4I8LA

Bovine trypsin at 0.87 resolution
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title On the reproducibility of protein crystal structures: five atomic resolution structures of trypsin.
pubmed doi rcsb
molecule tags Hydrolase
total genus 62
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4i8lA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4i8lA02
4A5TS 1Z1IA 1EATA 1C1NA 4X6PA 1O30A 4LK4A 5LPEA 2QXHA 4WWYA 1SVPA 1DY8A 1CGIE 5CHAB 3TVJB 1O3LA 1TAWA 5DP8A 3S7HB 2ZPSA 3A83A 2QIQA 2A5KA 1QQUA 1O3FA 2PUQH 5K7RA 1G3EA 2K1QA 1GBJA 1GMCF 1IQEA 2I6QA 1A0HB 1TLDA 2IPHA 1AZZA 1SGFA 2PTCE 1EASA 3AASA 4XFQA 4ZHLU 4LOYH 1QR3E 1C1SA 1O2QA 2WV4A 1L4DA 2TPIZ 4ZUHA 4ZXYH 5ABWA 4WMFA 1C1MA 5C1XA 3UOPA 1TNLA 2C3SA 2P8OC 2PHBA 4DJZB 3A80A 1QURH 3SNCA 4X2WA 2ANMH 1KSNA 2FOFA 1QBVH 1KTTB 4ABIA 1Z7KA 1NTPA 2FESH 2VVCA 3SBKA 4DIHH 1A61H 2BXUH 1KY9A 1ZMJA 1ETTH 1TBRH 3P95A 1VITF 1SFQB 4Y8ZA 2OC7A 1YBWA 1U6QA 3I77A 3T62A 1UK4A 2BLWA 2QCYA 3RMNH 1TA2A 1TRYA 1TNIA 4ISOA 4OS7A 2Q1JA 4Y7BA 3ZYEA 1O3GA 1AD8H 1SGEE 1O32A 1EAWA 4XBCA 1MQ6A 2BD5A 3LIWA 1DITH 5TJXA 1BB0B 2JH0D 1SBWA 1V2WT 1A0JA 1DWCH 1MBMA 2PSXA 4YLQH 2FLBH 4ABGA 4GCHF 2WPIS 2NU2E 4WVPE 3P92A 1FY1A 2BOHB 2H9TH 3AW0A 3QLPH 3FVFB 1GI2A 2HNTE 3T29A 1NROH 4WXIA 3VFEA 1FUJA 4I8LA 2W26A 4KTSA 1YCPM 1HAYB 4RSPA 1XMNB 1BIOA 1ZMLA 2EI8A 2VIOA 3FP8E 1Y5AT 3ZZ9A 4Y79A 8ESTE 4BXWA 1NFWA 2C8YB 2C8WB 3MNSA 3U1JB 1SHYA 1YPMH 1EZXC 3GISB 2VWNA 2FM2A 1GI8B 5EXMA 1K22H 1PPCE 2HNTC 1GJDB 3IG6B 1BTHH 5HMAA 3SJOA 3A81A 5IYTA 4X1SU 4DY7B 1O2RA 1CVWH 3CENA 1GBLA 2F83A 1IQJA 3UNSA 3MYWA 4CH8B 3F6UH 4Y0ZE 1IQFA 2OC8A 3NKKA 1TYNA 3U8RH 3M3VA 1HAHH 3O8BA 3ZZ8A 3PMJA 2F9OA 4Y6DA 1BBRH 1C9PA 1OX1A 2ZO3H 1GVZA 1L4ZA 3BEIB 3ODFA 2W3KA 3BIUH 4OS1A 3UPEA 3ZV8A 2B8OH 1O2LA 1MMJN 3SNAA 2FI4E 1FNIA 4HFPB 1JMOH 3QTOH 3MNCA 1RTKA 3LT3A 4JK5A 4CR5A 1BUIA 1GMDG 2PLXA 1AGJA 1D9IA 1ORFA 4FUIA 3RM2H 2PKAB 2Y7XA 1OP8A 4B2CA 1D3DB 3DFLA 1YGCH 2XBVA 4IS5A 1OS8A 1D3TB 1F7ZA 2PFEA 4R8TB 1OYQA 1H9HE 1UTJA 4J2YB 2BD7A 2ZU3A 2VB0A 4QT8C 4GAWA 4GVUA 1HAZB 1P04A 4MPXA 1EB2A 2XYAA 2Z9GA 4NWKA 3S9CA 2BOKA 1HNEE 2EEKA 5L30H 1C5TA 1GL1A 5AHGH 2CXVA 1GI0A 1LVBA 2AMDA 4I32A 2FX6A 1BA8B 4AG2A 4FUCA 1J14A 4FXGH 3BEFB 4K60A 3KQDA 3FZZA 4IMQA 2XTTB 2BVXH 1EAUA 4GHTA 1L1JA 7GCHF 3T27A 1MKXH 1HIAA 3AW1A 2GZ7A 1S82A 1T4VH 3PROA 1W7GH 3HKIB 1SGTA 4YLUA 2VGCB 3P8NA 2R3UA 3BTDE 1XUHA 3W95A 1P2QA 3Q3XA 1NS3A 1WTGH 4KGAA 1GHYH 2OLGA 1H8IH 1G3CA 2Y5FA 1S6FA 1T8MA 3E8LA 3SQHE 3ITIA 3UQVA 2R0KA 3S7KB 1UCYH 3C1KA 1O5AB 1TE0A 1HGTH 1JRSA 1WCZA 1GBMA 4JYUH 4MPWA 1WUNH 2BVSH 2ZKSA 2Y6TA 2Y7ZA 1T8OA 4NZQA 5A8ZA 4FVBA 3RXAA 2BZAA 3E0NB 1TGTA 4X6NA 2VIDA 1LVMA 2BMGB 2H9EH 2ZGCA 8GCHG 1QQ4A 5DG6A 1GJAB 2UWOA 5FCKA 1QJ1B 1Q2WA 1DVAH 1ZR0A 1XVOA 1O5FH 4BTTB 3MU4A 3QWCH 2GT7A 2UUKB 1P10A 1QB6A 4PROA 2BX3A 3GY8A 3RU4E 3G01A 1ZRBA 1LHGH 1NFYA 4HTCH 1QA0A 1O0DH 4I7YH 1BTZA 2W7SA 1G30B 2G4UA 1P2NA 1KXAA 1YPLH 3D49H 4CRAA 5L6NH 4OS5A 1AVGH 5GCHG 1N8OB 2O8UA 2C4FH 3Q3YA 4CRBA 4WXVA 1O2XA 1S5SA 3KEEA 1HIAB 2RG3A 1IOEA 5CMXH 4K5ZA 4FUHA 5G4BA 2ANKH 4WF8A 3VB6A 1HJAB 3UQOA 1OPHB 3KF2A 3QK1A 3MHWU 4WH6A 2CHAB 2RA3A 4FU9A 3NPSA 3ZVFA 2FO9A 1AB9C 3SHCH 1TGNA 1BDAA 4XSKU 3M5NA 1GI7B 3TK9A 1BTPA 2ZECA 1O35A 1V2LT 1P0SH 3O8RA 1SOZA 1ZSLA 4AYVB 1KYNA 5F8XA 3F9GA 1QL7A 2SGDE 4ZHAA 4DOQA 2GMTB 4TPYA 3S9BA 4MNYA 1C5LH 2D26C 4J1YA 1EOLA 4BNRA 1V2KT 3ZZ6A 2V3HH 2C93B 3BTHE 1O5BB 1AQ7A 3SGBE 1SGFG 1RS0A 3V13A 4BXSA 4X6OA 1O3AA 3JZ1B 1G37A 3SU0A 3T28A 1EPTC 2ZZUH 1AWHB 5C5OA 1GPZA 2GKVE 1ZRKA 1IQNA 1O33A 1ABIH 3GY3A 1T31A 5FPYA 3U8TH 2A45B 1EX3A 3SV2H 4Y8YA 4SGAE 3U8OH 1KLTA 1ELFA 4E05H 1FPCH 5HXFA 1UHBA 5JB9S 1FZZA 4D76A 4AOQA 2BD3A 2JH6D 3TU7H 3B23B 2BDCA 1SB1H 2ASUB 3MNBA 4I8KA 2A4OA 1TX8A 3RXQA 8LPRA 3NUMA 1WQVH 4CBNA 1BTUA 3BSQA 1QHRB 3BIVH 3SN8A 4ISHH 1W12U 1GVLA 2A5IA 1RD3B 3SHAH 6CHAC 2HGTH 1P3EA 1DXPA 3LGVA 1VCPA 1GHAF 3A7XA 2GDEH 2PKSC 1G2LA 4Z6AH 2IOTA 1CA0C 1XVMA 5A0CA 1G2MA 1KDQB 3UNQA 5E0JA 1P2KA 2ZTZA 1Q3XA 2V0BA 2FOCA 1DE7H 1ELCA 1XUGA 5EPNA 1TBZH 1QCPA 2F9UA 4NIXA 2ZCLP 4Y71A 3RXJA 3NZIA 3BTKE 1NRNH 1NZQH 1RXPA 4KP0A 3MU1A 2STBE 1E36B 1K1OA 2JKHA 4ZKNU 2F3CE 2IN2A 2BDGA 1O3HA 5CE1A 3RXRA 4K69A 3TNTA 2OXSA 2AS9A 1NY22 2J34A 3LGIA 1W10U 3SU4A 1B5GH 4CHAB 1V2QT 2WUBA 3GCNA 3SZNA 1YC0A 3KCGH 4D8NA 1EJNA 1H4WA 1GDQA 3VXEH 4MVNA 3ZZBA 1JRTA 4KKDA 4FUJA 3K9XB 1B0EA 2G4TA 2FEQH 9LPRA 1UVUH 4AX9H 1ESTA 1PPEE 1RIWC 4K1TA 3PMHB 2A4RA 5T6DA 3SU6A 1OSSA 3OX7U 3T25A 1PPFE 3UUZA 1C2LA 3T26A 3ZZ5A 3RXTA 2AYWA 1AZ8A 1KXCA 3KL6A 3ZVCA 1KTSB 1O3MA 1F0TA 1BRBE 3UR6A 1DS2E 3M7UA 1ANCA 2VU8E 1HCGA 1G3DA 1GCTB 3LH1A 3A7VA 4WMEA 1E0FD 3A86A 4TY7A 4DW2U 2I6SA 2EI6A 1IQGA 3BG4C 2STAE 1O3CA 2VNTA 1MTVA 4ISLA 2BY7X 3DHKH 1C4Y2 1GG6C 2BVRH 2Y82A 1EP5A 4E06H 4A92A 4ZKRU 4D9RA 1GI1A 1YKTA 2GD4B 2WPKS 3ZV9A 2A4GA 1LTOA 1GMHF 1P9UA 3BN9A 3BTWE 1LPGB 1E34B 1VZQH 1DANH 1AE5A 1TNKA 3NWUA 3RLWH 1SGYE 1S0QA 2ZI2H 1C2DA 1CT4E 1GJBB 4Y7AA 1DPOA 2BM2A 4X8UH 3ZVDA 3KQEA 2KAIB 1UVOA 1LO6A 2HALA 3B9FH 1WAYB 3LGYA 2A5AA 4KTUA 2BY6X 1FPHH 1ZGIA 3URCA 2CF8H 5EOKA 2Z3CA 2XBYA 3M36A 5ETXA 5GXPA 1A4WH 1V2UT 1BRCE 1PQ8A 4GPGA 3T5FH 1BTXA 5L2YH 1BZXE 2ZEBA 2CN0H 2XWBI 2ZFSA 3EA7A 1J15A 1O2OA 2Z94A 5JDUB 2ZPRA 1UJ1A 1MTNC 4ABBA 1TGSZ 1YPJH 2FOBA 4IBLH 4VGCC 2P3FH 1TQ0B 1C1RA 1SLWB 4DG4A 1ETRH 3JZ2B 5EQQA 4DURA 5E0HA 3A82A 1OWHA 1Z8JB 1YLDA 3FP7E 1MUEB 1KLIH 3M3SA 5F03A 1LMWB 2J4IA 5AVDA 1QBOA 4HI3A 1YCPK 5DP3A 4Q7XA 3KQBA 1O5GH 3SGQE 1ZSKA 3OSYA 3MH6A 1AUJA 1O3OA 3QTVH 2VH6A 4GUXA 1ZPZA 4Q80A 2G5NA 9ESTA 2CGAA 1CHOG 1KIGH 3QGNB 3NK8A 1UTQA 1GBCA 2VIPA 5FHTA 6GCHG 4ABAA 3M3TA 1AFQC 1W13U 1AE8H 2SNVA 2FOAA 1DWEH 5DK1A 1PJPA 2Y80A 3STIA 4MG3A 1LHCH 1ZTLA 1P9SA 1S0RA 4DCDA 2NU0E 5T6GA 3SV6A 1GJ8B 4TWWA 1D6RA 1W11U 2ILNA 1T8NA 2DE8A 1W7XH 2Y81A 4OGYA 2CJIA 1SGPE 1TPSA 1BMMH 1C5UA 2Y5GA 3I29A 3SI3H 3D62A 2OTVA 1MCVA 1ZTKA 2OINA 1BCUH 2VWOA 2P3UB 1D3PB 3K2UA 2TGAA 1FMGA 1ZMNA 2Y5HA 3EYDA 4X6MA 3VB4A 1FIWA 1FONA 1N6XA 1DUAA 1TMUH 1BHXB 5EXNA 4MDSA 1LPKB 3BF6H 5EXLA 3BG8A 2HNTF 1FY4A 1ZLRA 4JYTA 5A0BA 4RN6A 1C1WH 2ZDNA 1O2ZA 1HJ9A 2P94A 3M5OA 2ZGBH 4IN1A 5TCAA 5T3HA 2RA0A 3PV4A 4TPIZ 3ZZDA 4FU7A 1WYKA 1VGCC 4A7IB 2O8MA 4UFEH 1GL0E 1ACBE 3HK6B 3A7TA 4I31A 1O31A 1K28D 3M61U 3V7TA 3ZZCA 3K65B 1MQ5A 2PKAA 3SNEA 1HFDA 1GJ9B 3GY4A 3U9AH 1TQ7B 5FBEA 2VWMA 1GHZA 3LJJA 2TRMA 3MO3A 2TBSA 2ALVA 3GCTG 5DP4A 5SGAE 1YYY1 3STJA 1J16A 1WOFA 3EAJA 2J9NA 3M5MA 2VINA 1AMHA 1UVTH 2G8TA 1ELDE 3B8JA 2FXRA 3LGWA 3P8GA 2YNAA 2OP9A 3Q76A 2P59A 3HGNA 4X8SH 1AFEH 1PPBH 1ARBA 3SNDA 4UFFH 3SO3A 3QGJA 1GGDC 1GDUA 2OQ5A 2TGDA 2ZHEH 2F9NA 2PW8H 1GMCG 1T32A 4O3TA 1NN6A 4KELA 2PV9B 2QC2A 2FDAA 1HAXB 3UR9A 2A7HA 4E7NA 3VGCC 1N6YA 4HZHA 3RXFA 1ZJDA 4OS4A 1WSSH 2ZF0H 1EB1H 4K1EA 3SW2B 1K1LA 1GBIA 5JYIA 1Z8IB 3DT0H 2QA9E 1CT2E 2Q6DA 1XUIA 2F9VA 2AGGX 1Y8TA 4B74A 1SGRE 1NFUA 3RXIA 3RXGA 3QN7A 3TGKE 3TK5A 4Z0KA 1XUJA 1YPKH 3EQ0H 1NU9A 3M37A 3O8CA 3D65E 1UMAH 1V2TT 4I33A 3RXVA 5I25A 1J8AA 1GCDA 1UTOA 1C1UH 1TOCB 2HWLB 1K1PA 3E16B 2BLVA 1DSUA 1TBQH 3S0NA 3RXMA 4AG1A 3A88A 3ZZ3A 2C8XB 3SJ8A 2BY8X 1NC6A 2XNIA 3GCOA 1N1LA 1VITG 5DP5A 2GV6A 2AH4X 2J94A 2BLOA 5C1UA 2ESTE 1BHXF 5AF9H 2HVXA 1GHBF 1P11E 2A1DB 2VIVA 5E2PA 3LGUA 3VB5A 2SFAA 2ZHFH 2O8TA 2BDBA 3A8AA 3TITA 1GBHA 3A87A 5E0GA 1NT1A 3V12A 3M35A 1LKAA 1BRUP 1O5DH 3SU3A 4INKA 4GCHG 6CHAB 1K1IA 1TGBA 3TGIE 4YTAA 2J95A 2WUCA 2PKSB 1FAXA 4WMDA 1HJ8A 2A32A 1A3BH 1CA0B 3UWJH 1DSTA 1F0UA 2ZQ2A 3SORA 1AO5A 1GI9B 1P2IA 1ZHPA 1OP0A 2AMQA 1QY6A 4BAQB 2A2XH 2P95A 4UEHH 4LZ1H 1O3PB 1HXEH 3MO6A 1TX6A 2GGVB 2R2WU 1NRRH 5A8XA 1GI3A 4YM9A 2GX4A 4O03A 2OBOA 2WPHS 1F2SE 1EOJA 1PPGE 4CREA 3EE0B 2H6MA 3F1SB 1OYTH 3LONA 4JMYA 4NSYA 4X0WU 5EODA 2QXJA 1TABE 1GHXH 3KNXA 1VR1H 1Z1JA 2UUFB 2O9QA 4K2YA 3E0PB 3EA8A 3MU5A 5IDKA 3E91A 1UVSH 3ZZ4A 2TGPZ 4TYDA 1BMNH 4KTCA 2FPZA 3A89A 3IITA 4BAKB 1O5EH 4IN2A 2UWPA 1ABJH 2ZC9H 2BHGA 1GJCB 2H5CA 2Z3EA 2FTMA 1V2RT 4H4FA 1O2VA 1YF4A 3P8FA 1TB6H 5GJ4B 3DD2H 1RIWB 2TIOA 2QAAA 1THSH 3TIUA 3MH5A 2ALPA 1HAOH 3FAOA 3SUGA 1PPHE 1MKXK 1C5VA 2ZNKH 1MTSA 4MNXA 2ZFTA 5L2ZH 1NPMA 1O2IA 1O36A 5GPIB 5EW2H 4O97A 1FY3A 3I78A 4TWYA 1CBWB 1UTLM 3HK3B 1TMBH 5EQRA 2Q6GA 4O3UA 1M9UA 3SUFA 2NU1E 1AIXH 3MFJA 4XBBA 3HGPA 3RU4T 2B5TB 1BT7A 1FAKH 2BDHA 1UCYK 1Q31A 2ZFRH 3BG4B 1SLXB 4DT7B 5FBIA 3TH2H 1A0LA 4YOJA 4ZAEA 1A2CH 1AU8A 1QB9A 4U2WA 1SMFE 1WBGB 1KLJH 1DUEA 1LCYA 1V2NT 1TPOA 4X8VH 3SU2A 1IQIA 1KDQA 4Q7ZA 4NA8A 2D2DA 2ZFQH 4D9QA 4FUFA 2XBWA 2ZP0H 4X1RU 1Z8GA 2ZU2A 1CE5A 1P09A 1Y3UA 1LHEH 2RCEA 4FVDA 3M7QA 5T6FA 4IMZA 4UFDH 3TJNA 8KME2 2W3IA 2OUAA 2GCTB 2AGEX 1YLCA 4Y0YE 1SQAA 1YP9A 7GCHG 5DJ7A 2OC0A 1EJAA 5DPAA 4Y76A 1ELAA 3ESTA 3RXSA 1UTMA 4UD9H 4NIVA 2QXGA 3RXCA 1BMLA 4Y10E 1RFNA 2BY5X 4X1PU 3TPIZ 1ANBA 4ABJA 2GT8A 2J38A 1P8VC 1VCQA 1GHVH 4MNWA 4ABFA 3MH4A 2JETC 1SL3A 3GY5A 1IQLA 1WV7H 1C4V2 3RXUA 3GDVA 1MTNB 2UUJB 4NIYA 3VB7A 4B76A 2WYGA 4RKJB 1B0FA 1IQMA 4VGCB 5JBTA 1TRNA 1HXFH 1E38B 3MMGA 1KXBA 4YOGA 3FP6E 2A0QB 5AFYH 3RXHA 1HUTH 4ZMAH 1V3XA 1EZUC 1P3CA 3Q00A 5FPSA 1UTKA 2ZTYA 3QO6A 4OS6A 4MQAA 3RUOA 3RC5A 1KXDA 2V35A 1QRZA 5BPEA 1BJUA 1O37A 1H8DH 3MH7A 4ISNA 1L1NA 5FAHA 3UOUA 1GBTA 3PLBA 2WPJS 1C2KA 2P3TB 1O2TA 3ATWA 3T2NA 1ZSJA 1ZTJA 5ESBA 5DO4H 4IGDA 3CS7A 2BLQA 4H6SB 3RDZA 3ATLA 3QUMP 1GBAA 4B75A 1F5KU 2FI3E 4NSVA 4FU8A 2BD2A 1P57B 3GY6A 4K3JA 2GV7A 3TNSA 2G55A 3MTYA 2VGCC 1JIMA 4JZIA 1C2EA 2THFB 2VIQA 3VEQB 1O5CB 3UFAA 2P8OB 5DP9A 1GWAA 2GCHF 1ETSH 2A2QH 3LDXH 3P8OA 3A7YA 2FYRA 1YPHC 3PTNA 1O3DA 1Z6EA 1XX9A 1MKWK 2CF9H 1TGCA 5I46H 2A4QA 2H5DA 2SGAA 1UCYE 3EGKH 3VXFH 1MZDA 1RJXB 4UONA 2EC9H 1EAIA 2KAIA 2C8ZB 5GWZA 1OWJA 5DP7A 4X1QU 2ZQ1A 3MWIU 5C2ZA 2ZIQH 5GDSH 1QL8A 2QY0B 3TJUA 1INCA 1ELEE 2P93A 1OXGA 3DUXH 1C5PA 1P2OA 2G52A 3SU1A 1C1OA 3OYPA 5HM9A 1O39A 1MZAA 1SC8U 1HRTH 2ZA5A 1BMAA 1CSOE 4IW4E 3H7OA 2BDAA 4AYYB 3RXLA 2YNBA 1TRMA 4I8JA 1GBEA 3E90B 1A7SA 3LC3A 1VGCB 4R0IA 2VH0A 1C5XB 4CRDA 1MAXA 5A2MH 5C67A 1C2FA 4AN7A 1C2IA 2BDIA 4YT6H 3ATIA 2ODQA 1K1NA 2XBXA 3GCTF 1ZYOA 1C5YB 1EUFA 1QRXA 5HYOA 2G51A 2NWNA 5EGMA 1HBTH 1LVYA 4Y8XA 3RLYH 4DIIH 1GI5A 4OS2A 1DWDH 3V0XA 1HJAC 1Z6JH 1ZZZA 4JZ1A 2Z9KA 3SV7A 3VPKA 4WJG2 4NGAH 1E37B 1TONA 3F68H 3VB3A 1W0YH 3BTQE 1HAVA 3LU9B 2JH5D 5PTPA 3TGJE 3P6ZB 2OC1A 2FWWA 1C5QA 2SNWA 1LQEA 5LGOA 2ZHDA 1NESE 1Y5BT 1SPJA 4NA7A 1MU6B 1S6HA 1GHAG 1V2ST 1P2JA 2FZZA 1HDTH 1TNJA 7ESTE 1MD7A 1UTPA 5F6MA 1O38A 2NU3E 1TWXB 2GMTC 2GZ9A 1P05A 1ZPBA 4AGJA 4CRFA 1J9CH 3A7WA 4YT7H 2ZU1A 4ASHA 3VGCB 4JK6A 1NO9H 1X7AC 4H6TA 4RKOB 3CS0A 1C2HA 3LOXA 4GLYA 1NFXA 2A7JA 4AGKA 1HB0B 2ULLA 1AHTH 5JBCS 3TK6A 1NRSH 2QGRA 1EXFA 3PWBA 3QDZB 5A0AE 4FUDA 4X2YA 1AI8H 4ZHMU 4O9VA 1CQQA 1TX7A 4MTBA 1MTWA 4YO9A 1QL9A 1LHDH 2R0LA 3GYMA 1SQOA 1GJ6A 1LPZB 4CR9A 2GDDA 5F8TA 1YPGH 4NIWA 2R2MB 2Q6FA 2PSYA 2CV3A 1IQHA 1PFXC 4F4OC 2O8WA 1JWTA 3ZVGA 4MLFB 3GCHC 3MNXA 2WV5A 1IQKA 4BAMB 4D7FA 2FOHA 2FIRH 4JYVH 1SGQE 1F5RA 1HAVB 2BB4A 1Y59T 5J4SA 1D3QB 1KXEA 3GICB 4MNVA 3MOCA 3RM0H 1G9IE 4DGJA 3PO1C 1NU7B 2BQ7B 2XCNA 1UK2A 1XM1A 3URDA 3IWMA 2FP7B 4WY3A 4Q2KA 1XKAC 1K1MA 5LPFA 2AMPA 2EA3A 4MPUA 3GDSA 1QJ6B 4WH8A 4JZDH 1O34A 3LH3A 1G3BA 2OBQA 4UFGH 2WYJA 1SG8B 1H9IE 3BTFE 4U01A 1C4U2 2G81E 1NM6A 1C2GA 2FS8A 1OWDA 3CP7A 1O3KA 2BZ6H 3N7OA 3SJ9A 4CHAC 4AFUA 1GMHG 3GDUA 4NA9H 4THNH 2H1UA 1CHGA 1HV7A 3PWCA 1VJ9U 1A5HA 5ESTE 1GMDF 3U69H 1FJSA 2QN5T 2CMYA 2SGEE 1V6DA 1YM0A 1AKSB 1GVKB 3RXKA 1SGIB 1BOQA 3OY6U 1W14U 1ESAA 7LPRA 3L6PA 4ZKOU 3L3TA 1RRKA 3DFJA 3WY8A 1W0ZU 2PGQB 1SOTA 1QIXB 2BQWB 1MD8A 4K1SA 4B2BA 5EU8A 3SUEA 4B73A 1EPTA 3PYHA 3KHVA 1DT2A 1V2PT 3OU0A 1ANEA 1BRAA 1GCTC 3FZDA 1K9OE 3AAUA 4K8YA 3TJOA 1JIRA 5J4QA 4Y11E 1HAIH 3BTEE 5FX6A 4AORA 4DVAU 1AWFH 1ID5H 5K0HA 2XW9A 3UREA 1FXYA 2QV1A 1AVXA 1P03A 1C5RA 2R9PA 4K8BA 4XOJA 1OKXA 2BD4A 2AGIX 1DDJA 4ABEA 4FUBA 3UNRA 2G00A 1F5LA 3PTBA 1MTUA 2R3YA 3RP2A 1GBBA 4I8HA 1AB9B 1DXWA 3BEUA 3A85A 3KN2A 3UY9A 2HOBA 2BTCE 1T4UH 2BDYA 1Y3VA 4CRGA 3BTGE 5A09A 1EKBB 4ZH8A 4ESTE 3SUDA 3K6ZA 1V2VT 2LNCA 2ZDKA 3MU0A 8GCHF 3P17H 2A31A 2PWXA 1ESBA 1V2OT 1ZJKA 1SLVB 1RTFB 2Z9IA 2XCFA 3M7TA 4F49A 1O2YA 3ZZ7A 1ELTA 2BY9X 4B71A 1SGCA 2C90B 1EPTB 5BRRE 1HAPH 1T7CA 1Y3XA 3PMBB 1IHTH 1CGHA 5A8YA 4INLA 4YZUA 3ATMA 2ZDMA 4LXBH 5GCHF 1D4PB 3PMAB 3BTTE 1SI5H 2GZ8A 3H7TA 4BTIB 1O2MA 1UK3A 3RXDA 2JETB 4BANB 4AB9A 1C1TA 2VJ1A 3EDXB 2OQUA 4GHQA 3E3TA 1CGJE 5CHAC 3QZRA 4BAOB 4UDWH 3NCLA 1Y5UT 1P12E 2YOLA 1AUTC 1C5MD 2ANWA 2QXIA 2B9LA 7KMEH 5LPRA 1EAXA 2SGQE 1CA8B 1EQ9A 2FS9A 5C1YA 3SQEE 2ODYB 2B7DH 1BTYA 2HPQH 1K2I1 1MCTA 1VJAU 1BBRK 2Z9LA 1UTNA 3BTME 2Z3DA 5DKMA 4ZKSU 2B0FA 1HPGA 1TMTH 2BQ6B 3A8BA 2BD8A 4I8GA 2H2ZA 1TPAE 2ZU5A 2ZWLH 4NWLA 2PTNA 1QA7A 2FOGA 1GBDA 4CRCA 1A5GH 2ZPQA 1C1PA 1YPEH 1THPB 3LKWA 2SGPE 5FXLA 1OP2A 2ANYA 3U1IB 1TOMH 3LPRA 3R3GB 1TALA 3BV9B 2ZTXA 1PQAA 1TIOA 4NFEA 2F9BH 1P2MA 3KIDU 3MU8A 2DE9A 3C27B 1TNGA 2H9HA 1XUFA 4X8TH 2D1JA 2D8WA 2ZDLA 4JCNA 3UIRA 1P01A 5JBBS 1P06A 4X1NU 1LKBA 4A1VA 1Y3WA 3TJVA 4UE7H 2O8LA 3V3MA 1SLUB 1QTFA 2GTBA 5HM2A 1A1RA 1L2EA 1TPPA 2FOEA 2SGFE 1T8LA 2ZCKP 4JZFH 2ODPA 1WU1A 1LVOA 1MAYA 2ZDVH 2V3OH 2G5VA 2ZFPH 5HGGA 1NRPH 1FI8A 2M5TA 4A1TA 4D7GA 3RMMH 4U32A 3SOSA 2FI5E 2LPRA 1BJVA 4CH2B 4ISIH 1C5NH 1F0RA 2HPPH 1PYTC 5H4IB 1K1JA 1EP6A 1S85A 3RXOA 3ZVAA 1LHFH 1PQ5A 3SJIA 1BQYA 2ZHWH 1FDPA 3OTJE 1GG6B 3RMOH 2J92A 2ZGHA 2IJOB 1GHBG 3NXPA 4M7GA 2ZHQH 2P16A 1ANDA 3A7ZA 1GJ5H 3PM3A 3ZYDA 4AFSA 3S69A 3ENSB 3ZZAA 5JBAS 1SFIA 2GP9B 3RXBA 3ODDA 4ZROA 1AN1E 3SV9A 1F92A 1QBNA 3S9AA 3RC4A 4A6LA 5C3NA 4B1TA 1HLTH 1JOUB 1Y3YA 1RTLA 4HGCA 3HPTB 1S83A 1MH0A 4GSOA 2ZGXH 1O2GH 2ZU4A 3W94A 2FX4A 3F9HA 4AZ2B 3FANA 1BBRE 2AFQB 2BXTH 4IC6A 1H1BA 1W2KH 4TY6A 3RC6A 1D6WA 1SGNE 1QB1A 1PYTD 1CO7E 3GY2A 1GI4A 2DUCA 2XXLA 1C1QA 1C1VH 2AEIH 4OGXA 3RMLH 1P02A 3EA9A 1V2MT 3RXPA 1ZPCA 5EQSA 2VVVA 3L33A 3SI4H 4AFQA 1KXFA 1O2UA 1QNJA 4NFFA 1GBFA 1O3JA 2HRVA 5E8EH 3RU4D 3E1XB 5LH8A 1ZHRA 5FX5A 5F8ZA 1V2JT 1G32B 2FMJA 1O2NA 3GYLB 4ZXXH 3PB1E 1O2PA 1C5ZB 3O8DA 3HATH 1S81A 1MKWH 1ELGA 6ESTA 2F91A 3PLPA 3A84A 4FUEA 1A46H 2BD9A 5TCCA 3AVZA 2XC5A 3GCHB 2AIPA 4IC5A 1G36A 1TNHA 3A8DA 1YPHE 1DWBH 4NCYA 1BTWA 2V6NA 1NRQH 4NG9H 1Z8RA 3FFGA 2ZDAH 4X2VA 2FOMB 3P70B 1UVPA 1WTHD 2XC0A 1FLEE 1AFQB 1GJ7B 4NZLA 4XBDA 5C20A 5C5NA 6LPRA 3GOVB 1C5WB 1SGDE 1ELVA 3OY5U 4LZ4B 3PO1B 5GIBA 1ARCA 1TA6A 1ZGVA 2HLCA 2GVFA 3AAVA 1GBKA 4MPVA 1SR5C 1LQDB 1S84A 4BTUB 1DM4B 3QZQA 1C2MA 2EI7A 2XRCA 4B2AA 4YOIA 3MI4A 1OWKA 2NU4E 2FTLE 3HKJB 1O2WA 1O3IA 3KQCA 3LC5A 3UTUH 2W7UA 1FY5A 1MU8B 1DICA 2VIWA 1O2KA 1L0ZA 1FV9A 2FLRH 1FN6A 1F0SA 4XDEA 1DOJA 1MBQA 2F9PA 1O3NA 3LJOA 3A8CA 1ZHMA 2QF3A 3F9EA 2ZFFH 3QX5H 1SQTA 1XUKA 1UHBB 1XXFA 1O2HA 2UWLA 2Z7FE 4XE4A 1JXPA 4SGBE 1VCWA 2QF0A 1DFPA 1CT0E 3D23A 3MO9A 1A5IA 5JB8S 4E7RG 3ZVEA 1C5OH 2QYIA 3KGPA 2FODA 4JZEH 2BYAX 3TH3H 4H42U 1N8OC 1CHOF 1FY8E 1DLKB 2UUYA 3SGAE 1VITH 6GCHF 1C9TA 1THRH 1WQSA 1AVWA 3UWIA 1W3CA 3RXEA 4ABDA 1CBWC 1Z71A 3K6YA 5EW1H 2AIQA 1SSXA 3PLKA 1RGQA 3Q77A 2WINI 1GI6A 2WPLS 3U98H 4FUGA 3TH4H 1HAGE 3M5LA 3Q3KA 2Z6BD 1PPZA 4AFZA 1E35B 1QJ7B 2OD3B 2J2UA 2CHAC 3LGTA 1C2JA 2PUXB 1FQ3A 4A1XA 4BOHA 5B6OA 2ZCHP 1QFKH 1XKBC 1PQ7A 1DLEA 1AY6H 1IHSH 2RDLA 3DA9B 3TLOA 5AFZH 1W8BH 3GY7A 1GGDB 2BX4A 1L1GA 3SU5A 2W5EA 2VWLA 1O3EA 2Z9JA 1UO6A 1YCPH 3SV8A 1DY9A 5EG4A 5JPMH 1TFXA 1GDNA 2ZG0H 4Q7YA 1ELBA 1K21H 5FCRA 1OWEA 2FYQA 3F9FA 1O2SA 4X2XA 1JBUH 1LDTT 2GCTC 1EZQA 2TGTA 4U30A 2AERH 1OOKB 2PR3A 1QGFA 5E2OA 1FIZA 1EJMA 2XWAA 2VVUA 3SJKA 4YESB 1SHHB 1H9LB 1ZOMA 1CU1A 1EZSC 1C5SA 1HYLA 2WPMS 2GCHG 1O2JA 3R0FA 1J17T 1DX5M 5DGJA 1GJ4H 3ZVBA 5EPYA 1OWIA 1IAUA 2ZGJA 4AB8A 1AKSA 3ELAH 1QRWA 4BAHB 1A3EH 5FPTA 4INHA 1B7XB 2PGBB 1GHWH 1XXDA 2OCVB 3H5CB 3E6PH 5DP6A 2XC4A 3SNBA 4ABHA 1BITA 2A7CA 4CBOA 1FN8A 3ATKA 1O3BA
chains in the Genus database with same CATH superfamily
4A5TS 1Z1IA 1EATA 1C1NA 4X6PA 1O30A 4LK4A 5LPEA 2QXHA 4WWYA 1SVPA 4AC9A 1DY8A 1CGIE 5CHAB 3WWBA 3TVJB 1O3LA 1TAWA 5DP8A 3S7HB 2ZPSA 3A83A 2QIQA 2A5KA 1QQUA 1O3FA 2PUQH 5K7RA 1G3EA 2K1QA 1GBJA 1GMCF 1IQEA 2I6QA 3WWFA 1A0HB 1TLDA 2IPHA 3WW7A 1AZZA 1SGFA 2PTCE 1EASA 3AASA 2IJD1 4XFQA 4ZHLU 2HLDD 4LOYH 1QR3E 5KEDA 1C1SA 1O2QA 2WV4A 5HIZA 1L4DA 2TPIZ 4ZUHA 4ZXYH 5ABWA 4WMFA 3FN8A 1C1MA 5F53A 5C1XA 3UOPA 1TNLA 2C3SA 2P8OC 2PHBA 4DJZB 3A80A 3PRDA 1QURH 3SNCA 4X2WA 2ANMH 4ACAA 5EIYA 1KSNA 2FOFA 1QBVH 1KTTB 4ABIA 1Z7KA 1NTPA 2FESH 2VVCA 3SBKA 4FETA 4DIHH 1A61H 2BXUH 1KY9A 1ZMJA 1ETTH 1TBRH 3P95A 3DSGA 1VITF 1SFQB 4Y8ZA 2OC7A 1YBWA 1U6QA 3I77A 3T62A 1UK4A 2BLWA 3PRBA 2QCYA 3RMNH 1TA2A 2YMSC 1TRYA 1TNIA 4ISOA 4OS7A 2Q1JA 4Y7BA 3ZYEA 1O3GA 1AD8H 1SGEE 1O32A 1EAWA 4XBCA 1MQ6A 2AHME 2BD5A 3LIWA 1DITH 5TJXA 1BB0B 2JH0D 1SBWA 1V2WT 1A0JA 1DWCH 1MBMA 2PSXA 4YLQH 2FLBH 4ABGA 4GCHF 2WPIS 5EJLA 2NU2E 4WVPE 3P92A 1FY1A 2BOHB 2H9TH 2M2AA 3AW0A 3FVFB 3QLPH 1GI2A 2HNTE 3W1EA 3T29A 2GJGA 1NROH 4WXIA 3VFEA 1FUJA 4I8LA 4B6FA 2W26A 4KTSA 1YCPM 1HAYB 4RSPA 1XMNB 4TSFD 1BIOA 1ZMLA 2EI8A 2VIOA 3FP8E 1Y5AT 3ZZ9A 4Y79A 4RT1A 8ESTE 4BXWA 1NFWA 2C8YB 2C8WB 3MNSA 3U1JB 1SHYA 1YPMH 1EZXC 3GISB 1KMHB 2VWNA 2FM2A 1GI8B 5EXMA 1K22H 1PPCE 2HNTC 1GJDB 2IPQX 3IG6B 1BTHH 5HMAA 3SJOA 2LELA 3A81A 2YMSD 1SQRA 4X1SU 5IYTA 4DY7B 1O2RA 1CVWH 3CENA 1GBLA 2F83A 1WDIA 1IQJA 3UNSA 3MYWA 4CH8B 3F6UH 4Y0ZE 1IQFA 2OC8A 3NKKA 1TYNA 3U8RH 2EY4C 3M3VA 1HAHH 3O8BA 3ZZ8A 3PMJA 2F9OA 4Y6DA 1BBRH 1C9PA 1OX1A 3F2FA 2ZO3H 1GVZA 1L4ZA 3BEIB 3ODFA 2KM0A 2W3KA 3BIUH 4OS1A 3UPEA 3ZV8A 2B8OH 1O2LA 1MMJN 3SNAA 2FI4E 3N7DA 1FNIA 4HFPB 1JMOH 1BMFD 3QTOH 2XOKD 3MNCA 1RTKA 3LT3A 4JK5A 3F2GA 4CR5A 1BUIA 1GMDG 2PLXA 1AGJA 1D9IA 1ORFA 4FUIA 3RM2H 2PKAB 2Y7XA 1OP8A 4B2CA 1D3DB 3DFLA 1YGCH 2XBVA 4IS5A 1OS8A 1D3TB 1F7ZA 2PFEA 4R8TB 1OYQA 1H9HE 1UTJA 4J2YB 2BD7A 2ZU3A 2VB0A 4QT8C 4GAWA 4GVUA 1HAZB 1P04A 4MPXA 1EB2A 2XYAA 2Z9GA 4NWKA 2WHXA 3S9CA 2BOKA 1HNEE 2EEKA 5L30H 1C5TA 1GL1A 5AHGH 2CXVA 1GI0A 1LVBA 2AMDA 4I32A 2FX6A 1BA8B 4AG2A 4FUCA 1J14A 4FXGH 3BEFB 4K60A 3KQDA 3FZZA 4IMQA 2XTTB 2BVXH 1EAUA 4GHTA 1L1JA 7GCHF 3T27A 4ASUD 1MKXH 1HIAA 3AW1A 2GZ7A 1S82A 1T4VH 3PROA 1W7GH 3HKIB 1SGTA 4YLUA 2VGCB 3P8NA 2R3UA 3BTDE 1XUHA 3W95A 1P2QA 3Q3XA 1NS3A 1WTGH 4KGAA 1GHYH 2OLGA 1H8IH 1G3CA 2Y5FA 3PV2A 1S6FA 1T8MA 3E8LA 3SQHE 3ITIA 3UQVA 2R0KA 3S7KB 1UCYH 3C1KA 3SZEA 2W6ID 1O5AB 1TE0A 1HGTH 1JRSA 1WCZA 1GBMA 4JYUH 4MPWA 1WUNH 2BVSH 5IK2D 2ZKSA 2Y6TA 2Y7ZA 1T8OA 4NZQA 5A8ZA 4FVBA 3RXAA 2BZAA 3E0NB 3NRLA 1TGTA 4X6NA 2VIDA 1LVMA 2BMGB 2H9EH 2ZGCA 8GCHG 1QQ4A 2L6OA 3PV5A 5DG6A 1GJAB 2UWOA 5FCKA 1QJ1B 1Q2WA 1DVAH 1ZR0A 1XVOA 1O5FH 4BTTB 3MU4A 3QWCH 3UAIC 2GT7A 2UUKB 1P10A 1QB6A 4PROA 2BX3A 3GY8A 3RU4E 3G01A 1ZRBA 1LHGH 1NFYA 4HTCH 1QA0A 1O0DH 4I7YH 1BTZA 2W7SA 1G30B 2G4UA 1P2NA 1KXAA 1YPLH 3D49H 4CRAA 5L6NH 4OS5A 4Q4LA 1AVGH 5GCHG 1N8OB 2O8UA 2C4FH 3Q3YA 4CRBA 4WXVA 1O2XA 1S5SA 3KEEA 1HIAB 2RG3A 1IOEA 5CMXH 3U28C 4K5ZA 4FUHA 5G4BA 2ANKH 2KCAA 4WF8A 3VB6A 1HJAB 3UQOA 1OPHB 3KF2A 1NBME 3QK1A 3MHWU 4WH6A 2CHAB 2RA3A 4FU9A 3NPSA 1S6LA 3ZVFA 2FO9A 1AB9C 1E1RD 3SHCH 1TGNA 1BDAA 4XSKU 3M5NA 1GI7B 3TK9A 1BTPA 2ZECA 1O35A 1V2LT 1P0SH 3O8RA 1SOZA 1ZSLA 4AYVB 1KYNA 5F8XA 3F9GA 1QL7A 2SGDE 4ZHAA 4DOQA 4F48B 2GMTB 4TPYA 3S9BA 4MNYA 1C5LH 2D26C 4J1YA 1EOLA 4BNRA 1V2KT 3DCLA 3ZZ6A 2V3HH 2C93B 3BTHE 1O5BB 1AQ7A 3SGBE 1SGFG 1RS0A 3V13A 4BXSA 4X6OA 1O3AA 3JZ1B 1G37A 3SU0A 3T28A 1EPTC 2ZZUH 1AWHB 5C5OA 1GPZA 2GKVE 1ZRKA 1IQNA 1O33A 1ABIH 3GY3A 1T31A 5FPYA 3U8TH 2A45B 1EX3A 3SV2H 4Y8YA 4SGAE 3U8OH 1KLTA 1ELFA 4E05H 1FPCH 5HXFA 1UHBA 5JB9S 1FZZA 4D76A 4AOQA 2BD3A 2JH6D 4TT3D 3TU7H 3B23B 2BDCA 1SB1H 2ASUB 3MNBA 4I8KA 2A4OA 1TX8A 3RXQA 8LPRA 3NUMA 1WQVH 4CBNA 1BTUA 3BSQA 1QHRB 3BIVH 3SN8A 4ISHH 1W12U 1GVLA 2A5IA 1RD3B 3SHAH 6CHAC 2HGTH 1P3EA 1DXPA 3LGVA 1VCPA 1GHAF 3A7XA 1NBMD 2GDEH 2PKSC 1G2LA 4Z6AH 2IOTA 1CA0C 1XVMA 5A0CA 1G2MA 1KDQB 3UNQA 5E0JA 1P2KA 2ZTZA 1Q3XA 2V0BA 2FOCA 1DE7H 1ELCA 1XUGA 5EPNA 1TBZH 1QCPA 2F9UA 4NIXA 2ZCLP 4Y71A 3RXJA 3NZIA 3BTKE 1NRNH 1NZQH 1RXPA 4KP0A 3MU1A 2STBE 1E36B 1K1OA 2JKHA 4ZKNU 2F3CE 2IN2A 2BDGA 1O3HA 3F0OA 5CE1A 3RXRA 4K69A 3TNTA 2OXSA 2AS9A 1NY22 2J34A 3LGIA 1W10U 3SU4A 1B5GH 4CHAB 1V2QT 2WUBA 3GCNA 3SZNA 5HIYA 1YC0A 3KCGH 4D8NA 1EJNA 1H4WA 1GDQA 3VXEH 4MVNA 3ZZBA 1JRTA 4KKDA 4FUJA 3K9XB 1B0EA 2G4TA 2FEQH 9LPRA 1UVUH 4AX9H 1ESTA 1PPEE 1RIWC 4K1TA 3PMHB 2A4RA 5T6DA 3SU6A 1OSSA 3OX7U 3T25A 3OFND 1PPFE 3UUZA 1C2LA 3T26A 3ZZ5A 2YMSB 3RXTA 2AYWA 1AZ8A 1KXCA 3KL6A 3ZVCA 1KTSB 1O3MA 1F0TA 1BRBE 3UR6A 1DS2E 3M7UA 1ANCA 2VU8E 1HCGA 1G3DA 3EE7A 1GCTB 3LH1A 3A7VA 4WMEA 1E0FD 3A86A 4TY7A 4DW2U 2J98B 2I6SA 2EI6A 1IQGA 3BG4C 2STAE 1O3CA 2VNTA 1MTVA 4ISLA 2BY7X 3DHKH 1C4Y2 1GG6C 2BVRH 2Y82A 1EP5A 4E06H 4A92A 4ZKRU 4D9RA 1GI1A 1YKTA 2GD4B 2WPKS 3ZV9A 2A4GA 1LTOA 1GMHF 1P9UA 3BN9A 3BTWE 1LPGB 1E34B 1VZQH 1DANH 1AE5A 1TNKA 3NWUA 3RLWH 1SGYE 1S0QA 2ZI2H 1C2DA 3OTPA 2KCYA 1CT4E 1GJBB 4Y7AA 1DPOA 2BM2A 4X8UH 3ZVDA 3KQEA 2KAIB 1UVOA 1LO6A 5EJ1A 2HALA 3B9FH 1WAYB 3LGYA 2A5AA 4KTUA 2BY6X 1FPHH 1ZGIA 3URCA 2CF8H 5EOKA 2Z3CA 2XBYA 3M36A 5ETXA 5GXPA 1A4WH 1V2UT 1BRCE 1PQ8A 4GPGA 3T5FH 1BTXA 5L2YH 1BZXE 2ZEBA 2CN0H 2XWBI 2ZFSA 3EA7A 1J15A 1O2OA 2Z94A 5JDUB 2ZPRA 1UJ1A 5T1VA 1MTNC 4ABBA 1TGSZ 1YPJH 2FOBA 4IBLH 4VGCC 2P3FH 1TQ0B 1C1RA 1SLWB 4DG4A 1ETRH 3JZ2B 5EQQA 4DURA 2WPDD 5E0HA 2V7QD 3A82A 1OWHA 1Z8JB 1YLDA 3FP7E 1MUEB 1KLIH 3M3SA 1K0HA 5F03A 1LMWB 2J4IA 5AVDA 1QBOA 4HI3A 1YCPK 5DP3A 4Q7XA 3KQBA 1O5GH 3SGQE 1ZSKA 3OSYA 3F3BA 3MH6A 1AUJA 1O3OA 3QTVH 2VH6A 4GUXA 1ZPZA 4Q80A 1H8HD 2G5NA 9ESTA 2CGAA 1CHOG 1KIGH 3QGNB 3NK8A 1UTQA 1GBCA 2VIPA 5FHTA 6GCHG 4ABAA 1YLNA 3M3TA 1AFQC 1W13U 1AE8H 2SNVA 2FOAA 3N99A 1DWEH 5DK1A 1PJPA 2Y80A 3STIA 4MG3A 1LHCH 1ZTLA 1P9SA 1S0RA 2K8IA 2NU0E 5T6GA 4DCDA 1GJ8B 3SV6A 4TWWA 1D6RA 1W11U 2ILNA 1T8NA 2DE8A 1W7XH 2Y81A 4OGYA 2CJIA 1SGPE 1TPSA 1BMMH 1C5UA 2Y5GA 3I29A 3SI3H 3D62A 2OTVA 1MCVA 1ZTKA 2OINA 1BCUH 2VWOA 2P3UB 1D3PB 3K2UA 2TGAA 3FO8D 1FMGA 1ZMNA 2Y5HA 3EYDA 4X6MA 3VB4A 1FIWA 1FONA 1N6XA 1DUAA 1TMUH 1BHXB 5EXNA 4MDSA 1LPKB 3BF6H 5EXLA 3BG8A 2HNTF 1FY4A 1ZLRA 4JYTA 5A0BA 4RN6A 1C1WH 2ZDNA 1O2ZA 1HJ9A 2P94A 3M5OA 2ZGBH 4IN1A 5TCAA 5T3HA 2RA0A 3PV4A 4TPIZ 3ZZDA 4FU7A 1WYKA 1VGCC 4A7IB 2O8MA 4UFEH 1GL0E 1ACBE 3HK6B 3A7TA 4I31A 1O31A 1K28D 3M61U 3V7TA 3ZZCA 3K65B 1MQ5A 2PKAA 3SNEA 1HFDA 1GJ9B 3GY4A 3FKSD 3U9AH 1TQ7B 5FBEA 2VWMA 1GHZA 3LJJA 2TRMA 3MO3A 3OAAD 2TBSA 2ALVA 3GCTG 5DP4A 5SGAE 1YYY1 3STJA 1J16A 1E79D 1WOFA 3EAJA 2J9NA 3M5MA 2VINA 1AMHA 1UVTH 2G8TA 1ELDE 3B8JA 2CK3D 2FXRA 3LGWA 3P8GA 2YNAA 2F43B 2OP9A 3Q76A 2P59A 3HGNA 4X8SH 1AFEH 1W0JD 1PPBH 1ARBA 3SNDA 4UFFH 3SO3A 3QGJA 1GGDC 1GDUA 2OQ5A 2TGDA 2ZHEH 4XRNA 2F9NA 2PW8H 1GMCG 1T32A 4O3TA 1NN6A 4KELA 2PV9B 2QC2A 2FDAA 1HAXB 4M9FA 3UR9A 2A7HA 4E7NA 3VGCC 1N6YA 4HZHA 3RXFA 1ZJDA 4OS4A 1WSSH 2ZF0H 1EB1H 4K1EA 3SW2B 1K1LA 5KGOA 1GBIA 5JYIA 1Z8IB 3DT0H 2QA9E 1CT2E 2Q6DA 1XUIA 2F9VA 2AGGX 1Y8TA 4B74A 1SGRE 1NFUA 3RXIA 3RXGA 4XD7D 3QN7A 2XNDD 3TGKE 3TK5A 4Z0KA 1XUJA 1YPKH 3EQ0H 1NU9A 3M37A 2QF5A 3O8CA 3D65E 1UMAH 1V2TT 4I33A 3RXVA 5I25A 1J8AA 1GCDA 1UTOA 1C1UH 1TOCB 2HWLB 1K1PA 3E16B 2BLVA 1DSUA 1TBQH 3DSOA 3S0NA 3RXMA 4AG1A 3A88A 3ZZ3A 2C8XB 3SJ8A 2BY8X 1NC6A 2XNIA 3GCOA 1N1LA 1VITG 5DP5A 2GV6A 2AH4X 2J94A 2BLOA 5C1UA 2ESTE 1BHXF 5AF9H 2HVXA 1GHBF 1P11E 2A1DB 2VIVA 5E2PA 3LGUA 3VB5A 2SFAA 2ZHFH 2O8TA 2BDBA 3A8AA 3TITA 4Z1MD 1GBHA 3A87A 5E0GA 1NT1A 3V12A 3M35A 1LKAA 1BRUP 1O5DH 3SU3A 4INKA 4GCHG 6CHAB 1K1IA 1TGBA 3TGIE 4YTAA 2J95A 2WUCA 2PKSB 1FAXA 4WMDA 1HJ8A 2A32A 1A3BH 1CA0B 3OEED 3UWJH 1DSTA 1F0UA 2ZQ2A 3SORA 1AO5A 1GI9B 1P2IA 1ZHPA 1OP0A 2AMQA 1QY6A 4BAQB 2A2XH 2P95A 4UEHH 4LZ1H 1O3PB 1HXEH 3MO6A 1TX6A 2GGVB 2R2WU 1NRRH 5A8XA 1GI3A 4YM9A 2GX4A 4O03A 2OBOA 2WPHS 1F2SE 1EOJA 1PPGE 4CREA 3EE0B 2H6MA 3F1SB 1OYTH 3LONA 4JMYA 4NSYA 4X0WU 5EODA 2QXJA 1TABE 1GHXH 3KNXA 1VR1H 1Z1JA 2UUFB 2O9QA 4K2YA 3E0PB 3EA8A 3MU5A 5IDKA 3E91A 1UVSH 3ZZ4A 2TGPZ 4TYDA 1BMNH 4KTCA 2FPZA 3A89A 3IITA 4BAKB 1O5EH 4IN2A 2UWPA 1ABJH 2ZC9H 1SKYE 2BHGA 1GJCB 2H5CA 2Z3EA 2FTMA 1V2RT 4H4FA 1O2VA 1YF4A 3P8FA 1TB6H 5KECA 5GJ4B 3DD2H 1RIWB 2TIOA 2QAAA 1THSH 3TIUA 3MH5A 2ALPA 1HAOH 3FAOA 3SUGA 1PPHE 1MKXK 1C5VA 2ZNKH 1MTSA 4MNXA 2ZFTA 5L2ZH 1NPMA 1O2IA 1O36A 3OEHD 5GPIB 5EW2H 4O97A 1FY3A 3I78A 4TWYA 1CBWB 1UTLM 3HK3B 1TMBH 5EQRA 2Q6GA 4O3UA 1M9UA 3SUFA 2NU1E 1AIXH 3MFJA 2RFKC 4XBBA 3HGPA 3RU4T 2B5TB 1BT7A 1FAKH 2BDHA 1UCYK 1Q31A 2ZFRH 3BG4B 1SLXB 4DT7B 5FBIA 3TH2H 1A0LA 4YOJA 4ZAEA 1A2CH 1AU8A 1QB9A 4U2WA 1SMFE 1WBGB 1KLJH 1DUEA 2HVYB 1LCYA 1V2NT 1TPOA 4X8VH 3SU2A 1IQIA 1KDQA 4Q7ZA 4NA8A 2D2DA 2ZFQH 4D9QA 4FUFA 2XBWA 2ZP0H 5HKKD 4X1RU 1Z8GA 2ZU2A 1CE5A 1P09A 1Y3UA 1LHEH 2RCEA 4FVDA 3M7QA 5FL7D 5T6FA 4IMZA 2KCPA 2QE7D 4UFDH 3TJNA 8KME2 2W3IA 2OUAA 2GCTB 2AGEX 1YLCA 4Y0YE 1SQAA 2WZQA 1YP9A 7GCHG 5DJ7A 2OC0A 1EJAA 5DPAA 4Y76A 1ELAA 3ESTA 3RXSA 4YXWD 1UTMA 4UD9H 4NIVA 2QXGA 5EJZA 3RXCA 1BMLA 4Y10E 1RFNA 2BY5X 4X1PU 3TPIZ 1ANBA 4ABJA 2GT8A 2J38A 1P8VC 1VCQA 5C94A 1GHVH 4MNWA 4ABFA 3MH4A 2JETC 1SL3A 3GY5A 1IQLA 1WV7H 1C4V2 3RXUA 3GDVA 1MTNB 2UUJB 4NIYA 3VB7A 4B76A 2WYGA 4RKJB 1B0FA 1IQMA 4VGCB 5JBTA 1TRNA 1HXFH 1E38B 3MMGA 1KXBA 4YOGA 3FP6E 2A0QB 5AFYH 3RXHA 1HUTH 4ZMAH 2WV9A 1V3XA 1EZUC 1P3CA 3Q00A 5FPSA 1UTKA 2ZTYA 3QO6A 4OS6A 4MQAA 3RUOA 2JDID 3RC5A 1KXDA 2V35A 1QRZA 5BPEA 1BJUA 1O37A 1H8DH 3MH7A 4ISNA 1L1NA 5FAHA 3UOUA 1GBTA 2KX4A 3PLBA 2WPJS 1C2KA 2P3TB 1O2TA 3ATWA 3T2NA 1ZSJA 1ZTJA 5ESBA 5DO4H 2J98A 4IGDA 3CS7A 2BLQA 4H6SB 3RDZA 3ATLA 3QUMP 1GBAA 4B75A 1F5KU 2FI3E 4NSVA 4FU8A 2BD2A 1P57B 3GY6A 4K3JA 2GV7A 3TNSA 2G55A 2L74A 2VGCC 1JIMA 3MTYA 4JZIA 1C2EA 2THFB 2VIQA 3VEQB 1O5CB 3UFAA 2EQNA 2P8OB 5DP9A 1GWAA 2GCHF 1ETSH 2A2QH 3LDXH 3P8OA 3A7YA 2FYRA 1YPHC 3PTNA 1O3DA 1Z6EA 1XX9A 1MKWK 2CF9H 3UB0A 1TGCA 5I46H 2A4QA 2H5DA 2SGAA 1UCYE 3EGKH 3VXFH 1MZDA 1RJXB 4UONA 2EC9H 1EAIA 2KAIA 2C8ZB 5GWZA 1OWJA 5DP7A 4X1QU 2ZQ1A 3MWIU 5C2ZA 2ZIQH 5GDSH 1QL8A 2QY0B 3TJUA 1INCA 1ELEE 2P93A 1OXGA 3DUXH 1C5PA 2VBCA 1P2OA 2G52A 3SU1A 1C1OA 3OYPA 5HM9A 1O39A 5DSFA 1MZAA 1SC8U 1HRTH 2ZA5A 1BMAA 1CSOE 4IW4E 3H7OA 2BDAA 4AYYB 3RXLA 2YNBA 1TRMA 4I8JA 1GBEA 3E90B 1A7SA 3LC3A 1VGCB 4R0IA 2VH0A 1C5XB 4CRDA 1MAXA 5A2MH 5C67A 1C2FA 4AN7A 1C2IA 2BDIA 4YT6H 3ATIA 2ODQA 1K1NA 2XBXA 3GCTF 1ZYOA 1C5YB 1EUFA 1QRXA 3N7EA 5HYOA 2G51A 2NWNA 5EGMA 1HBTH 1LVYA 4Y8XA 3RLYH 4DIIH 1GI5A 4OS2A 1DWDH 3V0XA 1HJAC 1Z6JH 1ZZZA 4JZ1A 2Z9KA 3SV7A 3VPKA 4WJG2 4NGAH 4P00A 1E37B 1TONA 3F68H 3VB3A 1W0YH 3BTQE 1HAVA 3LU9B 1YWUA 2JH5D 5PTPA 3TGJE 3P6ZB 2RDEA 2OC1A 2FWWA 1C5QA 2SNWA 3KYFA 1LQEA 5LGOA 2ZHDA 1NESE 1Y5BT 4RI0A 1SPJA 4NA7A 1MU6B 1S6HA 1GHAG 1V2ST 1P2JA 2FZZA 1HDTH 1TNJA 3ZIAD 7ESTE 1MD7A 1UTPA 5F6MA 1O38A 2NU3E 1TWXB 2GMTC 2GZ9A 1P05A 1ZPBA 4AGJA 4CRFA 1J9CH 3A7WA 4YT7H 2ZU1A 4ASHA 3VGCB 4JK6A 1NO9H 1X7AC 4H6TA 4RKOB 3CS0A 1C2HA 3LOXA 4GLYA 1NFXA 2A7JA 4AGKA 1HB0B 2ULLA 1AHTH 5JBCS 3TK6A 1NRSH 2QGRA 1EXFA 3PWBA 3QDZB 5A0AE 4FUDA 4X2YA 1AI8H 4ZHMU 4O9VA 1W0KD 1CQQA 1TX7A 4MTBA 1MTWA 4YO9A 1QL9A 1LHDH 2R0LA 3GYMA 1SQOA 1GJ6A 1LPZB 4CR9A 2GDDA 5F8TA 1YPGH 4NIWA 2R2MB 2Q6FA 2PSYA 2CV3A 1IQHA 1EFRD 1PFXC 4F4OC 2O8WA 1JWTA 3ZVGA 4MLFB 3GCHC 3MNXA 2WV5A 1IQKA 4BAMB 4D7FA 2FOHA 2FIRH 4JYVH 1SGQE 1F5RA 1HAVB 2BB4A 1WXRA 1Y59T 5J4SA 1D3QB 1KXEA 3GICB 4MNVA 3MOCA 3RM0H 1G9IE 4DGJA 3PO1C 1NU7B 2BQ7B 2XCNA 3VG8A 4I86A 1UK2A 1XM1A 3URDA 3IWMA 2FP7B 4WY3A 4Q2KA 1XKAC 1K1MA 5LPFA 2AMPA 2EA3A 4MPUA 3GDSA 1QJ6B 4WH8A 4JZDH 1O34A 3LH3A 1G3BA 2OBQA 4UFGH 2WYJA 1SG8B 1H9IE 3BTFE 4U01A 1C4U2 2G81E 1NM6A 1C2GA 2FS8A 1OWDA 3CP7A 1O3KA 2BZ6H 3N7OA 3SJ9A 4CHAC 4AFUA 1GMHG 3GDUA 4NA9H 4THNH 4P02A 2H1UA 1CHGA 1HV7A 3PWCA 4FOUC 1VJ9U 1A5HA 5ESTE 1GMDF 3U69H 1FJSA 2QN5T 2CMYA 2SGEE 3H09A 1V6DA 2K0QA 1YM0A 1AKSB 1GVKB 3RXKA 1SGIB 1BOQA 3OY6U 1W14U 1ESAA 7LPRA 3L6PA 4ZKOU 3L3TA 1RRKA 3DFJA 3WY8A 1W0ZU 2PGQB 1SOTA 1QIXB 2BQWB 1MD8A 5C0UA 4K1SA 4B2BA 5EU8A 3SUEA 4B73A 1EPTA 3PYHA 3KHVA 1DT2A 1V2PT 3OU0A 1ANEA 1QZ8A 1BRAA 1GCTC 3FZDA 1K9OE 3AAUA 5CHBA 4K8YA 3TJOA 1JIRA 5J4QA 4Y11E 1HAIH 3BTEE 5FX6A 4AORA 4DVAU 1AWFH 1ID5H 5K0HA 2XW9A 3UREA 1FXYA 2QV1A 1AVXA 1P03A 1C5RA 2R9PA 4K8BA 4XOJA 1OKXA 2BD4A 2AGIX 1DDJA 4ABEA 4FUBA 3UNRA 2G00A 1F5LA 3PTBA 1MTUA 2R3YA 3RP2A 4B6EA 1E1QD 1GBBA 4I8HA 1AB9B 1DXWA 3BEUA 3A85A 3KN2A 3UY9A 2HOBA 2BTCE 1T4UH 2BDYA 1Y3VA 4CRGA 3BTGE 5A09A 1EKBB 4ZH8A 3CNRA 3SUDA 4ESTE 3K6ZA 1V2VT 2LNCA 2ZDKA 3MU0A 8GCHF 3P17H 2A31A 2PWXA 1ESBA 1V2OT 4DT4A 1ZJKA 1SLVB 1RTFB 2Z9IA 2XCFA 3M7TA 4F49A 1O2YA 3ZZ7A 1ELTA 2BY9X 4B71A 1SGCA 2C90B 1EPTB 5BRRE 1HAPH 1T7CA 1Y3XA 3PMBB 1IHTH 1CGHA 5A8YA 4INLA 4YZUA 3ATMA 2ZDMA 4LXBH 5GCHF 1D4PB 3F2HA 3PMAB 3BTTE 1SI5H 2GZ8A 3H7TA 4BTIB 1O2MA 1UK3A 3RXDA 2JETB 4BANB 4AB9A 3MQKC 1C1TA 2JJ2D 2VJ1A 3EDXB 2OQUA 4GHQA 3E3TA 1CGJE 5CHAC 3QZRA 4BAOB 4UDWH 3NCLA 1Y5UT 1P12E 2YOLA 1AUTC 2JIZD 1C5MD 2ANWA 2QXIA 2B9LA 7KMEH 5LPRA 1EAXA 2SGQE 1CA8B 1EQ9A 2FS9A 5C1YA 3SQEE 2ODYB 2B7DH 1BTYA 1COWD 1K2I1 2HPQH 1MCTA 1VJAU 1BBRK 2Z9LA 1UTNA 3BTME 2Z3DA 5DKMA 4ZKSU 2B0FA 1HPGA 4F55A 3SYJA 1TMTH 2BQ6B 3GS9A 5DN6D 3A8BA 2BD8A 2J97A 2KR7A 4I8GA 2H2ZA 1TPAE 2WSSD 2ZU5A 4RT0A 2ZWLH 4NWLA 5C17A 2PTNA 1QA7A 2FOGA 1GBDA 4CRCA 1A5GH 2ZPQA 1C1PA 1YPEH 1THPB 3LKWA 2SGPE 5FXLA 1OP2A 2ANYA 3U1IB 4ACBA 1TOMH 3LPRA 3R3GB 4Q63A 1TALA 3BV9B 2ZTXA 1PQAA 1TIOA 4NFEA 2F9BH 1P2MA 3KIDU 3MU8A 2DE9A 3C27B 1TNGA 2H9HA 1XUFA 4X8TH 2D1JA 2D8WA 2ZDLA 4JCNA 3DSPA 3UIRA 1P01A 5JBBS 1P06A 4X1NU 1LKBA 4A1VA 1Y3WA 3TJVA 4UE7H 2O8LA 3V3MA 1SLUB 1QTFA 2GTBA 5HM2A 1A1RA 1L2EA 1TPPA 2FOEA 2SGFE 1T8LA 2ZCKP 4JZFH 2ODPA 1WU1A 5CDFE 1LVOA 1MAYA 2ZDVH 5GNDA 2V3OH 2G5VA 2ZFPH 5HGGA 1NRPH 2F4LA 1FI8A 2M5TA 4A1TA 4D7GA 3RMMH 2KZ4A 4U32A 2FI5E 3SOSA 2LPRA 1BJVA 4CH2B 4ISIH 1C5NH 1F0RA 5B6LA 2HPPH 1PYTC 5H4IB 1K1JA 1EP6A 1S85A 3RXOA 3ZVAA 1LHFH 1PQ5A 1UW7A 3SJIA 1BQYA 2ZHWH 1FDPA 3OTJE 1GG6B 3RMOH 2J92A 2ZGHA 2IJOB 3AK5A 1GHBG 3NXPA 4HG6A 4M7GA 2ZHQH 2P16A 1ANDA 3A7ZA 1GJ5H 3PM3A 3ZYDA 4AFSA 3S69A 3ENSB 3ZZAA 5JBAS 1SFIA 2GP9B 3RXBA 3ODDA 4ZROA 1AN1E 3SV9A 2PP6A 1F92A 1QBNA 3S9AA 3KQ5A 3RC4A 4A6LA 5C3NA 4B1TA 1HLTH 4ZCNA 1JOUB 1Y3YA 1RTLA 4HGCA 3HPTB 1S83A 1MH0A 4GSOA 2ZGXH 1O2GH 1FX0B 2ZU4A 3W94A 2FX4A 3F9HA 4AZ2B 3FANA 1BBRE 2AFQB 2BXTH 4IC6A 1H1BA 1W2KH 4TY6A 3RC6A 2KFWA 1D6WA 1SGNE 1QB1A 1PYTD 1CO7E 3GY2A 1GI4A 2DUCA 2XXLA 1C1QA 1C1VH 2AEIH 4OGXA 3RMLH 1P02A 3EA9A 1V2MT 3RXPA 1ZPCA 5EQSA 2VVVA 3L33A 3SI4H 4AFQA 1KXFA 1O2UA 1VKYA 2LP6A 1QNJA 4NFFA 1GBFA 1O3JA 2HRVA 5E8EH 3RU4D 3E1XB 1YY3A 5LH8A 1ZHRA 5FX5A 5F8ZA 1V2JT 1G32B 2FMJA 1O2NA 3GYLB 4ZXXH 3PB1E 1O2PA 1C5ZB 3O8DA 3HATH 1S81A 1MKWH 1ELGA 6ESTA 2F91A 3PLPA 3A84A 4FUEA 1A46H 2BD9A 5TCCA 3AVZA 2XC5A 3GCHB 2AIPA 4IC5A 1G36A 1TNHA 3A8DA 1YPHE 1DWBH 4NCYA 1BTWA 2V6NA 1NRQH 4NG9H 1Z8RA 3FFGA 2KCOA 1H8ED 2ZDAH 4X2VA 2FOMB 3P70B 1UVPA 1WTHD 2XC0A 1FLEE 1AFQB 1GJ7B 4NZLA 4XBDA 5C20A 5C5NA 6LPRA 3GOVB 1C5WB 1SGDE 1ELVA 3OY5U 4LZ4B 3PO1B 5GIBA 1ARCA 2W6JD 1TA6A 1ZGVA 2HLCA 2GVFA 3AAVA 1GBKA 4MPVA 1SR5C 2V3MA 1LQDB 1S84A 4BTUB 1DM4B 3QZQA 1C2MA 2EI7A 2XRCA 2OK5A 4B2AA 4YOIA 3MI4A 1OWKA 2NU4E 2FTLE 3HKJB 1O2WA 1O3IA 3KQCA 3LC5A 3OE7D 3UTUH 2W7UA 1FY5A 1MU8B 1DICA 2VIWA 1O2KA 1L0ZA 1FV9A 5C0TA 2FLRH 1FN6A 2QF4A 1F0SA 4XDEA 1DOJA 1MBQA 2F9PA 1O3NA 3LJOA 3A8CA 1ZHMA 2QF3A 3F9EA 2ZFFH 3QX5H 1SQTA 1XUKA 1UHBB 1XXFA 1O2HA 2UWLA 2Z7FE 4XE4A 1JXPA 4SGBE 1VCWA 2QF0A 1DFPA 4OM9A 1CT0E 3D23A 3MO9A 1A5IA 5JB8S 4E7RG 3ZVEA 1C5OH 2QYIA 3KGPA 2FODA 3FOAA 4JZEH 2BYAX 3TH3H 4H42U 1N8OC 1CHOF 1FY8E 1DLKB 2UUYA 3SGAE 1VITH 6GCHF 1C9TA 1THRH 1WQSA 1AVWA 3UWIA 1W3CA 3RXEA 4ABDA 1CBWC 1Z71A 3K6YA 5EW1H 2AIQA 1SSXA 3PLKA 1RGQA 3Q77A 2WINI 1GI6A 2WPLS 3U98H 4FUGA 3TH4H 1HAGE 3M5LA 1MABB 3Q3KA 2Z6BD 1PPZA 4AFZA 2JJ1D 1E35B 1QJ7B 2OD3B 2J2UA 2CHAC 3LGTA 1C2JA 2PUXB 1FQ3A 4A1XA 4BOHA 5B6OA 2ZCHP 3F0PA 1QFKH 1XKBC 1PQ7A 1DLEA 1AY6H 1IHSH 2RDLA 3DA9B 3TLOA 1OHHD 5AFZH 1W8BH 3GY7A 1GGDB 2BX4A 1L1GA 3SU5A 2W5EA 2VWLA 1O3EA 2Z9JA 1UO6A 1YCPH 3SV8A 1DY9A 2J5UA 5EG4A 5JPMH 1TFXA 1GDNA 2ZG0H 4Q7YA 1ELBA 1K21H 5FCRA 1OWEA 2FYQA 3F9FA 1O2SA 4X2XA 1JBUH 1LDTT 2GCTC 1EZQA 2TGTA 4U30A 2AERH 1OOKB 2PR3A 1QGFA 5E2OA 1FIZA 1EJMA 2XWAA 2VVUA 3SJKA 4YESB 1SHHB 3KYGA 1H9LB 1ZOMA 1CU1A 1EZSC 1C5SA 1HYLA 2WPMS 2GCHG 1O2JA 3R0FA 1J17T 1DX5M 5DGJA 1GJ4H 3ZVBA 5EPYA 1OWIA 1IAUA 2ZGJA 4AB8A 1AKSA 3ELAH 1QRWA 4BAHB 1A3EH 5FPTA 4INHA 1B7XB 2PGBB 1GHWH 1XXDA 2OCVB 3H5CB 3E6PH 5DP6A 2XC4A 3SNBA 4ABHA 1BITA 2A7CA 4CBOA 1FN8A 3ATKA 1O3BA
chains in the Genus database with same CATH topology
4A5TS 1Z1IA 1EATA 1C1NA 4X6PA 1O30A 4LK4A 5LPEA 2QXHA 4WWYA 1SVPA 1DY8A 1CGIE 5CHAB 3TVJB 1O3LA 1TAWA 5DP8A 3S7HB 2ZPSA 3A83A 2QIQA 2A5KA 1QQUA 1O3FA 2PUQH 5K7RA 1G3EA 2K1QA 1GBJA 1GMCF 1IQEA 2I6QA 1A0HB 1TLDA 2IPHA 1AZZA 1SGFA 2PTCE 1EASA 3AASA 4XFQA 4ZHLU 4LOYH 1QR3E 1C1SA 1O2QA 2WV4A 1L4DA 2TPIZ 4ZUHA 4ZXYH 5ABWA 4WMFA 1C1MA 5C1XA 3UOPA 1TNLA 2C3SA 2P8OC 2PHBA 4DJZB 3A80A 1QURH 3SNCA 4X2WA 2ANMH 1KSNA 2FOFA 1QBVH 1KTTB 4ABIA 1Z7KA 1NTPA 2FESH 2VVCA 3SBKA 4DIHH 1A61H 2BXUH 1KY9A 1ZMJA 1ETTH 1TBRH 3P95A 1VITF 1SFQB 4Y8ZA 2OC7A 1YBWA 1U6QA 3I77A 3T62A 1UK4A 2BLWA 2QCYA 3RMNH 1TA2A 1TRYA 1TNIA 4ISOA 4OS7A 2Q1JA 4Y7BA 3ZYEA 1O3GA 1AD8H 1SGEE 1O32A 1EAWA 4XBCA 1MQ6A 2BD5A 3LIWA 1DITH 5TJXA 1BB0B 2JH0D 1SBWA 1V2WT 1A0JA 1DWCH 1MBMA 2PSXA 4YLQH 2FLBH 4ABGA 4GCHF 2WPIS 2NU2E 4WVPE 3P92A 1FY1A 2BOHB 2H9TH 3AW0A 3QLPH 3FVFB 1GI2A 2HNTE 3T29A 1NROH 4WXIA 3VFEA 1FUJA 4I8LA 2W26A 4KTSA 1YCPM 1HAYB 4RSPA 1XMNB 1BIOA 1ZMLA 2EI8A 2VIOA 3FP8E 1Y5AT 3ZZ9A 4Y79A 8ESTE 4BXWA 1NFWA 2C8YB 2C8WB 3MNSA 3U1JB 1SHYA 1YPMH 1EZXC 3GISB 2VWNA 2FM2A 1GI8B 5EXMA 1K22H 1PPCE 2HNTC 1GJDB 3IG6B 1BTHH 5HMAA 3SJOA 3A81A 5IYTA 4X1SU 4DY7B 1O2RA 1CVWH 3CENA 1GBLA 2F83A 1IQJA 3UNSA 3MYWA 4CH8B 3F6UH 4Y0ZE 1IQFA 2OC8A 3NKKA 1TYNA 3U8RH 3M3VA 1HAHH 3O8BA 3ZZ8A 3PMJA 2F9OA 4Y6DA 1BBRH 1C9PA 1OX1A 2ZO3H 1GVZA 1L4ZA 3BEIB 3ODFA 2W3KA 3BIUH 4OS1A 3UPEA 3ZV8A 2B8OH 1O2LA 1MMJN 3SNAA 2FI4E 1FNIA 4HFPB 1JMOH 3QTOH 3MNCA 1RTKA 3LT3A 4JK5A 4CR5A 1BUIA 1GMDG 2PLXA 1AGJA 1D9IA 1ORFA 4FUIA 3RM2H 2PKAB 2Y7XA 1OP8A 4B2CA 1D3DB 3DFLA 1YGCH 2XBVA 4IS5A 1OS8A 1D3TB 1F7ZA 2PFEA 4R8TB 1OYQA 1H9HE 1UTJA 4J2YB 2BD7A 2ZU3A 2VB0A 4QT8C 4GAWA 4GVUA 1HAZB 1P04A 4MPXA 1EB2A 2XYAA 2Z9GA 4NWKA 3S9CA 2BOKA 1HNEE 2EEKA 5L30H 1C5TA 1GL1A 5AHGH 2CXVA 1GI0A 1LVBA 2AMDA 4I32A 2FX6A 1BA8B 4AG2A 4FUCA 1J14A 4FXGH 3BEFB 4K60A 3KQDA 3FZZA 4IMQA 2XTTB 2BVXH 1EAUA 4GHTA 1L1JA 7GCHF 3T27A 1MKXH 1HIAA 3AW1A 2GZ7A 1S82A 1T4VH 3PROA 1W7GH 3HKIB 1SGTA 4YLUA 2VGCB 3P8NA 2R3UA 3BTDE 1XUHA 3W95A 1P2QA 3Q3XA 1NS3A 1WTGH 4KGAA 1GHYH 2OLGA 1H8IH 1G3CA 2Y5FA 1S6FA 1T8MA 3E8LA 3SQHE 3ITIA 3UQVA 2R0KA 3S7KB 1UCYH 3C1KA 1O5AB 1TE0A 1HGTH 1JRSA 1WCZA 1GBMA 4JYUH 4MPWA 1WUNH 2BVSH 2ZKSA 2Y6TA 2Y7ZA 1T8OA 4NZQA 5A8ZA 4FVBA 3RXAA 2BZAA 3E0NB 1TGTA 4X6NA 2VIDA 1LVMA 2BMGB 2H9EH 2ZGCA 8GCHG 1QQ4A 5DG6A 1GJAB 2UWOA 5FCKA 1QJ1B 1Q2WA 1DVAH 1ZR0A 1XVOA 1O5FH 4BTTB 3MU4A 3QWCH 2GT7A 2UUKB 1P10A 1QB6A 4PROA 2BX3A 3GY8A 3RU4E 3G01A 1ZRBA 1LHGH 1NFYA 4HTCH 1QA0A 1O0DH 4I7YH 1BTZA 2W7SA 1G30B 2G4UA 1P2NA 1KXAA 1YPLH 3D49H 4CRAA 5L6NH 4OS5A 1AVGH 5GCHG 1N8OB 2O8UA 2C4FH 3Q3YA 4CRBA 4WXVA 1O2XA 1S5SA 3KEEA 1HIAB 2RG3A 1IOEA 5CMXH 4K5ZA 4FUHA 5G4BA 2ANKH 4WF8A 3VB6A 1HJAB 3UQOA 1OPHB 3KF2A 3QK1A 3MHWU 4WH6A 2CHAB 2RA3A 4FU9A 3NPSA 3ZVFA 2FO9A 1AB9C 3SHCH 1TGNA 1BDAA 4XSKU 3M5NA 1GI7B 3TK9A 1BTPA 2ZECA 1O35A 1V2LT 1P0SH 3O8RA 1SOZA 1ZSLA 4AYVB 1KYNA 5F8XA 3F9GA 1QL7A 2SGDE 4ZHAA 4DOQA 2GMTB 4TPYA 3S9BA 4MNYA 1C5LH 2D26C 4J1YA 1EOLA 4BNRA 1V2KT 3ZZ6A 2V3HH 2C93B 3BTHE 1O5BB 1AQ7A 3SGBE 1SGFG 1RS0A 3V13A 4BXSA 4X6OA 1O3AA 3JZ1B 1G37A 3SU0A 3T28A 1EPTC 2ZZUH 1AWHB 5C5OA 1GPZA 2GKVE 1ZRKA 1IQNA 1O33A 1ABIH 3GY3A 1T31A 5FPYA 3U8TH 2A45B 1EX3A 3SV2H 4Y8YA 4SGAE 3U8OH 1KLTA 1ELFA 4E05H 1FPCH 5HXFA 1UHBA 5JB9S 1FZZA 4D76A 4AOQA 2BD3A 2JH6D 3TU7H 3B23B 2BDCA 1SB1H 2ASUB 3MNBA 4I8KA 2A4OA 1TX8A 3RXQA 8LPRA 3NUMA 1WQVH 4CBNA 1BTUA 3BSQA 1QHRB 3BIVH 3SN8A 4ISHH 1W12U 1GVLA 2A5IA 1RD3B 3SHAH 6CHAC 2HGTH 1P3EA 1DXPA 3LGVA 1VCPA 1GHAF 3A7XA 2GDEH 2PKSC 1G2LA 4Z6AH 2IOTA 1CA0C 1XVMA 5A0CA 1G2MA 1KDQB 3UNQA 5E0JA 1P2KA 2ZTZA 1Q3XA 2V0BA 2FOCA 1DE7H 1ELCA 1XUGA 5EPNA 1TBZH 1QCPA 2F9UA 4NIXA 2ZCLP 4Y71A 3RXJA 3NZIA 3BTKE 1NRNH 1NZQH 1RXPA 4KP0A 3MU1A 2STBE 1E36B 1K1OA 2JKHA 4ZKNU 2F3CE 2IN2A 2BDGA 1O3HA 5CE1A 3RXRA 4K69A 3TNTA 2OXSA 2AS9A 1NY22 2J34A 3LGIA 1W10U 3SU4A 1B5GH 4CHAB 1V2QT 2WUBA 3GCNA 3SZNA 1YC0A 3KCGH 4D8NA 1EJNA 1H4WA 1GDQA 3VXEH 4MVNA 3ZZBA 1JRTA 4KKDA 4FUJA 3K9XB 1B0EA 2G4TA 2FEQH 9LPRA 1UVUH 4AX9H 1ESTA 1PPEE 1RIWC 4K1TA 3PMHB 2A4RA 5T6DA 3SU6A 1OSSA 3OX7U 3T25A 1PPFE 3UUZA 1C2LA 3T26A 3ZZ5A 3RXTA 2AYWA 1AZ8A 1KXCA 3KL6A 3ZVCA 1KTSB 1O3MA 1F0TA 1BRBE 3UR6A 1DS2E 3M7UA 1ANCA 2VU8E 1HCGA 1G3DA 1GCTB 3LH1A 3A7VA 4WMEA 1E0FD 3A86A 4TY7A 4DW2U 2I6SA 2EI6A 1IQGA 3BG4C 2STAE 1O3CA 2VNTA 1MTVA 4ISLA 2BY7X 3DHKH 1C4Y2 1GG6C 2BVRH 2Y82A 1EP5A 4E06H 4A92A 4ZKRU 4D9RA 1GI1A 1YKTA 2GD4B 2WPKS 3ZV9A 2A4GA 1LTOA 1GMHF 1P9UA 3BN9A 3BTWE 1LPGB 1E34B 1VZQH 1DANH 1AE5A 1TNKA 3NWUA 3RLWH 1SGYE 1S0QA 2ZI2H 1C2DA 1CT4E 1GJBB 4Y7AA 1DPOA 2BM2A 4X8UH 3ZVDA 3KQEA 2KAIB 1UVOA 1LO6A 2HALA 3B9FH 1WAYB 3LGYA 2A5AA 4KTUA 2BY6X 1FPHH 1ZGIA 3URCA 2CF8H 5EOKA 2Z3CA 2XBYA 3M36A 5ETXA 5GXPA 1A4WH 1V2UT 1BRCE 1PQ8A 4GPGA 3T5FH 1BTXA 5L2YH 1BZXE 2ZEBA 2CN0H 2XWBI 2ZFSA 3EA7A 1J15A 1O2OA 2Z94A 5JDUB 2ZPRA 1UJ1A 1MTNC 4ABBA 1TGSZ 1YPJH 2FOBA 4IBLH 4VGCC 2P3FH 1TQ0B 1C1RA 1SLWB 4DG4A 1ETRH 3JZ2B 5EQQA 4DURA 5E0HA 3A82A 1OWHA 1Z8JB 1YLDA 3FP7E 1MUEB 1KLIH 3M3SA 5F03A 1LMWB 2J4IA 5AVDA 1QBOA 4HI3A 1YCPK 5DP3A 4Q7XA 3KQBA 1O5GH 3SGQE 1ZSKA 3OSYA 3MH6A 1AUJA 1O3OA 3QTVH 2VH6A 4GUXA 1ZPZA 4Q80A 2G5NA 9ESTA 2CGAA 1CHOG 1KIGH 3QGNB 3NK8A 1UTQA 1GBCA 2VIPA 5FHTA 6GCHG 4ABAA 3M3TA 1AFQC 1W13U 1AE8H 2SNVA 2FOAA 1DWEH 5DK1A 1PJPA 2Y80A 3STIA 4MG3A 1LHCH 1ZTLA 1P9SA 1S0RA 4DCDA 2NU0E 5T6GA 3SV6A 1GJ8B 4TWWA 1D6RA 1W11U 2ILNA 1T8NA 2DE8A 1W7XH 2Y81A 4OGYA 2CJIA 1SGPE 1TPSA 1BMMH 1C5UA 2Y5GA 3I29A 3SI3H 3D62A 2OTVA 1MCVA 1ZTKA 2OINA 1BCUH 2VWOA 2P3UB 1D3PB 3K2UA 2TGAA 1FMGA 1ZMNA 2Y5HA 3EYDA 4X6MA 3VB4A 1FIWA 1FONA 1N6XA 1DUAA 1TMUH 1BHXB 5EXNA 4MDSA 1LPKB 3BF6H 5EXLA 3BG8A 2HNTF 1FY4A 1ZLRA 4JYTA 5A0BA 4RN6A 1C1WH 2ZDNA 1O2ZA 1HJ9A 2P94A 3M5OA 2ZGBH 4IN1A 5TCAA 5T3HA 2RA0A 3PV4A 4TPIZ 3ZZDA 4FU7A 1WYKA 1VGCC 4A7IB 2O8MA 4UFEH 1GL0E 1ACBE 3HK6B 3A7TA 4I31A 1O31A 1K28D 3M61U 3V7TA 3ZZCA 3K65B 1MQ5A 2PKAA 3SNEA 1HFDA 1GJ9B 3GY4A 3U9AH 1TQ7B 5FBEA 2VWMA 1GHZA 3LJJA 2TRMA 3MO3A 2TBSA 2ALVA 3GCTG 5DP4A 5SGAE 1YYY1 3STJA 1J16A 1WOFA 3EAJA 2J9NA 3M5MA 2VINA 1AMHA 1UVTH 2G8TA 1ELDE 3B8JA 2FXRA 3LGWA 3P8GA 2YNAA 2OP9A 3Q76A 2P59A 3HGNA 4X8SH 1AFEH 1PPBH 1ARBA 3SNDA 4UFFH 3SO3A 3QGJA 1GGDC 1GDUA 2OQ5A 2TGDA 2ZHEH 2F9NA 2PW8H 1GMCG 1T32A 4O3TA 1NN6A 4KELA 2PV9B 2QC2A 2FDAA 1HAXB 3UR9A 2A7HA 4E7NA 3VGCC 1N6YA 4HZHA 3RXFA 1ZJDA 4OS4A 1WSSH 2ZF0H 1EB1H 4K1EA 3SW2B 1K1LA 1GBIA 5JYIA 1Z8IB 3DT0H 2QA9E 1CT2E 2Q6DA 1XUIA 2F9VA 2AGGX 1Y8TA 4B74A 1SGRE 1NFUA 3RXIA 3RXGA 3QN7A 3TGKE 3TK5A 4Z0KA 1XUJA 1YPKH 3EQ0H 1NU9A 3M37A 3O8CA 3D65E 1UMAH 1V2TT 4I33A 3RXVA 5I25A 1J8AA 1GCDA 1UTOA 1C1UH 1TOCB 2HWLB 1K1PA 3E16B 2BLVA 1DSUA 1TBQH 3S0NA 3RXMA 4AG1A 3A88A 3ZZ3A 2C8XB 3SJ8A 2BY8X 1NC6A 2XNIA 3GCOA 1N1LA 1VITG 5DP5A 2GV6A 2AH4X 2J94A 2BLOA 5C1UA 2ESTE 1BHXF 5AF9H 2HVXA 1GHBF 1P11E 2A1DB 2VIVA 5E2PA 3LGUA 3VB5A 2SFAA 2ZHFH 2O8TA 2BDBA 3A8AA 3TITA 1GBHA 3A87A 5E0GA 1NT1A 3V12A 3M35A 1LKAA 1BRUP 1O5DH 3SU3A 4INKA 4GCHG 6CHAB 1K1IA 1TGBA 3TGIE 4YTAA 2J95A 2WUCA 2PKSB 1FAXA 4WMDA 1HJ8A 2A32A 1A3BH 1CA0B 3UWJH 1DSTA 1F0UA 2ZQ2A 3SORA 1AO5A 1GI9B 1P2IA 1ZHPA 1OP0A 2AMQA 1QY6A 4BAQB 2A2XH 2P95A 4UEHH 4LZ1H 1O3PB 1HXEH 3MO6A 1TX6A 2GGVB 2R2WU 1NRRH 5A8XA 1GI3A 4YM9A 2GX4A 4O03A 2OBOA 2WPHS 1F2SE 1EOJA 1PPGE 4CREA 3EE0B 2H6MA 3F1SB 1OYTH 3LONA 4JMYA 4NSYA 4X0WU 5EODA 2QXJA 1TABE 1GHXH 3KNXA 1VR1H 1Z1JA 2UUFB 2O9QA 4K2YA 3E0PB 3EA8A 3MU5A 5IDKA 3E91A 1UVSH 3ZZ4A 2TGPZ 4TYDA 1BMNH 4KTCA 2FPZA 3A89A 3IITA 4BAKB 1O5EH 4IN2A 2UWPA 1ABJH 2ZC9H 2BHGA 1GJCB 2H5CA 2Z3EA 2FTMA 1V2RT 4H4FA 1O2VA 1YF4A 3P8FA 1TB6H 5GJ4B 3DD2H 1RIWB 2TIOA 2QAAA 1THSH 3TIUA 3MH5A 2ALPA 1HAOH 3FAOA 3SUGA 1PPHE 1MKXK 1C5VA 2ZNKH 1MTSA 4MNXA 2ZFTA 5L2ZH 1NPMA 1O2IA 1O36A 5GPIB 5EW2H 4O97A 1FY3A 3I78A 4TWYA 1CBWB 1UTLM 3HK3B 1TMBH 5EQRA 2Q6GA 4O3UA 1M9UA 3SUFA 2NU1E 1AIXH 3MFJA 4XBBA 3HGPA 3RU4T