3A88A

Crystal structure of trypsin complexed with (e)-4-((2-nicotinoylhydrazono)methyl)benzimidamide (soaking 30 minutes)
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
molecule tags Hydrolase
publication title In-Crystal Chemical Ligation for Drug Discovery
rcsb
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a88A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a88A02
3ZZ4A 2PTCE 5E0JA 2H2ZA 3UQOA 1EAWA 4YZUA 5EGMA 4MQAA 1RTFB 1MBQA 2M5TA 4KTSA 1IOEA 1G3BA 2V35A 3ZYEA 3VB3A 1AD8H 1BBRE 2EI7A 4I8JA 3S7KB 1THSH 4NIWA 5I25A 4TY6A 1PQ7A 2ZDLA 3SNEA 1QB6A 1NU9A 1HAVB 2R9PA 2FZZA 1LKBA 1UTLM 1ZMJA 1GBCA 3TIUA 2QA9E 4YESB 1DS2E 2NWNA 1AVGH 3LC3A 3G01A 2HGTH 3FVFB 2F3CE 1SGDE 3SU1A 1HAVA 1Z6EA 4FVDA 1S0QA 5T6DA 4E06H 1TX7A 1EP5A 5EQRA 4ZH8A 1PJPA 1YPHC 1TPSA 5EW1H 3P8FA 1JBUH 3SI3H 3RXMA 1TGCA 8LPRA 1C5VA 1KXFA 1N6YA 3H5CB 3T28A 1K21H 1ELVA 3SNBA 4ESTE 3M3TA 4UONA 1O34A 1SVPA 1GI5A 1O2MA 1UCYE 1FMGA 1A46H 1LHDH 1XKAC 4X8UH 1C9PA 5EU8A 2ZPRA 1RRKA 1O3NA 3P8GA 3K6ZA 2A7JA 1O3LA 3PLBA 4UE7H 2GMTC 3TH4H 1E38B 2PKAA 1D3DB 1S6FA 1C1QA 2ZP0H 3MO3A 1IQJA 1VITF 3RXLA 2SNVA 1C1UH 1QBOA 4BXWA 3U8OH 1NESE 4F4OC 1ZPBA 5L30H 2NU3E 2PHBA 3M5LA 4YLUA 1O37A 3F9HA 2ZHDA 2Q1JA 1DWDH 1NZQH 4X8SH 2J95A 1JIMA 4D7GA 1GHZA 3ZZ7A 1ZHRA 2NU2E 1P05A 1O3GA 2GP9B 2UUJB 4DT7B 1GHBF 5I46H 2GZ9A 3RXKA 4D76A 2C90B 1C5UA 1VJ9U 1DOJA 5HYOA 2OINA 1ESTA 1IHSH 5JB8S 5C1UA 4INHA 3GDUA 1LHFH 2ZHQH 2ANMH 1AHTH 2EI8A 1O2HA 3BTFE 5PTPA 1TRNA 4VGCB 3PWCA 1UTOA 1QQUA 1A3BH 3MO6A 5JBBS 2ZU2A 3ZZDA 3E90B 1TPPA 1LPZB 1AFQC 3SOSA 1DXWA 1BOQA 2CXVA 1CA0C 1KLTA 1BMMH 1PPGE 2ODYB 1SPJA 3FFGA 5C5OA 3FZDA 3U9AH 2ZGXH 1MKWH 3SUFA 1C5SA 4O97A 4A1VA 1C2HA 3DHKH 1UHBA 2GCHG 1BTWA 1YPKH 2PUXB 2VWMA 2ZTYA 4DVAU 2AIQA 1CT2E 1NRPH 1GI6A 1D3QB 3A81A 1FY3A 1IQFA 1DDJA 4H42U 5H4IB 1HJ8A 1AU8A 2F91A 1NFXA 2XXLA 4WMDA 8GCHF 5E2OA 1GBEA 1GJ6A 3MU4A 1UTKA 1HXFH 2JETB 2QCYA 1F0SA 3TNTA 1K2I1 1TA6A 2ZU4A 2DE8A 3EA9A 3MH6A 2WUCA 1XVMA 2FWWA 4INKA 4TPIZ 3UR9A 2J34A 1W7GH 5JDUB 3ZYDA 8ESTE 2A2QH 2A1DB 4NG9H 3LPRA 3SJKA 1LVYA 1AUTC 2HNTC 4X1QU 1T8MA 3FANA 3MFJA 1BMAA 2BD8A 4LZ4B 1EX3A 1Y59T 3I77A 3RXIA 1DX5M 1HBTH 4LXBH 1CHOG 2AFQB 2H9TH 2Y5HA 4K2YA 1WAYB 1T8LA 3L33A 1VJAU 2P3FH 3VXEH 2GT7A 2A5KA 1HXEH 2OC8A 2XRCA 3K65B 4K3JA 1K28D 1ZR0A 1TAWA 4NIXA 2PR3A 1FAXA 1ABJH 2PFEA 3L6PA 1QJ6B 1C2KA 1DE7H 1DPOA 7GCHF 1P3EA 1KIGH 3MOCA 4MNVA 3DD2H 1LQEA 1BTHH 2A45B 3SJIA 5F6MA 2QXJA 1CQQA 4FUDA 5DP3A 1PQ8A 1FV9A 1EJNA 1YBWA 3QZQA 4Y8XA 1OWEA 1SGNE 4X6PA 4GCHF 2OC0A 4Y8ZA 1BHXF 3UOPA 1MQ6A 1FPHH 1G2LA 1O3HA 2HPPH 4IGDA 4A6LA 5JB9S 2BX3A 1T7CA 4X2WA 2CN0H 2QC2A 1QCPA 1P09A 1SGEE 3RXFA 3T27A 2P59A 2JETC 5AHGH 2A7HA 3GYMA 4FUJA 1O2UA 1OPHB 1O3IA 5GDSH 3TH2H 2AGGX 9LPRA 3KF2A 3TVJB 1MAYA 1ARBA 3E1XB 3A7WA 2V6NA 1S81A 2OXSA 2XC5A 4FXGH 3PMJA 1H8DH 1QRWA 1O2GH 1P06A 2QAAA 3AVZA 1O5GH 3NUMA 3ZV8A 1DUAA 2I6SA 1AB9B 2ALPA 1TRMA 1GG6C 5L6NH 3A7TA 2QY0B 3LJOA 1W3CA 5E8EH 2FOHA 1N8OB 3HPTB 5FBEA 2O8MA 4I8HA 4Y7BA 5TCCA 3PMBB 1CHOF 1QTFA 2GTBA 2BD4A 4WMEA 2PW8H 4K1SA 1HIAA 5A8ZA 2ZC9H 1LCYA 1QRXA 3TGJE 3M61U 3ZVFA 3SHCH 1RJXB 1VCQA 2C8WB 1BTPA 2PGBB 3JZ2B 3PMHB 3E3TA 4Y79A 2BQ6B 1T8OA 2IOTA 2A4QA 4U30A 2BVXH 1LHGH 1BTUA 2STAE 2SGAA 2D2DA 3LGYA 1BRAA 1ZHMA 4Y11E 3TNSA 4X6MA 2BQ7B 1GBAA 1GHAG 3UTUH 2Q6GA 4O3UA 4AFQA 1F5KU 1C1NA 2D1JA 2XCFA 1TX8A 5F8ZA 2G51A 1F0TA 3C1KA 4YLQH 3KQDA 1MMJN 2Y82A 4ZHLU 2JH6D 1DT2A 4JZIA 4K5ZA 4AORA 2ZHEH 2QV1A 3SQEE 2ANWA 2O8UA 2F9BH 2IPHA 2AGEX 2CHAB 5FAHA 4MPVA 1SC8U 4UEHH 1P2IA 1A7SA 1HRTH 2ZGBH 4AN7A 3LGWA 3ZVCA 2O9QA 3TK9A 1HJ9A 1XUIA 3M37A 2P16A 5FPTA 1XKBC 1OS8A 4X8TH 2ZEBA 1PPBH 1C5TA 1SLWB 1GGDC 3STJA 1CO7E 1KLJH 1Z8RA 3TLOA 1P11E 3MWIU 1BTYA 3FZZA 1X7AC 1LQDB 1Y5BT 4ZXXH 2OBOA 1AZ8A 1LDTT 3F9FA 4KP0A 3K6YA 3NWUA 1UVUH 2XCNA 1FY8E 2OBQA 4AZ2B 1ELAA 5FCRA 2ZFRH 4BAKB 1DFPA 1AIXH 4J1YA 5A0BA 4U2WA 3A8BA 2CGAA 1O3OA 3LH1A 1T4VH 1GBFA 4WH6A 2ZCKP 1SQTA 2H5CA 1WCZA 1KLIH 1KSNA 2ZGCA 1AGJA 5LPRA 1HB0B 2IJOB 1A2CH 4X6NA 4BANB 1AFEH 2Z3CA 4AGKA 4B2AA 1WTGH 2BD7A 3AASA 1C1VH 3B9FH 3EGKH 2TRMA 3PV4A 1TB6H 5HM9A 3ZZCA 1TOCB 4X2VA 1AE5A 1VR1H 2ZCLP 1OP8A 3NPSA 1FNIA 4ABEA 1TMTH 2VIQA 1GBDA 1XUHA 2WUBA 2ZQ2A 3A8DA 1BIOA 3GY6A 4R0IA 1L4ZA 1NT1A 3S9BA 4DY7B 4AGJA 3LDXH 1ETRH 2C4FH 4Z0KA 2Z9LA 1OP0A 4IN2A 4JYUH 2BY6X 2XBYA 2RDLA 2XC0A 4NZQA 1L1JA 3ESTA 2VU8E 6GCHG 1SOTA 1ZJDA 3LIWA 3BTME 4Y76A 1OP2A 3RXJA 1C5QA 3PLKA 4IW4E 1DITH 2H5DA 3SNAA 1S85A 1O5DH 2BXUH 2PSXA 4MPUA 1IQMA 1EXFA 1WU1A 1O2VA 2J2UA 4OGYA 5A8XA 2QXHA 3GCOA 3K9XB 1V2OT 3RXRA 1F5LA 5CE1A 1LVOA 3R3GB 4E05H 3T5FH 1HAOH 1S84A 2FO9A 1SGFG 3F9GA 3M5OA 1AO5A 1TABE 1VCPA 4ZUHA 3RLYH 3RXAA 3BTDE 2HRVA 2ZU5A 3KQEA 4F49A 2PV9B 1FIWA 3BEFB 1O2TA 1O0DH 2WPJS 1GI4A 3ZZ6A 1HAHH 1GJ7B 1O3CA 1ZRKA 2VWLA 3GY8A 3MU1A 3M7UA 1QB9A 2BDGA 1TPOA 1YPHE 2BOHB 2Y7XA 4H6TA 1K1LA 4SGBE 1SQOA 2NU4E 2A5AA 2UWOA 3KQBA 3BIUH 1HUTH 1MZDA 5BPEA 1BITA 1O5EH 1SR5C 3LGTA 1XUGA 1GMDG 3LGIA 1K1JA 4MPXA 1AKSB 1GMDF 5SGAE 2ANYA 3A88A 1GJ8B 5AFZH 3QK1A 1CBWB 1A4WH 2CHAC 3RUOA 1WTHD 1QGFA 1KTTB 2ZIQH 3A8CA 4U01A 3KNXA 1D6RA 3MU5A 4CH2B 2ZHWH 1GI8B 1HJAB 1RTLA 2ESTE 1C5OH 2G4TA 1MU8B 2NU1E 1EASA 1OXGA 4NA7A 3BIVH 4YOIA 4ABFA 4X0WU 5FX5A 2ZDNA 1C2EA 1SLVB 1LHCH 2LPRA 3ZZ5A 2BDIA 1C5MD 1K1IA 4JYTA 2HLCA 1J16A 1C4V2 1UTJA 4GHTA 3LC5A 1BA8B 3E0NB 3P92A 4NSVA 4YM9A 5ESTE 4O9VA 1PPFE 1GJBB 1FZZA 1TRYA 3A86A 1UVPA 4AFZA 4NFEA 2BDCA 1EAXA 2Y81A 3PROA 3S0NA 1ZGVA 3RC6A 3SQHE 1F5RA 1K1OA 3S9CA 3VB7A 4LZ1H 5A2MH 5AVDA 3SGAE 3GCTG 3O8RA 1K1PA 1MBMA 1DICA 1GJDB 1WV7H 2BDYA 9ESTA 1GG6B 4IC6A 1P04A 4K1TA 2A31A 4YOJA 1C1RA 3L3TA 1J8AA 2QYIA 1TGTA 4CRDA 5L2YH 1SGQE 1O3MA 1BRBE 2R2WU 3GOVB 1GJAB 2BXTH 3B8JA 3GY5A 1TWXB 2HNTE 2FOBA 4FVBA 3RP2A 1Y3VA 2OTVA 4HZHA 2OQ5A 1KXCA 1RD3B 1ETSH 1P8VC 2HALA 4MLFB 4CRGA 6CHAB 5HGGA 1SGRE 2FTMA 1EAIA 3T2NA 5L2ZH 3O8DA 1QNJA 3V13A 1DWCH 1IAUA 1Z8IB 1NFUA 1GL1A 2BTCE 1W14U 2WINI 3AW1A 1UTQA 2FX6A 1P02A 4O3TA 1GBLA 4GSOA 1DSTA 1GVLA 1GJ9B 2ZI2H 3P8NA 5CHAB 2ZZUH 5ESBA 5FCKA 1UK2A 3ZZAA 1GJCB 3QWCH 5A0AE 1G9IE 1H1BA 1ETTH 4Y7AA 2ODPA 1GHAF 1MTSA 1BMLA 1GBBA 1S5SA 2P95A 1ELGA 1O3EA 4AX9H 1OWKA 1LPGB 2VIPA 1UK3A 1ZGIA 2VB0A 1HAYB 3HKJB 3RXUA 1OX1A 1LPKB 3OY6U 1PQAA 1UTNA 1T4UH 3T26A 1ZLRA 3GCHB 4BAMB 4WJG2 3RDZA 3BF6H 1V2KT 1MKXK 3PMAB 1AVWA 1PYTD 3LU9B 3U1IB 1P9SA 1FN6A 1W11U 5C67A 5JBAS 1CBWC 3H7OA 1Z8GA 3SV8A 4ISLA 1BBRH 5BRRE 2RCEA 2ZECA 1K22H 1O31A 2KAIB 1G3EA 5E0GA 6GCHF 3UQVA 1AWHB 3A80A 3ODDA 1UJ1A 1TYNA 4B76A 4UFEH 1RIWC 5C3NA 2WPKS 1MTNB 1DUEA 5IYTA 3ZVBA 4XBBA 2W7UA 1DXPA 1MD7A 1G3DA 1XMNB 3KN2A 4FU8A 1JRSA 4Y6DA 3CP7A 3M3VA 1S6HA 1MTNC 1EPTC 1SSXA 1RIWB 3SZNA 3TPIZ 2C8XB 3GICB 2WPIS 3AAVA 2FOEA 1EZQA 4Q7YA 1SFQB 1AY6H 2ZDMA 3UWIA 2ULLA 5LPFA 1BCUH 3RXTA 2Y7ZA 3ITIA 1GCTC 4Y71A 4KKDA 1ARCA 1J15A 1UVTH 5EODA 3RMOH 1XX9A 2FX4A 1EATA 1C5LH 2QXGA 2QIQA 1IHTH 3GCHC 1DLKB 5AF9H 2BD3A 1FONA 3UNRA 1SGIB 4JK6A 4MPWA 3V3MA 4BTUB 2A32A 1G3CA 2Y5FA 5IDKA 1O3KA 1QA7A 2F9VA 1EOLA 3Q76A 2VIDA 3QTOH 4K8BA 2FLBH 1OYTH 3TJOA 2R3YA 2YOLA 1GHXH 1A5HA 3P17H 3UFAA 3ATLA 5EXLA 3TITA 1FXYA 1E35B 3KQCA 1P10A 1O35A 2AH4X 1KXBA 3PTNA 1GMHF 1FY5A 1CHGA 4Q7ZA 1BTZA 3QN7A 3M3SA 3PB1E 1TPAE 4HTCH 1TLDA 3E8LA 2D26C 5EPYA 1TA2A 1BZXE 4A5TS 1BUIA 3MH7A 3LT3A 4E7NA 1O5CB 5J4SA 1G2MA 2BD5A 3RXHA 3RXSA 1PPZA 1RXPA 3FP7E 1N8OC 4X8VH 1E34B 3EDXB 3ATIA 4JYVH 2WYJA 3QTVH 4I8GA 4KGAA 2ZFTA 2VIOA 5T3HA 2BLVA 3SU4A 2BHGA 2AS9A 1NS3A 1O5AB 1C5RA 2FI3E 3EA7A 3A83A 4BTIB 5G4BA 2TBSA 2ZG0H 2ZPQA 2OC1A 2AMQA 5EQQA 3KGPA 3UREA 2IN2A 1C4U2 2PKSC 1BRCE 1AKSA 1O38A 2ZF0H 1ELBA 3ATWA 2DE9A 3KIDU 4ABHA 2VIVA 2H9HA 5FPSA 1ZPZA 1EJAA 4ABGA 2ZQ1A 5JBTA 1C2FA 1NRRH 1QL7A 4Y8YA 1O32A 5HM2A 1LKAA 3ZZ9A 3QZRA 5LGOA 4NIYA 2EA3A 3F6UH 5DP9A 1MUEB 3RC5A 2ZFFH 1XVOA 1LHEH 4IBLH 4X2XA 1XUFA 3FP8E 4UDWH 3GY3A 1TBZH 3KL6A 2SGFE 4WF8A 2Y5GA 3MU8A 2P8OC 4JZEH 4XBCA 1VGCB 1ABIH 1ZSJA 4I8LA 2XBVA 4IS5A 1TQ0B 3GY2A 1W13U 1C5PA 3JZ1B 2FS8A 2TPIZ 4A1XA 4AYVB 2C3SA 5DGJA 1DANH 1QQ4A 2GCHF 3A84A 5EOKA 3RXCA 4HFPB 4IC5A 1YCPH 1BQYA 3RU4E 1ORFA 4ZHAA 4NSYA 1GHBG 3RXDA 3M7TA 3K2UA 2SGEE 4Q7XA 5DK1A 4B2BA 1LMWB 3EE0B 1EZSC 4XE4A 2A4OA 2W5EA 4AOQA 3ENSB 2Z3EA 1HDTH 2RA3A 2BB4A 1J14A 2TGTA 3CS0A 4GPGA 2J92A 3A8AA 1O2QA 3OYPA 2W26A 4OS6A 1AMHA 3TH3H 3QDZB 1EB1H 3BTTE 1H4WA 2FS9A 2D8WA 1TX6A 1GL0E 1HLTH 2R0KA 3DT0H 1SGTA 2F83A 1GBIA 2J94A 3D49H 2H1UA 1MKWK 2PGQB 1E0FD 4DOQA 3UY9A 1GWAA 2RA0A 1RFNA 1SL3A 1KDQA 1WUNH 2OD3B 5EXNA 1KXAA 1XXFA 2Z7FE 2FTLE 1JWTA 1GGDB 1O2OA 5DKMA 3S9AA 1GDUA 3RU4T 1UMAH 1PPHE 1QHRB 5JPMH 3F68H 2VJ1A 3RXGA 5TCAA 1AB9C 4QT8C 1TNJA 3VB5A 4UFGH 1AFQB 1W7XH 3LGUA 3Q3XA 1NTPA 2BLQA 2TIOA 2XC4A 1FLEE 2Z3DA 4OS2A 4KTUA 2BZAA 1XM1A 2A7CA 1GBKA 4TWYA 4VGCC 4ABAA 3HGNA 3PM3A 1FAKH 1ZJKA 1AE8H 1B7XB 1P3CA 3M5MA 4RSPA 5AFYH 4NWLA 3NZIA 1CGIE 2ZDAH 1IQLA 2AERH 2ZHFH 1ZYOA 4GHQA 1AI8H 4NIVA 1RTKA 1IQEA 4UD9H 1EUFA 2FOCA 2HPQH 1NPMA 2V3OH 2ZCHP 3UR6A 2ILNA 3SU0A 1ZHPA 2A2XH 3E91A 3W94A 2OP9A 4Y0YE 1O2JA 2FP7B 4WH8A 1GVKB 2O8WA 3RXOA 3ATKA 3NK8A 4KTCA 1YLCA 2FXRA 3UWJH 1XXDA 1QB1A 2TGPZ 4NZLA 3SJ9A 4GLYA 2Y80A 3QO6A 1C1OA 2XW9A 4Y0ZE 1JXPA 1PFXC 4ZKNU 3BEIB 2B9LA 1C1WH 1C5YB 5K0HA 1J9CH 1G36A 2QF0A 1O3BA 1VCWA 1NY22 5GCHG 3Q77A 2GX4A 3HKIB 3MI4A 3MYWA 3MNSA 4JCNA 1O3PB 1V3XA 1ID5H 1C2GA 2QF3A 4RN6A 1TNGA 3ZVAA 1RS0A 1B0FA 1NFWA 1EAUA 1G37A 2JH5D 3TGIE 2XWAA 1C5XB 2WPMS 2J9NA 1O3JA 1OWHA 3URDA 1GMHG 1L2EA 2HWLB 2AMPA 4LOYH 1BJVA 4WWYA 2B7DH 5DJ7A 4GVUA 3BTEE 4TWWA 4ABIA 3GY4A 3VXFH 3SV6A 3DFJA 1GMCG 4CREA 1UCYH 2OLGA 1TMUH 2EEKA 1CE5A 3I78A 1V2JT 2A0QB 1P2NA 4TYDA 4TY7A 3A82A 3A7YA 1W0YH 3VB6A 3GY7A 4FUBA 3H7TA 1P0SH 2ZDVH 1UK4A 4UFDH 3UPEA 4BAHB 3NCLA 3A7XA 3OX7U 3DA9B 1V2VT 4AFUA 2GMTB 1T32A 1A3EH 4X1NU 3LGVA 4I8KA 4FUGA 1O3DA 3VEQB 2FEQH 4CRCA 1TE0A 1ZPCA 1V2QT 2SNWA 5GXPA 5J4QA 5TJXA 3W95A 1CVWH 1GHWH 4FUHA 3OU0A 3S69A 1SHHB 1XUKA 2Z9JA 1L4DA 4DJZB 2ZA5A 2GZ7A 4CRAA 1CGJE 2Z94A 1VGCC 3EQ0H 2VGCB 5DO4H 4UFFH 1M9UA 1EOJA 2G5NA 2W7SA 1G30B 1TIOA 4DIIH 1UTPA 1HGTH 2BY5X 2NU0E 5GIBA 2FI4E 3M7QA 1YKTA 4D8NA 4ZKSU 1F7ZA 1OOKB 2UWLA 4IMQA 1EPTB 1MTUA 1UCYK 1GJ5H 2STBE 1THRH 1P9UA 3UIRA 3RXPA 4I32A 1V2WT 1GI0A 3D62A 1WYKA 3FAOA 3C27B 1KY9A 3ZV9A 2Q6FA 5EPNA 3SJ8A 4CBOA 2KAIA 4ABBA 2GD4B 4X1PU 1GPZA 1H9HE 3BG4C 3GDSA 5C1XA 2VVCA 3BTKE 4IN1A 2GT8A 1WOFA 1C5ZB 1O39A 1MKXH 1GMCF 1H9LB 1P2OA 4A1TA 2ZWLH 5LPEA 1BTXA 1TGSZ 2BY7X 4NA9H 2JH0D 1TNIA 2WPLS 1LTOA 5DP4A 5JBCS 3VB4A 3P8OA 1BT7A 3BEUA 1O2RA 5K7RA 4R8TB 4D9RA 1HYLA 3SHAH 1RGQA 1A0HB 1UVSH 1P03A 4TPYA 5GPIB 1PYTC 3BG8A 2H6MA 1H9IE 2PWXA 1EB2A 1O5BB 2THFB 1ESBA 4ISNA 2AGIX 2CMYA 4CH8B 1CT0E 1O2NA 1Z6JH 2VVUA 4K1EA 2W3IA 5ABWA 1QIXB 2GVFA 1MCTA 2OC7A 2K1QA 2FLRH 2P8OB 1O3FA 1YP9A 1C2MA 5CHAC 1GI9B 4MDSA 4WY3A 3UUZA 1P57B 3TK5A 3BTQE 3RM0H 1Y5UT 3GYLB 1C2DA 2HVXA 2FI5E 1FI8A 4JZFH 3QGNB 3V7TA 4WVPE 1OWDA 3MNBA 3NKKA 2UUKB 4CHAB 4NGAH 1DVAH 2XYAA 3TGKE 1HIAB 3PLPA 1DWEH 3AW0A 3P95A 3LKWA 2CF9H 1SMFE 5GWZA 1KXEA 2CF8H 3QUMP 4GCHG 2V3HH 1SGPE 4ZHMU 1FPCH 4CR9A 4RKOB 2GV7A 4ISIH 1EZUC 1C2IA 4ABJA 3SORA 1ZSKA 2F9PA 1ELEE 2FOAA 3RXVA 4JZ1A 2ZGHA 3GISB 1TBRH 2BLWA 4OS5A 1WBGB 4M7GA 3SU2A 1W8BH 1C1TA 1GHVH 5E2PA 3U8RH 1HV7A 1C1MA 1Q3XA 3SU5A 3RXBA 3DFLA 2OUAA 1O2XA 3V12A 5FPYA 1QJ1B 3PWBA 4Q80A 2C8YB 4B1TA 3ZVGA 2WV5A 2W3KA 1T8NA 1E37B 1SGYE 1GBHA 2O8TA 5DP6A 3OTJE 1C2LA 1GBTA 2ZO3H 2VIWA 1ELTA 4OS7A 1QL8A 2GDEH 1HAXB 2VVVA 4B2CA 5C2ZA 1QA0A 1CSOE 1MAXA 2BM2A 1C2JA 5LH8A 2R3UA 3T62A 5EW2H 1QL9A 4NCYA 3QLPH 1QJ7B 3VFEA 1TMBH 1ZMNA 2JKHA 2Z9GA 3BTWE 4MTBA 4GUXA 5FHTA 3TK6A 5C20A 5F03A 1JMOH 4DGJA 2O8LA 3KEEA 1OWJA 1JIRA 1QFKH 7LPRA 5GCHF 5F8XA 4D7FA 3M35A 4FUCA 1NFYA 3IG6B 2BQWB 2SFAA 3SBKA 5T6GA 3P6ZB 1DM4B 4IMZA 1ZOMA 1ZTJA 4YO9A 5C1YA 3RMNH 1O2IA 4I33A 2AIPA 3A7ZA 3BTHE 5A09A 1GCTB 3F1SB 1N6XA 1D6WA 1MD8A 4FUIA 5JYIA 1LVMA 1ANBA 1Y3XA 4OS1A 4H4FA 4ZXYH 4NA8A 3CENA 3S7HB 2FIRH 1TNLA 1Q31A 1HPGA 1JRTA 2ZTXA 2ZFQH 2ZNKH 1DY9A 3ZVDA 2FODA 2GV6A 1BBRK 1K1MA 1FY1A 1ZTKA 5HMAA 2ZGJA 4CRBA 1P2KA 2J38A 2QXIA 2GZ8A 2G55A 3FP6E 4MNXA 1EKBB 3PTBA 3SGBE 4A7IB 1YYY1 2BY8X 3ATMA 2GCTC 3RMMH 1GI3A 3MNCA 1Z71A 4RKJB 3LONA 7ESTE 2C8ZB 3TJUA 2BX4A 2OCVB 2FM2A 2BLOA 4DCDA 3A7VA 3SGQE 2Y6TA 1FN8A 1YGCH 4FU9A 1AVXA 3SN8A 3SUEA 3UNSA 1UO6A 4AYYB 1O2ZA 2ZPSA 3ZVEA 1UHBB 2XBXA 3KHVA 1ELDE 2XTTB 4D9QA 1DLEA 8KME2 5CMXH 1CU1A 1OYQA 3WY8A 1SB1H 2VH6A 1ELFA 5E0HA 1SOZA 3CS7A 4DURA 2PKSB 2FPZA 3U98H 3TJVA 2QGRA 4GAWA 3GDVA 3MNXA 1W2KH 4INLA 3O8CA 5HXFA 4ZKOU 1P12E 2B0FA 3DUXH 1FY4A 4MNWA 1FIZA 2GKVE 1SHYA 4Y10E 1IQKA 4E7RG 4Z6AH 1L0ZA 1GHYH 1A5IA 1GDQA 3MTYA 3QGJA 2ZDKA 5GJ4B 1EZXC 2WPHS 4X2YA 1LO6A 2PUQH 4BAOB 3F9EA 1Z1JA 1GJ4H 1HNEE 3RC4A 1NRNH 1HAZB 2VNTA 1QR3E 1V2PT 1FJSA 1KXDA 1L1GA 5DP5A 1TGBA 1T31A 1YPJH 2ZTZA 2ZFSA 2AEIH 4A92A 4ZKRU 2A4GA 1GI1A 3RU4D 2Z9KA 2BDBA 4YTAA 1D9IA 2AMDA 4B74A 3T25A 2G81E 1D3TB 3IWMA 1O36A 4LK4A 2FDAA 4JZDH 4AB9A 4X1SU 1CA8B 3LH3A 1ANEA 2LNCA 3E16B 2QN5T 4YT7H 3BTGE 1C9TA 3SV2H 3OSYA 1ACBE 1V2RT 1ANCA 1HFDA 2G8TA 2VWOA 1ESAA 4XBDA 4I7YH 3ODFA 3M5NA 1P2JA 3MU0A 1J17T 1NO9H 1SGCA 1V2ST 1AUJA 7KMEH 4BXSA 1V2UT 2BD2A 1D4PB 2SGDE 2FOMB 2VH0A 4XOJA 1YPMH 5DG6A 1KYNA 1SQAA 3Q3KA 3R0FA 2PTNA 1IQNA 3NXPA 1A0LA 1C5NH 2YNAA 2B5TB 2ANKH 1AWFH 4AFSA 1N1LA 1PPCE 3HK6B 4X1RU 6CHAC 1C5WB 2P94A 1XUJA 2ZKSA 3LOXA 3HK3B 3HATH 1TFXA 4HI3A 1IQIA 3SNCA 1SG8B 8GCHG 4ZMAH 1O30A 2BMGB 2GGVB 4AG2A 1V2LT 4THNH 4XFQA 3EYDA 3OY5U 2FYQA 3VGCC 1E36B 3SU6A 1A1RA 2GCTB 1IQGA 1EJMA 3UNQA 3VPKA 1DY8A 4YOGA 1NRQH 4BTTB 1F0UA 2YNBA 1P2QA 2BVSH 4I31A 3GCNA 4B73A 4X6OA 4ASHA 1QY6A 3SW2B 2BZ6H 2H9EH 3Q3YA 1GDNA 2BDHA 4CHAC 2VINA 1YCPK 1GVZA 1SFIA 3LJJA 4PROA 1DSUA 1UTMA 2J4IA 1VITH 4CRFA 2DUCA 1MH0A 3SV7A 3RXQA 3PO1B 1A61H 1O3AA 1BDAA 3A87A 4NFFA 1O2PA 1YC0A 7GCHG 1BRUP 2A4RA 1Z8JB 2ZFPH 3TU7H 2UUFB 4AB8A 2GDDA 1D3PB 1B0EA 4ZROA 1DWBH 2XWBI 4B71A 1W12U 1Y3YA 2BDAA 4JK5A 3BSQA 3SU3A 1GI2A 1Z1IA 1O2YA 1C1SA 4YT6H 1HJAC 3KCGH 1F92A 1HCGA 4B75A 1INCA 2FESH 3MHWU 2R2MB 2FMJA 5DP8A 1AQ7A 2BD9A 2C93B 1C1PA 1OWIA 2G4UA 3MO9A 1BHXB 1ZZZA 2P93A 1THPB 3B23B 2BY9X 3U1JB 1BB0B 5EQSA 3SUGA 3BG4B 1TQ7B 4NWKA 2BOKA 4K69A 1V6DA 3HGPA 1MCVA 1CT4E 1PQ5A 3D65E 2UWPA 3U8TH 1TNKA 2EI6A 1FQ3A 4U32A 3RXEA 3ZZ8A 3IITA 2TGAA 1Q2WA 1V2TT 1ANDA 2Z6BD 4J2YB 1YPLH 4WXVA 1C4Y2 1O5FH 4OS4A 2VWNA 4BNRA 2CV3A 3N7OA 2R0LA 2F9UA 1HAPH 1O2WA 2FYRA 2A5IA 3MMGA 5ETXA 1VITG 1A5GH 4DG4A 1SLXB 1WSSH 2V0BA 3I29A 1S82A 3SO3A 1F2SE 1O2SA 3ZZBA 1MTVA 3PYHA 1NN6A 3AAUA 1GCDA 1NM6A 1H8IH 3Q00A 4BAQB 1ZTLA 4HGCA 1YM0A 5B6OA 3EAJA 1GBMA 1Y3WA 3EA8A 1A0JA 1YPGH 1Z7KA 4ABDA 2I6QA 2Z9IA 2HNTF 4XDEA 1FDPA 1OKXA 2P3TB 4H6SB 3RLWH 2CJIA 1U6QA 4DW2U 1QURH 1Y8TA 6ESTA 3U69H 1G32B 3TJNA 3ZZ3A 1Y3UA 1BMNH 1JOUB 3SNDA 1TBQH 3ELAH 4ISHH 5A0CA 1GI7B 1HAGE 1KTSB 4CR5A 1YF4A 1QBNA 2EC9H 4ZAEA 1GBJA 3E6PH 4ISOA 1EPTA 3E0PB 1WQVH 1K9OE 3URCA 2PSYA 4WMFA 1K1NA 2BVRH 5T6FA 4FUFA 2OQUA 1SGFA 4DIHH 4KELA 1TGNA 5FXLA 2F9NA 3SUDA 1YPEH 4XSKU 3VGCB 1AN1E 1V2MT 3BN9A 1AZZA 1LVBA 1EQ9A 3T29A 5FBIA 3M36A 1CGHA 4SGAE 1Y5AT 5A8YA 1OSSA 1BJUA 1SBWA 1QBVH 1P2MA 2F9OA 1QRZA 3A89A 1O2KA 2ALVA 1PPEE 4WXIA 3O8BA 1KDQB 1CA0B 2XBWA 1W0ZU 1SLUB 6LPRA 5C5NA 1MQ5A 2FOFA 3SI4H 1ZMLA 1NC6A 5DPAA 2TGDA 2XNIA 1MZAA 1O33A 2ODQA 1FUJA 1P01A 1VZQH 1S0RA 1WQSA 4MG3A 1EP6A 2ASUB 3RM2H 4K8YA 1MU6B 3BV9B 4K60A 2RG3A 4CBNA 4BOHA 1O2LA 1F0RA 3V0XA 1TALA 2VGCC 2Q6DA 4MVNA 4FU7A 1NU7B 4AG1A 1L1NA 3SV9A 2B8OH 1W10U 1B5GH 3D23A 2BYAX 2SGPE 2P3UB 3PO1C 5EXMA 1MTWA 3RMLH 1UVOA 2G5VA 5FX6A 4O03A 2ZU3A 2G00A 1YLDA 2G52A 2WYGA 3P70B 1TOMH 2SGQE 3QX5H 3MH5A 1HAIH 1S83A 1V2NT 2HOBA 1ELCA 4JMYA 4MNYA 2WV4A 3SJOA 3GCTF 3UOUA 2UUYA 2PKAB 4Q2KA 2ZU1A 3A85A 2AYWA 1IQHA 1YCPM 1TNHA 1TONA 4FUEA 1NROH 1ZSLA 1NRSH 5F8TA 5DP7A 5EG4A 1ZRBA 4OGXA 2FOGA 1SI5H 3MH4A 3STIA 2PLXA
chains in the Genus database with same CATH superfamily
3ZZ4A 2PTCE 5E0JA 2H2ZA 3UQOA 1EAWA 4YZUA 5EGMA 4MQAA 1RTFB 1MBQA 2M5TA 4KTSA 1IOEA 1G3BA 2V35A 3ZYEA 3VB3A 1AD8H 1BBRE 2EI7A 4I8JA 3S7KB 1E79D 3U28C 1THSH 4NIWA 5I25A 4TY6A 1PQ7A 2ZDLA 5F53A 3SNEA 1QB6A 1NU9A 2KFWA 1HAVB 2R9PA 2FZZA 1LKBA 1UTLM 1ZMJA 1GBCA 3TIUA 2QA9E 4YESB 1DS2E 2NWNA 4P02A 1AVGH 3LC3A 3G01A 4M9FA 2HGTH 3FVFB 2F3CE 1SGDE 3SU1A 1HAVA 1Z6EA 4FVDA 1S0QA 5T6DA 4E06H 1TX7A 1EP5A 4OM9A 5EQRA 4ZH8A 1PJPA 1YPHC 1TPSA 5EW1H 3P8FA 1BMFD 1JBUH 3SI3H 3RXMA 1TGCA 8LPRA 1C5VA 1KXFA 1N6YA 3H5CB 3T28A 1K21H 1ELVA 3SNBA 4ESTE 3M3TA 4UONA 1O34A 1SVPA 1VKYA 1GI5A 1O2MA 1UCYE 2J98A 1FMGA 1A46H 1LHDH 1XKAC 4X8UH 1C9PA 5EU8A 2ZPRA 1RRKA 1O3NA 3P8GA 3K6ZA 2A7JA 1O3LA 3PLBA 4UE7H 2GMTC 3TH4H 1E38B 2PKAA 1D3DB 1S6FA 1C1QA 2ZP0H 3MO3A 1IQJA 1VITF 3RXLA 2SNVA 1C1UH 1QBOA 4BXWA 3U8OH 1NESE 2J5UA 1OHHD 4F4OC 1ZPBA 5L30H 2NU3E 4HG6A 2PHBA 3M5LA 4YLUA 1O37A 3F9HA 2ZHDA 2Q1JA 1DWDH 1NZQH 4X8SH 2J95A 1JIMA 4D7GA 1GHZA 3ZZ7A 4Z1MD 1ZHRA 2NU2E 1P05A 1O3GA 2GP9B 2UUJB 4DT7B 1GHBF 5I46H 2GZ9A 3RXKA 4D76A 2C90B 5T1VA 1C5UA 1VJ9U 1DOJA 5HYOA 2OINA 1ESTA 2V7QD 1IHSH 5JB8S 4RI0A 5C1UA 4INHA 3GDUA 1LHFH 2ZHQH 2ANMH 1AHTH 2EI8A 1O2HA 3BTFE 5PTPA 1TRNA 4VGCB 3PWCA 1UTOA 1QQUA 1A3BH 3MO6A 5JBBS 2ZU2A 3ZZDA 3E90B 1TPPA 1LPZB 1AFQC 3SOSA 1DXWA 1BOQA 2CXVA 1CA0C 1KLTA 3EE7A 1BMMH 1PPGE 2ODYB 1W0JD 3DCLA 1SPJA 3FFGA 5C5OA 3FZDA 1YWUA 3U9AH 2ZGXH 1MKWH 3SUFA 1C5SA 4O97A 4A1VA 1C2HA 3DHKH 1UHBA 2GCHG 1BTWA 1YPKH 2PUXB 2VWMA 2ZTYA 4DVAU 2AIQA 1CT2E 1NRPH 1GI6A 1D3QB 3A81A 1FY3A 1IQFA 1DDJA 2YMSC 4H42U 5H4IB 1HJ8A 1AU8A 2F91A 1NFXA 2XXLA 4WMDA 8GCHF 5E2OA 1GBEA 1GJ6A 3MU4A 1UTKA 1HXFH 2JETB 2QCYA 1F0SA 3TNTA 1K2I1 1TA6A 2ZU4A 2DE8A 3EA9A 3MH6A 2WUCA 1XVMA 2FWWA 4INKA 4TPIZ 3UR9A 2J34A 1W7GH 5JDUB 3ZYDA 8ESTE 2A2QH 2A1DB 4NG9H 3LPRA 3SJKA 1LVYA 1AUTC 2HNTC 2W6ID 4X1QU 1T8MA 3FANA 3MFJA 1BMAA 2BD8A 4LZ4B 1EX3A 1Y59T 3I77A 3RXIA 1DX5M 1HBTH 4LXBH 1CHOG 2AFQB 2H9TH 2Y5HA 4K2YA 1WAYB 1T8LA 2XNDD 3L33A 1VJAU 2P3FH 1W0KD 3VXEH 2GT7A 2A5KA 1HXEH 2OC8A 2XRCA 3K65B 4B6EA 4K3JA 1K28D 1ZR0A 1TAWA 4NIXA 2PR3A 1FAXA 2PFEA 1ABJH 3L6PA 1QJ6B 1C2KA 1DE7H 2WHXA 1DPOA 7GCHF 1P3EA 1KIGH 3MOCA 4MNVA 3DD2H 1LQEA 1BTHH 2A45B 3SJIA 5F6MA 2QXJA 1CQQA 4FUDA 5DP3A 1PQ8A 1FV9A 1EJNA 1YBWA 3QZQA 4Y8XA 1OWEA 1SGNE 4X6PA 4GCHF 2OC0A 4Y8ZA 1BHXF 3UOPA 1MQ6A 1FPHH 2KCPA 1G2LA 1O3HA 2HPPH 4IGDA 4A6LA 2IPQX 5JB9S 2BX3A 1T7CA 4X2WA 2CN0H 2QC2A 1QCPA 1P09A 1SGEE 3RXFA 3T27A 2P59A 2JETC 5AHGH 2A7HA 3GYMA 4FUJA 1O2UA 1OPHB 1O3IA 5GDSH 3TH2H 2AGGX 9LPRA 3KF2A 2L6OA 3TVJB 1MAYA 1ARBA 3E1XB 3A7WA 2V6NA 1S81A 2OXSA 2XC5A 4FXGH 3PMJA 1H8DH 1QRWA 3OE7D 1O2GH 1P06A 2QAAA 3AVZA 1O5GH 2K0QA 3NUMA 1DUAA 2I6SA 3ZV8A 1AB9B 2ALPA 1TRMA 2CK3D 1GG6C 5L6NH 3A7TA 2QY0B 3LJOA 1W3CA 5E8EH 2FOHA 1N8OB 3HPTB 5FBEA 2O8MA 4I8HA 4Y7BA 5GNDA 5TCCA 3PMBB 1CHOF 1QTFA 2GTBA 2BD4A 4WMEA 2PW8H 4K1SA 1HIAA 5A8ZA 2ZC9H 4FOUC 1LCYA 1QRXA 3TGJE 3M61U 3ZVFA 4XRNA 3SHCH 1RJXB 1VCQA 2C8WB 5HKKD 1BTPA 2PGBB 3JZ2B 3PMHB 1WXRA 3E3TA 4Y79A 2BQ6B 1T8OA 2IOTA 2A4QA 4U30A 2BVXH 1LHGH 1BTUA 2STAE 2SGAA 2D2DA 3LGYA 1BRAA 1ZHMA 4Y11E 3TNSA 4X6MA 2BQ7B 1GBAA 1GHAG 3UAIC 5KGOA 3UTUH 2Q6GA 4O3UA 4AFQA 1F5KU 1C1NA 2D1JA 2XCFA 1TX8A 5F8ZA 2G51A 1F0TA 3C1KA 4YLQH 3KQDA 1MMJN 2Y82A 4ZHLU 3N7EA 2JH6D 1DT2A 4JZIA 4K5ZA 4AORA 2ZHEH 2QV1A 3SQEE 2ANWA 2O8UA 2F9BH 2IPHA 1QZ8A 2AGEX 2CHAB 5FAHA 4ZCNA 4MPVA 1SC8U 4UEHH 1P2IA 1A7SA 1HRTH 2ZGBH 4AN7A 3LGWA 3ZVCA 2O9QA 3TK9A 1HJ9A 1XUIA 1H8ED 3M37A 2P16A 5FPTA 1XKBC 1OS8A 4X8TH 2ZEBA 1PPBH 1C5TA 1SLWB 1GGDC 3STJA 1CO7E 1KLJH 1Z8RA 2LELA 3TLOA 1P11E 3MWIU 1BTYA 3FZZA 1X7AC 1LQDB 3ZIAD 1Y5BT 4ZXXH 2OBOA 1AZ8A 1LDTT 3F9FA 4KP0A 3K6YA 3NWUA 1UVUH 2XCNA 1FY8E 2OBQA 4AZ2B 1ELAA 5FCRA 2ZFRH 4BAKB 1EFRD 1YLNA 1DFPA 1AIXH 4J1YA 5A0BA 4U2WA 3A8BA 2CGAA 1O3OA 3LH1A 1T4VH 1GBFA 4WH6A 2ZCKP 1SQTA 2H5CA 1WCZA 1KLIH 1KSNA 2ZGCA 1AGJA 5LPRA 1HB0B 2IJOB 1A2CH 4X6NA 4BANB 1AFEH 2Z3CA 4AGKA 4B2AA 1WTGH 2BD7A 3AASA 1C1VH 3B9FH 3EGKH 2TRMA 3PV4A 1TB6H 5B6LA 3ZZCA 5HM9A 1TOCB 4X2VA 1AE5A 1VR1H 2ZCLP 1OP8A 3NPSA 1FNIA 4ABEA 1TMTH 4YXWD 2VIQA 2JJ1D 1GBDA 1XUHA 2WUBA 2ZQ2A 3A8DA 1BIOA 3GY6A 4R0IA 1L4ZA 1NT1A 3S9BA 4DY7B 4AGJA 3LDXH 1ETRH 2C4FH 4Z0KA 2Z9LA 1OP0A 4IN2A 4JYUH 2BY6X 2XBYA 2RDLA 2XC0A 4NZQA 1L1JA 3ESTA 2VU8E 6GCHG 1SOTA 1ZJDA 3LIWA 3BTME 4Y76A 1OP2A 3RXJA 1C5QA 3PLKA 4IW4E 1DITH 2H5DA 3SNAA 1S85A 1O5DH 2BXUH 2PSXA 4MPUA 1IQMA 1EXFA 1WU1A 1O2VA 2J2UA 2J98B 4OGYA 5A8XA 2QXHA 3GCOA 3K9XB 1V2OT 3RXRA 1F5LA 5CE1A 1LVOA 3R3GB 4E05H 3T5FH 1HAOH 1S84A 2FO9A 1SGFG 3F9GA 3M5OA 1AO5A 1TABE 1VCPA 4ZUHA 3RLYH 3RXAA 3BTDE 2HRVA 2ZU5A 3KQEA 3SZEA 4F49A 2PV9B 1FIWA 3BEFB 1O2TA 1O0DH 2WPJS 1GI4A 3ZZ6A 1HAHH 1GJ7B 1O3CA 1ZRKA 2VWLA 3GY8A 3MU1A 3M7UA 1QB9A 2BDGA 1TPOA 1YPHE 2BOHB 2Y7XA 4H6TA 1K1LA 3OTPA 4SGBE 1SQOA 2NU4E 2A5AA 2UWOA 3KQBA 3BIUH 1HUTH 1MZDA 5BPEA 1BITA 1O5EH 1SR5C 3LGTA 1XUGA 1GMDG 3LGIA 1K1JA 4MPXA 1AKSB 1GMDF 5SGAE 5KECA 2ANYA 3A88A 1GJ8B 5AFZH 3QK1A 1CBWB 1A4WH 2CHAC 3RUOA 1WTHD 1QGFA 1KTTB 2ZIQH 3A8CA 4U01A 3KNXA 1D6RA 2IJD1 3MU5A 4CH2B 2ZHWH 1GI8B 1HJAB 1RTLA 2ESTE 1C5OH 2G4TA 1MU8B 2NU1E 1EASA 1OXGA 4NA7A 3BIVH 2KR7A 4YOIA 4ABFA 4X0WU 5FX5A 2ZDNA 1C2EA 1SLVB 1LHCH 2LPRA 3ZZ5A 2BDIA 1C5MD 1K1IA 4JYTA 2HLCA 1J16A 5EJLA 1C4V2 1UTJA 4GHTA 3LC5A 1BA8B 3E0NB 3P92A 4NSVA 4YM9A 5ESTE 4O9VA 1PPFE 1GJBB 1FZZA 1TRYA 3A86A 1UVPA 4AFZA 4NFEA 2BDCA 1EAXA 2Y81A 3PROA 2RFKC 5KEDA 3S0NA 1ZGVA 3RC6A 3SQHE 1F5RA 1K1OA 3S9CA 3VB7A 4LZ1H 5A2MH 5AVDA 3SGAE 3GCTG 3O8RA 1K1PA 3FOAA 1MBMA 1DICA 1GJDB 1WV7H 2BDYA 9ESTA 1GG6B 4IC6A 1P04A 4K1TA 2A31A 4YOJA 1C1RA 3L3TA 1J8AA 2QYIA 1TGTA 4CRDA 5L2YH 1SGQE 1O3MA 1BRBE 2R2WU 3GOVB 1GJAB 2BXTH 3B8JA 3GY5A 1TWXB 1E1QD 2HNTE 2FOBA 4FVBA 3RP2A 1Y3VA 2OTVA 4HZHA 2OQ5A 3FN8A 1KXCA 1RD3B 1ETSH 1P8VC 2HALA 4MLFB 4CRGA 6CHAB 5HGGA 1SGRE 2FTMA 1EAIA 3T2NA 5L2ZH 3O8DA 1QNJA 3V13A 1DWCH 1IAUA 1Z8IB 1NFUA 1GL1A 2BTCE 1YY3A 1W14U 2WINI 3AW1A 1UTQA 2FX6A 1P02A 4O3TA 1GBLA 4GSOA 1DSTA 1GVLA 1GJ9B 2ZI2H 3P8NA 5CHAB 2ZZUH 5ESBA 5FCKA 3KQ5A 1UK2A 3ZZAA 1GJCB 3QWCH 5A0AE 1G9IE 1H1BA 1ETTH 4Y7AA 2ODPA 1GHAF 1MTSA 3PRDA 1BMLA 3OEED 1GBBA 1S5SA 2HVYB 2P95A 1ELGA 1O3EA 4AX9H 3OFND 2XOKD 1OWKA 4I86A 1LPGB 2VIPA 1UK3A 1ZGIA 2VB0A 1HAYB 3HKJB 3RXUA 2JDID 1OX1A 1LPKB 3OY6U 1PQAA 1UTNA 1T4UH 3T26A 1ZLRA 3GCHB 4BAMB 4WJG2 3RDZA 4F48B 3BF6H 1V2KT 1MKXK 3PMAB 5CHBA 1AVWA 1PYTD 3LU9B 4Q4LA 3U1IB 1P9SA 1FN6A 1W11U 5C67A 5JBAS 1CBWC 3H7OA 1Z8GA 3SV8A 4ISLA 1BBRH 5BRRE 2RCEA 2ZECA 1K22H 1O31A 2KAIB 1G3EA 5E0GA 6GCHF 3UQVA 1AWHB 3A80A 3ODDA 1UJ1A 1TYNA 4B76A 4UFEH 1RIWC 5C3NA 2WPKS 1MTNB 1DUEA 5IYTA 3ZVBA 4XBBA 2W7UA 1DXPA 3W1EA 1MD7A 1G3DA 2AHME 1XMNB 3KN2A 4FU8A 1JRSA 4Y6DA 3CP7A 3M3VA 1S6HA 1MTNC 1EPTC 1SSXA 1RIWB 3N99A 3SZNA 3TPIZ 2C8XB 3GICB 2WPIS 3AAVA 2FOEA 1EZQA 4Q7YA 1SFQB 1AY6H 2ZDMA 3UWIA 2ULLA 5LPFA 1BCUH 3RXTA 2Y7ZA 3ITIA 1GCTC 4Y71A 1MABB 4KKDA 1ARCA 1J15A 1UVTH 5EODA 3RMOH 1XX9A 2FX4A 1EATA 1C5LH 2QXGA 3PRBA 2QIQA 1IHTH 3GCHC 1DLKB 5AF9H 2BD3A 1FONA 3UNRA 1SGIB 4JK6A 4MPWA 3V3MA 4BTUB 2A32A 1G3CA 2Y5FA 3F3BA 5IDKA 1O3KA 1QA7A 2F9VA 1EOLA 3Q76A 2VIDA 3QTOH 4K8BA 2FLBH 1OYTH 3TJOA 2R3YA 2YOLA 1GHXH 1A5HA 3P17H 3UFAA 3ATLA 5EXLA 4AC9A 3TITA 1FXYA 1E35B 3KQCA 1P10A 1O35A 2AH4X 1KXBA 3PTNA 1GMHF 1FY5A 1CHGA 4Q7ZA 1BTZA 3QN7A 3M3SA 3PB1E 1TPAE 4HTCH 1TLDA 3E8LA 2D26C 5EPYA 1TA2A 1BZXE 4A5TS 2WSSD 1BUIA 3MH7A 3LT3A 4ACBA 4E7NA 1O5CB 5J4SA 1G2MA 2BD5A 4ASUD 3H09A 3RXHA 3RXSA 1PPZA 1RXPA 3FP7E 1N8OC 4X8VH 1E34B 3EDXB 3ATIA 4JYVH 2WYJA 3QTVH 4I8GA 4KGAA 2ZFTA 3N7DA 2VIOA 5T3HA 2BLVA 3SU4A 2BHGA 2AS9A 1NS3A 1O5AB 1C5RA 2FI3E 3EA7A 3A83A 4BTIB 5G4BA 3F2GA 2TBSA 2ZG0H 2ZPQA 2OC1A 2AMQA 5EQQA 3KGPA 3UREA 2IN2A 1C4U2 3AK5A 2PKSC 1BRCE 1AKSA 1O38A 2ZF0H 1ELBA 3ATWA 2DE9A 3KIDU 4ABHA 2VIVA 2H9HA 5FPSA 1ZPZA 1EJAA 4ABGA 2ZQ1A 4F55A 5JBTA 1C2FA 1NRRH 1QL7A 4Y8YA 1O32A 2LP6A 5HM2A 1LKAA 3ZZ9A 2KX4A 3QZRA 5LGOA 4NIYA 3FO8D 2EA3A 3F6UH 5DP9A 1MUEB 3RC5A 2ZFFH 1XVOA 1LHEH 4IBLH 4X2XA 1XUFA 2JJ2D 3FP8E 4UDWH 3GY3A 1TBZH 3KL6A 2SGFE 4WF8A 2Y5GA 3MU8A 2P8OC 4JZEH 4XBCA 1VGCB 1ABIH 1ZSJA 4I8LA 2XBVA 4IS5A 1TQ0B 3GY2A 1W13U 1C5PA 3JZ1B 2FS8A 2TPIZ 4A1XA 4AYVB 1E1RD 2C3SA 2L74A 5DGJA 1DANH 1QQ4A 2GCHF 3A84A 5EOKA 3RXCA 4HFPB 4IC5A 1YCPH 3PV5A 1BQYA 3RU4E 1ORFA 4ZHAA 4NSYA 1GHBG 3RXDA 3M7TA 3K2UA 3PV2A 2SGEE 4Q7XA 5DK1A 4B2BA 1LMWB 3EE0B 1EZSC 4XE4A 2A4OA 2W5EA 4AOQA 3ENSB 2Z3EA 4RT0A 1HDTH 2RA3A 2BB4A 1J14A 2TGTA 3CS0A 4GPGA 2J92A 3A8AA 3DSPA 1O2QA 3OYPA 2W26A 4OS6A 1AMHA 3TH3H 3QDZB 1EB1H 3BTTE 1H4WA 2FS9A 4ACAA 2D8WA 3WWBA 1TX6A 1GL0E 1HLTH 2R0KA 3DT0H 1SGTA 2F83A 1GBIA 1NBME 2J94A 3D49H 2H1UA 1MKWK 2PGQB 1E0FD 4DOQA 2JIZD 3UY9A 1GWAA 2RA0A 1RFNA 1SL3A 1KDQA 1WUNH 2OD3B 5EXNA 3UB0A 1KXAA 1XXFA 2Z7FE 2FTLE 1JWTA 1GGDB 1O2OA 5DKMA 3S9AA 1GDUA 3RU4T 1UMAH 1PPHE 1QHRB 4TSFD 5JPMH 3F68H 2VJ1A 3RXGA 5TCAA 1AB9C 4QT8C 1TNJA 3VB5A 4UFGH 1AFQB 1W7XH 3LGUA 3Q3XA 1NTPA 2BLQA 2TIOA 2XC4A 1FLEE 2Z3DA 4OS2A 4KTUA 2BZAA 1XM1A 2A7CA 1GBKA 4TWYA 4VGCC 4ABAA 3HGNA 3PM3A 1FAKH 1ZJKA 1AE8H 1B7XB 1P3CA 3M5MA 4RSPA 5AFYH 1SQRA 4NWLA 3NZIA 1CGIE 2ZDAH 1IQLA 2AERH 2QE7D 2ZHFH 1ZYOA 4GHQA 1AI8H 4NIVA 1RTKA 1IQEA 4UD9H 1EUFA 2FOCA 2HPQH 1NPMA 2V3OH 2ZCHP 3UR6A 2ILNA 3SU0A 1ZHPA 2A2XH 3E91A 3W94A 2OP9A 4Y0YE 1O2JA 2FP7B 4WH8A 1GVKB 2O8WA 3GS9A 3RXOA 3ATKA 3NK8A 4KTCA 1YLCA 2FXRA 3UWJH 1XXDA 1QB1A 2TGPZ 4NZLA 3SJ9A 4GLYA 2Y80A 3QO6A 1C1OA 2XW9A 4Y0ZE 1JXPA 1PFXC 4ZKNU 3BEIB 2B9LA 1C1WH 1C5YB 5K0HA 1J9CH 1G36A 3CNRA 2QF0A 1O3BA 5HIZA 1VCWA 1NY22 5GCHG 3Q77A 2GX4A 3HKIB 2YMSD 3MI4A 3MYWA 3MNSA 4JCNA 1O3PB 1V3XA 1ID5H 1C2GA 2QF3A 4RN6A 1TNGA 3ZVAA 1RS0A 1B0FA 1NFWA 1EAUA 1G37A 2JH5D 3TGIE 2XWAA 1C5XB 2WPMS 2J9NA 1O3JA 2KM0A 1OWHA 3URDA 1GMHG 1L2EA 2HWLB 2AMPA 1UW7A 4LOYH 1BJVA 4WWYA 2W6JD 2B7DH 5DJ7A 4GVUA 3BTEE 4TWWA 4ABIA 3GY4A 3VXFH 3SV6A 3DFJA 1GMCG 4CREA 1UCYH 2OLGA 1TMUH 2EEKA 1CE5A 3I78A 1V2JT 2A0QB 1P2NA 4TYDA 4TY7A 3A82A 3A7YA 1W0YH 3VB6A 3GY7A 4FUBA 3DSGA 3H7TA 1P0SH 2ZDVH 1UK4A 4UFDH 3UPEA 4BAHB 3NCLA 3A7XA 3OX7U 3DA9B 1V2VT 4AFUA 2GMTB 1T32A 1A3EH 4X1NU 3LGVA 4I8KA 4FUGA 1O3DA 3VEQB 3F0PA 2FEQH 4Q63A 4CRCA 3F2HA 1TE0A 1ZPCA 1V2QT 2SNWA 5GXPA 5J4QA 5TJXA 3W95A 5EJZA 1CVWH 1GHWH 4FUHA 3OU0A 3S69A 1SHHB 1XUKA 2Z9JA 1L4DA 4DJZB 2ZA5A 2GZ7A 4CRAA 1CGJE 2Z94A 1VGCC 3EQ0H 2VGCB 5DO4H 4UFFH 1M9UA 1EOJA 2G5NA 2W7SA 1G30B 1TIOA 4DIIH 1UTPA 1HGTH 2BY5X 2NU0E 5GIBA 2FI4E 3M7QA 1YKTA 4D8NA 4ZKSU 1F7ZA 1OOKB 2UWLA 4IMQA 1EPTB 5IK2D 1MTUA 1UCYK 1GJ5H 2STBE 1THRH 1P9UA 3UIRA 3RXPA 4I32A 1V2WT 2OK5A 1GI0A 3D62A 1WYKA 3FAOA 3C27B 1KY9A 3ZV9A 2Q6FA 5EPNA 3SJ8A 4CBOA 2KAIA 4ABBA 2GD4B 4X1PU 1GPZA 1H9HE 3BG4C 3GDSA 5C1XA 2VVCA 3BTKE 4IN1A 2GT8A 1WOFA 1C5ZB 1O39A 1MKXH 1GMCF 1H9LB 1P2OA 4A1TA 2ZWLH 5LPEA 1BTXA 1TGSZ 2BY7X 4NA9H 2JH0D 1TNIA 2WPLS 1LTOA 5DP4A 4P00A 5JBCS 3VB4A 3P8OA 1BT7A 3BEUA 1O2RA 5K7RA 4R8TB 4D9RA 1HYLA 3SHAH 1RGQA 1A0HB 1UVSH 1P03A 4TPYA 5GPIB 1PYTC 3BG8A 2H6MA 1H9IE 2PWXA 1EB2A 3MQKC 2THFB 1O5BB 1ESBA 4ISNA 2AGIX 2CMYA 4CH8B 1CT0E 1O2NA 1Z6JH 2VVUA 4K1EA 2W3IA 5ABWA 1QIXB 2GVFA 1MCTA 1FX0B 2OC7A 2K1QA 2FLRH 2P8OB 1O3FA 1YP9A 1C2MA 5CHAC 1GI9B 4MDSA 4WY3A 3UUZA 1P57B 3TK5A 3BTQE 3RM0H 1Y5UT 3GYLB 1C2DA 2HVXA 2FI5E 1FI8A 4JZFH 3QGNB 3V7TA 4WVPE 1OWDA 3MNBA 3NKKA 2UUKB 4CHAB 4NGAH 1DVAH 2XYAA 3TGKE 1HIAB 3PLPA 1DWEH 2RDEA 3AW0A 3P95A 3LKWA 2CF9H 1SMFE 5GWZA 1KXEA 2CF8H 3QUMP 4GCHG 2V3HH 1SGPE 4ZHMU 1FPCH 4CR9A 4RKOB 2KCAA 2GV7A 4ISIH 1EZUC 1C2IA 4ABJA 3SORA 1ZSKA 2F43B 2F9PA 1ELEE 2FOAA 3RXVA 4JZ1A 2ZGHA 3GISB 1TBRH 2BLWA 4OS5A 1WBGB 4M7GA 3SU2A 1W8BH 2WPDD 1C1TA 1GHVH 5E2PA 3U8RH 1HV7A 1C1MA 1Q3XA 3SU5A 3RXBA 3DFLA 2OUAA 1O2XA 3V12A 5FPYA 1QJ1B 3PWBA 4Q80A 2C8YB 4B1TA 3ZVGA 5CDFE 2WV5A 2W3KA 1T8NA 1E37B 1SGYE 1GBHA 2O8TA 5DP6A 3OTJE 1C2LA 1S6LA 2M2AA 1GBTA 2ZO3H 2VIWA 1ELTA 4OS7A 1QL8A 2GDEH 1HAXB 2VVVA 4B2CA 5C2ZA 1QA0A 1CSOE 1MAXA 2BM2A 1C2JA 5LH8A 2R3UA 3T62A 5EW2H 1QL9A 4NCYA 3QLPH 1QJ7B 3VFEA 1TMBH 1ZMNA 2JKHA 2Z9GA 3BTWE 4MTBA 4GUXA 5FHTA 3TK6A 5C20A 5F03A 1JMOH 4DGJA 2O8LA 3KEEA 1OWJA 1JIRA 1QFKH 2WZQA 7LPRA 5GCHF 5F8XA 4D7FA 3M35A 4FUCA 1NFYA 3IG6B 2BQWB 1NBMD 2SFAA 5T6GA 3SBKA 3P6ZB 2VBCA 1DM4B 1K0HA 4IMZA 1ZOMA 1ZTJA 4YO9A 5C1YA 3RMNH 1O2IA 4I33A 5EJ1A 2AIPA 3A7ZA 3BTHE 5A09A 3VG8A 1GCTB 3F1SB 1N6XA 1D6WA 1MD8A 4FUIA 5JYIA 1LVMA 1ANBA 1Y3XA 4OS1A 4H4FA 4ZXYH 4NA8A 3CENA 3S7HB 2FIRH 1TNLA 1Q31A 1HPGA 1JRTA 4XD7D 2ZTXA 2ZFQH 2ZNKH 1DY9A 3ZVDA 5C0UA 2FODA 2GV6A 1BBRK 1K1MA 1FY1A 1ZTKA 5HMAA 2ZGJA 2QF5A 4CRBA 1P2KA 2J38A 4RT1A 3SYJA 2QXIA 2GZ8A 2G55A 3FP6E 4MNXA 1EKBB 3PTBA 3SGBE 4A7IB 1YYY1 2BY8X 3ATMA 2GCTC 2YMSB 3RMMH 1GI3A 3MNCA 1Z71A 4RKJB 3LONA 7ESTE 2C8ZB 3TJUA 2BX4A 2OCVB 2FM2A 2BLOA 4DCDA 3A7VA 3SGQE 2Y6TA 5EIYA 1FN8A 1YGCH 4FU9A 1AVXA 3SN8A 3SUEA 3UNSA 1UO6A 2QF4A 4AYYB 1O2ZA 2ZPSA 2J97A 3ZVEA 1UHBB 2XBXA 3KHVA 1ELDE 2XTTB 4D9QA 1DLEA 4DT4A 8KME2 5HIYA 5CMXH 1CU1A 1OYQA 3WY8A 1SB1H 2VH6A 2KCYA 1ELFA 5E0HA 1SOZA 3CS7A 4DURA 2PKSB 2FPZA 3U98H 3TJVA 2QGRA 4GAWA 3GDVA 3MNXA 1W2KH 4INLA 3O8CA 5HXFA 4ZKOU 1P12E 1COWD 2B0FA 3DUXH 1FY4A 4MNWA 1FIZA 2GKVE 1SHYA 4Y10E 1IQKA 4E7RG 4Z6AH 1L0ZA 1GHYH 1A5IA 1GDQA 3MTYA 3QGJA 2ZDKA 5GJ4B 1EZXC 2WPHS 4X2YA 1LO6A 2PUQH 4BAOB 3F9EA 1Z1JA 1GJ4H 1HNEE 3RC4A 1NRNH 3KYGA 1HAZB 2VNTA 1QR3E 1V2PT 1FJSA 1KXDA 1L1GA 5DP5A 1TGBA 1T31A 1YPJH 2ZTZA 2ZFSA 2AEIH 4A92A 5C0TA 4ZKRU 2A4GA 1GI1A 3RU4D 2Z9KA 2BDBA 4YTAA 1D9IA 2AMDA 4B74A 2PP6A 3T25A 2G81E 1D3TB 3IWMA 1O36A 4LK4A 2FDAA 4JZDH 4AB9A 4X1SU 1CA8B 3LH3A 1ANEA 2LNCA 3E16B 2GJGA 2QN5T 4YT7H 3BTGE 1C9TA 3SV2H 3OSYA 1ACBE 1V2RT 3WWFA 1ANCA 1HFDA 2G8TA 2VWOA 1ESAA 4XBDA 4I7YH 3ODFA 3M5NA 1P2JA 3MU0A 1J17T 1NO9H 1SGCA 1SKYE 1V2ST 1AUJA 7KMEH 4BXSA 1V2UT 2BD2A 1D4PB 2SGDE 2FOMB 2VH0A 4XOJA 1YPMH 5DG6A 1KYNA 1SQAA 3Q3KA 3R0FA 2PTNA 1IQNA 3NXPA 1A0LA 1C5NH 2YNAA 2B5TB 2ANKH 3FKSD 1AWFH 4AFSA 1N1LA 1PPCE 3HK6B 4X1RU 6CHAC 1C5WB 2P94A 1XUJA 2ZKSA 3LOXA 3HK3B 3HATH 1TFXA 4HI3A 1IQIA 3SNCA 1SG8B 8GCHG 4ZMAH 1O30A 2BMGB 2GGVB 4AG2A 1V2LT 4THNH 4XFQA 2K8IA 3EYDA 3OY5U 2FYQA 3VGCC 4TT3D 1E36B 3SU6A 3WW7A 1A1RA 2GCTB 1IQGA 1EJMA 3UNQA 3VPKA 1DY8A 4YOGA 1NRQH 4BTTB 1F0UA 2YNBA 1P2QA 2BVSH 4I31A 3GCNA 4B73A 4X6OA 4ASHA 1QY6A 3SW2B 2BZ6H 2H9EH 3Q3YA 1GDNA 2BDHA 2EY4C 4CHAC 2VINA 1YCPK 1GVZA 1SFIA 3LJJA 4PROA 5FL7D 1DSUA 1UTMA 2J4IA 1VITH 4CRFA 5C17A 2DUCA 1MH0A 3SV7A 3RXQA 3PO1B 1A61H 1O3AA 1BDAA 3DSOA 3A87A 4NFFA 1O2PA 1YC0A 7GCHG 1BRUP 2A4RA 1Z8JB 2ZFPH 3TU7H 2UUFB 4AB8A 2GDDA 1D3PB 1B0EA 4ZROA 1DWBH 2XWBI 4B71A 1W12U 1Y3YA 2BDAA 4JK5A 3BSQA 3OAAD 3SU3A 1GI2A 1Z1IA 1O2YA 1C1SA 4YT6H 1HJAC 3KCGH 1WDIA 1F92A 1HCGA 4B75A 1INCA 2FESH 3MHWU 2R2MB 2FMJA 5DP8A 3OEHD 1AQ7A 2BD9A 2C93B 1C1PA 1OWIA 2G4UA 3MO9A 1BHXB 1ZZZA 2P93A 1THPB 3B23B 2BY9X 3U1JB 3NRLA 1BB0B 5EQSA 3SUGA 3BG4B 1TQ7B 4NWKA 2BOKA 4K69A 1V6DA 3HGPA 1MCVA 3F2FA 1CT4E 1PQ5A 3D65E 3KYFA 2UWPA 3U8TH 1TNKA 2EI6A 1FQ3A 4U32A 3RXEA 3ZZ8A 3IITA 2TGAA 1Q2WA 1V2TT 1ANDA 2V3MA 2Z6BD 4J2YB 1YPLH 4WXVA 1C4Y2 1O5FH 4OS4A 2VWNA 4BNRA 2CV3A 3N7OA 2R0LA 2F9UA 1HAPH 1O2WA 2FYRA 2A5IA 3MMGA 5ETXA 1VITG 3F0OA 1A5GH 4DG4A 1SLXB 1WSSH 2V0BA 3I29A 2KZ4A 1S82A 3SO3A 1F2SE 1O2SA 3ZZBA 1MTVA 3PYHA 1NN6A 3AAUA 1GCDA 1NM6A 1H8IH 3Q00A 4BAQB 1ZTLA 4HGCA 1YM0A 5B6OA 3EAJA 1GBMA 1Y3WA 3EA8A 1A0JA 2HLDD 1YPGH 1Z7KA 4ABDA 2I6QA 2Z9IA 2HNTF 4XDEA 1FDPA 1OKXA 2P3TB 4H6SB 3RLWH 2CJIA 1U6QA 4DW2U 1QURH 1Y8TA 6ESTA 3U69H 1G32B 3TJNA 3ZZ3A 1Y3UA 1BMNH 1JOUB 3SNDA 4FETA 1TBQH 5C94A 2EQNA 3ELAH 4ISHH 5A0CA 1GI7B 1HAGE 1KTSB 4CR5A 1YF4A 1QBNA 2EC9H 4ZAEA 1GBJA 3E6PH 4ISOA 1EPTA 3E0PB 1WQVH 1K9OE 3URCA 2PSYA 5DN6D 4WMFA 1K1NA 2BVRH 5T6FA 4FUFA 2OQUA 1SGFA 4DIHH 4KELA 1TGNA 5FXLA 2F9NA 3SUDA 1YPEH 4XSKU 3VGCB 1AN1E 1V2MT 3BN9A 1AZZA 1LVBA 1EQ9A 3T29A 5FBIA 1KMHB 5DSFA 3M36A 1CGHA 4SGAE 1Y5AT 5A8YA 1OSSA 1BJUA 1SBWA 1QBVH 1P2MA 2F9OA 1QRZA 3A89A 1O2KA 2ALVA 1PPEE 4WXIA 3O8BA 1KDQB 1CA0B 2XBWA 2F4LA 1W0ZU 1SLUB 6LPRA 5C5NA 1MQ5A 2FOFA 3SI4H 1ZMLA 1NC6A 5DPAA 2TGDA 2XNIA 1MZAA 1O33A 2ODQA 1FUJA 1P01A 1VZQH 1S0RA 1WQSA 4MG3A 1EP6A 2ASUB 3RM2H 4K8YA 1MU6B 4B6FA 3BV9B 4K60A 2RG3A 4CBNA 2WV9A 4BOHA 1O2LA 1F0RA 3V0XA 1TALA 2VGCC 2Q6DA 4MVNA 4FU7A 1NU7B 4AG1A 1L1NA 3SV9A 2B8OH 1W10U 1B5GH 3D23A 2BYAX 2SGPE 2P3UB 3PO1C 5EXMA 1MTWA 3RMLH 1UVOA 2G5VA 5FX6A 4O03A 2ZU3A 2G00A 1YLDA 2G52A 2WYGA 3P70B 1TOMH 2SGQE 3QX5H 3MH5A 1H8HD 1HAIH 1S83A 1V2NT 2HOBA 1ELCA 4JMYA 4MNYA 2WV4A 3SJOA 3GCTF 3UOUA 2UUYA 2PKAB 4Q2KA 2ZU1A 2KCOA 3A85A 2AYWA 1IQHA 1YCPM 1TNHA 1TONA 4FUEA 1NROH 1ZSLA 1NRSH 5F8TA 5DP7A 5EG4A 1ZRBA 4OGXA 2FOGA 1SI5H 3MH4A 3STIA 2PLXA
chains in the Genus database with same CATH topology
3ZZ4A 2PTCE 5E0JA 2H2ZA 3UQOA 1EAWA 4YZUA 5EGMA 4MQAA 1RTFB 1MBQA 2M5TA 4KTSA 1IOEA 1G3BA 2V35A 3ZYEA 3VB3A 1AD8H 1BBRE 2EI7A 4I8JA 3S7KB 1THSH 4NIWA 5I25A 4TY6A 1PQ7A 2ZDLA 3SNEA 1QB6A 1NU9A 1HAVB 2R9PA 2FZZA 1LKBA 1UTLM 1ZMJA 1GBCA 3TIUA 2QA9E 4YESB 1DS2E 2NWNA 1AVGH 3LC3A 3G01A 2HGTH 3FVFB 2F3CE 1SGDE 3SU1A 1HAVA 1Z6EA 4FVDA 1S0QA 5T6DA 4E06H 1TX7A 1EP5A 5EQRA 4ZH8A 1PJPA 1YPHC 1TPSA 5EW1H 3P8FA 1JBUH 3SI3H 3RXMA 1TGCA 8LPRA 1C5VA 1KXFA 1N6YA 3H5CB 3T28A 1K21H 1ELVA 3SNBA 4ESTE 3M3TA 4UONA 1O34A 1SVPA 1GI5A 1O2MA 1UCYE 1FMGA 1A46H 1LHDH 1XKAC 4X8UH 1C9PA 5EU8A 2ZPRA 1RRKA 1O3NA 3P8GA 3K6ZA 2A7JA 1O3LA 3PLBA 4UE7H 2GMTC 3TH4H 1E38B 2PKAA 1D3DB 1S6FA 1C1QA 2ZP0H 3MO3A 1IQJA 1VITF 3RXLA 2SNVA 1C1UH 1QBOA 4BXWA 3U8OH 1NESE 4F4OC 1ZPBA 5L30H 2NU3E 2PHBA 3M5LA 4YLUA 1O37A 3F9HA 2ZHDA 2Q1JA 1DWDH 1NZQH 4X8SH 2J95A 1JIMA 4D7GA 1GHZA 3ZZ7A 1ZHRA 2NU2E 1P05A 1O3GA 2GP9B 2UUJB 4DT7B 1GHBF 5I46H 2GZ9A 3RXKA 4D76A 2C90B 1C5UA 1VJ9U 1DOJA 5HYOA 2OINA 1ESTA 1IHSH 5JB8S 5C1UA 4INHA 3GDUA 1LHFH 2ZHQH 2ANMH 1AHTH 2EI8A 1O2HA 3BTFE 5PTPA 1TRNA 4VGCB 3PWCA 1UTOA 1QQUA 1A3BH 3MO6A 5JBBS 2ZU2A 3ZZDA 3E90B 1TPPA 1LPZB 1AFQC 3SOSA 1DXWA 1BOQA 2CXVA 1CA0C 1KLTA 1BMMH 1PPGE 2ODYB 1SPJA 3FFGA 5C5OA 3FZDA 3U9AH 2ZGXH 1MKWH 3SUFA 1C5SA 4O97A 4A1VA 1C2HA 3DHKH 1UHBA 2GCHG 1BTWA 1YPKH 2PUXB 2VWMA 2ZTYA 4DVAU 2AIQA 1CT2E 1NRPH 1GI6A 1D3QB 3A81A 1FY3A 1IQFA 1DDJA 4H42U 5H4IB 1HJ8A 1AU8A 2F91A 1NFXA 2XXLA 4WMDA 8GCHF 5E2OA 1GBEA 1GJ6A 3MU4A 1UTKA 1HXFH 2JETB 2QCYA 1F0SA 3TNTA 1K2I1 1TA6A 2ZU4A 2DE8A 3EA9A 3MH6A 2WUCA 1XVMA 2FWWA 4INKA 4TPIZ 3UR9A 2J34A 1W7GH 5JDUB 3ZYDA 8ESTE 2A2QH 2A1DB 4NG9H 3LPRA 3SJKA 1LVYA 1AUTC 2HNTC 4X1QU 1T8MA 3FANA 3MFJA 1BMAA 2BD8A 4LZ4B 1EX3A 1Y59T 3I77A 3RXIA 1DX5M 1HBTH 4LXBH 1CHOG 2AFQB 2H9TH 2Y5HA 4K2YA 1WAYB 1T8LA 3L33A 1VJAU 2P3FH 3VXEH 2GT7A 2A5KA 1HXEH 2OC8A 2XRCA 3K65B 4K3JA 1K28D 1ZR0A 1TAWA 4NIXA 2PR3A 1FAXA 1ABJH 2PFEA 3L6PA 1QJ6B 1C2KA 1DE7H 1DPOA 7GCHF 1P3EA 1KIGH 3MOCA 4MNVA 3DD2H 1LQEA 1BTHH 2A45B 3SJIA 5F6MA 2QXJA 1CQQA 4FUDA 5DP3A 1PQ8A 1FV9A 1EJNA 1YBWA 3QZQA 4Y8XA 1OWEA 1SGNE 4X6PA 4GCHF 2OC0A 4Y8ZA 1BHXF 3UOPA 1MQ6A 1FPHH 1G2LA 1O3HA 2HPPH 4IGDA 4A6LA 5JB9S 2BX3A 1T7CA 4X2WA 2CN0H 2QC2A 1QCPA 1P09A 1SGEE 3RXFA 3T27A 2P59A 2JETC 5AHGH 2A7HA 3GYMA 4FUJA 1O2UA 1OPHB 1O3IA 5GDSH 3TH2H 2AGGX 9LPRA 3KF2A 3TVJB 1MAYA 1ARBA 3E1XB 3A7WA 2V6NA 1S81A 2OXSA 2XC5A 4FXGH 3PMJA 1H8DH 1QRWA 1O2GH 1P06A 2QAAA 3AVZA 1O5GH 3NUMA 3ZV8A 1DUAA 2I6SA 1AB9B 2ALPA 1TRMA 1GG6C 5L6NH 3A7TA 2QY0B 3LJOA 1W3CA 5E8EH 2FOHA 1N8OB 3HPTB 5FBEA 2O8MA 4I8HA 4Y7BA 5TCCA 3PMBB 1CHOF 1QTFA 2GTBA 2BD4A 4WMEA 2PW8H 4K1SA 1HIAA 5A8ZA 2ZC9H 1LCYA 1QRXA 3TGJE 3M61U 3ZVFA 3SHCH 1RJXB 1VCQA 2C8WB 1BTPA 2PGBB 3JZ2B 3PMHB 3E3TA 4Y79A 2BQ6B 1T8OA 2IOTA 2A4QA 4U30A 2BVXH 1LHGH 1BTUA 2STAE 2SGAA 2D2DA 3LGYA 1BRAA 1ZHMA 4Y11E 3TNSA 4X6MA 2BQ7B 1GBAA 1GHAG 3UTUH 2Q6GA 4O3UA 4AFQA 1F5KU 1C1NA 2D1JA 2XCFA 1TX8A 5F8ZA 2G51A 1F0TA 3C1KA 4YLQH 3KQDA 1MMJN 2Y82A 4ZHLU 2JH6D 1DT2A 4JZIA 4K5ZA 4AORA 2ZHEH 2QV1A 3SQEE 2ANWA 2O8UA 2F9BH 2IPHA 2AGEX 2CHAB 5FAHA 4MPVA 1SC8U 4UEHH 1P2IA 1A7SA 1HRTH 2ZGBH 4AN7A 3LGWA 3ZVCA 2O9QA 3TK9A 1HJ9A 1XUIA 3M37A 2P16A 5FPTA 1XKBC 1OS8A 4X8TH 2ZEBA 1PPBH 1C5TA 1SLWB 1GGDC 3STJA 1CO7E 1KLJH 1Z8RA 3TLOA 1P11E 3MWIU 1BTYA 3FZZA 1X7AC 1LQDB 1Y5BT 4ZXXH 2OBOA 1AZ8A 1LDTT 3F9FA 4KP0A 3K6YA 3NWUA 1UVUH 2XCNA 1FY8E 2OBQA 4AZ2B 1ELAA 5FCRA 2ZFRH 4BAKB 1DFPA 1AIXH 4J1YA 5A0BA 4U2WA 3A8BA 2CGAA 1O3OA 3LH1A 1T4VH 1GBFA 4WH6A 2ZCKP 1SQTA 2H5CA 1WCZA 1KLIH 1KSNA 2ZGCA 1AGJA 5LPRA 1HB0B 2IJOB 1A2CH 4X6NA 4BANB 1AFEH 2Z3CA 4AGKA 4B2AA 1WTGH 2BD7A 3AASA 1C1VH 3B9FH 3EGKH 2TRMA 3PV4A 1TB6H 5HM9A 3ZZCA 1TOCB 4X2VA 1AE5A 1VR1H 2ZCLP 1OP8A 3NPSA 1FNIA 4ABEA 1TMTH 2VIQA 1GBDA 1XUHA 2WUBA 2ZQ2A 3A8DA 1BIOA 3GY6A 4R0IA 1L4ZA 1NT1A 3S9BA 4DY7B 4AGJA 3LDXH 1ETRH 2C4FH 4Z0KA 2Z9LA 1OP0A 4IN2A 4JYUH 2BY6X 2XBYA 2RDLA 2XC0A 4NZQA 1L1JA 3ESTA 2VU8E 6GCHG 1SOTA 1ZJDA 3LIWA 3BTME 4Y76A 1OP2A 3RXJA 1C5QA 3PLKA 4IW4E 1DITH 2H5DA 3SNAA 1S85A 1O5DH 2BXUH 2PSXA 4MPUA 1IQMA 1EXFA 1WU1A 1O2VA 2J2UA 4OGYA 5A8XA 2QXHA 3GCOA 3K9XB 1V2OT 3RXRA 1F5LA 5CE1A 1LVOA 3R3GB 4E05H 3T5FH 1HAOH 1S84A 2FO9A 1SGFG 3F9GA 3M5OA 1AO5A 1TABE 1VCPA 4ZUHA 3RLYH 3RXAA 3BTDE 2HRVA 2ZU5A 3KQEA 4F49A 2PV9B 1FIWA 3BEFB 1O2TA 1O0DH 2WPJS 1GI4A 3ZZ6A 1HAHH 1GJ7B 1O3CA 1ZRKA 2VWLA 3GY8A 3MU1A 3M7UA 1QB9A 2BDGA 1TPOA 1YPHE 2BOHB 2Y7XA 4H6TA 1K1LA 4SGBE 1SQOA 2NU4E 2A5AA 2UWOA 3KQBA 3BIUH 1HUTH 1MZDA 5BPEA 1BITA 1O5EH 1SR5C 3LGTA 1XUGA 1GMDG 3LGIA 1K1JA 4MPXA 1AKSB 1GMDF 5SGAE 2ANYA 3A88A 1GJ8B 5AFZH 3QK1A 1CBWB 1A4WH 2CHAC 3RUOA 1WTHD 1QGFA 1KTTB 2ZIQH 3A8CA 4U01A 3KNXA 1D6RA 3MU5A 4CH2B 2ZHWH 1GI8B 1HJAB 1RTLA 2ESTE 1C5OH 2G4TA 1MU8B 2NU1E 1EASA 1OXGA 4NA7A 3BIVH 4YOIA 4ABFA 4X0WU 5FX5A 2ZDNA 1C2EA 1SLVB 1LHCH 2LPRA 3ZZ5A 2BDIA 1C5MD 1K1IA 4JYTA 2HLCA 1J16A 1C4V2 1UTJA 4GHTA 3LC5A 1BA8B 3E0NB 3P92A 4NSVA 4YM9A 5ESTE 4O9VA 1PPFE 1GJBB 1FZZA 1TRYA 3A86A 1UVPA 4AFZA 4NFEA 2BDCA 1EAXA 2Y81A 3PROA 3S0NA 1ZGVA 3RC6A 3SQHE 1F5RA 1K1OA 3S9CA 3VB7A 4LZ1H 5A2MH 5AVDA 3SGAE 3GCTG 3O8RA 1K1PA 1MBMA 1DICA 1GJDB 1WV7H 2BDYA 9ESTA 1GG6B 4IC6A 1P04A 4K1TA 2A31A 4YOJA 1C1RA 3L3TA 1J8AA 2QYIA 1TGTA 4CRDA 5L2YH 1SGQE 1O3MA 1BRBE 2R2WU 3GOVB 1GJAB 2BXTH 3B8JA 3GY5A 1TWXB 2HNTE 2FOBA 4FVBA 3RP2A 1Y3VA 2OTVA 4HZHA 2OQ5A 1KXCA 1RD3B 1ETSH 1P8VC 2HALA 4MLFB 4CRGA 6CHAB 5HGGA 1SGRE 2FTMA 1EAIA 3T2NA 5L2ZH 3O8DA 1QNJA 3V13A 1DWCH 1IAUA 1Z8IB 1NFUA 1GL1A 2BTCE 1W14U 2WINI 3AW1A 1UTQA 2FX6A 1P02A 4O3TA 1GBLA 4GSOA 1DSTA 1GVLA 1GJ9B 2ZI2H 3P8NA 5CHAB 2ZZUH 5ESBA 5FCKA 1UK2A 3ZZAA 1GJCB 3QWCH 5A0AE 1G9IE 1H1BA 1ETTH 4Y7AA 2ODPA 1GHAF 1MTSA 1BMLA 1GBBA 1S5SA 2P95A 1ELGA 1O3EA 4AX9H 1OWKA 1LPGB 2VIPA 1UK3A 1ZGIA 2VB0A 1HAYB 3HKJB 3RXUA 1OX1A 1LPKB 3OY6U 1PQAA 1UTNA 1T4UH 3T26A 1ZLRA 3GCHB 4BAMB 4WJG2 3RDZA 3BF6H 1V2KT 1MKXK 3PMAB 1AVWA 1PYTD 3LU9B 3U1IB 1P9SA 1FN6A 1W11U 5C67A 5JBAS 1CBWC 3H7OA 1Z8GA 3SV8A 4ISLA 1BBRH 5BRRE 2RCEA 2ZECA 1K22H 1O31A 2KAIB 1G3EA 5E0GA 6GCHF 3UQVA 1AWHB 3A80A 3ODDA 1UJ1A 1TYNA 4B76A 4UFEH 1RIWC 5C3NA 2WPKS 1MTNB 1DUEA 5IYTA 3ZVBA 4XBBA 2W7UA 1DXPA 1MD7A 1G3DA 1XMNB 3KN2A 4FU8A 1JRSA 4Y6DA 3CP7A 3M3VA 1S6HA 1MTNC 1EPTC 1SSXA 1RIWB 3SZNA 3TPIZ 2C8XB 3GICB 2WPIS 3AAVA 2FOEA 1EZQA 4Q7YA 1SFQB 1AY6H 2ZDMA 3UWIA 2ULLA 5LPFA 1BCUH 3RXTA 2Y7ZA 3ITIA 1GCTC 4Y71A 4KKDA 1ARCA 1J15A 1UVTH 5EODA 3RMOH 1XX9A 2FX4A 1EATA 1C5LH 2QXGA 2QIQA 1IHTH 3GCHC 1DLKB 5AF9H 2BD3A 1FONA 3UNRA 1SGIB 4JK6A 4MPWA 3V3MA 4BTUB 2A32A 1G3CA 2Y5FA 5IDKA 1O3KA 1QA7A 2F9VA 1EOLA 3Q76A 2VIDA 3QTOH 4K8BA 2FLBH 1OYTH 3TJOA 2R3YA 2YOLA 1GHXH 1A5HA 3P17H 3UFAA 3ATLA 5EXLA 3TITA 1FXYA 1E35B 3KQCA 1P10A 1O35A 2AH4X 1KXBA 3PTNA 1GMHF 1FY5A 1CHGA 4Q7ZA 1BTZA 3QN7A 3M3SA 3PB1E 1TPAE 4HTCH 1TLDA 3E8LA 2D26C 5EPYA 1TA2A 1BZXE 4A5TS 1BUIA 3MH7A 3LT3A 4E7NA 1O5CB 5J4SA 1G2MA 2BD5A 3RXHA 3RXSA 1PPZA 1RXPA 3FP7E 1N8OC 4X8VH 1E34B 3EDXB 3ATIA 4JYVH 2WYJA 3QTVH 4I8GA 4KGAA 2ZFTA 2VIOA 5T3HA 2BLVA 3SU4A 2BHGA 2AS9A 1NS3A 1O5AB 1C5RA 2FI3E 3EA7A 3A83A 4BTIB 5G4BA 2TBSA 2ZG0H 2ZPQA 2OC1A 2AMQA 5EQQA 3KGPA 3UREA 2IN2A 1C4U2 2PKSC 1BRCE 1AKSA 1O38A 2ZF0H 1ELBA 3ATWA 2DE9A 3KIDU 4ABHA 2VIVA 2H9HA 5FPSA 1ZPZA 1EJAA 4ABGA 2ZQ1A 5JBTA 1C2FA 1NRRH 1QL7A 4Y8YA 1O32A 5HM2A 1LKAA 3ZZ9A 3QZRA 5LGOA 4NIYA 2EA3A 3F6UH 5DP9A 1MUEB 3RC5A 2ZFFH 1XVOA 1LHEH 4IBLH 4X2XA 1XUFA 3FP8E 4UDWH 3GY3A 1TBZH 3KL6A 2SGFE 4WF8A 2Y5GA 3MU8A 2P8OC 4JZEH 4XBCA 1VGCB 1ABIH 1ZSJA 4I8LA 2XBVA 4IS5A 1TQ0B 3GY2A 1W13U 1C5PA 3JZ1B 2FS8A 2TPIZ 4A1XA 4AYVB 2C3SA 5DGJA 1DANH 1QQ4A 2GCHF 3A84A 5EOKA 3RXCA 4HFPB 4IC5A 1YCPH 1BQYA 3RU4E 1ORFA 4ZHAA 4NSYA 1GHBG 3RXDA 3M7TA 3K2UA 2SGEE 4Q7XA 5DK1A 4B2BA 1LMWB 3EE0B 1EZSC 4XE4A 2A4OA 2W5EA 4AOQA 3ENSB 2Z3EA 1HDTH 2RA3A 2BB4A 1J14A 2TGTA 3CS0A 4GPGA 2J92A 3A8AA 1O2QA 3OYPA 2W26A 4OS6A 1AMHA 3TH3H 3QDZB 1EB1H 3BTTE