X 1BMLA 1NY22 3TITA 3AVZA 4AORA 1DWEH 5DN6D 3A7ZA 4NCYA 1YLNA 4TT3D 1AI8H 2GZ8A 2RG3A 1GHVH 1LKBA 2ZHQH 2ZU1A 1E1QD 2Z7FE 2UUKB 2ZIQH 1ZLRA 3EE7A 4X8UH 3OX7U 1LQDB 2AH4X 1ELEE 2AGEX 3U8OH 4Y7BA 2Z9GA 1C2FA 4Q7ZA 5EQRA 1ANEA 2ZU5A 5DP4A 1GCDA 1O2PA 2F9NA 1C1QA 1J8AA 1OYQA 1MTNB 1KXCA 1IAUA 1RTFB 1YGCH 5FBIA 4K1SA 1QR3E 3SQEE 1ZSKA 2WV4A 3D65E 1FN6A 2SGDE 2BTCE 2XYAA 4LZ4B 1BHXF 5GCHG 1S6LA 3FANA 4THNH 1TQ7B 3TK6A 5CDFE 3E1XB 4DT4A 1GVLA 1J14A 2WINI 1LPGB 1T4VH 5I46H 3UNSA 3B9FH 1UTNA 3ZZ8A 1BQYA 1ZPCA 3SJ8A 1SLWB 1VZQH 2NU1E 1OYTH 3U1IB 1GBIA 1Y3XA 1MZDA 4MNVA 1Z71A 2A31A 4M9FA 1C5QA 1NBMD 2GDEH 1NO9H 4FXGH 3HGPA 1TYNA 1KLTA 5GNDA 1YP9A 1OSSA 2ZDKA 2VVVA 5DJ7A 1LQEA 2FLBH 1T7CA 1SGFG 1W0JD 2BX3A 2CN0H 1TA2A 2ZHWH 3QZRA 4O3TA 1GHBG 1GGDC 3I77A 2BOKA 3SV7A 4DVAU 3GDSA 2FX6A 4F55A 1HNEE 1DLEA 3ZIAD 1EPTA 2ZF0H 1GJBB 2XC4A 1BT7A 4XE4A 3RXQA 1BDAA 3PWCA 4WMFA 1IHSH 1O5BB 2JJ2D 2PGBB 3DT0H 1CA0B 3OEED 4Q63A 1P2QA 4U01A 4DCDA 2H9TH 2ZHDA 1XXFA 1TX6A 3PV2A 3E91A 2LP6A 2JH0D 3PLKA 1SLVB 1G3BA 1XMNB 5CE1A 4MQAA 5C1YA 3RXEA 1O5AB 5IDKA 1P11E 3VEQB 1OP0A 3EA9A 1KIGH 1EPTC 1OS8A 3RU4D 4CH2B 3T62A 3UOPA 2BX4A 4K8YA 1UJ1A 1TMBH 5LGOA 2CK3D 4J2YB 5EPYA 3T5FH 1C9PA 1B0FA 3RLYH 1V2OT 2QAAA 1UHBB 2XW9A 1SOZA 3V13A 2BMGB 2L74A 3GCHC 3SW2B 3UREA 3KYFA 1EZXC 2F9UA 4BAOB 1AFQC 3MH5A 2FM2A 3EGKH 2BB4A 2OBOA 2QYIA 2YMSD 3ZVFA 1S0QA 1IQFA 1QCPA 3VGCC 4ABAA 5CHAC 1QL9A 4CRGA 1W2KH 4Y71A 4B1TA 3NKKA 4CR5A 2XC5A 5L6NH 3SNCA 2FYQA 2BDHA 2KFWA 3RLWH 4KP0A 1OWJA 1H9LB 2W3KA 3F0OA 3SNDA 2LPRA 1MZAA 1SGTA 3SV9A 1MAYA 5ESBA 4I32A 1C5OH 1O2KA 4B71A 1E0FD 1F0TA 3RU4T 5EGMA 1FY8E 1GHXH 2Z3CA 3NPSA 1HAVB 2XNIA 5A09A 2ODPA 1QBNA 8KME2 1C2DA 1SI5H 3U69H 1O3EA 4DG4A 3DCLA 1EJAA 4ZCNA 1O2HA 4E7NA 1O30A 1SGCA 4KTCA 2BQWB 3TH2H 2FIRH 1GJ9B 5FPTA 2ASUB 4CR9A 5F8TA 1HB0B 3DUXH 1V6DA 1VITH 4AC9A 3RXUA 1DY9A 1DOJA 1LCYA 1AB9B 3BTFE 4OS4A 1SGIB 1TB6H 2L6OA 2BD8A 3H7OA 1AKSA 4AG1A 3KNXA 1GMHF 4AOQA 2H2ZA 2OD3B 4Y79A 1A4WH 2F9PA 1MKWK 1THSH 3FZZA 2BD9A 4R8TB 1AZZA 3KIDU 4ZHMU 2GGVB 5TCAA 2I6SA 1V2JT 1X7AC 3GY7A 5AFYH 4BTUB 2WV9A 3T25A 1A1RA 1ELVA 1W13U 2A4OA 1NROH 3ODFA 4TY7A 2FWWA 1O3NA 3FO8D 2A5IA 3PMJA 2PP6A 1LVOA 3MNXA 4I33A 2AEIH 5E8EH 4WJG2 1MD8A 3ZV8A 2ZU4A 7GCHF 4D8NA 1O0DH 1ZGVA 2IJOB 2XBYA 4CRAA 1C2KA 2BLQA 1CBWB 3ZYEA 1GJ8B 3P8FA 1DFPA 1O3PB 2Y80A 3M36A 1GPZA 4DOQA 1ACBE 1IQNA 1COWD 4SGBE 1TPPA 3MNBA 1SGEE 2OLGA 1D3PB 2V0BA 2UWPA 3LT3A 3STJA 5IK2D 1P09A 5F8ZA 2GKVE 1RD3B 2ULLA 3TPIZ 1MTWA 4BANB 1EATA 4FU9A 1ESTA 2ZCHP 3W95A 2RA3A 3VFEA 1IQJA 1E36B 3A8AA 1P0SH 3TGKE 3R3GB 1FPHH 2KCPA 1S5SA 3MMGA 5FX5A 3SGAE 2B9LA 2HALA 2P3FH 4JZEH 3FZDA 1QA7A 3ZVCA 2OBQA 1P3EA 1GWAA 2NWNA 1C2GA 2F9VA 1QQUA 2Y5HA 2J98B 1HAIH 3TIUA 3UTUH 2AGIX 5LPRA 4ASUD 1DY8A 3P6ZB 1DUAA 1O3OA 5ESTE 1FV9A 1S6FA 3EQ0H 1IQLA 5T1VA 1GHZA 1GBTA 1WDIA 5DP7A 3ZVEA 5EJ1A 3QO6A 5FCRA 1W0ZU 2BDGA 3F9FA 1QB9A 3FN8A 4A1TA 1AUJA 1C4U2 1EZUC 1ZSJA 3MH6A 4WH6A 4IN2A 3UWJH 1NRPH 1PQ8A 4KTSA 4ZAEA 4CH8B 2ZCLP 1MMJN 4E06H 2M2AA 2QIQA 3BTKE 2ZCKP 1FY3A 2GVFA 2VH6A 3KQBA 1S6HA 4LZ1H 3VPKA 1MQ5A 2FOCA 4KTUA 3GCHB 1A61H 2ZA5A 3C27B 1DSTA 1ZJKA 1IOEA 1SG8B 2J95A 1F0SA 1SSXA 1TA6A 3GYMA 4X1PU 2ZTZA 2R3UA 4X6NA 1N8OC 3SU0A 1NRSH 5FL7D 1NN6A 1BTHH 4TWYA 2ZQ2A 1KDQA 4IGDA 4X8VH 5L30H 4B74A 4BAKB 4CHAC 1CHGA 4KELA 2QF4A 1ELDE 1MH0A 2OC8A 5EW1H 2UWLA 2O8WA 1P04A 2FPZA 1C4Y2 1IQKA 1PPEE 2SGEE 3R0FA 4FUFA 1Z1IA 5A0BA 1HFDA 1IHTH 3QK1A 2ALPA 4D7GA 3UUZA 1VITG 1TRYA 1ZR0A 1Q3XA 2Y81A 2WPDD 1ETSH 1NRNH 1V2QT 1VJAU 1A0HB 1LHFH 1FY1A 3V12A 2ZGJA 3UNQA 3QX5H 1P9UA 4Q7XA 4P00A 1MKWH 3UPEA 1UCYK 4Y11E 1ESBA 4TPIZ 4KKDA 1FX0B 1Q2WA 4UFGH 1NZQH 1MTUA 1W10U 2A0QB 5E0GA 1P2OA 4XRNA 1WOFA 1FIZA 1GJ7B 2ILNA 4YZUA 3K2UA 2VWMA 1FY5A 1QIXB 3TNTA 2PKSB 4FUIA 3VG8A 2ZFQH 1WYKA 1F0RA 1MBMA 2BQ6B 4O9VA 2C3SA 1AWFH 3S9BA 4WMDA 2EQNA 4NZQA 1BRUP 2P8OB 3S0NA 1NM6A 3LDXH 2Z9JA 3UQVA 1SGNE 4RI0A 4X2YA 1CGJE 3M5LA 4A1XA 1ZHPA 1TONA 1MTVA 3UFAA 4ACBA 2RDEA 2QC2A 1QA0A 3ZZDA 2HNTF 3RC5A 5JPMH 1DM4B 2UUFB 1SFQB 1JRSA 3QZQA 4ISIH 3RXHA 5HM2A 1XUKA 2FI4E 1G30B 1NPMA 1C1UH 1TWXB 3I29A 3LKWA 4A5TS 2NU3E 1FLEE 5HYOA 4FOUC 4MPVA 1SR5C 2ANKH 4UONA 3S9CA 1BIOA 1AFEH 1K1OA 1JOUB 1PPBH 1YCPM 1XUGA 3F0PA 3S7KB 3NWUA 2A32A 2BY5X 2ZFSA 2WUCA 3LONA 1BMMH 1L4DA 1C1WH 4NFEA 3BTME 1KTTB 1V2RT 3A85A 3N99A 1UTMA 2F91A 2FEQH 4I86A 2XCFA 3RXJA 3UB0A 4AFQA 1SLUB 3BN9A 5K7RA 1O5EH 1GVZA 4ZHAA 4BAQB 4BXWA 3P8GA 4H42U 1GCTB 1O2XA 4JCNA 5A8XA 1K22H 1ZMLA 4NA7A 1J16A 2FOMB 1EQ9A 2XBVA 4YOJA 2NU2E 3LGVA 4Z0KA 2BVSH 2DE8A 5H4IB 1GG6B 5FHTA 3F9HA 3NK8A 1O5CB 1FY4A 2ZGXH 2ZHEH 4MLFB 3SU3A 5C3NA 1G32B 3F9GA 2OXSA 1BBRK 2XRCA 3PO1C 4B76A 1EXFA 2WPIS 3KCGH 3GY6A 4IBLH 5F8XA 5GJ4B 4O03A 5C5NA 3A7VA 4RN6A 5A2MH 2EI8A 1M9UA 1HCGA 2FESH 3PM3A 2J92A 3JZ1B 2SGFE 5A8ZA 3ODDA 3STIA 1HAZB 2AIQA 3TGJE 2IPHA 1GHYH 1TPOA 3QUMP 2W3IA 5PTPA 2C4FH 4Q4LA 2W6JD 2ZQ1A 1QBVH 3Q3KA 1TPSA 1NS3A 3UR9A 4B75A 4DURA 3SJOA 1C1VH 2RDLA 3ELAH 1WUNH 3MO6A 3OAAD 4FUDA 2WPLS 1BCUH 2A7CA 3MH7A 2ZECA 2PUQH 4UDWH 3ZZAA 1BA8B 3SORA 2GT8A 1C9TA 1GMCF 1UTKA 3IWMA 5CMXH 4CHAB 1O37A 3M7TA 2A7JA 3RXAA 5KECA 1TMTH 1A5GH 2V7QD 2WUBA 4JZFH 1HDTH 3KF2A 4FUGA 1KXFA 1PQ5A 4MNWA 3P17H 1UCYH 3ZVDA 1XUJA 1P8VC 3ZZ7A 1J17T 1JIMA 2Z6BD 2F9BH 3LGYA 3DSGA 2ZNKH 1WTHD 4JK6A 2UUJB 4K3JA 5C20A 3RXTA 3CENA 3B8JA 1O2IA 1KMHB 2FS9A 1GBMA 5A8YA 8GCHF 3HKIB 4ISHH 3UY9A 1Z6JH 1O2WA 1YF4A 3SJ9A 1V2TT 4YOIA 1EAXA 1UVUH 3F6UH 1GVKB 5DP3A 4ZXXH 1F2SE 2M5TA 1RTKA 2KAIA 2P59A 1EFRD 2EY4C 1MU6B 2J4IA
chains in the Genus database with same CATH topology
4OGYA 3B23B 3AW0A 4DIHH 1BTYA 3SJKA 1B0EA 5JDUB 5E0HA 1SC8U 3ZYDA 1MKXK 4ZUHA 1EB2A 4IC6A 2TGDA 1UTOA 4X1QU 5G4BA 1T8OA 2D8WA 1PPGE 8ESTE 2VIDA 3U8RH 1V2ST 4AB9A 3FFGA 2ZPQA 4DY7B 4CRBA 1SVPA 2TBSA 3SI4H 2FDAA 1THRH 1SL3A 1UTPA 4WY3A 4ABIA 1NU9A 2GX4A 5LH8A 4JMYA 3MOCA 3IG6B 5EODA 1ABJH 1INCA 4I8KA 3S9AA 1N1LA 1SOTA 1A7SA 3GDVA 3GY3A 4X1RU 1DT2A 4U30A 5EU8A 2R2WU 2J94A 1NC6A 1G3CA 3LC3A 3Q77A 3G01A 1O3MA 1FN8A 4JZDH 4AG2A 1D9IA 2G51A 1A3EH 2B7DH 2Y7ZA 2UWOA 3OSYA 1UCYE 4ESTE 2D26C 3RXDA 1CHOG 1O5DH 4GAWA 4NA9H 1CSOE 2SFAA 1H9IE 2AMDA 1W7GH 2XCNA 1FMGA 6CHAB 1OWKA 2W26A 1DVAH 3T29A 1IQIA 1YBWA 1ZTJA 2HPPH 4QT8C 1BBRH 2Y6TA 5JB8S 1XX9A 1LHCH 3TK5A 3MHWU 1QY6A 1GMHG 1VCPA 2HLCA 2QA9E 2FTMA 4OGXA 4AB8A 3F68H 1GHAG 4CRCA 3TH3H 5JB9S 1JMOH 4FUJA 3SUGA 2OC7A 1C1TA 5LPFA 1CT2E 3A89A 1O2GH 1IQHA 1V2NT 1GI3A 1QGFA 1EB1H 1KXDA 1G2LA 1GBKA 1TGTA 2QXHA 2CF8H 1AGJA 1SQTA 2HOBA 2RA0A 4FU7A 4RKJB 2BVXH 1TNHA 2P16A 4U32A 4YLUA 2PKAB 1O33A 4H6TA 3DA9B 1EAIA 1L0ZA 3PMAB 3GY4A 4IS5A 1DWCH 5HMAA 3ZZ6A 2OC0A 4AGKA 1EOLA 1ZGIA 1FI8A 1C2HA 2P3TB 4BXSA 4X6OA 3QLPH 3TU7H 5T6DA 4ZHLU 3QDZB 2ZDAH 4NGAH 1O3JA 3BV9B 2GMTB 1HIAB 1VGCC 4ABFA 3F9EA 1BTXA 1RIWB 3ZZBA 2BDBA 4YM9A 5DO4H 1Y5UT 3MU1A 3MU5A 1GBCA 1O36A 2H6MA 3OYPA 5LPEA 1HJAB 2PLXA 2WPHS 4WF8A 5A0CA 2EC9H 3KQEA 4E05H 1TOCB 1C1SA 1TBRH 1GI1A 1P3CA 3U1JB 3IITA 3EAJA 4NIVA 1ZYOA 1KLJH 1Z6EA 1GI8B 2GD4B 2ESTE 2W7UA 1C5ZB 1T31A 3SU5A 4MDSA 3BG8A 4XBBA 3SZNA 1OWIA 1C2MA 5DP9A 1UK4A 1ZJDA 1BBRE 2SGAA 1IQMA 1MKXH 3TK9A 3TH4H 1FPCH 1C1NA 1HBTH 1QNJA 1JWTA 4NSYA 4O3UA 1G37A 5GCHF 3BEIB 4AFUA 3T2NA 1VCWA 1O2SA 5AF9H 1YLDA 1PYTD 2F3CE 4YESB 1TABE 2AIPA 5JYIA 3M3TA 3PB1E 1CT4E 1O2TA 2GTBA 3RXSA 1C1RA 1P2JA 1G9IE 2SNWA 1T8LA 1ANCA 1ELBA 4NIXA 3H7TA 3FP6E 1EAWA 4DT7B 3I78A 2ZC9H 3A7WA 1N6YA 3T26A 4ZXYH 4X2VA 4Y0YE 1ZRBA 1F5KU 3K6YA 2CHAC 1YCPK 1D3QB 5DP8A 3LGWA 1BITA 1PQ7A 3O8CA 2XTTB 1SGPE 2A45B 5C67A 1T4UH 1F0UA 4XOJA 3TVJB 2ZGHA 4UFDH 1W14U 1GI0A 1V2PT 1W0YH 5GDSH 1OXGA 4X6PA 1AU8A 5E2PA 5FX6A 3ZVAA 1ELTA 3MTYA 1ZTKA 4I8GA 1DUEA 2HNTC 1O3KA 4D7FA 1DWBH 1KXBA 3MNSA 2YNBA 1JIRA 1YC0A 2O8LA 1HGTH 1ZMJA 4Y8XA 5F03A 3SGBE 1O2RA 3GISB 1GI9B 2F83A 2TRMA 4BTTB 4FUHA 4NZLA 1S83A 2ZPRA 1U6QA 3K9XB 3MNCA 1TBQH 1A0JA 2WYJA 3M35A 1Y5AT 1GGDB 1SGYE 1C5SA 1D6RA 3TNSA 1AO5A 4ISNA 2QF0A 1YYY1 2OTVA 2FODA 1YLCA 5GPIB 4XSKU 2ZU3A 2CMYA 9LPRA 1WQSA 3PROA 4FU8A 1GBJA 2BXTH 2R9PA 3RXOA 1EP5A 1DXPA 2ANYA 1S84A 1LDTT 1Z8RA 3HK3B 2BVRH 4NFFA 5E0JA 3VXFH 1SHHB 4ABHA 2ODYB 2WPJS 1KTSB 1DDJA 2XWBI 4LK4A 3GY5A 3BTQE 2SNVA 4MVNA 2XC0A 1V2VT 1EPTB 3HKJB 3ATLA 3K6ZA 1E34B 1NFYA 3P92A 1XKAC 3UR6A 1V2LT 4ABBA 1C5XB 3ESTA 1NU7B 3SUEA 1ARBA 1EAUA 1O38A 4HTCH 2FLRH 4UE7H 1UVPA 2YOLA 3BTHE 1C5LH 1JBUH 1FDPA 1D4PB 3PWBA 3A8BA 1ZPZA 2QY0B 3GCTF 4NIWA 4INKA 3SBKA 1RXPA 3ATKA 2Y82A 2EA3A 1A5IA 2NU4E 4X2WA 1K1LA 3BG4C 1AFQB 2VWLA 3K65B 3T27A 1BOQA 2STBE 1H8DH 2ZDNA 1O2UA 1ZSLA 1G2MA 1AVXA 3RXMA 1CGHA 1ELCA 1C5WB 2OCVB 3VGCB 1ZOMA 2Y7XA 5CHAB 1EZSC 3A84A 1ZMNA 4OS1A 5HGGA 2ALVA 4K60A 4FVDA 2PGQB 3AASA 1F5LA 5ABWA 2O8TA 1OP8A 4AZ2B 1ID5H 3D62A 3GDUA 3LH3A 2ODQA 1PPFE 1HAGE 1RJXB 4Y76A 1TOMH 4D76A 1O3HA 2V3OH 1TE0A 1O3GA 5EXMA 3VB6A 2JKHA 4TWWA 2GZ7A 2FZZA 2FOAA 1GJ5H 4XBDA 2JH6D 1QB1A 3DFJA 2PUXB 3PMHB 3KHVA 2VWNA 1DWDH 3NCLA 2Y5GA 1N6XA 6LPRA 3SNBA 1TGBA 3E8LA 1OWHA 1KXEA 3O8DA 2HPQH 2JETC 6ESTA 5ETXA 1S0RA 2FX4A 3HATH 2LNCA 3SUFA 3P95A 1OKXA 3M5NA 2J38A 3GY8A 1YCPH 4F4OC 1GDQA 3QTOH 1AQ7A 1IQEA 4Q80A 1NRRH 2FOEA 4X6MA 3M7QA 3RMLH 2GZ9A 5K0HA 1O2OA 4HZHA 3SV8A 3A87A 4H6SB 1TNJA 2C93B 2Z94A 5EOKA 1UVTH 4K1EA 1GMCG 3SGQE 1C5YB 4R0IA 1KXAA 3KEEA 3LGTA 3RXVA 4IN1A 2GCTC 1K1MA 1GBFA 3BTEE 1AKSB 2BZ6H 4CREA 1E37B 1XUIA 2EI7A 1QRWA 1TMUH 1F5RA 4H4FA 1ELAA 1O5FH 5JBBS 3UWIA 1NRQH 1GBEA 3A82A 2BLWA 4GVUA 1CVWH 2PTCE 2QXJA 4MG3A 4WXVA 5T6FA 1T32A 3LGUA 3M61U 2GCHG 2ZWLH 2A4GA 3D49H 1P01A 1RS0A 1MTNC 4WVPE 1MAXA 3AAUA 1UTLM 3LH1A 3RU4E 1MD7A 1P2IA 3P8NA 1THPB 5C1UA 3U8TH 1EJNA 4DIIH 4GLYA 1YPLH 2GV7A 2W5EA 1GBLA 5AHGH 1V2KT 1TPAE 5B6OA 2G4UA 3DFLA 3VB3A 4X8TH 4NG9H 3PLPA 2WV5A 1CU1A 2I6QA 3GY2A 3RDZA 2P95A 3MI4A 2P93A 4B2CA 1LHDH 1V2MT 2GDDA 1O35A 1KLIH 1TNGA 1SPJA 2G5NA 1PQAA 1GDUA 1UO6A 4WH8A 1NTPA 1S81A 1XM1A 5EG4A 3LPRA 2DUCA 4A92A 3SOSA 2FS8A 4UFEH 1TRMA 2VVUA 2AFQB 4BTIB 1Z8GA 1LMWB 2RCEA 2TIOA 2ZG0H 1L1GA 1IQGA 1L1NA 2QCYA 1BMNH 3QGJA 1HV7A 1SBWA 3F1SB 1TGSZ 1FAKH 3MYWA 2SGQE 1W3CA 2A5KA 3CP7A 2ZFFH 4M7GA 1SMFE 5JBCS 5T6GA 3BEUA 5SGAE 2CGAA 2PR3A 4FUCA 1XKBC 1VJ9U 5EQSA 1CA0C 4GHTA 1HRTH 3FP7E 1K1PA 2GP9B 2BY6X 1P05A 3ZZ3A 1C2LA 3BSQA 1NESE 1N8OB 3OU0A 1DICA 4HGCA 1K1JA 4NWKA 1UHBA 2JH5D 2A7HA 3RXRA 3GYLB 1H1BA 1Z8JB 1W8BH 3EA7A 3RXPA 4ZKOU 3RUOA 1ARCA 3SI3H 1OOKB 1KYNA 1AN1E 2PSYA 2XBXA 4TYDA 1AMHA 1WTGH 5GIBA 2SGPE 2QF3A 4I31A 3VB4A 1UVOA 2PTNA 2VB0A 3SNAA 4XFQA 1DLKB 1BRCE 1KDQB 1ETTH 3V3MA 5F6MA 1HAYB 3LGIA 1E35B 4PROA 3OTJE 1BUIA 3DD2H 3TJOA 2G52A 1QRZA 3EDXB 2ZKSA 3Q76A 1TRNA 2ZTYA 1O2NA 4HFPB 1JRTA 2A2QH 2VINA 5EW2H 1HAVA 3SHAH 2G4TA 2VGCC 3S7HB 1ELFA 3UNRA 1BRAA 3GCOA 4OS6A 6GCHF 2WPKS 2GT7A 1KSNA 3UOUA 4I8JA 3SNEA 2BDCA 2Q6DA 1BB0B 3QTVH 4CBNA 7LPRA 3CS7A 1QB6A 3FAOA 5DP5A 3RM0H 3MO3A 3PLBA 2ZGBH 2BM2A 2P94A 1O32A 2VIWA 4Q2KA 1ZTLA 2BD3A 4I8HA 5EQQA 4X2XA 4I8LA 5A0AE 1TAWA 1L2EA 4K69A 3SV6A 1PPHE 2J9NA 1O5GH 3A80A 1TNLA 1AB9C 3BIUH 5DPAA 4YOGA 3ZVGA 1V2UT 5DP6A 1B7XB 1B5GH 1BHXB 2VIOA 4GPGA 1DSUA 3M3SA 1QQ4A 1YPKH 1WU1A 1FNIA 3RMMH 1MQ6A 3OY6U 1ZRKA 1QURH 1ZPBA 1MBQA 1CGIE 1TX8A 1DS2E 1P9SA 4YTAA 2C90B 4DJZB 1VCQA 1ANDA 1D3TB 4A1VA 3EE0B 4TPYA 3TJVA 1QL7A 1SQOA 1DX5M 2HWLB 2QV1A 1C1PA 1CBWC 2ZP0H 4D9RA 4TY6A 1HUTH 2B0FA 1BTUA 4ZH8A 3A86A 1Z7KA 1JXPA 4ZKNU 3RMOH 4AYVB 1DXWA 4IMZA 4NSVA 3WY8A 3SN8A 2UUYA 3ITIA 1BRBE 3PV4A 3MFJA 4YLQH 3BF6H 2GV6A 4VGCC 1MU8B 2K1QA 1RTLA 1K21H 1LPKB 3PO1B 1EASA 4FVBA 4GCHF 1SGQE 1O39A 1WQVH 3FVFB 5AFZH 9ESTA 3LJJA 4RKOB 4X1SU 1V2WT 2C8ZB 2Z9LA 3VB7A 2C8XB 4F49A 3GICB 1A5HA 7GCHG 3BTWE 3QN7A 1DE7H 5FPSA 5E2OA 1XXDA 4GHQA 5HM9A 3DHKH 1TFXA 4YO9A 1PPZA 2PWXA 5EPNA 5EXLA 1SB1H 4JZ1A 1EP6A 1AE5A 1GI6A 2ZZUH 4ASHA 2A4QA 3A8CA 1BTZA 3AAVA 4ISOA 1W7XH 4A7IB 1O31A 3M37A 1C1OA 1FUJA 3VXEH 1AVWA 3M5MA 1GMDF 1HLTH 4UFFH 2H5DA 1FXYA 3RXKA 4K2YA 5EXNA 4INHA 2PSXA 1AIXH 4MPUA 2G8TA 1BTWA 1FQ3A 1PJPA 3E6PH 3O8RA 3BTDE 2HRVA 2BY8X 3RXLA 4XDEA 2PW8H 4Y6DA 1O2QA 3N7OA 3TLOA 2FP7B 2FO9A 2WYGA 2BDIA 1CT0E 2OQUA 2ANMH 2AS9A 1Y8TA 1LVYA 3A7XA 3UIRA 3S69A 1C5MD 2HVXA 2PHBA 3CS0A 1C4V2 2BYAX 2Q6GA 1WSSH 1ZHRA 2OUAA 3ATIA 2BD2A 2PV9B 1QRXA 2VGCB 1EUFA 1ETRH 5T3HA 1GI2A 1HAHH 2BLVA 1ESAA 2HGTH 4NA8A 1T8MA 1O2YA 2BD4A 5J4QA 1GHWH 3GCTG 1QHRB 1O2MA 3RC6A 2FMJA 4IC5A 4Q7YA 3C1KA 4MNXA 4Y7AA 4JYTA 3SU1A 1A3BH 1AUTC 2KAIB 1C5UA 7KMEH 1HAOH 1CHOF 3A7YA 4O97A 1J9CH 1UK2A 2C8YB 2QXIA 2VH0A 1QFKH 3RXBA 2STAE 1L4ZA 2BLOA 3SO3A 1C1MA 1GBDA 4SGAE 4B2AA 1Y3UA 3KGPA 4J1YA 2ZDMA 2OINA 3KQCA 1QJ6B 1BJVA 4WMEA 1A0LA 1HXFH 1TNKA 2BHGA 3NZIA 3SU6A 3W94A 4DGJA 8LPRA 2HNTE 2QXGA 4AGJA 2C8WB 5J4SA 1GHBF 1GHAF 1MUEB 1WCZA 2CXVA 1P2MA 2A4RA 3JZ2B 2PKSC 1OX1A 3BTTE 4X0WU 1BMAA 2BDAA 3MH4A 1HJ8A 4Y10E 2XXLA 1HYLA 1XVOA 1ELGA 2P8OC 1S85A 5BPEA 4X1NU 2TGPZ 2VIPA 2ZPSA 1C5RA 2YNAA 1GDNA 1HXEH 1TQ0B 1LO6A 1RFNA 3M3VA 1ANBA 4IMQA 4ISLA 3LJOA 4E7RG 1AWHB 1O3AA 3LC5A 1Z8IB 4Z6AH 3TJNA 2AMPA 1C5PA 1OWDA 2V3HH 2G5VA 3A88A 3NUMA 4K8BA 3RXFA 2BDYA 4VGCB 3P8OA 2FTLE 2IOTA 1P03A 3RC4A 4AFSA 1HAXB 5DK1A 2CV3A 1YPMH 5HXFA 3L33A 1EOJA 3T28A 3BEFB 1GJAB 1GBBA 1UMAH 2B5TB 3UQOA 5TJXA 1SGDE 3MU0A 1Q31A 1CA8B 4YT6H 4BAHB 1K1IA 1G3DA 4MPXA 4JZIA 1OPHB 1PPCE 1UVSH 3VB5A 3URDA 2B8OH 1GCTC 4JYVH 1O3BA 2Q1JA 3TJUA 1H9HE 2H1UA 4XBCA 2OQ5A 1C2EA 1GJ6A 1DANH 3L3TA 5BRRE 4Y8ZA 3SJIA 3SU4A 1UTJA 1GG6C 4BAMB 1VGCB 1WBGB 3RXGA 1TIOA 3ENSB 4B73A 1GI7B 4ABGA 4JYUH 4UEHH 4ABJA 1F7ZA 3Q3YA 3RP2A 3KQDA 1P57B 2D2DA 2BD7A 2WPMS