4I8LA

Bovine trypsin at 0.87 resolution
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title On the reproducibility of protein crystal structures: five atomic resolution structures of trypsin.
pubmed doi rcsb
molecule tags Hydrolase
total genus 62
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4i8lA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4i8lA02
1EOLA 1UVUH 3UNQA 1AFQB 1P04A 1H1BA 2FOHA 4ABGA 4MDSA 3KIDU 1C5MD 5K0HA 2ZFRH 3A81A 4Y6DA 1S5SA 3TGJE 2HNTF 1MMJN 2H9EH 3RXTA 1TMBH 1N8OC 3SNEA 3C1KA 2EA3A 2SNVA 5GWZA 1GMHG 1RS0A 1CGHA 1O3HA 1O30A 3DA9B 3UWIA 4AB9A 4D7GA 2ZHFH 1NPMA 1OPHB 2FDAA 3ITIA 4Y71A 2G4TA 1O35A 4ZUHA 4IS5A 1YPEH 2Y81A 3Q00A 1CSOE 1AMHA 1C5PA 1Z8IB 3M7UA 5A09A 2ANWA 4YLUA 4WMDA 1MAXA 4BAKB 5B6OA 1QQ4A 1BRCE 1UTMA 1C2IA 1HGTH 1AZZA 1KTTB 1Y3WA 2SNWA 4IW4E 1K1JA 3HGNA 3SN8A 2BDBA 1CT2E 1YPHC 2FWWA 2F9NA 2FI4E 3NK8A 3PLKA 2AYWA 4FUFA 3V7TA 4X6NA 2FOGA 1BCUH 4CBOA 3SW2B 1QL7A 2HALA 1GHAG 2FX4A 4MVNA 3A7ZA 2WPIS 1ETTH 1GBTA 1ZJKA 5EG4A 1EAWA 3O8RA 2O9QA 3A84A 1DM4B 3JZ2B 3S9CA 1BJUA 1GJ5H 1O3AA 2ANMH 1FLEE 2P16A 1GBBA 3MU5A 1EZQA 3PLPA 5I46H 5H4IB 4ZKOU 7LPRA 4CRFA 1FY4A 3MHWU 3TJNA 1JWTA 1SGTA 2ZA5A 2NWNA 4FVBA 2EI8A 1GGDB 3KL6A 1WU1A 1OYQA 4ZH8A 1CA0C 1FN8A 4K5ZA 1T8NA 2ZGCA 1OWEA 1MTVA 4X2XA 4JYUH 2F3CE 5IYTA 2ANYA 2NU2E 1ZHMA 3MU1A 1F5KU 1IHTH 1FPCH 2AS9A 3A8DA 2XCFA 1GPZA 1QB6A 3OYPA 2TGDA 1O2RA 1QB1A 1TA6A 3SUGA 1Y5AT 5G4BA 1UMAH 1HB0B 1EAUA 3K2UA 1NM6A 1P3EA 2CF8H 3MYWA 4XBBA 3RXHA 1K9OE 6LPRA 1BTYA 3GY3A 1NTPA 1HUTH 2ALVA 4ZXYH 1ZSLA 5T6GA 4KTCA 2OINA 1F0UA 1TRNA 4LXBH 1TBZH 1CBWC 4HFPB 1OP8A 3ZVGA 5EQRA 5T6FA 4A1TA 3LIWA 3ESTA 1YCPM 3PROA 1UHBA 2O8UA 2BQ6B 2B7DH 2QF0A 3BTDE 1OWDA 1A0HB 5HYOA 1CA0B 3HK3B 2Y82A 7KMEH 5EGMA 1O5BB 2ASUB 3LDXH 1OS8A 1YCPK 4Y76A 1H9LB 4TPIZ 1BITA 1S84A 3A88A 4WWYA 3QGNB 2BD9A 2FOAA 5GXPA 1NRRH 1A5HA 2ZEBA 3UNSA 5GJ4B 1Y3XA 3UOPA 1XUFA 3BIVH 1V2UT 1THRH 1JBUH 2BLVA 3TLOA 2ZPRA 1C5WB 2ZDAH 1QCPA 3MNBA 2JH6D 1QTFA 1D9IA 2ZTZA 4JMYA 4PROA 4YTAA 1DITH 1MZDA 3FP8E 1QBVH 2BD8A 3UWJH 3I77A 1DSTA 1TGCA 1AWFH 1EZSC 3LGUA 2ZC9H 2A31A 1LPKB 1ARBA 3GDVA 3ZZ7A 3BTKE 4K1SA 1GVZA 2OLGA 1V6DA 5EQSA 1CBWB 2BLWA 1TFXA 2WINI 4Y7BA 1PPGE 3V3MA 2BD4A 1C5QA 2RA3A 2P3FH 1YLDA 1TRYA 1OKXA 2ESTE 1CE5A 2A7JA 1DANH 1SGRE 1TNKA 3QLPH 3QDZB 1S0QA 1LHCH 2G4UA 2FXRA 3RMMH 1VITF 4TWYA 2FO9A 3GISB 2C8XB 1PPZA 1YCPH 3U69H 1F0SA 4FUEA 1NU7B 2BYAX 1Z6EA 4J2YB 3S9BA 2A7HA 3ZVFA 3M5OA 1G2LA 2FS8A 3DD2H 2A1DB 4WH8A 2STBE 1QHRB 5EW1H 4Y11E 4UDWH 5LPFA 4H6SB 4TY7A 5T6DA 2RDLA 3PMAB 3QZQA 3QWCH 3SU1A 1ELFA 1S82A 1KDQB 5K7RA 2OTVA 4GUXA 2GT8A 1VJAU 1H8IH 5AFZH 2G8TA 1GI6A 2ZU2A 4UEHH 1BRUP 2XWBI 1Q3XA 2VGCC 3CP7A 4NWLA 1O2VA 3E3TA 2CJIA 1QR3E 1L1JA 1GJ6A 2ODPA 1P2NA 1BMLA 1SFQB 5FBIA 3U98H 5FCRA 3LONA 4DGJA 5FHTA 3A87A 4Y0YE 2V3OH 1DE7H 1K21H 1O2YA 4Y8ZA 4ZKSU 1IOEA 1C2KA 2QYIA 1KLTA 1HYLA 1LHDH 2ZHEH 4Q2KA 1QB9A 2FESH 1V2ST 3BTWE 1ZSKA 1FUJA 1ANBA 3SORA 2XC0A 1GI3A 1BJVA 1LKBA 1DY9A 2W3IA 3RXIA 1IQJA 1BBRK 3PM3A 4KTSA 3RXUA 6CHAC 1PQAA 4GPGA 5EPYA 1TB6H 1ARCA 1DWCH 1GBKA 4AB8A 4NA7A 3R0FA 1MH0A 3SI4H 1ESAA 1LMWB 1G2MA 1FAXA 4DOQA 5L2ZH 2CN0H 1OSSA 3NWUA 2UUYA 3UQVA 1J16A 1QGFA 2VGCB 1WOFA 1K1PA 1K1NA 3MH7A 3A7TA 3PMJA 1UJ1A 5C5OA 3TH2H 2TBSA 3RXPA 2AMDA 3C27B 2AGEX 2LNCA 3F9GA 3JZ1B 1SOTA 2UWLA 4WF8A 1JMOH 1XXDA 3UFAA 1OXGA 2P3TB 1O33A 4AZ2B 1TX6A 1Q2WA 1ZPZA 3SJ8A 3QTVH 1HAHH 4FUDA 2PUQH 3UR9A 2O8TA 2PV9B 4XFQA 1VZQH 1ELDE 4KTUA 5EPNA 1EXFA 4I8GA 4CH2B 1UTNA 4DIIH 3O8CA 1BTHH 6CHAB 1BBRH 3L33A 1W14U 1O3FA 1ACBE 4R8TB 4NCYA 5L2YH 5A8ZA 5DGJA 1L4ZA 1RTKA 1J8AA 1CHOF 1ELCA 2PTNA 3BEFB 1EB1H 2ZDLA 1UTOA 3S7KB 4IN1A 3ZVBA 2K1QA 2I6QA 2F9UA 4FUIA 1BTXA 2FLBH 1DX5M 4INKA 1P10A 3SJIA 1C4U2 2BLQA 4MNVA 2Y6TA 4BTTB 2FZZA 3F6UH 1O0DH 2ZU1A 1TX7A 5JBBS 4J1YA 1O39A 2ZQ1A 4MNWA 5EODA 3V13A 3SBKA 5DP8A 1FIWA 1TGTA 3VXEH 3LH3A 1LVBA 4UFFH 2VJ1A 3AVZA 1BQYA 5C20A 1AZ8A 1A5GH 2XCNA 3VB5A 3TJVA 1CT0E 1O3BA 1JRSA 1KXAA 1X7AC 3E91A 3SV7A 2D2DA 4CRGA 1SLWB 4JCNA 5F8ZA 2QXGA 2IN2A 3UIRA 1P2IA 2FMJA 1KSNA 2A5KA 4NSVA 3E16B 1ZYOA 1O2KA 3LGIA 4ZHLU 4U30A 2WYGA 3PO1C 1V2LT 4U01A 3P8GA 3MFJA 2Q6FA 2W7SA 1P12E 2O8WA 2R3YA 3BG4C 4Y7AA 1AVWA 2F9PA 1H4WA 1HFDA 1KLIH 1LVOA 4AGKA 1GJ7B 5ABWA 2ZO3H 2A2QH 1RIWC 1HAIH 1K1LA 1A2CH 2GMTC 1W13U 3MOCA 1K22H 3P92A 2FTMA 3EYDA 4X8TH 4BOHA 3PMBB 2R0KA 4DCDA 1HAGE 3TNTA 2F9BH 4JZFH 1OP2A 4JYTA 1KXEA 1W10U 1P2QA 3AW1A 4K8YA 3GCHC 1XKAC 4AYYB 2D1JA 1VGCB 4DJZB 1AUTC 1ELVA 1TGBA 2XC4A 5A0CA 1C5XB 1VITG 1K1IA 2A4RA 4K1TA 2B8OH 1VR1H 3SQEE 3SV6A 1G9IE 1RFNA 3FANA 1L4DA 3M7QA 5JDUB 1AI8H 1A0JA 1LO6A 1SGYE 2BY6X 1SGPE 3TH4H 3QN7A 2FOBA 2GZ8A 1N6YA 1SOZA 2FS9A 1EP6A 1GJ9B 3BG4B 2WYJA 5E0HA 1JIMA 2GDEH 2AMPA 3ELAH 1XUIA 3UPEA 3UY9A 5F03A 3LGTA 4X1PU 1NROH 3GY2A 1G3BA 4DIHH 1RIWB 1TPPA 1JRTA 1BUIA 1TIOA 1IQGA 1DS2E 2GCTB 3MH5A 1GBIA 2H5DA 3T29A 1TNGA 2B0FA 4K69A 2EI7A 5T3HA 4FUCA 2C8WB 2PSYA 1PPEE 4YT6H 4ISLA 1YKTA 1AWHB 1BBRE 3GCHB 2H1UA 1V2PT 1EB2A 1Z71A 2AMQA 3GOVB 1C1MA 1LTOA 1DFPA 1W8BH 2ZFPH 2GZ7A 1QIXB 3E0NB 4JZEH 1SHHB 1TWXB 1B0FA 1F92A 2UUFB 1HAZB 3BEUA 2BTCE 3SHAH 3BTQE 2P93A 1BMMH 1XX9A 1EPTB 5DP6A 2WPLS 4RSPA 3KHVA 4F4OC 4ABIA 1GL1A 3FFGA 5DP9A 1O2LA 2Z7FE 2SFAA 3VGCC 2BMGB 3ZV9A 1PQ5A 3LC3A 1NRNH 1BRAA 1LPGB 5FBEA 2VIOA 2XBYA 3E1XB 1WYKA 4NFEA 3F9HA 4UD9H 4BAQB 1O5EH 2F91A 4OS1A 3ZZCA 5HMAA 3VXFH 3B23B 4NA8A 3HKIB 1BHXB 1DDJA 1FI8A 3K6YA 1GJCB 2FODA 3OU0A 5CHAC 2VWMA 2Z9KA 1SL3A 1O2UA 1ESBA 1O36A 1GJBB 2VWOA 4OS7A 1EAXA 2NU4E 1AN1E 1TA2A 2PGBB 1WAYB 1YPKH 3FAOA 3LC5A 1ZMJA 1O3PB 4FXGH 4IGDA 1GJ4H 2BB4A 1C1UH 4HI3A 1DICA 1F7ZA 1MZAA 2A2XH 4NGAH 1Y3UA 1DUEA 3LJOA 1ZSJA 2VIPA 3ENSB 4OGYA 2OC1A 2WV5A 2RA0A 1YPHE 1NU9A 3RLWH 1DOJA 1Z8JB 1KXFA 3OSYA 1ZHRA 5A0AE 1ZRBA 1DLKB 2ZI2H 2OC0A 3TU7H 4TYDA 5EQQA 4BAMB 1CHOG 3MI4A 3V12A 1ORFA 4MPXA 1GI1A 2G81E 1CQQA 3B8JA 3UREA 2WUCA 1O3CA 1EX3A 5L30H 1GI5A 2IOTA 3TITA 3LKWA 1PPBH 1GI0A 2TGTA 5CHAB 5GPIB 3T26A 1V2VT 2FYQA 2R2WU 1UVOA 2HVXA 2PW8H 4JZ1A 1EP5A 2OC7A 5FPSA 4ZHAA 5DG6A 1HIAB 1E37B 4AFZA 2HPPH 1Z8GA 2CXVA 1S6HA 4TY6A 2FOCA 1DWBH 1AB9B 1GGDC 1SQTA 1DXWA 1DWDH 1SR5C 2Q6GA 4AG2A 2ULLA 4FUHA 3G01A 8KME2 2BDYA 1TNIA 4DY7B 2OC8A 4M7GA 2ZZUH 3F1SB 4A5TS 3EA7A 4ISIH 3SU2A 7GCHF 1QRXA 2EEKA 1O3LA 2ZCLP 1VCWA 2A4OA 5C1YA 1TPSA 4AFQA 1MU8B 4YZUA 5DJ7A 1YF4A 2A32A 1GMCF 3QTOH 1S6FA 1F5RA 1M9UA 2ZGHA 1FXYA 1EJMA 4X1RU 1GHYH 1GCDA 2G51A 3MU4A 4IBLH 4I33A 2ZECA 3A80A 4D9RA 4Q7ZA 2YOLA 2BXUH 4X2WA 3U8OH 1TMTH 1SC8U 1SFIA 4X0WU 3A7XA 2ZHDA 1MCVA 1L2EA 4ISNA 1P9UA 5FPTA 4KKDA 9ESTA 1XUKA 2QA9E 1RD3B 3VPKA 2Y80A 1EATA 3LU9B 5J4QA 2AGIX 1HXFH 3ATIA 2KAIB 2Z9JA 1P09A 2ZP0H 3P8NA 2ZDMA 3M3TA 4Q7YA 7ESTE 3M37A 4X6MA 5JBTA 2AH4X 2PGQB 4FUJA 3TJUA 1VJ9U 1C4V2 4FUGA 2OUAA 1ETSH 4XSKU 2DE9A 2Z3DA 1SBWA 2J9NA 3Q76A 1D3QB 1W12U 1TOCB 2A0QB 2CF9H 2PKSB 4JK6A 5A2MH 5FX6A 3O8DA 1GHVH 1C5VA 3ATMA 4SGAE 3BTGE 1FJSA 1GBAA 2ZPQA 1P57B 4VGCC 3EGKH 4BAOB 3PMHB 4NSYA 4YLQH 4TPYA 1BTPA 2BDAA 1ZPCA 2GTBA 2Z3CA 3PTBA 4Y0ZE 1TQ0B 1TGSZ 1T7CA 4JYVH 2AIPA 1UK4A 3GDUA 1G3EA 5GIBA 1AVXA 1SMFE 1T8LA 2ZU3A 1YYY1 2XC5A 1ZHPA 3PWBA 1C2HA 1A5IA 2A4GA 3U9AH 1XVOA 5DP7A 2GP9B 1E0FD 1GDUA 2PTCE 1SPJA 3KQBA 5TCAA 5FAHA 2BX3A 4B76A 3L6PA 1GVKB 1ZTLA 2BY7X 1WV7H 2XW9A 5CMXH 1WCZA 2P95A 2GV7A 4DT7B 1V2KT 5JB8S 2XBVA 1XUGA 2FP7B 4D8NA 1TX8A 2PHBA 4DW2U 1WTHD 3A8BA 4O97A 3VB7A 4ESTE 3EE0B 3ATLA 1W11U 1V2TT 3T2NA 1V2NT 1QRWA 2BHGA 2QN5T 1O34A 3GCNA 4VGCB 3E8LA 2PKAB 2XNIA 2IPHA 4X2YA 4ABAA 1V2RT 4O3TA 2ZFFH 2XBXA 1IQNA 1GBCA 1C2EA 3EA9A 2C3SA 2ZG0H 3QUMP 1O5CB 2ZGJA 2VWLA 3ZZ5A 1RJXB 3O8BA 1BHXF 4MG3A 5PTPA 1HJAC 3A8CA 2Y5HA 1EPTA 1Y59T 4K2YA 2W3KA 1GI8B 2QC2A 4D7FA 3A82A 1C5LH 3RXRA 1HCGA 1SGQE 1RTLA 4CREA 3A86A 2SGQE 3QK1A 2TRMA 5LPEA 2VINA 3BTFE 1Y5BT 2TGPZ 1FAKH 2WV4A 1GCTB 3AW0A 2F9OA 4GAWA 3ODDA 4D76A 1AFEH 3SZNA 2NU0E 4I8KA 1MTWA 2W5EA 2XXLA 4I31A 1TABE 1ZR0A 4GVUA 8GCHF 2Y5FA 1TPOA 1ZGIA 1HJAB 1GHBF 4O9VA 2W7UA 2C8YB 1TPAE 2Y5GA 1C2FA 4X1SU 2BD5A 5EU8A 2UWOA 2OBQA 5EOKA 5A8XA 4AFUA 1B7XB 2VWNA 4Y10E 3SU0A 2YNAA 4ABBA 3MU8A 1EJNA 2B9LA 3V0XA 2HRVA 3SUEA 1P01A 1RRKA 1A7SA 4NIXA 1DSUA 2FTLE 3GY8A 2I6SA 5LH8A 1ZGVA 3ZZ4A 1VITH 1C1WH 3A85A 2UUKB 1GL0E 1EJAA 1F2SE 4O3UA 1SB1H 4HGCA 4IC5A 1AQ7A 1HIAA 1LHGH 2FOFA 1IHSH 3K9XB 3SU4A 7GCHG 4AYVB 2VVUA 2ALPA 3HK6B 3OY5U 3MO6A 2HNTC 1YBWA 1NC6A 3SGQE 1GMCG 5F8XA 5GCHF 1G37A 3LGYA 4I8HA 2AEIH 2ZFTA 4ZAEA 3PWCA 4OS6A 3URDA 3ODFA 3BEIB 3RMLH 5A0BA 1O2XA 3RXAA 3SNCA 1P8VC 3RXMA 3DHKH 1O2WA 1NFUA 3KEEA 3MNXA 2TGAA 2BX4A 2ZFQH 1O2HA 1SGIB 2C93B 1MKXK 5E2PA 1O5AB 1AKSB 3ZYDA 2P59A 1D3TB 2G55A 5C2ZA 1YM0A 1YP9A 4KGAA 1NFWA 1G36A 2FEQH 1GBJA 3NKKA 2ZFSA 1P2MA 3IITA 4BTIB 5I25A 4DVAU 9LPRA 3LPRA 1GJAB 1TRMA 1O2IA 2KAIA 2BZAA 1PFXC 1ZZZA 1DVAH 1DY8A 3UTUH 4UFGH 2ZU4A 2Q6DA 5HM9A 2FM2A 1S0RA 2FOMB 1ETRH 1MTSA 4X6PA 5DKMA 4ABDA 4OS4A 3BTME 4IMQA 4UFDH 3SNBA 2JETC 1DXPA 2BLOA 5C3NA 3Q3KA 3ZYEA 3T27A 1HAPH 3MNCA 1MKXH 4AOQA 1VGCC 2FLRH 5LGOA 3RXBA 1CVWH 1GBDA 1UVSH 2QGRA 1CU1A 1TNHA 2Z6BD 1XKBC 2BDHA 3LGWA 1C2JA 3AAVA 1GBEA 5CE1A 2SGDE 1O32A 1O2QA 1O38A 3EQ0H 3STJA 4YO9A 3FZZA 2A4QA 3E6PH 4GHQA 3D65E 1HJ9A 2GD4B 2TIOA 2VU8E 5FX5A 1HAYB 4X8VH 1W0ZU 1E34B 4JK5A 5AVDA 4UE7H 2H2ZA 5C1UA 3GYMA 2QXJA 1HAVB 2GCTC 1AIXH 4NG9H 1Z1JA 5DO4H 2OD3B 1PPFE 4AX9H 3P95A 4WXIA 4Q7XA 1V2WT 2IJOB 2NU3E 1D4PB 2JETB 1F0TA 2PKAA 1O2SA 1THPB 4TWWA 4CBNA 1BT7A 3M7TA 2C90B 2CHAC 1GMDF 1FY5A 4I8LA 1SGFG 4QT8C 1W7GH 4CHAB 1BMNH 1F5LA 4WJG2 3RXFA 3A7WA 3SGBE 1GHWH 2XYAA 1GVLA 3S7HB 1EPTC 3M61U 2OCVB 2ZHWH 1QBNA 3MNSA 1C5OH 3TH3H 1LPZB 3SQHE 5FXLA 2XRCA 4FVDA 2VIWA 1T8MA 1MU6B 2ILNA 1P03A 3FZDA 4INLA 1NO9H 3W95A 2CV3A 1U6QA 1EZXC 1HXEH 1VCPA 1OWKA 2ZPSA 4A1VA 4ABJA 3FP6E 1PJPA 2A5AA 1HAXB 5JBAS 4Z6AH 1EKBB 1WQSA 3A89A 1IQHA 1LCYA 3NPSA 3CS7A 1GHXH 4X1QU 2BVSH 1GDQA 8GCHG 3SNAA 1MD8A 1C5NH 1QQUA 3ATKA 1GHBG 2CHAB 1O2OA 1MTNC 1W2KH 4WMFA 1N6XA 3KN2A 2JH5D 3M5NA 2V35A 1SG8B 3GY5A 5TJXA 4B2AA 2GCHF 3T28A 3SJKA 4NIYA 1A46H 2VH0A 4K8BA 2FX6A 3MTYA 2RCEA 4GCHF 3QZRA 3BN9A 4NZQA 1ELEE 1O2ZA 3D62A 3ZZ8A 5E0JA 1ZOMA 1YLCA 4X1NU 1KXBA 4YT7H 3DUXH 1IQKA 3SV8A 1K1MA 1E36B 4NFFA 1S85A 2B5TB 1QRZA 1SGCA 3KGPA 1H9IE 1KXDA 1AE8H 3HKJB 3Q3XA 4WH6A 1BA8B 1UK2A 4A6LA 2VH6A 5J4SA 1EASA 4CRBA 1FY8E 3LJJA 2BOKA 1JIRA 2ANKH 1Y3YA 1ZMLA 1MTNB 3A83A 5GCHG 2O8MA 2PLXA 3TK9A 3ZZDA 1FONA 3PB1E 1AB9C 3A7YA 1LDTT 2THFB 2D8WA 3LGVA 1SGDE 2HOBA 4U32A 3IG6B 1BTUA 2BD7A 3RM0H 2F83A 2H6MA 5DP3A 2Z9LA 1INCA 1B5GH 2ZTXA 1AE5A 2P94A 1C1RA 1J14A 1QJ7B 2VNTA 1D3DB 4MNYA 2GT7A 1B0EA 1HV7A 3M36A 1YGCH 3F68H 4CRDA 1O2MA 1UCYK 1ZJDA 4GSOA 2GKVE 2Z9IA 1AKSA 4AN7A 5TCCA 3ZZBA 1GBHA 4ABFA 3VFEA 1MUEB 4B1TA 2JKHA 1DWEH 3MH6A 4ZROA 1Y5UT 1P02A 3TJOA 4H42U 1V2MT 5EXMA 1ZPBA 1G32B 2A5IA 2ZQ2A 5HM2A 2OQUA 1O5DH 2P8OB 4E7RG 1PQ8A 1WQVH 2OP9A 2V6NA 1NESE 1S81A 4WXVA 2Y7ZA 1DLEA 2FI5E 1TLDA 1BRBE 1V2OT 5ETXA 4YM9A 2PUXB 1UTKA 1FMGA 4IMZA 4XDEA 3A7VA 2FOEA 1A0LA 1O3DA 2BM2A 1TBQH 2PKSC 3ZZ6A 1D3PB 3F9EA 1SSXA 4BAHB 1T4VH 1C1SA 1QJ1B 1F0RA 1BOQA 1GJ8B 2ODYB 5F6MA 1UCYH 1GI4A 1AD8H 2BY8X 4BANB 1IQLA 2WPMS 1LKAA 4I7YH 2BZ6H 1AGJA 1TGNA 1SLVB 1T32A 4MPVA 1PYTC 3M35A 8LPRA 1QA0A 2PSXA 3BTTE 2SGAA 3M5MA 3RU4D 4FU7A 4CR9A 4E06H 1N8OB 1Z1IA 2UUJB 4XE4A 1QJ6B 4ASHA 5E2OA 2YNBA 3CS0A 3PV4A 1AU8A 4B74A 4GLYA 2OXSA 1MBQA 1AY6H 1QL8A 4CR5A 4OGXA 3ZZ3A 1K2I1 3FP7E 1HAVA 1LQDB 2R2MB 1GMDG 1AHTH 3PTNA 1CHGA 3NZIA 3TK6A 1O3MA 3AAUA 4I32A 1AUJA 3SUDA 3T25A 1GJDB 3MH4A 1C2GA 2BD3A 3GYLB 3UUZA 3BIUH 3TNSA 3S0NA 1TQ7B 3TIUA 3RMOH 3RXDA 3OX7U 1NFYA 2J4IA 1CO7E 1LHEH 1C2LA 2VIVA 1SGNE 3RDZA 3VB4A 2ZGXH 1PPCE 1N1LA 4FU8A 4BXWA 1TYNA 1LQEA 4RKOB 1O3OA 1O37A 3RXGA 1T8OA 3RXLA 1FZZA 4U2WA 2F9VA 1EZUC 2VVVA 1AVGH 3WY8A 1MQ6A 2Z9GA 1P05A 1QNJA 4F49A 3U8TH 1G3DA 3KCGH 3SUFA 4ZKNU 3VEQB 2V0BA 2FIRH 4SGBE 3DFJA 4Q80A 3RC5A 2QXIA 1RXPA 1GCTC 3K65B 2ZNKH 3RC6A 1BIOA 2GCHG 2HPQH 1NS3A 1GBMA 2JH0D 1A3EH 5ESTE 1HNEE 1HRTH 4WVPE 2HWLB 4KELA 4ZMAH 4GCHG 2G5VA 4LZ4B 2R0LA 2OBOA 4B2BA 1P9SA 4KP0A 3ZV8A 3U1IB 3RUOA 1W0YH 3BSQA 3VB3A 6GCHF 3SOSA 1Z7KA 2CMYA 1ZRKA 2H9TH 1RTFB 1ESTA 1WSSH 1MBMA 3SNDA 3P6ZB 4RN6A 4LK4A 5BPEA 1SLUB 2ZCKP 1P2KA 1GDNA 1YPMH 2BQWB 5JYIA 3GCTF 1L0ZA 1T4UH 4MPWA 1NFXA 2PWXA 1MKWK 3RXVA 1VCQA 1GI2A 4X2VA 1UTQA 1Z6JH 1GI9B 1KTSB 1OWJA 4B2CA 1ANDA 1C9TA 1KY9A 4OS2A 5AFYH 3VB6A 3QX5H 1ANCA 1SGFA 3MWIU 4XOJA 1UCYE 1Q31A 3M3SA 1P11E 3NXPA 3P70B 1IQIA 2HLCA 1C1TA 1ZTKA 1C2MA 1SVPA 1AO5A 3MO9A 3SO3A 3Q77A 3I29A 4B71A 4X8SH 4B75A 1Y8TA 3F9FA 1A4WH 1WUNH 2HNTE 2GZ9A 2QXHA 1A61H 1S83A 3QO6A 5EXNA 2WPJS 2V3HH 1V2JT 3CENA 2QF3A 1DPOA 4E05H 1ANEA 4YESB 2J92A 3SHCH 3BG8A 2QIQA 4BXSA 1E35B 1C4Y2 1EAIA 1NRPH 3KNXA 1DT2A 5SGAE 1C5ZB 3MO3A 1PQ7A 3GDSA 1O2JA 1MKWH 1SQAA 4H6TA 4IN2A 1TE0A 4INHA 3UQOA 4MQAA 3P17H 1E38B 1TALA 5FPYA 4H4FA 1FNIA 5HGGA 1SQOA 3B9FH 4MPUA 4O03A 5DP4A 3FVFB 1G3CA 3I78A 1HBTH 1H9HE 1L1NA 4NZLA 1Y3VA 2H9HA 2P3UB 2BDGA 1UTPA 2QY0B 3SU5A 1CGJE 1A3BH 3SU6A 2SGFE 5BRRE 5LPRA 3ZVDA 2VVCA 2NU1E 5E0GA 1GBFA 1KLJH 3RU4T 4ABHA 1A1RA 4XBCA 3TGKE 4ISOA 3TGIE 3GY7A 2CGAA 1QURH 3OTJE 3W94A 2XWAA 1JXPA 1PYTD 4NWKA 3SI3H 2M5TA 3LH1A 4DURA 1THSH 1UTLM 4LOYH 3KF2A 1GBLA 4CRAA 2Q1JA 1XMNB 4K3JA 1V2QT 3R3GB 4WMEA 2BVRH 1C1PA 1O3JA 3D49H 1KXCA 1LVMA 1FIZA 4WY3A 1CGIE 1YPGH 2C8ZB 3Q3YA 1P06A 2UWPA 2XTTB 4R0IA 1OYTH 4B73A 5C67A 2BXTH 1FY1A 2HGTH 5E8EH 6ESTA 1UVTH 1QL9A 2ZDVH 3P8FA 4YOJA 1ZMNA 3U8RH 1P0SH 2VB0A 2GGVB 2BY5X 2G00A 5AF9H 2Z94A 1NY22 1O3KA 8ESTE 5ESBA 2STAE 3S9AA 3BF6H 2PFEA 2C4FH 5DPAA 2WUBA 1IQEA 1GG6C 1O3IA 1TNLA 1O2NA 1ID5H 1SLXB 1OOKB 3UNRA 2H5CA 2PR3A 2LPRA 3TK5A 1C1NA 3GY4A 3RXSA 4A1XA 1SI5H 4BTUB 1BTWA 2EC9H 5AHGH 3KQDA 1GMHF 3QGJA 1C5RA 2R9PA 1BB0B 3H5CB 2XBWA 3UR6A 4NA9H 1P2OA 2G5NA 3RP2A 4K60A 1C5TA 3BTEE 1BTZA 1O3EA 1C9PA 1W7XH 1UK3A 3RU4E 1O5GH 1SHYA 2WPHS 2SGPE 1O2PA 3SV2H 2BY9X 2ZCHP 1QA7A 1TNJA 4UONA 4CHAC 1HDTH 4YOGA 5JB9S 1XVMA 2OQ5A 1OP0A 1IQMA 3TVJB 4JZIA 2W26A 3D23A 1GWAA 1IAUA 1L1GA 2ZWLH 1J9CH 2BOHB 3RC4A 1XXFA 1GHAF 3RM2H 1GG6B 4MNXA 3PLBA 1KIGH 2FYRA 1C1OA 4I8JA 4GHTA 1HAOH 1QBOA 4AFSA 1UO6A 1NRQH 1MCTA 1O3GA 1Z8RA 1XUHA 2BDIA 3RXJA 3T5FH 5IDKA 2BVXH 2ZKSA 1TBRH 1FQ3A 1MAYA 1YC0A 5F8TA 1O2TA 3BTHE 2A45B 3N7OA 5C1XA 1LHFH 2J94A 3S69A 2GX4A 1DUAA 1GI7B 1EQ9A 1HLTH 1O3NA 1YPJH 5EW2H 3SJ9A 4ZKRU 1TMUH 3RMNH 6GCHG 1K28D 3EAJA 3UOUA 4K1EA 5C5NA 1KYNA 1SGEE 2AGGX 1FY3A 3GICB 2VIQA 4THNH 5HXFA 3ZZ9A 2FI3E 3MMGA 1BMAA 3HATH 3ZVAA 4AG1A 2QAAA 3KQEA 3ZVCA 2J38A 1O2GH 4XBDA 1OWHA 2J34A 1ZTJA 1C5SA 3GCTG 5A8YA 1HPGA 3SJOA 5L6NH 1HJ8A 2AFQB 5DK1A 1C2DA 3MU0A 4FUBA 4ABEA 3ZVEA 1XUJA 4Y79A 3LT3A 1UHBB 4MLFB 3H7TA 2ZDKA 1CA8B 1D6WA 2O8LA 1P3CA 3PO1B 2Y7XA 1FV9A 4Z0KA 4IC6A 1J15A 3SU3A 2ZF0H 2GV6A 1IQFA 2AIQA 2EI6A 1T31A 4ISHH 1FPHH 3NUMA 2A7CA 2G52A 1NRSH 3RLYH 3K6ZA 4ZXXH 2ZTYA 4X6OA 1CT4E 2GMTB 3URCA 2BD2A 1UTJA 3HGPA 3ZZAA 4D9QA 1EUFA 4NIVA 4MTBA 4UFEH 4A92A 3STIA 1UVPA 3P8OA 3SV9A 1BZXE 1ELAA 5DP5A 1ZLRA 3T62A 3DFLA 1KDQA 2ZU5A 1V3XA 1NN6A 2RG3A 4E7NA 1ABIH 2QV1A 2GVFA 3AASA 1MTUA 4BNRA 3RXCA 2BQ7B 1QY6A 1C1VH 1C5UA 3H7OA 3EDXB 5FCKA 4A7IB 1XM1A 1K1OA 3LOXA 3SGAE 1PPHE 3EA8A 2QCYA 5JPMH 4AGJA 3ATWA 1TAWA 2ZDNA 1BDAA 4JZDH 3U1JB 2VIDA 3E90B 4NIWA 4HTCH 2DE8A 3E0PB 4LZ1H 2ZIQH 2TPIZ 2ZGBH 5GDSH 2ZHQH 5EXLA 1MD7A 2BDCA 1J17T 1P2JA 3NCLA 1G30B 2J2UA 2SGEE 3KQCA 4Y8XA 1AFQC 1TOMH 2J95A 3GY6A 3BV9B 2FPZA 1WBGB 1RGQA 1ABJH 1OWIA 2D26C 2WPKS 1FN6A 1C5YB 2AERH 3OY6U 4AORA 4ZHMU 2P8OC 3RXKA 3L3TA 3DT0H 4CH8B 1JOUB 1MQ5A 4DG4A 3RXQA 2R3UA 1OX1A 2GDDA 1TONA 3M5LA 4RKJB 4X8UH 5JBCS 3RXOA 3TPIZ 1YPLH 2Z3EA 1WTGH 3GCOA 2DUCA 3HPTB 4OS5A 1ELGA 2ODQA 4CRCA 3RXEA 3IWMA 1O31A 1LVYA 1QFKH 4Y8YA 4HZHA 1GHZA 4FU9A 3A8AA 1ELTA 1NT1A 1FDPA 1H8DH 3M3VA 3PYHA 1EOJA 1ELBA 1D6RA 1C1QA 1O5FH 3VGCB 1W3CA 1NZQH 4YOIA
chains in the Genus database with same CATH superfamily
1EOLA 5C0TA 1UVUH 3UNQA 1AFQB 1P04A 1H1BA 2FOHA 4ABGA 4MDSA 3KIDU 1C5MD 3OEHD 5K0HA 2ZFRH 3A81A 4Y6DA 5KECA 1S5SA 3TGJE 2HNTF 1MMJN 2H9EH 5DN6D 3RXTA 1TMBH 1N8OC 3SNEA 3C1KA 2EA3A 2SNVA 5GWZA 1GMHG 1RS0A 1CGHA 1O3HA 1O30A 3DA9B 3UWIA 4AB9A 4D7GA 2ZHFH 1NPMA 1OPHB 2FDAA 3ITIA 4Y71A 2OK5A 2G4TA 1O35A 4ZUHA 4IS5A 1OHHD 1YPEH 2Y81A 3Q00A 1CSOE 1AMHA 1C5PA 1Z8IB 3M7UA 5A09A 2ANWA 4YLUA 4WMDA 1MAXA 4BAKB 5B6OA 1QQ4A 1BRCE 1UTMA 1C2IA 1HGTH 1AZZA 1KTTB 1Y3WA 2SNWA 4IW4E 1K1JA 3HGNA 5CHBA 3SN8A 2BDBA 1CT2E 1YPHC 2FWWA 2F9NA 2FI4E 3NK8A 3PLKA 2AYWA 4FUFA 3V7TA 4X6NA 2FOGA 1BCUH 4CBOA 3SW2B 1QL7A 2HALA 1GHAG 2FX4A 4MVNA 3A7ZA 2WPIS 1ETTH 1GBTA 1ZJKA 5EG4A 1EAWA 3O8RA 2O9QA 3A84A 1DM4B 3DSGA 3JZ2B 4RT1A 3S9CA 1BJUA 1GJ5H 1O3AA 2ANMH 1FLEE 2P16A 1GBBA 3MU5A 1EZQA 3PLPA 5I46H 5H4IB 4ZKOU 7LPRA 4CRFA 1FY4A 3MHWU 3TJNA 1JWTA 1SGTA 2ZA5A 2NWNA 4FVBA 2EI8A 1GGDB 3KL6A 1WU1A 1OYQA 4ZH8A 1CA0C 1FN8A 4K5ZA 1T8NA 2ZGCA 1OWEA 1MTVA 4X2XA 4JYUH 2F3CE 5IYTA 2ANYA 2NU2E 1ZHMA 3MU1A 1F5KU 1IHTH 1FPCH 2AS9A 3A8DA 2XCFA 1GPZA 1QB6A 3OYPA 2TGDA 1O2RA 1QB1A 1TA6A 3SUGA 1Y5AT 5G4BA 1UMAH 1HB0B 1EAUA 3K2UA 1NM6A 1P3EA 2CF8H 3MYWA 4XBBA 3RXHA 1K9OE 6LPRA 1BTYA 3GY3A 5DSFA 1NTPA 1HUTH 2ALVA 4ZXYH 1ZSLA 5T6GA 4KTCA 2OINA 1F0UA 1TRNA 4LXBH 1TBZH 1CBWC 4HFPB 1OP8A 3ZVGA 5EQRA 5T6FA 5CDFE 4A1TA 3LIWA 3ESTA 1YCPM 3PROA 1UHBA 2O8UA 2BQ6B 2B7DH 2QF0A 3BTDE 1OWDA 1A0HB 5HYOA 1CA0B 3HK3B 2Y82A 7KMEH 5EGMA 1O5BB 5T1VA 2ASUB 3LDXH 1OS8A 1YCPK 4Y76A 1H9LB 4TPIZ 1BITA 1S84A 3A88A 4WWYA 3QGNB 2BD9A 2FOAA 5GXPA 1NRRH 1A5HA 2ZEBA 3UNSA 5GJ4B 1Y3XA 3UOPA 1XUFA 3BIVH 1V2UT 1THRH 1JBUH 2BLVA 3TLOA 2ZPRA 1C5WB 2ZDAH 1QCPA 3MNBA 2PP6A 2JH6D 1QTFA 1D9IA 2ZTZA 4FOUC 4JMYA 4PROA 4YTAA 1DITH 1MZDA 3FP8E 1QBVH 2BD8A 3UWJH 3I77A 1DSTA 1TGCA 1AWFH 1EZSC 3LGUA 2ZC9H 2A31A 1LPKB 1ARBA 3GDVA 3ZZ7A 3BTKE 4K1SA 1GVZA 2W6ID 2OLGA 1V6DA 5EQSA 2RFKC 1CBWB 2BLWA 1TFXA 2WINI 4Y7BA 1PPGE 3V3MA 2BD4A 1C5QA 2RA3A 2P3FH 1YLDA 1YWUA 1TRYA 1OKXA 2ESTE 3U28C 1CE5A 2A7JA 3CNRA 1DANH 1SGRE 1TNKA 3QLPH 4YXWD 3QDZB 1S0QA 1LHCH 2G4UA 2FXRA 3RMMH 1VITF 4TWYA 2FO9A 3GISB 2C8XB 1PPZA 1YCPH 3U69H 1F0SA 4FUEA 1NU7B 2BYAX 1Z6EA 4J2YB 3S9BA 2A7HA 3ZVFA 1W0JD 1COWD 3M5OA 1G2LA 2FS8A 3DD2H 2A1DB 4WH8A 2STBE 1QHRB 5EW1H 4Y11E 4UDWH 5LPFA 4H6SB 4TY7A 5T6DA 2RDLA 3PMAB 3QZQA 3QWCH 3SU1A 1ELFA 1S82A 1KDQB 5K7RA 2OTVA 4GUXA 2GT8A 1VJAU 1H8IH 5AFZH 2G8TA 1GI6A 2ZU2A 4UEHH 1BRUP 2XWBI 1Q3XA 2VGCC 3CP7A 4NWLA 1O2VA 3E3TA 2CJIA 1QR3E 1L1JA 2KR7A 1GJ6A 2ODPA 1P2NA 1BMLA 1SFQB 5FBIA 3U98H 5FCRA 3LONA 4DGJA 5FHTA 3A87A 4Y0YE 2V3OH 1DE7H 1K21H 1O2YA 2HLDD 4Y8ZA 4ZKSU 1IOEA 1C2KA 2QYIA 1KLTA 1HYLA 2LELA 1LHDH 2ZHEH 4Q2KA 1QB9A 2FESH 1V2ST 3BTWE 1ZSKA 1FUJA 1ANBA 3SORA 2XC0A 1GI3A 1BJVA 1LKBA 4F48B 1DY9A 2W3IA 3RXIA 1IQJA 1BBRK 1SQRA 3PM3A 4KTSA 3RXUA 6CHAC 3PRBA 1PQAA 4GPGA 5EPYA 1TB6H 1ARCA 1DWCH 1GBKA 4AB8A 4NA7A 3R0FA 4F55A 1MH0A 3OAAD 3SI4H 1ESAA 1LMWB 1G2MA 1FAXA 4DOQA 5L2ZH 2CN0H 1OSSA 3KYFA 3NWUA 2UUYA 3UQVA 1J16A 1QGFA 2VGCB 1WOFA 1K1PA 1K1NA 3MH7A 3A7TA 3PMJA 1UJ1A 5C5OA 3TH2H 2TBSA 3RXPA 2AMDA 3C27B 2AGEX 2LNCA 3F9GA 2YMSC 3JZ1B 1SOTA 2UWLA 4WF8A 1JMOH 1XXDA 3UFAA 1OXGA 2P3TB 1O33A 4AZ2B 1TX6A 1Q2WA 1ZPZA 3SJ8A 3QTVH 1HAHH 4FUDA 2PUQH 3UR9A 2O8TA 2PV9B 4XFQA 1VZQH 1ELDE 4KTUA 1W0KD 5EPNA 1EXFA 4I8GA 4CH2B 1UTNA 4DIIH 3O8CA 1BTHH 6CHAB 1BBRH 3L33A 1W14U 1O3FA 1ACBE 4R8TB 4NCYA 5L2YH 5A8ZA 5DGJA 1L4ZA 1RTKA 1J8AA 1CHOF 1ELCA 2PTNA 3BEFB 2V3MA 1EB1H 2ZDLA 3WWFA 5B6LA 1UTOA 3S7KB 4IN1A 3ZVBA 2K1QA 2I6QA 2F9UA 2JJ1D 4FUIA 1BTXA 2FLBH 1DX5M 4INKA 1P10A 3SJIA 1C4U2 2BLQA 4MNVA 2Y6TA 4BTTB 2YMSB 5EJLA 2FZZA 3F6UH 1O0DH 2ZU1A 1TX7A 5JBBS 4J1YA 1O39A 2ZQ1A 4MNWA 5EODA 3V13A 2EY4C 3SBKA 5DP8A 1FIWA 4P02A 1TGTA 3VXEH 3LH3A 4Q63A 1LVBA 4UFFH 2VJ1A 4AC9A 3AVZA 1BQYA 5C20A 1AZ8A 1A5GH 2XCNA 3VB5A 3TJVA 1CT0E 1O3BA 1JRSA 1KXAA 1X7AC 2QF4A 3E91A 2D2DA 3SV7A 4CRGA 1SLWB 4JCNA 5F8ZA 2QXGA 2IN2A 2KZ4A 3UIRA 1P2IA 2FMJA 1KSNA 2A5KA 4NSVA 3E16B 1ZYOA 1O2KA 3LGIA 4ZHLU 4U30A 2WYGA 3PO1C 1V2LT 4U01A 3P8GA 3MFJA 2Q6FA 2W7SA 1P12E 2O8WA 2R3YA 3BG4C 4Y7AA 1AVWA 2F9PA 1H4WA 1HFDA 1KLIH 1LVOA 4AGKA 1GJ7B 5ABWA 2ZO3H 2A2QH 1RIWC 1HAIH 1K1LA 1A2CH 2GMTC 1W13U 3MOCA 1K22H 3P92A 2FTMA 3EYDA 4X8TH 4BOHA 3PMBB 2R0KA 4DCDA 1HAGE 3TNTA 2F9BH 4JZFH 4B6FA 1OP2A 4JYTA 1KXEA 1W10U 1P2QA 3AW1A 4K8YA 3GCHC 1XKAC 4AYYB 2D1JA 1VGCB 2KM0A 4DJZB 1AUTC 1ELVA 1TGBA 2XC4A 5A0CA 1C5XB 1VITG 1K1IA 2A4RA 4K1TA 2B8OH 1VR1H 3SQEE 3SV6A 1G9IE 1RFNA 3FANA 1L4DA 3M7QA 5JDUB 1AI8H 1A0JA 1LO6A 1SGYE 2BY6X 1SGPE 3TH4H 3QN7A 2FOBA 1NBMD 2W6JD 2GZ8A 1N6YA 1SOZA 2FS9A 3FO8D 1EP6A 1GJ9B 3BG4B 2WYJA 3PRDA 5E0HA 1JIMA 2GDEH 2AMPA 3ELAH 1XUIA 3UPEA 3UY9A 5F03A 3LGTA 4X1PU 1MABB 1NROH 3GY2A 1G3BA 4DIHH 1RIWB 1TPPA 1JRTA 1BUIA 1TIOA 1IQGA 1DS2E 2CK3D 2GCTB 3MH5A 1GBIA 2H5DA 3T29A 1TNGA 2B0FA 1WXRA 4K69A 2EI7A 5T3HA 4FUCA 2C8WB 2PSYA 1PPEE 4YT6H 4ISLA 1YKTA 1AWHB 1BBRE 3DSOA 3GCHB 2H1UA 1V2PT 1EB2A 1Z71A 2AMQA 2J98B 3GOVB 1C1MA 1LTOA 1DFPA 1W8BH 2ZFPH 2GZ7A 1QIXB 3E0NB 4JZEH 1SHHB 1TWXB 1B0FA 1F92A 2UUFB 1HAZB 3BEUA 2BTCE 3SHAH 3BTQE 2P93A 1BMMH 1XX9A 2F4LA 1EPTB 5DP6A 2WPLS 4RSPA 3KHVA 4F4OC 4ABIA 1GL1A 2L74A 3FFGA 5DP9A 1O2LA 2Z7FE 2SFAA 3VGCC 2BMGB 2IJD1 3ZV9A 4Q4LA 1PQ5A 3LC3A 1NRNH 1BRAA 1LPGB 5FBEA 2VIOA 2YMSD 2XBYA 3E1XB 1WYKA 4NFEA 3F9HA 4UD9H 4BAQB 1O5EH 2F91A 4OS1A 3ZZCA 5HMAA 3VXFH 3B23B 4NA8A 3HKIB 1BHXB 1DDJA 1FI8A 3K6YA 1GJCB 2FODA 3OU0A 5CHAC 2VWMA 2Z9KA 1SL3A 1O2UA 1ESBA 1O36A 1GJBB 2VWOA 3SYJA 4OS7A 1SKYE 1EAXA 2NU4E 1AN1E 1TA2A 2PGBB 1WAYB 1YPKH 2L6OA 3FAOA 1ZMJA 3LC5A 1O3PB 4FXGH 4IGDA 1GJ4H 2BB4A 1C1UH 4HI3A 1E79D 1DICA 1F7ZA 1MZAA 2A2XH 4NGAH 1Y3UA 1DUEA 3LJOA 1ZSJA 2VIPA 3ENSB 4OGYA 2OC1A 2WV5A 2RA0A 1YPHE 1NU9A 3RLWH 1DOJA 1Z8JB 1KXFA 3OSYA 1ZHRA 5A0AE 1ZRBA 1DLKB 2ZI2H 2OC0A 3TU7H 4TYDA 5EQQA 4BAMB 1CHOG 3MI4A 3V12A 1ORFA 4MPXA 1GI1A 2G81E 1CQQA 3B8JA 3UREA 2WUCA 1O3CA 1EX3A 5L30H 1GI5A 2IOTA 3TITA 3LKWA 1PPBH 1GI0A 2TGTA 5CHAB 5GPIB 3T26A 1V2VT 2FYQA 2R2WU 1UVOA 2HVXA 2PW8H 4JZ1A 1EP5A 2OC7A 5FPSA 4ZHAA 5DG6A 1HIAB 1E37B 4AFZA 2HPPH 1Z8GA 2CXVA 1S6HA 4TY6A 2FOCA 1DWBH 1AB9B 1GGDC 1SQTA 1DXWA 1DWDH 1SR5C 2Q6GA 4AG2A 2ULLA 4FUHA 3G01A 8KME2 2BDYA 1TNIA 4DY7B 2OC8A 4M7GA 5HIZA 2ZZUH 3F1SB 4A5TS 3EA7A 4ISIH 3SU2A 7GCHF 1QRXA 2EEKA 1O3LA 2ZCLP 1VCWA 2A4OA 5C1YA 1TPSA 4AFQA 1MU8B 4YZUA 5DJ7A 3GS9A 1YF4A 2A32A 1GMCF 3QTOH 1S6FA 1F5RA 1M9UA 5KGOA 2ZGHA 1FXYA 1EJMA 2K8IA 4X1RU 1GHYH 1GCDA 2G51A 3MU4A 4IBLH 4I33A 5HIYA 2ZECA 3A80A 3N7EA 4D9RA 4Q7ZA 2YOLA 2BXUH 4X2WA 3U8OH 1TMTH 1SC8U 1SFIA 4X0WU 3A7XA 2ZHDA 1MCVA 1L2EA 4ISNA 1P9UA 5FPTA 4KKDA 9ESTA 1XUKA 2QA9E 1RD3B 3VPKA 2Y80A 1EATA 3LU9B 5J4QA 2AGIX 1HXFH 3ATIA 2KAIB 2Z9JA 1P09A 2ZP0H 3P8NA 2ZDMA 3M3TA 4Q7YA 7ESTE 3M37A 4X6MA 4XRNA 5JBTA 2AH4X 2PGQB 4FUJA 3TJUA 1VJ9U 4Z1MD 1C4V2 4FUGA 2OUAA 1ETSH 4XSKU 2DE9A 2Z3DA 1SBWA 2J9NA 3Q76A 1D3QB 1W12U 1TOCB 2A0QB 2CF9H 2PKSB 4JK6A 5A2MH 5FX6A 3O8DA 1GHVH 1C5VA 3ATMA 4SGAE 3BTGE 2WV9A 1FJSA 1GBAA 2ZPQA 1P57B 4VGCC 3EGKH 4BAOB 3PMHB 4NSYA 4YLQH 4TPYA 1BTPA 2BDAA 1ZPCA 4P00A 5FL7D 2GTBA 2Z3CA 3PTBA 4Y0ZE 1TQ0B 1FX0B 1TGSZ 1T7CA 4JYVH 2AIPA 1UK4A 3GDUA 1G3EA 5GIBA 1AVXA 1SMFE 1T8LA 2ZU3A 1YYY1 2XC5A 1ZHPA 3PWBA 1C2HA 1A5IA 2A4GA 3U9AH 2K0QA 1XVOA 4ASUD 5DP7A 2GP9B 1E0FD 1GDUA 2PTCE 1SPJA 3KQBA 5TCAA 5FAHA 2BX3A 4B76A 5KEDA 3L6PA 1GVKB 1ZTLA 2BY7X 1WV7H 2XW9A 5CMXH 1WCZA 2P95A 2JDID 2GV7A 4DT7B 1V2KT 5JB8S 2XBVA 1XUGA 2FP7B 4D8NA 1TX8A 2PHBA 4DW2U 1WTHD 3A8BA 4O97A 3VB7A 4ESTE 2KCYA 3EE0B 3ATLA 1W11U 1V2TT 3T2NA 1V2NT 1QRWA 2BHGA 2QN5T 1O34A 3GCNA 3OFND 4VGCB 3E8LA 2PKAB 2XNIA 2IPHA 4X2YA 4ABAA 2J98A 1V2RT 4O3TA 2ZFFH 2XBXA 1IQNA 2WHXA 1NBME 1GBCA 1C2EA 3EA9A 2C3SA 2ZG0H 3QUMP 1O5CB 2ZGJA 2VWLA 3ZZ5A 1RJXB 3O8BA 1BHXF 4MG3A 5PTPA 1HJAC 3A8CA 2Y5HA 1EPTA 1Y59T 4K2YA 2W3KA 1GI8B 2QC2A 5HKKD 4D7FA 3A82A 1C5LH 3RXRA 1HCGA 1SGQE 1RTLA 4CREA 3A86A 2SGQE 3QK1A 2TRMA 4ZCNA 2VINA 3BTFE 5LPEA 1Y5BT 2TGPZ 2KX4A 1FAKH 2WV4A 3H09A 1GCTB 3AW0A 2F9OA 4GAWA 3ODDA 4D76A 1AFEH 3SZNA 2NU0E 4I8KA 1MTWA 2W5EA 2XXLA 4I31A 1TABE 1ZR0A 4GVUA 8GCHF 2Y5FA 1TPOA 1ZGIA 1HJAB 1GHBF 4O9VA 2W7UA 2C8YB 2F43B 1TPAE 2Y5GA 1C2FA 2KCPA 4X1SU 2BD5A 5EU8A 2UWOA 2OBQA 5EOKA 5A8XA 4AFUA 1B7XB 2VWNA 4Y10E 3SU0A 2YNAA 4ABBA 3MU8A 1EJNA 2B9LA 1UW7A 3V0XA 2HRVA 3SUEA 1P01A 1RRKA 1A7SA 4NIXA 3N99A 1DSUA 2FTLE 3GY8A 2I6SA 5LH8A 1ZGVA 3FN8A 3ZZ4A 1VITH 1C1WH 3A85A 2UUKB 1GL0E 1EJAA 1F2SE 4O3UA 1SB1H 4HGCA 4IC5A 1AQ7A 1HIAA 1LHGH 2FOFA 1IHSH 3K9XB 3SU4A 7GCHG 4AYVB 3FOAA 2VVUA 2ALPA 3HK6B 3OY5U 3MO6A 2HNTC 1YBWA 1NC6A 3SGQE 1GMCG 5F8XA 5GCHF 1G37A 3LGYA 4I8HA 2AEIH 2ZFTA 4ZAEA 3PWCA 4OS6A 3URDA 3ODFA 3BEIB 3RMLH 5A0BA 1O2XA 3RXAA 3SNCA 1P8VC 3RXMA 3DHKH 1O2WA 1NFUA 3KEEA 3MNXA 2TGAA 2BX4A 2ZFQH 1WDIA 1O2HA 1SGIB 2C93B 1MKXK 5E2PA 1O5AB 1AKSB 3ZYDA 2P59A 1D3TB 2G55A 5C2ZA 1YM0A 1YP9A 4KGAA 1NFWA 1YY3A 1G36A 2FEQH 1GBJA 3NKKA 2ZFSA 1P2MA 3IITA 4BTIB 5I25A 4DVAU 9LPRA 3LPRA 1GJAB 1TRMA 1O2IA 2KAIA 2BZAA 1PFXC 1ZZZA 1DVAH 1DY8A 3UTUH 4UFGH 2ZU4A 2Q6DA 5HM9A 2FM2A 1S0RA 2FOMB 1ETRH 1MTSA 4X6PA 5DKMA 2WZQA 4ABDA 4OS4A 3BTME 4TSFD 4IMQA 2RDEA 4UFDH 3SNBA 3F0PA 2JETC 1DXPA 2BLOA 5C3NA 3Q3KA 3ZYEA 3T27A 1HAPH 3MNCA 1MKXH 4AOQA 1VGCC 2FLRH 5LGOA 3RXBA 3F2GA 1CVWH 1GBDA 1UVSH 4TT3D 2QGRA 1CU1A 1TNHA 2Z6BD 1XKBC 1S6LA 2BDHA 3LGWA 1C2JA 3AAVA 1GBEA 5CE1A 2SGDE 1O32A 1O2QA 1O38A 3EQ0H 3STJA 4YO9A 3FZZA 2A4QA 3E6PH 4GHQA 3D65E 1HJ9A 2GD4B 2TIOA 2VU8E 5FX5A 1HAYB 4X8VH 1W0ZU 1E34B 4JK5A 2LP6A 5AVDA 4UE7H 2H2ZA 4ACBA 5C1UA 3GYMA 2QXJA 1HAVB 2GCTC 1AIXH 4NG9H 1Z1JA 5DO4H 2OD3B 1PPFE 4AX9H 3P95A 4WXIA 4Q7XA 1V2WT 2IJOB 2NU3E 1D4PB 2JETB 2WSSD 1F0TA 2PKAA 1O2SA 1THPB 4TWWA 5C0UA 4CBNA 1BT7A 3M7TA 2C90B 2CHAC 1GMDF 1FY5A 4I8LA 1SGFG 4QT8C 1W7GH 4CHAB 1BMNH 1F5LA 4WJG2 3RXFA 3A7WA 3SGBE 1GHWH 2XYAA 1GVLA 3S7HB 1EPTC 3M61U 2OCVB 2ZHWH 1QBNA 3MNSA 1C5OH 3TH3H 1LPZB 3SQHE 5FXLA 2XRCA 4FVDA 2VIWA 1T8MA 1MU6B 2ILNA 1P03A 3FZDA 4INLA 1NO9H 3W95A 2CV3A 1U6QA 1EZXC 1HXEH 1VCPA 1OWKA 2ZPSA 3NRLA 4A1VA 4ABJA 3FP6E 1PJPA 2A5AA 1HAXB 5JBAS 4Z6AH 1EKBB 1WQSA 3A89A 1IQHA 1LCYA 3NPSA 3CS7A 1GHXH 4X1QU 2BVSH 1GDQA 8GCHG 3SNAA 1MD8A 1C5NH 1QQUA 3ATKA 1GHBG 2CHAB 1O2OA 1MTNC 1W2KH 4WMFA 1N6XA 3KN2A 2JH5D 3M5NA 2V35A 1SG8B 3GY5A 5TJXA 4B2AA 2GCHF 3T28A 3SJKA 4NIYA 1A46H 2VH0A 4K8BA 2FX6A 3MTYA 2RCEA 4GCHF 3QZRA 3BN9A 4NZQA 1ELEE 1O2ZA 3D62A 3ZZ8A 5E0JA 1ZOMA 1YLCA 4X1NU 1KXBA 4YT7H 3DUXH 1IQKA 3SV8A 5IK2D 4RI0A 1K1MA 1E36B 4NFFA 1S85A 2B5TB 1QRZA 1SGCA 3KGPA 1H9IE 1KXDA 1AE8H 3HKJB 3Q3XA 4WH6A 5EIYA 1BA8B 1UK2A 4A6LA 2VH6A 5J4SA 1EASA 4CRBA 1FY8E 3LJJA 2BOKA 1JIRA 2ANKH 1Y3YA 1ZMLA 1MTNB 3A83A 5GCHG 2O8MA 2PLXA 3TK9A 3ZZDA 5C94A 1FONA 3PB1E 1AB9C 3A7YA 3OTPA 1LDTT 2THFB 2D8WA 3LGVA 1SGDE 2HOBA 4U32A 3IG6B 1BTUA 2BD7A 4RT0A 3RM0H 2H6MA 2F83A 5DP3A 2Z9LA 1INCA 1B5GH 2ZTXA 1AE5A 2P94A 1KMHB 1C1RA 1J14A 1QJ7B 2VNTA 1D3DB 4MNYA 2GT7A 1B0EA 1HV7A 3M36A 1YGCH 3F68H 4CRDA 3KYGA 1O2MA 1UCYK 1ZJDA 4GSOA 2GKVE 2Z9IA 1AKSA 4AN7A 5TCCA 3ZZBA 1GBHA 4ABFA 2HVYB 3VFEA 1MUEB 4B1TA 2JKHA 1DWEH 3MH6A 4ZROA 1Y5UT 1P02A 3TJOA 4H42U 1V2MT 3VG8A 5EXMA 1ZPBA 1G32B 2A5IA 2KFWA 2ZQ2A 2OQUA 1O5DH 2P8OB 5HM2A 4E7RG 1PQ8A 1WQVH 2OP9A 2V6NA 1NESE 1S81A 4WXVA 2Y7ZA 1DLEA 2FI5E 1TLDA 1BRBE 1V2OT 5ETXA 4YM9A 2PUXB 1UTKA 1FMGA 4IMZA 4XDEA 3A7VA 2FOEA 1A0LA 1O3DA 2BM2A 1TBQH 2PKSC 3ZZ6A 1D3PB 3F9EA 1SSXA 4BAHB 2QE7D 1T4VH 1C1SA 1QJ1B 1F0RA 1BOQA 1GJ8B 2ODYB 5F6MA 1UCYH 1GI4A 1AD8H 2BY8X 4BANB 1IQLA 2WPMS 3SZEA 2J97A 1LKAA 4I7YH 2BZ6H 1AGJA 1TGNA 1SLVB 1T32A 5F53A 4MPVA 1PYTC 3M35A 8LPRA 1QA0A 2PSXA 3BTTE 2SGAA 3M5MA 3RU4D 4FU7A 4CR9A 4E06H 1N8OB 1Z1IA 2UUJB 4XE4A 1QJ6B 4ASHA 5E2OA 2YNBA 3CS0A 3PV4A 1AU8A 2XOKD 4B74A 4GLYA 2OXSA 1MBQA 3ZIAD 1AY6H 1QL8A 4CR5A 4OGXA 3ZZ3A 1K2I1 3FP7E 1HAVA 1LQDB 3WW7A 2R2MB 1GMDG 1AHTH 3PTNA 1CHGA 3NZIA 3TK6A 1O3MA 3AAUA 4I32A 1AUJA 3SUDA 3T25A 1GJDB 3MH4A 1C2GA 3OEED 4I86A 2BD3A 3GYLB 3UUZA 3BIUH 3TNSA 3S0NA 1TQ7B 3TIUA 3RMOH 3RXDA 3OX7U 1NFYA 2J4IA 1CO7E 1LHEH 1C2LA 2VIVA 5EJZA 1SGNE 3RDZA 3VB4A 2ZGXH 1PPCE 1N1LA 4FU8A 4BXWA 1TYNA 1EFRD 1LQEA 4RKOB 1O3OA 1O37A 3RXGA 1T8OA 3RXLA 1FZZA 4B6EA 4U2WA 1VKYA 2F9VA 1EZUC 2VVVA 1AVGH 3WY8A 1MQ6A 2Z9GA 1P05A 1QNJA 4F49A 3U8TH 1G3DA 1YLNA 3KCGH 3SUFA 4ZKNU 3VEQB 2V0BA 2FIRH 4SGBE 2KCAA 3DFJA 4FETA 4Q80A 3RC5A 2QXIA 3WWBA 1RXPA 1GCTC 3K65B 2ZNKH 3RC6A 1BIOA 2GCHG 2HPQH 1NS3A 2J5UA 1GBMA 2JH0D 1A3EH 5ESTE 1HNEE 1HRTH 4WVPE 1K0HA 2HWLB 4KELA 4ZMAH 4GCHG 2G5VA 4LZ4B 2R0LA 2OBOA 3W1EA 4B2BA 2EQNA 1P9SA 4KP0A 2JJ2D 3ZV8A 3U1IB 3RUOA 1W0YH 3BSQA 3VB3A 6GCHF 3SOSA 2JIZD 1Z7KA 2CMYA 1ZRKA 2H9TH 1RTFB 1ESTA 1WSSH 1MBMA 3SNDA 3P6ZB 4RN6A 4LK4A 5BPEA 1SLUB 2ZCKP 1P2KA 1GDNA 1YPMH 2BQWB 5JYIA 3GCTF 1L0ZA 1T4UH 4MPWA 1NFXA 2PWXA 1MKWK 3RXVA 1VCQA 1GI2A 4X2VA 1UTQA 1Z6JH 1GI9B 1KTSB 1OWJA 4B2CA 1ANDA 1C9TA 1KY9A 4OS2A 5AFYH 3VB6A 3QX5H 1ANCA 1SGFA 3MWIU 4XOJA 5C17A 1UCYE 1Q31A 3M3SA 1P11E 3NXPA 3P70B 1IQIA 2HLCA 1C1TA 1ZTKA 1C2MA 1SVPA 1AO5A 1E1RD 3MO9A 3SO3A 3Q77A 3I29A 4B71A 4X8SH 3F2HA 1Y8TA 4B75A 3F9FA 1A4WH 1WUNH 2HNTE 1H8HD 2GZ9A 4HG6A 2QXHA 1A61H 1S83A 3QO6A 5EXNA 2WPJS 2V3HH 1V2JT 3CENA 2QF3A 1DPOA 1BMFD 4E05H 1ANEA 4YESB 4M9FA 2J92A 3SHCH 3BG8A 2QIQA 4BXSA 1E35B 1C4Y2 1EAIA 1NRPH 3KNXA 1DT2A 5SGAE 1C5ZB 3MO3A 1PQ7A 3GDSA 1O2JA 1MKWH 1SQAA 4H6TA 4IN2A 1TE0A 4INHA 3UQOA 4MQAA 3P17H 1E38B 1TALA 5FPYA 4H4FA 1FNIA 5HGGA 1SQOA 3B9FH 4MPUA 4O03A 5DP4A 3FVFB 1G3CA 3I78A 1HBTH 1H9HE 1L1NA 4NZLA 1Y3VA 2H9HA 2P3UB 2BDGA 1UTPA 2QY0B 3SU5A 1CGJE 1A3BH 3SU6A 2SGFE 5BRRE 5LPRA 3ZVDA 2VVCA 2NU1E 5E0GA 3DSPA 1GBFA 1KLJH 3RU4T 4ABHA 1A1RA 4XBCA 3TGKE 4ISOA 3TGIE 3GY7A 2CGAA 1QURH 3OTJE 3W94A 2XWAA 1JXPA 1PYTD 4NWKA 3SI3H 2M5TA 3LH1A 4DURA 1THSH 1UTLM 4LOYH 3UB0A 3KF2A 1GBLA 4CRAA 2Q1JA 1XMNB 4K3JA 1V2QT 3R3GB 4WMEA 2BVRH 1C1PA 1O3JA 3D49H 1KXCA 1LVMA 1FIZA 4WY3A 1CGIE 1YPGH 2C8ZB 3Q3YA 1P06A 2UWPA 2XTTB 4R0IA 1OYTH 4B73A 3EE7A 5C67A 2BXTH 1FY1A 2HGTH 5E8EH 6ESTA 1UVTH 3FKSD 4ACAA 1QL9A 2ZDVH 3P8FA 4YOJA 1ZMNA 3U8RH 1P0SH 2VB0A 2GGVB 2BY5X 2G00A 5AF9H 2Z94A 1NY22 1O3KA 8ESTE 5ESBA 2STAE 3S9AA 3BF6H 2PFEA 2C4FH 5DPAA 2WUBA 4XD7D 1IQEA 1GG6C 1O3IA 1TNLA 1O2NA 1ID5H 1SLXB 1OOKB 3UNRA 2H5CA 2PR3A 2LPRA 3TK5A 1C1NA 3GY4A 3RXSA 4A1XA 1SI5H 4BTUB 1BTWA 2EC9H 5AHGH 3KQDA 1GMHF 3QGJA 1C5RA 2R9PA 1BB0B 3H5CB 2XBWA 3UR6A 4NA9H 1P2OA 2G5NA 2QF5A 3RP2A 2KCOA 1C5TA 4K60A 3BTEE 1BTZA 1O3EA 1C9PA 1W7XH 1UK3A 3RU4E 1O5GH 1SHYA 2WPHS 2SGPE 1O2PA 3F0OA 3SV2H 2BY9X 2ZCHP 1QA7A 1TNJA 4UONA 4CHAC 1HDTH 4YOGA 5JB9S 1XVMA 2OQ5A 1OP0A 1IQMA 3TVJB 4JZIA 2W26A 3D23A 1GWAA 1IAUA 1L1GA 2ZWLH 1J9CH 2BOHB 3RC4A 1XXFA 1E1QD 1GHAF 3RM2H 1GG6B 4MNXA 3PLBA 1KIGH 2FYRA 1C1OA 4I8JA 4GHTA 1HAOH 1QBOA 4AFSA 1UO6A 1NRQH 1MCTA 1O3GA 1Z8RA 1XUHA 2BDIA 5EJ1A 3RXJA 3T5FH 5IDKA 2BVXH 2ZKSA 1TBRH 1FQ3A 1MAYA 1YC0A 5F8TA 1O2TA 3BTHE 2A45B 3N7OA 5GNDA 5C1XA 1LHFH 2J94A 3PV2A 3S69A 2GX4A 1DUAA 1GI7B 1EQ9A 1HLTH 1O3NA 1YPJH 5EW2H 3SJ9A 4ZKRU 3MQKC 1TMUH 3RMNH 6GCHG 1K28D 3EAJA 3UOUA 4K1EA 5C5NA 1KYNA 1SGEE 2AGGX 1FY3A 3GICB 2VIQA 4THNH 5HXFA 3OE7D 3ZZ9A 2FI3E 3MMGA 2VBCA 1BMAA 3HATH 3ZVAA 4AG1A 2QAAA 3KQEA 3ZVCA 2J38A 3DCLA 1O2GH 2XNDD 4XBDA 1OWHA 2J34A 1ZTJA 1C5SA 3GCTG 5A8YA 1HPGA 3SJOA 5L6NH 1HJ8A 2AFQB 5DK1A 1C2DA 3MU0A 4FUBA 4ABEA 3ZVEA 1XUJA 1H8ED 4Y79A 3LT3A 2GJGA 2IPQX 1UHBB 4MLFB 3H7TA 2ZDKA 1CA8B 1D6WA 2O8LA 1P3CA 3PO1B 2Y7XA 1FV9A 4Z0KA 4IC6A 1J15A 3SU3A 2ZF0H 2GV6A 1IQFA 2AIQA 3KQ5A 2EI6A 1T31A 4ISHH 1FPHH 3NUMA 2A7CA 2G52A 4DT4A 1NRSH 3RLYH 3K6ZA 4ZXXH 2ZTYA 3PV5A 4X6OA 1CT4E 2GMTB 3URCA 2BD2A 1UTJA 3HGPA 3ZZAA 4D9QA 1EUFA 4NIVA 4MTBA 4UFEH 4A92A 3STIA 1UVPA 2AHME 3F3BA 3P8OA 3SV9A 1BZXE 1ELAA 5DP5A 1ZLRA 3T62A 3DFLA 1KDQA 2ZU5A 1V3XA 1NN6A 2RG3A 4E7NA 1ABIH 2QV1A 2GVFA 3AASA 1MTUA 4BNRA 3RXCA 2BQ7B 1QY6A 1C1VH 1C5UA 3H7OA 3EDXB 5FCKA 4A7IB 1XM1A 1K1OA 2M2AA 3LOXA 3SGAE 2WPDD 1PPHE 3EA8A 2QCYA 5JPMH 4AGJA 3ATWA 1TAWA 4OM9A 2ZDNA 1BDAA 4JZDH 3U1JB 2VIDA 3E90B 4NIWA 4HTCH 2DE8A 3E0PB 4LZ1H 1QZ8A 2ZIQH 2TPIZ 2ZGBH 5GDSH 2ZHQH 5EXLA 1MD7A 2BDCA 1J17T 1P2JA 3NCLA 1G30B 2J2UA 2SGEE 3KQCA 4Y8XA 1AFQC 1TOMH 2J95A 2V7QD 3GY6A 3BV9B 2FPZA 1WBGB 1RGQA 1ABJH 1OWIA 2D26C 2WPKS 1FN6A 1C5YB 2AERH 3OY6U 4AORA 4ZHMU 2P8OC 3RXKA 3L3TA 3DT0H 4CH8B 1JOUB 1MQ5A 4DG4A 3RXQA 2R3UA 1OX1A 2GDDA 1TONA 3M5LA 4RKJB 4X8UH 5JBCS 3RXOA 3TPIZ 1YPLH 2Z3EA 1WTGH 3GCOA 3UAIC 2DUCA 3HPTB 4OS5A 1ELGA 2ODQA 4CRCA 3RXEA 3IWMA 1O31A 1LVYA 1QFKH 4Y8YA 4HZHA 1GHZA 3N7DA 4FU9A 3A8AA 1ELTA 1NT1A 1FDPA 1H8DH 3M3VA 3PYHA 3AK5A 1EOJA 1ELBA 1D6RA 3F2FA 1C1QA 1O5FH 3VGCB 1W3CA 1NZQH 4YOIA
chains in the Genus database with same CATH topology
1EOLA 1UVUH 3UNQA 1AFQB 1P04A 1H1BA 2FOHA 4ABGA 4MDSA 3KIDU 1C5MD 5K0HA 2ZFRH 3A81A 4Y6DA 1S5SA 3TGJE 2HNTF 1MMJN 2H9EH 3RXTA 1TMBH 1N8OC 3SNEA 3C1KA 2EA3A 2SNVA 5GWZA 1GMHG 1RS0A 1CGHA 1O3HA 1O30A 3DA9B 3UWIA 4AB9A 4D7GA 2ZHFH 1NPMA 1OPHB 2FDAA 3ITIA 4Y71A 2G4TA 1O35A 4ZUHA 4IS5A 1YPEH 2Y81A 3Q00A 1CSOE 1AMHA 1C5PA 1Z8IB 3M7UA 5A09A 2ANWA 4YLUA 4WMDA 1MAXA 4BAKB 5B6OA 1QQ4A 1BRCE 1UTMA 1C2IA 1HGTH 1AZZA 1KTTB 1Y3WA 2SNWA 4IW4E 1K1JA 3HGNA 3SN8A 2BDBA 1CT2E 1YPHC 2FWWA 2F9NA 2FI4E 3NK8A 3PLKA 2AYWA 4FUFA 3V7TA 4X6NA 2FOGA 1BCUH 4CBOA 3SW2B 1QL7A 2HALA 1GHAG 2FX4A 4MVNA 3A7ZA 2WPIS 1ETTH 1GBTA 1ZJKA 5EG4A 1EAWA 3O8RA 2O9QA 3A84A 1DM4B 3JZ2B 3S9CA 1BJUA 1GJ5H 1O3AA 2ANMH 1FLEE 2P16A 1GBBA 3MU5A 1EZQA 3PLPA 5I46H 5H4IB 4ZKOU 7LPRA 4CRFA 1FY4A 3MHWU 3TJNA 1JWTA 1SGTA 2ZA5A 2NWNA 4FVBA 2EI8A 1GGDB 3KL6A 1WU1A 1OYQA 4ZH8A 1CA0C 1FN8A 4K5ZA 1T8NA 2ZGCA 1OWEA 1MTVA 4X2XA 4JYUH 2F3CE 5IYTA 2ANYA 2NU2E 1ZHMA 3MU1A 1F5KU 1IHTH 1FPCH 2AS9A 3A8DA 2XCFA 1GPZA 1QB6A 3OYPA 2TGDA 1O2RA 1QB1A 1TA6A 3SUGA 1Y5AT 5G4BA 1UMAH 1HB0B 1EAUA 3K2UA 1NM6A 1P3EA 2CF8H 3MYWA 4XBBA 3RXHA 1K9OE 6LPRA 1BTYA 3GY3A 1NTPA 1HUTH 2ALVA 4ZXYH 1ZSLA 5T6GA 4KTCA 2OINA 1F0UA 1TRNA 4LXBH 1TBZH 1CBWC 4HFPB 1OP8A 3ZVGA 5EQRA 5T6FA 4A1TA 3LIWA 3ESTA 1YCPM 3PROA 1UHBA 2O8UA 2BQ6B 2B7DH 2QF0A 3BTDE 1OWDA 1A0HB 5HYOA 1CA0B 3HK3B 2Y82A 7KMEH 5EGMA 1O5BB 2ASUB 3LDXH 1OS8A 1YCPK 4Y76A 1H9LB 4TPIZ 1BITA 1S84A 3A88A 4WWYA 3QGNB 2BD9A 2FOAA 5GXPA 1NRRH 1A5HA 2ZEBA 3UNSA 5GJ4B 1Y3XA 3UOPA 1XUFA 3BIVH 1V2UT 1THRH 1JBUH 2BLVA 3TLOA 2ZPRA 1C5WB 2ZDAH 1QCPA 3MNBA 2JH6D 1QTFA 1D9IA 2ZTZA 4JMYA 4PROA 4YTAA 1DITH 1MZDA 3FP8E 1QBVH 2BD8A 3UWJH 3I77A 1DSTA 1TGCA 1AWFH 1EZSC 3LGUA 2ZC9H 2A31A 1LPKB 1ARBA 3GDVA 3ZZ7A 3BTKE 4K1SA 1GVZA 2OLGA 1V6DA 5EQSA 1CBWB 2BLWA 1TFXA 2WINI 4Y7BA 1PPGE 3V3MA 2BD4A 1C5QA 2RA3A 2P3FH 1YLDA 1TRYA 1OKXA 2ESTE 1CE5A 2A7JA 1DANH 1SGRE 1TNKA 3QLPH 3QDZB 1S0QA 1LHCH 2G4UA 2FXRA 3RMMH 1VITF 4TWYA 2FO9A 3GISB 2C8XB 1PPZA 1YCPH 3U69H 1F0SA 4FUEA 1NU7B 2BYAX 1Z6EA 4J2YB 3S9BA 2A7HA 3ZVFA 3M5OA 1G2LA 2FS8A 3DD2H 2A1DB 4WH8A 2STBE 1QHRB 5EW1H 4Y11E 4UDWH 5LPFA 4H6SB 4TY7A 5T6DA 2RDLA 3PMAB 3QZQA 3QWCH 3SU1A 1ELFA 1S82A 1KDQB 5K7RA 2OTVA 4GUXA 2GT8A 1VJAU 1H8IH 5AFZH 2G8TA 1GI6A 2ZU2A 4UEHH 1BRUP 2XWBI 1Q3XA 2VGCC 3CP7A 4NWLA 1O2VA 3E3TA 2CJIA 1QR3E 1L1JA 1GJ6A 2ODPA 1P2NA 1BMLA 1SFQB 5FBIA 3U98H 5FCRA 3LONA 4DGJA 5FHTA 3A87A 4Y0YE 2V3OH 1DE7H 1K21H 1O2YA 4Y8ZA 4ZKSU 1IOEA 1C2KA 2QYIA 1KLTA 1HYLA 1LHDH 2ZHEH 4Q2KA 1QB9A 2FESH 1V2ST 3BTWE 1ZSKA 1FUJA 1ANBA 3SORA 2XC0A 1GI3A 1BJVA 1LKBA 1DY9A 2W3IA 3RXIA 1IQJA 1BBRK 3PM3A 4KTSA 3RXUA 6CHAC 1PQAA 4GPGA 5EPYA 1TB6H 1ARCA 1DWCH 1GBKA 4AB8A 4NA7A 3R0FA 1MH0A 3SI4H 1ESAA 1LMWB 1G2MA 1FAXA 4DOQA 5L2ZH 2CN0H 1OSSA 3NWUA 2UUYA 3UQVA 1J16A 1QGFA 2VGCB 1WOFA 1K1PA 1K1NA 3MH7A 3A7TA 3PMJA 1UJ1A 5C5OA 3TH2H 2TBSA 3RXPA 2AMDA 3C27B 2AGEX 2LNCA 3F9GA 3JZ1B 1SOTA 2UWLA 4WF8A 1JMOH 1XXDA 3UFAA 1OXGA 2P3TB 1O33A 4AZ2B 1TX6A 1Q2WA 1ZPZA 3SJ8A 3QTVH 1HAHH 4FUDA 2PUQH 3UR9A 2O8TA 2PV9B 4XFQA 1VZQH 1ELDE 4KTUA 5EPNA 1EXFA 4I8GA 4CH2B 1UTNA 4DIIH 3O8CA 1BTHH 6CHAB 1BBRH 3L33A 1W14U 1O3FA 1ACBE 4R8TB 4NCYA 5L2YH 5A8ZA 5DGJA 1L4ZA 1RTKA 1J8AA 1CHOF 1ELCA 2PTNA 3BEFB 1EB1H 2ZDLA 1UTOA 3S7KB 4IN1A 3ZVBA 2K1QA 2I6QA 2F9UA 4FUIA 1BTXA 2FLBH 1DX5M 4INKA 1P10A 3SJIA 1C4U2 2BLQA 4MNVA 2Y6TA 4BTTB 2FZZA 3F6UH 1O0DH 2ZU1A 1TX7A 5JBBS 4J1YA 1O39A 2ZQ1A 4MNWA 5EODA 3V13A 3SBKA 5DP8A 1FIWA 1TGTA 3VXEH 3LH3A 1LVBA 4UFFH 2VJ1A 3AVZA 1BQYA 5C20A 1AZ8A 1A5GH 2XCNA 3VB5A 3TJVA 1CT0E 1O3BA 1JRSA 1KXAA 1X7AC 3E91A 3SV7A 2D2DA 4CRGA 1SLWB 4JCNA 5F8ZA 2QXGA 2IN2A 3UIRA 1P2IA 2FMJA 1KSNA 2A5KA 4NSVA 3E16B 1ZYOA 1O2KA 3LGIA 4ZHLU 4U30A 2WYGA 3PO1C 1V2LT 4U01A 3P8GA 3MFJA 2Q6FA 2W7SA 1P12E 2O8WA 2R3YA 3BG4C 4Y7AA 1AVWA 2F9PA 1H4WA 1HFDA 1KLIH 1LVOA 4AGKA 1GJ7B 5ABWA 2ZO3H 2A2QH 1RIWC 1HAIH 1K1LA 1A2CH 2GMTC 1W13U 3MOCA 1K22H 3P92A 2FTMA 3EYDA 4X8TH 4BOHA 3PMBB 2R0KA 4DCDA 1HAGE 3TNTA 2F9BH 4JZFH 1OP2A 4JYTA 1KXEA 1W10U 1P2QA 3AW1A 4K8YA 3GCHC 1XKAC 4AYYB 2D1JA 1VGCB 4DJZB 1AUTC 1ELVA 1TGBA 2XC4A 5A0CA 1C5XB 1VITG 1K1IA 2A4RA 4K1TA 2B8OH 1VR1H 3SQEE 3SV6A 1G9IE 1RFNA 3FANA 1L4DA 3M7QA 5JDUB 1AI8H 1A0JA 1LO6A 1SGYE 2BY6X 1SGPE 3TH4H 3QN7A 2FOBA 2GZ8A 1N6YA 1SOZA 2FS9A 1EP6A 1GJ9B 3BG4B 2WYJA 5E0HA 1JIMA 2GDEH 2AMPA 3ELAH 1XUIA 3UPEA 3UY9A 5F03A 3LGTA 4X1PU 1NROH 3GY2A 1G3BA 4DIHH 1RIWB 1TPPA 1JRTA 1BUIA 1TIOA 1IQGA 1DS2E 2GCTB 3MH5A 1GBIA 2H5DA 3T29A 1TNGA 2B0FA 4K69A 2EI7A 5T3HA 4FUCA 2C8WB 2PSYA 1PPEE 4YT6H 4ISLA 1YKTA 1AWHB 1BBRE 3GCHB 2H1UA 1V2PT 1EB2A 1Z71A 2AMQA 3GOVB 1C1MA 1LTOA 1DFPA 1W8BH 2ZFPH 2GZ7A 1QIXB 3E0NB 4JZEH 1SHHB 1TWXB 1B0FA 1F92A 2UUFB 1HAZB 3BEUA 2BTCE 3SHAH 3BTQE 2P93A 1BMMH 1XX9A 1EPTB 5DP6A 2WPLS 4RSPA 3KHVA 4F4OC 4ABIA 1GL1A 3FFGA 5DP9A 1O2LA 2Z7FE 2SFAA 3VGCC 2BMGB 3ZV9A 1PQ5A 3LC3A 1NRNH 1BRAA 1LPGB 5FBEA 2VIOA 2XBYA 3E1XB 1WYKA 4NFEA 3F9HA 4UD9H 4BAQB 1O5EH 2F91A 4OS1A 3ZZCA 5HMAA 3VXFH 3B23B 4NA8A 3HKIB 1BHXB 1DDJA 1FI8A 3K6YA 1GJCB 2FODA 3OU0A 5CHAC 2VWMA 2Z9KA 1SL3A 1O2UA 1ESBA 1O36A 1GJBB 2VWOA 4OS7A 1EAXA 2NU4E 1AN1E 1TA2A 2PGBB 1WAYB 1YPKH 3FAOA 3LC5A 1ZMJA 1O3PB 4FXGH 4IGDA 1GJ4H 2BB4A 1C1UH 4HI3A 1DICA 1F7ZA 1MZAA 2A2XH 4NGAH 1Y3UA 1DUEA 3LJOA 1ZSJA 2VIPA 3ENSB 4OGYA 2OC1A 2WV5A 2RA0A 1YPHE 1NU9A 3RLWH 1DOJA 1Z8JB 1KXFA 3OSYA 1ZHRA 5A0AE 1ZRBA 1DLKB 2ZI2H 2OC0A 3TU7H 4TYDA 5EQQA 4BAMB 1CHOG 3MI4A 3V12A 1ORFA 4MPXA 1GI1A 2G81E 1CQQA 3B8JA 3UREA 2WUCA 1O3CA 1EX3A 5L30H 1GI5A 2IOTA 3TITA 3LKWA 1PPBH 1GI0A 2TGTA 5CHAB 5GPIB 3T26A 1V2VT 2FYQA 2R2WU 1UVOA 2HVXA 2PW8H 4JZ1A 1EP5A 2OC7A 5FPSA 4ZHAA 5DG6A 1HIAB 1E37B 4AFZA 2HPPH 1Z8GA 2CXVA 1S6HA 4TY6A 2FOCA 1DWBH 1AB9B 1GGDC 1SQTA 1DXWA 1DWDH 1SR5C 2Q6GA 4AG2A 2ULLA 4FUHA 3G01A 8KME2 2BDYA 1TNIA 4DY7B 2OC8A 4M7GA 2ZZUH 3F1SB 4A5TS 3EA7A 4ISIH 3SU2A 7GCHF 1QRXA 2EEKA 1O3LA 2ZCLP 1VCWA 2A4OA 5C1YA 1TPSA 4AFQA 1MU8B 4YZUA 5DJ7A 1YF4A 2A32A 1GMCF 3QTOH 1S6FA 1F5RA 1M9UA 2ZGHA 1FXYA 1EJMA 4X1RU 1GHYH 1GCDA 2G51A 3MU4A 4IBLH 4I33A 2ZECA 3A80A 4D9RA 4Q7ZA 2YOLA 2BXUH 4X2WA 3U8OH 1TMTH 1SC8U 1SFIA 4X0WU 3A7XA 2ZHDA 1MCVA 1L2EA 4ISNA 1P9UA 5FPTA 4KKDA 9ESTA 1XUKA 2QA9E 1RD3B 3VPKA 2Y80A 1EATA 3LU9B 5J4QA 2AGIX 1HXFH 3ATIA 2KAIB 2Z9JA 1P09A 2ZP0H 3P8NA 2ZDMA 3M3TA 4Q7YA 7ESTE 3M37A 4X6MA 5JBTA 2AH4X 2PGQB 4FUJA 3TJUA 1VJ9U 1C4V2 4FUGA 2OUAA 1ETSH 4XSKU 2DE9A 2Z3DA 1SBWA 2J9NA 3Q76A 1D3QB 1W12U 1TOCB 2A0QB 2CF9H 2PKSB 4JK6A 5A2MH 5FX6A 3O8DA 1GHVH 1C5VA 3ATMA 4SGAE 3BTGE 1FJSA 1GBAA 2ZPQA 1P57B 4VGCC 3EGKH 4BAOB 3PMHB 4NSYA 4YLQH 4TPYA 1BTPA 2BDAA 1ZPCA 2GTBA 2Z3CA 3PTBA 4Y0ZE 1TQ0B 1TGSZ 1T7CA 4JYVH 2AIPA 1UK4A 3GDUA 1G3EA 5GIBA 1AVXA 1SMFE 1T8LA 2ZU3A 1YYY1 2XC5A 1ZHPA 3PWBA 1C2HA 1A5IA 2A4GA 3U9AH 1XVOA 5DP7A 2GP9B 1E0FD 1GDUA 2PTCE 1SPJA 3KQBA 5TCAA 5FAHA 2BX3A 4B76A 3L6PA 1GVKB 1ZTLA 2BY7X 1WV7H 2XW9A 5CMXH 1WCZA 2P95A 2GV7A 4DT7B 1V2KT 5JB8S 2XBVA 1XUGA 2FP7B 4D8NA 1TX8A 2PHBA 4DW2U 1WTHD 3A8BA 4O97A 3VB7A 4ESTE 3EE0B 3ATLA 1W11U 1V2TT 3T2NA 1V2NT 1QRWA 2BHGA 2QN5T 1O34A 3GCNA 4VGCB 3E8LA 2PKAB 2XNIA 2IPHA 4X2YA 4ABAA 1V2RT 4O3TA 2ZFFH 2XBXA 1IQNA 1GBCA 1C2EA 3EA9A 2C3SA 2ZG0H 3QUMP 1O5CB 2ZGJA 2VWLA 3ZZ5A 1RJXB 3O8BA 1BHXF 4MG3A 5PTPA 1HJAC 3A8CA 2Y5HA 1EPTA 1Y59T 4K2YA 2W3KA 1GI8B 2QC2A 4D7FA 3A82A 1C5LH 3RXRA 1HCGA 1SGQE 1RTLA 4CREA 3A86A 2SGQE 3QK1A 2TRMA 5LPEA 2VINA 3BTFE 1Y5BT 2TGPZ 1FAKH 2WV4A 1GCTB 3AW0A 2F9OA 4GAWA 3ODDA 4D76A 1AFEH 3SZNA 2NU0E 4I8KA 1MTWA 2W5EA 2XXLA 4I31A 1TABE 1ZR0A 4GVUA 8GCHF 2Y5FA 1TPOA 1ZGIA 1HJAB 1GHBF 4O9VA 2W7UA 2C8YB 1TPAE 2Y5GA 1C2FA 4X1SU 2BD5A 5EU8A 2UWOA 2OBQA 5EOKA 5A8XA 4AFUA 1B7XB 2VWNA 4Y10E 3SU0A 2YNAA 4ABBA 3MU8A 1EJNA 2B9LA 3V0XA 2HRVA 3SUEA 1P01A 1RRKA 1A7SA 4NIXA 1DSUA 2FTLE 3GY8A 2I6SA 5LH8A 1ZGVA 3ZZ4A 1VITH 1C1WH 3A85A 2UUKB 1GL0E 1EJAA 1F2SE 4O3UA 1SB1H 4HGCA 4IC5A 1AQ7A 1HIAA 1LHGH