3A88A

Crystal structure of trypsin complexed with (e)-4-((2-nicotinoylhydrazono)methyl)benzimidamide (soaking 30 minutes)
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In-Crystal Chemical Ligation for Drug Discovery
rcsb
molecule tags Hydrolase
molecule keywords Cationic trypsin
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a88A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a88A02
3BIUH 1K9OE 1ZTKA 2RA3A 3QGNB 1O3MA 2Q6FA 3CP7A 1YCPK 3TPIZ 4RKJB 1O31A 1H9IE 1SG8B 4MNXA 1UVTH 1YPEH 3QN7A 3ODFA 3Q77A 1GBHA 1HAYB 3RXBA 4ABAA 3S9BA 2Q1JA 2JH0D 1EZUC 1HJ9A 1QGFA 2OC0A 4X2VA 1W0ZU 4I31A 1KYNA 1TGCA 1N6XA 3RXEA 1PPBH 3V12A 1BB0B 1XM1A 1T8NA 2VINA 2BOKA 4H6SB 3V0XA 4BXSA 1UVPA 1LVYA 3KQBA 5C1YA 1XXFA 3BEFB 3RLWH 2Y82A 2G8TA 2BTCE 2ESTE 4U30A 1ESTA 2ZFSA 3QX5H 3UUZA 1QQUA 1FN8A 5E2PA 5GIBA 3LH1A 1VITF 1C1UH 4JYVH 2J95A 4OS1A 1ZPZA 3P6ZB 2FYRA 2TGDA 5AHGH 4I8LA 1ELDE 2Z3DA 3MU0A 4FUCA 2ZQ1A 1JXPA 3UOPA 4YOJA 3QUMP 3SU6A 2B7DH 2ANKH 1FQ3A 1KXEA 4KGAA 1HDTH 3NKKA 2ODQA 1EKBB 1HJ8A 1O3DA 1DT2A 3A85A 5TCCA 1VCQA 1C5QA 4MLFB 2BM2A 2WPKS 1T7CA 1A4WH 2FTLE 1GI7B 4JYUH 1Q2WA 4AN7A 2ZU3A 3F6UH 1O2VA 4D7GA 2A7HA 1EJMA 1UMAH 2ZGCA 3RXDA 3T27A 1JIRA 1WQSA 4NCYA 4NWKA 3MU8A 3MNSA 4JMYA 1L4DA 8KME2 2VWMA 1SGFG 1GJ7B 1OPHB 1HXFH 1UVOA 4WH6A 4X2XA 3EA7A 3AASA 3DHKH 3E16B 4MNVA 4CR5A 3ZZ9A 1EAWA 1MUEB 1P10A 3M5LA 1OYQA 3URCA 4CBNA 5E8EH 3VFEA 1QJ7B 1HGTH 4K1EA 4X6OA 3JZ1B 1P8VC 3Q3KA 1IQEA 1J8AA 2F83A 1C5VA 5GPIB 1NFXA 4WMFA 3RXHA 2WPLS 1ETRH 1NN6A 1OYTH 2SGFE 4XBDA 1THPB 1JWTA 2BLVA 4UD9H 4WY3A 4BAOB 2CJIA 4WXVA 5C5OA 3PWBA 4ISOA 3KGPA 3ZZBA 2XWAA 2ZDNA 2LNCA 4H4FA 1WV7H 3B23B 1QY6A 1AQ7A 3HATH 2NU3E 1O2PA 4FUGA 5T6FA 2FS9A 7ESTE 3ATMA 4X8UH 3QWCH 1OXGA 4AB8A 2FOMB 3SHCH 1VR1H 3TIUA 5DO4H 3T29A 1MTVA 1E36B 2TGTA 1TX6A 2DE8A 3GISB 2FYQA 1LTOA 1ACBE 2KAIB 1RTLA 2TIOA 1C2DA 4Y11E 2BVXH 1HIAA 1AKSA 4OGYA 1INCA 1KLJH 1K1OA 3SJ9A 2O8UA 4CRBA 2W3IA 4B1TA 1PPGE 4A7IB 4TY6A 2EC9H 1UCYK 1SGPE 4WXIA 1BRAA 2D1JA 4ZUHA 1MKXH 1UTLM 3BV9B 1BMMH 3PYHA 1GVZA 1GHZA 4ISHH 1NS3A 1D6WA 1FPHH 1EASA 3OTJE 2WYGA 1S85A 1O5AB 1UTPA 1C5ZB 2BYAX 3SN8A 3RU4E 1T8MA 2F9NA 2FO9A 1MZAA 1UK3A 1P57B 1K1JA 2R3YA 2BD8A 4YESB 1GG6C 4B71A 2Y5HA 3SUFA 4Y8XA 1EAIA 1O5DH 1TOMH 2XTTB 3FFGA 4I33A 3KQCA 2P59A 2VJ1A 3B8JA 1ELFA 1DICA 1OWEA 1O3HA 1QB1A 3M37A 5EPNA 1LDTT 2WUBA 2BZAA 3BTTE 4IGDA 4A1TA 1H9HE 1O5FH 3FAOA 3OY6U 1OWIA 1DFPA 3A81A 3QO6A 3BG4C 1LPKB 3PO1B 3KQEA 3DUXH 1ETSH 1G3CA 1UHBB 2BMGB 5FPTA 1RFNA 2PGQB 1E34B 3MTYA 2Z9GA 4B2CA 3SI4H 2JETB 1C5LH 5A8XA 3ZZCA 1B5GH 2FDAA 3RC6A 3MU1A 2XC4A 3M35A 3QDZB 1O3LA 1EOJA 1MBMA 4JYTA 1A3BH 1KXFA 1TNGA 1FY4A 4CRCA 2Q6DA 2ANWA 1J9CH 1IQLA 2VVUA 2QA9E 4Y7BA 5GDSH 1WTGH 4X6MA 3UY9A 1ESAA 1FLEE 1HJAB 2ZFPH 1ARBA 3SGAE 4YT6H 2AMQA 1ANDA 1DM4B 2BY5X 1DXWA 2QF0A 3PM3A 2OUAA 1NRNH 3PMAB 1BHXB 1C1VH 3K9XB 4THNH 2K1QA 3GYLB 1MZDA 3NWUA 1P11E 4MDSA 2ZZUH 1W2KH 3MO9A 1MTNB 2BXUH 1O3IA 2FI4E 1FPCH 2ZKSA 2IN2A 2P8OB 4X8TH 1GVLA 1QQ4A 1SHYA 3GDVA 2BY9X 3RXPA 2PTNA 4Y79A 3RLYH 1BTWA 2UUJB 1C4U2 3GY6A 1UTNA 5FX5A 3ZVAA 2V3OH 3DD2H 5FHTA 1UHBA 1FV9A 1ZPBA 1DUAA 3IG6B 1O2NA 1HRTH 1EPTB 1BITA 3NCLA 3QTOH 1WTHD 4NA7A 1TALA 4I7YH 1BOQA 2A2XH 1FNIA 1HUTH 1FN6A 3E6PH 2F9BH 2TGPZ 1V2PT 5TCAA 3FANA 3L6PA 1NRSH 3MHWU 1ABJH 2BY8X 4B74A 4HZHA 4AOQA 2QF3A 4WF8A 4JZ1A 2Z94A 1IQMA 3GY4A 5E0GA 1F0UA 2UUFB 1O3AA 3LJOA 1AGJA 1KXAA 2ZU1A 2VIPA 2SNVA 2J4IA 2ZF0H 1NRPH 2EEKA 1GWAA 2HPQH 2XCNA 4U2WA 1BTPA 4IN1A 3HKJB 1UTOA 1C2GA 1SMFE 3FZDA 4B76A 4BOHA 4I8JA 1TB6H 2FOHA 1LPGB 4NSYA 4X1SU 4WVPE 4YZUA 2Z3EA 1YPHE 2BD9A 4PROA 2GZ7A 2OINA 3RXFA 4MQAA 1YPHC 2PFEA 1ORFA 1AIXH 2F3CE 3AAVA 2GMTC 1GI6A 3TNSA 1XKAC 1D3PB 2GMTB 1KDQB 1LHDH 4ZKOU 5CHAB 4DW2U 4ZXXH 3U69H 3BF6H 2V0BA 1YYY1 2VWLA 3CS0A 4Y76A 1FI8A 1QCPA 2NU2E 2AIQA 4ASHA 1M9UA 1QRWA 3E0PB 4WJG2 3V13A 5JBBS 2ZECA 1RJXB 5A2MH 1AFQB 5CHAC 1K2I1 2ZI2H 1BTYA 4H42U 1G32B 2ZWLH 3RUOA 1TWXB 2BDYA 2ZA5A 1SGRE 1PJPA 2G00A 1O33A 1P03A 1C1PA 1LHFH 2GDDA 5FAHA 1VCPA 5E0HA 2ZNKH 1EOLA 3ESTA 5C20A 5EU8A 2RDLA 3C1KA 2PKSC 1PPCE 5C1UA 3VXEH 3PLKA 1DLEA 1AE8H 1LKBA 2J94A 2AGIX 4ZHMU 6ESTA 3U1IB 2FODA 1P2JA 5FCRA 1QHRB 4FU7A 3SGQE 3UTUH 1XVOA 4LZ1H 2AIPA 1GHVH 1ZPCA 2UUYA 3BG8A 3QGJA 5EW1H 2BDBA 2FOGA 5EXNA 4D7FA 3BTEE 1V2NT 2M5TA 5DP3A 4DVAU 1GBCA 1BTXA 2R2MB 1LKAA 2J38A 3MYWA 1OWJA 4Q2KA 1Y3XA 1SLWB 3W95A 4O9VA 4K69A 1YPGH 3QK1A 4HFPB 1IQHA 1O34A 1GHAF 1AWFH 1G3EA 1KY9A 1MCTA 3SV8A 1O3KA 3RU4D 4INLA 3TK5A 3GYMA 3MH5A 1SLXB 5IDKA 3SNDA 3E1XB 1O0DH 1V6DA 2YNAA 1GMDF 1A46H 3D65E 3KHVA 1HV7A 5A0CA 1V2WT 5EG4A 1CBWB 2Q6GA 3BIVH 5F03A 3STIA 1P0SH 3TJNA 4OS2A 4AYYB 1O5EH 5LH8A 2VH6A 1AE5A 6CHAC 1GDUA 2PUQH 2F9UA 3GCNA 3KN2A 4HGCA 1X7AC 5LPEA 2B9LA 3S7KB 3LGTA 2HNTC 5DP9A 1YGCH 2SNWA 3H5CB 2HNTF 3M5MA 3SGBE 1P2QA 3NXPA 1DSTA 1NO9H 3UFAA 2PUXB 3TNTA 1Z6EA 3V7TA 1FY1A 1EX3A 1F92A 4UFDH 3RXVA 4AYVB 1YCPM 4NZLA 5GCHG 3M5OA 3RC5A 1C2FA 1NFUA 4ZHAA 1BHXF 1DS2E 1BT7A 5ABWA 1XUIA 2G5NA 1AU8A 2VNTA 3HK3B 3GCHC 1AB9C 4KP0A 3T28A 1PPEE 3OSYA 4UE7H 1TBRH 4LOYH 5ESTE 2ZP0H 4MPWA 3ZVBA 4LXBH 4CRGA 1C4Y2 1NPMA 1UVSH 4KELA 3ZV8A 4XBBA 1AMHA 1Z6JH 3T62A 1C1SA 2O8WA 2ZDAH 2XBXA 5FPSA 3RU4T 3MI4A 1C1QA 3I29A 1XUFA 4WWYA 1C1RA 1LCYA 1ZYOA 1VGCC 4Y0ZE 2DE9A 1HCGA 4I8HA 1MH0A 1XVMA 1YLDA 3MO6A 3U9AH 1HAHH 4BTTB 1IHTH 5HM9A 4FVBA 1GBFA 4TPIZ 1AVWA 4Y8ZA 4DGJA 3F1SB 1BBRH 2A45B 4IW4E 1KTSB 1SGDE 4GLYA 7GCHG 1EP6A 4BTIB 1TAWA 1A0HB 3MWIU 1OP2A 3PLPA 5EODA 4AORA 1VITH 5LPFA 3BTFE 2TGAA 2XXLA 1F7ZA 1LPZB 4MG3A 5EGMA 3ZZ8A 1FIWA 3ZVFA 1G3DA 3UWIA 1C2JA 3FP8E 1TX7A 2OCVB 1C5PA 2ZQ2A 4BAMB 2RCEA 1LMWB 3SU0A 4NSVA 3A88A 1MTWA 1UVUH 1AZZA 3S9AA 1GMDG 1KXDA 4SGAE 2GT7A 4SGBE 1B7XB 5JBTA 1P05A 2AS9A 3GICB 4AB9A 2FPZA 5A0AE 1K1LA 1AUJA 1O30A 2JKHA 4IBLH 4INKA 4JZFH 2FP7B 1K1IA 2UWLA 1GDNA 1TYNA 4X0WU 1SQOA 1CU1A 4ABDA 2A0QB 1FAXA 4FXGH 1K28D 1P06A 2QXGA 1LHGH 1TRNA 1O36A 1HAZB 3M3VA 3L3TA 3SJOA 5B6OA 1F5LA 5EQSA 1HIAB 2ZFRH 1EJAA 1O2IA 1GI4A 2PKAB 3NK8A 2QY0B 4K1SA 2QXIA 3U8RH 2OLGA 3OYPA 1TPSA 2FOAA 1GCDA 2P93A 3P17H 1LVOA 2ZPSA 1UJ1A 3ZVGA 4XBCA 2A2QH 4YOIA 1OP0A 4VGCB 2O8MA 1AKSB 1OS8A 1W12U 1RXPA 2ZDLA 2TRMA 1RIWC 1GCTB 3KQDA 2GZ8A 5JDUB 1JRTA 2GCHG 2D8WA 4AFSA 1UCYH 4B75A 2G52A 1C5MD 1JMOH 3LDXH 2P3TB 1Z7KA 3ZZAA 3IITA 2ZGXH 4JZEH 1ZMLA 2ZC9H 1QBOA 2TBSA 3M36A 3VB4A 4Z0KA 1XX9A 1NU9A 3G01A 2NU1E 5HM2A 5EQRA 2PKSB 1TA2A 2HNTE 4LK4A 4OS4A 2H2ZA 1SPJA 1F0SA 1DLKB 1QBNA 1W0YH 1A0JA 3RXTA 4CH2B 1W3CA 3SJ8A 2A7JA 4RKOB 1KLTA 2ASUB 2QXJA 4KKDA 2A4QA 2CF8H 2BDHA 3RMMH 3TITA 2F91A 1GMHF 3BG4B 3EYDA 1O5BB 2BOHB 5HGGA 4BNRA 2PKAA 2Z9IA 2UUKB 1Z8IB 3I78A 5DP6A 2WV5A 1TE0A 3JZ2B 4BAQB 1TNHA 1SGIB 2BLOA 1BZXE 1P04A 3N7OA 1A61H 1W8BH 1Y5AT 1CHOG 3MO3A 1P9SA 1V2KT 1D9IA 4X2WA 1XUGA 4JZIA 3M5NA 1SQTA 4CBOA 1D3TB 1K1MA 1KDQA 3BTQE 5E0JA 1ARCA 1AB9B 1BJVA 2GV6A 2HGTH 3QZQA 1S0RA 1O2UA 4D9QA 4DIHH 3LPRA 3PLBA 3P8FA 4GVUA 1W11U 1L1GA 1OWHA 3K65B 4AGKA 4YM9A 1MU6B 1P01A 1MD8A 2A4OA 3GDSA 4RSPA 1SHHB 5HYOA 3A83A 2SGAA 4KTUA 3SW2B 3EA8A 3TVJB 3FVFB 1O3JA 1ZTJA 2ZCLP 2WV4A 5EXMA 1QNJA 1HB0B 1PPHE 1QJ1B 2BXTH 1GVKB 2Y81A 2Z3CA 1C5YB 4ZMAH 7GCHF 5A0BA 3SUGA 3RXUA 1Z1IA 4K60A 2H9TH 1RS0A 5DK1A 2BD3A 1C9PA 4M7GA 4NIYA 3P92A 2JH5D 1YPJH 2FMJA 2Z9LA 2ZTZA 2AH4X 3BSQA 1J14A 3A82A 1C1NA 1GHBF 3TGIE 2FWWA 1O3GA 1O2YA 3LJJA 3UOUA 3PROA 2CGAA 5ETXA 2ALPA 2FX4A 2P16A 4RN6A 1GBDA 4ZXYH 1O3BA 3B9FH 1SOZA 3OY5U 1FZZA 3TLOA 4YLUA 4GCHF 5JB9S 1ZTLA 3K6YA 2WPJS 4AG1A 4F49A 2GTBA 1J15A 2BD5A 2BLQA 1O2GH 3PTNA 4Y10E 1GPZA 2XNIA 1A5HA 1O2SA 2LPRA 1TGBA 2Y7ZA 5C2ZA 1ELVA 2SGPE 2FESH 1UO6A 2H9EH 4U32A 1J16A 1EQ9A 3RXRA 4ISNA 2GVFA 1Y8TA 1P2KA 1XMNB 4WMDA 1ELBA 3TJOA 2VWNA 1HJAC 2CV3A 4TWWA 1TBZH 1TNKA 1A0LA 1A7SA 1H9LB 2PW8H 3IWMA 1HXEH 3HGNA 2WPHS 5T6DA 1IQJA 1BRCE 3P70B 2GZ9A 3U8TH 2O9QA 2WINI 3TGKE 3TJVA 1D4PB 5T3HA 1UTQA 2ODYB 5G4BA 1DPOA 1DY9A 1FMGA 1C2LA 5EW2H 2OBOA 2HRVA 1YCPH 3QLPH 3A87A 2WPIS 3RC4A 2XC5A 1BJUA 1Y5BT 1HYLA 1RTFB 2PR3A 3P8OA 1ZZZA 1PQ5A 4NWLA 1MCVA 2B8OH 1ZRKA 5DP4A 1P2OA 2Y80A 3TK9A 2BB4A 1DOJA 1CGJE 1GL1A 1MD7A 3LONA 1P2IA 1TRMA 1RD3B 1WAYB 3H7TA 4KTCA 1O2TA 1CGIE 1SFIA 2NU4E 1ESBA 5A09A 1O2OA 3DA9B 2VIWA 3PWCA 1BTZA 1GHXH 3RMOH 3ATWA 3KL6A 1O3EA 1BQYA 1YPKH 3ZZ6A 4TYDA 4K2YA 3SHAH 2HOBA 1YKTA 3P95A 1BCUH 1Q3XA 1T4UH 1QRZA 3SV7A 5E2OA 4JK5A 1GJBB 2ANMH 2ZEBA 1YF4A 1HAPH 3MH4A 3BEUA 1QL8A 2Z7FE 2PGBB 3SO3A 1UCYE 1GJ9B 3LT3A 2OXSA 1V2OT 3SNBA 3U1JB 1S0QA 2SFAA 8LPRA 1CA0B 1E0FD 1O3FA 1C2IA 3HGPA 1CA0C 2ZFQH 1C5XB 4JCNA 1VJAU 2GT8A 3TH3H 5T6GA 4TY7A 2XWBI 4OS6A 1TMUH 1TNIA 2GCTB 2H5CA 1C1TA 1FONA 1N8OB 3LH3A 1SGYE 1CT2E 4D76A 2ZGBH 1ELGA 5FBEA 5DP7A 1BBRK 1GJAB 1TPAE 3U8OH 2IJOB 4NIXA 1GBKA 4BANB 2W7SA 1VITG 5SGAE 1NFYA 6LPRA 1C1MA 1O2MA 1H8DH 1NT1A 1GHAG 3HKIB 1SVPA 4AG2A 1SOTA 4FUDA 1A3EH 2JETC 2XRCA 4DT7B 4X1PU 1BTUA 5JYIA 1GJ8B 3U98H 2PHBA 1CO7E 3SV6A 5I46H 3KF2A 3VGCB 1SQAA 4FUJA 3O8RA 3EGKH 1G37A 4X2YA 4B2BA 1GJ5H 1SFQB 2NU0E 5EPYA 1O39A 1KXCA 1UTMA 1W10U 3PO1C 1UK2A 2ZCKP 4GCHG 4IS5A 5DGJA 2ZGHA 1CA8B 5A8ZA 1TMBH 4O97A 1FY8E 1FY3A 1O2QA 5FXLA 4BXWA 4E06H 1HAXB 1OX1A 5CE1A 3LC3A 2A4GA 3NUMA 1S84A 1GBMA 1V2UT 1GI5A 1XXDA 3ODDA 2F9VA 4INHA 5GWZA 1H1BA 1O2RA 3HPTB 2A5AA 3MH6A 1Z8GA 1ELTA 3EA9A 3RXGA 2H6MA 3T5FH 3UNRA 1DDJA 1ZJKA 2O8LA 1F0RA 3SUEA 1TBQH 2VGCB 5FCKA 4IMZA 3NPSA 4YLQH 1TRYA 2OBQA 4OS5A 4U01A 1WYKA 2FZZA 3Q00A 2IOTA 3S69A 2Y5GA 2GKVE 2WUCA 1SLUB 3A7ZA 4ZKSU 1IHSH 4FU9A 2ZDMA 3MNXA 3A7WA 1A5GH 2ZU2A 5HXFA 4UFFH 3SQEE 4GAWA 2FX6A 2YNBA 1N6YA 4ISLA 4IC5A 4B2AA 2VIOA 1BTHH 4R0IA 1GHWH 1T32A 5DP5A 4J1YA 5DG6A 3NZIA 1C5OH 1MKWH 1DWCH 2FIRH 4ZHLU 5HMAA 1LO6A 3RP2A 4XDEA 1JIMA 3RXIA 1LVMA 4IN2A 1ANBA 2YOLA 5L6NH 2G81E 3R3GB 4GSOA 1PYTC 2PWXA 1AO5A 4I8GA 1DITH 1NY22 1N1LA 1EPTC 2BDAA 5I25A 2ZDVH 2QXHA 1IQIA 3A7VA 3E3TA 4DY7B 1YPMH 4Y0YE 1NZQH 1ZLRA 1YLCA 5L2YH 2ILNA 2H9HA 2AYWA 1O5CB 3VPKA 4JK6A 4R8TB 3T25A 2ZFFH 1ANCA 1QR3E 1C2EA 3DT0H 3MU4A 2ZGJA 3HK6B 2Z6BD 1KTTB 3ATIA 4FU8A 1ZMJA 3A86A 4YT7H 4ABIA 3EAJA 3RMNH 4Y71A 2EI8A 5F8XA 1P12E 1O2KA 1HPGA 2ZG0H 3LOXA 3SNCA 1TMTH 3TU7H 1SC8U 1S5SA 1WSSH 1T8OA 3TH4H 3M7UA 5F8TA 2A5KA 1OKXA 1AUTC 3SU4A 2G55A 3F9HA 1DWBH 2GCTC 2GCHF 2AGGX 1G36A 4MPUA 1UTKA 3F68H 1DWEH 4OS7A 4X8SH 1O3NA 1NRQH 1O3PB 1XUKA 2OC1A 3E91A 4CRAA 2O8TA 3ZV9A 1F5RA 1GJ4H 4VGCC 2OP9A 4K8BA 3RXQA 4K8YA 1Y3VA 1C5UA 1QB9A 3FZZA 1O3OA 3ELAH 1AFQC 2P94A 3AVZA 4A92A 4DIIH 1GGDB 3UQVA 5L2ZH 2BD2A 2BDGA 4MTBA 2UWOA 2GP9B 1O2JA 4AFUA 2XBYA 1P02A 2P8OC 2GD4B 1PPZA 4AGJA 1DWDH 1P3EA 3O8BA 1GCTC 4Y8YA 3SV9A 3RXMA 1EPTA 1RRKA 2OD3B 4D8NA 1QURH 3GY8A 2I6SA 1A1RA 4H6TA 4A1XA 3A7TA 2ZO3H 1FAKH 1IOEA 1OOKB 3SJIA 4TPYA 1ELAA 1DE7H 5GXPA 2ANYA 4JZDH 3UPEA 3CS7A 1Y3YA 1MBQA 1GMHG 1EB2A 5C3NA 2G51A 1CT4E 4DOQA 1IQNA 3SNEA 1RGQA 5GJ4B 2UWPA 2DUCA 4AFZA 4FUFA 3PTBA 1PFXC 4UEHH 1C2KA 4BTUB 4ISIH 3O8DA 4IMQA 4AX9H 2GDEH 2VH0A 2HWLB 1O35A 1LHCH 1QB6A 1SL3A 1ZSKA 2OTVA 5F8ZA 3UWJH 3ZZ5A 3SU5A 1BMLA 2QV1A 3RM0H 2BLWA 2Z9JA 1BDAA 1NC6A 2J2UA 1QBVH 5EQQA 1TNJA 1WCZA 1G3BA 1GBAA 1LQEA 3M61U 1ZR0A 4O3TA 1O3CA 4LZ4B 1V2LT 1QTFA 3A8DA 3BTWE 1L2EA 4I32A 1S6HA 1JBUH 1O2LA 1SB1H 2ZTYA 7LPRA 2ULLA 2A1DB 1S6FA 1TONA 1QIXB 2VB0A 2FLRH 2C8XB 4Q7ZA 1HBTH 4O3UA 3TJUA 3R0FA 2EA3A 2XYAA 1VGCB 1C2MA 1ID5H 1T8LA 1YP9A 1XUHA 3CENA 3ZZ4A 1VZQH 5PTPA 3H7OA 2OQ5A 2B5TB 2VVVA 1HNEE 1IQFA 2G4UA 1NROH 2QCYA 1ELEE 4FUIA 2ZU4A 1TQ7B 1D6RA 2STBE 5DPAA 4X1QU 2J34A 3VB5A 1H8IH 1AVGH 1L1NA 1NM6A 5K7RA 1AWHB 5EXLA 4K1TA 4Q80A 1GI1A 1BA8B 3LGWA 2FOFA 2BQ7B 2ZHEH 1EZSC 3EQ0H 1GG6B 3C27B 5J4SA 2F9OA 3M3SA 1GI3A 4HTCH 3MFJA 1GBIA 3RXSA 3K6ZA 1BRUP 1Z71A 3SU1A 1C1OA 1UTJA 1SI5H 1TFXA 4J2YB 1Z1JA 1QL9A 3E8LA 3BEIB 4UFEH 1HAGE 3S9CA 3L33A 1ZHPA 3MH7A 2FOBA 1SGEE 4DCDA 3RDZA 3PB1E 1HAOH 2BX4A 5BRRE 4CHAB 1ZOMA 1GBJA 1HFDA 1EAUA 4BAKB 3ENSB 1DX5M 2FS8A 3SU3A 3I77A 1W7GH 1IQGA 4WH8A 3RXJA 2QYIA 2W5EA 1TPPA 1MTUA 3TK6A 2ZPQA 3ZYEA 3ZZ3A 4ZKRU 1L4ZA 1KXBA 1BUIA 1FUJA 1TNLA 4NG9H 3STJA 2OC7A 3RM2H 2V35A 1EAXA 3UNSA 1LVBA 3LGVA 3PMBB 2ZFTA 4ESTE 4ZH8A 1JRSA 1PPFE 2ZU5A 2C93B 2A5IA 3SBKA 3SORA 1ZJDA 2GV7A 3GOVB 1JOUB 2FI3E 2CHAB 4Y6DA 2XW9A 1MKWK 1GMCF 3AW1A 3S0NA 5DKMA 2VU8E 2IPHA 1EATA 1CT0E 1E38B 1YM0A 2QC2A 3A89A 3ZVEA 1AY6H 3FP6E 1EZXC 1XKBC 3M3TA 3KNXA 1CSOE 1P9UA 4HI3A 6CHAB 1EZQA 5AFYH 2VWOA 1BRBE 3SQHE 4A5TS 1TX8A 3K2UA 3ATLA 4AFQA 1DVAH 2P3FH 1CBWC 3VB3A 2C4FH 1C5TA 2NWNA 1QRXA 3D49H 2AERH 2BX3A 3GY7A 1V2QT 1H4WA 1NRRH 2XC0A 1WU1A 1TQ0B 1SGCA 2J92A 2OC8A 2ODPA 3QTVH 2W26A 4NIWA 5AF9H 8GCHG 3TGJE 4QT8C 1C5SA 4E7NA 4X8VH 3VB6A 1GJ6A 1MTSA 3A7YA 1V2RT 1PQAA 2BDCA 1WBGB 3MOCA 2BQ6B 3SV2H 5JBCS 1GGDC 3GCTF 4DG4A 3A84A 3V3MA 2XBVA 2P95A 1PQ8A 3P8GA 4X6PA 3MNBA 3A8CA 4X1NU 1LHEH 3BTKE 2ZHQH 1ZSJA 4KTSA 4NZQA 2B0FA 4MPXA 3SNAA 1ZGIA 3MU5A 2G5VA 1FJSA 1TGSZ 2FXRA 2QIQA 3EE0B 3W94A 4XFQA 1C1WH 3MNCA 1G2MA 3FP7E 4IC6A 4ABJA 2R3UA 2Y6TA 2BZ6H 3SU2A 1Y3UA 1YBWA 4NA9H 2P3UB 2ALVA 5K0HA 1CQQA 1D3DB 1G30B 1GJDB 2AMDA 2ZDKA 1D3QB 3RXCA 2A4RA 2RA0A 2BQWB 1C9TA 1Z8RA 2C8YB 1QL7A 3SZNA 3BN9A 1GI9B 3DFJA 4MNYA 1YPLH 3VB7A 1A5IA 3SOSA 4Q7YA 3F9EA 2C8ZB 1TA6A 2D26C 2AFQB 3BTHE 3F9FA 2C8WB 1SLVB 1UK4A 1AZ8A 3UIRA 1B0FA 4K5ZA 2PV9B 2V6NA 2PSYA 1O37A 3GDUA 1A2CH 4MPVA 2STAE 2I6QA 5LPRA 2SGQE 4Q7XA 1CVWH 1DUEA 4UFGH 2Z9KA 2EI6A 1MQ6A 1EJNA 4F4OC 3LIWA 3RMLH 1J17T 1T31A 1TOCB 2SGEE 3OX7U 1C2HA 2CHAC 3ZZ7A 4ZAEA 1GBEA 4XE4A 1XUJA 4NGAH 4AZ2B 4A6LA 4O03A 5JB8S 1F5KU 1V2MT 3UR6A 1AVXA 1B0EA 2RG3A 5CMXH 5DJ7A 1O5GH 5FBIA 4GUXA 3TH2H 4B73A 1FDPA 1FXYA 1GMCG 1GBLA 1K1NA 4YO9A 1Q31A 1TGTA 1W14U 2ZHDA 4MVNA 2Y7XA 3AAUA 1GHYH 2R2WU 2FOCA 1LQDB 5JBAS 3UNQA 1YC0A 1QJ6B 4FVDA 2R0KA 2BDIA 1F2SE 3PV4A 1EP5A 1W7XH 2ZTXA 3MMGA 6GCHG 2A32A 4ABBA 5JPMH 2VIDA 1AN1E 1VJ9U 4K3JA 5DP8A 1ANEA 5A8YA 1AI8H 2BVSH 1NTPA 2V3HH 3GY3A 2AEIH 4NFEA 7KMEH 1QFKH 3ZZDA 1HAVB 4UONA 1ZGVA 4GHQA 1C4V2 2FI5E 2CN0H 3A7XA 4D9RA 3RXKA 1SGNE 2QAAA 3T26A 2BD4A 3EDXB 4FUBA 2ZHFH 2VGCC 3OU0A 5GCHF 2CXVA 5C67A 2A7CA 4I8KA 1S82A 2VVCA 3GCTG 1FY5A 1SGTA 4ZKNU 1DANH 1K1PA 1SBWA 4X6NA 2ZPRA 2W7UA 3RXLA 1C5NH 4Z6AH 1TLDA 3LU9B 1MTNC 1TABE 1NESE 5FX6A 1WUNH 3KCGH 3KIDU 4NIVA 1N8OC 9ESTA 4YTAA 2D2DA 2QGRA 1BBRE 3M7QA 2BY7X 3M7TA 4E7RG 3GY2A 2PTCE 4DJZB 2BHGA 5TJXA 2BY6X 3ZVCA 1O2WA 1ZHRA 4CH8B 1MU8B 1RIWB 5ESBA 4CRFA 1QA7A 1HLTH 2FM2A 4WMEA 3BTME 4XOJA 2AGEX 2GGVB 4ZROA 1GI8B 2HVXA 2FEQH 4MNWA 1NFWA 2A31A 5AFZH 3ATKA 1GI2A 4ABHA 1MQ5A 1MAYA 1SGFA 2H1UA 3Q76A 4FUEA 4GPGA 9LPRA 1Y59T 2VIVA 2KAIA 1BMAA 1K21H 5IYTA 2QN5T 4Y7AA 3BTDE 1THRH 3GY5A 5J4QA 2PLXA 1P2MA 1DSUA 4E05H 3RXAA 1MAXA 2HLCA 5FPYA 1O32A 2SGDE 2WPMS 2CMYA 1BIOA 1O38A 3LGUA 5LGOA 1PYTD 1C5WB 1OWDA 1WQVH 1G9IE 2G4TA 4TWYA 1WOFA 4CREA 3KEEA 1Y5UT 2R9PA 1KIGH 1HAIH 1V2VT 1V2JT 8GCHF 4BAHB 1T4VH 3VEQB 1KLIH 1EXFA 1L0ZA 1OWKA 5C5NA 1GJCB 2ZHWH 1U6QA 3RXOA 1Z8JB 1NU7B 3LGIA 1P2NA 1GI0A 1F0TA 1ABIH 1PQ7A 1TGNA 3BTGE 4YOGA 1MKXK 5BPEA 3SI3H 1G2LA 1EB1H 3E0NB 3LGYA 3E90B 2CF9H 4ABGA 1SGQE 1C5RA 4ABFA 4XSKU 4A1VA 3UR9A 3F9GA 5AVDA 2TPIZ 5L30H 6GCHF 1O2HA 5F6MA 2BVRH 3D23A 2XCFA 2THFB 5C1XA 3DFLA 5EOKA 1P3CA 1CHOF 2W3KA 3Q3YA 1FIZA 1GBTA 1L1JA 4CR9A 4DURA 3P8NA 4CHAC 3T2NA 1GHBG 1ZMNA 4X1RU 3ZYDA 4ABEA 8ESTE 2FOEA 2WYJA 3SUDA 1P09A 3S7HB 1S81A 3A80A 5H4IB 3QZRA 3URDA 1AFEH 1MMJN 4CRDA 1O2ZA 3PMHB 2C90B 1V2ST 2OQUA 1AD8H 2HALA 2VIQA 1IQKA 3ZVDA 1TIOA 3GCHB 1RTKA 2FTMA 1OSSA 2FLBH 1AHTH 2F9PA 1GDQA 1ZRBA 3A8BA 1E37B 1CE5A 2ZIQH 3AW0A 3O8CA 1V3XA 3GCOA 1DY8A 1SR5C 1BMNH 3WY8A 1DXPA 1K22H 1SSXA 1Y3WA 1ZSLA 4UDWH 1W13U 1E35B 4NFFA 1EUFA 1IAUA 1O2XA 3UQOA 4NA8A 1GBBA 2AMPA 2BD7A 1TPOA 3VGCC 3UREA 1ETTH 1V2TT 1ELCA 1KSNA 4OGXA 1VCWA 2R0LA 1THSH 4GHTA 3A8AA 2JH6D 3SJKA 1OP8A 3PMJA 4FUHA 2J9NA 1HAVA 2ZCHP 3Q3XA 2HPPH 1S83A 3D62A 1GL0E 2EI7A 2H5DA 2C3SA 3LKWA 1ZHMA 2PSXA 1CHGA 2GX4A 2XBWA 2Y5FA 1CGHA 3ITIA 3LC5A 3VXFH 1QA0A
chains in the Genus database with same CATH superfamily
3BIUH 1K9OE 1ZTKA 2RA3A 3QGNB 1O3MA 2Q6FA 3CP7A 1YCPK 3TPIZ 4RKJB 1O31A 1H9IE 1SG8B 4MNXA 1UVTH 1YPEH 3QN7A 3ODFA 3Q77A 1GBHA 1HAYB 3RXBA 4ABAA 3S9BA 2Q1JA 1YLNA 2JH0D 1EZUC 1HJ9A 1QGFA 2OC0A 4X2VA 1W0ZU 4I31A 1KYNA 1TGCA 1N6XA 5GNDA 3RXEA 1PPBH 3V12A 1BB0B 3SZEA 1XM1A 1T8NA 2VINA 2BOKA 1UW7A 4H6SB 3V0XA 4BXSA 1UVPA 1LVYA 3KQBA 5C1YA 1XXFA 3BEFB 3RLWH 2K8IA 2Y82A 2G8TA 2BTCE 2ESTE 4U30A 1ESTA 2ZFSA 2J5UA 3QX5H 3UUZA 1QQUA 1FN8A 5E2PA 5GIBA 3LH1A 1VITF 1C1UH 4JYVH 1E1RD 2J95A 4OS1A 1ZPZA 3P6ZB 2FYRA 2TGDA 5AHGH 4I8LA 1ELDE 2Z3DA 3MU0A 4FUCA 2ZQ1A 1JXPA 3UOPA 4YOJA 3QUMP 3SU6A 2B7DH 2ANKH 1FQ3A 1KXEA 4KGAA 1HDTH 3NKKA 2ODQA 1EKBB 1HJ8A 1O3DA 2QF4A 2WPDD 1DT2A 3A85A 5TCCA 1VCQA 2M2AA 1C5QA 4MLFB 2BM2A 2WPKS 1T7CA 1A4WH 2FTLE 1GI7B 4JYUH 1Q2WA 5HIZA 4AN7A 3DSGA 2ZU3A 3F6UH 1O2VA 4D7GA 3NRLA 2A7HA 1EJMA 1UMAH 2ZGCA 3RXDA 3T27A 1JIRA 1WQSA 4NCYA 4NWKA 3MU8A 3MNSA 4JMYA 1L4DA 8KME2 2VWMA 2WZQA 1SGFG 1GJ7B 1OPHB 1HXFH 1UVOA 4Q63A 4WH6A 4X2XA 3EA7A 3AASA 3DHKH 3E16B 4MNVA 4CR5A 3ZZ9A 1EAWA 1MUEB 1P10A 3M5LA 1OYQA 3URCA 4CBNA 5E8EH 3VFEA 1QJ7B 4AC9A 1HGTH 4K1EA 4X6OA 3JZ1B 1P8VC 3Q3KA 1IQEA 1J8AA 2F83A 2F43B 1C5VA 5GPIB 4F48B 1NFXA 4WMFA 3RXHA 2WPLS 1ETRH 1NN6A 1OYTH 2SGFE 4XBDA 1THPB 1JWTA 2BLVA 4UD9H 4WY3A 4BAOB 2CJIA 4WXVA 5C5OA 3PWBA 4ISOA 3KGPA 3ZZBA 2XWAA 2ZDNA 2LNCA 4H4FA 1WV7H 3B23B 1QY6A 1AQ7A 3HATH 2NU3E 3FO8D 1O2PA 4FUGA 5T6FA 2FS9A 7ESTE 3ATMA 4X8UH 3QWCH 4Q4LA 1OXGA 4AB8A 2FOMB 3SHCH 1VR1H 3TIUA 5DO4H 3T29A 1MTVA 1E36B 2TGTA 3GS9A 1TX6A 2DE8A 2J98B 3GISB 2FYQA 1LTOA 1ACBE 2KAIB 1RTLA 2TIOA 1C2DA 4Y11E 2BVXH 1HIAA 1AKSA 4OGYA 1INCA 1KLJH 1K1OA 3SJ9A 2O8UA 4CRBA 2W3IA 4B1TA 5EIYA 1PPGE 4A7IB 4TY6A 2EC9H 1UCYK 1SGPE 4WXIA 1BRAA 2D1JA 4ZUHA 1MKXH 1UTLM 3BV9B 1BMMH 3PYHA 1GVZA 1GHZA 4ISHH 1NS3A 1D6WA 1FPHH 1EASA 3OTJE 1S85A 2WYGA 1O5AB 1UTPA 1C5ZB 2BYAX 3SN8A 3RU4E 1T8MA 2F9NA 2FO9A 1MZAA 1UK3A 1P57B 1K1JA 2R3YA 2BD8A 4YESB 1GG6C 4B71A 2Y5HA 4TT3D 3SUFA 4Y8XA 1EAIA 1O5DH 1TOMH 2XTTB 3FFGA 4I33A 3KQCA 2P59A 2VJ1A 3B8JA 1ELFA 1DICA 1OWEA 1O3HA 1QB1A 3M37A 5EPNA 1LDTT 2WUBA 2BZAA 3BTTE 4IGDA 4A1TA 1H9HE 1O5FH 3FAOA 3OY6U 1OWIA 1DFPA 3A81A 3QO6A 3BG4C 1W0KD 1LPKB 3PO1B 3KQEA 3DUXH 1ETSH 1G3CA 1UHBB 2BMGB 5FPTA 1RFNA 2PGQB 1E34B 3MTYA 4DT4A 2Z9GA 4B2CA 3DCLA 3SI4H 2JETB 1C5LH 1K0HA 5A8XA 3ZZCA 1B5GH 2FDAA 3RC6A 3MU1A 2XC4A 3M35A 3QDZB 1O3LA 5IK2D 1EOJA 1MBMA 4JYTA 1A3BH 1KXFA 3PV5A 3N99A 1TNGA 1FY4A 4CRCA 2Q6DA 2ANWA 1J9CH 1IQLA 2VVUA 2QA9E 4Y7BA 5GDSH 1WTGH 4X6MA 3UY9A 1ESAA 1FLEE 1HJAB 3N7EA 2ZFPH 1ARBA 3SGAE 4YT6H 2AMQA 1ANDA 1DM4B 2BY5X 1DXWA 2QF0A 3PM3A 2OUAA 1NRNH 2KCPA 3PMAB 1BHXB 1C1VH 5F53A 3K9XB 2AHME 4THNH 2K1QA 3GYLB 1MZDA 3NWUA 1P11E 4MDSA 3UAIC 2ZZUH 1W2KH 3MO9A 1MTNB 2BXUH 1O3IA 2FI4E 1FPCH 2ZKSA 2IN2A 2P8OB 4P00A 4X8TH 1GVLA 1QQ4A 1SHYA 3GDVA 2BY9X 3RXPA 2PTNA 4Y79A 3RLYH 1BTWA 2UUJB 1C4U2 3GY6A 1UTNA 5FX5A 3ZVAA 2QF5A 2V3OH 3DD2H 5FHTA 1UHBA 1FV9A 1ZPBA 1DUAA 3IG6B 1O2NA 1HRTH 1EPTB 1BITA 3NCLA 3QTOH 1WTHD 4NA7A 1TALA 4I7YH 1BOQA 2A2XH 1FNIA 1HUTH 1FN6A 3E6PH 2F9BH 2TGPZ 1V2PT 5TCAA 3FANA 3L6PA 1NRSH 3MHWU 1ABJH 2BY8X 4B74A 4HZHA 4AOQA 2QF3A 4WF8A 4JZ1A 2Z94A 1IQMA 3GY4A 5E0GA 1F0UA 2UUFB 1O3AA 3LJOA 1AGJA 1KXAA 2ZU1A 2VIPA 2KCAA 2SNVA 2J4IA 2ZF0H 1NRPH 2EEKA 1GWAA 2HPQH 2XCNA 4U2WA 1BTPA 4IN1A 3HKJB 1UTOA 1C2GA 1SMFE 3FZDA 2L6OA 4B76A 4BOHA 4I8JA 1TB6H 2FOHA 1LPGB 4NSYA 4X1SU 4WVPE 2CK3D 5EJLA 4YZUA 2Z3EA 1YPHE 2BD9A 4PROA 2GZ7A 2OINA 3RXFA 4MQAA 1YPHC 2PFEA 1ORFA 1AIXH 2F3CE 3AAVA 2GMTC 1GI6A 3TNSA 1XKAC 1D3PB 2GMTB 1KDQB 1LHDH 4ZKOU 5CHAB 4DW2U 4ZXXH 3U69H 3BF6H 2V0BA 1YYY1 2VWLA 3CS0A 4Y76A 1FI8A 1QCPA 2NU2E 2AIQA 4ASHA 1M9UA 1QRWA 3E0PB 4WJG2 3V13A 5JBBS 2ZECA 1EFRD 1RJXB 5A2MH 1AFQB 5CHAC 1K2I1 2ZI2H 1BTYA 4H42U 1G32B 2ZWLH 3RUOA 5CHBA 1TWXB 2BDYA 2KR7A 1SGRE 1PJPA 2ZA5A 3ZIAD 2G00A 1O33A 1P03A 1C1PA 1LHFH 2GDDA 5FAHA 1VCPA 5E0HA 2ZNKH 1EOLA 3ESTA 5C20A 5EU8A 2RDLA 3C1KA 2PKSC 1PPCE 5C1UA 3VXEH 3PLKA 1DLEA 1AE8H 1LKBA 2J94A 2AGIX 4ZHMU 6ESTA 3U1IB 2FODA 1P2JA 5FCRA 1QHRB 4FU7A 3SGQE 3UTUH 1XVOA 4LZ1H 2AIPA 1GHVH 1ZPCA 2UUYA 3BG8A 3QGJA 5EW1H 2BDBA 2FOGA 5EXNA 4D7FA 3BTEE 1V2NT 2M5TA 5DP3A 4DVAU 1GBCA 1BTXA 2R2MB 1LKAA 2J38A 3MYWA 3OEHD 1OWJA 4Q2KA 1Y3XA 1SLWB 3W95A 4O9VA 4K69A 1YPGH 3QK1A 4HFPB 3OTPA 1IQHA 1O34A 1GHAF 1AWFH 1COWD 1G3EA 1KY9A 1MCTA 3SV8A 1O3KA 3F0OA 1YWUA 3RU4D 4INLA 3TK5A 3GYMA 3MH5A 1SLXB 5IDKA 3SNDA 3E1XB 1O0DH 1V6DA 3PV2A 2YNAA 1GMDF 1A46H 3D65E 3KHVA 1HV7A 5A0CA 1V2WT 5EG4A 1CBWB 2Q6GA 3BIVH 5F03A 3STIA 1P0SH 3TJNA 4OS2A 4M9FA 5C94A 4AYYB 1O5EH 5LH8A 2VH6A 1AE5A 6CHAC 1GDUA 2PUQH 2F9UA 3GCNA 3KN2A 4HGCA 1X7AC 5LPEA 2B9LA 3S7KB 3LGTA 2HNTC 5DP9A 1YGCH 2SNWA 3H5CB 2HNTF 3M5MA 3SGBE 1P2QA 3NXPA 1DSTA 1NO9H 4RT0A 3UFAA 2PUXB 3TNTA 1Z6EA 3V7TA 1FY1A 1EX3A 1F92A 4UFDH 3RXVA 4AYVB 1YCPM 4NZLA 5GCHG 3M5OA 3RC5A 1C2FA 1NFUA 4ZHAA 1BHXF 1DS2E 1BT7A 5ABWA 1XUIA 2G5NA 1AU8A 2VNTA 3HK3B 3GCHC 1AB9C 4KP0A 3T28A 1PPEE 3OSYA 4UE7H 1TBRH 4LOYH 5ESTE 2ZP0H 4MPWA 3W1EA 4LXBH 3ZVBA 1C4Y2 1NPMA 1UVSH 4KELA 4CRGA 3FN8A 3F3BA 3ZV8A 4XBBA 1AMHA 1Z6JH 3T62A 1C1SA 2O8WA 2ZDAH 2XBXA 5FPSA 3RU4T 3MI4A 1C1QA 3I29A 1XUFA 4WWYA 1C1RA 1LCYA 1ZYOA 1VGCC 4Y0ZE 2DE9A 3OE7D 2V7QD 1HCGA 4I8HA 2V3MA 1MH0A 1XVMA 1YLDA 3MO6A 3U9AH 1HAHH 4BTTB 1IHTH 5HM9A 4FVBA 1GBFA 4TPIZ 1AVWA 4Y8ZA 4DGJA 3F1SB 1BBRH 2A45B 4IW4E 1KTSB 1SGDE 4GLYA 7GCHG 1EP6A 4BTIB 1TAWA 1A0HB 3MWIU 1OP2A 3PLPA 5EODA 4AORA 1VITH 5LPFA 3BTFE 2TGAA 2XXLA 1F7ZA 1LPZB 4MG3A 5EGMA 3ZZ8A 1FIWA 3ZVFA 1G3DA 3UWIA 1C2JA 3FP8E 1TX7A 3PRDA 2OCVB 1C5PA 2ZQ2A 4BAMB 2RCEA 1LMWB 3SU0A 4NSVA 3A88A 1MTWA 1UVUH 1WXRA 1AZZA 2W6JD 3S9AA 1GMDG 2KX4A 1KXDA 4SGAE 2GT7A 3F2HA 4SGBE 1B7XB 5JBTA 1P05A 2AS9A 3GICB 4AB9A 2FPZA 5A0AE 1K1LA 1AUJA 1O30A 2JKHA 4IBLH 4INKA 4JZFH 5DN6D 2FP7B 1K1IA 2UWLA 1GDNA 1TYNA 4X0WU 1E1QD 1SQOA 3MQKC 1CU1A 4ABDA 2A0QB 1FAXA 4FXGH 1K28D 1P06A 2QXGA 1LHGH 1TRNA 1O36A 1HAZB 3M3VA 3L3TA 3SJOA 5B6OA 1F5LA 5EQSA 1HIAB 2ZFRH 1EJAA 1O2IA 1GI4A 2PKAB 3NK8A 2QY0B 4K1SA 2QXIA 3U8RH 2OLGA 3OYPA 1TPSA 2FOAA 1GCDA 2P93A 3P17H 1LVOA 2ZPSA 1SQRA 1UJ1A 3ZVGA 3H09A 4XBCA 2A2QH 4YOIA 1OP0A 4VGCB 2O8MA 1AKSB 1OS8A 1W12U 1RXPA 2ZDLA 2TRMA 1RIWC 1GCTB 3KQDA 2GZ8A 5JDUB 1JRTA 2GCHG 2D8WA 4AFSA 1UCYH 4B75A 2G52A 4ACAA 1C5MD 1JMOH 3LDXH 1QZ8A 2P3TB 1Z7KA 3ZZAA 3IITA 2ZGXH 4JZEH 1ZMLA 2ZC9H 1QBOA 2TBSA 3M36A 3VB4A 4Z0KA 1XX9A 1NU9A 3G01A 2NU1E 5HM2A 2XNDD 5EQRA 2PKSB 1TA2A 2HNTE 4LK4A 4OS4A 2H2ZA 1SPJA 1F0SA 1DLKB 1QBNA 1W0YH 1A0JA 3RXTA 4CH2B 4YXWD 1W3CA 3SJ8A 2A7JA 4RKOB 1KLTA 2ASUB 2QXJA 4KKDA 2A4QA 2CF8H 2BDHA 3RMMH 3TITA 2F91A 1GMHF 3BG4B 3EYDA 1O5BB 2BOHB 5HGGA 4BNRA 2PKAA 2Z9IA 2UUKB 1Z8IB 3I78A 5DP6A 2WV5A 1TE0A 3JZ2B 4BAQB 3KQ5A 1TNHA 1SGIB 2BLOA 3F0PA 1BZXE 1P04A 3N7OA 1A61H 2RFKC 1W8BH 1Y5AT 1CHOG 3F2GA 3MO3A 1P9SA 1V2KT 1D9IA 4X2WA 1XUGA 4JZIA 3M5NA 1SQTA 4CBOA 5EJZA 1D3TB 1K1MA 1KDQA 3BTQE 5E0JA 1ARCA 1AB9B 1BJVA 2GV6A 2HGTH 3QZQA 1S0RA 1O2UA 4ASUD 4XD7D 4D9QA 3LPRA 4DIHH 3PLBA 3P8FA 4GVUA 1W11U 1L1GA 1OWHA 3K65B 4AGKA 1NBME 4YM9A 1MU6B 1P01A 1MD8A 2A4OA 3GDSA 4RSPA 1SHHB 4ZCNA 5HYOA 3A83A 2SGAA 4KTUA 3SW2B 3EA8A 3TVJB 3FVFB 1O3JA 1ZTJA 2ZCLP 2WV4A 5EXMA 1QNJA 1HB0B 1PPHE 1QJ1B 2BXTH 1GVKB 2WHXA 2Y81A 2Z3CA 1C5YB 4ZMAH 7GCHF 5A0BA 3SUGA 3RXUA 1Z1IA 1BMFD 4K60A 2H9TH 1RS0A 5DK1A 2BD3A 1C9PA 4M7GA 4NIYA 3P92A 2JH5D 1YPJH 2FMJA 2Z9LA 2ZTZA 2AH4X 3BSQA 1J14A 3A82A 1C1NA 1GHBF 3TGIE 2FWWA 1O3GA 1O2YA 3LJJA 3UOUA 3PROA 2CGAA 5ETXA 2ALPA 2FX4A 2P16A 4RN6A 1GBDA 4ZXYH 1O3BA 2KZ4A 3B9FH 1SOZA 3OY5U 1FZZA 3TLOA 4YLUA 4GCHF 5JB9S 1ZTLA 3K6YA 2WPJS 4AG1A 4F49A 2GTBA 1J15A 2BD5A 2BLQA 1O2GH 3PTNA 4Y10E 1GPZA 2XNIA 1A5HA 1O2SA 2LPRA 1TGBA 2Y7ZA 5C2ZA 1ELVA 2SGPE 2FESH 1UO6A 2H9EH 4U32A 1J16A 1EQ9A 3RXRA 4ISNA 2GVFA 1Y8TA 1P2KA 1XMNB 2YMSC 4WMDA 1ELBA 3TJOA 2VWNA 1HJAC 2CV3A 4TWWA 1TBZH 1TNKA 1A0LA 1A7SA 1H9LB 2PW8H 3IWMA 1HXEH 3HGNA 2WPHS 5T6DA 1IQJA 1BRCE 3P70B 2GZ9A 3U8TH 1W0JD 2O9QA 2WINI 4RI0A 3TGKE 3TJVA 1D4PB 5T3HA 1UTQA 2ODYB 5G4BA 1DPOA 1DY9A 1FMGA 1C2LA 5EW2H 2OBOA 1VKYA 2HRVA 1YCPH 3QLPH 3A87A 2WPIS 3RC4A 2XC5A 1BJUA 1Y5BT 2LP6A 1HYLA 1RTFB 2PR3A 3P8OA 1ZZZA 1PQ5A 4NWLA 1MCVA 2B8OH 1ZRKA 5DP4A 1P2OA 2Y80A 3TK9A 2BB4A 1DOJA 1CGJE 1GL1A 1MD7A 3LONA 1P2IA 1TRMA 1RD3B 1WAYB 3H7TA 4KTCA 1O2TA 2LELA 1CGIE 1SFIA 2NU4E 1ESBA 5A09A 1O2OA 3DA9B 2VIWA 3PWCA 1BTZA 1GHXH 3RMOH 3ATWA 3KL6A 1O3EA 2WV9A 1BQYA 1YPKH 3ZZ6A 5HKKD 4HG6A 4TYDA 4K2YA 3SHAH 2HOBA 1YKTA 3P95A 1BCUH 1Q3XA 1T4UH 2GJGA 1QRZA 3SV7A 5E2OA 4JK5A 1GJBB 2ANMH 2ZEBA 1YF4A 1HAPH 3MH4A 4P02A 3BEUA 1QL8A 2Z7FE 2PGBB 3SO3A 1UCYE 1GJ9B 3LT3A 2OXSA 1V2OT 2KCYA 3SNBA 3U1JB 1S0QA 2SFAA 8LPRA 1CA0B 1E0FD 1O3FA 1C2IA 3HGPA 1CA0C 2ZFQH 1C5XB 4JCNA 1VJAU 5KGOA 2GT8A 3TH3H 5T6GA 4TY7A 2XWBI 4OS6A 1TMUH 1TNIA 2GCTB 2H5CA 1C1TA 2JIZD 1FONA 1N8OB 3LH3A 1SGYE 1CT2E 4D76A 2ZGBH 1ELGA 5C17A 4FETA 5FBEA 5DP7A 1BBRK 1GJAB 1TPAE 3U8OH 2IJOB 4NIXA 1GBKA 4BANB 2W7SA 1VITG 5SGAE 5C0TA 1NFYA 6LPRA 1C1MA 1O2MA 1H8DH 1NT1A 1GHAG 3HKIB 1SVPA 4AG2A 1SOTA 4FUDA 1A3EH 2JETC 2XRCA 4DT7B 4X1PU 3WWFA 1BTUA 5JYIA 1GJ8B 3U98H 3F2FA 2PHBA 1CO7E 3SV6A 4B6FA 5I46H 3KF2A 3VGCB 1SQAA 4FUJA 3O8RA 3EGKH 1G37A 4X2YA 4B2BA 1GJ5H 1SFQB 2NU0E 5EPYA 1O39A 1KXCA 1UTMA 1W10U 3PO1C 1UK2A 2ZCKP 4GCHG 4IS5A 5DGJA 2ZGHA 1CA8B 5A8ZA 1TMBH 4O97A 1FY8E 1FY3A 1O2QA 5FXLA 4BXWA 4E06H 1HAXB 1OX1A 5CE1A 3LC3A 2A4GA 3NUMA 1S84A 1GBMA 1V2UT 1GI5A 1XXDA 3ODDA 2F9VA 4INHA 5GWZA 1H1BA 1O2RA 3HPTB 2A5AA 3MH6A 1Z8GA 1ELTA 3EA9A 3RXGA 5DSFA 2H6MA 3T5FH 3UNRA 1DDJA 1ZJKA 2O8LA 1F0RA 3SUEA 1TBQH 2VGCB 5FCKA 4IMZA 3NPSA 4YLQH 1TRYA 2OBQA 4OS5A 4U01A 1WYKA 2FZZA 3Q00A 2IOTA 2K0QA 5KEDA 3S69A 1OHHD 2Y5GA 2GKVE 3KYGA 2WUCA 1SLUB 3A7ZA 4ZKSU 1IHSH 4FU9A 2ZDMA 3MNXA 3A7WA 1A5GH 3FOAA 2ZU2A 5HXFA 4UFFH 3SQEE 3CNRA 4GAWA 2FX6A 2YNBA 1N6YA 3OFND 4ISLA 4IC5A 4B2AA 2VIOA 1H8ED 1BTHH 2J97A 4R0IA 1GHWH 1T32A 5DP5A 4J1YA 5DG6A 3NZIA 1C5OH 1MKWH 1DWCH 2FIRH 4ZHLU 5HMAA 1LO6A 3RP2A 4XDEA 1JIMA 3RXIA 1LVMA 2YMSD 4IN2A 1ANBA 3N7DA 2YOLA 5L6NH 2G81E 3R3GB 4GSOA 1PYTC 2PWXA 1AO5A 4I8GA 1DITH 1NY22 1N1LA 2EQNA 1EPTC 2BDAA 5I25A 2IPQX 2ZDVH 2QXHA 1IQIA 3A7VA 3E3TA 4DY7B 1YPMH 4Y0YE 1NZQH 1ZLRA 1YLCA 5L2YH 2ILNA 2H9HA 2AYWA 1O5CB 3VPKA 4JK6A 4R8TB 3T25A 2ZFFH 1ANCA 1QR3E 1C2EA 2JJ1D 3DT0H 3MU4A 2ZGJA 1MABB 3HK6B 2Z6BD 1KTTB 3ATIA 4FU8A 1ZMJA 3A86A 4YT7H 4ABIA 3EAJA 3RMNH 4Y71A 2EI8A 5F8XA 1P12E 1O2KA 1HPGA 2ZG0H 3LOXA 3SNCA 1TMTH 3TU7H 1SC8U 1S5SA 1WSSH 1T8OA 2HLDD 3TH4H 3M7UA 5F8TA 2A5KA 1OKXA 1AUTC 3OAAD 3SU4A 2G55A 2VBCA 1DWBH 3F9HA 2GCTC 2GCHF 2AGGX 1G36A 4MPUA 1UTKA 3F68H 1DWEH 4OS7A 4X8SH 1O3NA 1NRQH 2OC1A 1O3PB 1XUKA 3E91A 4CRAA 1E79D 2O8TA 3ZV9A 1F5RA 1GJ4H 4VGCC 2OP9A 4K8BA 3RXQA 4K8YA 1Y3VA 4I86A 1C5UA 1QB9A 3FZZA 1O3OA 3ELAH 1AFQC 2P94A 3AVZA 4A92A 4DIIH 1GGDB 3UQVA 5L2ZH 2BD2A 2L74A 2BDGA 4MTBA 2UWOA 2GP9B 1O2JA 4AFUA 2XBYA 1P02A 2P8OC 2GD4B 1PPZA 4AGJA 1DWDH 1P3EA 3O8BA 1GCTC 4Y8YA 3SV9A 2HVYB 1S6LA 3RXMA 1EPTA 1RRKA 2OD3B 4D8NA 1QURH 3GY8A 2I6SA 1A1RA 4H6TA 4A1XA 3A7TA 2ZO3H 1FAKH 1IOEA 1OOKB 3SJIA 2OK5A 4TPYA 1ELAA 1DE7H 5GXPA 2ANYA 4JZDH 3UPEA 3CS7A 1Y3YA 1MBQA 1GMHG 1EB2A 5C3NA 2G51A 1CT4E 4DOQA 1IQNA 3SNEA 1RGQA 5GJ4B 2UWPA 2DUCA 4AFZA 4FUFA 3PTBA 1PFXC 4UEHH 1C2KA 4BTUB 4ISIH 3O8DA 4IMQA 4AX9H 2GDEH 2VH0A 5FL7D 2HWLB 1O35A 1SKYE 1LHCH 1QB6A 1SL3A 1ZSKA 2OTVA 5F8ZA 3UWJH 3ZZ5A 3SU5A 1BMLA 2QV1A 3RM0H 2BLWA 2Z9JA 1BDAA 1NC6A 4XRNA 2J2UA 1QBVH 5EQQA 1TNJA 1WCZA 1G3BA 1GBAA 1LQEA 3M61U 1ZR0A 4O3TA 1O3CA 4LZ4B 1V2LT 1FX0B 1QTFA 3A8DA 1L2EA 3BTWE 4I32A 3U28C 1S6HA 1JBUH 1O2LA 1SB1H 2ZTYA 7LPRA 2ULLA 2A1DB 1S6FA 1TONA 1QIXB 2VB0A 2FLRH 2C8XB 4Q7ZA 1HBTH 4O3UA 3TJUA 3R0FA 2EA3A 2XYAA 1VGCB 1C2MA 1ID5H 1T8LA 1YP9A 1XUHA 3CENA 3ZZ4A 1VZQH 5PTPA 3H7OA 2OQ5A 2B5TB 2EY4C 2VVVA 1HNEE 1IQFA 2G4UA 1NROH 2QCYA 1ELEE 4FUIA 2ZU4A 2KM0A 1TQ7B 1D6RA 2STBE 5DPAA 4X1QU 2J34A 3VB5A 1YY3A 3UB0A 1H8IH 1AVGH 1L1NA 1NM6A 2JJ2D 5K7RA 1AWHB 5EXLA 4K1TA 4Q80A 1GI1A 1BA8B 3LGWA 4B6EA 2FOFA 2BQ7B 2ZHEH 1EZSC 3EQ0H 1GG6B 3C27B 5J4SA 2F9OA 3M3SA 1GI3A 4HTCH 3MFJA 1GBIA 3RXSA 3K6ZA 1BRUP 1Z71A 3SU1A 1C1OA 1UTJA 1SI5H 1TFXA 4J2YB 1Z1JA 1QL9A 3E8LA 3BEIB 4UFEH 1HAGE 3S9CA 3L33A 1ZHPA 3MH7A 2FOBA 1SGEE 4DCDA 3RDZA 3PB1E 1HAOH 2BX4A 5BRRE 4CHAB 1ZOMA 1GBJA 3PRBA 1HFDA 1EAUA 4BAKB 3ENSB 1DX5M 2FS8A 3SU3A 3I77A 1W7GH 1IQGA 4WH8A 3RXJA 2QYIA 2W5EA 1TPPA 1MTUA 3TK6A 2ZPQA 3ZYEA 3ZZ3A 4ZKRU 1L4ZA 1KXBA 1BUIA 1FUJA 1TNLA 3KYFA 4NG9H 3STJA 3SYJA 2OC7A 3RM2H 3AK5A 2V35A 1EAXA 2F4LA 3UNSA 1LVBA 3LGVA 3PMBB 2ZFTA 4ESTE 4ZH8A 1JRSA 1PPFE 2ZU5A 2C93B 2A5IA 3SBKA 3SORA 1ZJDA 2GV7A 3GOVB 1JOUB 2FI3E 4TSFD 2CHAB 4Y6DA 2KFWA 2XW9A 1MKWK 1GMCF 3AW1A 3S0NA 5DKMA 2VU8E 4FOUC 2IPHA 1EATA 1CT0E 1E38B 1YM0A 2QC2A 3A89A 3ZVEA 1AY6H 3FP6E 1EZXC 3WW7A 1XKBC 3M3TA 3KNXA 1CSOE 1P9UA 4HI3A 6CHAB 1EZQA 5AFYH 2VWOA 1BRBE 3SQHE 4A5TS 1TX8A 3K2UA 3ATLA 4AFQA 1DVAH 2P3FH 1KMHB 1CBWC 3VB3A 2C4FH 1C5TA 1H8HD 2NWNA 1QRXA 3D49H 2AERH 2BX3A 3GY7A 1V2QT 1H4WA 1NRRH 2XC0A 1WU1A 3VG8A 1TQ0B 1SGCA 2J92A 2OC8A 2ODPA 3QTVH 2W26A 4NIWA 5AF9H 8GCHG 3TGJE 4QT8C 1C5SA 4E7NA 4X8VH 3VB6A 1GJ6A 1MTSA 3A7YA 1V2RT 1PQAA 2BDCA 1WBGB 3MOCA 2BQ6B 3SV2H 5JBCS 1GGDC 3GCTF 4DG4A 3A84A 3V3MA 2XBVA 2P95A 1PQ8A 3P8GA 4X6PA 3MNBA 3A8CA 4X1NU 1LHEH 2RDEA 3BTKE 2ZHQH 1ZSJA 4KTSA 5T1VA 4NZQA 2B0FA 2YMSB 4MPXA 3SNAA 1ZGIA 3MU5A 2G5VA 1FJSA 1TGSZ 2FXRA 2QIQA 3EE0B 3W94A 4XFQA 1C1WH 3MNCA 1G2MA 3FP7E 4IC6A 4ABJA 2R3UA 2Y6TA 2BZ6H 3SU2A 1Y3UA 1YBWA 4NA9H 2P3UB 2ALVA 5K0HA 1CQQA 1D3DB 1G30B 1GJDB 2AMDA 2ZDKA 1D3QB 3RXCA 2A4RA 2RA0A 2BQWB 1C9TA 1Z8RA 2C8YB 1QL7A 3SZNA 3BN9A 1GI9B 3DFJA 4MNYA 1YPLH 3VB7A 1A5IA 3SOSA 4Q7YA 3F9EA 2C8ZB 1TA6A 2D26C 2AFQB 3BTHE 3F9FA 2C8WB 1SLVB 1UK4A 1AZ8A 3UIRA 1B0FA 4K5ZA 2PV9B 2V6NA 2PSYA 1O37A 3GDUA 1A2CH 4MPVA 2STAE 2I6QA 5LPRA 2SGQE 4Q7XA 1CVWH 1DUEA 4UFGH 2Z9KA 2EI6A 1MQ6A 1EJNA 4F4OC 3LIWA 2W6ID 3RMLH 1J17T 1T31A 1TOCB 2SGEE 3OX7U 1C2HA 2CHAC 3ZZ7A 4ZAEA 1GBEA 4XE4A 1XUJA 4NGAH 4AZ2B 4A6LA 4O03A 5JB8S 1F5KU 1V2MT 3UR6A 1AVXA 1B0EA 2RG3A 5CMXH 5DJ7A 2JDID 1O5GH 3DSOA 5FBIA 4GUXA 3TH2H 4B73A 5C0UA 1FDPA 1FXYA 1GMCG 1GBLA 1K1NA 1NBMD 4YO9A 1Q31A 1TGTA 1W14U 2ZHDA 4MVNA 2Y7XA 3AAUA 5HIYA 1GHYH 2R2WU 2FOCA 1LQDB 5JBAS 3UNQA 1YC0A 1QJ6B 4FVDA 2R0KA 2BDIA 1F2SE 3PV4A 1EP5A 1W7XH 2ZTXA 3MMGA 6GCHG 2A32A 4ABBA 5JPMH 2VIDA 1AN1E 1VJ9U 4K3JA 5DP8A 1ANEA 5A8YA 1AI8H 2BVSH 1NTPA 2V3HH 3GY3A 2AEIH 4NFEA 7KMEH 1QFKH 3ZZDA 3EE7A 1HAVB 5EJ1A 4UONA 1ZGVA 2WSSD 4GHQA 1C4V2 2FI5E 2CN0H 3A7XA 4D9RA 3RXKA 1SGNE 2QAAA 3T26A 2BD4A 3EDXB 4FUBA 2ZHFH 2VGCC 3OU0A 5GCHF 2CXVA 5C67A 2A7CA 4I8KA 1S82A 2VVCA 3GCTG 1FY5A 1SGTA 4ZKNU 1DANH 1K1PA 4ACBA 1SBWA 4X6NA 2ZPRA 2W7UA 3RXLA 1C5NH 4Z6AH 1TLDA 3LU9B 1MTNC 1TABE 1NESE 5FX6A 1WUNH 3KCGH 3KIDU 4NIVA 1N8OC 9ESTA 4YTAA 2D2DA 2QGRA 1BBRE 3M7QA 2BY7X 3M7TA 4E7RG 3GY2A 2PTCE 4OM9A 3DSPA 4DJZB 2BHGA 1WDIA 5TJXA 2BY6X 3ZVCA 5B6LA 1O2WA 1ZHRA 4CH8B 1MU8B 1RIWB 5ESBA 4CRFA 1QA7A 1HLTH 2FM2A 4WMEA 3BTME 2XOKD 4XOJA 2AGEX 2GGVB 4ZROA 1GI8B 2HVXA 2FEQH 4MNWA 1NFWA 2A31A 5AFZH 3ATKA 1GI2A 4ABHA 1MQ5A 1MAYA 1SGFA 2H1UA 3Q76A 4FUEA 4GPGA 9LPRA 1Y59T 2VIVA 2KAIA 1BMAA 1K21H 5IYTA 2QN5T 4Y7AA 3BTDE 1THRH 3GY5A 5J4QA 2PLXA 1P2MA 1DSUA 4E05H 3RXAA 1MAXA 2HLCA 5FPYA 1O32A 2SGDE 2WPMS 5CDFE 2CMYA 1BIOA 1O38A 4RT1A 3LGUA 5LGOA 1PYTD 1C5WB 1OWDA 1WQVH 1G9IE 2G4TA 4TWYA 1WOFA 4CREA 3KEEA 1Y5UT 2R9PA 1KIGH 1HAIH 1V2VT 1V2JT 8GCHF 4BAHB 1T4VH 3VEQB 1KLIH 1EXFA 1L0ZA 3FKSD 1OWKA 2KCOA 2J98A 5C5NA 3WWBA 1GJCB 2ZHWH 1U6QA 3RXOA 1Z8JB 1NU7B 3LGIA 1P2NA 1GI0A 1F0TA 1ABIH 1PQ7A 1TGNA 3BTGE 4YOGA 1MKXK 5BPEA 3SI3H 1G2LA 1EB1H 3E0NB 3LGYA 3E90B 2CF9H 4ABGA 1SGQE 1C5RA 4ABFA 4XSKU 2IJD1 4A1VA 3UR9A 3F9GA 5AVDA 2TPIZ 5L30H 6GCHF 1O2HA 5F6MA 2BVRH 3D23A 2XCFA 2THFB 5C1XA 3DFLA 5EOKA 1P3CA 1CHOF 2W3KA 3Q3YA 1FIZA 1GBTA 4F55A 1L1JA 4CR9A 4DURA 3P8NA 4CHAC 3T2NA 1GHBG 1ZMNA 4X1RU 3ZYDA 4ABEA 8ESTE 2FOEA 2WYJA 3SUDA 1P09A 3S7HB 2PP6A 1S81A 3A80A 5H4IB 3QZRA 3URDA 1AFEH 1MMJN 4CRDA 1O2ZA 3PMHB 2C90B 1V2ST 2OQUA 1AD8H 2HALA 2VIQA 1IQKA 3ZVDA 1TIOA 3GCHB 1RTKA 2FTMA 3OEED 1OSSA 2FLBH 1AHTH 2F9PA 1GDQA 1ZRBA 3A8BA 1E37B 1CE5A 2ZIQH 3AW0A 3O8CA 5KECA 1V3XA 3GCOA 1DY8A 1SR5C 1BMNH 3WY8A 1DXPA 1K22H 1SSXA 1Y3WA 1ZSLA 4UDWH 1W13U 1E35B 4NFFA 1EUFA 1IAUA 1O2XA 3UQOA 4NA8A 1GBBA 2AMPA 2BD7A 1TPOA 3VGCC 3UREA 1ETTH 1V2TT 1ELCA 1KSNA 4OGXA 1VCWA 2R0LA 1THSH 4GHTA 3A8AA 2JH6D 3SJKA 1OP8A 3PMJA 4FUHA 2J9NA 1HAVA 2ZCHP 4Z1MD 3Q3XA 2HPPH 1S83A 3D62A 1GL0E 2EI7A 2H5DA 2C3SA 3LKWA 1ZHMA 2PSXA 1CHGA 2GX4A 2XBWA 2Y5FA 1CGHA 3ITIA 3LC5A 3VXFH 2QE7D 1QA0A
chains in the Genus database with same CATH topology
3BIUH 1K9OE 1ZTKA 2RA3A 3QGNB 1O3MA 2Q6FA 3CP7A 1YCPK 3TPIZ 4RKJB 1O31A 1H9IE 1SG8B 4MNXA 1UVTH 1YPEH 3QN7A 3ODFA 3Q77A 1GBHA 1HAYB 3RXBA 4ABAA 3S9BA 2Q1JA 2JH0D 1EZUC 1HJ9A 1QGFA 2OC0A 4X2VA 1W0ZU 4I31A 1KYNA 1TGCA 1N6XA 3RXEA 1PPBH 3V12A 1BB0B 1XM1A 1T8NA 2VINA 2BOKA 4H6SB 3V0XA 4BXSA 1UVPA 1LVYA 3KQBA 5C1YA 1XXFA 3BEFB 3RLWH 2Y82A 2G8TA 2BTCE 2ESTE 4U30A 1ESTA 2ZFSA 3QX5H 3UUZA 1QQUA 1FN8A 5E2PA 5GIBA 3LH1A 1VITF 1C1UH 4JYVH 2J95A 4OS1A 1ZPZA 3P6ZB 2FYRA 2TGDA 5AHGH 4I8LA 1ELDE 2Z3DA 3MU0A 4FUCA 2ZQ1A 1JXPA 3UOPA 4YOJA 3QUMP 3SU6A 2B7DH 2ANKH 1FQ3A 1KXEA 4KGAA 1HDTH 3NKKA 2ODQA 1EKBB 1HJ8A 1O3DA 1DT2A 3A85A 5TCCA 1VCQA 1C5QA 4MLFB 2BM2A 2WPKS 1T7CA 1A4WH 2FTLE 1GI7B 4JYUH 1Q2WA 4AN7A 2ZU3A 3F6UH 1O2VA 4D7GA 2A7HA 1EJMA 1UMAH 2ZGCA 3RXDA 3T27A 1JIRA 1WQSA 4NCYA 4NWKA 3MU8A 3MNSA 4JMYA 1L4DA 8KME2 2VWMA 1SGFG 1GJ7B 1OPHB 1HXFH 1UVOA 4WH6A 4X2XA 3EA7A 3AASA 3DHKH 3E16B 4MNVA 4CR5A 3ZZ9A 1EAWA 1MUEB 1P10A 3M5LA 1OYQA 3URCA 4CBNA 5E8EH 3VFEA 1QJ7B 1HGTH 4K1EA 4X6OA 3JZ1B 1P8VC 3Q3KA 1IQEA 1J8AA 2F83A 1C5VA 5GPIB 1NFXA 4WMFA 3RXHA 2WPLS 1ETRH 1NN6A 1OYTH 2SGFE 4XBDA 1THPB 1JWTA 2BLVA 4UD9H 4WY3A 4BAOB 2CJIA 4WXVA 5C5OA 3PWBA 4ISOA 3KGPA 3ZZBA 2XWAA 2ZDNA 2LNCA 4H4FA 1WV7H 3B23B 1QY6A 1AQ7A 3HATH 2NU3E 1O2PA 4FUGA 5T6FA 2FS9A 7ESTE 3ATMA 4X8UH 3QWCH 1OXGA 4AB8A 2FOMB 3SHCH 1VR1H 3TIUA 5DO4H 3T29A 1MTVA 1E36B 2TGTA 1TX6A 2DE8A 3GISB 2FYQA 1LTOA 1ACBE 2KAIB 1RTLA 2TIOA 1C2DA 4Y11E 2BVXH 1HIAA 1AKSA 4OGYA 1INCA 1KLJH 1K1OA 3SJ9A 2O8UA 4CRBA 2W3IA 4B1TA 1PPGE 4A7IB 4TY6A 2EC9H 1UCYK 1SGPE 4WXIA 1BRAA 2D1JA 4ZUHA 1MKXH 1UTLM 3BV9B 1BMMH 3PYHA 1GVZA 1GHZA 4ISHH 1NS3A 1D6WA 1FPHH 1EASA 3OTJE 2WYGA 1S85A 1O5AB 1UTPA 1C5ZB 2BYAX 3SN8A 3RU4E 1T8MA 2F9NA 2FO9A 1MZAA 1UK3A 1P57B 1K1JA 2R3YA 2BD8A 4YESB 1GG6C 4B71A 2Y5HA 3SUFA 4Y8XA 1EAIA 1O5DH 1TOMH 2XTTB 3FFGA 4I33A 3KQCA 2P59A 2VJ1A 3B8JA 1ELFA 1DICA 1OWEA 1O3HA 1QB1A 3M37A 5EPNA 1LDTT 2WUBA 2BZAA 3BTTE 4IGDA 4A1TA 1H9HE 1O5FH 3FAOA 3OY6U 1OWIA 1DFPA 3A81A 3QO6A 3BG4C 1LPKB 3PO1B 3KQEA 3DUXH 1ETSH 1G3CA 1UHBB 2BMGB 5FPTA 1RFNA 2PGQB 1E34B 3MTYA 2Z9GA 4B2CA 3SI4H 2JETB 1C5LH 5A8XA 3ZZCA 1B5GH 2FDAA 3RC6A 3MU1A 2XC4A 3M35A 3QDZB 1O3LA 1EOJA 1MBMA 4JYTA 1A3BH 1KXFA 1TNGA 1FY4A 4CRCA 2Q6DA 2ANWA 1J9CH 1IQLA 2VVUA 2QA9E 4Y7BA 5GDSH 1WTGH 4X6MA 3UY9A 1ESAA 1FLEE 1HJAB 2ZFPH 1ARBA 3SGAE 4YT6H 2AMQA 1ANDA 1DM4B 2BY5X 1DXWA 2QF0A 3PM3A 2OUAA 1NRNH 3PMAB 1BHXB 1C1VH 3K9XB 4THNH 2K1QA 3GYLB 1MZDA 3NWUA 1P11E 4MDSA 2ZZUH 1W2KH 3MO9A 1MTNB 2BXUH 1O3IA 2FI4E 1FPCH 2ZKSA 2IN2A 2P8OB 4X8TH 1GVLA 1QQ4A 1SHYA 3GDVA 2BY9X 3RXPA 2PTNA 4Y79A 3RLYH 1BTWA 2UUJB 1C4U2 3GY6A 1UTNA 5FX5A 3ZVAA 2V3OH 3DD2H 5FHTA 1UHBA 1FV9A 1ZPBA 1DUAA 3IG6B 1O2NA 1HRTH 1EPTB 1BITA 3NCLA 3QTOH 1WTHD 4NA7A 1TALA 4I7YH 1BOQA 2A2XH 1FNIA 1HUTH 1FN6A 3E6PH 2F9BH 2TGPZ 1V2PT 5TCAA 3FANA 3L6PA 1NRSH 3MHWU 1ABJH 2BY8X 4B74A 4HZHA 4AOQA 2QF3A 4WF8A 4JZ1A 2Z94A 1IQMA 3GY4A 5E0GA 1F0UA 2UUFB 1O3AA 3LJOA 1AGJA 1KXAA 2ZU1A 2VIPA 2SNVA 2J4IA 2ZF0H 1NRPH 2EEKA 1GWAA 2HPQH 2XCNA 4U2WA 1BTPA 4IN1A 3HKJB 1UTOA 1C2GA 1SMFE 3FZDA 4B76A 4BOHA 4I8JA 1TB6H 2FOHA 1LPGB 4NSYA 4X1SU 4WVPE 4YZUA 2Z3EA 1YPHE 2BD9A 4PROA 2GZ7A 2OINA 3RXFA 4MQAA 1YPHC 2PFEA 1ORFA 1AIXH 2F3CE 3AAVA 2GMTC 1GI6A 3TNSA 1XKAC 1D3PB 2GMTB 1KDQB 1LHDH 4ZKOU 5CHAB 4DW2U 4ZXXH 3U69H 3BF6H 2V0BA 1YYY1 2VWLA 3CS0A 4Y76A 1FI8A 1QCPA 2NU2E 2AIQA 4ASHA 1M9UA 1QRWA 3E0PB 4WJG2 3V13A 5JBBS 2ZECA 1RJXB 5A2MH 1AFQB 5CHAC 1K2I1 2ZI2H 1BTYA 4H42U 1G32B 2ZWLH 3RUOA 1TWXB 2BDYA 2ZA5A 1SGRE 1PJPA 2G00A 1O33A 1P03A 1C1PA 1LHFH 2GDDA 5FAHA 1VCPA 5E0HA 2ZNKH 1EOLA 3ESTA 5C20A 5EU8A 2RDLA 3C1KA 2PKSC 1PPCE 5C1UA 3VXEH 3PLKA 1DLEA 1AE8H 1LKBA 2J94A 2AGIX 4ZHMU 6ESTA 3U1IB 2FODA 1P2JA 5FCRA 1QHRB 4FU7A 3SGQE 3UTUH 1XVOA 4LZ1H 2AIPA 1GHVH 1ZPCA 2UUYA 3BG8A 3QGJA 5EW1H 2BDBA 2FOGA 5EXNA 4D7FA 3BTEE 1V2NT 2M5TA 5DP3A 4DVAU 1GBCA 1BTXA 2R2MB 1LKAA 2J38A 3MYWA 1OWJA 4Q2KA 1Y3XA 1SLWB 3W95A 4O9VA 4K69A 1YPGH 3QK1A 4HFPB 1IQHA 1O34A 1GHAF 1AWFH 1G3EA 1KY9A 1MCTA 3SV8A 1O3KA 3RU4D 4INLA 3TK5A 3GYMA 3MH5A 1SLXB 5IDKA 3SNDA 3E1XB 1O0DH 1V6DA 2YNAA 1GMDF 1A46H 3D65E 3KHVA 1HV7A 5A0CA 1V2WT 5EG4A 1CBWB 2Q6GA 3BIVH 5F03A 3STIA 1P0SH 3TJNA 4OS2A 4AYYB 1O5EH 5LH8A 2VH6A 1AE5A 6CHAC 1GDUA 2PUQH 2F9UA 3GCNA 3KN2A 4HGCA 1X7AC 5LPEA 2B9LA 3S7KB 3LGTA 2HNTC 5DP9A 1YGCH 2SNWA 3H5CB 2HNTF 3M5MA 3SGBE 1P2QA 3NXPA 1DSTA 1NO9H 3UFAA 2PUXB 3TNTA 1Z6EA 3V7TA 1FY1A 1EX3A 1F92A 4UFDH 3RXVA 4AYVB 1YCPM 4NZLA 5GCHG 3M5OA 3RC5A 1C2FA 1NFUA 4ZHAA 1BHXF 1DS2E 1BT7A 5ABWA 1XUIA 2G5NA 1AU8A 2VNTA 3HK3B 3GCHC 1AB9C 4KP0A 3T28A 1PPEE 3OSYA 4UE7H 1TBRH 4LOYH 5ESTE 2ZP0H 4MPWA 3ZVBA 4LXBH 4CRGA 1C4Y2 1NPMA 1UVSH 4KELA 3ZV8A 4XBBA 1AMHA 1Z6JH 3T62A 1C1SA 2O8WA 2ZDAH 2XBXA 5FPSA 3RU4T 3MI4A 1C1QA 3I29A 1XUFA 4WWYA 1C1RA 1LCYA 1ZYOA 1VGCC 4Y0ZE 2DE9A 1HCGA 4I8HA 1MH0A 1XVMA 1YLDA 3MO6A 3U9AH 1HAHH 4BTTB 1IHTH 5HM9A 4FVBA 1GBFA 4TPIZ 1AVWA 4Y8ZA 4DGJA 3F1SB 1BBRH 2A45B 4IW4E 1KTSB 1SGDE 4GLYA 7GCHG 1EP6A 4BTIB 1TAWA 1A0HB 3MWIU 1OP2A 3PLPA 5EODA 4AORA 1VITH 5LPFA 3BTFE 2TGAA 2XXLA 1F7ZA 1LPZB 4MG3A 5EGMA 3ZZ8A 1FIWA 3ZVFA 1G3DA 3UWIA 1C2JA 3FP8E 1TX7A 2OCVB 1C5PA 2ZQ2A 4BAMB 2RCEA 1LMWB 3SU0A 4NSVA 3A88A 1MTWA 1UVUH 1AZZA 3S9AA 1GMDG 1KXDA 4SGAE 2GT7A 4SGBE 1B7XB 5JBTA 1P05A 2AS9A 3GICB 4AB9A 2FPZA 5A0AE 1K1LA 1AUJA 1O30A 2JKHA 4IBLH 4INKA 4JZFH 2FP7B 1K1IA 2UWLA 1GDNA 1TYNA 4X0WU 1SQOA 1CU1A 4ABDA 2A0QB 1FAXA 4FXGH 1K28D 1P06A 2QXGA 1LHGH 1TRNA 1O36A 1HAZB 3M3VA 3L3TA 3SJOA 5B6OA 1F5LA 5EQSA 1HIAB 2ZFRH 1EJAA 1O2IA 1GI4A 2PKAB 3NK8A 2QY0B 4K1SA 2QXIA 3U8RH 2OLGA 3OYPA 1TPSA 2FOAA 1GCDA 2P93A 3P17H 1LVOA 2ZPSA 1UJ1A 3ZVGA 4XBCA 2A2QH 4YOIA 1OP0A 4VGCB 2O8MA 1AKSB 1OS8A 1W12U 1RXPA 2ZDLA 2TRMA 1RIWC 1GCTB 3KQDA 2GZ8A 5JDUB 1JRTA 2GCHG 2D8WA 4AFSA 1UCYH 4B75A 2G52A 1C5MD 1JMOH 3LDXH 2P3TB 1Z7KA 3ZZAA 3IITA 2ZGXH 4JZEH 1ZMLA 2ZC9H 1QBOA 2TBSA 3M36A 3VB4A 4Z0KA 1XX9A 1NU9A 3G01A 2NU1E 5HM2A 5EQRA 2PKSB 1TA2A 2HNTE 4LK4A 4OS4A 2H2ZA 1SPJA 1F0SA 1DLKB 1QBNA 1W0YH 1A0JA 3RXTA 4CH2B 1W3CA 3SJ8A 2A7JA 4RKOB 1KLTA 2ASUB 2QXJA 4KKDA 2A4QA 2CF8H 2BDHA 3RMMH 3TITA 2F91A 1GMHF 3BG4B 3EYDA 1O5BB 2BOHB 5HGGA 4BNRA 2PKAA 2Z9IA 2UUKB 1Z8IB 3I78A 5DP6A 2WV5A 1TE0A 3JZ2B 4BAQB 1TNHA 1SGIB 2BLOA 1BZXE 1P04A 3N7OA 1A61H 1W8BH 1Y5AT 1CHOG 3MO3A 1P9SA 1V2KT 1D9IA 4X2WA 1XUGA 4JZIA 3M5NA 1SQTA 4CBOA 1D3TB 1K1MA 1KDQA 3BTQE 5E0JA 1ARCA 1AB9B 1BJVA 2GV6A 2HGTH 3QZQA 1S0RA 1O2UA 4D9QA 4DIHH 3LPRA 3PLBA 3P8FA 4GVUA 1W11U 1L1GA 1OWHA 3K65B 4AGKA 4YM9A 1MU6B 1P01A 1MD8A 2A4OA 3GDSA 4RSPA 1SHHB 5HYOA 3A83A 2SGAA 4KTUA 3SW2B 3EA8A 3TVJB 3FVFB 1O3JA 1ZTJA 2ZCLP 2WV4A 5EXMA 1QNJA 1HB0B 1PPHE 1QJ1B 2BXTH 1GVKB 2Y81A 2Z3CA 1C5YB 4ZMAH 7GCHF 5A0BA 3SUGA 3RXUA 1Z1IA 4K60A 2H9TH 1RS0A 5DK1A 2BD3A 1C9PA 4M7GA 4NIYA 3P92A 2JH5D 1YPJH 2FMJA 2Z9LA 2ZTZA 2AH4X 3BSQA 1J14A 3A82A 1C1NA 1GHBF 3TGIE 2FWWA 1O3GA 1O2YA 3LJJA 3UOUA 3PROA 2CGAA 5ETXA 2ALPA 2FX4A 2P16A 4RN6A 1GBDA 4ZXYH 1O3BA 3B9FH 1SOZA 3OY5U 1FZZA 3TLOA 4YLUA 4GCHF 5JB9S 1ZTLA 3K6YA 2WPJS 4AG1A 4F49A 2GTBA 1J15A 2BD5A 2BLQA 1O2GH 3PTNA 4Y10E 1GPZA 2XNIA 1A5HA 1O2SA 2LPRA 1TGBA 2Y7ZA 5C2ZA 1ELVA 2SGPE 2FESH 1UO6A 2H9EH 4U32A 1J16A 1EQ9A 3RXRA 4ISNA 2GVFA 1Y8TA 1P2KA 1XMNB 4WMDA 1ELBA 3TJOA 2VWNA 1HJAC 2CV3A 4TWWA 1TBZH 1TNKA 1A0LA 1A7SA 1H9LB 2PW8H 3IWMA 1HXEH 3HGNA 2WPHS 5T6DA 1IQJA 1BRCE 3P70B 2GZ9A 3U8TH 2O9QA 2WINI 3TGKE 3TJVA 1D4PB 5T3HA 1UTQA 2ODYB 5G4BA 1DPOA 1DY9A 1FMGA 1C2LA 5EW2H 2OBOA 2HRVA 1YCPH 3QLPH 3A87A 2WPIS 3RC4A 2XC5A 1BJUA 1Y5BT 1HYLA 1RTFB 2PR3A 3P8OA 1ZZZA 1PQ5A 4NWLA 1MCVA 2B8OH 1ZRKA 5DP4A 1P2OA 2Y80A 3TK9A 2BB4A 1DOJA 1CGJE 1GL1A 1MD7A 3LONA 1P2IA 1TRMA 1RD3B 1WAYB 3H7TA 4KTCA 1O2TA 1CGIE 1SFIA 2NU4E 1ESBA 5A09A 1O2OA 3DA9B 2VIWA 3PWCA 1BTZA 1GHXH 3RMOH 3ATWA 3KL6A 1O3EA 1BQYA 1YPKH 3ZZ6A 4TYDA 4K2YA 3SHAH 2HOBA 1YKTA 3P95A 1BCUH 1Q3XA 1T4UH 1QRZA 3SV7A 5E2OA 4JK5A