3A88A

Crystal structure of trypsin complexed with (e)-4-((2-nicotinoylhydrazono)methyl)benzimidamide (soaking 30 minutes)
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cationic trypsin
publication title In-Crystal Chemical Ligation for Drug Discovery
rcsb
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a88A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a88A02
4D7FA 4ISHH 4ABFA 1DUAA 2BQ6B 4FUJA 2BY7X 1P2KA 5GJ4B 3RC5A 3ZV9A 1GG6B 7GCHG 3KQCA 1GBHA 1ABIH 4KTCA 2WYJA 4K60A 1PPFE 3ZZ9A 1N8OC 3SU1A 2PW8H 3O8BA 1QQUA 4GVUA 3SU6A 1MZDA 2ZDKA 4K1SA 1Y5UT 2A31A 2BD2A 3QLPH 2VGCB 2ZDAH 3FFGA 3SJKA 1A7SA 3SNCA 1SHYA 1MMJN 2A4RA 1SGDE 3VB6A 1KXAA 1DX5M 1C5QA 2NU4E 3ZZDA 4XOJA 3CENA 1RGQA 4X8UH 3JZ2B 3MTYA 3D65E 1YC0A 2GCTC 1P09A 5E2OA 3SV6A 4E7RG 1IQEA 3OTJE 4R0IA 1K1JA 1OXGA 1C1TA 4ISNA 1E37B 3DUXH 1FY5A 2FOEA 2PTCE 4B76A 2EA3A 3S9CA 2ZFTA 1BZXE 3T27A 1V2TT 3PLPA 1S6HA 1H9IE 1VITG 2FXRA 1AD8H 1HDTH 3NXPA 1QB6A 1P01A 1SQTA 2D2DA 3P92A 5E0JA 1ZRKA 5F6MA 2ZDMA 1C1MA 2ZU1A 1QL7A 1GJBB 2WPKS 4NZQA 2FMJA 5AHGH 1EAXA 3RU4D 1IQMA 4INKA 3BF6H 4XSKU 1FDPA 1FIZA 3LH3A 1Y5AT 1EZUC 2ULLA 3TNTA 1D3TB 1UVPA 1A61H 2FESH 1TE0A 1SFQB 3ZZCA 3RXTA 5LPEA 4Q80A 4ASHA 4CRCA 1NC6A 2WPLS 1DS2E 1O5FH 3RMOH 4YT6H 4D9QA 4X2WA 2BDGA 1V2MT 3QX5H 3SJ9A 1SGEE 3A83A 1FN8A 4I8HA 2BDBA 1LPKB 1GDNA 3PMJA 1UTQA 2FYRA 2ZDVH 5HMAA 4ZXYH 1YKTA 3GY5A 1IQHA 1C1VH 1NU9A 5E0GA 2PKAB 1BRAA 1TYNA 2A1DB 4D76A 4CR5A 3BTHE 4Y76A 1DANH 1E34B 3WY8A 1U6QA 4XBCA 3K6YA 3HPTB 2FWWA 3UR6A 2FODA 1ETTH 3HKIB 3MH5A 4XE4A 5IYTA 2SGPE 1THSH 2ZFSA 1FI8A 1C4V2 1GBBA 1ZGVA 5HGGA 1A1RA 4MNYA 4NIVA 1MTSA 8ESTE 6CHAB 4LK4A 1NT1A 1V2LT 3NPSA 2UUKB 4BAOB 1EOJA 1SGRE 1BBRH 3EAJA 1AE8H 1NPMA 3RXSA 2CXVA 1O3IA 2HOBA 1RIWC 4Y10E 1O0DH 3QK1A 4VGCB 3LIWA 4ZKSU 3TLOA 1Y3XA 1GGDB 2Z6BD 2JETB 2QGRA 2BDYA 1C5WB 5E8EH 1XUFA 3VFEA 4ZXXH 1ZMLA 4MPVA 1CQQA 1AE5A 1BHXB 1C4U2 1MD7A 2ZFFH 4O3TA 1C2FA 2QF0A 1LVYA 5DP4A 1OYQA 1TBZH 3MO3A 4WH8A 2B9LA 3ATMA 3S7KB 2PKAA 5AVDA 1RS0A 1YLDA 1WOFA 4YT7H 1JXPA 3P8FA 2D26C 3NCLA 3ZZ5A 2O8TA 2AGIX 3SNBA 2UUYA 2AIPA 5LPRA 4Y7BA 3SORA 1P3EA 2FI3E 7LPRA 5EW1H 1JBUH 1HFDA 1P2NA 2RG3A 2CHAB 4QT8C 4JK6A 1AFQB 1AY6H 3SUGA 1YP9A 3LGWA 2J2UA 1H8DH 2XBVA 5DP8A 2A4GA 3GISB 3QTVH 1C2DA 1BBRK 1NO9H 5BPEA 2HPQH 2P93A 1KY9A 1GI0A 3FP7E 3URCA 3UOUA 1C1UH 4CHAC 3LGUA 2HGTH 2FOHA 1M9UA 4DG4A 6GCHF 1IQGA 2Q6DA 1AVWA 5AFYH 1L4DA 1UHBB 2QIQA 2ZFPH 1KDQB 4MQAA 4X6NA 2XTTB 4JCNA 3TH4H 4SGAE 1TA6A 4GHTA 4X8VH 1UK4A 1P12E 2W7UA 1OWEA 4MDSA 1GJ7B 2P59A 5C67A 2XC4A 4GUXA 1AWFH 3FP8E 4WF8A 4DIIH 1SI5H 4DT7B 1O2OA 1LPZB 1EUFA 4ABAA 1X7AC 1NN6A 2THFB 1YCPK 3BTQE 1UK2A 3EDXB 2XWBI 2LPRA 3E90B 3MU5A 1L4ZA 2GP9B 1ANDA 2ZKSA 3GDUA 4B2BA 5EW2H 2ZPRA 1SGYE 4OS1A 4X1QU 4UFGH 1QB1A 2A5AA 1SLWB 1KXFA 2XCNA 1AZZA 1JMOH 1QURH 3A7YA 5DK1A 1Z71A 3F9HA 4ABBA 4FUIA 4YM9A 2BYAX 1EZXC 5GWZA 4BAKB 1MTNB 1N1LA 1QQ4A 3TK9A 1TA2A 6GCHG 1FJSA 3V7TA 3T5FH 1NRPH 3GYLB 3RM0H 1A3EH 1OWHA 1UHBA 2QXHA 1KDQA 1CA0B 1WUNH 1BRBE 5F8TA 3S0NA 5J4SA 4WY3A 3GDVA 3BN9A 3ATWA 5EXLA 1W3CA 2ALVA 1VJAU 1WYKA 3TU7H 1FIWA 2AMQA 3DA9B 2XRCA 1O32A 1ARCA 3RXAA 1CBWB 1SFIA 1T31A 3T28A 1SLVB 3QO6A 5DP3A 4CREA 2NU2E 1EZQA 2IOTA 3KCGH 1T8OA 1SGFG 2CJIA 4PROA 4ABIA 1TPOA 1V2QT 3PM3A 2SNWA 3HGNA 4AORA 3TIUA 2ZCKP 4NA8A 1C1PA 1ELEE 2PLXA 1S0QA 4X1RU 4Y7AA 2VH0A 4Y0YE 4X8TH 2UUFB 1KLTA 1TIOA 1UCYH 5CHAB 2BX4A 3F6UH 3GOVB 4WXIA 1KXBA 1AQ7A 1G3DA 2C4FH 1TGNA 1O2UA 1NTPA 1W0ZU 3BG4B 4XBDA 1A4WH 2RA3A 4YOGA 1PFXC 1Z8JB 2PR3A 3ZZBA 4YOJA 4CH2B 1ELAA 4BTTB 3TJOA 3ESTA 4FUGA 2GZ8A 2BVRH 1W14U 2G55A 4TWWA 3V12A 2G5NA 1C2MA 3IITA 4AYVB 3HATH 2GDEH 4D7GA 1OP8A 1V2NT 4IMZA 2J38A 2ESTE 2P8OC 3VB4A 2A5IA 3IWMA 3MH7A 1O2WA 1F0TA 1J9CH 3LH1A 4GSOA 4X0WU 2BDIA 2ZHQH 1TALA 1CT0E 1D6WA 1EP6A 1GHBG 3NWUA 1A5HA 2C8ZB 1G3CA 1ZRBA 1K1OA 1E38B 1OSSA 1HAHH 3E6PH 1L2EA 1VITH 1Y5BT 2GV6A 3L3TA 3V0XA 4ZH8A 4A1TA 5A8YA 3M5MA 3U8OH 1MCVA 3F1SB 1NZQH 1ZTJA 3I29A 2C93B 4DCDA 1S84A 2B5TB 1UO6A 1UCYK 5F8XA 1EPTB 1TMUH 1FPHH 1GBTA 1GL0E 1O5BB 4UEHH 5C1UA 3ZZ8A 3A85A 4ABDA 1MBQA 1OWJA 3PYHA 4I33A 4HZHA 1ZZZA 1NS3A 1PPGE 3M7TA 4CH8B 4H6TA 1TGTA 1C5RA 3F68H 2ZP0H 3DFLA 1O36A 2Z7FE 4LZ4B 1V2VT 2J92A 4OGXA 1GBCA 1OPHB 2VVCA 1VR1H 1O2NA 1RTFB 4B2CA 1BTHH 1B0EA 1GMDF 4F49A 2FTLE 1HAZB 5C5NA 5T6GA 1O3MA 1DWBH 4Y8YA 4DURA 3QTOH 2I6QA 1JRSA 4YOIA 2ZFQH 1OWDA 4Y8XA 1K21H 1HXFH 2AGGX 1ELGA 4YESB 4YO9A 2C8YB 4BAQB 2VB0A 1QGFA 1MTWA 2OBQA 1SPJA 1YCPM 3TJVA 2H9EH 1MTVA 1TRMA 5FAHA 1EAIA 3KQBA 2M5TA 4K69A 1OWKA 2A4OA 2BD9A 2ZGBH 3SJOA 1UTKA 2ZHWH 5ESBA 3RXIA 1C5MD 1K22H 2ZF0H 4RN6A 4ISOA 1MH0A 3RXDA 1P3CA 1EPTA 1BDAA 2BD5A 2ASUB 2F9OA 4K8YA 1FY8E 5LH8A 1QRXA 3U98H 4ZROA 3A7XA 1W7GH 1UTPA 1NRQH 1ANBA 4K8BA 3C27B 5H4IB 1ELDE 1P2MA 2RDLA 3AASA 2H9TH 4DOQA 1B5GH 3GYMA 2JH5D 4AN7A 2ZEBA 4BANB 1LKBA 1MU6B 1F0UA 1HRTH 1KXCA 4MTBA 3ZZ4A 1ETRH 3BSQA 3KN2A 1INCA 1FMGA 1C5PA 1AB9C 4FUBA 1TQ7B 3LDXH 4E06H 1W7XH 1WBGB 4NWKA 4JZEH 3T29A 4IN1A 4NGAH 1AU8A 1QBOA 3A89A 5K0HA 3O8DA 4I8KA 1S82A 2GCTB 3ATLA 1OOKB 3VB5A 1G30B 1UMAH 5FPTA 3C1KA 3E3TA 1C1NA 1QL8A 1HNEE 1P04A 1O3FA 1MKWH 3SV2H 3SNDA 4AB8A 2ANWA 1MCTA 1RXPA 1T32A 4GCHF 2BM2A 2UWOA 2PV9B 4AB9A 1Y3UA 3I78A 1BMAA 5A2MH 1TMBH 2HPPH 2ZGCA 1AGJA 4BAMB 2ANYA 1O2GH 1GHAG 1YF4A 2FM2A 2Z9IA 2AH4X 3MOCA 1O2XA 1EASA 1O3GA 4YLUA 2BVXH 4I31A 3ZVEA 3K2UA 3MH6A 2Y82A 1V2KT 1GHWH 4K3JA 4TY6A 1LDTT 2QXJA 3KGPA 1F0RA 2XXLA 1ELBA 1O2YA 7KMEH 1ARBA 1FAKH 1GI6A 3RXGA 2AGEX 1UVOA 2XC0A 2Z3DA 2XWAA 3EGKH 4Q2KA 1QRZA 1G3EA 1MBMA 1DDJA 1SGFA 3BEFB 2H5CA 3ZVGA 1EJAA 1FLEE 5FHTA 3ATIA 3AW0A 1MKWK 1L0ZA 2FI5E 3A8BA 2PUXB 1IOEA 5EPYA 1YPLH 3LC3A 3PV4A 5C3NA 2BQWB 5GPIB 2FX6A 1GMHG 3U1JB 1FZZA 1SGNE 4KTSA 1NFXA 1P0SH 1OX1A 5EOKA 7ESTE 5IDKA 2W3KA 4H6SB 2BDCA 2EEKA 1O30A 5EQRA 1FN6A 4O97A 4JK5A 2BDAA 2ZDLA 4IMQA 5A0CA 2FIRH 3SUEA 5EGMA 1V2JT 1GBKA 2OD3B 2QF3A 3S69A 4BNRA 1Y3YA 1HPGA 1S85A 3E91A 3PWCA 1L1GA 1ETSH 1O2QA 2BD4A 3AW1A 3DHKH 3SQEE 1EP5A 2HALA 3RMNH 4DY7B 5C1YA 8GCHF 5ABWA 2HVXA 1A5GH 1D9IA 1RIWB 2PUQH 3TK6A 3RXOA 1ZPBA 1EB2A 4JYTA 1AFEH 5JBAS 1NY22 3HKJB 1VZQH 2PHBA 2WPMS 1Q2WA 2F9NA 3SGBE 9ESTA 4BTIB 2A7HA 4IBLH 1ZPCA 2BZ6H 1GBAA 1YYY1 2VIPA 3Q3XA 1J17T 2OUAA 1GCTC 3STJA 5DO4H 1IAUA 2PKSC 1ZSJA 4AZ2B 1XKBC 2Z9LA 2G51A 2G81E 1P03A 2OXSA 3SV9A 1CHGA 2Q6GA 1AVGH 1O3PB 3AAVA 5K7RA 3SJIA 3AVZA 2DE9A 4CRGA 1YGCH 4ZUHA 5GIBA 1QR3E 1UTJA 1DWEH 2BD7A 4K1TA 3A82A 4FUFA 1C5XB 4ABEA 3E0PB 1CT2E 3BTDE 3FANA 3M3SA 6LPRA 3AAUA 2GT7A 3U8TH 1SLUB 4GHQA 1TX7A 3B8JA 2G4TA 3MNBA 3A86A 3QGNB 3ZZ7A 1G2LA 1GBLA 3H5CB 1P9SA 1THRH 1HCGA 1C2LA 1ELVA 1V3XA 3GY8A 1MZAA 1IQIA 4UFEH 4Z0KA 2V3OH 2WV4A 1V2UT 2W3IA 4CHAB 1NRSH 1ZTLA 1O5AB 3KQDA 3RXVA 3RLYH 4NFFA 1BCUH 1GI2A 2V3HH 3FVFB 4NWLA 5ETXA 2C8XB 2AFQB 3LKWA 2A2QH 3TGIE 1ACBE 2Y81A 3UY9A 2BLWA 1O33A 4AFSA 1KLJH 1P06A 2TPIZ 2XBWA 1ZHPA 4LZ1H 4ZKRU 4UDWH 3GCTF 1SR5C 1EB1H 4KGAA 1GBEA 1PPCE 1XUJA 3LPRA 3G01A 2CMYA 1UVSH 1BIOA 2ANKH 1Y3VA 4HI3A 1SL3A 1TAWA 4Q7XA 4B74A 3Q3KA 1DLEA 2PSYA 2ILNA 2O8MA 4IGDA 2VWLA 1O2SA 1AUTC 1TNJA 3PLBA 2P94A 3M37A 1V6DA 3V3MA 1BB0B 2ZHFH 3D49H 4Y6DA 2DUCA 3LC5A 1WTHD 1O2PA 3R3GB 3S9BA 1DUEA 4X8SH 4E7NA 1LVMA 4MVNA 3PMAB 4INLA 5DP5A 3KEEA 1O2LA 1TOCB 5L2YH 2ZI2H 3QZQA 4X6MA 3P8NA 3SZNA 4JMYA 1O3LA 3STIA 1YCPH 3Q77A 2H2ZA 1Y3WA 2AERH 2FS8A 1GVLA 1BRUP 3I77A 4AG1A 1C1WH 2YNBA 3PMHB 1W0YH 1QCPA 3K65B 1GI9B 3Q76A 1DOJA 1HAIH 4I32A 3HK3B 1AHTH 1BRCE 1AIXH 3NKKA 2BOKA 1HAOH 4BXWA 3ITIA 3UOPA 3BIVH 1H9LB 2BDHA 3OX7U 2BXUH 3U1IB 5JPMH 2R2WU 2QY0B 2C8WB 1IQKA 2WPIS 4GAWA 4FUCA 1YPGH 3BTFE 2BQ7B 4U01A 2AS9A 1XUKA 4MPWA 1C2IA 5JDUB 1GBDA 4AFZA 1SGPE 1BQYA 5HXFA 1KLIH 3PTBA 1UVUH 4B75A 3MFJA 2ZU3A 1DXWA 3BTKE 1MAYA 1C5SA 3UIRA 5EXNA 2BX3A 3TK5A 3VB3A 3NUMA 1O3DA 3MO6A 5CE1A 1UTOA 1J16A 3QN7A 1J15A 1T4VH 3KIDU 1Y59T 4X2VA 1UTMA 1A0LA 1ELCA 3M5NA 1G3BA 1LMWB 3A7TA 2OC1A 4DVAU 2A4QA 3ODFA 3MMGA 2P8OB 1QBVH 4VGCC 3MU1A 3E16B 5A0BA 1JWTA 4RSPA 1HB0B 3DD2H 4OS4A 3BEIB 5FBIA 1FQ3A 1GMCF 1O3KA 4JZFH 1BTXA 3Q3YA 4JYUH 4DW2U 3A81A 1CT4E 2PWXA 1HJAC 5DKMA 5A09A 1XUHA 2F83A 2SGEE 1P11E 1O34A 3VPKA 1SSXA 1Q3XA 3T62A 4Y11E 3GY3A 4U2WA 1O2KA 3SHAH 3PWBA 3RXBA 2NU0E 1NRNH 2ZWLH 1O38A 4UD9H 1CHOF 2PTNA 4FU9A 1BMMH 1QBNA 1G9IE 3K6ZA 4I8JA 3KL6A 2ZU4A 1RFNA 2CHAC 3VB7A 2TIOA 4RKOB 1A5IA 2F9PA 3QWCH 3ZZ3A 1P10A 2UUJB 1P05A 1KXDA 2F9VA 1G2MA 1PPHE 3TITA 2F9BH 2A7CA 3D62A 2A5KA 3OU0A 1RTKA 4ZKNU 2C90B 1AWHB 2J34A 2VWMA 1IHTH 1LCYA 2YNAA 1TMTH 1DVAH 3VXEH 1GI8B 1EX3A 1TQ0B 3ZVFA 1EJNA 1MQ6A 1BJUA 1UK3A 4X1NU 2OBOA 3MO9A 2Z9JA 4Y8ZA 5F03A 3HGPA 4LOYH 1UJ1A 3A8CA 4ZHAA 2ZFRH 3GCNA 4A5TS 1HAVB 3GY6A 2QYIA 5L2ZH 1W12U 5F8ZA 2IN2A 4CRDA 1O39A 3T25A 1BOQA 1HXEH 2O9QA 2ZQ2A 2GX4A 3BTEE 5J4QA 1ZHMA 1XUGA 1D3DB 1SBWA 3UR9A 5L6NH 5DPAA 2EI6A 3BEUA 2RCEA 1G32B 1ANEA 5LGOA 2QC2A 4AFQA 1H4WA 1HGTH 1IQLA 3T26A 3U9AH 3ZVAA 2UWPA 3RM2H 1CGHA 3TNSA 1SQOA 4D8NA 3A8DA 4NIXA 1N6YA 1HJ9A 4Y71A 1XVOA 3SUDA 2VVUA 1TX6A 1K1PA 3LU9B 4X1SU 1O2HA 5GCHF 2Z94A 3M5LA 3OY6U 2BD3A 1C5TA 4NZLA 2H1UA 4UONA 2ZHEH 2VIDA 1W11U 4TY7A 3SGQE 3SU4A 1C9TA 1MTNC 3OSYA 1DWDH 2ZU5A 3ZV8A 1AB9B 1BMNH 1PYTC 3H7OA 3RXQA 3LJOA 2VWOA 1O5GH 5DP7A 4I8LA 4CRBA 3ODDA 1HAVA 1IHSH 5PTPA 3RUOA 3RXRA 1ZSKA 1HUTH 2GDDA 1QJ6B 1HYLA 1MQ5A 1P2IA 5AFZH 3R0FA 1A2CH 2FX4A 1HAPH 5E0HA 3BIUH 1HV7A 1O2IA 3BTWE 5G4BA 1SLXB 3SN8A 4I7YH 4X6PA 3SI3H 2KAIB 2GTBA 1GVKB 3A7WA 3SNEA 1XX9A 1YPMH 1GWAA 1O3NA 2R0LA 1C2HA 4B73A 1QFKH 3MI4A 1WQVH 1C1RA 3GCHC 1LHDH 1KTTB 3SU3A 1TNLA 5FXLA 2F3CE 2SNVA 1JRTA 1LPGB 4X2XA 2A2XH 4OGYA 2BTCE 1O3EA 3MNSA 1CO7E 2PFEA 4Z6AH 2QA9E 1RD3B 5T3HA 1PPBH 1WQSA 4NG9H 3ZZ6A 2FI4E 3PO1C 1CGJE 1TFXA 5AF9H 2NU3E 3UWJH 2Z3EA 1OP0A 3A88A 2STBE 5DJ7A 2BD8A 3P8GA 1TNHA 1V2RT 3RXLA 1QB9A 1CU1A 4ZHLU 2Z3CA 3KNXA 2BVSH 3KF2A 1GMDG 1TGSZ 2GKVE 1FPCH 1N8OB 2TGDA 3BG8A 2G52A 1QJ1B 2FOBA 2TGPZ 3V13A 1DM4B 5EU8A 4ABJA 2VJ1A 4WH6A 1ZMJA 2KAIA 2AMPA 1BHXF 2D8WA 2JH6D 1PQ8A 3SV7A 1O3OA 2TRMA 1FNIA 1ZPZA 1SGQE 4ABHA 5SGAE 1O2VA 1P57B 3NZIA 4BXSA 1XUIA 2ZPSA 5C5OA 1SQAA 3MYWA 1TGBA 4GLYA 1ZMNA 1VCQA 3M3TA 4JYVH 1DFPA 5FX6A 4HGCA 2FOGA 4UE7H 1HJ8A 3LJJA 3A7VA 3GCOA 1DSTA 2CV3A 2FLBH 1D3PB 1O2TA 1A3BH 1VCPA 1G37A 2SGQE 1K1IA 1S81A 4IW4E 2IJOB 1PJPA 3MHWU 4MNWA 2Y5HA 4YLQH 3TGKE 2V35A 4INHA 8LPRA 1H9HE 4IS5A 3RXHA 1K9OE 1FONA 1A0JA 2ZDNA 3SUFA 2J9NA 2BY9X 1FAXA 1KSNA 1SG8B 2R2MB 1ESAA 3RXCA 1FY3A 2HNTF 1YPKH 4O03A 2FTMA 1QA0A 1D4PB 1GCTB 1Z8GA 4NCYA 2PKSB 1VCWA 4M7GA 3ELAH 2FDAA 4J2YB 1BTUA 1DICA 8KME2 1O31A 2W7SA 4E05H 1IQFA 1QL9A 1C5UA 4X1PU 4OS6A 3F9EA 2FO9A 1VJ9U 1NM6A 1H8IH 2BY8X 1QA7A 1QY6A 2Q1JA 1P2JA 1VITF 1Z8IB 3LGYA 1T4UH 2ZGJA 2ZA5A 2V6NA 3EA8A 3P17H 5EODA 5LPFA 2BZAA 3EA7A 1AI8H 5A8ZA 4D9RA 1JIRA 1GJ9B 2ZQ1A 4FVBA 4ZKOU 1QTFA 2HWLB 1OP2A 4CRFA 1MUEB 4BTUB 1ZJDA 2BLVA 1F5KU 4GCHG 2VNTA 2R0KA 3ZVCA 3GY2A 2ZECA 5T6FA 2ZIQH 2CN0H 1OS8A 1J14A 1ORFA 1TGCA 1TONA 3RP2A 2JKHA 4B71A 1HAXB 1NFUA 4JZ1A 1K28D 1VGCC 1FUJA 1MKXH 1O2MA 3LGVA 1YBWA 4KP0A 1P9UA 1T8LA 4CBOA 1ABJH 2STAE 1D6RA 1DITH 3L6PA 2AMDA 3CP7A 1WSSH 5JBBS 4O3UA 3SI4H 3RXFA 3TGJE 1O2JA 1C1OA 3RLWH 1MD8A 4UFDH 1O3HA 3RXKA 2A0QB 1QIXB 1K2I1 1C2KA 4TPYA 1H1BA 2OQ5A 1AVXA 3LOXA 1PQ7A 2ZC9H 2G8TA 2W26A 3F9GA 3RXUA 1SVPA 2FS9A 5T6DA 2ODYB 2H5DA 1GHYH 2GMTC 3TH2H 4Q7YA 3RDZA 3FP6E 1LKAA 2QN5T 3QUMP 3TJUA 1B7XB 1V2WT 1L1JA 1CVWH 4X2YA 1MKXK 1EAWA 2ZU2A 3MWIU 2VIWA 1BTZA 1S83A 2VVVA 3SW2B 3UQVA 3VGCC 3S7HB 2WYGA 3SU5A 3MU4A 2B7DH 5GXPA 3PB1E 1A0HB 4O9VA 1C2JA 8GCHG 1S5SA 1ELFA 1GG6C 1BBRE 1EXFA 1TX8A 1BMLA 1C5LH 4WMFA 2ZNKH 2QCYA 4K2YA 4HFPB 5EQQA 1TABE 3T2NA 1MAXA 1NESE 4IC6A 2VGCC 5JYIA 1TOMH 4K5ZA 1QHRB 4NA7A 1LHGH 3DFJA 2Y7ZA 1UTNA 2H9HA 1GI3A 1Z7KA 2ZGHA 4ABGA 3O8CA 1SOTA 3E0NB 3UWIA 5TCAA 1O5EH 3TH3H 2GT8A 1DSUA 1F7ZA 1HBTH 2AYWA 3EYDA 4AG2A 2GD4B 5FCKA 1SGTA 1FY4A 4WMEA 2XBYA 1WAYB 4WXVA 3P6ZB 3VXFH 2V0BA 4NSYA 1WCZA 2UWLA 4FUEA 1GPZA 4BAHB 1L1NA 2ZO3H 2FOMB 1TNGA 3M36A 1BJVA 2G4UA 1P8VC 1EKBB 3UUZA 1HIAB 3ZYDA 4Q7ZA 1O5CB 2QAAA 4NIYA 2Z9KA 1LVBA 1RJXB 1YPEH 1V2PT 4Y0ZE 1Z1IA 3UQOA 2CF8H 3URDA 2J95A 2ZTZA 1BT7A 2OC0A 1NROH 5HM9A 1PPEE 2EI8A 1C4Y2 2C3SA 2BLOA 1YPHE 3B23B 2A45B 1XKAC 1BITA 2WV5A 3SNAA 2ZCLP 2P3FH 1HJAB 3U8RH 3H7TA 4YZUA 3UPEA 1ID5H 1YPHC 2JH0D 2O8UA 5FX5A 4MNVA 5CMXH 3OYPA 1PYTD 1TRYA 1SGCA 3TVJB 1NFYA 1OWIA 2QXIA 1SGIB 4FUHA 1SB1H 1O3JA 1CGIE 1O3AA 3RC6A 2P95A 3KHVA 2ODQA 3A7ZA 3GCTG 1GJCB 2Y5FA 4TWYA 2ALPA 4A1VA 5L30H 1CSOE 2ZGXH 3E1XB 1WU1A 1CA8B 2EI7A 2RA0A 3EE0B 2D1JA 2O8WA 1OYTH 3VEQB 4OS7A 1GL1A 2WPHS 1E36B 3LT3A 5JBTA 5DGJA 1ZHRA 3MU8A 1QNJA 2BHGA 2BY6X 1KXEA 2IPHA 2Y5GA 2WUBA 5BRRE 1GI4A 1GJ4H 2GZ9A 2FOAA 1W2KH 1FY1A 1HIAA 5DP9A 4UFFH 2A7JA 5ESTE 1SOZA 2DE8A 5EQSA 2WINI 4AGKA 6ESTA 1Z6JH 2F9UA 1GI5A 1BTYA 1DLKB 1GBIA 4AOQA 1ZTKA 2TGAA 1DXPA 3RXPA 2YOLA 2FLRH 4F4OC 1C2EA 2XC5A 2I6SA 1Y8TA 2HRVA 3P70B 3FAOA 4CR9A 6CHAC 2Y7XA 3DT0H 4H4FA 4ISIH 1YPJH 1DT2A 1BTWA 2SGFE 1F2SE 4NSVA 3GY7A 4ZMAH 1J8AA 1TLDA 3QZRA 1EZSC 1GGDC 2JETC 3W95A 1DWCH 1T7CA 5FBEA 1ELTA 1AKSB 5C20A 3GICB 1FV9A 3TPIZ 2R3YA 3RU4E 4TPIZ 1GJ6A 2CGAA 3LGIA 1C1QA 4A6LA 4U32A 2BY5X 4FUDA 1C5YB 3UNQA 2VIVA 4WMDA 3MH4A 3FZZA 2Q6FA 1AUJA 1WTGH 3EA9A 4KTUA 1F0SA 2ANMH 4XDEA 5B6OA 1ZLRA 1GCDA 3ZVDA 1MTUA 5DG6A 1ZR0A 1UCYE 1EAUA 4JZDH 2GCHF 5JB8S 1GHVH 2ZPQA 2ZTYA 5E2PA 5TCCA 1N6XA 2ZG0H 3KQEA 3BTGE 3UREA 4HTCH 1K1LA 3P8OA 3O8RA 1YLCA 4RKJB 3ATKA 3PTNA 1Z1JA 1OKXA 1ZSLA 1AFQC 1TRNA 1TNIA 3CS7A 1LHCH 5FPYA 2HNTE 3ZZAA 1O3CA 1AZ8A 1GHBF 3RC4A 3LGTA 2HNTC 1PQ5A 5HM2A 5TJXA 2ZTXA 3S9AA 1SHHB 4MG3A 2XNIA 2PGQB 3N7OA 4GPGA 4FU8A 4CRAA 3GCHB 1A46H 1AKSA 3RXMA 4DJZB 1GMCG 1GDQA 4MNXA 2K1QA 1C5ZB 1C5VA 1LTOA 1W13U 4A92A 2WPJS 2R3UA 3F9FA 3A80A 5EG4A 3K9XB 3MNXA 3PO1B 2W5EA 1F5RA 3GY4A 1K1NA 2GCHG 1TB6H 4H42U 1EOLA 1LQEA 1V2ST 2NWNA 3SU2A 3D23A 1CHOG 1HLTH 1P2OA 2PGBB 1PPZA 1GDUA 2WUCA 3BV9B 4ESTE 1AN1E 3Q00A 2H6MA 1HAGE 3IG6B 1SMFE 3SJ8A 3UTUH 3LONA 2VINA 3W94A 2BLQA 3PROA 1W10U 1RRKA 4XBBA 1EJMA 1GJDB 4AX9H 1K1MA 2A32A 1Z8RA 1WV7H 4WWYA 3RU4T 2ZHDA 1C9PA 1DY9A 1KTSB 1LVOA 4THNH 2P3TB 1NFWA 2B0FA 2CF9H 3B9FH 3OY5U 1UTLM 1XXDA 4NIWA 5HYOA 2B8OH 1XMNB 1S0RA 2PSXA 1JOUB 2XYAA 1EATA 1FXYA 1S6FA 3SBKA 3A87A 1GJ8B 1CA0C 2VIOA 3M5OA 1GHZA 1LQDB 1KYNA 2P3UB 2G00A 3BTME 2OC7A 1UVTH 1P2QA 2VIQA 2F91A 2BB4A 2BXTH 5C1XA 1GVZA 1F92A 2R9PA 1CBWC 2GGVB 2XW9A 1QJ7B 2VH6A 4XFQA 3RMMH 1F5LA 3U69H 5I25A 1T8MA 2SGDE 2AEIH 3P95A 4R8TB 2SGAA 1Q31A 4X6OA 1ESTA 1D3QB 1HAYB 3SO3A 3BTTE 3ENSB 1ZYOA 2OTVA 4IN2A 1THPB 4WJG2 1KIGH 3CS0A 4AFUA 4JZIA 2GZ7A 4ISLA 3M7UA 3A84A 1TPSA 5CHAC 2TGTA 3TJNA 3PLKA 3UFAA 2FOCA 3ZYEA 9LPRA 4B1TA 5GCHG 2AIQA 4I8GA 1DY8A 1GBFA 2BOHB 2NU1E 3BG4C 1GHXH 3GDSA 3SHCH 2OLGA 1C5OH 3JZ1B 1O2ZA 1SC8U 2FYQA 1NU7B 1GBJA 1V2OT 1Z6EA 5A8XA 4WVPE 5JB9S 4B2AA 2FPZA 2XBXA 4MPXA 1AMHA 2FEQH 2LNCA 3SU0A 2OINA 4KKDA 1XM1A 1LO6A 2OCVB 1GJAB 3UNRA 3FZDA 2J4IA 3E8LA 2FZZA 1TBRH 1ESBA 1P02A 3L33A 4YTAA 4NFEA 1AO5A 3MU0A 5EPNA 1O2RA 3RMLH 1GJ5H 1E35B 3RXEA 1PQAA 1GHAF 4A1XA 1O3BA 1BTPA 5I46H 1C2GA 2ZZUH 2P16A 2QV1A 2XCFA 1G36A 1B0FA 4TYDA 4OS5A 3M35A 1DPOA 1TNKA 5GDSH 1ZGIA 1IQJA 1EPTC 1VGCB 1C1SA 1TWXB 1QRWA 4ZHMU 4CBNA 3A8AA 3HK6B 5JBCS 2BMGB 1GI1A 2ZCHP 5A0AE 1W8BH 1E0FD 2TBSA 3M7QA 4J1YA 5C2ZA 1LHFH 2QXGA 7GCHF 3RXJA 4Y79A 1NRRH 2EC9H 4MLFB 2HLCA 5EXMA 4A7IB 1RTLA 4AYYB 1EQ9A 2GVFA 4BOHA 1GI7B 2G5VA 2Y80A 1MU8B 4FVDA 2OC8A 4K1EA 3SOSA 1LHEH 4DGJA 3M3VA 1BUIA 3MNCA 2O8LA 2Y6TA 2OQUA 1O5DH 3SV8A 5FCRA 1IQNA 5FPSA 1GMHF 1O35A 1C5NH 2VU8E 2Z9GA 4SGBE 4ZAEA 1T8NA 4NA9H 4MPUA 1DE7H 2GMTB 2FOFA 1O37A 1ZOMA 2VWNA 3UNSA 3QGJA 1XVMA 2OP9A 4LXBH 4FU7A 4DIHH 2J94A 3PMBB 4FXGH 1XXFA 1TPPA 1BA8B 3NK8A 1JIMA 2FP7B 1TPAE 4OS2A 3SGAE 4AGJA 1YM0A 2GV7A 3M61U 5DP6A 1ZJKA 3EQ0H 1CE5A 4KELA 4U30A 3SQHE 3VGCB 1GBMA 2SFAA 4IC5A 3ZVBA 1ANCA 1TBQH 2ODPA 3QDZB
chains in the Genus database with same CATH superfamily
4D7FA 4ISHH 4ABFA 1DUAA 2BQ6B 4FUJA 2BY7X 1P2KA 2V7QD 5GJ4B 3RC5A 3ZV9A 1GG6B 7GCHG 3KQCA 1GBHA 1ABIH 4KTCA 2WYJA 4K60A 1PPFE 3ZZ9A 1N8OC 3SU1A 2PW8H 3O8BA 3DSGA 1QQUA 4GVUA 3SU6A 2RFKC 1MZDA 2ZDKA 4K1SA 1Y5UT 2A31A 2BD2A 3QLPH 2VGCB 2ZDAH 3FFGA 3SJKA 1A7SA 3SNCA 1SHYA 1MMJN 2A4RA 1SGDE 3VB6A 1KXAA 1DX5M 1C5QA 2NU4E 3ZZDA 4XOJA 3CENA 1RGQA 4X8UH 3JZ2B 3MTYA 3D65E 1YC0A 2GCTC 1P09A 5E2OA 3SV6A 4E7RG 1IQEA 3OTJE 4R0IA 1K1JA 1OXGA 1C1TA 4ISNA 1E37B 3DUXH 1FY5A 2FOEA 2PTCE 4B76A 2EA3A 3S9CA 2ZFTA 1BZXE 3T27A 1V2TT 3PLPA 1S6HA 1H9IE 1VITG 2FXRA 1AD8H 1HDTH 3NXPA 1QB6A 1P01A 1SQTA 2D2DA 3P92A 5E0JA 1ZRKA 5F6MA 2ZDMA 1C1MA 2ZU1A 1QL7A 3OE7D 1GJBB 2WPKS 4NZQA 2FMJA 5AHGH 1EAXA 3RU4D 1IQMA 4INKA 3BF6H 4XSKU 1FDPA 1FIZA 3LH3A 1Y5AT 1EZUC 2ULLA 3TNTA 2J97A 2LP6A 1D3TB 1UVPA 3UB0A 1A61H 1BMFD 2FESH 1TE0A 1SFQB 5HIZA 4Z1MD 3ZZCA 3RXTA 5LPEA 4Q80A 5EJ1A 4ASHA 4CRCA 2KCAA 1NC6A 2WPLS 1DS2E 1O5FH 3RMOH 4YT6H 4D9QA 4X2WA 2BDGA 1V2MT 2PP6A 3QX5H 3SJ9A 1SGEE 3A83A 1FN8A 4I8HA 2BDBA 2HVYB 1LPKB 1GDNA 3PMJA 1UTQA 2FYRA 2ZDVH 5HMAA 4ZXYH 1YKTA 3GY5A 1IQHA 1C1VH 1NU9A 5E0GA 2PKAB 1BRAA 1TYNA 2A1DB 4D76A 4CR5A 3BTHE 4Y76A 1DANH 1E34B 3WY8A 3AK5A 1U6QA 4XBCA 2L6OA 3K6YA 3HPTB 3ZIAD 2FWWA 3UR6A 2FODA 1ETTH 3HKIB 3MH5A 4XE4A 5IYTA 1YY3A 2SGPE 1THSH 2ZFSA 1FI8A 1C4V2 1GBBA 1ZGVA 5HGGA 1A1RA 4MNYA 4NIVA 1MTSA 8ESTE 6CHAB 4LK4A 1NT1A 1V2LT 3NPSA 5B6LA 2UUKB 4BAOB 1EOJA 1SGRE 1BBRH 3EAJA 1AE8H 1NPMA 3RXSA 2CXVA 1O3IA 2HOBA 1RIWC 4Y10E 1O0DH 3QK1A 4VGCB 3LIWA 4ZKSU 3TLOA 1Y3XA 1GGDB 2Z6BD 2JETB 2QGRA 2BDYA 1C5WB 4M9FA 1XUFA 5E8EH 3VFEA 4ZXXH 1ZMLA 4MPVA 1CQQA 1AE5A 1BHXB 1C4U2 1MD7A 2ZFFH 4O3TA 1C2FA 2QF0A 1LVYA 5DP4A 1OYQA 1TBZH 3MO3A 4WH8A 4RT1A 1SKYE 2B9LA 3ATMA 3S7KB 2PKAA 5AVDA 1RS0A 1YLDA 1WOFA 4YT7H 2V3MA 1JXPA 3P8FA 2D26C 3NCLA 3ZZ5A 2O8TA 2AGIX 2JJ1D 3SNBA 2UUYA 2AIPA 5LPRA 4Y7BA 3SORA 1P3EA 2FI3E 5DSFA 7LPRA 5EW1H 1JBUH 1HFDA 1P2NA 2RG3A 2CHAB 4QT8C 4JK6A 1AFQB 1AY6H 3SUGA 1YP9A 2J98B 3LGWA 2J2UA 1H8DH 2XBVA 5DP8A 2A4GA 3GISB 3QTVH 1C2DA 1BBRK 1NO9H 5BPEA 2HPQH 2P93A 1KY9A 1GI0A 3FP7E 3URCA 3UOUA 1C1UH 4CHAC 3LGUA 2HGTH 2FOHA 1M9UA 4DG4A 6GCHF 1IQGA 2Q6DA 1AVWA 5AFYH 1L4DA 1UHBB 2QIQA 2ZFPH 1KDQB 4MQAA 4X6NA 2XTTB 4JCNA 3TH4H 4SGAE 1TA6A 4GHTA 4X8VH 1UK4A 1P12E 2W7UA 1OWEA 3N99A 4MDSA 1GJ7B 2P59A 5C67A 2XC4A 4GUXA 1AWFH 3FP8E 4WF8A 4DIIH 1SI5H 4DT7B 1O2OA 1LPZB 1EUFA 4ABAA 1X7AC 1NN6A 2THFB 1YCPK 3BTQE 1UK2A 3EDXB 2KCOA 2XWBI 2LPRA 3E90B 3MU5A 1L4ZA 2GP9B 1ANDA 5C0TA 2ZKSA 3GDUA 4B2BA 5EW2H 2ZPRA 1SGYE 4OS1A 2KX4A 4X1QU 4UFGH 1QB1A 2A5AA 1SLWB 1KXFA 2XCNA 3OTPA 1AZZA 1JMOH 1QURH 3A7YA 5DK1A 1Z71A 3F9HA 4ABBA 4FUIA 4YM9A 2BYAX 1EZXC 5GWZA 4BAKB 1MTNB 1N1LA 1QQ4A 3TK9A 1TA2A 6GCHG 1FJSA 3V7TA 3T5FH 4ASUD 1NRPH 3GYLB 3RM0H 1A3EH 1OWHA 1UHBA 2QXHA 1KDQA 1CA0B 1WUNH 1BRBE 5F8TA 3S0NA 5J4SA 4WY3A 3GDVA 3BN9A 3ATWA 5EXLA 1W3CA 2YMSD 2ALVA 1VJAU 1WYKA 3TU7H 1FIWA 2AMQA 3DA9B 2XRCA 1O32A 1ARCA 3RXAA 1CBWB 1SFIA 1T31A 3T28A 1SLVB 1H8HD 3QO6A 5DP3A 4CREA 2NU2E 1EZQA 2IOTA 3KCGH 1T8OA 1SGFG 2CJIA 4PROA 4ABIA 1TPOA 1V2QT 3PM3A 2SNWA 3HGNA 4AORA 3TIUA 2ZCKP 4NA8A 1C1PA 1ELEE 2PLXA 1S0QA 4X1RU 4Y7AA 2VH0A 4Y0YE 4X8TH 3VG8A 2UUFB 1KLTA 1TIOA 1UCYH 5CHAB 2BX4A 3F6UH 3GOVB 4WXIA 1KXBA 1AQ7A 1G3DA 2C4FH 1TGNA 1E1RD 1O2UA 1NTPA 1W0ZU 3BG4B 4XBDA 1A4WH 2RA3A 4YOGA 1PFXC 1Z8JB 2PR3A 3ZZBA 4YOJA 4CH2B 1ELAA 4HG6A 4BTTB 3TJOA 3ESTA 4FUGA 2GZ8A 2BVRH 1W14U 2G55A 4TWWA 3V12A 2G5NA 1C2MA 3IITA 4AYVB 3DSOA 4AC9A 3HATH 2GDEH 3EE7A 4D7GA 4F55A 1OP8A 1V2NT 4IMZA 2J38A 2ESTE 2P8OC 3VB4A 2A5IA 3IWMA 3MH7A 1O2WA 1F0TA 4B6FA 1J9CH 3LH1A 4GSOA 4X0WU 2BDIA 2ZHQH 1TALA 1CT0E 1D6WA 1EP6A 1GHBG 3NWUA 1A5HA 2C8ZB 1G3CA 3DCLA 1ZRBA 1K1OA 1E38B 1OSSA 1HAHH 3E6PH 1L2EA 1VITH 1Y5BT 2GV6A 3L3TA 3V0XA 4ZH8A 4A1TA 5A8YA 3M5MA 3U8OH 1MCVA 3F1SB 1NZQH 1ZTJA 3I29A 2C93B 4DCDA 1S84A 2B5TB 1UO6A 1UCYK 2OK5A 5F8XA 1EPTB 1TMUH 1FPHH 1GBTA 1GL0E 1O5BB 4UEHH 5C1UA 3ZZ8A 3A85A 4ABDA 1MBQA 1OWJA 3PYHA 4I33A 4HZHA 1ZZZA 1NS3A 1PPGE 3M7TA 4CH8B 1H8ED 4H6TA 1TGTA 1E79D 1C5RA 3F68H 2ZP0H 3DFLA 1YLNA 1O36A 2Z7FE 4LZ4B 1V2VT 1K0HA 2J92A 2JIZD 1GBCA 1OPHB 2VVCA 4OGXA 1VR1H 1O2NA 1RTFB 4B2CA 1BTHH 1B0EA 1GMDF 4F49A 2FTLE 1HAZB 5C5NA 5T6GA 1O3MA 1DWBH 4Y8YA 4DURA 3QTOH 2I6QA 1JRSA 4YOIA 2ZFQH 1OWDA 1COWD 4Y8XA 1K21H 1HXFH 2AGGX 1ELGA 4YESB 4YO9A 2C8YB 4BAQB 2VB0A 1QGFA 1MTWA 2OBQA 1SPJA 1YCPM 3TJVA 2H9EH 1MTVA 1TRMA 5FAHA 1EAIA 3KQBA 2M5TA 4FOUC 4K69A 1OWKA 2A4OA 2BD9A 2ZGBH 3SJOA 1UTKA 2ZHWH 5ESBA 3RXIA 1C5MD 1K22H 2ZF0H 4RN6A 4ISOA 1MH0A 3RXDA 1P3CA 1EPTA 1BDAA 2BD5A 2WSSD 2ASUB 2F9OA 4K8YA 1FY8E 2W6ID 5LH8A 1QRXA 3U98H 4ZROA 3A7XA 1W7GH 1UTPA 1NRQH 1ANBA 4K8BA 3C27B 5H4IB 1ELDE 2EQNA 1P2MA 2RDLA 3AASA 2H9TH 4DOQA 1B5GH 4P02A 3GYMA 2JH5D 4AN7A 2ZEBA 4BANB 1LKBA 1MU6B 1F0UA 1HRTH 1KXCA 4MTBA 3ZZ4A 1ETRH 3BSQA 3KN2A 1INCA 1FMGA 3F0PA 1C5PA 1AB9C 4FUBA 1TQ7B 3LDXH 4E06H 2J5UA 1MABB 1W7XH 1WBGB 4NWKA 5T1VA 4JZEH 3T29A 4IN1A 4NGAH 1AU8A 1QBOA 3A89A 5K0HA 3O8DA 4I8KA 1S82A 2GCTB 1OHHD 3ATLA 1OOKB 2JJ2D 5CHBA 3VB5A 1G30B 1UMAH 5FPTA 1WDIA 4RT0A 5KECA 3C1KA 3E3TA 2LELA 1C1NA 1QL8A 1HNEE 1P04A 1O3FA 1MKWH 3SV2H 3SNDA 1YWUA 4AB8A 2ANWA 3OFND 1MCTA 1RXPA 1QZ8A 1T32A 4GCHF 2BM2A 2UWOA 2PV9B 4AB9A 1Y3UA 3I78A 1BMAA 5A2MH 1TMBH 2HPPH 2ZGCA 1AGJA 4BAMB 2ANYA 1O2GH 1GHAG 1YF4A 2FM2A 2Z9IA 2AH4X 3MOCA 1O2XA 1EASA 1O3GA 4YLUA 2BVXH 4I31A 3ZVEA 3K2UA 3MH6A 2Y82A 4TSFD 1V2KT 1GHWH 4K3JA 4TY6A 1LDTT 2QXJA 3KGPA 1F0RA 2XXLA 1ELBA 1O2YA 7KMEH 1ARBA 1FAKH 1GI6A 3RXGA 2AGEX 1UVOA 2XC0A 2Z3DA 2XWAA 3EGKH 4Q2KA 1QRZA 1G3EA 1MBMA 1DDJA 5HKKD 1SGFA 3BEFB 2QE7D 2H5CA 3ZVGA 1EJAA 1FLEE 5FHTA 3ATIA 3AW0A 1MKWK 1L0ZA 2FI5E 3A8BA 2PUXB 1IOEA 5EPYA 1YPLH 3LC3A 3SZEA 1W0KD 3PV4A 5C3NA 2BQWB 5GPIB 2FX6A 1GMHG 3U1JB 1FZZA 1SGNE 4KTSA 1NFXA 1P0SH 1OX1A 5EOKA 7ESTE 5IDKA 2W3KA 4H6SB 2BDCA 1EFRD 2EEKA 1O30A 5EQRA 1FN6A 4O97A 4JK5A 2BDAA 2ZDLA 4IMQA 5A0CA 2FIRH 3SUEA 5EGMA 1V2JT 1GBKA 2OD3B 2QF3A 3S69A 4BNRA 1Y3YA 1HPGA 1S85A 3E91A 3PWCA 1L1GA 1ETSH 1O2QA 2BD4A 3AW1A 3DHKH 3SQEE 1EP5A 2HALA 3RMNH 4DY7B 5C1YA 8GCHF 5ABWA 2HVXA 1A5GH 1D9IA 1RIWB 2PUQH 3TK6A 3RXOA 1ZPBA 1EB2A 4JYTA 1AFEH 5JBAS 1NY22 3HKJB 1VZQH 2PHBA 2WPMS 1Q2WA 2F9NA 2WV9A 3SGBE 9ESTA 4BTIB 2A7HA 2WHXA 4IBLH 1ZPCA 2BZ6H 1GBAA 1YYY1 2VIPA 3Q3XA 1J17T 2OUAA 1GCTC 3STJA 5DO4H 1IAUA 2PKSC 1ZSJA 4AZ2B 1XKBC 2Z9LA 2G51A 2G81E 1P03A 2OXSA 3SV9A 1CHGA 2Q6GA 1AVGH 1O3PB 3AAVA 5K7RA 3SJIA 3AVZA 2DE9A 4CRGA 1YGCH 4ZUHA 5GIBA 1QR3E 1UTJA 1DWEH 2BD7A 4K1TA 3A82A 4FUFA 1C5XB 4ABEA 3E0PB 1CT2E 3BTDE 3FANA 3M3SA 6LPRA 3AAUA 2GT7A 3U8TH 1SLUB 4GHQA 1TX7A 3B8JA 2G4TA 3MNBA 3A86A 3QGNB 3ZZ7A 1G2LA 1GBLA 3H5CB 1P9SA 1THRH 1HCGA 1C2LA 2KZ4A 1ELVA 1V3XA 3GY8A 1MZAA 1IQIA 4UFEH 4Z0KA 2V3OH 2WV4A 1V2UT 2W3IA 4CHAB 1NRSH 1ZTLA 1O5AB 3KQDA 3RXVA 3RLYH 4NFFA 2IPQX 1BCUH 1GI2A 2V3HH 3FVFB 4NWLA 5ETXA 5EIYA 2C8XB 3KQ5A 2AFQB 3LKWA 2A2QH 3TGIE 1ACBE 2Y81A 3UY9A 2BLWA 3FOAA 1O33A 4AFSA 1KLJH 1P06A 2TPIZ 2XBWA 1ZHPA 4LZ1H 4ZKRU 4UDWH 3GCTF 1SR5C 1EB1H 4KGAA 1GBEA 1PPCE 1XUJA 3LPRA 3G01A 2CMYA 1UVSH 1BIOA 2ANKH 1Y3VA 4HI3A 1SL3A 1TAWA 4Q7XA 4B74A 3Q3KA 3UAIC 1DLEA 2PSYA 2ILNA 2O8MA 4IGDA 2VWLA 1O2SA 1AUTC 1TNJA 3PLBA 2P94A 3M37A 1V6DA 1S6LA 3V3MA 1BB0B 2ZHFH 3D49H 4Y6DA 3WWFA 2DUCA 3KYGA 3LC5A 1WTHD 1O2PA 3R3GB 3S9BA 3F2GA 1DUEA 4X8SH 4E7NA 1LVMA 4MVNA 3PMAB 4INLA 5DP5A 3KEEA 1O2LA 1TOCB 5L2YH 2ZI2H 3QZQA 4X6MA 3P8NA 3SZNA 4JMYA 1O3LA 3STIA 1YCPH 3Q77A 2H2ZA 1Y3WA 5C17A 2AERH 2FS8A 1GVLA 1BRUP 3N7DA 3I77A 4AG1A 1C1WH 2YNBA 3PMHB 1W0YH 1QCPA 3K65B 1GI9B 2AHME 1DOJA 3Q76A 1HAIH 3MQKC 4I32A 3HK3B 1AHTH 1BRCE 1AIXH 3NKKA 2BOKA 1HAOH 4BXWA 3ITIA 3UOPA 3BIVH 1H9LB 2BDHA 3OX7U 2BXUH 3U1IB 5JPMH 2R2WU 2QY0B 2C8WB 1IQKA 2WPIS 4GAWA 4FUCA 5KEDA 1YPGH 3BTFE 2BQ7B 4U01A 2AS9A 1XUKA 2HLDD 1C2IA 4MPWA 5JDUB 1GBDA 4AFZA 1SGPE 1BQYA 5HXFA 1KLIH 3PTBA 1UVUH 4B75A 3MFJA 2ZU3A 1DXWA 3BTKE 1MAYA 3NRLA 1C5SA 3UIRA 5EXNA 2BX3A 3TK5A 3VB3A 3NUMA 1O3DA 3MO6A 5CE1A 1UTOA 1J16A 3QN7A 1J15A 1T4VH 3KIDU 1Y59T 4X2VA 1UTMA 1A0LA 1ELCA 3M5NA 4ACAA 1G3BA 1LMWB 3A7TA 2OC1A 4DVAU 2A4QA 3ODFA 3MMGA 2P8OB 1QBVH 4VGCC 3MU1A 3E16B 5A0BA 1JWTA 4RSPA 1KMHB 1HB0B 3DD2H 4OS4A 3BEIB 5DN6D 5FBIA 1FQ3A 1GMCF 1O3KA 4JZFH 1BTXA 3Q3YA 4JYUH 4DW2U 3A81A 1CT4E 2PWXA 1HJAC 5DKMA 5A09A 1XUHA 2F83A 2SGEE 1P11E 4Q4LA 1O34A 3VPKA 1SSXA 1Q3XA 3T62A 4Y11E 3GY3A 4U2WA 1O2KA 3SHAH 3PRDA 3PWBA 2NU0E 3RXBA 1NRNH 2ZWLH 1O38A 2F4LA 4UD9H 1CHOF 2PTNA 4FU9A 1BMMH 1QBNA 1G9IE 3K6ZA 4I8JA 3KL6A 2ZU4A 1RFNA 2CHAC 3VB7A 4P00A 2TIOA 4RKOB 1A5IA 2F9PA 3QWCH 3ZZ3A 1P10A 2UUJB 1P05A 1KXDA 2JDID 2F9VA 1G2MA 1PPHE 3TITA 2F9BH 4DT4A 2A7CA 3D62A 2A5KA 3OU0A 1RTKA 4ZKNU 2C90B 1AWHB 2J34A 2VWMA 1IHTH 1LCYA 2YNAA 1TMTH 1DVAH 3VXEH 1GI8B 1EX3A 1TQ0B 3ZVFA 1EJNA 1MQ6A 1BJUA 1UK3A 4X1NU 2OBOA 3MO9A 2Z9JA 4Y8ZA 5F03A 3HGPA 4LOYH 1UJ1A 3A8CA 4ZHAA 2ZFRH 3GCNA 4A5TS 1HAVB 3GY6A 3FO8D 2QYIA 5L2ZH 1W12U 5F8ZA 2IN2A 4CRDA 1O39A 3T25A 1BOQA 1HXEH 2O9QA 2ZQ2A 2GX4A 3BTEE 5J4QA 1SQRA 1ZHMA 1XUGA 1D3DB 1SBWA 3UR9A 5L6NH 5DPAA 2EI6A 3BEUA 2RCEA 1G32B 1ANEA 5LGOA 2QC2A 4AFQA 1H4WA 1HGTH 1IQLA 3T26A 3U9AH 3ZVAA 2UWPA 3RM2H 1CGHA 3TNSA 1SQOA 4D8NA 3A8DA 4NIXA 1N6YA 1HJ9A 4Y71A 1XVOA 3SUDA 2VVUA 1TX6A 1K1PA 3LU9B 4X1SU 1O2HA 5GCHF 2Z94A 3M5LA 3OY6U 2BD3A 1C5TA 4NZLA 2H1UA 4UONA 2ZHEH 2VIDA 1W11U 4TY7A 3SGQE 3SU4A 1C9TA 1MTNC 2KCYA 3OSYA 1DWDH 2ZU5A 3ZV8A 1AB9B 1BMNH 1PYTC 3H7OA 3RXQA 3LJOA 2VWOA 1O5GH 2YMSB 5DP7A 4I8LA 4CRBA 5EJZA 3ODDA 1HAVA 1IHSH 5PTPA 3RUOA 3RXRA 1ZSKA 1HUTH 2GDDA 1QJ6B 1HYLA 1MQ5A 1W0JD 1P2IA 5AFZH 3R0FA 1A2CH 2FX4A 1HAPH 5E0HA 3BIUH 1HV7A 1O2IA 3BTWE 5G4BA 4XRNA 1SLXB 3SN8A 4I7YH 4X6PA 3SI3H 2KAIB 2WPDD 2GTBA 1GVKB 3A7WA 3SNEA 1XX9A 1YPMH 1GWAA 1O3NA 2R0LA 1C2HA 4B73A 1QFKH 3MI4A 1WQVH 1C1RA 3GCHC 1LHDH 2EY4C 1KTTB 3SU3A 1TNLA 5FXLA 2F3CE 2SNVA 1JRTA 1LPGB 4X2XA 2A2XH 4OGYA 2BTCE 1O3EA 3MNSA 1CO7E 2PFEA 4Z6AH 2QA9E 1RD3B 5T3HA 1PPBH 1WQSA 4NG9H 3ZZ6A 2FI4E 2W6JD 3KYFA 3PO1C 1CGJE 1TFXA 3F2HA 5AF9H 2NU3E 3UWJH 2Z3EA 1OP0A 3A88A 2STBE 2CK3D 5DJ7A 2BD8A 3P8GA 1TNHA 1V2RT 1VKYA 3RXLA 1QB9A 1CU1A 4ZHLU 2Z3CA 3KNXA 2BVSH 3KF2A 1GMDG 2IJD1 1TGSZ 2GKVE 1FPCH 1N8OB 2TGDA 3BG8A 2G52A 1QJ1B 2FOBA 2TGPZ 3V13A 1DM4B 5EU8A 4ABJA 2VJ1A 4WH6A 1ZMJA 2KAIA 2AMPA 1BHXF 2D8WA 2JH6D 1PQ8A 3SV7A 1O3OA 2TRMA 1FNIA 1ZPZA 3OEED 1SGQE 4ABHA 5SGAE 1O2VA 1P57B 3NZIA 4BXSA 1XUIA 2ZPSA 5C5OA 1SQAA 3MYWA 1TGBA 4GLYA 1ZMNA 1VCQA 3M3TA 4JYVH 1DFPA 5FX6A 4HGCA 2FOGA 4UE7H 1HJ8A 3LJJA 3A7VA 3GCOA 1DSTA 2CV3A 2FLBH 1D3PB 1O2TA 1A3BH 1VCPA 1G37A 2SGQE 1K1IA 1S81A 4IW4E 2IJOB 1PJPA 3MHWU 1NBME 4MNWA 2Y5HA 4YLQH 3TGKE 2V35A 4INHA 8LPRA 1H9HE 4IS5A 3RXHA 1K9OE 1FONA 1A0JA 2ZDNA 3SUFA 2J9NA 2BY9X 3OEHD 1FAXA 1KSNA 1SG8B 2R2MB 1ESAA 3RXCA 1FY3A 2HNTF 1YPKH 4O03A 2FTMA 1QA0A 1D4PB 1GCTB 1Z8GA 3FN8A 3PV2A 4NCYA 2PKSB 1VCWA 4M7GA 3ELAH 3OAAD 2FDAA 4J2YB 1BTUA 1DICA 8KME2 1O31A 2W7SA 4E05H 1IQFA 1QL9A 1C5UA 4X1PU 4OS6A 3F9EA 2FO9A 1VJ9U 1NM6A 1H8IH 2BY8X 1QA7A 1QY6A 2Q1JA 1P2JA 1VITF 1Z8IB 3LGYA 1T4UH 2ZGJA 2ZA5A 2V6NA 3EA8A 3P17H 5EODA 5LPFA 2BZAA 3EA7A 1AI8H 5A8ZA 3U28C 1JIRA 1GJ9B 2ZQ1A 4FVBA 4D9RA 2L74A 4ZKOU 1QTFA 2HWLB 2QF5A 1OP2A 4CRFA 4Q63A 1WXRA 1MUEB 4BTUB 1ZJDA 2BLVA 1F5KU 4GCHG 2VNTA 2R0KA 3ZVCA 3GY2A 2ZECA 5T6FA 2ZIQH 2CN0H 1OS8A 1J14A 1ORFA 1TGCA 1TONA 3RP2A 2JKHA 4B71A 1HAXB 1NFUA 4JZ1A 1K28D 1VGCC 1FUJA 1MKXH 1O2MA 3LGVA 5C94A 1YBWA 4KP0A 1P9UA 1E1QD 1T8LA 4CBOA 1ABJH 2STAE 1D6RA 2VBCA 1DITH 3L6PA 2AMDA 3CP7A 1WSSH 5JBBS 4O3UA 1FX0B 3SI4H 3RXFA 3TGJE 1O2JA 1C1OA 3RLWH 5KGOA 1MD8A 4UFDH 1O3HA 3RXKA 2A0QB 1QIXB 1K2I1 1C2KA 4TPYA 1H1BA 2OQ5A 1AVXA 3LOXA 1PQ7A 5FL7D 2ZC9H 2G8TA 2W26A 3F9GA 2XNDD 3RXUA 1SVPA 2FS9A 5T6DA 2ODYB 2H5DA 1GHYH 2GMTC 3TH2H 2GJGA 4Q7YA 3RDZA 3FP6E 1LKAA 2QN5T 3PRBA 3QUMP 3TJUA 1B7XB 1V2WT 1L1JA 1CVWH 4X2YA 1MKXK 1EAWA 2ZU2A 3MWIU 2VIWA 1BTZA 1S83A 2VVVA 3SW2B 3UQVA 3VGCC 3S7HB 2WYGA 3SU5A 3MU4A 2B7DH 5GXPA 3PB1E 1A0HB 4O9VA 1C2JA 5HIYA 8GCHG 1S5SA 1ELFA 4YXWD 1GG6C 1BBRE 1EXFA 1TX8A 1BMLA 1C5LH 4WMFA 2ZNKH 2QCYA 4K2YA 4HFPB 4FETA 1UW7A 5EQQA 1TABE 3T2NA 1MAXA 1NESE 4IC6A 2VGCC 5JYIA 1TOMH 4K5ZA 1QHRB 4NA7A 1LHGH 3DFJA 2Y7ZA 1UTNA 2H9HA 1GI3A 1Z7KA 2ZGHA 4ABGA 3O8CA 1SOTA 3E0NB 3UWIA 5EJLA 5TCAA 1O5EH 3TH3H 2GT8A 1DSUA 1F7ZA 1HBTH 2AYWA 3EYDA 4AG2A 2GD4B 5FCKA 1SGTA 1FY4A 4WMEA 2XBYA 1WAYB 4WXVA 3P6ZB 3VXFH 2V0BA 4NSYA 1WCZA 2UWLA 4FUEA 1GPZA 5CDFE 4TT3D 4BAHB 1L1NA 2ZO3H 2FOMB 1TNGA 3M36A 1BJVA 2G4UA 1P8VC 5F53A 1EKBB 3UUZA 1HIAB 3ZYDA 4Q7ZA 3F2FA 1O5CB 2QAAA 4NIYA 2Z9KA 1LVBA 1RJXB 1YPEH 1V2PT 4Y0ZE 1Z1IA 3UQOA 2CF8H 3URDA 2J95A 2ZTZA 1BT7A 2OC0A 1NROH 5HM9A 2RDEA 1PPEE 2EI8A 1C4Y2 2C3SA 2BLOA 1YPHE 3B23B 2A45B 1XKAC 1BITA 2WV5A 3SNAA 2ZCLP 2P3FH 1HJAB 3U8RH 3H7TA 4YZUA 3UPEA 1ID5H 1YPHC 2JH0D 2O8UA 5FX5A 4MNVA 5CMXH 3OYPA 1PYTD 1TRYA 1SGCA 3TVJB 1NFYA 1OWIA 2QXIA 1SGIB 3W1EA 4FUHA 1SB1H 1O3JA 1CGIE 1O3AA 3RC6A 2P95A 3KHVA 2ODQA 3A7ZA 3GCTG 1GJCB 2Y5FA 4TWYA 2ALPA 4A1VA 5L30H 1CSOE 2ZGXH 3E1XB 1WU1A 1CA8B 2EI7A 2RA0A 3EE0B 4OM9A 2D1JA 2O8WA 1OYTH 3VEQB 4OS7A 1GL1A 2WPHS 1E36B 3LT3A 5JBTA 5DGJA 1ZHRA 3MU8A 1QNJA 2BHGA 2BY6X 1KXEA 2IPHA 2Y5GA 2WUBA 5BRRE 1GI4A 1GJ4H 2GZ9A 2FOAA 1W2KH 1FY1A 1HIAA 5DP9A 4UFFH 2A7JA 5ESTE 1SOZA 2DE8A 5EQSA 2WINI 4AGKA 4I86A 6ESTA 1Z6JH 2F9UA 1GI5A 1BTYA 3F0OA 1DLKB 1GBIA 4AOQA 1ZTKA 2TGAA 1DXPA 3RXPA 2YOLA 2FLRH 4F4OC 1C2EA 2XC5A 2I6SA 1Y8TA 2HRVA 3P70B 3FAOA 4CR9A 6CHAC 2Y7XA 3DT0H 4H4FA 4ISIH 1YPJH 3SYJA 1DT2A 3CNRA 1BTWA 2SGFE 1F2SE 4NSVA 3GY7A 4ZMAH 1J8AA 1TLDA 3QZRA 1EZSC 1GGDC 2JETC 3W95A 1DWCH 1T7CA 2QF4A 5FBEA 1ELTA 1AKSB 5C20A 3GICB 1FV9A 3TPIZ 2R3YA 5C0UA 3RU4E 4TPIZ 1GJ6A 2CGAA 3LGIA 1C1QA 4A6LA 4U32A 2BY5X 4FUDA 1C5YB 3UNQA 2VIVA 2J98A 4WMDA 3MH4A 3FZZA 2Q6FA 1AUJA 1WTGH 3EA9A 4KTUA 1F0SA 2ANMH 4XDEA 2KFWA 1ZLRA 5B6OA 1GCDA 3ZVDA 1MTUA 5DG6A 1ZR0A 1UCYE 4RI0A 1EAUA 4JZDH 2GCHF 5JB8S 1GHVH 2K8IA 2ZPQA 2ZTYA 5E2PA 5TCCA 1N6XA 2ZG0H 3KQEA 3BTGE 3UREA 4HTCH 1K1LA 3P8OA 3O8RA 1YLCA 4RKJB 3WW7A 3ATKA 3PTNA 1Z1JA 1OKXA 1ZSLA 1AFQC 1TRNA 1TNIA 3CS7A 1LHCH 5FPYA 2HNTE 3ZZAA 1O3CA 1AZ8A 1GHBF 3RC4A 3LGTA 2HNTC 1PQ5A 5HM2A 1NBMD 5TJXA 2ZTXA 3S9AA 2KR7A 1SHHB 4MG3A 2XNIA 2PGQB 3N7OA 4GPGA 3N7EA 4FU8A 4CRAA 3GCHB 1A46H 1AKSA 3F3BA 3RXMA 4DJZB 1GMCG 1GDQA 4MNXA 2K1QA 1C5ZB 1C5VA 1LTOA 1W13U 2KM0A 3FKSD 4A92A 2WPJS 2R3UA 3F9FA 3A80A 5EG4A 3K9XB 3MNXA 3PO1B 2W5EA 1F5RA 2XOKD 3GY4A 1K1NA 2GCHG 1TB6H 4H42U 1EOLA 1LQEA 1V2ST 2NWNA 3SU2A 3D23A 1CHOG 1HLTH 1P2OA 2PGBB 1PPZA 1GDUA 2WUCA 3BV9B 4ESTE 1AN1E 3Q00A 2H6MA 1HAGE 3IG6B 1SMFE 3SJ8A 3UTUH 3LONA 2VINA 3W94A 2BLQA 3PROA 2WZQA 1W10U 1RRKA 4XBBA 1EJMA 1GJDB 4AX9H 1K1MA 2A32A 1Z8RA 1WV7H 4WWYA 3RU4T 2ZHDA 1C9PA 1DY9A 1KTSB 1LVOA 4THNH 2P3TB 1NFWA 2B0FA 2CF9H 3B9FH 3OY5U 1UTLM 1XXDA 4NIWA 5HYOA 2B8OH 1XMNB 1S0RA 2PSXA 1JOUB 2XYAA 1EATA 1FXYA 1S6FA 3SBKA 3A87A 1GJ8B 1CA0C 2VIOA 3M5OA 1GHZA 3PV5A 1LQDB 1KYNA 2P3UB 2G00A 3BTME 2OC7A 1UVTH 1P2QA 2VIQA 2F91A 2BB4A 2BXTH 5C1XA 1GVZA 4ZCNA 1F92A 2R9PA 1CBWC 2GGVB 2XW9A 1QJ7B 2VH6A 4XFQA 3RMMH 1F5LA 3U69H 5I25A 1T8MA 2SGDE 2AEIH 3P95A 4R8TB 2SGAA 1Q31A 4X6OA 1ESTA 1D3QB 1HAYB 3SO3A 3BTTE 3ENSB 1ZYOA 4ACBA 2OTVA 4IN2A 1THPB 4WJG2 1KIGH 3CS0A 4AFUA 4JZIA 2GZ7A 4ISLA 4XD7D 3M7UA 3A84A 1TPSA 5CHAC 5IK2D 2TGTA 3TJNA 3PLKA 3UFAA 2FOCA 3ZYEA 9LPRA 4B1TA 5GCHG 2AIQA 4I8GA 1DY8A 1GBFA 2BOHB 2NU1E 3BG4C 1GHXH 3GDSA 3SHCH 2OLGA 1C5OH 3JZ1B 1O2ZA 1SC8U 2FYQA 1NU7B 1V2OT 1GBJA 1Z6EA 5A8XA 4WVPE 5JB9S 4B2AA 2FPZA 2XBXA 4MPXA 1AMHA 2FEQH 2LNCA 3SU0A 2OINA 4KKDA 1XM1A 1LO6A 2OCVB 1GJAB 3UNRA 3FZDA 2J4IA 3E8LA 3GS9A 2FZZA 1TBRH 1ESBA 1P02A 3L33A 4YTAA 4NFEA 1AO5A 3MU0A 5EPNA 1O2RA 3RMLH 1GJ5H 1E35B 3RXEA 1PQAA 1GHAF 4A1XA 1O3BA 1BTPA 5I46H 1C2GA 2ZZUH 2P16A 2QV1A 2XCFA 1G36A 1B0FA 4TYDA 4OS5A 3M35A 1DPOA 1TNKA 5GDSH 1ZGIA 1IQJA 1EPTC 1VGCB 1C1SA 1TWXB 1QRWA 4ZHMU 4CBNA 3A8AA 3HK6B 5JBCS 3H09A 2BMGB 1GI1A 2ZCHP 5A0AE 1W8BH 1E0FD 2TBSA 3M7QA 4J1YA 5C2ZA 2YMSC 1LHFH 2QXGA 7GCHF 5GNDA 3RXJA 4Y79A 1NRRH 2EC9H 4MLFB 2HLCA 3WWBA 5EXMA 4A7IB 1RTLA 2KCPA 4AYYB 1EQ9A 2GVFA 4BOHA 1GI7B 2G5VA 2Y80A 1MU8B 4FVDA 2OC8A 4K1EA 3SOSA 1LHEH 4DGJA 3M3VA 2F43B 2M2AA 1BUIA 3MNCA 2O8LA 2Y6TA 2OQUA 1O5DH 3SV8A 5FCRA 4F48B 1IQNA 5FPSA 1GMHF 1O35A 1C5NH 2VU8E 2Z9GA 4SGBE 4ZAEA 1T8NA 4NA9H 4MPUA 1DE7H 2GMTB 2FOFA 1O37A 1ZOMA 2VWNA 3UNSA 3QGJA 1XVMA 2OP9A 4LXBH 4FU7A 4DIHH 2J94A 3PMBB 4FXGH 1XXFA 1TPPA 1BA8B 3NK8A 1JIMA 3DSPA 2FP7B 1TPAE 4OS2A 3SGAE 4AGJA 1YM0A 2GV7A 3M61U 5DP6A 1ZJKA 2K0QA 1CE5A 3EQ0H 4KELA 4U30A 3SQHE 1GBMA 2SFAA 4IC5A 3VGCB 1ANCA 3ZVBA 1TBQH 2ODPA 4B6EA 3QDZB
chains in the Genus database with same CATH topology
4D7FA 4ISHH 4ABFA 1DUAA 2BQ6B 4FUJA 2BY7X 1P2KA 5GJ4B 3RC5A 3ZV9A 1GG6B 7GCHG 3KQCA 1GBHA 1ABIH 4KTCA 2WYJA 4K60A 1PPFE 3ZZ9A 1N8OC 3SU1A 2PW8H 3O8BA 1QQUA 4GVUA 3SU6A 1MZDA 2ZDKA 4K1SA 1Y5UT 2A31A 2BD2A 3QLPH 2VGCB 2ZDAH 3FFGA 3SJKA 1A7SA 3SNCA 1SHYA 1MMJN 2A4RA 1SGDE 3VB6A 1KXAA 1DX5M 1C5QA 2NU4E 3ZZDA 4XOJA 3CENA 1RGQA 4X8UH 3JZ2B 3MTYA 3D65E 1YC0A 2GCTC 1P09A 5E2OA 3SV6A 4E7RG 1IQEA 3OTJE 4R0IA 1K1JA 1OXGA 1C1TA 4ISNA 1E37B 3DUXH 1FY5A 2FOEA 2PTCE 4B76A 2EA3A 3S9CA 2ZFTA 1BZXE 3T27A 1V2TT 3PLPA 1S6HA 1H9IE 1VITG 2FXRA 1AD8H 1HDTH 3NXPA 1QB6A 1P01A 1SQTA 2D2DA 3P92A 5E0JA 1ZRKA 5F6MA 2ZDMA 1C1MA 2ZU1A 1QL7A 1GJBB 2WPKS 4NZQA 2FMJA 5AHGH 1EAXA 3RU4D 1IQMA 4INKA 3BF6H 4XSKU 1FDPA 1FIZA 3LH3A 1Y5AT 1EZUC 2ULLA 3TNTA 1D3TB 1UVPA 1A61H 2FESH 1TE0A 1SFQB 3ZZCA 3RXTA 5LPEA 4Q80A 4ASHA 4CRCA 1NC6A 2WPLS 1DS2E 1O5FH 3RMOH 4YT6H 4D9QA 4X2WA 2BDGA 1V2MT 3QX5H 3SJ9A 1SGEE 3A83A 1FN8A 4I8HA 2BDBA 1LPKB 1GDNA 3PMJA 1UTQA 2FYRA 2ZDVH 5HMAA 4ZXYH 1YKTA 3GY5A 1IQHA 1C1VH 1NU9A 5E0GA 2PKAB 1BRAA 1TYNA 2A1DB 4D76A 4CR5A 3BTHE 4Y76A 1DANH 1E34B 3WY8A 1U6QA 4XBCA 3K6YA 3HPTB 2FWWA 3UR6A 2FODA 1ETTH 3HKIB 3MH5A 4XE4A 5IYTA 2SGPE 1THSH 2ZFSA 1FI8A 1C4V2 1GBBA 1ZGVA 5HGGA 1A1RA 4MNYA 4NIVA 1MTSA 8ESTE 6CHAB 4LK4A 1NT1A 1V2LT 3NPSA 2UUKB 4BAOB 1EOJA 1SGRE 1BBRH 3EAJA 1AE8H 1NPMA 3RXSA 2CXVA 1O3IA 2HOBA 1RIWC 4Y10E 1O0DH 3QK1A 4VGCB 3LIWA 4ZKSU 3TLOA 1Y3XA 1GGDB 2Z6BD 2JETB 2QGRA 2BDYA 1C5WB 5E8EH 1XUFA 3VFEA 4ZXXH 1ZMLA 4MPVA 1CQQA 1AE5A 1BHXB 1C4U2 1MD7A 2ZFFH 4O3TA 1C2FA 2QF0A 1LVYA 5DP4A 1OYQA 1TBZH 3MO3A 4WH8A 2B9LA 3ATMA 3S7KB 2PKAA 5AVDA 1RS0A 1YLDA 1WOFA 4YT7H 1JXPA 3P8FA 2D26C 3NCLA 3ZZ5A 2O8TA 2AGIX 3SNBA 2UUYA 2AIPA 5LPRA 4Y7BA 3SORA 1P3EA 2FI3E 7LPRA 5EW1H 1JBUH 1HFDA 1P2NA 2RG3A 2CHAB 4QT8C 4JK6A 1AFQB 1AY6H 3SUGA 1YP9A 3LGWA 2J2UA 1H8DH 2XBVA 5DP8A 2A4GA 3GISB 3QTVH 1C2DA 1BBRK 1NO9H 5BPEA 2HPQH 2P93A 1KY9A 1GI0A 3FP7E 3URCA 3UOUA 1C1UH 4CHAC 3LGUA 2HGTH 2FOHA 1M9UA 4DG4A 6GCHF 1IQGA 2Q6DA 1AVWA 5AFYH 1L4DA 1UHBB 2QIQA 2ZFPH 1KDQB 4MQAA 4X6NA 2XTTB 4JCNA 3TH4H 4SGAE 1TA6A 4GHTA 4X8VH 1UK4A 1P12E 2W7UA 1OWEA 4MDSA 1GJ7B 2P59A 5C67A 2XC4A 4GUXA 1AWFH 3FP8E 4WF8A 4DIIH 1SI5H 4DT7B 1O2OA 1LPZB 1EUFA 4ABAA 1X7AC 1NN6A 2THFB 1YCPK 3BTQE 1UK2A 3EDXB 2XWBI 2LPRA 3E90B 3MU5A 1L4ZA 2GP9B 1ANDA 2ZKSA 3GDUA 4B2BA 5EW2H 2ZPRA 1SGYE 4OS1A 4X1QU 4UFGH 1QB1A 2A5AA 1SLWB 1KXFA 2XCNA 1AZZA 1JMOH 1QURH 3A7YA 5DK1A 1Z71A 3F9HA 4ABBA 4FUIA 4YM9A 2BYAX 1EZXC 5GWZA 4BAKB 1MTNB 1N1LA 1QQ4A 3TK9A 1TA2A 6GCHG 1FJSA 3V7TA 3T5FH 1NRPH 3GYLB 3RM0H 1A3EH 1OWHA 1UHBA 2QXHA 1KDQA 1CA0B 1WUNH 1BRBE 5F8TA 3S0NA 5J4SA 4WY3A 3GDVA 3BN9A 3ATWA 5EXLA 1W3CA 2ALVA 1VJAU 1WYKA 3TU7H 1FIWA 2AMQA 3DA9B 2XRCA 1O32A 1ARCA 3RXAA 1CBWB 1SFIA 1T31A 3T28A 1SLVB 3QO6A 5DP3A 4CREA 2NU2E 1EZQA 2IOTA 3KCGH 1T8OA 1SGFG 2CJIA 4PROA 4ABIA 1TPOA 1V2QT 3PM3A 2SNWA 3HGNA 4AORA 3TIUA 2ZCKP 4NA8A 1C1PA 1ELEE 2PLXA 1S0QA 4X1RU 4Y7AA 2VH0A 4Y0YE 4X8TH 2UUFB 1KLTA 1TIOA 1UCYH 5CHAB 2BX4A 3F6UH 3GOVB 4WXIA 1KXBA 1AQ7A 1G3DA 2C4FH 1TGNA 1O2UA 1NTPA 1W0ZU 3BG4B 4XBDA 1A4WH 2RA3A 4YOGA 1PFXC 1Z8JB 2PR3A 3ZZBA 4YOJA 4CH2B 1ELAA 4BTTB 3TJOA 3ESTA 4FUGA 2GZ8A 2BVRH 1W14U 2G55A 4TWWA 3V12A 2G5NA 1C2MA 3IITA 4AYVB 3HATH 2GDEH 4D7GA 1OP8A 1V2NT 4IMZA 2J38A 2ESTE 2P8OC 3VB4A 2A5IA 3IWMA 3MH7A 1O2WA 1F0TA 1J9CH 3LH1A 4GSOA 4X0WU 2BDIA 2ZHQH 1TALA 1CT0E 1D6WA 1EP6A 1GHBG 3NWUA 1A5HA 2C8ZB 1G3CA 1ZRBA 1K1OA 1E38B 1OSSA 1HAHH 3E6PH 1L2EA 1VITH 1Y5BT 2GV6A 3L3TA 3V0XA 4ZH8A 4A1TA 5A8YA 3M5MA 3U8OH 1MCVA 3F1SB 1NZQH 1ZTJA 3I29A 2C93B 4DCDA 1S84A 2B5TB 1UO6A 1UCYK 5F8XA 1EPTB 1TMUH 1FPHH 1GBTA 1GL0E 1O5BB 4UEHH 5C1UA 3ZZ8A 3A85A 4ABDA 1MBQA 1OWJA 3PYHA 4I33A 4HZHA 1ZZZA 1NS3A 1PPGE 3M7TA 4CH8B 4H6TA 1TGTA 1C5RA 3F68H 2ZP0H 3DFLA 1O36A 2Z7FE 4LZ4B 1V2VT 2J92A 4OGXA 1GBCA 1OPHB 2VVCA 1VR1H 1O2NA 1RTFB 4B2CA 1BTHH 1B0EA 1GMDF 4F49A 2FTLE 1HAZB 5C5NA 5T6GA 1O3MA 1DWBH 4Y8YA 4DURA 3QTOH 2I6QA 1JRSA 4YOIA 2ZFQH 1OWDA 4Y8XA 1K21H 1HXFH 2AGGX 1ELGA 4YESB 4YO9A 2C8YB 4BAQB 2VB0A 1QGFA 1MTWA 2OBQA 1SPJA 1YCPM 3TJVA 2H9EH 1MTVA 1TRMA 5FAHA 1EAIA 3KQBA 2M5TA 4K69A 1OWKA 2A4OA 2BD9A 2ZGBH 3SJOA 1UTKA 2ZHWH 5ESBA 3RXIA 1C5MD 1K22H 2ZF0H 4RN6A 4ISOA 1MH0A 3RXDA 1P3CA 1EPTA 1BDAA 2BD5A 2ASUB 2F9OA 4K8YA 1FY8E 5LH8A 1QRXA 3U98H 4ZROA 3A7XA 1W7GH 1UTPA 1NRQH 1ANBA 4K8BA 3C27B 5H4IB 1ELDE 1P2MA 2RDLA 3AASA 2H9TH 4DOQA 1B5GH 3GYMA 2JH5D 4AN7A 2ZEBA 4BANB 1LKBA 1MU6B 1F0UA 1HRTH 1KXCA 4MTBA 3ZZ4A 1ETRH 3BSQA 3KN2A 1INCA 1FMGA 1C5PA 1AB9C 4FUBA 1TQ7B 3LDXH 4E06H 1W7XH 1WBGB 4NWKA 4JZEH 3T29A 4IN1A 4NGAH 1AU8A 1QBOA 3A89A 5K0HA 3O8DA 4I8KA 1S82A 2GCTB 3ATLA 1OOKB 3VB5A 1G30B 1UMAH 5FPTA 3C1KA 3E3TA 1C1NA 1QL8A 1HNEE 1P04A 1O3FA 1MKWH 3SV2H 3SNDA 4AB8A 2ANWA 1MCTA 1RXPA 1T32A 4GCHF 2BM2A 2UWOA 2PV9B 4AB9A 1Y3UA 3I78A 1BMAA 5A2MH 1TMBH 2HPPH 2ZGCA 1AGJA 4BAMB 2ANYA 1O2GH 1GHAG 1YF4A 2FM2A 2Z9IA 2AH4X 3MOCA 1O2XA 1EASA 1O3GA 4YLUA 2BVXH 4I31A 3ZVEA 3K2UA 3MH6A 2Y82A 1V2KT 1GHWH 4K3JA 4TY6A 1LDTT 2QXJA 3KGPA 1F0RA 2XXLA 1ELBA 1O2YA 7KMEH 1ARBA 1FAKH 1GI6A 3RXGA 2AGEX 1UVOA 2XC0A 2Z3DA 2XWAA 3EGKH 4Q2KA 1QRZA 1G3EA 1MBMA 1DDJA 1SGFA 3BEFB 2H5CA 3ZVGA 1EJAA 1FLEE 5FHTA 3ATIA 3AW0A 1MKWK 1L0ZA 2FI5E 3A8BA 2PUXB 1IOEA 5EPYA 1YPLH 3LC3A 3PV4A 5C3NA 2BQWB 5GPIB 2FX6A 1GMHG 3U1JB 1FZZA 1SGNE 4KTSA 1NFXA 1P0SH 1OX1A 5EOKA 7ESTE 5IDKA 2W3KA 4H6SB 2BDCA 2EEKA 1O30A 5EQRA 1FN6A 4O97A 4JK5A 2BDAA 2ZDLA 4IMQA 5A0CA 2FIRH 3SUEA 5EGMA 1V2JT 1GBKA 2OD3B 2QF3A 3S69A 4BNRA 1Y3YA 1HPGA 1S85A 3E91A 3PWCA 1L1GA 1ETSH 1O2QA 2BD4A 3AW1A 3DHKH 3SQEE 1EP5A 2HALA 3RMNH 4DY7B 5C1YA 8GCHF 5ABWA 2HVXA 1A5GH 1D9IA 1RIWB 2PUQH 3TK6A 3RXOA 1ZPBA 1EB2A 4JYTA 1AFEH 5JBAS 1NY22 3HKJB 1VZQH 2PHBA 2WPMS 1Q2WA 2F9NA 3SGBE 9ESTA 4BTIB 2A7HA 4IBLH 1ZPCA 2BZ6H 1GBAA 1YYY1 2VIPA 3Q3XA 1J17T 2OUAA 1GCTC 3STJA 5DO4H 1IAUA 2PKSC 1ZSJA 4AZ2B 1XKBC 2Z9LA 2G51A 2G81E 1P03A 2OXSA 3SV9A 1CHGA 2Q6GA 1AVGH 1O3PB 3AAVA 5K7RA 3SJIA 3AVZA 2DE9A 4CRGA 1YGCH 4ZUHA 5GIBA 1QR3E 1UTJA 1DWEH 2BD7A 4K1TA 3A82A 4FUFA 1C5XB 4ABEA 3E0PB 1CT2E 3BTDE 3FANA 3M3SA 6LPRA 3AAUA 2GT7A 3U8TH 1SLUB 4GHQA 1TX7A 3B8JA 2G4TA 3MNBA 3A86A 3QGNB 3ZZ7A 1G2LA 1GBLA 3H5CB 1P9SA 1THRH 1HCGA 1C2LA 1ELVA 1V3XA 3GY8A 1MZAA 1IQIA 4UFEH 4Z0KA 2V3OH 2WV4A 1V2UT 2W3IA 4CHAB 1NRSH 1ZTLA 1O5AB 3KQDA 3RXVA 3RLYH 4NFFA 1BCUH 1GI2A 2V3HH 3FVFB 4NWLA 5ETXA 2C8XB 2AFQB 3LKWA 2A2QH 3TGIE 1ACBE 2Y81A 3UY9A 2BLWA 1O33A 4AFSA 1KLJH 1P06A 2TPIZ 2XBWA 1ZHPA 4LZ1H 4ZKRU 4UDWH 3GCTF 1SR5C 1EB1H 4KGAA 1GBEA 1PPCE 1XUJA 3LPRA 3G01A 2CMYA 1UVSH 1BIOA 2ANKH 1Y3VA 4HI3A 1SL3A 1TAWA 4Q7XA 4B74A 3Q3KA 1DLEA 2PSYA 2ILNA 2O8MA 4IGDA 2VWLA 1O2SA 1AUTC 1TNJA 3PLBA 2P94A 3M37A 1V6DA 3V3MA 1BB0B 2ZHFH 3D49H 4Y6DA 2DUCA 3LC5A 1WTHD 1O2PA 3R3GB 3S9BA 1DUEA 4X8SH 4E7NA 1LVMA 4MVNA 3PMAB 4INLA 5DP5A 3KEEA 1O2LA 1TOCB 5L2YH 2ZI2H 3QZQA 4X6MA 3P8NA 3SZNA 4JMYA 1O3LA 3STIA 1YCPH 3Q77A 2H2ZA 1Y3WA 2AERH 2FS8A 1GVLA 1BRUP 3I77A 4AG1A 1C1WH 2YNBA 3PMHB 1W0YH 1QCPA 3K65B 1GI9B 3Q76A 1DOJA 1HAIH 4I32A 3HK3B 1AHTH 1BRCE 1AIXH 3NKKA 2BOKA 1HAOH 4BXWA 3ITIA 3UOPA 3BIVH 1H9LB 2BDHA 3OX7U 2BXUH 3U1IB 5JPMH 2R2WU 2QY0B 2C8WB 1IQKA 2WPIS 4GAWA 4FUCA 1YPGH 3BTFE 2BQ7B 4U01A 2AS9A 1XUKA 4MPWA 1C2IA 5JDUB 1GBDA 4AFZA 1SGPE 1BQYA 5HXFA 1KLIH 3PTBA 1UVUH 4B75A 3MFJA 2ZU3A 1DXWA 3BTKE 1MAYA 1C5SA 3UIRA 5EXNA 2BX3A 3TK5A 3VB3A 3NUMA 1O3DA 3MO6A 5CE1A 1UTOA 1J16A 3QN7A 1J15A 1T4VH 3KIDU 1Y59T 4X2VA 1UTMA 1A0LA 1ELCA 3M5NA 1G3BA 1LMWB 3A7TA 2OC1A 4DVAU 2A4QA 3ODFA 3MMGA 2P8OB 1QBVH 4VGCC 3MU1A 3E16B 5A0BA 1JWTA 4RSPA 1HB0B 3DD2H 4OS4A 3BEIB 5FBIA 1FQ3A 1GMCF 1O3KA 4JZFH 1BTXA 3Q3YA 4JYUH 4DW2U 3A81A 1CT4E 2PWXA 1HJAC 5DKMA 5A09A 1XUHA 2F83A 2SGEE 1P11E 1O34A 3VPKA 1SSXA 1Q3XA 3T62A 4Y11E 3GY3A 4U2WA 1O2KA 3SHAH 3PWBA 3RXBA 2NU0E 1NRNH 2ZWLH 1O38A 4UD9H 1CHOF 2PTNA 4FU9A 1BMMH 1QBNA 1G9IE 3K6ZA 4I8JA 3KL6A 2ZU4A 1RFNA 2CHAC 3VB7A 2TIOA 4RKOB