3A88A

Crystal structure of trypsin complexed with (e)-4-((2-nicotinoylhydrazono)methyl)benzimidamide (soaking 30 minutes)
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In-Crystal Chemical Ligation for Drug Discovery
rcsb
molecule tags Hydrolase
molecule keywords Cationic trypsin
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a88A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a88A02
1UCYH 4HTCH 3UY9A 1TMTH 1WAYB 4Y0YE 1TA2A 1OSSA 2ZG0H 1ZTKA 4YO9A 2ZDNA 3P8FA 4DIIH 1JMOH 1TRYA 2WUCA 3S7KB 1PPCE 2ILNA 1MU8B 1ELAA 3MNXA 5A0CA 1QFKH 1VR1H 2ZU1A 1ELVA 1CO7E 3FZDA 2D8WA 4NIVA 1SGYE 2RA0A 1PPHE 4FU8A 7GCHF 1FAKH 1P11E 2CHAC 3BIVH 1E37B 2F9VA 3GDVA 2B7DH 1GBAA 1BTZA 4TY7A 1PQ8A 5EXNA 1EB2A 1NFUA 2SGDE 3EDXB 4WWYA 1IQHA 1EXFA 1ZJKA 2BLQA 2UUYA 1CA0B 1B0EA 1FY4A 1QQUA 1UJ1A 2ANMH 3RU4T 3ZV8A 3T26A 1PPFE 3QK1A 3P8GA 3BTTE 2PHBA 4A92A 1GDNA 1CBWB 3LC5A 3Q3YA 3RXMA 2VIQA 4CREA 1ID5H 2PLXA 1C1PA 1ZPCA 2GZ7A 5GCHF 3ZV9A 2Q6DA 4LXBH 1TFXA 3RM2H 5AF9H 4K8YA 1AFQC 2Z3DA 1T31A 3M3SA 3SV2H 1ZPBA 2TGTA 1GHVH 1KXDA 1OWKA 3EAJA 1PYTD 2H9HA 5JB8S 2GCHG 2HPQH 3SV7A 3OTJE 3STJA 1Z8RA 1JOUB 5EGMA 1V2TT 2WYJA 1HV7A 3RC6A 4BTIB 1A46H 1QB9A 1ZHRA 4D9QA 5EODA 1OP2A 3MOCA 1DM4B 1HAVB 3Q76A 1LDTT 1BTXA 2G4UA 1HAHH 3ZZ9A 2QV1A 1GMHG 3O8RA 3MTYA 3ZZ3A 4Q7ZA 2BDIA 4OGYA 1O2QA 1G3DA 1EASA 1C9PA 3KQDA 1GBHA 1ZOMA 4HI3A 1GBBA 2VIVA 5JDUB 3VB3A 2CGAA 4AB8A 1OYTH 1C5MD 4CBOA 3ZYEA 2BY7X 2ULLA 2P8OB 4Q7XA 1GBFA 1O2HA 1XUKA 2Z94A 1O2ZA 4NGAH 2ANWA 2V0BA 2O8WA 1AHTH 1QJ1B 5TCAA 1YPMH 5HYOA 1SHHB 4CRAA 2J95A 1C5YB 4ISIH 1HAZB 1RTKA 1YPJH 5A0AE 3GCNA 3LGWA 4Q80A 1DY9A 1C1RA 2ZDMA 2QN5T 1FONA 1DSUA 1P57B 1O3BA 4NA8A 1EOJA 3QO6A 3V13A 1C5RA 3UQVA 3T27A 1PYTC 3TGIE 3KIDU 4X8VH 1ZPZA 3SJOA 3EA8A 3MNCA 1S82A 5LPFA 1YLDA 3MO9A 1FPHH 2FESH 1MKWK 2BDAA 1XXFA 3RXUA 3GY2A 2PKAB 4I8JA 1DOJA 1P2JA 2A4GA 2GX4A 3F9HA 3S7HB 3QDZB 4AG2A 2OTVA 1RIWC 3A7TA 3ENSB 1T8OA 1K28D 1BB0B 1UTOA 3HKJB 1CA0C 2FOBA 1V2RT 5LGOA 3SW2B 1KIGH 1BTYA 2ZGCA 3V7TA 1RTFB 3DT0H 3VFEA 1AVXA 1ZSJA 2Q6GA 4O97A 1TNLA 1GJDB 5DPAA 3PO1C 2D1JA 1EKBB 1BBRK 4AFQA 1ZHPA 4Y8XA 1GJ9B 4X8TH 1DPOA 3TH4H 1RFNA 1XUFA 1BHXB 4ABEA 3A7VA 4X2XA 1TNGA 1C5TA 1W12U 4WF8A 1YPHE 5FPYA 1V2JT 1LHEH 1MZDA 1P9SA 1ELGA 1THRH 4B2AA 1RRKA 1AQ7A 5EW1H 1AB9B 1NRQH 1GBCA 2DUCA 2ZNKH 4BAMB 1C5UA 2J4IA 3QGJA 1QA7A 3UQOA 1T32A 3F9EA 3KQBA 4ABDA 3L33A 3D65E 1CT0E 2B5TB 4HGCA 2BQ6B 1O3CA 3TVJB 2Y81A 3RLYH 1FZZA 2J34A 3PLKA 2BM2A 2EEKA 3SUEA 1ZJDA 4WVPE 4AX9H 1Y3WA 6ESTA 3HK6B 3U8TH 1K22H 3PTNA 3RXFA 2SGEE 4Y11E 1TONA 1NPMA 2W7UA 3LC3A 1EX3A 1NTPA 1TWXB 2F9OA 3MH7A 2FS9A 2G55A 4AZ2B 2GCHF 1X7AC 3SJKA 1K21H 1S83A 2UUKB 3GCOA 2BXTH 1A3EH 2A2QH 1QIXB 2ZP0H 5JB9S 1MTNB 4YLQH 3E90B 3MU8A 1GBLA 1KYNA 2ASUB 2VGCB 1SLUB 2WPLS 3K6ZA 3VPKA 3V0XA 1KDQA 1O36A 1G3CA 4X1SU 2BY6X 4YLUA 1GL1A 1J15A 1P09A 1LPZB 2GCTB 3W95A 2VVUA 1V2VT 3PYHA 1O31A 1EAWA 3GCHB 4A7IB 5GWZA 1CA8B 1W8BH 3KEEA 4OS2A 4ABIA 1K2I1 2F9UA 4FU9A 1P0SH 2XBXA 4DVAU 3GY7A 3JZ2B 3M36A 5FPSA 2BB4A 3F6UH 1HIAA 2NU1E 2ZGXH 1V2QT 3ATWA 5F8TA 1S6FA 2O9QA 4YESB 2Y82A 1QHRB 3BTWE 4I8GA 2BLVA 4DY7B 1C1QA 2C8WB 4MDSA 4MTBA 4TWWA 1KTSB 2ZFQH 4D9RA 3KHVA 1T4VH 2JH6D 2WPHS 4KKDA 4ZKNU 2IOTA 2A4OA 4IMQA 4YOIA 5A2MH 1FY1A 3FP6E 1MU6B 4FUHA 1C5SA 2DE8A 1O3KA 5E0GA 5DKMA 2R2MB 1O5GH 1V2PT 1TABE 3UR9A 1W13U 5DP3A 2UWLA 2ALVA 3ZVEA 1D3QB 2BQ7B 4D7GA 2ZHWH 4IMZA 1DWEH 1AU8A 2A5IA 1SVPA 1Y3UA 1P02A 1AZZA 2FZZA 2B9LA 2P3TB 3ZVGA 3EYDA 1GJ7B 1NFYA 4CH2B 1XUGA 1KXEA 4HZHA 4IBLH 3VXFH 3U98H 1HAGE 1GI0A 1Z1JA 3SUGA 3TGJE 1EUFA 1V2ST 1TOCB 1ESBA 1C2LA 2J38A 1T8LA 4ZKSU 2F9BH 2A31A 2G5NA 4K69A 2CV3A 1VZQH 3ZVBA 1HGTH 4IC6A 1C2HA 1ACBE 1O3IA 1P3EA 3OSYA 1QL9A 3P17H 1HIAB 4BNRA 3TITA 1UMAH 2BVSH 2FMJA 3ZZBA 1HBTH 2SNWA 2FTMA 3OY5U 1LTOA 3RMOH 3LGYA 3RU4E 1BIOA 1GCTB 1UTPA 2F91A 2VGCC 3BN9A 3D23A 3E6PH 3SNEA 1QL8A 5H4IB 2B0FA 2ZDVH 1KDQB 2PSXA 3RXPA 1ELEE 1O0DH 1GHBF 2G5VA 2UWOA 3S0NA 3F68H 1NN6A 1MZAA 1D6RA 2R3YA 2H9TH 4IN1A 1XUHA 1QRWA 1LPKB 4WH8A 3LU9B 2AERH 1RTLA 1ZTLA 3RM0H 2FM2A 2STBE 1NM6A 5T6FA 1WUNH 1ANCA 1ANBA 4IGDA 1E35B 4O9VA 1C2JA 1MCVA 3A8DA 1QB1A 5JBCS 1ETTH 3PO1B 1HLTH 1ZRBA 1K1LA 2ZHFH 2GMTC 2OC0A 4XBBA 3PWCA 3UOUA 3QTOH 2GZ9A 1O2YA 1GHAF 3RU4D 2Y80A 1P03A 3PB1E 1YLCA 1ZGVA 1QNJA 2WPKS 1O2MA 3T5FH 1F0UA 3UREA 1DLEA 2CXVA 3HGNA 5E2PA 3SNCA 1O35A 1UTJA 1L0ZA 3LGUA 3ZVFA 4XBDA 4NZQA 3FFGA 2FX4A 2NU0E 5CE1A 1PPZA 2XC5A 3AW0A 4SGAE 1QCPA 2BD8A 4UDWH 3O8BA 3RC4A 1EAUA 1O2TA 3I78A 1O37A 3STIA 2WV5A 2FI5E 2GP9B 3HATH 2SGAA 1G32B 4ABAA 1S0QA 3FANA 2OXSA 2CMYA 3LT3A 1N6YA 1O5CB 3SNAA 3NUMA 4LOYH 5C20A 1TNIA 1GMDF 3SU6A 3RXJA 1UCYK 2ZA5A 4K1TA 1LKBA 1TOMH 3UNSA 4DIHH 1CGHA 1NRSH 1IOEA 1HJ8A 3B8JA 2EI8A 4Z0KA 1F5KU 1MKWH 2GDDA 1AKSB 3K9XB 2ZKSA 1SC8U 2BD7A 3QLPH 3JZ1B 2VINA 1AD8H 1GVKB 5A0BA 3UTUH 3SV8A 4OGXA 4AORA 2XXLA 3P70B 4MPXA 1GMDG 1MQ6A 4K1EA 5ESTE 1QURH 2TPIZ 3R0FA 2AGEX 2KAIA 2FWWA 1FY3A 1V2WT 1DFPA 1OP0A 1QGFA 2Y5FA 2V35A 1NO9H 3IITA 1GHAG 1C2GA 1EAXA 1TGSZ 1OP8A 2GZ8A 1C2DA 2BY8X 1HPGA 2QCYA 3M3VA 3Q3KA 4UFEH 5A09A 3OX7U 4GHQA 3RXOA 5J4SA 1GI6A 1ELCA 3SU0A 1K1PA 1C9TA 1SR5C 1O3JA 1E0FD 1FI8A 1UVTH 2FTLE 2OUAA 3S9BA 4NSYA 1AE8H 3A7ZA 3LKWA 5GIBA 4ZROA 1TBRH 2BDCA 4GCHG 2FODA 4X6NA 3URCA 1UVPA 3NKKA 3MNBA 2ZU4A 5GPIB 1LVYA 1Y3XA 1HXEH 3LDXH 4ZKRU 4NFFA 1RGQA 3U8OH 5HGGA 5CHAC 1YC0A 3RXAA 1ABJH 1AFQB 3BIUH 5EOKA 2SGPE 1GJ6A 1FAXA 4Y8YA 2PKSC 3LPRA 1SFIA 1LQEA 1A0HB 1O3OA 5HXFA 1A5GH 2OC1A 3MNSA 1IAUA 1BA8B 1F2SE 3H7TA 4MPVA 2W3KA 2PW8H 1AB9C 4OS7A 4XDEA 4H6SB 1W7XH 1EPTC 4I31A 3MU1A 1O3AA 2XWBI 8ESTE 2P8OC 3KGPA 5C1UA 3MH4A 3MH5A 4JZEH 3GDSA 2VWLA 1HJAC 4ISHH 1L4ZA 1GBDA 1TE0A 3FP8E 2H5CA 2RG3A 3KQEA 2F3CE 2OQ5A 1QJ7B 4INLA 3M7QA 3TGKE 6GCHF 3SU2A 4Y8ZA 2R9PA 3LONA 4R8TB 1SPJA 3ZZCA 5FHTA 2WPJS 1KXAA 5AHGH 1C5LH 2B8OH 4ABGA 1P9UA 4Y79A 2VWOA 3TNSA 1GMCF 3BTEE 2FLRH 4X8UH 1XUJA 1C5XB 3P95A 1GVZA 3OY6U 3CS0A 2BHGA 5LH8A 1TQ7B 1DWDH 3NXPA 2A2XH 2VIDA 3RXIA 1OWHA 1TNHA 1LVMA 1IQNA 1MD7A 3H5CB 3RXEA 1SQAA 2VJ1A 3GOVB 1TGNA 4X6PA 4B73A 1A0LA 1F92A 4FUJA 1S84A 2P59A 1DX5M 1TLDA 4ZAEA 1WTHD 2O8TA 2ZDLA 3GYMA 1JBUH 1ANEA 2G4TA 1W7GH 5A8ZA 1AUJA 1TIOA 5T6DA 1NU9A 1QBVH 4ABHA 5DK1A 1C2EA 2P95A 4A1VA 5ESBA 3A8AA 3A84A 4WJG2 4JMYA 4FVDA 1W0YH 2QXJA 1SSXA 1QRXA 3A88A 2AEIH 3RXRA 2TIOA 1BHXF 1AKSA 3SUFA 4AOQA 2NU4E 1IQJA 1BZXE 3BTME 3MU0A 2FDAA 1SOZA 2FX6A 4X2YA 1U6QA 3MU5A 2BOHB 2PKAA 1EJAA 1O5AB 5DP8A 4AFSA 1SGFG 2FXRA 3QX5H 4A5TS 4NG9H 4OS5A 1P12E 1AIXH 2ZFSA 1OWDA 3TJNA 2WPIS 3Q77A 1O2UA 1QBNA 2BOKA 2ZFPH 3AAUA 2FIRH 1W14U 3TIUA 1GI8B 2IN2A 3SJIA 1N8OC 3P6ZB 4O3TA 2VVVA 1GHYH 3ZYDA 1TALA 4MPWA 1CSOE 2F83A 1SI5H 3ZZ8A 1E38B 4GVUA 5EPYA 1GDUA 4DW2U 2BD5A 1Z6EA 1GJ4H 5E0JA 1V2MT 1GBTA 1JIRA 4ZUHA 1NT1A 1RS0A 5JBBS 1VCWA 1SGCA 3C27B 3RXBA 2OCVB 4E7NA 3LIWA 4R0IA 1AWFH 1C1VH 3LGVA 3PM3A 2FOAA 5G4BA 3D49H 2HLCA 1KTTB 2A7HA 3RXCA 1OPHB 3TJVA 5FCKA 4NZLA 2FOFA 1AVGH 1E36B 5HM2A 2A4RA 2EI6A 1Y3YA 4Y10E 3NWUA 3QGNB 1WSSH 7KMEH 1MTUA 2CJIA 2GD4B 3FZZA 3BV9B 4ZKOU 1B7XB 1YCPK 1HXFH 3F9FA 2C8YB 2IPHA 4Q7YA 1SGPE 4X0WU 4VGCB 3TU7H 1P3CA 1O5DH 2WUBA 4GUXA 4MPUA 4I32A 1B5GH 3EA9A 1G30B 5LPRA 3BG4C 3ATIA 1UTLM 1CHGA 1V2UT 2LNCA 1O3EA 1MUEB 1AUTC 1NFXA 2IJOB 1AN1E 2V3HH 1KXBA 2PUXB 3B9FH 1XVMA 4O3UA 3S9CA 1EP6A 5CHAB 4BOHA 2RA3A 3ITIA 3ODDA 1UVSH 5C5NA 2Z7FE 3LGTA 5C3NA 1T4UH 3SV6A 1YPEH 4K60A 2I6QA 4U01A 4WMEA 3SU3A 3NCLA 1J8AA 4B74A 2TBSA 4H42U 2A7CA 2Z9LA 1OWJA 2PV9B 1B0FA 1TAWA 6CHAC 3BTQE 1YPHC 3ESTA 4X1QU 2FP7B 1C1SA 2HALA 1EZXC 4CRBA 2R2WU 2C4FH 2HNTC 3ATKA 3PTBA 1PQ7A 2XTTB 4GHTA 2BLWA 3F1SB 3E16B 3M7TA 4UE7H 2TGAA 1BTWA 2P16A 4SGBE 4JZIA 1TGBA 2WINI 1C5WB 4MNYA 4DURA 3MWIU 2OC8A 1S81A 4H4FA 4IS5A 3MO6A 3TJOA 4JK5A 1KY9A 3W94A 2ZDAH 1E34B 1HAYB 1NRNH 5DG6A 4ABJA 5HMAA 1CGJE 1O32A 4U2WA 2J92A 3UOPA 1V2OT 3UNQA 1PFXC 5BRRE 4J2YB 1RIWB 1TB6H 2Q1JA 3EGKH 5AFZH 1THPB 3G01A 2HVXA 4H6TA 1Q3XA 1Z6JH 2HPPH 4TPYA 2GCTC 3MMGA 2UUFB 2VVCA 2BVXH 3PLPA 3DA9B 3SO3A 3Q3XA 2J9NA 3SI4H 1C5QA 2XBYA 5EW2H 2W26A 1MTSA 2BDGA 2W5EA 1ZZZA 1W11U 4I7YH 2PFEA 4B1TA 1YGCH 4KTUA 1EZQA 1Z1IA 4XBCA 4ZXXH 1O5EH 4YTAA 1JRTA 1TA6A 1BCUH 4ISOA 1CT2E 3T28A 4JZ1A 3A82A 4F49A 3U69H 1MKXH 4PROA 1UO6A 1TPOA 1VITH 1H8DH 1V2KT 2W7SA 4B2CA 5C5OA 3OU0A 3SU4A 3NZIA 3MO3A 4LZ4B 1ETRH 1C4V2 4M7GA 2ZHEH 1F0SA 3RLWH 1BTPA 3UPEA 2GVFA 3NK8A 4NWKA 1HB0B 3IWMA 1GBJA 4UFFH 1DSTA 3S9AA 1SB1H 3CS7A 1PPEE 2BVRH 2ZHDA 1ABIH 1NS3A 1C2FA 5E0HA 2BZAA 1XKBC 1DANH 6GCHG 2HGTH 1IHTH 5AFYH 1BRBE 3I77A 1NZQH 2G81E 2ZPQA 1LO6A 5DJ7A 1EJMA 1SLVB 2VIOA 1XX9A 1O5FH 4IC5A 2JH5D 3T25A 5F8ZA 2Z9KA 3DFLA 2OP9A 2J94A 1BOQA 2C8XB 3T2NA 1SGDE 3GDUA 4CR9A 2FI3E 3M7UA 4INHA 2J2UA 1HAOH 2SFAA 1GL0E 1DE7H 1GDQA 1ZHMA 2SGFE 1GG6C 2V3OH 3FAOA 3PMBB 3QTVH 3M5MA 1CHOG 5DP4A 3DD2H 3BEIB 9ESTA 4Y6DA 4CBNA 3AASA 4Q2KA 1VCQA 1V2LT 1TRMA 1G36A 3GCHC 4TPIZ 1ZSKA 1BITA 3KNXA 2YOLA 4WY3A 1JIMA 5DP6A 2ZU2A 2VH0A 4J1YA 4ASHA 1LHCH 3GY5A 4KTSA 3SU1A 5EXMA 1FPCH 1EZUC 1LHFH 4AYVB 2FYQA 2QF3A 1K1OA 1ARBA 1O3NA 2R0LA 4AGKA 2BX4A 1FXYA 4OS4A 4X2VA 3RXDA 1BRUP 4I8HA 1GCTC 1H1BA 3M5LA 1XM1A 1DXPA 4CRGA 1OWEA 4OS6A 1AGJA 1FY5A 1MH0A 2ZGBH 1WQSA 4UEHH 1ZR0A 2FOMB 1MTWA 1QJ6B 1INCA 1P04A 1THSH 1LVOA 1AVWA 1OS8A 1S5SA 1J17T 3EE0B 2HRVA 4RKOB 1OXGA 1WYKA 1HRTH 1DXWA 4WMDA 1JXPA 1QRZA 5JYIA 1MKXK 1O2PA 2THFB 1GHBG 1Z71A 2BYAX 1GI9B 4X6OA 1D3PB 1BDAA 1BRAA 3KL6A 1IQMA 1YYY1 1NFWA 2W3IA 3GY3A 2OLGA 1SBWA 2KAIB 5JBAS 2BX3A 3A7XA 4MNVA 2AIQA 1QBOA 3SJ9A 3LJJA 3SHCH 1SL3A 4JZDH 1A1RA 1IQKA 1QL7A 1SG8B 3SBKA 2Z3EA 1HAXB 4CHAB 1NU7B 2VIPA 2P93A 3HGPA 3VB7A 4JYTA 1DT2A 2YNBA 1O3MA 1SGEE 1ZRKA 4AGJA 1HUTH 1ETSH 2NU3E 3CP7A 1HCGA 1GVLA 5L2ZH 1TQ0B 1TX8A 4FU7A 1O34A 3F9GA 1HFDA 2CHAB 2QF0A 1TBZH 4AFZA 3T29A 4Y0ZE 5L2YH 6LPRA 3HKIB 4D7FA 1TGTA 3I29A 3GCTF 3PROA 4FXGH 3BEUA 1TPPA 3GY8A 4NSVA 4BAHB 5FX6A 1TRNA 3RMLH 4YOGA 3VB6A 1O39A 2XC4A 1BJUA 3O8CA 2ZTZA 3TJUA 4NA9H 1QQ4A 3SHAH 1GBMA 2QAAA 1G2MA 4BANB 1FIZA 5EQRA 4Y71A 2P94A 3VXEH 1SQOA 3ZVCA 3ZZ4A 1O30A 1A2CH 5JPMH 2GTBA 1O2LA 1GI4A 1Y59T 1FNIA 1LPGB 2PTNA 3QN7A 5A8YA 1AWHB 1VITF 3VGCB 4B71A 4Z6AH 1K1JA 4NIWA 4TYDA 1O3PB 1H8IH 1C5VA 2TGPZ 2AGIX 1F0TA 2ESTE 3BSQA 1CHOF 1K1NA 1GHZA 3RXQA 1C2IA 2TGDA 1O2OA 2BD4A 5FXLA 4K8BA 4KTCA 3TK6A 1ELTA 1L1NA 3HK3B 1P2IA 1BT7A 1TNJA 1O2XA 4O03A 3BTFE 5C67A 1FUJA 5FX5A 1P2QA 2RDLA 2H9EH 2OBQA 5L6NH 4KELA 1AO5A 3LOXA 3SGQE 1N1LA 1VGCB 1YCPH 5FCRA 3SU5A 4FUGA 3S69A 4X2WA 1F0RA 1UHBB 5T6GA 1BMNH 1P06A 1ZSLA 3K2UA 1HYLA 2D2DA 4FUIA 2ZPRA 1H9IE 4MQAA 1RD3B 1ELFA 3A80A 5BPEA 1FDPA 8LPRA 1SLWB 1ZMNA 4CRCA 1G37A 3SUDA 2VB0A 1IQEA 2ZWLH 1D9IA 1YM0A 3TPIZ 2O8LA 1D3DB 1FLEE 2AS9A 4VGCC 2NU2E 1BMAA 1D6WA 4RKJB 1VJAU 1DDJA 2AMPA 4DG4A 1TNKA 4QT8C 1O3DA 3ATLA 2AFQB 8GCHG 1AMHA 1LMWB 2A7JA 1P05A 4IW4E 1GG6B 2GMTB 4Y7AA 1XMNB 1HNEE 4MVNA 1QA0A 2JETB 5GCHG 4GPGA 4DGJA 3BTHE 2G52A 4FUCA 1GI1A 4X1NU 3A87A 1ELDE 1O2JA 1NY22 2TRMA 3MH6A 4UONA 3SGBE 1ZMJA 4FUEA 2A1DB 3BTDE 2Z6BD 2ZFRH 2Z3CA 1SOTA 1WU1A 4BTUB 5FBIA 3TLOA 4B2BA 1O2KA 1XUIA 3ZVAA 1ZGIA 2QA9E 1FJSA 3A8CA 1Q31A 4DT7B 3M5NA 1NC6A 4KP0A 2P3FH 4XSKU 3QZQA 1A61H 4NCYA 4CH8B 1OOKB 2VU8E 2C8ZB 1WQVH 1UTNA 3UFAA 4JYUH 3QUMP 1UTQA 1QY6A 2BTCE 3UWJH 4A1TA 1DWCH 4BXWA 1N6XA 5C1XA 2ZGHA 3AW1A 1WV7H 3RMNH 4ZH8A 2G00A 3VGCC 1BUIA 3RXGA 1ARCA 2VH6A 2DE9A 1GMHF 2YNAA 2SNVA 4MNXA 1C5OH 1MAXA 8KME2 7ESTE 1O2WA 1AZ8A 2G8TA 4B75A 1CQQA 1GJAB 4THNH 1EAIA 1OX1A 2CF9H 5K0HA 1C4U2 2A0QB 2XWAA 2ANKH 3EQ0H 5EQQA 3ZZ7A 3UUZA 1UTKA 4AN7A 3BTKE 1GJ8B 1RJXB 1SQTA 4FUFA 1CU1A 1GJCB 3RXSA 5ABWA 4ZXYH 4BXSA 2PUQH 4YT7H 1GCDA 1GBIA 1BTUA 3BF6H 3SOSA 3SNBA 5C2ZA 2BY9X 3A7YA 2HNTE 2Z9GA 2ZHQH 4ZHLU 1EPTA 4JK6A 3P92A 1AFEH 4Y7BA 1ZLRA 2UWPA 1KLTA 2A5AA 1IQIA 2CN0H 1YPLH 5F6MA 3PWBA 3FVFB 1CT4E 1Y8TA 1O2RA 1DS2E 1M9UA 3Q00A 2ZTYA 2OBOA 4K3JA 3MU4A 1Z7KA 1CBWC 2JKHA 2FPZA 2ZGJA 1UHBA 3SN8A 1JRSA 1PQAA 2ZQ1A 3V3MA 3RXLA 1Z8JB 1L1GA 4YT6H 1IHSH 2ZU3A 1WTGH 4FUBA 1GBKA 3PMJA 5DP5A 3E8LA 1KLJH 2ZF0H 3PMAB 4OS1A 1EOLA 4GCHF 1UCYE 1FIWA 2BQWB 5DGJA 1KLIH 2PR3A 3TK9A 2FS8A 1HAVA 1NESE 3KF2A 1NRRH 3V12A 2I6SA 4K2YA 5EXLA 1GHWH 4X1PU 1EB1H 2FLBH 4WXIA 3N7OA 1VJ9U 1V6DA 1ZTJA 3BG4B 2GT8A 4HFPB 2GV6A 4GSOA 4D76A 1Y5UT 2ALPA 5PTPA 3GY6A 3RMMH 3A8BA 1SHYA 1K1MA 4TY6A 5A8XA 1AE5A 3P8NA 3U1IB 3SNDA 3SI3H 2CF8H 1GJ5H 2Z9IA 1CVWH 2EI7A 4ZMAH 4K5ZA 2ZCLP 1UK4A 3UWIA 1G9IE 1IQGA 3LH1A 1BJVA 3C1KA 1KXFA 1QR3E 1C1MA 3GYLB 1K9OE 2GGVB 1P2NA 5AVDA 1BTHH 5HM9A 2RCEA 1J9CH 3M3TA 1AY6H 5IDKA 4LK4A 2BDHA 4TWYA 1UTMA 1BRCE 1WCZA 1HAIH 2QGRA 1IQLA 2XRCA 1SGFA 1VITG 1EJNA 2ANYA 3SJ8A 3T62A 4JZFH 2PTCE 4MLFB 2C93B 2NWNA 5EQSA 2FO9A 2QY0B 2XYAA 2GDEH 1ORFA 2ZFTA 3A83A 1XVOA 2F9NA 1S0RA 3VB5A 3D62A 4BTTB 1OYQA 1WOFA 2PGBB 1UK2A 5ETXA 3E0NB 5F8XA 5GDSH 1Q2WA 2XCFA 3SGAE 1GGDC 1FN8A 2ZI2H 3HPTB 1VCPA 5TCCA 1LVBA 5E8EH 2FOHA 1C1NA 1H4WA 5DP7A 4U30A 3E1XB 4U32A 1TPAE 2ZECA 2ODPA 4BAOB 2ZZUH 3B23B 2A45B 3ELAH 1A3BH 2OQUA 3ZVDA 2M5TA 4AFUA 3M37A 1O5BB 1H9HE 2FEQH 1PQ5A 2XBWA 2Y7XA 4ESTE 1NRPH 1Z8GA 2FI4E 3WY8A 1MBMA 1P10A 3SZNA 2ZDKA 5CMXH 1MAYA 5FBEA 5IYTA 3GISB 2BZ6H 2QC2A 2EC9H 2H2ZA 2PWXA 1LCYA 4X6MA 3M35A 3PV4A 3UNRA 1A5IA 2ZPSA 1C1UH 1LKAA 2XBVA 2OD3B 3A86A 1TX7A 3E0PB 3CENA 1MTVA 1O2GH 3A7WA 1GBEA 3LH3A 3ODFA 2D26C 4NFEA 5TJXA 1DVAH 3BG8A 4E7RG 3PLBA 2AYWA 2Y5GA 3K6YA 1ESAA 2BLOA 4D8NA 4JYVH 1PPBH 1DICA 1TMUH 3QWCH 4I33A 2XNIA 3AAVA 3RC5A 1BMMH 2BY5X 2ZCKP 2QXGA 2PKSB 2ZCHP 4YM9A 2A4QA 4YOJA 4ISLA 2PSYA 1YF4A 3NPSA 1MMJN 3E3TA 3RXTA 1P2KA 1Z8IB 1EPTB 5EG4A 5FPTA 1TGCA 2AMQA 2Y5HA 3U1JB 1FN6A 2HNTF 4WH6A 1WBGB 1SMFE 3KN2A 1H9LB 1HJAB 4F4OC 5K7RA 3IG6B 1O33A 1LQDB 1YCPM 4Y76A 1DY8A 2ZQ2A 1TBQH 1UVOA 2VWNA 3A85A 1D4PB 7LPRA 1GI7B 3RP2A 2Y7ZA 5EU8A 1TPSA 1BBRH 3L6PA 1EP5A 1W2KH 3TNTA 1F7ZA 4CHAC 2JH0D 4UFGH 3AVZA 1MCTA 3URDA 4IN2A 2VWMA 4LZ1H 3RXHA 4NWLA 4XFQA 5SGAE 3H7OA 1FQ3A 1SGTA 2O8MA 1DITH 1G3EA 3A81A 1YBWA 3VEQB 2JETC 1KSNA 3UIRA 2Q6FA 1RXPA 3RXVA 2EA3A 2Y6TA 4XOJA 1SGRE 1XXDA 1DLKB 1BQYA 3MI4A 2QYIA 5C1YA 1L2EA 2AGGX 4E05H 1GJBB 2BD2A 1YPKH 4UFDH 2XCNA 2XW9A 5E2OA 2SGQE 1IQFA 2C90B 1P2OA 1T8MA 1DUEA 2BD3A 1QTFA 3ZZ5A 2BDYA 3U8RH 3ZZDA 1J14A 3LGIA 4FVBA 1CE5A 4MNWA 1K1IA 4I8KA 5J4QA 3GY4A 2LPRA 4GAWA 1O2IA 3O8DA 1GPZA 4FUDA 3L3TA 1O2VA 1F5LA 1EQ9A 1ELBA 1YPGH 4AG1A 1AI8H 2ZEBA 4JCNA 4INKA 2ZO3H 1TMBH 3PMHB 1FY8E 3P8OA 1ZYOA 1GI3A 1Y5AT 1C1TA 4UD9H 2GKVE 4AB9A 4RN6A 1GI2A 2WPMS 1C2KA 1O3LA 1OKXA 3ATMA 1L4DA 1GWAA 2Z9JA 1MTNC 1S6HA 3K65B 2FYRA 2K1QA 1N8OB 1GGDB 7GCHG 2BMGB 1JWTA 4B76A 4KGAA 4E06H 3SV9A 2ODQA 1C5PA 2PGQB 1GMCG 4CRDA 1L1JA 1W0ZU 1KXCA 4A6LA 2G51A 1A7SA 2WV4A 4A1XA 2BD9A 2V6NA 4YZUA 3MHWU 1SLXB 2ZFFH 3RUOA 1VGCC 4K1SA 1O2SA 2HOBA 4XE4A 1YP9A 3TK5A 2H6MA 3BEFB 2H5DA 3SQEE 3FP7E 1HDTH 1SGQE 1UK3A 2ZU5A 1PJPA 1O3FA 1DUAA 1W10U 2C3SA 4BAQB 9LPRA 3UR6A 1O3GA 2R0KA 1XKAC 4ZHAA 3LJOA 1G2LA 4DJZB 1SGNE 3GICB 1O3HA 2ZIQH 2ZTXA 5JBTA 1MD8A 2BXUH 1C1WH 1C4Y2 1C2MA 2STAE 5I46H 2ZC9H 2WYGA 5GJ4B 1G3BA 1T8NA 3DHKH 3EA7A 2FOCA 3TH2H 4ABFA 3RDZA 1PPGE 1P8VC 1CGIE 1GI5A 1D3TB 1UVUH 1FV9A 1T7CA 3SORA 2OC7A 1BMLA 1FMGA 1EATA 1MBQA 2ODYB 3KCGH 3QZRA 5B6OA 1A4WH 2O8UA 2VIWA 3KQCA 3VB4A 4NIXA 3M61U 1QB6A 1C5NH 2VNTA 2AH4X 1HJ9A 2HWLB 5L30H 2FOEA 1TX6A 2R3UA 3TH3H 3MFJA 3ZZ6A 5F03A 1SFQB 2QIQA 3RXKA 1W3CA 2QXIA 3SQHE 6CHAB 2P3UB 1Y5BT 3GCTG 2BDBA 2A32A 4GLYA 4AYYB 4CR5A 1BBRE 2XC0A 1J16A 1P01A 3MYWA 4WXVA 1EZSC 2FOGA 1A0JA 5EPNA 4DOQA 1HAPH 4ISNA 4ZHMU 1Y3VA 1C1OA 3M5OA 1F5RA 5T3HA 4I8LA 1TYNA 4NIYA 4X8SH 2QXHA 1C5ZB 1MQ5A 2OINA 3BTGE 4NA7A 4ABBA 3DFJA 3U9AH 2GV7A 4CRFA 8GCHF 5GXPA 1O2NA 1NROH 3DUXH 1YKTA 1GHXH 2F9PA 3R3GB 2AIPA 3E91A 4DCDA 1O38A 3OYPA 1V3XA 4WMFA 1ZMLA 1P2MA 5FAHA 1A5HA 1LHDH 1OWIA 2A5KA 3A89A 4BAKB 5LPEA 1SGIB 2H1UA 4MG3A 1DWBH 4RSPA 5DO4H 2GT7A 1LHGH 1ANDA 3ZZAA 1S85A 2UUJB 5DP9A 1ESTA 5I25A 2AMDA 1V2NT 4X1RU
chains in the Genus database with same CATH superfamily
1UCYH 4HTCH 3UY9A 1TMTH 1WAYB 4Y0YE 1TA2A 1OSSA 2ZG0H 1ZTKA 4YO9A 2ZDNA 3P8FA 4DIIH 1JMOH 1TRYA 2WUCA 3S7KB 1PPCE 2ILNA 1MU8B 1ELAA 3MNXA 5A0CA 1QFKH 1VR1H 2ZU1A 1ELVA 1CO7E 3FZDA 2D8WA 4NIVA 1SGYE 2RA0A 1PPHE 4FU8A 7GCHF 1FAKH 1P11E 4ZCNA 2CHAC 3BIVH 1E37B 2F9VA 3GDVA 2B7DH 1GBAA 1BTZA 4TY7A 1PQ8A 5EXNA 1EB2A 1NFUA 2SGDE 3EDXB 4WWYA 1IQHA 1EXFA 1ZJKA 2BLQA 2UUYA 1CA0B 1B0EA 1FY4A 1QQUA 1UJ1A 2ANMH 3RU4T 3ZV8A 3T26A 1PPFE 3QK1A 3P8GA 3BTTE 2PHBA 4A92A 1GDNA 1CBWB 3LC5A 3Q3YA 3RXMA 4F48B 2VIQA 4CREA 1ID5H 2PLXA 1C1PA 1ZPCA 2GZ7A 5GCHF 1OHHD 3ZV9A 3F0OA 2Q6DA 4LXBH 1TFXA 3RM2H 5AF9H 4K8YA 1AFQC 2Z3DA 5HIYA 1T31A 3M3SA 3SV2H 1ZPBA 2TGTA 1GHVH 1KXDA 1OWKA 3EAJA 1PYTD 2H9HA 5JB8S 2GCHG 2HPQH 3SV7A 3OTJE 3STJA 1Z8RA 1JOUB 5EGMA 1V2TT 2WYJA 1HV7A 3RC6A 4BTIB 1A46H 1QB9A 4OM9A 1ZHRA 4D9QA 5EODA 1OP2A 3MOCA 1DM4B 1HAVB 3Q76A 1LDTT 1BTXA 2G4UA 1HAHH 3ZZ9A 2QV1A 1GMHG 3O8RA 3MTYA 3ZZ3A 4Q7ZA 2BDIA 4OGYA 2LP6A 1O2QA 1G3DA 1EASA 4Q63A 1C9PA 3KQDA 1GBHA 1ZOMA 4HI3A 1GBBA 2VIVA 5JDUB 3VB3A 2CGAA 4AB8A 1OYTH 1C5MD 4CBOA 2XNDD 3ZYEA 2BY7X 2ULLA 2P8OB 4Q7XA 1GBFA 1O2HA 1XUKA 2Z94A 1O2ZA 4NGAH 2ANWA 2V0BA 2O8WA 1FX0B 1AHTH 1QJ1B 5TCAA 1YPMH 5HYOA 1SHHB 4CRAA 2J95A 1C5YB 4ISIH 1HAZB 1RTKA 1YPJH 5A0AE 3GCNA 3LGWA 4Q80A 1DY9A 1C1RA 2ZDMA 2QN5T 1FONA 1DSUA 1P57B 1O3BA 4NA8A 1EOJA 3QO6A 3V13A 1C5RA 3UQVA 3T27A 1PYTC 3TGIE 3KIDU 4X8VH 1ZPZA 3SJOA 3EA8A 3MNCA 1S82A 5LPFA 1YLDA 3MO9A 1FPHH 2FESH 1MKWK 2BDAA 1XXFA 3RXUA 3GY2A 2PKAB 3OEHD 4I8JA 1DOJA 1P2JA 2A4GA 2GX4A 3F9HA 3S7HB 3QDZB 4AG2A 2OTVA 1RIWC 1YLNA 3A7TA 3ENSB 4F55A 1T8OA 1K28D 1BB0B 1UTOA 3HKJB 1CA0C 2FOBA 1V2RT 5LGOA 3SW2B 1KIGH 1BTYA 2ZGCA 3V7TA 1RTFB 3DT0H 3VFEA 1AVXA 1ZSJA 2WV9A 2Q6GA 4O97A 1TNLA 1GJDB 5DPAA 3PO1C 2D1JA 1EKBB 1BBRK 4AFQA 1ZHPA 4Y8XA 1GJ9B 2XOKD 4X8TH 1DPOA 3TH4H 1RFNA 1XUFA 1BHXB 4ABEA 3A7VA 3EE7A 4X2XA 1TNGA 1C5TA 1W12U 4WF8A 1YPHE 5FPYA 1V2JT 1LHEH 1MZDA 1P9SA 1ELGA 1THRH 4B2AA 1RRKA 1AQ7A 5EW1H 1AB9B 1NRQH 1GBCA 2DUCA 2ZNKH 4I86A 3UB0A 4BAMB 1C5UA 2J4IA 3QGJA 1QA7A 3UQOA 1T32A 3F9EA 3KQBA 4ABDA 3L33A 3D65E 1CT0E 2B5TB 4HGCA 2BQ6B 1O3CA 3TVJB 2Y81A 3RLYH 1FZZA 2J34A 3PLKA 2BM2A 2EEKA 3SUEA 4RT0A 1ZJDA 4WVPE 4AX9H 1Y3WA 6ESTA 3HK6B 3U8TH 1K22H 3PTNA 3RXFA 2SGEE 4Y11E 1TONA 1NPMA 3NRLA 2W7UA 3LC3A 1EX3A 1NTPA 1TWXB 2F9OA 3MH7A 2FS9A 2G55A 4AZ2B 2GCHF 1X7AC 3SJKA 4TT3D 1K21H 1S83A 2W6ID 2UUKB 3GCOA 2BXTH 1A3EH 2A2QH 1QIXB 2ZP0H 5JB9S 1MTNB 4YLQH 3E90B 3MU8A 1GBLA 1KYNA 2ASUB 2VGCB 3PV2A 1SLUB 2WPLS 3K6ZA 3VPKA 3V0XA 2IJD1 1KDQA 1O36A 1G3CA 4X1SU 2BY6X 4YLUA 1GL1A 1J15A 1P09A 5C0UA 4Q4LA 1LPZB 2GCTB 3W95A 2VVUA 1V2VT 3PYHA 1O31A 1EAWA 3GCHB 3WWBA 4A7IB 5GWZA 1CA8B 1W8BH 3KEEA 4OS2A 4ABIA 1K2I1 2F9UA 4FU9A 1P0SH 2XBXA 4DVAU 3GY7A 3JZ2B 3M36A 5FPSA 2BB4A 3F6UH 1HIAA 2NU1E 2ZGXH 1V2QT 3ATWA 5F8TA 1S6FA 2O9QA 4YESB 2Y82A 1QHRB 3BTWE 4I8GA 2BLVA 4DY7B 1C1QA 2C8WB 4MDSA 3DSPA 4MTBA 4TWWA 1KTSB 2KCOA 2ZFQH 4D9RA 3KHVA 1T4VH 2JH6D 2WPHS 4KKDA 4ZKNU 2IOTA 2A4OA 4IMQA 4YOIA 5A2MH 1FY1A 3FP6E 1MU6B 4FUHA 1C5SA 2DE8A 1O3KA 5E0GA 5DKMA 2R2MB 1O5GH 1E79D 1V2PT 1TABE 3UR9A 1W13U 5DP3A 2UWLA 2ALVA 3H09A 3ZVEA 1D3QB 2BQ7B 4D7GA 2ZHWH 4IMZA 1DWEH 1AU8A 2A5IA 1SVPA 1Y3UA 1P02A 1AZZA 2FZZA 2B9LA 1S6LA 2P3TB 3ZVGA 3EYDA 1GJ7B 1NFYA 4CH2B 1XUGA 1KXEA 4HZHA 4IBLH 3VXFH 3U98H 1HAGE 1GI0A 1Z1JA 3SUGA 3TGJE 1EUFA 1V2ST 4B6FA 4FOUC 1TOCB 4B6EA 1ESBA 1C2LA 2J38A 1T8LA 4ZKSU 2F9BH 3OTPA 2A31A 2G5NA 4K69A 2CV3A 1VZQH 3ZVBA 1HGTH 4IC6A 1C2HA 1ACBE 1O3IA 1P3EA 3OSYA 1QL9A 3P17H 1HIAB 2J98A 4BNRA 3TITA 1UMAH 2BVSH 2FMJA 3ZZBA 1HBTH 2SNWA 2FTMA 3OY5U 1LTOA 3RMOH 1E1QD 3LGYA 3RU4E 1BIOA 1GCTB 1UTPA 2F91A 2VGCC 3BN9A 3D23A 3E6PH 3SNEA 1QL8A 5H4IB 2B0FA 2ZDVH 1KDQB 2PSXA 3RXPA 1ELEE 1O0DH 1GHBF 2G5VA 2UWOA 3S0NA 3F68H 1NN6A 1MZAA 1D6RA 2R3YA 2H9TH 4IN1A 1XUHA 1QRWA 1LPKB 4WH8A 3LU9B 2AERH 1RTLA 1ZTLA 3RM0H 2FM2A 2STBE 1NM6A 5T6FA 1WUNH 1ANCA 1ANBA 4IGDA 1E35B 4O9VA 1YY3A 1C2JA 1MCVA 3A8DA 1QB1A 5JBCS 1ETTH 3PO1B 1HLTH 1ZRBA 1K1LA 2ZHFH 2GMTC 2OC0A 4XBBA 3PWCA 3UOUA 3QTOH 2GZ9A 1O2YA 1GHAF 3RU4D 2Y80A 1P03A 3PB1E 1YLCA 5T1VA 1ZGVA 3OAAD 1QNJA 2WPKS 1O2MA 3T5FH 1F0UA 3UREA 1DLEA 2CXVA 3HGNA 5E2PA 4P00A 3SNCA 1O35A 1UTJA 1L0ZA 3LGUA 3ZVFA 4XBDA 4NZQA 3FFGA 4Z1MD 2FX4A 2NU0E 5CE1A 1PPZA 5C17A 2XC5A 3AW0A 4SGAE 1QCPA 2BD8A 4UDWH 3O8BA 3RC4A 1EAUA 1O2TA 3I78A 1O37A 3STIA 2WV5A 2FI5E 2GP9B 5C0TA 3HATH 2SGAA 1G32B 4ABAA 1S0QA 3FANA 2OXSA 2CMYA 3LT3A 1N6YA 1O5CB 3SNAA 3NUMA 4LOYH 5C20A 1TNIA 1GMDF 3SU6A 3RXJA 1UCYK 2ZA5A 2J97A 4K1TA 1LKBA 1TOMH 3UNSA 4DIHH 1CGHA 1NRSH 2LELA 1IOEA 1HJ8A 2J5UA 3B8JA 1EFRD 2EI8A 4Z0KA 1F5KU 1MKWH 2GDDA 1AKSB 3K9XB 2ZKSA 1SC8U 2BD7A 3QLPH 3JZ1B 2VINA 1AD8H 1GVKB 5A0BA 3UTUH 3SV8A 4OGXA 4AORA 2XXLA 3P70B 4MPXA 1GMDG 1MQ6A 4K1EA 5ESTE 1QURH 2TPIZ 3R0FA 2AGEX 2KAIA 2FWWA 1FY3A 1V2WT 1DFPA 1OP0A 1QGFA 2Y5FA 2V35A 1NO9H 3IITA 1GHAG 1C2GA 1EAXA 1TGSZ 1OP8A 2GZ8A 1C2DA 2BY8X 2QF5A 1HPGA 2QCYA 3M3VA 3Q3KA 4UFEH 5A09A 3OX7U 4GHQA 3RXOA 5J4SA 1ELCA 1GI6A 3SU0A 1K1PA 1C9TA 1SR5C 4ASUD 1O3JA 1E0FD 1H8ED 3N7DA 1FI8A 1UVTH 2FTLE 2OUAA 3S9BA 4NSYA 1AE8H 3FO8D 3A7ZA 3LKWA 5GIBA 4ZROA 1TBRH 2BDCA 4GCHG 2FODA 4X6NA 3URCA 1UVPA 3NKKA 3MNBA 2ZU4A 2KZ4A 5GPIB 1LVYA 1Y3XA 1HXEH 3LDXH 4ZKRU 4NFFA 1RGQA 3U8OH 5HGGA 5CHAC 1YC0A 3RXAA 1ABJH 1AFQB 3BIUH 5EOKA 2SGPE 1GJ6A 1FAXA 4Y8YA 2PKSC 3LPRA 1SFIA 1LQEA 1A0HB 1O3OA 5HXFA 1A5GH 2OC1A 3MNSA 1IAUA 1BA8B 1F2SE 3H7TA 4MPVA 2W3KA 2PW8H 1AB9C 4OS7A 4XDEA 4H6SB 2AHME 1W7XH 1EPTC 1UW7A 4I31A 3MU1A 1O3AA 2XWBI 8ESTE 2P8OC 3KGPA 5C1UA 3MH4A 3MH5A 4JZEH 3GDSA 2VWLA 1HJAC 4ISHH 1L4ZA 1GBDA 1TE0A 3FP8E 2H5CA 2RG3A 3KQEA 2F3CE 2OQ5A 1QJ7B 4INLA 3M7QA 3TGKE 6GCHF 3SU2A 4Y8ZA 2R9PA 3LONA 4R8TB 1SPJA 3ZZCA 5FHTA 2WPJS 1KXAA 5AHGH 1C5LH 2B8OH 4ABGA 1P9UA 2V7QD 4YXWD 4Y79A 2VWOA 3TNSA 1GMCF 3BTEE 2FLRH 2JIZD 4X8UH 1XUJA 1C5XB 3P95A 1GVZA 3OY6U 3CS0A 3UAIC 2BHGA 5LH8A 1TQ7B 1DWDH 3NXPA 5CHBA 2A2XH 2VIDA 3RXIA 1OWHA 1TNHA 1LVMA 1IQNA 2HVYB 1MD7A 3H5CB 3RXEA 1SQAA 2VJ1A 3GOVB 1TGNA 4X6PA 4B73A 1A0LA 1F92A 4FUJA 1S84A 2P59A 1DX5M 1TLDA 4ZAEA 1WTHD 2O8TA 2ZDLA 3GYMA 1JBUH 1ANEA 2G4TA 1W0JD 1W7GH 5A8ZA 1AUJA 3ZIAD 1TIOA 5T6DA 1NU9A 1QBVH 4ABHA 5DK1A 1C2EA 2P95A 4A1VA 5ESBA 3A8AA 2RFKC 3A84A 4WJG2 3DSGA 4JMYA 4FETA 4FVDA 1W0YH 2QXJA 1SSXA 1QRXA 3A88A 2AEIH 3RXRA 2TIOA 1BHXF 1AKSA 3SUFA 4AOQA 2NU4E 1IQJA 1BZXE 3BTME 3MU0A 2FDAA 1SOZA 2FX6A 4X2YA 1U6QA 3MU5A 2BOHB 2PKAA 1EJAA 1O5AB 5DP8A 4AFSA 1SGFG 2FXRA 3QX5H 4A5TS 4NG9H 4OS5A 1P12E 1AIXH 2ZFSA 1OWDA 3TJNA 2WPIS 3Q77A 1O2UA 1QBNA 2BOKA 2ZFPH 3AAUA 2FIRH 1W14U 3TIUA 1GI8B 2IN2A 3SJIA 1N8OC 3P6ZB 4O3TA 3GS9A 2VVVA 1GHYH 3ZYDA 1TALA 4MPWA 1CSOE 2F83A 1SI5H 3ZZ8A 1E38B 4GVUA 5EPYA 1GDUA 4DW2U 2BD5A 1Z6EA 2EY4C 1GJ4H 5E0JA 1V2MT 1GBTA 1JIRA 4ZUHA 1NT1A 1RS0A 5JBBS 2OK5A 1VCWA 1SGCA 2KX4A 3C27B 3RXBA 2OCVB 4E7NA 3LIWA 4R0IA 1AWFH 1C1VH 3LGVA 3PM3A 2FOAA 5G4BA 3D49H 2HLCA 1KTTB 2A7HA 3RXCA 1OPHB 3TJVA 2QE7D 4NZLA 2FOFA 1AVGH 5FCKA 1E36B 5HM2A 2A4RA 2EI6A 1Y3YA 4Y10E 3NWUA 3QGNB 1WSSH 7KMEH 1MTUA 2CJIA 2GD4B 3FZZA 3BV9B 4ZKOU 1B7XB 1YCPK 1HXFH 3F9FA 2C8YB 2IPHA 4Q7YA 1SGPE 4X0WU 4VGCB 3TU7H 1P3CA 1O5DH 2WUBA 4GUXA 4MPUA 4I32A 1B5GH 3EA9A 1G30B 5LPRA 3BG4C 3ATIA 1UTLM 1CHGA 1W0KD 1V2UT 2LNCA 1O3EA 1MUEB 1AUTC 1NFXA 2IJOB 1AN1E 2V3HH 1KXBA 2PUXB 3B9FH 1XVMA 4O3UA 3S9CA 1EP6A 5CHAB 4BOHA 2RA3A 1NBMD 3ITIA 3ODDA 1UVSH 2YMSD 5C5NA 2Z7FE 3LGTA 5C3NA 1T4UH 3SV6A 1YPEH 4K60A 2I6QA 4U01A 4WMEA 3SU3A 3NCLA 1J8AA 4B74A 2TBSA 4H42U 2A7CA 2Z9LA 1OWJA 2PV9B 1B0FA 1TAWA 6CHAC 3BTQE 1YPHC 3ESTA 4X1QU 2FP7B 1C1SA 2HALA 1EZXC 4CRBA 2R2WU 2C4FH 2HNTC 3ATKA 3PTBA 1PQ7A 2XTTB 4GHTA 2BLWA 3F1SB 3E16B 3M7TA 4UE7H 2TGAA 1BTWA 5KEDA 5HKKD 2P16A 2CK3D 4SGBE 4JZIA 1TGBA 2WINI 1C5WB 4MNYA 4DURA 3MWIU 2OC8A 1S81A 4H4FA 4IS5A 3MO6A 3TJOA 4JK5A 1KY9A 3W94A 2ZDAH 1E34B 1HAYB 1NRNH 5DG6A 4ABJA 5HMAA 1CGJE 1O32A 4U2WA 2J92A 3UOPA 1V2OT 2M2AA 3UNQA 1PFXC 5BRRE 4J2YB 1RIWB 1TB6H 2Q1JA 3EGKH 5AFZH 1THPB 3G01A 2HVXA 4H6TA 1Q3XA 1Z6JH 2HPPH 4TPYA 2GCTC 3MMGA 2UUFB 2VVCA 2BVXH 3PLPA 3DA9B 3SO3A 3Q3XA 2J9NA 3SI4H 1C5QA 1WDIA 2XBYA 5EW2H 2W26A 1MTSA 2BDGA 2W5EA 1ZZZA 1W11U 4I7YH 2PFEA 4B1TA 1YGCH 4KTUA 1EZQA 1Z1IA 4XBCA 4ZXXH 1O5EH 4YTAA 1JRTA 1TA6A 2YMSC 2V3MA 1BCUH 4ISOA 1CT2E 3T28A 4JZ1A 3A82A 4F49A 3F2GA 3U69H 1MKXH 2W6JD 4PROA 1UO6A 1TPOA 1VITH 4ACBA 1H8DH 1V2KT 2W7SA 4B2CA 5C5OA 3OU0A 1KMHB 3SU4A 3NZIA 3MO3A 4LZ4B 1ETRH 1C4V2 4M7GA 2ZHEH 1F0SA 3RLWH 1BTPA 3UPEA 2GVFA 3NK8A 4NWKA 1HB0B 3IWMA 1GBJA 4UFFH 1DSTA 3S9AA 1SB1H 3CS7A 1PPEE 2BVRH 2ZHDA 1ABIH 1NS3A 1C2FA 5E0HA 2BZAA 1XKBC 1DANH 1H8HD 6GCHG 2HGTH 1IHTH 5AFYH 1BRBE 1VKYA 3I77A 1NZQH 2G81E 2ZPQA 1LO6A 5DJ7A 1EJMA 1SLVB 2VIOA 1XX9A 1O5FH 4IC5A 2JH5D 3T25A 5F8ZA 2Z9KA 3DFLA 2OP9A 2J94A 1BOQA 2C8XB 3T2NA 1SGDE 3GDUA 4CR9A 2FI3E 3M7UA 4INHA 2J2UA 1HAOH 2SFAA 3KQ5A 1GL0E 1DE7H 1GDQA 1ZHMA 2SGFE 1GG6C 2V3OH 3FAOA 3PMBB 3QTVH 3M5MA 1CHOG 5DP4A 3DD2H 3BEIB 9ESTA 4Y6DA 4CBNA 4TSFD 3AASA 4Q2KA 1VCQA 1V2LT 1TRMA 1G36A 3GCHC 4HG6A 4TPIZ 3N99A 1ZSKA 3FOAA 1BITA 3KNXA 2YOLA 4WY3A 1JIMA 5DP6A 2ZU2A 2VH0A 4J1YA 4ASHA 1LHCH 3GY5A 4KTSA 3SU1A 5EXMA 1FPCH 1EZUC 1LHFH 4AYVB 2FYQA 5IK2D 2QF3A 1K1OA 1ARBA 1O3NA 2R0LA 4AGKA 2BX4A 4M9FA 1FXYA 4OS4A 4X2VA 3RXDA 2HLDD 1BRUP 4I8HA 1GCTC 1H1BA 3M5LA 1XM1A 1DXPA 4CRGA 1OWEA 4OS6A 1AGJA 1FY5A 1MH0A 2ZGBH 1WQSA 4UEHH 1ZR0A 2FOMB 1MTWA 1QJ6B 1INCA 3VG8A 5B6LA 1P04A 1THSH 1LVOA 1AVWA 1OS8A 1S5SA 1J17T 3EE0B 2HRVA 4RKOB 1OXGA 1WYKA 1HRTH 1DXWA 4WMDA 1JXPA 1QRZA 5JYIA 1MKXK 1O2PA 2THFB 1GHBG 1Z71A 2BYAX 1GI9B 4X6OA 1D3PB 3W1EA 1BDAA 1BRAA 3KL6A 1IQMA 1YYY1 1NFWA 2W3IA 3GY3A 2OLGA 1SBWA 2KAIB 5JBAS 2BX3A 3A7XA 4MNVA 2AIQA 1QBOA 3SJ9A 3LJJA 3SHCH 1SL3A 4JZDH 1A1RA 1IQKA 1QL7A 1SG8B 3SBKA 2Z3EA 1HAXB 4CHAB 1NU7B 2VIPA 2P93A 3HGPA 3VB7A 4JYTA 4XD7D 1DT2A 2YNBA 1O3MA 1SGEE 1ZRKA 4AGJA 1HUTH 1ETSH 2NU3E 3CP7A 1HCGA 1GVLA 5L2ZH 1TQ0B 1TX8A 4FU7A 1O34A 3F9GA 1HFDA 2CHAB 2QF0A 1TBZH 4AFZA 3T29A 4Y0ZE 5L2YH 6LPRA 3HKIB 4D7FA 5KGOA 1TGTA 3I29A 3GCTF 3PROA 4FXGH 3BEUA 1TPPA 3GY8A 4NSVA 4BAHB 5FX6A 1TRNA 3RMLH 4YOGA 3SYJA 3VB6A 1O39A 2XC4A 1BJUA 3O8CA 2ZTZA 3TJUA 4NA9H 1QQ4A 3SHAH 1GBMA 2QAAA 1G2MA 4BANB 1FIZA 5EQRA 4Y71A 2P94A 3VXEH 1SQOA 3ZVCA 3ZZ4A 1O30A 1A2CH 5JPMH 2GTBA 1O2LA 1GI4A 1Y59T 1FNIA 1LPGB 2PTNA 2JJ1D 3QN7A 5HIZA 5A8YA 1AWHB 1VITF 3VGCB 4B71A 4Z6AH 1K1JA 4NIWA 4TYDA 1O3PB 1H8IH 1C5VA 2TGPZ 2AGIX 1F0TA 2ESTE 3BSQA 1CHOF 1K1NA 1GHZA 3RXQA 1C2IA 2TGDA 1O2OA 2BD4A 5FXLA 4K8BA 4KTCA 3TK6A 1ELTA 1L1NA 3HK3B 1P2IA 1BT7A 1TNJA 1O2XA 5CDFE 1NBME 4O03A 3BTFE 5C67A 1FUJA 5FX5A 1P2QA 2RDLA 2H9EH 2OBQA 5L6NH 4KELA 1AO5A 3LOXA 3SGQE 1N1LA 1VGCB 1YCPH 5FCRA 3SU5A 4FUGA 3S69A 4X2WA 1F0RA 1UHBB 3F3BA 5T6GA 1BMNH 1P06A 1ZSLA 3K2UA 1HYLA 2D2DA 4FUIA 2ZPRA 1H9IE 4MQAA 1RD3B 1WXRA 3WW7A 1ELFA 3A80A 5BPEA 1FDPA 8LPRA 1SLWB 1ZMNA 4CRCA 1G37A 3SUDA 2VB0A 1IQEA 2ZWLH 1D9IA 1YM0A 3TPIZ 2O8LA 1D3DB 1FLEE 2AS9A 4VGCC 2NU2E 1BMAA 1D6WA 4RKJB 1VJAU 1DDJA 2AMPA 4DG4A 1TNKA 4QT8C 1O3DA 5DSFA 3ATLA 2AFQB 8GCHG 1AMHA 1LMWB 2A7JA 2YMSB 1P05A 4IW4E 1GG6B 2GMTB 4Y7AA 1XMNB 1HNEE 3OFND 4MVNA 1QA0A 2JETB 5GCHG 4GPGA 4DGJA 3BTHE 2G52A 4FUCA 1GI1A 4X1NU 3A87A 3DSOA 1ELDE 1O2JA 1NY22 2TRMA 3MH6A 4UONA 3SGBE 1ZMJA 4FUEA 2A1DB 3BTDE 2Z6BD 2ZFRH 2Z3CA 1SOTA 1WU1A 4BTUB 5FBIA 3TLOA 4B2BA 1O2KA 1XUIA 3ZVAA 1ZGIA 2QA9E 1FJSA 3A8CA 1Q31A 4DT7B 3M5NA 1NC6A 4KP0A 2QF4A 2P3FH 4XSKU 3QZQA 1A61H 4NCYA 4CH8B 1OOKB 2VU8E 2C8ZB 1WQVH 1UTNA 3UFAA 4JYUH 3QUMP 1UTQA 1QY6A 2BTCE 2JJ2D 3UWJH 4A1TA 1SKYE 1DWCH 4BXWA 1N6XA 5GNDA 5C1XA 2ZGHA 3AW1A 1WV7H 3RMNH 4ZH8A 2G00A 3VGCC 1BUIA 2KCYA 3RXGA 5EJZA 1ARCA 5KECA 2VH6A 2DE9A 1GMHF 2YNAA 2SNVA 4MNXA 1C5OH 1MAXA 8KME2 7ESTE 1O2WA 1AZ8A 2G8TA 4B75A 1CQQA 1GJAB 4THNH 5EJLA 1EAIA 1OX1A 5FL7D 2CF9H 5K0HA 1C4U2 2A0QB 2XWAA 2ANKH 3EQ0H 5EQQA 3ZZ7A 4XRNA 3UUZA 1UTKA 4AN7A 3BTKE 1GJ8B 1RJXB 1SQTA 4FUFA 1CU1A 1GJCB 3RXSA 5ABWA 4ZXYH 4BXSA 2PUQH 4YT7H 1GCDA 1GBIA 1BTUA 3BF6H 3SOSA 3SNBA 5C2ZA 2BY9X 3A7YA 2HNTE 3U28C 2Z9GA 2ZHQH 4ZHLU 1EPTA 4JK6A 3P92A 1AFEH 4Y7BA 1ZLRA 2UWPA 1KLTA 2A5AA 1IQIA 2CN0H 1YPLH 5F6MA 3PWBA 3FVFB 3F2HA 1CT4E 1Y8TA 1O2RA 1DS2E 2F43B 1M9UA 3Q00A 2ZTYA 2OBOA 4K3JA 3MU4A 1Z7KA 2KR7A 1CBWC 2JKHA 1K0HA 2FPZA 2ZGJA 1UHBA 3SN8A 1JRSA 1PQAA 2ZQ1A 3V3MA 3RXLA 1Z8JB 1L1GA 4YT6H 1IHSH 2ZU3A 1WTGH 4FUBA 1GBKA 3PMJA 1SQRA 5DP5A 3E8LA 1KLJH 2ZF0H 3PMAB 4OS1A 1EOLA 4GCHF 1UCYE 1FIWA 2BQWB 5DGJA 1KLIH 2PR3A 3TK9A 2FS8A 1HAVA 1NESE 3KF2A 1NRRH 3V12A 2I6SA 4K2YA 5EXLA 1GHWH 4X1PU 1EB1H 2FLBH 4WXIA 3N7OA 1VJ9U 1V6DA 1ZTJA 3BG4B 2GT8A 4HFPB 2GV6A 4GSOA 4D76A 1Y5UT 2ALPA 5PTPA 3GY6A 3RMMH 3A8BA 1SHYA 1K1MA 4TY6A 5A8XA 3WWFA 1AE5A 2KFWA 3P8NA 1E1RD 3U1IB 3SNDA 3SI3H 2CF8H 1GJ5H 2Z9IA 1CVWH 2EI7A 4ZMAH 4K5ZA 2F4LA 2ZCLP 1UK4A 3UWIA 1G9IE 1IQGA 3LH1A 1BJVA 3C1KA 1KXFA 1QR3E 1C1MA 3GYLB 1K9OE 2GGVB 1P2NA 5AVDA 1BTHH 5HM9A 2RCEA 1J9CH 3M3TA 1AY6H 5IDKA 4LK4A 2BDHA 4TWYA 1MABB 1UTMA 1BRCE 1WCZA 1HAIH 2QGRA 1IQLA 2XRCA 1SGFA 1VITG 1EJNA 2ANYA 3SJ8A 3T62A 4JZFH 2PTCE 4MLFB 2C93B 2NWNA 5EQSA 2FO9A 2QY0B 2XYAA 2GDEH 2RDEA 1ORFA 2ZFTA 3A83A 1XVOA 2F9NA 1S0RA 3VB5A 3D62A 4BTTB 1OYQA 1WOFA 2PGBB 1UK2A 5ETXA 3E0NB 5F8XA 5GDSH 1Q2WA 2XCFA 3SGAE 1GGDC 1FN8A 2ZI2H 3HPTB 1VCPA 5TCCA 1LVBA 5E8EH 2FOHA 3FN8A 3CNRA 1C1NA 1H4WA 5DP7A 4U30A 3E1XB 4U32A 1TPAE 2ZECA 2ODPA 4BAOB 2EQNA 2ZZUH 3B23B 2A45B 3ELAH 1A3BH 2OQUA 3ZVDA 2M5TA 4AFUA 3M37A 1O5BB 1H9HE 2FEQH 1PQ5A 2XBWA 2Y7XA 4ESTE 1NRPH 1Z8GA 2FI4E 3WY8A 1MBMA 1P10A 3SZNA 2ZDKA 5CMXH 1MAYA 5FBEA 5IYTA 4P02A 3GISB 2BZ6H 2QC2A 2EC9H 2H2ZA 2PWXA 1LCYA 4X6MA 3M35A 3PV4A 3UNRA 1A5IA 2ZPSA 4AC9A 1C1UH 1LKAA 2XBVA 3F2FA 2OD3B 3A86A 1TX7A 3E0PB 3CENA 4RI0A 1MTVA 3SZEA 1O2GH 3A7WA 1GBEA 3LH3A 3ODFA 2D26C 4NFEA 5TJXA 1DVAH 3BG8A 1YWUA 4E7RG 3PLBA 2AYWA 2Y5GA 3K6YA 1ESAA 2BLOA 4D8NA 4JYVH 1PPBH 2J98B 1DICA 1TMUH 3QWCH 4I33A 2XNIA 2KCPA 3AAVA 3RC5A 1BMMH 2BY5X 2ZCKP 2QXGA 2PKSB 2ZCHP 4YM9A 2A4QA 4YOJA 4DT4A 3OE7D 4ISLA 2KM0A 2PSYA 3PRDA 1YF4A 3NPSA 1MMJN 3E3TA 3RXTA 1P2KA 1Z8IB 1EPTB 5EG4A 4ACAA 5FPTA 1TGCA 2AMQA 2Y5HA 3U1JB 1FN6A 2HNTF 4WH6A 1WBGB 1SMFE 3KN2A 1H9LB 1HJAB 4F4OC 4RT1A 5K7RA 3IG6B 1O33A 1LQDB 1YCPM 4Y76A 1DY8A 2ZQ2A 1TBQH 1UVOA 2K8IA 2VWNA 3A85A 1D4PB 7LPRA 1GI7B 3RP2A 2Y7ZA 5EU8A 1TPSA 1BBRH 3L6PA 1EP5A 2PP6A 1W2KH 3TNTA 1F7ZA 4CHAC 5EIYA 2JH0D 4UFGH 3AVZA 1MCTA 3URDA 4IN2A 2VWMA 4LZ1H 3RXHA 4NWLA 4XFQA 5SGAE 3H7OA 1FQ3A 3KYFA 1SGTA 2O8MA 1DITH 1G3EA 3A81A 2WSSD 1YBWA 3VEQB 2JETC 1BMFD 1KSNA 3UIRA 2Q6FA 1RXPA 3RXVA 2EA3A 2Y6TA 4XOJA 1SGRE 1XXDA 1DLKB 1BQYA 3MI4A 2QYIA 5C1YA 1L2EA 2AGGX 4E05H 1GJBB 2BD2A 1YPKH 4UFDH 2XCNA 2XW9A 5E2OA 2SGQE 1IQFA 2C90B 1P2OA 1T8MA 1DUEA 2BD3A 1QTFA 3PRBA 2JDID 3ZZ5A 2BDYA 3U8RH 3ZZDA 1J14A 3LGIA 4FVBA 1CE5A 4MNWA 1K1IA 4I8KA 5J4QA 3GY4A 2LPRA 4GAWA 1O2IA 3O8DA 1GPZA 4FUDA 3L3TA 2GJGA 1O2VA 1QZ8A 1F5LA 1EQ9A 1ELBA 1YPGH 4AG1A 1AI8H 2ZEBA 4JCNA 4INKA 5C94A 2ZO3H 1TMBH 3PMHB 1FY8E 3P8OA 1ZYOA 1GI3A 1Y5AT 1C1TA 4UD9H 2GKVE 4AB9A 4RN6A 1GI2A 2WPMS 1C2KA 1O3LA 1OKXA 3ATMA 5DN6D 1L4DA 3N7EA 1GWAA 2Z9JA 1MTNC 1S6HA 3K65B 2FYRA 2K1QA 1N8OB 1GGDB 7GCHG 3F0PA 2BMGB 1JWTA 4B76A 3FKSD 4KGAA 4E06H 3SV9A 2ODQA 1C5PA 2PGQB 1GMCG 4CRDA 1L1JA 1W0ZU 5F53A 1KXCA 4A6LA 2G51A 1A7SA 2WV4A 4A1XA 2BD9A 2V6NA 4YZUA 3MHWU 1SLXB 2ZFFH 3RUOA 1VGCC 4K1SA 1O2SA 3OEED 2HOBA 4XE4A 1YP9A 3TK5A 2H6MA 3BEFB 2H5DA 3SQEE 3PV5A 3FP7E 1HDTH 1SGQE 1UK3A 2ZU5A 1PJPA 1O3FA 1DUAA 1W10U 2C3SA 4BAQB 9LPRA 5EJ1A 3UR6A 1O3GA 2WPDD 2R0KA 1XKAC 4ZHAA 3LJOA 1G2LA 4DJZB 1SGNE 3GICB 2VBCA 1O3HA 2ZIQH 2ZTXA 5JBTA 1MD8A 2BXUH 1C1WH 1C4Y2 1C2MA 2STAE 5I46H 2ZC9H 2WYGA 5GJ4B 1G3BA 1T8NA 2IPQX 3DHKH 3EA7A 2FOCA 3TH2H 4ABFA 3RDZA 1PPGE 1P8VC 1CGIE 1GI5A 1D3TB 3KYGA 1UVUH 1FV9A 1T7CA 3SORA 2OC7A 1BMLA 1FMGA 1EATA 1MBQA 2ODYB 3KCGH 3QZRA 5B6OA 1A4WH 2O8UA 2VIWA 3KQCA 3VB4A 4NIXA 3M61U 1QB6A 1C5NH 2VNTA 2AH4X 1HJ9A 2HWLB 5L30H 2FOEA 1TX6A 2R3UA 3TH3H 3MFJA 3ZZ6A 5F03A 1SFQB 2QIQA 2WHXA 3RXKA 1W3CA 2QXIA 2L6OA 3AK5A 3SQHE 6CHAB 2P3UB 1Y5BT 3GCTG 2BDBA 2A32A 4GLYA 4AYYB 4CR5A 1BBRE 2XC0A 1J16A 1P01A 3MYWA 4WXVA 1EZSC 2FOGA 1A0JA 5EPNA 4DOQA 1HAPH 2KCAA 4ISNA 4ZHMU 2K0QA 1Y3VA 1C1OA 3M5OA 1F5RA 5T3HA 4I8LA 1TYNA 4NIYA 4X8SH 2QXHA 1C5ZB 1MQ5A 2OINA 3BTGE 4NA7A 4ABBA 3DFJA 3U9AH 2GV7A 4CRFA 8GCHF 5GXPA 1O2NA 1NROH 3MQKC 3DUXH 1YKTA 1GHXH 2F9PA 3R3GB 2AIPA 3E91A 4DCDA 1O38A 3OYPA 1V3XA 4WMFA 1ZMLA 1COWD 1P2MA 2WZQA 5FAHA 1A5HA 1LHDH 1OWIA 2A5KA 3A89A 4BAKB 5LPEA 1SGIB 2H1UA 4MG3A 1DWBH 4RSPA 2L74A 5DO4H 2GT7A 1LHGH 1ANDA 3ZZAA 1S85A 2UUJB 3DCLA 5DP9A 1ESTA 5I25A 2AMDA 1V2NT 4X1RU
chains in the Genus database with same CATH topology
1UCYH 4HTCH 3UY9A 1TMTH 1WAYB 4Y0YE 1TA2A 1OSSA 2ZG0H 1ZTKA 4YO9A 2ZDNA 3P8FA 4DIIH 1JMOH 1TRYA 2WUCA 3S7KB 1PPCE 2ILNA 1MU8B 1ELAA 3MNXA 5A0CA 1QFKH 1VR1H 2ZU1A 1ELVA 1CO7E 3FZDA 2D8WA 4NIVA 1SGYE 2RA0A 1PPHE 4FU8A 7GCHF 1FAKH 1P11E 2CHAC 3BIVH 1E37B 2F9VA 3GDVA 2B7DH 1GBAA 1BTZA 4TY7A 1PQ8A 5EXNA 1EB2A 1NFUA 2SGDE 3EDXB 4WWYA 1IQHA 1EXFA 1ZJKA 2BLQA 2UUYA 1CA0B 1B0EA 1FY4A 1QQUA 1UJ1A 2ANMH 3RU4T 3ZV8A 3T26A 1PPFE 3QK1A 3P8GA 3BTTE 2PHBA 4A92A 1GDNA 1CBWB 3LC5A 3Q3YA 3RXMA 2VIQA 4CREA 1ID5H 2PLXA 1C1PA 1ZPCA 2GZ7A 5GCHF 3ZV9A 2Q6DA 4LXBH 1TFXA 3RM2H 5AF9H 4K8YA 1AFQC 2Z3DA 1T31A 3M3SA 3SV2H 1ZPBA 2TGTA 1GHVH 1KXDA 1OWKA 3EAJA 1PYTD 2H9HA 5JB8S 2GCHG 2HPQH 3SV7A 3OTJE 3STJA 1Z8RA 1JOUB 5EGMA 1V2TT 2WYJA 1HV7A 3RC6A 4BTIB 1A46H 1QB9A 1ZHRA 4D9QA 5EODA 1OP2A 3MOCA 1DM4B 1HAVB 3Q76A 1LDTT 1BTXA 2G4UA 1HAHH 3ZZ9A 2QV1A 1GMHG 3O8RA 3MTYA 3ZZ3A 4Q7ZA 2BDIA 4OGYA 1O2QA 1G3DA 1EASA 1C9PA 3KQDA 1GBHA 1ZOMA 4HI3A 1GBBA 2VIVA 5JDUB 3VB3A 2CGAA 4AB8A 1OYTH 1C5MD 4CBOA 3ZYEA 2BY7X 2ULLA 2P8OB 4Q7XA 1GBFA 1O2HA 1XUKA 2Z94A 1O2ZA 4NGAH 2ANWA 2V0BA 2O8WA 1AHTH 1QJ1B 5TCAA 1YPMH 5HYOA 1SHHB 4CRAA 2J95A 1C5YB 4ISIH 1HAZB 1RTKA 1YPJH 5A0AE 3GCNA 3LGWA 4Q80A 1DY9A 1C1RA 2ZDMA 2QN5T 1FONA 1DSUA 1P57B 1O3BA 4NA8A 1EOJA 3QO6A 3V13A 1C5RA 3UQVA 3T27A 1PYTC 3TGIE 3KIDU 4X8VH 1ZPZA 3SJOA 3EA8A 3MNCA 1S82A 5LPFA 1YLDA 3MO9A 1FPHH 2FESH 1MKWK 2BDAA 1XXFA 3RXUA 3GY2A 2PKAB 4I8JA 1DOJA 1P2JA 2A4GA 2GX4A 3F9HA 3S7HB 3QDZB 4AG2A 2OTVA 1RIWC 3A7TA 3ENSB 1T8OA 1K28D 1BB0B 1UTOA 3HKJB 1CA0C 2FOBA 1V2RT 5LGOA 3SW2B 1KIGH 1BTYA 2ZGCA 3V7TA 1RTFB 3DT0H 3VFEA 1AVXA 1ZSJA 2Q6GA 4O97A 1TNLA 1GJDB 5DPAA 3PO1C 2D1JA 1EKBB 1BBRK 4AFQA 1ZHPA 4Y8XA 1GJ9B 4X8TH 1DPOA 3TH4H 1RFNA 1XUFA 1BHXB 4ABEA 3A7VA 4X2XA 1TNGA 1C5TA 1W12U 4WF8A 1YPHE 5FPYA 1V2JT 1LHEH 1MZDA 1P9SA 1ELGA 1THRH 4B2AA 1RRKA 1AQ7A 5EW1H 1AB9B 1NRQH 1GBCA 2DUCA 2ZNKH 4BAMB 1C5UA 2J4IA 3QGJA 1QA7A 3UQOA 1T32A 3F9EA 3KQBA 4ABDA 3L33A 3D65E 1CT0E 2B5TB 4HGCA 2BQ6B 1O3CA 3TVJB 2Y81A 3RLYH 1FZZA 2J34A 3PLKA 2BM2A 2EEKA 3SUEA 1ZJDA 4WVPE 4AX9H 1Y3WA 6ESTA 3HK6B 3U8TH 1K22H 3PTNA 3RXFA 2SGEE 4Y11E 1TONA 1NPMA 2W7UA 3LC3A 1EX3A 1NTPA 1TWXB 2F9OA 3MH7A 2FS9A 2G55A 4AZ2B 2GCHF 1X7AC 3SJKA 1K21H 1S83A 2UUKB 3GCOA 2BXTH 1A3EH 2A2QH 1QIXB 2ZP0H 5JB9S 1MTNB 4YLQH 3E90B 3MU8A 1GBLA 1KYNA 2ASUB 2VGCB 1SLUB 2WPLS 3K6ZA 3VPKA 3V0XA 1KDQA 1O36A 1G3CA 4X1SU 2BY6X 4YLUA 1GL1A 1J15A 1P09A 1LPZB 2GCTB 3W95A 2VVUA 1V2VT 3PYHA 1O31A 1EAWA 3GCHB 4A7IB 5GWZA 1CA8B 1W8BH 3KEEA 4OS2A 4ABIA 1K2I1 2F9UA 4FU9A 1P0SH 2XBXA 4DVAU 3GY7A 3JZ2B 3M36A 5FPSA 2BB4A 3F6UH 1HIAA 2NU1E 2ZGXH 1V2QT 3ATWA 5F8TA 1S6FA 2O9QA 4YESB 2Y82A 1QHRB 3BTWE 4I8GA 2BLVA 4DY7B 1C1QA 2C8WB 4MDSA 4MTBA 4TWWA 1KTSB 2ZFQH 4D9RA 3KHVA 1T4VH 2JH6D 2WPHS 4KKDA 4ZKNU 2IOTA 2A4OA 4IMQA 4YOIA 5A2MH 1FY1A 3FP6E 1MU6B 4FUHA 1C5SA 2DE8A 1O3KA 5E0GA 5DKMA 2R2MB 1O5GH 1V2PT 1TABE 3UR9A 1W13U 5DP3A 2UWLA 2ALVA 3ZVEA 1D3QB 2BQ7B 4D7GA 2ZHWH 4IMZA 1DWEH 1AU8A 2A5IA 1SVPA 1Y3UA 1P02A 1AZZA 2FZZA 2B9LA 2P3TB 3ZVGA 3EYDA 1GJ7B 1NFYA 4CH2B 1XUGA 1KXEA 4HZHA 4IBLH 3VXFH 3U98H 1HAGE 1GI0A 1Z1JA 3SUGA 3TGJE 1EUFA 1V2ST 1TOCB 1ESBA 1C2LA 2J38A 1T8LA 4ZKSU 2F9BH 2A31A 2G5NA 4K69A 2CV3A 1VZQH 3ZVBA 1HGTH 4IC6A 1C2HA 1ACBE 1O3IA 1P3EA 3OSYA 1QL9A 3P17H 1HIAB 4BNRA 3TITA 1UMAH 2BVSH 2FMJA 3ZZBA 1HBTH 2SNWA 2FTMA 3OY5U 1LTOA 3RMOH 3LGYA 3RU4E 1BIOA 1GCTB 1UTPA 2F91A 2VGCC 3BN9A 3D23A 3E6PH 3SNEA 1QL8A 5H4IB 2B0FA 2ZDVH 1KDQB 2PSXA 3RXPA 1ELEE 1O0DH 1GHBF 2G5VA 2UWOA 3S0NA 3F68H 1NN6A 1MZAA 1D6RA 2R3YA 2H9TH 4IN1A 1XUHA 1QRWA 1LPKB 4WH8A 3LU9B 2AERH 1RTLA 1ZTLA 3RM0H 2FM2A 2STBE 1NM6A 5T6FA 1WUNH 1ANCA 1ANBA 4IGDA 1E35B 4O9VA 1C2JA 1MCVA 3A8DA 1QB1A 5JBCS 1ETTH 3PO1B 1HLTH 1ZRBA 1K1LA 2ZHFH 2GMTC 2OC0A 4XBBA 3PWCA 3UOUA 3QTOH 2GZ9A 1O2YA 1GHAF 3RU4D 2Y80A 1P03A 3PB1E 1YLCA 1ZGVA 1QNJA 2WPKS 1O2MA 3T5FH 1F0UA 3UREA 1DLEA 2CXVA 3HGNA 5E2PA 3SNCA 1O35A 1UTJA 1L0ZA 3LGUA 3ZVFA 4XBDA 4NZQA 3FFGA 2FX4A 2NU0E 5CE1A 1PPZA 2XC5A 3AW0A 4SGAE 1QCPA 2BD8A 4UDWH 3O8BA 3RC4A 1EAUA 1O2TA 3I78A 1O37A 3STIA 2WV5A 2FI5E 2GP9B 3HATH 2SGAA 1G32B 4ABAA 1S0QA 3FANA 2OXSA 2CMYA 3LT3A 1N6YA 1O5CB 3SNAA 3NUMA 4LOYH 5C20A 1TNIA 1GMDF 3SU6A 3RXJA 1UCYK 2ZA5A 4K1TA 1LKBA 1TOMH 3UNSA 4DIHH 1CGHA 1NRSH 1IOEA 1HJ8A 3B8JA 2EI8A 4Z0KA 1F5KU 1MKWH 2GDDA 1AKSB 3K9XB 2ZKSA 1SC8U 2BD7A 3QLPH 3JZ1B 2VINA 1AD8H 1GVKB 5A0BA 3UTUH 3SV8A 4OGXA 4AORA 2XXLA 3P70B 4MPXA 1GMDG 1MQ6A 4K1EA 5ESTE 1QURH 2TPIZ 3R0FA 2AGEX 2KAIA 2FWWA 1FY3A 1V2WT 1DFPA 1OP0A 1QGFA 2Y5FA 2V35A 1NO9H 3IITA 1GHAG 1C2GA 1EAXA 1TGSZ 1OP8A 2GZ8A 1C2DA 2BY8X 1HPGA 2QCYA 3M3VA 3Q3KA 4UFEH 5A09A 3OX7U 4GHQA 3RXOA 5J4SA 1GI6A 1ELCA 3SU0A 1K1PA 1C9TA 1SR5C 1O3JA 1E0FD 1FI8A 1UVTH 2FTLE 2OUAA 3S9BA 4NSYA 1AE8H 3A7ZA 3LKWA 5GIBA 4ZROA 1TBRH 2BDCA 4GCHG 2FODA 4X6NA 3URCA 1UVPA 3NKKA 3MNBA 2ZU4A 5GPIB 1LVYA 1Y3XA 1HXEH 3LDXH 4ZKRU 4NFFA 1RGQA 3U8OH 5HGGA 5CHAC 1YC0A 3RXAA 1ABJH 1AFQB 3BIUH 5EOKA 2SGPE 1GJ6A 1FAXA 4Y8YA 2PKSC 3LPRA 1SFIA 1LQEA 1A0HB 1O3OA 5HXFA 1A5GH 2OC1A 3MNSA 1IAUA 1BA8B 1F2SE 3H7TA 4MPVA 2W3KA 2PW8H 1AB9C 4OS7A 4XDEA 4H6SB 1W7XH 1EPTC 4I31A 3MU1A 1O3AA 2XWBI 8ESTE 2P8OC 3KGPA 5C1UA 3MH4A 3MH5A 4JZEH 3GDSA 2VWLA 1HJAC 4ISHH 1L4ZA 1GBDA 1TE0A 3FP8E 2H5CA 2RG3A 3KQEA 2F3CE 2OQ5A 1QJ7B 4INLA 3M7QA 3TGKE 6GCHF 3SU2A 4Y8ZA 2R9PA 3LONA 4R8TB 1SPJA 3ZZCA 5FHTA 2WPJS 1KXAA 5AHGH 1C5LH 2B8OH 4ABGA 1P9UA 4Y79A 2VWOA 3TNSA 1GMCF 3BTEE 2FLRH 4X8UH 1XUJA 1C5XB 3P95A 1GVZA 3OY6U 3CS0A 2BHGA 5LH8A 1TQ7B 1DWDH 3NXPA 2A2XH 2VIDA 3RXIA 1OWHA 1TNHA 1LVMA 1IQNA 1MD7A 3H5CB 3RXEA 1SQAA 2VJ1A 3GOVB 1TGNA 4X6PA 4B73A 1A0LA 1F92A 4FUJA 1S84A 2P59A 1DX5M 1TLDA 4ZAEA 1WTHD 2O8TA 2ZDLA 3GYMA 1JBUH 1ANEA 2G4TA 1W7GH 5A8ZA 1AUJA 1TIOA 5T6DA 1NU9A 1QBVH 4ABHA 5DK1A 1C2EA 2P95A 4A1VA 5ESBA 3A8AA 3A84A 4WJG2 4JMYA 4FVDA 1W0YH 2QXJA 1SSXA 1QRXA 3A88A 2AEIH 3RXRA 2TIOA 1BHXF 1AKSA 3SUFA 4AOQA 2NU4E 1IQJA 1BZXE 3BTME 3MU0A 2FDAA 1SOZA 2FX6A 4X2YA 1U6QA 3MU5A 2BOHB 2PKAA 1EJAA 1O5AB 5DP8A 4AFSA 1SGFG 2FXRA 3QX5H 4A5TS 4NG9H 4OS5A 1P12E 1AIXH 2ZFSA 1OWDA 3TJNA 2WPIS 3Q77A 1O2UA 1QBNA 2BOKA 2ZFPH 3AAUA 2FIRH 1W14U 3TIUA 1GI8B 2IN2A 3SJIA 1N8OC 3P6ZB 4O3TA 2VVVA 1GHYH 3ZYDA 1TALA 4MPWA 1CSOE 2F83A 1SI5H 3ZZ8A 1E38B 4GVUA 5EPYA 1GDUA 4DW2U 2BD5A 1Z6EA 1GJ4H 5E0JA 1V2MT 1GBTA 1JIRA 4ZUHA 1NT1A 1RS0A 5JBBS 1VCWA 1SGCA 3C27B 3RXBA 2OCVB 4E7NA 3LIWA 4R0IA 1AWFH 1C1VH 3LGVA 3PM3A 2FOAA 5G4BA 3D49H 2HLCA 1KTTB 2A7HA 3RXCA 1OPHB 3TJVA 5FCKA 4NZLA 2FOFA 1AVGH 1E36B 5HM2A 2A4RA 2EI6A 1Y3YA 4Y10E 3NWUA 3QGNB 1WSSH 7KMEH 1MTUA 2CJIA 2GD4B 3FZZA 3BV9B 4ZKOU 1B7XB 1YCPK 1HXFH 3F9FA 2C8YB 2IPHA 4Q7YA 1SGPE 4X0WU 4VGCB 3TU7H 1P3CA 1O5DH 2WUBA 4GUXA 4MPUA 4I32A 1B5GH 3EA9A 1G30B 5LPRA 3BG4C 3ATIA 1UTLM 1CHGA 1V2UT 2LNCA 1O3EA 1MUEB 1AUTC 1NFXA 2IJOB 1AN1E 2V3HH 1KXBA 2PUXB 3B9FH 1XVMA 4O3UA 3S9CA 1EP6A 5CHAB 4BOHA 2RA3A 3ITIA 3ODDA 1UVSH 5C5NA 2Z7FE 3LGTA 5C3NA 1T4UH 3SV6A 1YPEH 4K60A 2I6QA 4U01A 4WMEA 3SU3A 3NCLA 1J8AA 4B74A 2TBSA 4H42U 2A7CA 2Z9LA 1OWJA 2PV9B 1B0FA 1TAWA 6CHAC 3BTQE 1YPHC 3ESTA 4X1QU 2FP7B 1C1SA 2HALA 1EZXC 4CRBA 2R2WU 2C4FH 2HNTC 3ATKA 3PTBA 1PQ7A 2XTTB 4GHTA 2BLWA 3F1SB 3E16B 3M7TA 4UE7H 2TGAA 1BTWA 2P16A 4SGBE 4JZIA 1TGBA 2WINI 1C5WB 4MNYA 4DURA 3MWIU 2OC8A 1S81A 4H4FA 4IS5A 3MO6A 3TJOA 4JK5A 1KY9A 3W94A 2ZDAH 1E34B 1HAYB 1NRNH 5DG6A 4ABJA 5HMAA 1CGJE 1O32A 4U2WA 2J92A 3UOPA 1V2OT 3UNQA 1PFXC 5BRRE 4J2YB 1RIWB 1TB6H 2Q1JA 3EGKH 5AFZH 1THPB 3G01A 2HVXA 4H6TA 1Q3XA 1Z6JH 2HPPH 4TPYA 2GCTC 3MMGA 2UUFB 2VVCA 2BVXH 3PLPA 3DA9B 3SO3A 3Q3XA 2J9NA 3SI4H 1C5QA 2XBYA 5EW2H 2W26A 1MTSA 2BDGA 2W5EA 1ZZZA 1W11U 4I7YH 2PFEA 4B1TA 1YGCH 4KTUA 1EZQA 1Z1IA 4XBCA 4ZXXH 1O5EH 4YTAA 1JRTA 1TA6A 1BCUH 4ISOA 1CT2E 3T28A 4JZ1A 3A82A 4F49A 3U69H 1MKXH 4PROA 1UO6A 1TPOA 1VITH 1H8DH 1V2KT 2W7SA 4B2CA 5C5OA 3OU0A 3SU4A 3NZIA 3MO3A 4LZ4B 1ETRH 1C4V2 4M7GA 2ZHEH 1F0SA 3RLWH