4I8LA

Bovine trypsin at 0.87 resolution
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cationic trypsin
publication title On the reproducibility of protein crystal structures: five atomic resolution structures of trypsin.
pubmed doi rcsb
total genus 62
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4i8lA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4i8lA02
2H6MA 4XE4A 2Z94A 2ZTXA 1ZYOA 1SOZA 2VGCC 1O3KA 4I7YH 3A83A 4OGYA 2D2DA 2FI5E 3M5LA 3SZNA 3TPIZ 4BAKB 1ZSKA 1O5EH 1HJAB 4O3UA 1ZGVA 1SLVB 3M5MA 1FY1A 4AZ2B 3RUOA 4NA8A 1AZ8A 1AZZA 1J8AA 1O3HA 5FX6A 3O8RA 3JZ2B 5FX5A 2BDBA 4E7NA 1K1MA 3RU4D 3FVFB 3SJ8A 3RM2H 3OTJE 2P8OC 2GV6A 2G4TA 1A1RA 4KTCA 2GCHG 1QB9A 1TQ7B 1A3EH 1RTFB 1NFXA 1UO6A 3HGNA 2R3UA 3A7XA 3ATMA 3E6PH 3SU1A 1GBFA 1C1VH 1VR1H 1O32A 1FV9A 1MD8A 3RLYH 2BZ6H 6LPRA 1SG8B 1GBJA 1GJ5H 4UDWH 4LZ1H 1UK3A 3SU2A 2GKVE 1YF4A 2CJIA 3EE0B 1KXBA 3GY8A 2XWBI 1MTNC 1YPHE 1HXEH 2GDEH 1V2LT 1BZXE 4DURA 2KAIB 3HK3B 3MH6A 3OY6U 4DT7B 1PYTC 2ZDMA 5A8ZA 2FESH 5DP5A 1DSTA 4DCDA 5EXLA 1KXAA 4UONA 2ZA5A 1QNJA 5JPMH 4GAWA 1EPTA 1W12U 1O3GA 1HB0B 3EA7A 1ORFA 4Q7XA 4A5TS 1GCTB 4AG1A 5GWZA 4AGKA 1O3EA 4ESTE 3LGIA 1MU8B 2BXTH 1WQSA 1O3OA 5PTPA 1Y3UA 4AFZA 4FUDA 2OC8A 2BB4A 4O3TA 1UTQA 4CR5A 1A0HB 1B7XB 2OP9A 3SJKA 2BVRH 3MOCA 1KTSB 3H7TA 1ESTA 4OGXA 1NRPH 2JH0D 1UVPA 1IQEA 5CMXH 1F0UA 1C5RA 1V2MT 6ESTA 4CBOA 2B8OH 4B2CA 1O36A 1TBRH 4GCHG 3CS0A 5DPAA 1GI5A 2P93A 1PPGE 1P11E 4ZHMU 5L6NH 1ZOMA 4FUBA 1ANDA 3UR6A 3PO1B 1GMCF 2BLOA 5C5NA 2Y5HA 3QX5H 4I8KA 2ZGXH 1TPAE 3V3MA 1C5XB 1SGTA 2EC9H 2XC5A 2VVUA 2G00A 3SGBE 4ZH8A 1OKXA 3UUZA 3ZVBA 2GMTB 2FIRH 4H42U 2JETC 4ZXYH 2J2UA 4WMEA 2VWNA 3L33A 2BM2A 2UUKB 4XOJA 1ZR0A 2ASUB 4UE7H 3WY8A 1ANEA 4MPWA 2GTBA 2TPIZ 3BTGE 2WINI 4I8JA 2DE9A 1BB0B 1GGDC 1CBWB 6CHAB 3DT0H 1G3EA 1C2JA 4NIVA 3S69A 1KXCA 1Z8GA 1DXPA 1RJXB 1AFQB 2FOHA 3P8NA 1ELEE 3FZDA 2BD9A 3PLBA 1IQHA 1EJMA 1T7CA 3P8GA 2ZGCA 1YPKH 1G32B 1A4WH 3MNXA 2XXLA 1O2OA 1CHGA 1S85A 2ZKSA 3GYMA 4GHQA 3RMOH 1C5WB 5J4QA 5EW1H 1ESBA 2WUBA 3IG6B 3GCTF 3MH5A 5AF9H 4NIYA 1PQ5A 3F68H 3ZZDA 3ESTA 5EG4A 3A8DA 3BTME 5EODA 3BIUH 1FN8A 3Q77A 2AIPA 3GCHC 1C5UA 1VJAU 1Z7KA 3MU5A 1LPKB 2PGQB 3EAJA 4B2AA 2TGAA 1JIMA 1O31A 3E90B 4HFPB 1ABJH 4X1QU 1EZXC 9ESTA 1EZSC 4VGCB 1AHTH 1A0LA 1TOCB 3TLOA 1E34B 2ZDKA 2FPZA 3V7TA 4XBCA 4ISHH 2O8UA 1LVMA 4INHA 1FY8E 8GCHG 3RDZA 1Y5AT 1KXEA 3OU0A 2C4FH 3NUMA 1GHXH 1MQ5A 3A85A 3FANA 2VVVA 1ZJKA 3M37A 2OXSA 1BTHH 2ZIQH 1K1OA 2FODA 5AHGH 3PROA 2YNAA 4B76A 2C8XB 1TPOA 1T8LA 3F9EA 1BBRK 1IHTH 2XBXA 3DFLA 2P16A 1C2DA 3LGWA 3M35A 2XBVA 3A84A 1BHXF 2ZFPH 1AVGH 4OS4A 4WMDA 2YNBA 4H6TA 4CRDA 3A7ZA 2NU4E 2Q6GA 1ZMLA 4NG9H 4K60A 1K28D 1O2IA 1LQDB 1G36A 1SQOA 1AD8H 4FUCA 1RD3B 1GVZA 4AG2A 4ABBA 3SNBA 5ESBA 1OWEA 2WPKS 5I46H 2J34A 2ZGBH 1P2OA 4UEHH 4AB8A 2UUYA 1S83A 3BG8A 2P94A 3PB1E 1OOKB 1HBTH 4U30A 1E36B 1LVYA 1OS8A 2G81E 2ZPSA 1GJ6A 3URDA 2P95A 3RXIA 1XM1A 2ULLA 2FYRA 3ELAH 3SI4H 5EPYA 3TGKE 2F9PA 1TPSA 3LIWA 1HJ8A 2FWWA 3EDXB 3FZZA 2Z3CA 1P05A 3E0NB 5JBCS 5CE1A 4FUIA 2FXRA 2ZFTA 1IHSH 2NWNA 4K2YA 1FONA 1C9TA 1G3CA 1BMNH 1SFQB 1QJ6B 3SV7A 3ZZAA 1D3DB 3HKJB 1V2ST 1ACBE 1C2KA 4A7IB 1OP8A 2V0BA 1IAUA 1TRNA 2ANWA 5EU8A 1Y3VA 1HAIH 2CV3A 2J9NA 4ZAEA 3FAOA 4BAHB 2SGAA 1U6QA 3KF2A 2QIQA 3GY2A 3MFJA 3ZZ7A 1ABIH 3MU0A 1BTWA 1A5HA 1TE0A 4Y79A 2ZU1A 1VCWA 1AVXA 1O2GH 2JH5D 3SU4A 1XXDA 3ITIA 4FU8A 4D9QA 5LPRA 4CRBA 1SGDE 1GBIA 4ABEA 3Q00A 1T4UH 1S0QA 4MDSA 4JK5A 1RXPA 3KHVA 2QXIA 2VIPA 3JZ1B 3HKIB 3ZVFA 2OCVB 1GMDF 2J4IA 1QBNA 3ZZ9A 2AERH 3EA9A 2H5DA 5IYTA 2BOHB 4H6SB 2RDLA 1FN6A 1WTHD 5BPEA 1GL0E 1HPGA 1O2LA 5A0BA 4MTBA 1YLDA 1BTYA 1KSNA 1EOLA 1VCPA 1G30B 1PPHE 4NGAH 4INLA 2VU8E 5JBAS 3TJUA 3S9AA 1P2MA 1HAZB 2C3SA 1GCTC 4LZ4B 2TGTA 1W3CA 2CF9H 1P04A 4HI3A 1EP5A 2ZF0H 2Y80A 1TX6A 4DOQA 2V6NA 2G51A 5JB9S 1F7ZA 1GJ8B 2EI8A 3A89A 1SBWA 2P3TB 1ZRBA 2LPRA 2QF0A 1V2OT 3GDUA 1KIGH 1EAIA 4XBBA 3FP7E 4GPGA 4ZKRU 1D3TB 5T6DA 1GMHF 2I6SA 1Z1JA 1O3DA 1C5PA 2HNTF 1HAVB 1KLTA 2SFAA 4WVPE 5AFYH 3UOUA 3ZZ5A 3RU4E 3A7VA 3FP6E 1H9IE 2LNCA 3RXJA 4U01A 1AB9B 1O3IA 1P9UA 1V2WT 2FZZA 2SGPE 3BEFB 1OYQA 1UCYH 4X0WU 7GCHG 1AWHB 1WU1A 4GHTA 3SORA 1C2EA 1MD7A 2GDDA 1CT2E 1ZHMA 1P57B 1UTJA 2HNTE 1O35A 3PO1C 1O2VA 3K2UA 1F0TA 2A1DB 2AMDA 2GD4B 4H4FA 2H1UA 3IWMA 3PMHB 4BOHA 1WBGB 4D7GA 4Y76A 1F2SE 1INCA 3VFEA 1ELAA 1DWEH 1BITA 3RXDA 2OINA 2AS9A 4FUHA 5TCCA 2W3KA 4BAOB 1EB1H 2GMTC 1C5VA 1QY6A 3SUEA 2ZU3A 3CS7A 4JZ1A 1Z6EA 1NO9H 1OPHB 1K1IA 3ATLA 2ZEBA 4AX9H 2J95A 4NFEA 1H9LB 1S84A 3Q3YA 3F9HA 1XUFA 3B23B 2PV9B 3TH2H 1BMAA 1CBWC 6CHAC 1ZMNA 3BN9A 1HAOH 1C5TA 1SGIB 1DLKB 3MNCA 1AFQC 1RIWB 3QTOH 1YLCA 3MTYA 1MKXH 1O2XA 1MKWH 1O2UA 2AGEX 1AO5A 1LDTT 3MU4A 1MTVA 5LGOA 2ALVA 1O38A 1SR5C 3U8RH 1FY3A 1ELVA 1LHCH 2J94A 4DGJA 2A2XH 1NFWA 2TIOA 1G9IE 4FUEA 3TK6A 3DFJA 1DT2A 1E35B 3K6ZA 2BD3A 1HJ9A 1K22H 1LHGH 5EOKA 9LPRA 5F6MA 1O39A 4NSVA 1OXGA 4J2YB 4ZMAH 2ZP0H 1UK4A 5TCAA 2A5KA 2H9EH 2XBYA 1O3AA 4FU9A 4Z0KA 1BRAA 4NSYA 2ZPRA 5FPSA 1ZLRA 2PWXA 1ELFA 1XMNB 1AIXH 1EASA 4D8NA 2W5EA 2WPMS 1V2KT 3STJA 4YM9A 4SGAE 5E8EH 2IOTA 1KDQB 4TWYA 3LGTA 1QR3E 1L1JA 1GL1A 1AQ7A 4Z6AH 3TJVA 3KQBA 4B71A 1GBLA 2ZU2A 1EB2A 4DW2U 1H9HE 3LT3A 1P02A 2PW8H 3L6PA 4FUJA 1WUNH 2OD3B 3A7TA 3GCNA 1CT0E 1ELTA 1RTLA 2ZHFH 2VWMA 5HMAA 5F8ZA 1BHXB 3H7OA 1O2MA 4AOQA 1W10U 3AAVA 4X6MA 1BIOA 5EGMA 1P3EA 1V2RT 5EPNA 4LK4A 4AORA 5GDSH 1GPZA 1W11U 1P0SH 3F9FA 1SGRE 3RXVA 1ZSJA 1VITF 1T8OA 4IBLH 3P17H 1GVLA 3DD2H 1C5MD 3P8OA 1C2LA 4TPYA 2B7DH 3BTTE 2ZDVH 1EKBB 3ZVAA 5C3NA 1JBUH 1CGHA 1TRMA 2RG3A 1CGJE 1AFEH 1AMHA 1V3XA 2F9OA 1ZTLA 3KN2A 3SGQE 1C1TA 1PQAA 3BEUA 1GJAB 2O8WA 3SI3H 1BA8B 4X8TH 1MCVA 1YP9A 3QLPH 2VNTA 4ISNA 1THPB 3RXUA 4YO9A 2ZZUH 1FUJA 1RTKA 3D49H 1HLTH 4PROA 2VWOA 1GI1A 2BY8X 1ZSLA 2UWPA 2UUFB 1EAUA 4KGAA 2FX6A 4IMZA 2VIDA 3GY6A 3LGUA 4NZQA 5FBEA 1TLDA 5L2ZH 2ZDLA 5C20A 3TK5A 3MH4A 1HGTH 1Y3XA 2BYAX 4ASHA 3GY4A 1PJPA 2BQ7B 2SNWA 2QF3A 2BLQA 1TALA 1P8VC 4A92A 3PYHA 1BRUP 1O2ZA 3TK9A 2CXVA 5CHAB 3W95A 1PFXC 4DIIH 3F6UH 2HOBA 3EGKH 1LKBA 1ZPBA 1YPHC 2AIQA 3E3TA 4CRCA 2A4RA 4ZXXH 3MMGA 4O97A 2Z7FE 2FOBA 2TGPZ 2CMYA 3P95A 2Y6TA 4X6NA 4B74A 4WJG2 1T8MA 4HTCH 3RMMH 2OC1A 3FFGA 1UVTH 1DSUA 1MZAA 3W94A 1GHAG 4X6PA 1QB6A 3SV8A 4TY7A 1J14A 1C2MA 5EW2H 1A5GH 1V2PT 1EJAA 3OY5U 4CH8B 3STIA 1T32A 4UD9H 4DG4A 1DOJA 2H9TH 3VEQB 1DPOA 4IS5A 3UREA 4OS6A 2F9NA 2VINA 3VGCB 3UQOA 1Z8JB 1GJ7B 2QAAA 3SHAH 1THRH 4X8VH 1YC0A 1TOMH 2ODYB 2AMPA 1GMDG 1XX9A 2JKHA 2WUCA 1FPHH 2TGDA 6GCHG 2B9LA 5ETXA 3M7QA 1ELGA 2W26A 1A7SA 1BTUA 1TGTA 3LPRA 5EQSA 2OQUA 5GIBA 3GDVA 2WV5A 2AEIH 1W0ZU 2V3HH 3UNRA 2O9QA 4K1TA 1AB9C 3QDZB 4WXVA 1BJVA 1W7GH 1BTXA 1CE5A 1G2MA 3GY7A 2YOLA 3R0FA 5GCHF 2BDHA 2HRVA 1NRSH 2WPIS 1NESE 1C2GA 3TNTA 1SGPE 5A8XA 1AGJA 1AVWA 2WYGA 3F1SB 4O03A 2BD8A 2C93B 4IMQA 1S6FA 2XRCA 5I25A 1GHBG 2GVFA 4RSPA 1BQYA 1GCDA 2Z9JA 1W7XH 3ZVEA 1ID5H 2EEKA 3KNXA 1C5LH 1O5AB 3C1KA 4CRFA 1LHDH 4I8HA 2O8MA 2ZECA 1BBRH 1HAXB 4J1YA 1ZHRA 2R0KA 1E0FD 2FS9A 1C2FA 2FYQA 2BVSH 2A45B 1N8OC 8KME2 1H1BA 2SGEE 3MH7A 1BMLA 5DP4A 1UJ1A 2NU3E 4CR9A 1ZPZA 3A8AA 4KP0A 5C1XA 4QT8C 3UPEA 4FVDA 4K1SA 1CHOF 1RIWC 2ZNKH 1GI6A 2A7CA 1MTWA 1FNIA 4XFQA 1ETRH 1TBZH 1XUIA 1F5KU 3BTQE 4OS5A 4YLQH 1PQ8A 2BDIA 2HVXA 1FMGA 1GI7B 1OYTH 1QCPA 2AGGX 5C1UA 3VPKA 1XVMA 1TMBH 2PSXA 1DX5M 2WPJS 1VGCB 2BDGA 2WYJA 1K1NA 2GGVB 1AKSA 5HM9A 1Q2WA 2OC7A 5C2ZA 3UWIA 1SB1H 4YOGA 1MTSA 4JZEH 3S7KB 1J9CH 1C1PA 1TNLA 1X7AC 2FOEA 2OC0A 3BTHE 3PTBA 4KTUA 5E2OA 3ATWA 4YOJA 1DS2E 5DK1A 3T5FH 5FCKA 3RP2A 5HXFA 3KIDU 4JZFH 1K9OE 1SGFG 5FXLA 4R0IA 2I6QA 1CT4E 3SU3A 2IN2A 2QV1A 4NIXA 1TMUH 3RXKA 1FPCH 1Z8RA 3ZVCA 4THNH 4MG3A 3B8JA 1FJSA 3DHKH 3VXFH 4RKOB 3K6YA 2ANKH 1A0JA 1GVKB 1QL8A 5L2YH 2FM2A 3PLKA 2GZ8A 3TNSA 3RXTA 1DUAA 7KMEH 3KGPA 2BD5A 2CGAA 1SI5H 4YZUA 4TY6A 3ZV8A 1FY5A 1CA8B 1PPCE 3GCOA 4U2WA 4CREA 4XDEA 3TH3H 2D8WA 1YPLH 2EI7A 4BTTB 3LC5A 3P8FA 4GUXA 2A2QH 3NKKA 3QO6A 5E0JA 1Q31A 1GHWH 1SSXA 1C5QA 4X6OA 5TJXA 1C1WH 2AH4X 3U9AH 5JB8S 1L1NA 1UMAH 5DO4H 2OUAA 2ZWLH 1LVOA 1XVOA 4FVBA 3MO6A 1O2HA 5B6OA 3RXEA 1BT7A 3O8DA 3Q3KA 3AAUA 1GJ9B 4E05H 2PKAB 1JXPA 4WF8A 4ZKOU 2FOAA 1Y5UT 1BRCE 4MNWA 4Q7ZA 1GG6B 3MO3A 1LKAA 3MI4A 3SHCH 3BF6H 1BCUH 1IQFA 2B5TB 2C8WB 2CF8H 4LXBH 3QTVH 3QUMP 3L3TA 3T2NA 1ZJDA 2RA0A 1HJAC 1O34A 1YGCH 3QZRA 2Y82A 3BV9B 2GCHF 1PYTD 2QYIA 3SUFA 2PFEA 2UUJB 3KQDA 3RXAA 3T62A 3S0NA 1PQ7A 1TNHA 1S6HA 4RKJB 2PKSB 1HUTH 2BY6X 2HPQH 3UIRA 1LTOA 5CHAC 1WCZA 2VWLA 3RC4A 3T26A 1UK2A 3QZQA 2F83A 4AFQA 4AN7A 1D3PB 2A5IA 4YOIA 1ARBA 3LKWA 2SNVA 1YCPM 4DY7B 1E38B 5DJ7A 5FCRA 2STAE 3D23A 1QRXA 4LOYH 1TQ0B 2AMQA 1ELBA 4JZIA 1JRTA 1W14U 3TGIE 4Q80A 2ZCHP 4BTUB 1GJDB 3SV6A 1LPZB 2Y5FA 2A0QB 2Z9IA 4Y0YE 5C1YA 1KY9A 4WXIA 1A61H 1DITH 1QL9A 2Y7ZA 3MHWU 1UHBA 1FAKH 1GBMA 2PR3A 3QN7A 1FAXA 3MU1A 3H5CB 1IQIA 1GDUA 4K69A 4KKDA 4D7FA 2O8TA 5A09A 4F4OC 1UVSH 5ABWA 2FOCA 2JH6D 1J17T 1W0YH 1OSSA 5JBTA 3A88A 4RN6A 1NS3A 1S5SA 4KTSA 1AE5A 2QCYA 4K3JA 4GCHF 1C9PA 2XWAA 3BG4B 1C5YB 2A4OA 4ZKNU 2BQWB 2HNTC 3SO3A 1Z71A 3QGJA 1F0RA 1ZPCA 3URCA 1SGNE 2FP7B 1WTGH 3RXCA 2A7JA 2SGFE 5A0CA 4X2XA 4A1VA 3NCLA 2Z9LA 1T8NA 3AASA 1W8BH 1EAXA 2ALPA 4SGBE 2FLRH 2XCFA 1TNKA 3RXPA 4XBDA 3V13A 2EI6A 3K9XB 4DIHH 1RFNA 5H4IB 3TVJB 1HAYB 2GT7A 4YLUA 7ESTE 1UVUH 4AYYB 3IITA 5FPYA 1GHZA 2W7SA 4IC6A 5F8TA 1PPFE 2ZGJA 5E2PA 1SHYA 1OWIA 1C1OA 3SU5A 3KQCA 3GY3A 2H5CA 2HPPH 5AFZH 1BBRE 1FIWA 3V12A 2PTCE 1S0RA 1TPPA 4X1RU 1SGQE 2VIOA 3BEIB 4GLYA 5FHTA 2PTNA 2ZDNA 1O2YA 3LC3A 2FTLE 1HV7A 4X2WA 1EPTB 2XYAA 1GMCG 2QGRA 2XCNA 1UTMA 4ABAA 4CRAA 4AYVB 3AW1A 1JOUB 3K65B 4WY3A 1MTUA 4JMYA 1T31A 2OQ5A 1O2WA 4I8LA 2A4QA 2ANYA 5GJ4B 1MU6B 2WV4A 1TA6A 3RMNH 4B2BA 3AW0A 1MZDA 5T3HA 1F92A 4MPXA 4X1PU 1GGDB 2BMGB 1P2NA 1HAPH 1MAXA 1LO6A 1TRYA 1O3BA 1TB6H 1FQ3A 4MQAA 1EUFA 1N1LA 1VGCC 2G8TA 1LQEA 3ATIA 2BD4A 3T28A 1UTPA 2O8LA 1TGBA 3G01A 3SQEE 2BHGA 1TABE 2ZDAH 3HPTB 8GCHF 3A80A 3B9FH 4X2YA 2BX3A 4ZHAA 3DUXH 4VGCC 1CSOE 1C4Y2 3SJIA 1QBOA 1GWAA 4O9VA 1NRNH 3VB4A 2WPHS 1FZZA 1KLJH 1XKAC 2B0FA 4ISOA 4UFGH 1ESAA 4X8SH 2GZ9A 2ZHQH 4CRGA 1L0ZA 4ISLA 3ZZ4A 3RC5A 1GBHA 2Z9GA 1SLXB 3RXSA 3U8OH 2QA9E 2R9PA 3SUDA 1EATA 1EXFA 1C2IA 3GCTG 1NROH 1O5DH 2A31A 2XBWA 4HZHA 4ZHLU 2Y5GA 4ZROA 1GJ4H 1JWTA 1W13U 3U98H 1V2UT 1G2LA 2BTCE 4DJZB 1EP6A 5F8XA 3I77A 1ZTKA 1C1QA 2CN0H 3LDXH 4TWWA 4FU7A 3LGVA 1C5OH 2STBE 4MNYA 2ZO3H 5E0HA 1EAWA 1P12E 1KXFA 1TX7A 1UTNA 2ODQA 2FDAA 2Q1JA 4FXGH 5HGGA 1ANBA 1PPEE 4ZUHA 1P01A 2UWOA 3RXRA 1TGNA 1G3BA 2PGBB 1IQMA 1C1UH 1C4U2 1F5RA 3M7UA 3M3TA 3SV9A 1QJ1B 1RRKA 1WV7H 3KCGH 3LH1A 2Z3DA 3UWJH 1GI4A 1LHFH 5GXPA 1FLEE 3QWCH 5EQQA 2ZU5A 2AGIX 1QA0A 3T27A 2ZCKP 1H8DH 2W3IA 3TGJE 1NRQH 2K1QA 3UTUH 1AKSB 3ZVGA 3UFAA 2ZGHA 2HALA 2PLXA 3M5NA 1O2QA 3BTWE 1GG6C 4R8TB 3ATKA 3TH4H 1WSSH 1TX8A 3A82A 1D6RA 1ETSH 3M3SA 3SNDA 4WH8A 2ZI2H 4ABDA 2R0LA 1O0DH 2Z6BD 4A1TA 2F9VA 2F9BH 2RCEA 2R2MB 1HRTH 1XUKA 4AFSA 1O3NA 3PWBA 4OS7A 1UTLM 1WOFA 1BJUA 4IN2A 3M61U 1NPMA 1QA7A 5DP7A 1HIAA 2FO9A 2PKSC 1PPBH 4B1TA 3EQ0H 5K0HA 1SGEE 3UR9A 2XNIA 3SV2H 1TGCA 5DP8A 2V3OH 1P3CA 1CGIE 2FOMB 2BLWA 3RXOA 1D9IA 2TRMA 1MUEB 4K1EA 1Y5BT 1HAVA 3TITA 3S9CA 4IN1A 1YBWA 1GI2A 1T4VH 4ABJA 3BTDE 2VJ1A 3LJOA 2PSYA 3PMBB 4IGDA 4I31A 4Y7AA 4NA9H 4DVAU 1GI0A 4GVUA 4Y10E 1LHEH 1LVBA 3D65E 1P06A 2CHAB 2D1JA 2QXHA 1ZMJA 4AFUA 1K2I1 1DM4B 2BD2A 4MVNA 4NWLA 1H8IH 1GHYH 1AI8H 1NRRH 1V2VT 4I32A 1GI9B 3KEEA 2J92A 3SW2B 1DY9A 3RXBA 3U69H 4D76A 4ABGA 1JIRA 5ESTE 1FY4A 1YPJH 3BG4C 3LONA 7GCHF 1SHHB 4K8BA 2OBOA 2ZFRH 4Y8XA 1GBCA 5DP3A 3GDSA 1XXFA 1C5ZB 4ABIA 2A5AA 3Q76A 1CVWH 2ILNA 5LPFA 2A32A 2V35A 1PPZA 1SGCA 2J38A 1OP0A 1DDJA 4YT7H 1UCYE 2AFQB 3RXQA 3ZZ8A 1O5CB 4KELA 2FLBH 1QB1A 1GHVH 1QIXB 2BZAA 5T6GA 3C27B 4ZKSU 4CHAB 1P10A 2ESTE 1BOQA 2BD7A 3GICB 3A8BA 1SPJA 3PWCA 2VH0A 2Z9KA 3CENA 3I29A 5G4BA 3ZV9A 1S82A 3RU4T 2P3FH 1P2IA 1HAHH 4NA7A 5L30H 5C5OA 1GMHG 1O2SA 4NIWA 1TWXB 1CA0B 2XTTB 3S7HB 2BX4A 5JBBS 1SQAA 2SGQE 2HWLB 4MNXA 1O2RA 1IQJA 2GZ7A 1OWKA 2FOGA 2FMJA 2VIWA 2OLGA 1BMMH 4BXWA 4K8YA 5SGAE 1UHBB 8ESTE 1FXYA 1ELDE 3U1IB 1EPTC 4Q7YA 3ZYEA 1KDQA 1YCPH 1MQ6A 1C1SA 1K1JA 1UVOA 3SBKA 1NM6A 1Z8IB 4D9RA 4Y11E 3OX7U 2BQ6B 5F03A 8LPRA 1SLUB 2M5TA 1GBAA 3EYDA 1DFPA 1JRSA 1UTKA 2QN5T 2C90B 1MAYA 3O8BA 3SJ9A 5IDKA 2FS8A 1FIZA 4X2VA 2XC0A 4AGJA 1SQTA 3ZVDA 2ZU4A 1Y3YA 2NU0E 3UOPA 3NPSA 2GT8A 3V0XA 5A8YA 3RMLH 5K7RA 4X1NU 4F49A 2Z3EA 1OWHA 2QXJA 1D3QB 1C5NH 4YESB 4JCNA 1CQQA 2ZHDA 1IQGA 2Y81A 1Y59T 2ZQ2A 1GBTA 1QRZA 2R3YA 2ZHEH 3D62A 1MMJN 2QC2A 3E16B 1DLEA 1SGYE 3SOSA 1IQKA 1QBVH 1QURH 2BY9X 1OWJA 3T29A 4M7GA 1O5BB 1GBEA 3SNEA 2HGTH 4NFFA 3RXLA 1AUTC 1BDAA 1O3LA 3PM3A 3NZIA 2OTVA 1E37B 5HM2A 1F0SA 1MBQA 1XKBC 3RM0H 1HAGE 4MPUA 1G3DA 1TNIA 3LJJA 3SNAA 3TU7H 4BAQB 3NWUA 1QFKH 2A7HA 3O8CA 1NFYA 1K21H 1Y8TA 1QTFA 2C8YB 2VB0A 3T25A 1YCPK 5T6FA 3P6ZB 2GCTB 4WMFA 1Z1IA 1GBKA 4MNVA 3ZYDA 3MNSA 1O2KA 4INKA 2IPHA 1A2CH 1P2QA 1CO7E 1WAYB 3HK6B 4UFFH 3GYLB 3A7WA 2ZPQA 1N6XA 4FUGA 1LMWB 1BTZA 1G37A 3BIVH 3TIUA 2TBSA 5FAHA 5EQRA 5FPTA 1O37A 4WWYA 4A6LA 1C2HA 3LH3A 1QQUA 3ZZCA 4OS1A 1GJCB 4MPVA 1NFUA 1V2TT 1J16A 2G5VA 3SUGA 2HLCA 4JK6A 2KAIA 3A8CA 3UNSA 1L4DA 2ZQ1A 1DWCH 3DA9B 3BTKE 3VXEH 4TYDA 4ISIH 3MU8A 4Y6DA 4JYVH 1VITG 1VITH 4I33A 3OSYA 4YT6H 2ODPA 3U1JB 2XC4A 3NXPA 1LCYA 1ZTJA 5BRRE 1A3BH 1DE7H 1BRBE 2SGDE 2DUCA 1XUJA 5FBIA 1NU9A 4Y71A 4UFEH 1TGSZ 2ZFSA 1S81A 3RXHA 3MYWA 3N7OA 4WH6A 1SOTA 2FI4E 2VVCA 1C1NA 2VGCB 2R2WU 3ODFA 1BTPA 2D26C 1JMOH 1HXFH 1BUIA 2VH6A 1TYNA 2P59A 1Q3XA 1IQLA 1YPMH 1SL3A 1P9SA 1ZZZA 1UTOA 1GHAF 4Y0ZE 1EJNA 1HDTH 1RS0A 4NZLA 1EQ9A 1O5GH 4BTIB 5EXNA 3VB6A 1AUJA 1HFDA 1ZRKA 2P8OB 1V6DA 3EA8A 1O2NA 1QJ7B 2ZFFH 1O2PA 2VIQA 1K1LA 1TMTH 3SNCA 2GP9B 1W2KH 1YPEH 1TIOA 3MWIU 1SVPA 3P92A 1ARCA 2BXUH 3R3GB 1L2EA 2G55A 3ENSB 1NTPA 3PV4A 1YKTA 3A7YA 1DWBH 1O3PB 1QGFA 3RC6A 1V2JT 1MTNB 3CP7A 4CH2B 2CHAC 3SN8A 1GBBA 1P2KA 5GPIB 1L4ZA 1A46H 6GCHF 1SMFE 2ZTYA 2FOFA 3VGCC 1DICA 1TFXA 2BDAA 1B5GH 2IJOB 2BY5X 1P03A 3RLWH 1YPGH 1SC8U 3UQVA 1AU8A 3I78A 1EZQA 4AB9A 1AE8H 3SU0A 1FDPA 2FEQH 1GJBB 1LPGB 3RXMA 2XW9A 2AYWA 1DVAH 2BDYA 4Y8ZA 2VIVA 1THSH 1OP2A 5DP9A 1NT1A 1SGFA 1HIAB 1TNGA 4ABHA 3M3VA 1O2JA 1GHBF 1TONA 3M5OA 4U32A 4MLFB 3RXGA 1F5LA 3E8LA 5DP6A 3LOXA 2H2ZA 3HATH 1YM0A 1H4WA 2A4GA 5JYIA 1HNEE 4CHAC 2Q6DA 3FP8E 3E91A 1DXWA 3NK8A 3AVZA 1QL7A 3RXFA 1L1GA 2EA3A 4GSOA 4Y8YA 1XUGA 1NN6A 5DKMA 1P2JA 3KL6A 2NU2E 2GV7A 1GI3A 4Q2KA 1P09A 1CA0C 1HCGA 3F9GA 2THFB 4IW4E 1O3MA 1O30A 5J4SA 2ZFQH 2BY7X 4NCYA 3GISB 2Y7XA 1GI8B 5A2MH 1C5SA 1NZQH 3OYPA 2QY0B 1TAWA 3U8TH 5GCHG 1RGQA 1NY22 2UWLA 4IC5A 2JETB 3ZZ6A 2C8ZB 3MO9A 1J15A 2G5NA 1YYY1 4BAMB 1N8OB 1D6WA 3A81A 1AY6H 1O5FH 2PUQH 3QGNB 1C4V2 1ETTH 2ZCLP 1Z6JH 1XUHA 1O33A 2H9HA 1EX3A 3E0PB 2RA3A 4E7RG 1K1PA 1ZGIA 3PLPA 2WPLS 4K5ZA 1C1MA 3M36A 2ANMH 4B75A 1O3FA 2NU1E 2F91A 4I8GA 2BVXH 5HYOA 3LGYA 4BANB 3LU9B 1GDNA 4BNRA 2G52A 3UY9A 5DG6A 3GOVB 1AWFH 1KLIH 1CHOG 1DANH 5LPEA 2BOKA 1IQNA 1WQVH 3A86A 1SLWB 2W7UA 1FI8A 2PKAA 3PMJA 2QXGA 1VZQH 3GCHB 1QQ4A 1TNJA 5DGJA 5AVDA 1UCYK 1MCTA 2FTMA 3S9BA 1MH0A 4UFDH 1HYLA 4X8UH 3UNQA 1VJ9U 4JZDH 1OWDA 1O2TA 4Y7BA 1CU1A 3PTNA 3VB7A 4BXSA 1N6YA 2BDCA 3SU6A 1V2QT 2Q6FA 1TBQH 1TA2A 3SJOA 1WYKA 1NU7B 2GX4A 4JYUH 1ZHPA 1M9UA 4XSKU 1KTTB 2GCTC 3PMAB 2BLVA 2G4UA 3TJOA 2F3CE 1QHRB 1V2NT 3VB5A 3ZZ3A 1B0FA 1B0EA 1O3CA 1GBDA 2PUXB 5LH8A 4A1XA 1D4PB 1DUEA 1MBMA 4FUFA 1GDQA 3BTEE 1C1RA 1DY8A 7LPRA 2OBQA 3Q3XA 1EZUC 2ZG0H 2FI3E 3TJNA 1KXDA 4ABFA 5E0GA 1ANCA 3BSQA 4E06H 3P70B 3M7TA 2ZTZA 3SQHE 1VCQA 3HGPA 3E1XB 1QRWA 2ZC9H 3MNBA 4HGCA 1O3JA 4OS2A 4X1SU 4B73A 1KYNA 3ODDA 4NWKA 4CBNA 1Y3WA 1MKXK 2F9UA 3A87A 4TPIZ 3ZZBA 1AN1E 5A0AE 1MKWK 2DE8A 2ZHWH 3KQEA 1DWDH 2P3UB 1A5IA 4JYTA 1SFIA 3BTFE 5EXMA 5C67A 5JDUB 1ELCA 2PHBA 1OX1A 1EOJA 4YTAA 3GY5A 1IOEA 3SGAE 1NC6A 3VB3A 3QK1A 2FX4A
chains in the Genus database with same CATH superfamily
2H6MA 4XE4A 2Z94A 2ZTXA 1ZYOA 1SOZA 2VGCC 1O3KA 4I7YH 3A83A 4OGYA 1E1QD 2D2DA 2FI5E 3M5LA 3SZNA 3TPIZ 4BAKB 1ZSKA 1O5EH 1HJAB 2KM0A 4O3UA 1ZGVA 1SLVB 3M5MA 5C0TA 1FY1A 4AZ2B 3RUOA 4NA8A 1AZ8A 1AZZA 1J8AA 1O3HA 5FX6A 3O8RA 3JZ2B 5FX5A 2BDBA 4E7NA 1K1MA 3RU4D 3FVFB 3SJ8A 3RM2H 3WWFA 3OTJE 2P8OC 2GV6A 2G4TA 1A1RA 4KTCA 2GCHG 1QB9A 1TQ7B 1A3EH 1RTFB 4Q4LA 1NFXA 1UO6A 3HGNA 2R3UA 3A7XA 3ATMA 3E6PH 3SU1A 1E79D 1GBFA 1C1VH 1VR1H 1O32A 1FV9A 1MD8A 3RLYH 2BZ6H 6LPRA 1SG8B 1GBJA 1GJ5H 4UDWH 4LZ1H 1UK3A 3SU2A 2GKVE 1YF4A 2CJIA 3EE0B 1KXBA 3GY8A 2XWBI 4RT1A 1MTNC 1YPHE 1HXEH 2GDEH 1V2LT 1BZXE 4DURA 2KAIB 3HK3B 3MH6A 3OY6U 4DT7B 1PYTC 2ZDMA 5A8ZA 2FESH 5DP5A 2W6JD 1DSTA 4DCDA 5EXLA 1KXAA 4UONA 2ZA5A 1QNJA 5JPMH 4GAWA 1EPTA 1W12U 1O3GA 1HB0B 3KYFA 3EA7A 1ORFA 4Q7XA 4A5TS 3W1EA 1GCTB 4AG1A 5GWZA 4AGKA 5EJ1A 1O3EA 4ESTE 3LGIA 1MU8B 2BXTH 1WQSA 1O3OA 5PTPA 1NBMD 1Y3UA 4AFZA 5EIYA 4FUDA 2OC8A 2BB4A 4O3TA 1UTQA 4CR5A 1A0HB 1B7XB 2OP9A 3SJKA 2BVRH 3MOCA 1KTSB 3FKSD 3H7TA 1ESTA 4OGXA 1NRPH 2JH0D 1UVPA 1IQEA 5CMXH 1F0UA 1C5RA 1V2MT 6ESTA 4CBOA 2B8OH 4B2CA 1O36A 1TBRH 4GCHG 3CS0A 5DPAA 1GI5A 2P93A 1PPGE 1P11E 4ZHMU 5L6NH 1ZOMA 4FUBA 1ANDA 3UR6A 3PO1B 1GMCF 2BLOA 5C5NA 2Y5HA 3QX5H 4I8KA 2ZGXH 1TPAE 1COWD 3V3MA 1C5XB 1SGTA 2EC9H 2XC5A 2VVUA 2G00A 3SGBE 4ZH8A 1OKXA 3UUZA 4AC9A 3ZVBA 2GMTB 2FIRH 4H42U 2JETC 5T1VA 2KX4A 4ZXYH 2J2UA 4WMEA 5CHBA 2VWNA 3L33A 2BM2A 2UUKB 4XOJA 1ZR0A 2ASUB 4UE7H 3WY8A 1ANEA 4MPWA 2GTBA 2TPIZ 3BTGE 2WINI 4I8JA 2DE9A 1BB0B 1GGDC 1CBWB 6CHAB 3DT0H 1G3EA 1C2JA 4NIVA 3S69A 1KXCA 1Z8GA 1DXPA 1RJXB 1AFQB 4RT0A 2FOHA 3P8NA 1ELEE 3FZDA 2BD9A 3PLBA 1IQHA 1EJMA 1T7CA 3P8GA 2ZGCA 1YPKH 1G32B 1A4WH 3MNXA 2XXLA 1O2OA 1CHGA 1S85A 2ZKSA 3GYMA 4GHQA 3RMOH 1C5WB 5J4QA 5EW1H 1ESBA 2WUBA 3IG6B 3GCTF 3MH5A 5AF9H 4NIYA 1PQ5A 3F68H 3ZZDA 3ESTA 5EG4A 3A8DA 3BTME 5EODA 3BIUH 1FN8A 3Q77A 2AIPA 3GCHC 1C5UA 1VJAU 1Z7KA 3MU5A 1LPKB 2PGQB 3EAJA 4B2AA 2TGAA 1JIMA 1O31A 3E90B 4HFPB 1ABJH 4X1QU 1EZXC 9ESTA 1EZSC 4VGCB 1AHTH 1A0LA 1TOCB 3TLOA 1E34B 2ZDKA 2FPZA 3PRDA 3V7TA 4XBCA 4ISHH 2O8UA 1LVMA 4INHA 1FY8E 8GCHG 3RDZA 1Y5AT 1KXEA 3OU0A 2C4FH 3NUMA 1GHXH 1MQ5A 3A85A 3FANA 2VVVA 1ZJKA 3M37A 2OXSA 1BTHH 2ZIQH 1K1OA 2FODA 5AHGH 3PROA 2YNAA 4B76A 2C8XB 1TPOA 1T8LA 3F9EA 1BBRK 1IHTH 2XBXA 3DFLA 4P02A 2P16A 1C2DA 3LGWA 3M35A 2XBVA 1YLNA 3A84A 1BHXF 2ZFPH 1AVGH 4OS4A 4WMDA 2YNBA 4H6TA 4CRDA 3A7ZA 2NU4E 2Q6GA 1ZMLA 4NG9H 4K60A 1K28D 1O2IA 1LQDB 1G36A 1SQOA 1AD8H 4FUCA 1RD3B 1GVZA 4AG2A 4ABBA 3SNBA 5ESBA 1OWEA 2WPKS 5I46H 2J34A 2ZGBH 1P2OA 4UEHH 4AB8A 2UUYA 1S83A 3BG8A 2P94A 3PB1E 1OOKB 1HBTH 4U30A 1E36B 1LVYA 1OS8A 2G81E 2ZPSA 3F2FA 1GJ6A 1QZ8A 1SKYE 3URDA 2P95A 3RXIA 1XM1A 2ULLA 2FYRA 3ELAH 3SI4H 2HVYB 5EPYA 3TGKE 3UAIC 2F9PA 1TPSA 3LIWA 1HJ8A 2FWWA 3EDXB 3FZZA 2Z3CA 1P05A 3E0NB 5JBCS 5CE1A 4FUIA 2FXRA 2ZFTA 1IHSH 2NWNA 4K2YA 1FONA 1C9TA 1G3CA 1BMNH 1OHHD 1QJ6B 1SFQB 3OAAD 2JIZD 3SV7A 3ZZAA 1D3DB 2IJD1 3HKJB 1V2ST 1ACBE 1C2KA 4A7IB 1OP8A 2V0BA 1IAUA 1TRNA 2ANWA 5EU8A 1Y3VA 1HAIH 2CV3A 2J9NA 4ZAEA 3FAOA 4BAHB 2SGAA 1U6QA 3KF2A 2QIQA 3GY2A 3U28C 3MFJA 3ZZ7A 1ABIH 3MU0A 1BTWA 1A5HA 1TE0A 4Y79A 2ZU1A 1VCWA 1AVXA 1O2GH 2JDID 2JH5D 3SU4A 2YMSD 1KMHB 1XXDA 3ITIA 4FU8A 4D9QA 5LPRA 4CRBA 1SGDE 1GBIA 4ABEA 3Q00A 1T4UH 1S0QA 4MDSA 4JK5A 1RXPA 2KCPA 3KHVA 2QXIA 2VIPA 3JZ1B 3HKIB 3ZVFA 2OCVB 1GMDF 2J4IA 1QBNA 3ZZ9A 2AERH 3EA9A 2H5DA 5IYTA 2BOHB 4H6SB 2RDLA 1FN6A 1WTHD 5BPEA 1GL0E 1HPGA 1O2LA 5A0BA 4MTBA 2XNDD 1YLDA 1BTYA 1KSNA 1EOLA 1VCPA 1G30B 1PPHE 4NGAH 4INLA 1K0HA 2VU8E 5JBAS 3TJUA 3S9AA 1P2MA 1HAZB 2C3SA 1GCTC 4LZ4B 2TGTA 1W3CA 2CF9H 5C94A 1P04A 4HI3A 1EP5A 2ZF0H 2Y80A 1TX6A 4DOQA 2V6NA 2G51A 5JB9S 1F7ZA 1GJ8B 2EI8A 3A89A 1SBWA 2P3TB 1ZRBA 2LPRA 2QF0A 1V2OT 3GDUA 1KIGH 1EAIA 4XBBA 3FP7E 4GPGA 4ZKRU 1D3TB 5T6DA 1GMHF 2I6SA 1Z1JA 2HNTF 1O3DA 1C5PA 1HAVB 1KLTA 2SFAA 4WVPE 5AFYH 1EFRD 3UOUA 3ZZ5A 3RU4E 3A7VA 3FP6E 1H9IE 2LNCA 3RXJA 4U01A 1AB9B 1O3IA 1P9UA 1V2WT 2FZZA 2SGPE 3BEFB 2V7QD 1OYQA 1UCYH 4X0WU 7GCHG 1AWHB 1WU1A 2KFWA 4GHTA 3SORA 1C2EA 1MD7A 2GDDA 1CT2E 1ZHMA 1P57B 1UTJA 2HNTE 1O35A 3PO1C 1O2VA 3K2UA 1F0TA 2A1DB 2AMDA 2GD4B 4H4FA 2H1UA 3IWMA 3PMHB 4BOHA 1WBGB 4D7GA 4Y76A 1F2SE 1INCA 3VFEA 1ELAA 1DWEH 1BITA 3RXDA 2OINA 2AS9A 1YWUA 4FUHA 5TCCA 2W3KA 4BAOB 1EB1H 2GMTC 1C5VA 1QY6A 3SUEA 2ZU3A 3CS7A 4JZ1A 1Z6EA 1H8ED 1NO9H 1OPHB 1K1IA 3ATLA 2ZEBA 4AX9H 2J95A 4NFEA 1H9LB 1S84A 3Q3YA 3F9HA 1XUFA 3B23B 2PV9B 4FOUC 3TH2H 1BMAA 1CBWC 6CHAC 1ZMNA 3BN9A 1HAOH 1C5TA 1SGIB 1DLKB 3MNCA 1AFQC 1RIWB 3QTOH 3UB0A 1YLCA 3MTYA 1MKXH 3OEED 2KCYA 1NBME 1O2XA 1MKWH 1O2UA 2AGEX 1AO5A 1LDTT 3MU4A 1MTVA 5LGOA 2ALVA 1O38A 1SR5C 3U8RH 1FY3A 1ELVA 1LHCH 2J94A 4DGJA 2A2XH 1NFWA 2TIOA 1G9IE 4FUEA 3TK6A 3DFJA 1DT2A 1E35B 3K6ZA 2BD3A 1HJ9A 1K22H 1LHGH 5EOKA 9LPRA 5F6MA 1O39A 4NSVA 1OXGA 4J2YB 4ZMAH 2ZP0H 1UK4A 5TCAA 2A5KA 2H9EH 2XBYA 1O3AA 4FU9A 4Z0KA 1BRAA 4NSYA 2ZPRA 5FPSA 1ZLRA 2PWXA 1ELFA 1XMNB 1AIXH 1EASA 4D8NA 2W5EA 2WPMS 1V2KT 3STJA 4YM9A 4SGAE 5E8EH 2IOTA 1KDQB 4TWYA 3LGTA 1QR3E 1L1JA 1GL1A 1AQ7A 4Z6AH 3TJVA 3KQBA 3F0PA 4B71A 4YXWD 1GBLA 2ZU2A 1EB2A 4DW2U 1H9HE 3LT3A 1P02A 2PW8H 3L6PA 4FUJA 1WUNH 2OD3B 3A7TA 3GCNA 1CT0E 1ELTA 1RTLA 4P00A 2ZHFH 2VWMA 5HMAA 1WDIA 5F8ZA 1BHXB 3H7OA 1O2MA 4AOQA 1W10U 3AAVA 4X6MA 5EJZA 1BIOA 5EGMA 1P3EA 1V2RT 5EPNA 4LK4A 4AORA 5GDSH 1GPZA 1W11U 1P0SH 3F9FA 1SGRE 3RXVA 1ZSJA 1VITF 1T8OA 4IBLH 3P17H 1GVLA 3DD2H 1C5MD 3P8OA 1C2LA 4TPYA 2B7DH 3BTTE 2ZDVH 1EKBB 3ZVAA 5C3NA 1JBUH 1CGHA 1TRMA 2RG3A 1CGJE 1AFEH 1AMHA 1V3XA 2F9OA 1ZTLA 3KN2A 3SGQE 3EE7A 1C1TA 1PQAA 3BEUA 1GJAB 2O8WA 3SI3H 1BA8B 4X8TH 1MCVA 1YP9A 3QLPH 2VNTA 4ISNA 1THPB 5B6LA 3RXUA 4YO9A 2ZZUH 1FUJA 1RTKA 3D49H 1HLTH 4PROA 2VWOA 1GI1A 2BY8X 1ZSLA 2UWPA 2UUFB 1EAUA 4KGAA 2FX6A 4IMZA 2VIDA 3GY6A 3LGUA 4NZQA 5FBEA 1TLDA 5L2ZH 2ZDLA 5C20A 3TK5A 1H8HD 2BYAX 1HGTH 1Y3XA 3MH4A 4ASHA 3GY4A 1PJPA 2BQ7B 2SNWA 2QF3A 2BLQA 1TALA 1P8VC 4A92A 3PYHA 1BRUP 1O2ZA 3DSOA 3TK9A 2CXVA 5CHAB 3W95A 1PFXC 4DIIH 3F6UH 2HOBA 3EGKH 1LKBA 1ZPBA 1YPHC 2AIQA 3E3TA 2F4LA 4CRCA 2A4RA 4ZXXH 3MMGA 4O97A 2Z7FE 2FOBA 2TGPZ 2CMYA 3P95A 2Y6TA 4X6NA 4B74A 4WJG2 1T8MA 4HTCH 3RMMH 2OC1A 3FFGA 1UVTH 1DSUA 1MZAA 3W94A 1GHAG 4X6PA 1QB6A 3SV8A 4TY7A 1J14A 1C2MA 5EW2H 4B6EA 1A5GH 1V2PT 1EJAA 3OY5U 4CH8B 3STIA 1T32A 4UD9H 4DG4A 1DOJA 3FO8D 2H9TH 3VEQB 1DPOA 4IS5A 3UREA 4OS6A 2F9NA 2VINA 3VGCB 3UQOA 2J98B 1Z8JB 1GJ7B 2QAAA 3SHAH 1THRH 3SZEA 4X8VH 1YC0A 1TOMH 2ODYB 2AMPA 1GMDG 1XX9A 2JKHA 2WUCA 1FPHH 2TGDA 6GCHG 2B9LA 3CNRA 5ETXA 3M7QA 1ELGA 2W26A 1A7SA 1BTUA 1TGTA 3LPRA 5EQSA 2OQUA 5GIBA 3GDVA 2WV5A 2AEIH 1W0ZU 2V3HH 3UNRA 2O9QA 4K1TA 1AB9C 3QDZB 4WXVA 1BJVA 1W7GH 1BTXA 1CE5A 1G2MA 3GY7A 1UW7A 2YOLA 3R0FA 5GCHF 2BDHA 2HRVA 1NRSH 2WPIS 1NESE 1C2GA 4I86A 1SGPE 3TNTA 5A8XA 1AGJA 1AVWA 2WYGA 4M9FA 3F1SB 4O03A 2BD8A 2C93B 4IMQA 1S6FA 2XRCA 5I25A 1GHBG 2GVFA 4RSPA 1BQYA 1GCDA 2WV9A 2Z9JA 3SYJA 1W7XH 3ZVEA 1ID5H 2EEKA 3KNXA 1C5LH 1O5AB 3C1KA 4CRFA 1LHDH 4I8HA 2O8MA 2ZECA 1BBRH 1HAXB 4J1YA 1ZHRA 2R0KA 1E0FD 2FS9A 1C2FA 2FYQA 2BVSH 2A45B 1N8OC 8KME2 1H1BA 2SGEE 2CK3D 3MH7A 3H09A 1BMLA 5DP4A 1UJ1A 2NU3E 4CR9A 1ZPZA 3A8AA 4KP0A 5C1XA 4QT8C 3UPEA 4FVDA 4K1SA 1CHOF 2RFKC 1RIWC 2ZNKH 1GI6A 2A7CA 1MTWA 1FNIA 4XFQA 1ETRH 1TBZH 1XUIA 4Q63A 1F5KU 2K0QA 3BTQE 4OS5A 4YLQH 1PQ8A 2BDIA 2HVXA 1FMGA 1GI7B 2J97A 1OYTH 1QCPA 2AGGX 5C1UA 3VPKA 1XVMA 1TMBH 2PSXA 1DX5M 2WPJS 1VGCB 2BDGA 3OE7D 2WYJA 2KZ4A 1K1NA 2GGVB 1AKSA 5HM9A 1Q2WA 2OC7A 5C2ZA 3UWIA 1SB1H 3DSPA 4YOGA 1MTSA 4JZEH 3S7KB 1J9CH 1C1PA 1TNLA 1X7AC 2FOEA 2OC0A 3BTHE 3PTBA 4KTUA 5E2OA 3ATWA 4YOJA 1DS2E 5DK1A 3T5FH 5FCKA 3RP2A 5HXFA 3KIDU 4JZFH 1K9OE 1SGFG 5FXLA 5KEDA 4R0IA 2I6QA 1CT4E 2K8IA 3SU3A 2IN2A 2QV1A 4NIXA 1TMUH 3PV2A 3RXKA 1FPCH 1Z8RA 3ZVCA 4THNH 4MG3A 3B8JA 1FJSA 3DHKH 3VXFH 4RKOB 3K6YA 2ANKH 1A0JA 1GVKB 1QL8A 5L2YH 2FM2A 3PLKA 2GZ8A 3TNSA 5HIYA 1DUAA 3RXTA 7KMEH 3KGPA 2BD5A 2CGAA 1SI5H 4YZUA 4TY6A 3ZV8A 1FY5A 1CA8B 1PPCE 3GCOA 4U2WA 4CREA 4XDEA 3TH3H 2D8WA 1YPLH 2EI7A 4BTTB 3LC5A 3P8FA 4GUXA 5KECA 2A2QH 3NKKA 3GS9A 3QO6A 5E0JA 1Q31A 1GHWH 1SSXA 1C5QA 4X6OA 5TJXA 1C1WH 2AH4X 3U9AH 5JB8S 1L1NA 1UMAH 5DO4H 2OUAA 2ZWLH 1LVOA 1XVOA 4ACBA 4FVBA 3MO6A 1O2HA 5B6OA 3RXEA 1BT7A 3O8DA 3Q3KA 3AAUA 1GJ9B 4E05H 2PKAB 1JXPA 4WF8A 4ZKOU 2FOAA 1Y5UT 1BRCE 4MNWA 4Q7ZA 1GG6B 3MO3A 1LKAA 3MI4A 3SHCH 5CDFE 3BF6H 1BCUH 1IQFA 4XD7D 2B5TB 2C8WB 2CF8H 4LXBH 3QTVH 3QUMP 3L3TA 3T2NA 1ZJDA 2L74A 2RA0A 1HJAC 1O34A 1YGCH 3QZRA 2Y82A 3BV9B 2GCHF 1PYTD 2QYIA 2PP6A 3SUFA 2PFEA 2UUJB 3KQ5A 3KQDA 3RXAA 3T62A 3S0NA 1PQ7A 1TNHA 1S6HA 4RKJB 2PKSB 3OFND 1HUTH 2BY6X 2HPQH 3UIRA 1LTOA 5DSFA 5CHAC 1WCZA 2VWLA 3RC4A 3T26A 1UK2A 3QZQA 2F83A 4AFQA 4AN7A 1D3PB 2A5IA 4YOIA 1ARBA 3LKWA 2SNVA 1YCPM 4DY7B 1E38B 5DJ7A 5FCRA 2STAE 3D23A 4F48B 1QRXA 4LOYH 1TQ0B 2AMQA 1ELBA 4JZIA 1JRTA 1W14U 3TGIE 4Q80A 2ZCHP 4BTUB 1GJDB 3SV6A 1LPZB 2Y5FA 2A0QB 2Z9IA 4Y0YE 5C1YA 1E1RD 1KY9A 4WXIA 1A61H 1DITH 1QL9A 2Y7ZA 3MHWU 1UHBA 1FAKH 1GBMA 2PR3A 5HIZA 3QN7A 1FAXA 4HG6A 3MU1A 3H5CB 1IQIA 1GDUA 4K69A 4KKDA 4D7FA 2O8TA 5A09A 4F4OC 1UVSH 5ABWA 2FOCA 2JH6D 3DSGA 1J17T 1W0YH 1OSSA 5JBTA 3A88A 4RN6A 1NS3A 1S5SA 4KTSA 1AE5A 2QCYA 4K3JA 4GCHF 1C9PA 2XWAA 3BG4B 1C5YB 2A4OA 4ZKNU 2YMSB 2BQWB 2HNTC 3SO3A 1Z71A 3QGJA 1F0RA 1ZPCA 4XRNA 3URCA 1SGNE 2FP7B 1WTGH 3RXCA 2A7JA 2SGFE 5A0CA 4X2XA 4A1VA 3NCLA 2Z9LA 1T8NA 3AASA 1W8BH 1EAXA 2ALPA 4SGBE 2FLRH 2XCFA 1TNKA 4Z1MD 3RXPA 4XBDA 3V13A 2EI6A 3K9XB 4DIHH 1RFNA 5H4IB 3TVJB 1HAYB 1VKYA 2GT7A 4YLUA 1UVUH 7ESTE 4AYYB 3IITA 5FPYA 1GHZA 2W7SA 4IC6A 5F8TA 1PPFE 2ZGJA 5E2PA 1W0JD 1SHYA 1OWIA 1C1OA 2JJ1D 3SU5A 3KQCA 3GY3A 2H5CA 2HPPH 5AFZH 1BBRE 1FIWA 3V12A 2PTCE 1S0RA 1TPPA 4X1RU 1SGQE 2VIOA 3BEIB 4GLYA 5FHTA 2PTNA 2ZDNA 2QF4A 5IK2D 1O2YA 3LC3A 2FTLE 1HV7A 4X2WA 1EPTB 5C0UA 2XYAA 1GMCG 2QGRA 2XCNA 1UTMA 4ABAA 4CRAA 4AYVB 3AW1A 1JOUB 3K65B 4FETA 4WY3A 1MTUA 4JMYA 1T31A 2OQ5A 1O2WA 4I8LA 2A4QA 2ANYA 5GJ4B 2QF5A 1MU6B 2WV4A 1TA6A 3RMNH 4B2BA 3AW0A 1MZDA 5T3HA 1F92A 4MPXA 4X1PU 1GGDB 2BMGB 1P2NA 1HAPH 1MAXA 1LO6A 1TRYA 1O3BA 1TB6H 1FQ3A 4MQAA 1EUFA 3N7DA 1N1LA 1VGCC 4TSFD 2G8TA 1LQEA 3ATIA 2BD4A 3T28A 1UTPA 2O8LA 1TGBA 3G01A 3SQEE 2BHGA 1TABE 2ZDAH 3WW7A 3HPTB 8GCHF 3A80A 3B9FH 4X2YA 2BX3A 4ZHAA 3DUXH 4VGCC 1CSOE 1C4Y2 3SJIA 1QBOA 1GWAA 4O9VA 1NRNH 3VB4A 2WPHS 1FZZA 1KLJH 1XKAC 2B0FA 4ISOA 4UFGH 1ESAA 4X8SH 2GZ9A 2ZHQH 4CRGA 1L0ZA 4ISLA 2IPQX 3ZZ4A 3RC5A 1GBHA 1YY3A 1SLXB 2Z9GA 3OEHD 2QA9E 5FL7D 2R9PA 3RXSA 3U8OH 3SUDA 1EATA 1EXFA 1C2IA 3GCTG 1NROH 1O5DH 2A31A 2XBWA 4HZHA 4ZHLU 2Y5GA 4ZROA 1GJ4H 1JWTA 1W13U 3U98H 1V2UT 1G2LA 2BTCE 4DJZB 1EP6A 5F8XA 3I77A 1ZTKA 1C1QA 2CN0H 3LDXH 4TWWA 2WPDD 4FU7A 3LGVA 1C5OH 2STBE 4MNYA 2ZO3H 5E0HA 1EAWA 1P12E 1KXFA 1TX7A 1UTNA 2ODQA 2FDAA 2Q1JA 4FXGH 5HGGA 1ANBA 1PPEE 4ZUHA 1P01A 2UWOA 3RXRA 1TGNA 1G3BA 1WXRA 2PGBB 1IQMA 1C1UH 1C4U2 1F5RA 3M7UA 3F3BA 3M3TA 3SV9A 1QJ1B 1RRKA 1WV7H 3KCGH 5HKKD 3LH1A 2Z3DA 3UWJH 1GI4A 1LHFH 5GXPA 1FLEE 3QWCH 5EQQA 2ZU5A 2AGIX 1QA0A 2VBCA 3T27A 2ZCKP 1H8DH 2W3IA 3TGJE 1NRQH 2K1QA 3UTUH 1AKSB 3ZVGA 3UFAA 2ZGHA 2HALA 2PLXA 3M5NA 1O2QA 3BTWE 1GG6C 4R8TB 3ATKA 3TH4H 1WSSH 1S6LA 1TX8A 3A82A 1D6RA 1ETSH 3M3SA 3SNDA 4WH8A 2ZI2H 4ABDA 2R0LA 1O0DH 2Z6BD 4A1TA 2F9VA 2F9BH 2RCEA 2R2MB 1HRTH 2LP6A 1XUKA 4AFSA 1O3NA 3PWBA 2GJGA 4OS7A 1UTLM 1WOFA 1BJUA 4IN2A 3M61U 1NPMA 1QA7A 5DP7A 3F2GA 1HIAA 5C17A 2FO9A 2PKSC 1PPBH 4B1TA 3EQ0H 5K0HA 1SGEE 3UR9A 2XNIA 3SV2H 1TGCA 5DP8A 2V3OH 1P3CA 1CGIE 2FOMB 2BLWA 3RXOA 1D9IA 2TRMA 1MUEB 4K1EA 1Y5BT 1HAVA 3TITA 3S9CA 4IN1A 1YBWA 5DN6D 4F55A 1GI2A 1T4VH 4ABJA 3BTDE 2VJ1A 3LJOA 2PSYA 3PMBB 4IGDA 4I31A 4Y7AA 4NA9H 4DVAU 1GI0A 4GVUA 4Y10E 1LHEH 1LVBA 3D65E 1P06A 2CHAB 2D1JA 2QXHA 1ZMJA 4AFUA 1K2I1 1DM4B 2BD2A 4MVNA 4NWLA 1H8IH 1GHYH 3PV5A 1AI8H 1NRRH 4ACAA 1V2VT 4I32A 1GI9B 3KEEA 3FN8A 2J92A 3SW2B 1DY9A 3RXBA 3ZIAD 3U69H 4D76A 4ABGA 1JIRA 5ESTE 1FY4A 1YPJH 3BG4C 3LONA 7GCHF 1SHHB 2YMSC 4K8BA 2OBOA 2ZFRH 4Y8XA 1GBCA 5DP3A 3N99A 3GDSA 1XXFA 1C5ZB 4ABIA 2A5AA 3Q76A 1CVWH 2ILNA 5LPFA 2A32A 2V35A 1PPZA 1SGCA 2J38A 1OP0A 1DDJA 4YT7H 1UCYE 2AFQB 3RXQA 3ZZ8A 1O5CB 4KELA 2XOKD 2FLBH 1QB1A 1GHVH 1QIXB 2BZAA 3N7EA 5T6GA 3C27B 4ZKSU 4CHAB 1P10A 2ESTE 1BOQA 2BD7A 3GICB 3A8BA 1SPJA 3PWCA 2VH0A 2Z9KA 3CENA 3I29A 5G4BA 3ZV9A 1S82A 3RU4T 2P3FH 1P2IA 1HAHH 4NA7A 5L30H 5C5OA 1GMHG 1O2SA 4NIWA 1TWXB 1CA0B 2XTTB 3S7HB 2BX4A 5JBBS 1SQAA 2SGQE 2HWLB 4MNXA 5EJLA 1O2RA 1IQJA 2GZ7A 1OWKA 2FOGA 2FMJA 2OK5A 2VIWA 2OLGA 1BMMH 4BXWA 4K8YA 5SGAE 1UHBB 8ESTE 1FXYA 1ELDE 3U1IB 1EPTC 4Q7YA 3ZYEA 1KDQA 1YCPH 1MQ6A 1C1SA 1K1JA 1UVOA 3SBKA 1NM6A 1Z8IB 4D9RA 4Y11E 3OX7U 2BQ6B 5F03A 8LPRA 1SLUB 2M5TA 1GBAA 3EYDA 1DFPA 2LELA 1JRSA 1UTKA 2QN5T 2C90B 1MAYA 3O8BA 3SJ9A 5IDKA 2WZQA 2FS8A 3KYGA 1FIZA 4X2VA 2XC0A 4AGJA 1SQTA 3ZVDA 2ZU4A 1Y3YA 2NU0E 3UOPA 3NPSA 2GT8A 3V0XA 5A8YA 3RMLH 5K7RA 4X1NU 3NRLA 4F49A 2Z3EA 1OWHA 2QXJA 1D3QB 1C5NH 4YESB 4JCNA 1CQQA 2ZHDA 1IQGA 2Y81A 1Y59T 2ZQ2A 1GBTA 1QRZA 3DCLA 2R3YA 2ZHEH 3D62A 2F43B 1MMJN 2QC2A 3E16B 1DLEA 1SGYE 3SOSA 1IQKA 1SQRA 1QBVH 1QURH 2BY9X 1OWJA 3T29A 4M7GA 1O5BB 1GBEA 3SNEA 2HGTH 4NFFA 3RXLA 1AUTC 1BDAA 1O3LA 3PM3A 3NZIA 2OTVA 1E37B 5HM2A 1F0SA 1MBQA 1XKBC 5GNDA 3RM0H 1HAGE 3F2HA 4MPUA 1G3DA 1TNIA 3LJJA 3SNAA 3TU7H 4BAQB 3NWUA 1QFKH 2A7HA 3O8CA 1NFYA 3OTPA 1K21H 1Y8TA 1QTFA 2C8YB 2VB0A 3T25A 2M2AA 1YCPK 5T6FA 4DT4A 3P6ZB 2GCTB 4WMFA 1Z1IA 1GBKA 4MNVA 3ZYDA 3MNSA 1O2KA 4INKA 2IPHA 1A2CH 1P2QA 1CO7E 1WAYB 3HK6B 4UFFH 3GYLB 3A7WA 2ZPQA 1N6XA 4FUGA 1LMWB 1BTZA 1G37A 3BIVH 3TIUA 2TBSA 5FAHA 5EQRA 5FPTA 1O37A 4WWYA 4A6LA 1C2HA 3LH3A 1QQUA 3ZZCA 4OS1A 1GJCB 4MPVA 1NFUA 1V2TT 1J16A 2KCAA 2G5VA 3SUGA 2HLCA 4JK6A 2KAIA 3A8CA 3UNSA 1L4DA 2ZQ1A 1DWCH 3DA9B 3BTKE 3VXEH 4TYDA 4ISIH 3MU8A 4Y6DA 4JYVH 1VITG 1VITH 4I33A 3OSYA 4YT6H 2ODPA 3U1JB 1W0KD 2XC4A 3NXPA 5KGOA 1LCYA 1ZTJA 5BRRE 1A3BH 1DE7H 1BRBE 2SGDE 2DUCA 4OM9A 1XUJA 5FBIA 1NU9A 4Y71A 2QE7D 4UFEH 1TGSZ 2ZFSA 1S81A 3RXHA 3MYWA 3N7OA 4WH6A 1SOTA 2J98A 2FI4E 2VVCA 1C1NA 2KCOA 2VGCB 2R2WU 3ODFA 1BTPA 2D26C 1JMOH 1HXFH 1BUIA 2VH6A 1TYNA 2P59A 1Q3XA 1IQLA 1YPMH 2W6ID 2HLDD 1SL3A 1P9SA 1ZZZA 1UTOA 1GHAF 4Y0ZE 1EJNA 2RDEA 3F0OA 1HDTH 1RS0A 4NZLA 1EQ9A 1O5GH 4BTIB 5EXNA 3VB6A 1AUJA 1HFDA 1ZRKA 2J5UA 2P8OB 1V6DA 3EA8A 1O2NA 1QJ7B 2ZFFH 1O2PA 2VIQA 1K1LA 1TMTH 3SNCA 2GP9B 1W2KH 1YPEH 1TIOA 3MWIU 1SVPA 3P92A 1ARCA 2BXUH 3R3GB 1L2EA 2G55A 3ENSB 1NTPA 3FOAA 3PV4A 1YKTA 1FX0B 3A7YA 1DWBH 1O3PB 1QGFA 3RC6A 1V2JT 3VG8A 1MTNB 3CP7A 4CH2B 2CHAC 3SN8A 1GBBA 1P2KA 5GPIB 1L4ZA 1A46H 4B6FA 6GCHF 1SMFE 2ZTYA 2FOFA 3VGCC 1DICA 1TFXA 2BDAA 1B5GH 2IJOB 2BY5X 1P03A 3RLWH 2EQNA 1YPGH 3AK5A 1SC8U 3UQVA 1AU8A 3I78A 1EZQA 4AB9A 1AE8H 3SU0A 1FDPA 2FEQH 1GJBB 1LPGB 3RXMA 2XW9A 2AYWA 1DVAH 2BDYA 2WHXA 4Y8ZA 2VIVA 1THSH 1OP2A 1BMFD 5DP9A 1NT1A 1SGFA 1HIAB 1TNGA 4ABHA 3M3VA 1O2JA 4RI0A 1GHBF 1TONA 3M5OA 4U32A 4MLFB 3RXGA 2WSSD 1F5LA 3E8LA 5DP6A 3LOXA 2EY4C 2H2ZA 3HATH 1YM0A 1H4WA 2A4GA 5F53A 5JYIA 1HNEE 4CHAC 2Q6DA 3FP8E 3E91A 1DXWA 3NK8A 3AVZA 1QL7A 3RXFA 1L1GA 2EA3A 4GSOA 4Y8YA 1XUGA 1NN6A 5DKMA 1P2JA 3KL6A 2NU2E 2GV7A 1GI3A 4Q2KA 2L6OA 1P09A 1CA0C 1HCGA 3F9GA 2THFB 4IW4E 1O3MA 1O30A 5J4SA 2ZFQH 2BY7X 4NCYA 3GISB 3WWBA 2Y7XA 1GI8B 5A2MH 1C5SA 1NZQH 3OYPA 2QY0B 1TAWA 3U8TH 5GCHG 1RGQA 1NY22 2UWLA 4IC5A 2JETB 3ZZ6A 2C8ZB 3MO9A 1J15A 2G5NA 1YYY1 4TT3D 4BAMB 1N8OB 1D6WA 3A81A 1AY6H 1O5FH 2PUQH 3QGNB 1C4V2 1ETTH 2ZCLP 1Z6JH 1XUHA 1O33A 2H9HA 1EX3A 3E0PB 2RA3A 4E7RG 1K1PA 1ZGIA 3PLPA 2WPLS 4K5ZA 1C1MA 3M36A 4ASUD 2ANMH 4B75A 1O3FA 2NU1E 2F91A 4I8GA 2BVXH 5HYOA 3LGYA 4BANB 4ZCNA 3LU9B 1GDNA 4BNRA 2G52A 3UY9A 5DG6A 3GOVB 1AWFH 1KLIH 1CHOG 1DANH 5LPEA 2BOKA 1IQNA 1WQVH 3A86A 1SLWB 2W7UA 1FI8A 2PKAA 3PMJA 2QXGA 1VZQH 3GCHB 1QQ4A 1TNJA 5DGJA 5AVDA 1UCYK 1MCTA 2FTMA 3S9BA 1MH0A 4UFDH 1HYLA 4X8UH 3UNQA 1VJ9U 4JZDH 1OWDA 1O2TA 4Y7BA 1CU1A 3PTNA 3VB7A 4BXSA 1N6YA 2BDCA 3SU6A 1V2QT 2Q6FA 1TBQH 1TA2A 2V3MA 3SJOA 1WYKA 1NU7B 2GX4A 4JYUH 1ZHPA 1M9UA 4XSKU 1KTTB 1MABB 2GCTC 3PMAB 2BLVA 2G4UA 3TJOA 2F3CE 1QHRB 1V2NT 3VB5A 3ZZ3A 1B0FA 1B0EA 1O3CA 2JJ2D 1GBDA 2PUXB 5LH8A 4A1XA 1D4PB 1DUEA 1MBMA 4FUFA 1GDQA 3BTEE 1C1RA 1DY8A 7LPRA 2OBQA 3Q3XA 1EZUC 2ZG0H 2FI3E 3TJNA 1KXDA 4ABFA 5E0GA 1ANCA 3BSQA 4E06H 3P70B 3M7TA 2ZTZA 3PRBA 3SQHE 1VCQA 2KR7A 3HGPA 3E1XB 1QRWA 2ZC9H 3MNBA 4HGCA 1O3JA 4OS2A 4X1SU 4B73A 1KYNA 3ODDA 4NWKA 4CBNA 1Y3WA 1MKXK 2F9UA 3A87A 4TPIZ 3ZZBA 1AN1E 2AHME 5A0AE 1MKWK 3MQKC 2DE8A 2ZHWH 3KQEA 1DWDH 2P3UB 1A5IA 4JYTA 1SFIA 3BTFE 5EXMA 5C67A 5JDUB 1ELCA 2PHBA 1OX1A 1EOJA 4YTAA 3GY5A 1IOEA 3SGAE 1NC6A 3VB3A 3QK1A 2FX4A
chains in the Genus database with same CATH topology
2H6MA 4XE4A 2Z94A 2ZTXA 1ZYOA 1SOZA 2VGCC 1O3KA 4I7YH 3A83A 4OGYA 2D2DA 2FI5E 3M5LA 3SZNA 3TPIZ 4BAKB 1ZSKA 1O5EH 1HJAB 4O3UA 1ZGVA 1SLVB 3M5MA 1FY1A 4AZ2B 3RUOA 4NA8A 1AZ8A 1AZZA 1J8AA 1O3HA 5FX6A 3O8RA 3JZ2B 5FX5A 2BDBA 4E7NA 1K1MA 3RU4D 3FVFB 3SJ8A 3RM2H 3OTJE 2P8OC 2GV6A 2G4TA 1A1RA 4KTCA 2GCHG 1QB9A 1TQ7B 1A3EH 1RTFB 1NFXA 1UO6A 3HGNA 2R3UA 3A7XA 3ATMA 3E6PH 3SU1A 1GBFA 1C1VH 1VR1H 1O32A 1FV9A 1MD8A 3RLYH 2BZ6H 6LPRA 1SG8B 1GBJA 1GJ5H 4UDWH 4LZ1H 1UK3A 3SU2A 2GKVE 1YF4A 2CJIA 3EE0B 1KXBA 3GY8A 2XWBI 1MTNC 1YPHE 1HXEH 2GDEH 1V2LT 1BZXE 4DURA 2KAIB 3HK3B 3MH6A 3OY6U 4DT7B 1PYTC 2ZDMA 5A8ZA 2FESH 5DP5A 1DSTA 4DCDA 5EXLA 1KXAA 4UONA 2ZA5A 1QNJA 5JPMH 4GAWA 1EPTA 1W12U 1O3GA 1HB0B 3EA7A 1ORFA 4Q7XA 4A5TS 1GCTB 4AG1A 5GWZA 4AGKA 1O3EA 4ESTE 3LGIA 1MU8B 2BXTH 1WQSA 1O3OA 5PTPA 1Y3UA 4AFZA 4FUDA 2OC8A 2BB4A 4O3TA 1UTQA 4CR5A 1A0HB 1B7XB 2OP9A 3SJKA 2BVRH 3MOCA 1KTSB 3H7TA 1ESTA 4OGXA 1NRPH 2JH0D 1UVPA 1IQEA 5CMXH 1F0UA 1C5RA 1V2MT 6ESTA 4CBOA 2B8OH 4B2CA 1O36A 1TBRH 4GCHG 3CS0A 5DPAA 1GI5A 2P93A 1PPGE 1P11E 4ZHMU 5L6NH 1ZOMA 4FUBA 1ANDA 3UR6A 3PO1B 1GMCF 2BLOA 5C5NA 2Y5HA 3QX5H 4I8KA 2ZGXH 1TPAE 3V3MA 1C5XB 1SGTA 2EC9H 2XC5A 2VVUA 2G00A 3SGBE 4ZH8A 1OKXA 3UUZA 3ZVBA 2GMTB 2FIRH 4H42U 2JETC 4ZXYH 2J2UA 4WMEA 2VWNA 3L33A 2BM2A 2UUKB 4XOJA 1ZR0A 2ASUB 4UE7H 3WY8A 1ANEA 4MPWA 2GTBA 2TPIZ 3BTGE 2WINI 4I8JA 2DE9A 1BB0B 1GGDC 1CBWB 6CHAB 3DT0H 1G3EA 1C2JA 4NIVA 3S69A 1KXCA 1Z8GA 1DXPA 1RJXB 1AFQB 2FOHA 3P8NA 1ELEE 3FZDA 2BD9A 3PLBA 1IQHA 1EJMA 1T7CA 3P8GA 2ZGCA 1YPKH 1G32B 1A4WH 3MNXA 2XXLA 1O2OA 1CHGA 1S85A 2ZKSA 3GYMA 4GHQA 3RMOH 1C5WB 5J4QA 5EW1H 1ESBA 2WUBA 3IG6B 3GCTF 3MH5A 5AF9H 4NIYA 1PQ5A 3F68H 3ZZDA 3ESTA 5EG4A 3A8DA 3BTME 5EODA 3BIUH 1FN8A 3Q77A 2AIPA 3GCHC 1C5UA 1VJAU 1Z7KA 3MU5A 1LPKB 2PGQB 3EAJA 4B2AA 2TGAA 1JIMA 1O31A 3E90B 4HFPB 1ABJH 4X1QU 1EZXC 9ESTA 1EZSC 4VGCB 1AHTH 1A0LA 1TOCB 3TLOA 1E34B 2ZDKA 2FPZA 3V7TA 4XBCA 4ISHH 2O8UA 1LVMA 4INHA 1FY8E 8GCHG 3RDZA 1Y5AT 1KXEA 3OU0A 2C4FH 3NUMA 1GHXH 1MQ5A 3A85A 3FANA 2VVVA 1ZJKA 3M37A 2OXSA 1BTHH 2ZIQH 1K1OA 2FODA 5AHGH 3PROA 2YNAA 4B76A 2C8XB 1TPOA 1T8LA 3F9EA 1BBRK 1IHTH 2XBXA 3DFLA 2P16A 1C2DA 3LGWA 3M35A 2XBVA 3A84A 1BHXF 2ZFPH 1AVGH 4OS4A 4WMDA 2YNBA 4H6TA 4CRDA 3A7ZA 2NU4E 2Q6GA 1ZMLA 4NG9H 4K60A 1K28D 1O2IA 1LQDB 1G36A 1SQOA 1AD8H 4FUCA 1RD3B 1GVZA 4AG2A 4ABBA 3SNBA 5ESBA 1OWEA 2WPKS 5I46H 2J34A 2ZGBH 1P2OA 4UEHH 4AB8A 2UUYA 1S83A 3BG8A 2P94A 3PB1E 1OOKB 1HBTH 4U30A 1E36B 1LVYA 1OS8A 2G81E 2ZPSA 1GJ6A 3URDA 2P95A 3RXIA 1XM1A 2ULLA 2FYRA 3ELAH 3SI4H 5EPYA 3TGKE 2F9PA 1TPSA 3LIWA 1HJ8A 2FWWA 3EDXB 3FZZA 2Z3CA 1P05A 3E0NB 5JBCS 5CE1A 4FUIA 2FXRA 2ZFTA 1IHSH 2NWNA 4K2YA 1FONA 1C9TA 1G3CA 1BMNH 1SFQB 1QJ6B 3SV7A 3ZZAA 1D3DB 3HKJB 1V2ST 1ACBE 1C2KA 4A7IB 1OP8A 2V0BA 1IAUA 1TRNA 2ANWA 5EU8A 1Y3VA 1HAIH 2CV3A 2J9NA 4ZAEA 3FAOA 4BAHB 2SGAA 1U6QA 3KF2A 2QIQA 3GY2A 3MFJA 3ZZ7A 1ABIH 3MU0A 1BTWA 1A5HA 1TE0A 4Y79A 2ZU1A 1VCWA 1AVXA 1O2GH 2JH5D 3SU4A 1XXDA 3ITIA 4FU8A 4D9QA 5LPRA 4CRBA 1SGDE 1GBIA 4ABEA 3Q00A 1T4UH 1S0QA 4MDSA 4JK5A 1RXPA 3KHVA 2QXIA 2VIPA 3JZ1B 3HKIB 3ZVFA 2OCVB 1GMDF 2J4IA 1QBNA 3ZZ9A 2AERH 3EA9A 2H5DA 5IYTA 2BOHB 4H6SB 2RDLA 1FN6A 1WTHD 5BPEA 1GL0E 1HPGA 1O2LA 5A0BA 4MTBA 1YLDA 1BTYA 1KSNA 1EOLA 1VCPA 1G30B 1PPHE 4NGAH 4INLA 2VU8E 5JBAS 3TJUA 3S9AA 1P2MA 1HAZB 2C3SA 1GCTC 4LZ4B 2TGTA 1W3CA 2CF9H 1P04A 4HI3A 1EP5A 2ZF0H 2Y80A 1TX6A 4DOQA 2V6NA 2G51A 5JB9S 1F7ZA 1GJ8B 2EI8A 3A89A 1SBWA 2P3TB 1ZRBA 2LPRA 2QF0A 1V2OT 3GDUA 1KIGH 1EAIA 4XBBA 3FP7E 4GPGA 4ZKRU 1D3TB 5T6DA 1GMHF 2I6SA 1Z1JA 1O3DA 1C5PA 2HNTF 1HAVB 1KLTA 2SFAA 4WVPE 5AFYH 3UOUA 3ZZ5A 3RU4E 3A7VA 3FP6E 1H9IE 2LNCA 3RXJA 4U01A 1AB9B 1O3IA 1P9UA 1V2WT 2FZZA 2SGPE 3BEFB 1OYQA 1UCYH 4X0WU 7GCHG 1AWHB 1WU1A 4GHTA 3SORA 1C2EA 1MD7A 2GDDA 1CT2E 1ZHMA 1P57B 1UTJA 2HNTE 1O35A 3PO1C 1O2VA 3K2UA 1F0TA 2A1DB 2AMDA 2GD4B 4H4FA 2H1UA 3IWMA 3PMHB 4BOHA 1WBGB 4D7GA 4Y76A 1F2SE 1INCA 3VFEA 1ELAA 1DWEH 1BITA 3RXDA 2OINA 2AS9A 4FUHA 5TCCA 2W3KA 4BAOB 1EB1H 2GMTC 1C5VA 1QY6A 3SUEA 2ZU3A 3CS7A 4JZ1A 1Z6EA 1NO9H 1OPHB 1K1IA 3ATLA 2ZEBA 4AX9H 2J95A 4NFEA 1H9LB 1S84A 3Q3YA 3F9HA 1XUFA 3B23B 2PV9B 3TH2H 1BMAA 1CBWC 6CHAC 1ZMNA 3BN9A 1HAOH 1C5TA 1SGIB 1DLKB 3MNCA 1AFQC 1RIWB 3QTOH 1YLCA 3MTYA 1MKXH 1O2XA 1MKWH 1O2UA 2AGEX 1AO5A 1LDTT 3MU4A 1MTVA 5LGOA 2ALVA 1O38A 1SR5C 3U8RH 1FY3A 1ELVA 1LHCH 2J94A 4DGJA 2A2XH 1NFWA 2TIOA 1G9IE 4FUEA 3TK6A 3DFJA 1DT2A 1E35B 3K6ZA 2BD3A 1HJ9A 1K22H 1LHGH 5EOKA 9LPRA 5F6MA 1O39A 4NSVA 1OXGA 4J2YB 4ZMAH 2ZP0H 1UK4A 5TCAA 2A5KA 2H9EH 2XBYA 1O3AA 4FU9A 4Z0KA 1BRAA 4NSYA 2ZPRA 5FPSA 1ZLRA 2PWXA 1ELFA 1XMNB 1AIXH 1EASA 4D8NA 2W5EA 2WPMS 1V2KT 3STJA 4YM9A 4SGAE 5E8EH 2IOTA 1KDQB 4TWYA 3LGTA 1QR3E 1L1JA 1GL1A 1AQ7A 4Z6AH 3TJVA 3KQBA 4B71A 1GBLA 2ZU2A 1EB2A 4DW2U 1H9HE 3LT3A 1P02A 2PW8H 3L6PA 4FUJA 1WUNH 2OD3B 3A7TA 3GCNA 1CT0E 1ELTA 1RTLA 2ZHFH 2VWMA 5HMAA 5F8ZA 1BHXB 3H7OA 1O2MA 4AOQA 1W10U 3AAVA 4X6MA 1BIOA 5EGMA 1P3EA 1V2RT 5EPNA 4LK4A 4AORA 5GDSH 1GPZA 1W11U 1P0SH 3F9FA 1SGRE 3RXVA 1ZSJA 1VITF 1T8OA 4IBLH 3P17H 1GVLA 3DD2H 1C5MD 3P8OA 1C2LA 4TPYA 2B7DH 3BTTE 2ZDVH 1EKBB 3ZVAA 5C3NA 1JBUH 1CGHA 1TRMA 2RG3A 1CGJE 1AFEH 1AMHA 1V3XA 2F9OA 1ZTLA 3KN2A 3SGQE 1C1TA 1PQAA 3BEUA 1GJAB 2O8WA 3SI3H 1BA8B 4X8TH 1MCVA 1YP9A 3QLPH 2VNTA 4ISNA 1THPB 3RXUA 4YO9A 2ZZUH 1FUJA 1RTKA 3D49H 1HLTH 4PROA 2VWOA 1GI1A 2BY8X 1ZSLA 2UWPA 2UUFB 1EAUA 4KGAA 2FX6A 4IMZA 2VIDA 3GY6A 3LGUA 4NZQA 5FBEA 1TLDA 5L2ZH 2ZDLA 5C20A 3TK5A 3MH4A 1HGTH 1Y3XA 2BYAX 4ASHA 3GY4A 1PJPA 2BQ7B 2SNWA 2QF3A 2BLQA 1TALA 1P8VC 4A92A 3PYHA 1BRUP 1O2ZA 3TK9A 2CXVA 5CHAB 3W95A 1PFXC 4DIIH 3F6UH 2HOBA 3EGKH 1LKBA 1ZPBA 1YPHC 2AIQA 3E3TA 4CRCA 2A4RA 4ZXXH 3MMGA 4O97A 2Z7FE 2FOBA 2TGPZ 2CMYA 3P95A 2Y6TA 4X6NA 4B74A 4WJG2 1T8MA 4HTCH 3RMMH 2OC1A 3FFGA 1UVTH 1DSUA 1MZAA 3W94A 1GHAG 4X6PA 1QB6A 3SV8A 4TY7A 1J14A 1C2MA 5EW2H 1A5GH 1V2PT 1EJAA 3OY5U 4CH8B 3STIA 1T32A 4UD9H 4DG4A 1DOJA 2H9TH 3VEQB 1DPOA 4IS5A 3UREA 4OS6A 2F9NA 2VINA 3VGCB 3UQOA 1Z8JB 1GJ7B 2QAAA 3SHAH 1THRH 4X8VH 1YC0A 1TOMH 2ODYB 2AMPA 1GMDG 1XX9A 2JKHA 2WUCA 1FPHH 2TGDA 6GCHG 2B9LA 5ETXA 3M7QA 1ELGA 2W26A 1A7SA 1BTUA 1TGTA 3LPRA 5EQSA 2OQUA 5GIBA 3GDVA 2WV5A 2AEIH 1W0ZU 2V3HH 3UNRA 2O9QA 4K1TA 1AB9C 3QDZB 4WXVA 1BJVA 1W7GH 1BTXA 1CE5A 1G2MA 3GY7A 2YOLA 3R0FA 5GCHF 2BDHA 2HRVA 1NRSH 2WPIS 1NESE 1C2GA 3TNTA 1SGPE 5A8XA 1AGJA 1AVWA 2WYGA 3F1SB 4O03A 2BD8A 2C93B 4IMQA 1S6FA 2XRCA 5I25A 1GHBG 2GVFA 4RSPA 1BQYA 1GCDA 2Z9JA 1W7XH 3ZVEA 1ID5H 2EEKA 3KNXA 1C5LH 1O5AB 3C1KA 4CRFA 1LHDH 4I8HA 2O8MA 2ZECA 1BBRH 1HAXB 4J1YA 1ZHRA 2R0KA 1E0FD 2FS9A 1C2FA 2FYQA 2BVSH 2A45B 1N8OC 8KME2 1H1BA 2SGEE 3MH7A 1BMLA 5DP4A 1UJ1A 2NU3E 4CR9A 1ZPZA 3A8AA 4KP0A 5C1XA 4QT8C 3UPEA 4FVDA 4K1SA 1CHOF 1RIWC 2ZNKH 1GI6A 2A7CA 1MTWA 1FNIA 4XFQA 1ETRH 1TBZH 1XUIA 1F5KU 3BTQE 4OS5A 4YLQH 1PQ8A 2BDIA 2HVXA 1FMGA 1GI7B 1OYTH 1QCPA 2AGGX 5C1UA 3VPKA 1XVMA 1TMBH 2PSXA 1DX5M 2WPJS 1VGCB 2BDGA 2WYJA 1K1NA 2GGVB 1AKSA 5HM9A 1Q2WA 2OC7A 5C2ZA 3UWIA 1SB1H 4YOGA 1MTSA 4JZEH 3S7KB 1J9CH 1C1PA 1TNLA 1X7AC 2FOEA 2OC0A 3BTHE 3PTBA 4KTUA 5E2OA 3ATWA 4YOJA 1DS2E 5DK1A 3T5FH 5FCKA 3RP2A 5HXFA 3KIDU 4JZFH 1K9OE 1SGFG 5FXLA 4R0IA 2I6QA 1CT4E 3SU3A 2IN2A 2QV1A 4NIXA 1TMUH 3RXKA 1FPCH 1Z8RA 3ZVCA 4THNH 4MG3A 3B8JA 1FJSA 3DHKH 3VXFH 4RKOB 3K6YA 2ANKH 1A0JA 1GVKB 1QL8A 5L2YH 2FM2A 3PLKA 2GZ8A 3TNSA 3RXTA 1DUAA 7KMEH 3KGPA 2BD5A 2CGAA 1SI5H 4YZUA 4TY6A 3ZV8A 1FY5A 1CA8B 1PPCE 3GCOA 4U2WA 4CREA 4XDEA 3TH3H 2D8WA 1YPLH 2EI7A 4BTTB 3LC5A 3P8FA 4GUXA 2A2QH 3NKKA 3QO6A 5E0JA 1Q31A 1GHWH 1SSXA 1C5QA 4X6OA 5TJXA 1C1WH 2AH4X 3U9AH 5JB8S 1L1NA 1UMAH 5DO4H 2OUAA 2ZWLH 1LVOA 1XVOA 4FVBA 3MO6A 1O2HA 5B6OA 3RXEA 1BT7A 3O8DA 3Q3KA 3AAUA 1GJ9B 4E05H 2PKAB 1JXPA 4WF8A 4ZKOU 2FOAA 1Y5UT 1BRCE 4MNWA 4Q7ZA 1GG6B 3MO3A 1LKAA 3MI4A 3SHCH 3BF6H 1BCUH 1IQFA 2B5TB 2C8WB 2CF8H 4LXBH 3QTVH 3QUMP 3L3TA 3T2NA 1ZJDA 2RA0A