5C94A

Infectious bronchitis virus nsp9
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
116
structure length
116
Chain Sequence
GPLGSNNELMPHGVKTKACVAGVDQAHCSVESKCYYTSISGSSVVAAITSSNPNLKVASFLNEAGNQIYVDLDPPCKFGMKVGDKVEVVYLYFIKNTRSIVRGMVLGAISNVVVLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-structural protein 9
publication title Crystal structure of nsp9 from infectious bronchitis virus (IBV) at 2.44 Angstroms resolution
rcsb
source organism Avian infectious bronchitis virus
molecule tags Hydrolase
total genus 22
structure length 116
sequence length 116
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08710 nsp9 nsp9 replicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.250 Mainly Beta Beta Barrel Thrombin, subunit H Replicase NSP9 5c94A00
3EE7A 1UW7A 1QZ8A 2J97A 5HIZA 5HIYA 5C94A 2J98A 2J98B
chains in the Genus database with same CATH superfamily
1ZYOA 1LHEH 4NZLA 1S85A 4H6TA 2P8OC 4TWYA 1MU8B 2YMSC 2ZA5A 2ULLA 1MTUA 1UVSH 2FO9A 3ZZ4A 4Y6DA 3SORA 3VB7A 1L4DA 2PV9B 4Q7XA 5JPMH 3RXHA 1VR1H 2HNTC 2WUBA 5JBBS 1RGQA 3RLYH 2PGQB 3OE7D 2CXVA 2FIRH 1O3LA 4SGAE 1O3PB 4PROA 3ZZ8A 4GUXA 1PPFE 3GCTF 7ESTE 5EODA 4CRAA 1QCPA 2W26A 4D8NA 3RU4D 3BG4C 1QNJA 4DW2U 2AGIX 1P2IA 2A31A 2NU3E 4RN6A 2KAIA 2PSYA 1WSSH 4ZKRU 3FOAA 2XTTB 2ZHQH 1C1OA 3ATWA 1T7CA 1Y3YA 2WYGA 1HB0B 2OBQA 5DP4A 1LPZB 1SGDE 3HGPA 3SV9A 5C0UA 3MHWU 3LDXH 3TNSA 1MAYA 1B0FA 5I46H 2XBXA 2CF8H 1GHYH 3FFGA 4D7GA 3ZIAD 1ZSKA 1P3CA 4Q4LA 4Y10E 1YPKH 1FAXA 3MI4A 3U1JB 1KXEA 2ILNA 2JH5D 2NU1E 3MNCA 2J5UA 3E16B 4NCYA 1O5FH 3WY8A 1D4PB 2PKAB 5A0BA 5DK1A 4K3JA 1VCPA 2HRVA 4ABFA 3M3TA 2Z9GA 2ANWA 1G3BA 3LH1A 1GJAB 1SLXB 4B75A 1HJAC 1HCGA 4OS2A 3SU5A 1EB1H 3F2GA 1KTTB 1UHBA 5C3NA 2BDBA 1UTKA 1V2NT 1XUIA 1Y3VA 5EQRA 5EXMA 1N1LA 2BDAA 2VIQA 2P16A 3V3MA 2DE8A 2J2UA 2B0FA 2B7DH 1SQRA 5FHTA 1P01A 5DO4H 4E7RG 2GCHG 2AYWA 1ACBE 4MQAA 5C2ZA 4LOYH 5CE1A 2A5IA 2ZG0H 4DT4A 5EQQA 1GCTB 1PQ7A 2F9PA 1QZ8A 5TJXA 3DSPA 1NT1A 1RIWC 3RDZA 4XBBA 4X6PA 2WV5A 4X1QU 3GICB 2F9NA 1V2MT 1SI5H 2BQ7B 2I6SA 2J92A 5CHAC 3SNEA 1OWDA 3BEIB 2VH6A 4MPUA 2BD7A 2FX4A 2JKHA 4X2WA 1GBIA 5HYOA 3RXAA 1ZOMA 4X1PU 2W7SA 5HM9A 2PTNA 2P93A 3TLOA 2ZQ1A 2ANKH 2HNTF 1TABE 1O2RA 1GHXH 3SHCH 3MU0A 2PW8H 1G2LA 1ELCA 2BD8A 1Z8GA 1NZQH 2D26C 3UOPA 4YOGA 2Z9KA 1ZHRA 2ZIQH 3A89A 3ATLA 2QAAA 1NPMA 2ZZUH 1WV7H 4AYYB 1GCTC 1O3JA 4K8YA 4ISHH 1E36B 1A5HA 1EAIA 5DN6D 2OBOA 4CRBA 1Y59T 1P0SH 1C5QA 2VVCA 2ZPRA 3SV6A 1JBUH 1C5ZB 1AE8H 1BTYA 2FI4E 3QTVH 1BTZA 4Y11E 1MUEB 3KN2A 2EI7A 1NFUA 5EU8A 2BLQA 2GGVB 2F9UA 1PPCE 1KXFA 3F9GA 1ETRH 4Y8XA 4BAHB 4YM9A 3UAIC 1DLEA 1F0UA 3H7TA 3RC6A 2TGDA 1C5LH 1FNIA 1ZMJA 2Y7XA 2ODQA 3O8BA 4FETA 4B1TA 1HIAB 2O8LA 1NRPH 2WPLS 1COWD 1P12E 3SU3A 2ZU1A 3KQBA 1YLNA 1SLVB 5AFYH 1H8DH 1O2MA 2KX4A 1AB9C 1RTLA 1SLWB 2QCYA 4E05H 3HATH 1SVPA 4Z6AH 5I25A 1V2WT 1NESE 2GMTB 1MCTA 4JZEH 2H5DA 3SJ9A 2GZ9A 1OWKA 3VPKA 1AVWA 3TH4H 1ZTLA 3A7VA 4WXIA 1CT4E 1SSXA 2EA3A 1OXGA 1C4U2 2JDID 3UY9A 3TJVA 1TNHA 4AFUA 1V2UT 1ELTA 2AEIH 3RXEA 1CE5A 1C1VH 2GT7A 1MKXH 1IQKA 5KEDA 2Y6TA 1IQFA 2QF0A 3ZZBA 1EZXC 1KLTA 2O9QA 3M3SA 5FBEA 3SJ8A 1UK2A 1SQTA 1ID5H 4TT3D 4YZUA 4ISNA 3V12A 1LPKB 1PJPA 2WV4A 3DCLA 2V35A 2XC5A 3SUDA 1AD8H 1KXAA 2BD2A 4FOUC 1XVMA 2RDLA 8LPRA 2GT8A 5C5OA 1G36A 3OYPA 2A45B 2KCPA 4TPIZ 1L2EA 2QN5T 1K2I1 1DUAA 1W7GH 1YPHE 1K0HA 2ZDAH 3QGNB 4OS4A 1TGNA 1HAOH 1A5GH 2K0QA 1ETTH 1RS0A 3PMHB 4ZHLU 3FVFB 3PWCA 2VU8E 2FOFA 1E38B 2Z9JA 3LKWA 1C5VA 4TSFD 1O3NA 1WYKA 4ABJA 1BT7A 4B74A 3Q3KA 2KCOA 4Q7ZA 1Z8IB 3OAAD 3S7KB 3LIWA 4FUDA 1DWDH 3DSGA 3OSYA 4X1SU 2BDGA 1Y5AT 1AKSB 3A88A 1ARCA 1O3OA 3A82A 1WQVH 4FUCA 2G51A 5C0TA 1ARBA 1K21H 5LPEA 1WOFA 2P3FH 3LC3A 1N6XA 2FOMB 5EPNA 2V3MA 2G00A 4Q80A 5EJZA 1CGJE 4AB8A 1TFXA 1PPEE 4HZHA 3B23B 1AVGH 3RXFA 1Q31A 1MBQA 1AO5A 5EG4A 2FOEA 2CF9H 5C1UA 4FUJA 1NFXA 4FU7A 2H9EH 1P2JA 3ZZ9A 1ELGA 3GCNA 4MPWA 1RFNA 4B73A 4D9QA 2VWMA 1W12U 3HKJB 3HGNA 2HPQH 4F49A 5HM2A 1QQUA 1V2OT 1PFXC 5LPRA 4E06H 5HMAA 3SUFA 5DP7A 2ZCLP 2A7HA 4TWWA 3E90B 3U28C 1BMNH 3QK1A 4X8SH 2GCHF 2A5KA 1GBAA 1W0YH 2Z94A 1P8VC 3N7EA 4IN1A 1MD7A 3NPSA 1W0ZU 5F03A 2J98A 2J38A 3BTKE 3V0XA 1C2HA 1XXFA 1H4WA 5AFZH 2ZTYA 3ODFA 3VB4A 3GY6A 3TIUA 4LZ1H 5B6LA 1TMBH 2XCNA 2M2AA 1Y8TA 1AY6H 1C1QA 4ABAA 7GCHG 1V2JT 2P59A 1DY8A 3PLBA 1ZPCA 4JZ1A 1VGCB 1PQ5A 2L6OA 1O2HA 2FTMA 1GI7B 1ZHPA 1FAKH 3C27B 1PYTC 1YPJH 1LCYA 2QF4A 3T2NA 2ZCKP 1CSOE 1Y5BT 1GBTA 3PM3A 2FWWA 4YLQH 1BTHH 2IPHA 4K1SA 1SB1H 4INHA 1YPMH 4FU8A 1O3KA 1IQHA 9ESTA 1BRUP 1J9CH 1GMHG 1QTFA 1W14U 1ABIH 1GG6C 1LQEA 4A1TA 1DS2E 1JIRA 2VWLA 1TOMH 4MG3A 1K1OA 5FPYA 1TOCB 2B8OH 2A4QA 1PPBH 3S9AA 1GBHA 1MU6B 4I8GA 4HGCA 3BTEE 2DE9A 4NA9H 4U30A 1ZJDA 2QC2A 1MTVA 2WPIS 1YLCA 4ABBA 1UMAH 2LPRA 5E2OA 1VGCC 1QRWA 2QXIA 2BB4A 2JJ2D 1PYTD 3PLKA 3TGJE 1GBBA 1C1MA 1TNLA 1WQSA 2SNVA 1ZZZA 1AVXA 4O9VA 4ASUD 2VGCC 2W3KA 2FP7B 2OC0A 1TB6H 2LELA 2TBSA 3V7TA 2BXUH 4FU9A 1FY5A 1BMFD 1O34A 3MMGA 4DY7B 2F9VA 2HPPH 1NS3A 1C1RA 2QIQA 3I29A 3GCHB 3K6ZA 2FOHA 2C8ZB 4XE4A 3WW7A 3LGUA 1MD8A 3Q00A 1EJAA 4BAOB 1QJ7B 2PLXA 3TGKE 1MTNB 1V2ST 5EGMA 2PKSB 2OC8A 1EX3A 2O8MA 2BD3A 1GHBF 5EW1H 1PPGE 1V2TT 1Z1IA 1C5UA 1C5WB 2AERH 1O37A 2KZ4A 1BHXB 2V0BA 1O2VA 2GJGA 4MPXA 3OFND 3Q77A 1HBTH 3MH7A 5T6GA 2VIDA 3QO6A 3URCA 3EDXB 1W11U 1TGTA 5A8YA 2F9BH 1KY9A 2Y80A 1S81A 1ANBA 1O35A 2D8WA 3GCHC 1TYNA 3M36A 2UUFB 1IQGA 1IOEA 3SV2H 5EPYA 3UR9A 5FCKA 2BZAA 1IAUA 4ABEA 4CBNA 1NFYA 1K1PA 2VNTA 2ZU4A 3A85A 1HXEH 1K22H 3UTUH 1CA0B 2NU2E 2OUAA 4Q63A 3QGJA 1C2DA 4K1TA 3EA8A 4K2YA 5F53A 3UFAA 5KECA 2BY7X 2P95A 1GHVH 3MOCA 3SU4A 2VIPA 1QB9A 1HV7A 2NU4E 1TRMA 3ENSB 3F9EA 3S7HB 2Z9IA 1LVMA 2BDHA 1NRNH 4B6EA 5B6OA 1GVZA 3PTBA 5H4IB 1A1RA 1HAXB 1SKYE 1Z71A 1YCPH 1ZMNA 1MBMA 2ZWLH 4OM9A 1TRNA 1HPGA 3P17H 2GKVE 2ANMH 1YLDA 4NSVA 5FX6A 1YGCH 1QL8A 3UR6A 1O2IA 2ESTE 1CT2E 1XUJA 3SU6A 1GHAF 3N99A 1LQDB 2VB0A 1CA0C 1G9IE 6GCHG 2WPMS 1O3FA 4ZHAA 3UQVA 4D7FA 2QYIA 3SU0A 1OYTH 1UO6A 3MO9A 1TX7A 1TIOA 4DIIH 4CREA 4AFSA 4OS5A 4A7IB 1SFIA 1C4Y2 3MNXA 1NC6A 2Y82A 2ZU5A 2YMSB 3RLWH 2BX4A 2ZU2A 3ZZ3A 2M5TA 1E1QD 1ZMLA 1BRCE 1J14A 1VCWA 5EOKA 3TGIE 2K8IA 3KCGH 2FI5E 3A8BA 1NROH 1O31A 3BG4B 1W0JD 3GDUA 1ANDA 3PLPA 2VVUA 3RU4T 2ZGCA 2XCFA 3E0NB 1AQ7A 1ELDE 2BTCE 4CR5A 1IHTH 3A8AA 7LPRA 1G3DA 2KCAA 4B76A 3QWCH 2AS9A 1GWAA 2G4UA 3RXKA 2G81E 2JIZD 1TE0A 4TY7A 3E91A 2HGTH 1SG8B 2SGQE 3K2UA 3T29A 2VIWA 4GAWA 3A86A 1EJNA 1GJ4H 2LP6A 4ACAA 1EPTA 3M5MA 4AG2A 1NU7B 3LGVA 3CS7A 3OU0A 1BHXF 4NIWA 1Z1JA 2J9NA 2R3UA 3VB5A 1TGSZ 1IQMA 3PV2A 3RMOH 3DA9B 5GXPA 1DT2A 2PR3A 5T1VA 5JB9S 1O2LA 3CS0A 4O03A 3H5CB 2R3YA 8GCHG 1O2ZA 3RMLH 2OC1A 1ANCA 4U32A 1HJAB 4YOJA 3U69H 1P9UA 1L4ZA 5FPSA 1O2SA 4XD7D 1YPEH 3M5OA 2FX6A 3GOVB 4JYUH 5F8XA 2O8UA 5FPTA 2HWLB 1O3EA 3PV5A 5E0GA 4HG6A 2G52A 3EE7A 5E8EH 1AUJA 3SW2B 1S6HA 3LGTA 2XBWA 3ELAH 2FDAA 2WPJS 1A3BH 3MU5A 1H1BA 1RIWB 2FYRA 1BMLA 1TMUH 2G55A 3U8RH 5CHAB 1ZSLA 1DE7H 3KQEA 2FS9A 3M3VA 1TGBA 4K1EA 4WY3A 1UJ1A 5C17A 1BJVA 1X7AC 3E3TA 1ZRBA 3UREA 4KP0A 1A0HB 4Y71A 1KDQB 1ZR0A 2ZHEH 1XUKA 1ZJKA 1HAGE 1AHTH 2XOKD 4X6OA 1NRRH 1QB1A 1V2KT 4DJZB 8ESTE 1P06A 5L2YH 2UWPA 2WUCA 3T27A 3PWBA 1C1PA 5DPAA 1HAVB 3BTHE 4CRDA 3F9HA 2C3SA 3RXCA 2ZHFH 1ZSJA 3MH6A 1UTMA 1E35B 4ZUHA 3DHKH 1D3DB 2FM2A 2XYAA 5DG6A 2B9LA 4IN2A 2G5VA 2Q6DA 3GY4A 3L6PA 2CK3D 4K5ZA 4NIVA 4B71A 1C2JA 3TJUA 3UNRA 1GI9B 1MKWH 3L3TA 4K8BA 2UUYA 1QB6A 3AASA 2ZPQA 1ZRKA 3SZNA 4AX9H 5TCCA 3ZV8A 2D1JA 5A09A 4LZ4B 3QX5H 3F9FA 2KM0A 2RFKC 4IMQA 1AFQC 1XMNB 1OKXA 1T31A 5L2ZH 1KIGH 2QE7D 1BRAA 3GY3A 1V2LT 4NA7A 2HLDD 3TH3H 1B7XB 1TNIA 4NFFA 4TYDA 3ZVEA 1GBDA 4UFEH 3AAVA 4XRNA 1TX6A 1AB9B 3SZEA 3P8NA 1GI2A 1UW7A 4ZKOU 3LJOA 4THNH 1O5AB 1GL0E 1ESAA 4IS5A 1PPZA 5EXLA 1C5YB 4FUIA 2FTLE 1YM0A 3S9CA 2FOBA 5DP3A 3F1SB 1A7SA 3MU8A 1CA8B 1Z7KA 4J2YB 2Y5FA 3HK6B 2OD3B 1OWJA 3F68H 3LJJA 2PGBB 1P04A 3UWIA 2ALVA 4F55A 3KF2A 4X6MA 2WZQA 4BOHA 6LPRA 1E0FD 1UTLM 2R0KA 1P05A 5DP8A 1UTPA 1DSTA 1LDTT 1HAYB 1O3IA 4ZH8A 1BUIA 1TA2A 1L1JA 2QGRA 3VXFH 4I8HA 3A84A 1SHYA 3QN7A 1GGDC 4DIHH 3RXQA 3WWFA 2HOBA 1FY4A 1GHWH 1NBMD 3GDSA 4TY6A 2YOLA 4MNYA 1FPCH 4YLUA 5J4SA 3BTWE 4RT0A 5GCHG 1AFEH 1U6QA 7KMEH 1GDUA 2H5CA 1BJUA 3VG8A 1GVLA 2FPZA 1H8ED 3I78A 1EZQA 1HNEE 1SPJA 5JB8S 3SBKA 4JCNA 1YF4A 5BPEA 1O5CB 1K9OE 3BG8A 1C2LA 1QIXB 4ESTE 1WAYB 2WPHS 2ZCHP 2GDEH 3ZVCA 2A4GA 1DPOA 1SQAA 4BTUB 4GVUA 1T8LA 3BIVH 4WMDA 1BBRK 2GVFA 2F9OA 1BRBE 1SOZA 1SGRE 3FZDA 2ANYA 2W5EA 2ZTZA 1YP9A 1C2GA 1C2KA 2EEKA 3F6UH 4UD9H 3KNXA 3NRLA 3A7WA 1L0ZA 1EAUA 1GMDG 3A80A 2XXLA 1WUNH 1UVTH 3GY7A 4KTCA 1C5PA 2XNIA 1K1MA 2G4TA 1Z6JH 5HGGA 1CBWC 5GPIB 4FUBA 3SJOA 1VJ9U 5EQSA 3SUEA 2BMGB 2RA0A 5EJLA 3O8DA 4ZAEA 8KME2 4MLFB 1TAWA 1C1NA 2I6QA 3F3BA 3RXOA 3KIDU 4VGCB 1BCUH 1W8BH 2QF5A 2Q1JA 3I77A 2W7UA 1OX1A 1GJ5H 1FONA 3FP7E 1C5OH 4DGJA 2A1DB 1MABB 2VBCA 1P2OA 2EQNA 2Z9LA 4UFGH 3VGCB 1LPGB 3KL6A 4WF8A 4YOIA 1SHHB 3BV9B 1WDIA 2P94A 1KXCA 4CRGA 4A1XA 2P3UB 1FN6A 3PB1E 1TRYA 1EXFA 3UPEA 1AMHA 1P10A 3ODDA 4Y76A 2F83A 1WBGB 2ZDNA 4FVBA 1FJSA 3T25A 4NSYA 1SOTA 2GZ8A 4Q7YA 2XW9A 1T32A 2AFQB 3VB6A 4B2AA 1WTGH 1AZZA 4INLA 3EA7A 1LKBA 1KMHB 4VGCC 5AVDA 3H09A 3RXUA 1BITA 4IC6A 3TH2H 1LHFH 1QL7A 3IWMA 4JYVH 1FV9A 3HPTB 2HVYB 1GBFA 1C1WH 4JYTA 1GJDB 2BD9A 3SGBE 3VGCC 1P03A 4J1YA 1GMCG 3TVJB 1GG6B 3GY2A 3AW0A 4KKDA 5F8TA 3MH5A 3PO1C 1MZAA 1F0TA 4O97A 1BBRE 1HGTH 3F2FA 2OINA 2PKAA 3M5LA 4ZROA 1RJXB 5L30H 1QL9A 4WVPE 2WSSD 3LONA 3TJOA 1RD3B 1SFQB 3URDA 1UCYK 1AWHB 4A6LA 3SNAA 3UB0A 4X1RU 2VWOA 2Y81A 1O2OA 3ZYEA 5BRRE 4DCDA 1NRQH 4KTUA 1CU1A 3E0PB 3MU4A 1W10U 4RKOB 2CV3A 3D62A 3MH4A 4INKA 2QF3A 3R3GB 4QT8C 4A5TS 4CR9A 2YNAA 1QFKH 2QY0B 1HYLA 1BA8B 2VGCB 2DUCA 1S0RA 1XM1A 1FY3A 1QA7A 5KGOA 1YCPK 3SUGA 4OGXA 2KAIB 5F8ZA 4WJG2 1JIMA 1TPOA 3OTJE 4WH6A 4FVDA 1AU8A 1C9TA 1P2MA 3MNSA 2XNDD 1BMMH 1EOJA 1QJ1B 4BXWA 3TK5A 4FUEA 1V2RT 1HJ9A 4YTAA 1FXYA 3PV4A 1GPZA 4WH8A 2WYJA 1Q2WA 4FUFA 3QUMP 3ZVDA 2FODA 2G5NA 1K1IA 4GLYA 2F43B 3EGKH 2ZFQH 2SGPE 1EPTC 3BSQA 3RUOA 4HFPB 3SI4H 4OS6A 3SJIA 2ZHDA 3EYDA 1YCPM 2BZ6H 3ZZCA 2Y5GA 2GX4A 4OS7A 1NU9A 3SYJA 1V6DA 3DT0H 3PRBA 2FMJA 1GL1A 1O38A 1OP8A 2C8YB 3DFLA 3RC5A 1EP6A 1UHBB 1TWXB 2BVSH 1QGFA 3GISB 2BOHB 1A46H 4P00A 1CVWH 4AFZA 4ZMAH 1S6LA 3QZRA 3TITA 2JH0D 1SGYE 1YKTA 1GDQA 1BIOA 5ESBA 3TK6A 3KYGA 1ZPBA 1UVUH 2ZGJA 4FUGA 4A92A 2Y5HA 2AMDA 1FY1A 2OC7A 1UCYE 1MMJN 2AMQA 3K9XB 3W95A 3MWIU 1ORFA 1HIAA 4X8VH 3B8JA 3RM0H 3K6YA 2A4RA 2OQ5A 1LTOA 1CGIE 3TJNA 2TGPZ 1AGJA 1NRSH 2R2MB 2ZFPH 3AAUA 3S9BA 2OCVB 3SGQE 3TNTA 4R0IA 4BANB 1LHDH 2CHAB 2D2DA 1O3CA 4GCHG 4BNRA 4I8KA 3PTNA 1ZTJA 4NWKA 2HLCA 4X8UH 3SGAE 2QV1A 3T62A 2R2WU 1DWEH 2RG3A 1YWUA 2ZDKA 3M35A 1GI4A 5A8ZA 1M9UA 2Y7ZA 3QTOH 1Q3XA 3RXVA 1N8OB 3U1IB 1V3XA 2O8TA 1Y3WA 1JMOH 2ZI2H 3NWUA 1QA0A 3BN9A 1HFDA 3F0PA 1GMDF 3RXMA 4AOQA 3Q3XA 1EJMA 1QHRB 1O2UA 1P02A 1N6YA 1H9LB 1EAWA 1CO7E 3RP2A 4A1VA 1TBZH 1E37B 2BY5X 1O2NA 3U98H 2CHAC 3A7YA 2XRCA 2JJ1D 2V7QD 4RT1A 4YXWD 1NN6A 1C5MD 1A5IA 1G2MA 4BXSA 2BHGA 4MDSA 4DVAU 1D6RA 3SU2A 2GV7A 4ZKNU 3KQCA 5CHBA 4AGKA 3G01A 2A7JA 5JYIA 1N8OC 3A8CA 2PUXB 1OS8A 2C8XB 3W1EA 5GWZA 3KEEA 2EI8A 2PUQH 3QZQA 3RXRA 1OWEA 4CRCA 1RRKA 4I32A 4YT7H 1SC8U 4WXVA 5TCAA 1G37A 2VIVA 2ZDLA 2AH4X 2GP9B 3LT3A 2BY9X 1DM4B 2F4LA 5K0HA 3MYWA 3ATKA 3IITA 3Q3YA 4SGBE 1LVOA 2VJ1A 1OSSA 1ABJH 1C4V2 1F5KU 3ZZAA 1SGCA 2BY6X 3GYLB 5C20A 1AKSA 1MAXA 1QJ6B 3BEFB 1DDJA 1JRSA 1O5DH 1C5XB 1DANH 5PTPA 1A61H 1C2FA 5LGOA 3JZ1B 3D49H 1FIZA 2FZZA 3KGPA 4JK5A 3GCOA 2ZDMA 3FO8D 5EW2H 2RDEA 1CGHA 1J16A 5FXLA 1IQEA 1BTXA 4UEHH 4YT6H 3M7TA 3P6ZB 1BTUA 3Q76A 1OHHD 1F2SE 1NY22 4K69A 2SNWA 5DJ7A 1VITH 2BDYA 1TGCA 1FDPA 2IJOB 1DXWA 3UUZA 1T4VH 2ZTXA 1AIXH 5J4QA 7GCHF 2RA3A 3O8RA 1DXPA 4GPGA 5DSFA 3ZVBA 1OOKB 1GBJA 1KYNA 1GVKB 3NK8A 1W3CA 4M9FA 1YPLH 6CHAB 2EY4C 4FXGH 1F0SA 4O3TA 5T6DA 4XDEA 4ABGA 2SGFE 1XXDA 1S83A 1IHSH 4IGDA 1D9IA 1EZSC 4KELA 5E0HA 5HKKD 1TONA 3P92A 2NWNA 4JZFH 1KSNA 1DY9A 2FS8A 4FUHA 2IN2A 4IC5A 1Z8JB 1MH0A 1S84A 4UFDH 2C4FH 3FN8A 1DFPA 5E0JA 2TGTA 3STIA 2ZFFH 1MQ5A 1GMHF 4CH8B 3LH3A 3ZVFA 1AZ8A 3SO3A 1CQQA 2CGAA 1K28D 1QQ4A 2BD4A 1ZTKA 3DUXH 2HVXA 3OEED 5HIZA 2BQ6B 1LVBA 2UWLA 4ABIA 2JETB 4ACBA 2PSXA 1WTHD 1O3GA 5C1YA 1O2JA 1QBVH 1UTNA 3PMJA 4ZCNA 5HXFA 2W6ID 4ASHA 3RXLA 3U8TH 6CHAC 1SR5C 3SQHE 2ZC9H 3JZ2B 5A0CA 1BTPA 2ZECA 1IQLA 1TALA 1P2NA 1SMFE 3LGWA 1O5BB 5IK2D 3PMAB 3EAJA 5E2PA 4LK4A 3SU1A 2THFB 1GJ7B 5JDUB 5SGAE 1O2WA 1QRXA 3KYFA 1TPAE 4AN7A 1C5TA 2FOCA 2KR7A 5GJ4B 1SL3A 4H42U 3WWBA 2YMSD 1SGIB 1Y3XA 1SGFA 4KGAA 5G4BA 4DT7B 2ZGHA 4RI0A 1XKAC 2JETC 1NFWA 3FZZA 4JMYA 1BMAA 1ELVA 3BTGE 1SGEE 3N7OA 3V13A 1AFQB 2STBE 4Y0ZE 1A3EH 3RU4E 1YYY1 1E34B 1ESTA 2TGAA 1EFRD 1MKXK 2H6MA 2J98B 3CP7A 2QXGA 4ABHA 3O8CA 5ESTE 1O33A 2Z3EA 4WWYA 1O2KA 1K1LA 4Y0YE 3A7ZA 1SQOA 1PQ8A 1S5SA 5F6MA 1LO6A 4AFQA 1G32B 4WMEA 4X8TH 3P95A 4LXBH 1FPHH 1D6WA 1GI3A 2AIPA 3OY6U 4BAKB 4IMZA 3ZZ6A 4GCHF 1ZPZA 3ZVGA 4Z0KA 3SV7A 3GY8A 3UWJH 2ZKSA 1EUFA 2QXJA 2HNTE 3DSOA 5LH8A 2UWOA 5FX5A 1WXRA 5T6FA 1H9IE 3MU1A 1ZGIA 2GD4B 3UIRA 2H9TH 1F5LA 1W2KH 2V6NA 3SHAH 5A8XA 1GBCA 2GDDA 3LGIA 1MQ6A 2ASUB 2FYQA 4ISOA 1GJ8B 1TX8A 1VJAU 4YO9A 2SGDE 5GIBA 1O0DH 2KCYA 1OYQA 1TA6A 4JZIA 1DLKB 1WU1A 1CHOG 1FX0B 2VH0A 1O2YA 3SV8A 1TBRH 4D9RA 2BYAX 1CT0E 1GBEA 5DP6A 3B9FH 2BXTH 2OK5A 4XFQA 1GGDB 1PPHE 3P70B 4WMFA 3UNQA 3ZVAA 3GDVA 4XBDA 2BM2A 3IG6B 1XX9A 1AWFH 1KLIH 3BTQE 3OX7U 3ITIA 1ELAA 3M7QA 6ESTA 2A5AA 2WHXA 2A4OA 1J8AA 4O3UA 2AGGX 4KTSA 1HAIH 3T5FH 2R0LA 3SNCA 4F48B 3AVZA 2H1UA 2SGAA 2ZFSA 1GCDA 4OGYA 1ANEA 2FI3E 1YPHC 4XSKU 1O36A 1OP0A 4I7YH 1DWCH 2AGEX 4DOQA 6GCHF 1MTWA 2CN0H 5CDFE 4GHTA 1A2CH 2STAE 3PROA 3TK9A 1FQ3A 3BF6H 3ZZ7A 2C93B 4BAMB 2A32A 3RC4A 4CHAB 1SLUB 1F92A 3T28A 2ZGBH 5T3HA 2OTVA 3ZYDA 1O3HA 1O32A 3RXDA 3F2HA 4RKJB 4BTIB 3SN8A 1FY8E 3OEHD 4D76A 1XUGA 4MTBA 2FOAA 1L1GA 2ZO3H 2ZNKH 3KHVA 3KQDA 4I8JA 2WPKS 3VFEA 4GHQA 4ABDA 4R8TB 3W94A 1THSH 5JBAS 1ZHMA 2ODYB 4CRFA 4X2XA 3MO6A 1V2PT 2WPDD 4XOJA 1CBWB 2ZEBA 2K1QA 4MNWA 1BOQA 3E8LA 1O39A 2J97A 2Z6BD 1O3AA 4AYVB 4AORA 3E1XB 5FCRA 2A2XH 2Q6GA 1UK4A 1GHBG 1C1UH 4CHAC 2J34A 1BZXE 2BX3A 2O8WA 2VINA 1B0EA 3OTPA 1DX5M 3STJA 1XVOA 1THRH 2QXHA 1C2EA 3E6PH 2BVRH 4AB9A 2Q6FA 1J17T 3RMMH 1T8NA 3RXSA 1TBQH 1S0QA 5C67A 4JZDH 1VKYA 4NWLA 1E1RD 5AHGH 4AG1A 1P9SA 4NGAH 5C5NA 3MQKC 3EQ0H 3A7XA 2J4IA 2P3TB 3SNDA 3FAOA 1NO9H 3P8OA 2ZU3A 1TPPA 2PP6A 1P3EA 1ZGVA 2Z3DA 2GMTC 5IDKA 1F5RA 3GYMA 3RXGA 1YPGH 1NBME 1BDAA 1P09A 1C1TA 2OQUA 4I8LA 4IW4E 8GCHF 1GI5A 2BD5A 4H4FA 1ZLRA 3BEUA 4TPYA 1GJBB 3L33A 4JK6A 4P02A 3S69A 2YNBA 2OP9A 5DP5A 4Q2KA 4ZHMU 1JWTA 1GBMA 3HKIB 1QR3E 5CMXH 1EOLA 1HAZB 2WV9A 3MTYA 5GDSH 1S82A 4IBLH 1IQIA 4ISLA 2CMYA 1YBWA 2GZ7A 1GBLA 4AC9A 2ZPSA 3PO1B 1F7ZA 4B2BA 4RSPA 2ZHWH 1QBOA 4Y7AA 5FAHA 5JBTA 1DUEA 4NFEA 4OS1A 3SNBA 2WINI 1O3DA 4BTTB 2AMPA 5HIYA 1MTSA 2Z3CA 2SGEE 3MNBA 1V2QT 4ZXYH 1XUFA 2H2ZA 2ZF0H 3S0NA 1LHGH 3R0FA 1GHAG 3UQOA 1JRTA 1LVYA 4B2CA 1V2VT 2W3IA 1THPB 2BDIA 5EJ1A 4NIXA 1DITH 5FBIA 5ABWA 1EQ9A 3QDZB 5DKMA 1C2MA 2XC4A 1VITG 2VVVA 3UNSA 4UONA 2F91A 1SGNE 1KXBA 1GBKA 1T8OA 3SJKA 1MCVA 2ZFTA 4GSOA 2A0QB 2XBVA 1GDNA 3FANA 3KQ5A 2GV6A 1P2QA 3T26A 1RTKA 2A2QH 4AGJA 3BTFE 1SGFG 3U9AH 4UDWH 2PWXA 2V3HH 2UUJB 1EKBB 1KDQA 3ATMA 5C1XA 1EPTB 1LKAA 1SGQE 4NA8A 3VB3A 1SBWA 1JOUB 1HAHH 4NZQA 3ZZ5A 1WCZA 1HAVA 3EE0B 1FUJA 3F0OA 1K1NA 2GTBA 5DP9A 2TRMA 3C1KA 1AN1E 3LU9B 4B6FA 1TMTH 3BTTE 2HALA 4Y8YA 4ISIH 4X0WU 2TPIZ 4MNXA 5L6NH 3NZIA 1KLJH 1GJCB 1CHOF 1INCA 3AW1A 1D3PB 3N7DA 4CBOA 2BLWA 2Z7FE 3BTME 1DSUA 1XKBC 1LMWB 3LPRA 5A2MH 3SI3H 4Y79A 1TNKA 2ZP0H 1P57B 4Y8ZA 2FESH 3RXJA 3RM2H 3LGYA 1BBRH 1HLTH 2V3OH 2ZFRH 1C5NH 4X2VA 3GCTG 4UE7H 3UOUA 1ELEE 3CENA 1MZDA 1F0RA 3TPIZ 1EP5A 1HAPH 2TIOA 3RMNH 1E79D 3A7TA 3RXPA 4CH2B 4NIYA 2PTCE 1QURH 1Z6EA 4F4OC 5AF9H 1UVOA 1H8HD 3SQEE 5EXNA 2FOGA 2FXRA 3K65B 1C5RA 4X2YA 3LOXA 1C1SA 3SOSA 1SGPE 3FP8E 1EATA 2G8TA 1O2TA 2BQWB 2BVXH 2C8WB 2FLBH 1EAXA 4X1NU 2BLVA 2VWNA 4AZ2B 3PYHA 3ZV9A 1W13U 1GI8B 3U8OH 1B5GH 2PHBA 1VCQA 1FMGA 2B5TB 3TU7H 2IPQX 1UTQA 5GCHF 3A83A 1OWIA 2CJIA 4X6NA 1GI6A 4ZXXH 1HXFH 1H9HE 4NG9H 1GJ6A 1ETSH 1LHCH 1O2PA 1SGTA 1C2IA 3MO3A 4H6SB 1VZQH 4U2WA 1FIWA 1D3TB 4HI3A 1FZZA 1GI0A 2ODPA 1YC0A 3M7UA 1RTFB 1CHGA 1Y5UT 1A0JA 3M61U 2F3CE 2J95A 4Z1MD 2IOTA 1GHZA 2NU0E 4MNVA 3H7OA 1TLDA 2H9HA 1C5SA 1QBNA 3NKKA 1W7XH 1QY6A 1HRTH 2R9PA 5FL7D 1DVAH 4U01A 1AE5A 1C9PA 1BB0B 1T8MA 2LNCA 5A0AE 1G30B 3A8DA 3NXPA 3AK5A 5JBCS 3EA9A 2SFAA 4I31A 4MPVA 4HTCH 4I86A 4E7NA 1FI8A 3P8GA 2BOKA 2ZQ2A 2IJD1 3A87A 1O2QA 5DGJA 2J94A 4M7GA 1MTNC 1UCYH 2PKSC 5EIYA 2GCTB 1P11E 3HK3B 3NCLA 1G3EA 1D3QB 1EASA 1W0KD 1S6FA 1FLEE 3FP6E 3D23A 3CNRA 2EI6A 3FKSD 1YY3A 3DD2H 1BTWA 3VXEH 1XUHA 2A7CA 3VEQB 3NUMA 1IQJA 1O3BA 3PMBB 2JH6D 1UTOA 1Z8RA 4UFFH 1ELFA 5GNDA 1QRZA 3A81A 1JXPA 2XC0A 3RXIA 1OPHB 1KXDA 2W6JD 2XWBI 4I33A 2ZGXH 9LPRA 5K7RA 1TNJA 1O5GH 1TQ7B 2XWAA 1G3CA 4MVNA 2UUKB 2BDCA 1ESBA 1Y3UA 2BLOA 1DWBH 1TQ0B 1AI8H 1ELBA 2FEQH 2GCTC 3BTDE 2VIOA 1PQAA 1KTSB 3ZZDA 3ATIA 1OP2A 2C90B 1BQYA 1H8IH 4ZKSU 1EZUC 1A0LA 1DICA 4Y7BA 1HDTH 1TPSA 2OLGA 4K60A 1DOJA 1P2KA 1O2XA 2QA9E 1VITF 2ZDVH 1GMCF 2AIQA 2KFWA 3QLPH 1MKWK 1TNGA 2P8OB 3MFJA 2EC9H 2RCEA 5ETXA 3ESTA 4DURA 1J15A 2ALPA 1T4UH 4BAQB 1O3MA 3GS9A 2L74A 3DFJA 1A4WH 3LC5A 2AHME 5IYTA 1GI1A 3GY5A 4DG4A 1FN8A 5C94A 3M5NA 1RXPA 3RXTA 3PRDA 1L1NA 4YESB 1O30A 2BY8X 1OWHA 2PFEA 2OXSA 2XBYA 3OY5U 1HJ8A 1IQNA 1NM6A 1GJ9B 1K1JA 1HUTH 3BIUH 3D65E 1EB2A 1UTJA 1UK3A 3RXBA 1O5EH 1UVPA 2FLRH 1AUTC 3P8FA 5LPFA 1NTPA 1O2GH 4XBCA 3M37A
chains in the Genus database with same CATH topology
3EE7A 1UW7A 1QZ8A 2J97A 5HIZA 5HIYA 5C94A 2J98A 2J98B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EE7 A;  1UW7 A;  1QZ8 A;  2J97 A;  5HIZ A;  5HIY A;  5C94 A;  2J98 A;  2J98 B; 
#chains in the Genus database with same CATH topology
 1ZYO A;  1LHE H;  4NZL A;  1S85 A;  4H6T A;  2P8O C;  4TWY A;  1MU8 B;  2YMS C;  2ZA5 A;  2ULL A;  1MTU A;  1UVS H;  2FO9 A;  3ZZ4 A;  4Y6D A;  3SOR A;  3VB7 A;  1L4D A;  2PV9 B;  4Q7X A;  5JPM H;  3RXH A;  1VR1 H;  2HNT C;  2WUB A;  5JBB S;  1RGQ A;  3RLY H;  2PGQ B;  3OE7 D;  2CXV A;  2FIR H;  1O3L A;  4SGA E;  1O3P B;  4PRO A;  3ZZ8 A;  4GUX A;  1PPF E;  3GCT F;  7EST E;  5EOD A;  4CRA A;  1QCP A;  2W26 A;  4D8N A;  3RU4 D;  3BG4 C;  1QNJ A;  4DW2 U;  2AGI X;  1P2I A;  2A31 A;  2NU3 E;  4RN6 A;  2KAI A;  2PSY A;  1WSS H;  4ZKR U;  3FOA A;  2XTT B;  2ZHQ H;  1C1O A;  3ATW A;  1T7C A;  1Y3Y A;  2WYG A;  1HB0 B;  2OBQ A;  5DP4 A;  1LPZ B;  1SGD E;  3HGP A;  3SV9 A;  5C0U A;  3MHW U;  3LDX H;  3TNS A;  1MAY A;  1B0F A;  5I46 H;  2XBX A;  2CF8 H;  1GHY H;  3FFG A;  4D7G A;  3ZIA D;  1ZSK A;  1P3C A;  4Q4L A;  4Y10 E;  1YPK H;  1FAX A;  3MI4 A;  3U1J B;  1KXE A;  2ILN A;  2JH5 D;  2NU1 E;  3MNC A;  2J5U A;  3E16 B;  4NCY A;  1O5F H;  3WY8 A;  1D4P B;  2PKA B;  5A0B A;  5DK1 A;  4K3J A;  1VCP A;  2HRV A;  4ABF A;  3M3T A;  2Z9G A;  2ANW A;  1G3B A;  3LH1 A;  1GJA B;  1SLX B;  4B75 A;  1HJA C;  1HCG A;  4OS2 A;  3SU5 A;  1EB1 H;  3F2G A;  1KTT B;  1UHB A;  5C3N A;  2BDB A;  1UTK A;  1V2N T;  1XUI A;  1Y3V A;  5EQR A;  5EXM A;  1N1L A;  2BDA A;  2VIQ A;  2P16 A;  3V3M A;  2DE8 A;  2J2U A;  2B0F A;  2B7D H;  1SQR A;  5FHT A;  1P01 A;  5DO4 H;  4E7R G;  2GCH G;  2AYW A;  1ACB E;  4MQA A;  5C2Z A;  4LOY H;  5CE1 A;  2A5I A;  2ZG0 H;  4DT4 A;  5EQQ A;  1GCT B;  1PQ7 A;  2F9P A;  1QZ8 A;  5TJX A;  3DSP A;  1NT1 A;  1RIW C;  3RDZ A;  4XBB A;  4X6P A;  2WV5 A;  4X1Q U;  3GIC B;  2F9N A;  1V2M T;  1SI5 H;  2BQ7 B;  2I6S A;  2J92 A;  5CHA C;  3SNE A;  1OWD A;  3BEI B;  2VH6 A;  4MPU A;  2BD7 A;  2FX4 A;  2JKH A;  4X2W A;  1GBI A;  5HYO A;  3RXA A;  1ZOM A;  4X1P U;  2W7S A;  5HM9 A;  2PTN A;  2P93 A;  3TLO A;  2ZQ1 A;  2ANK H;  2HNT F;  1TAB E;  1O2R A;  1GHX H;  3SHC H;  3MU0 A;  2PW8 H;  1G2L A;  1ELC A;  2BD8 A;  1Z8G A;  1NZQ H;  2D26 C;  3UOP A;  4YOG A;  2Z9K A;  1ZHR A;  2ZIQ H;  3A89 A;  3ATL A;  2QAA A;  1NPM A;  2ZZU H;  1WV7 H;  4AYY B;  1GCT C;  1O3J A;  4K8Y A;  4ISH H;  1E36 B;  1A5H A;  1EAI A;  5DN6 D;  2OBO A;  4CRB A;  1Y59 T;  1P0S H;  1C5Q A;  2VVC A;  2ZPR A;  3SV6 A;  1JBU H;  1C5Z B;  1AE8 H;  1BTY A;  2FI4 E;  3QTV H;  1BTZ A;  4Y11 E;  1MUE B;  3KN2 A;  2EI7 A;  1NFU A;  5EU8 A;  2BLQ A;  2GGV B;  2F9U A;  1PPC E;  1KXF A;  3F9G A;  1ETR H;  4Y8X A;  4BAH B;  4YM9 A;  3UAI C;  1DLE A;  1F0U A;  3H7T A;  3RC6 A;  2TGD A;  1C5L H;  1FNI A;  1ZMJ A;  2Y7X A;  2ODQ A;  3O8B A;  4FET A;  4B1T A;  1HIA B;  2O8L A;  1NRP H;  2WPL S;  1COW D;  1P12 E;  3SU3 A;  2ZU1 A;  3KQB A;  1YLN A;  1SLV B;  5AFY H;  1H8D H;  1O2M A;  2KX4 A;  1AB9 C;  1RTL A;  1SLW B;  2QCY A;  4E05 H;  3HAT H;  1SVP A;  4Z6A H;  5I25 A;  1V2W T;  1NES E;  2GMT B;  1MCT A;  4JZE H;  2H5D A;  3SJ9 A;  2GZ9 A;  1OWK A;  3VPK A;  1AVW A;  3TH4 H;  1ZTL A;  3A7V A;  4WXI A;  1CT4 E;  1SSX A;  2EA3 A;  1OXG A;  1C4U 2;  2JDI D;  3UY9 A;  3TJV A;  1TNH A;  4AFU A;  1V2U T;  1ELT A;  2AEI H;  3RXE A;  1CE5 A;  1C1V H;  2GT7 A;  1MKX H;  1IQK A;  5KED A;  2Y6T A;  1IQF A;  2QF0 A;  3ZZB A;  1EZX C;  1KLT A;  2O9Q A;  3M3S A;  5FBE A;  3SJ8 A;  1UK2 A;  1SQT A;  1ID5 H;  4TT3 D;  4YZU A;  4ISN A;  3V12 A;  1LPK B;  1PJP A;  2WV4 A;  3DCL A;  2V35 A;  2XC5 A;  3SUD A;  1AD8 H;  1KXA A;  2BD2 A;  4FOU C;  1XVM A;  2RDL A;  8LPR A;  2GT8 A;  5C5O A;  1G36 A;  3OYP A;  2A45 B;  2KCP A;  4TPI Z;  1L2E A;  2QN5 T;  1K2I 1;  1DUA A;  1W7G H;  1YPH E;  1K0H A;  2ZDA H;  3QGN B;  4OS4 A;  1TGN A;  1HAO H;  1A5G H;  2K0Q A;  1ETT H;  1RS0 A;  3PMH B;  4ZHL U;  3FVF B;  3PWC A;  2VU8 E;  2FOF A;  1E38 B;  2Z9J A;  3LKW A;  1C5V A;  4TSF D;  1O3N A;  1WYK A;  4ABJ A;  1BT7 A;  4B74 A;  3Q3K A;  2KCO A;  4Q7Z A;  1Z8I B;  3OAA D;  3S7K B;  3LIW A;  4FUD A;  1DWD H;  3DSG A;  3OSY A;  4X1S U;  2BDG A;  1Y5A T;  1AKS B;  3A88 A;  1ARC A;  1O3O A;  3A82 A;  1WQV H;  4FUC A;  2G51 A;  5C0T A;  1ARB A;  1K21 H;  5LPE A;  1WOF A;  2P3F H;  3LC3 A;  1N6X A;  2FOM B;  5EPN A;  2V3M A;  2G00 A;  4Q80 A;  5EJZ A;  1CGJ E;  4AB8 A;  1TFX A;  1PPE E;  4HZH A;  3B23 B;  1AVG H;  3RXF A;  1Q31 A;  1MBQ A;  1AO5 A;  5EG4 A;  2FOE A;  2CF9 H;  5C1U A;  4FUJ A;  1NFX A;  4FU7 A;  2H9E H;  1P2J A;  3ZZ9 A;  1ELG A;  3GCN A;  4MPW A;  1RFN A;  4B73 A;  4D9Q A;  2VWM A;  1W12 U;  3HKJ B;  3HGN A;  2HPQ H;  4F49 A;  5HM2 A;  1QQU A;  1V2O T;  1PFX C;  5LPR A;  4E06 H;  5HMA A;  3SUF A;  5DP7 A;  2ZCL P;  2A7H A;  4TWW A;  3E90 B;  3U28 C;  1BMN H;  3QK1 A;  4X8S H;  2GCH F;  2A5K A;  1GBA A;  1W0Y H;  2Z94 A;  1P8V C;  3N7E A;  4IN1 A;  1MD7 A;  3NPS A;  1W0Z U;  5F03 A;  2J98 A;  2J38 A;  3BTK E;  3V0X A;  1C2H A;  1XXF A;  1H4W A;  5AFZ H;  2ZTY A;  3ODF A;  3VB4 A;  3GY6 A;  3TIU A;  4LZ1 H;  5B6L A;  1TMB H;  2XCN A;  2M2A A;  1Y8T A;  1AY6 H;  1C1Q A;  4ABA A;  7GCH G;  1V2J T;  2P59 A;  1DY8 A;  3PLB A;  1ZPC A;  4JZ1 A;  1VGC B;  1PQ5 A;  2L6O A;  1O2H A;  2FTM A;  1GI7 B;  1ZHP A;  1FAK H;  3C27 B;  1PYT C;  1YPJ H;  1LCY A;  2QF4 A;  3T2N A;  2ZCK P;  1CSO E;  1Y5B T;  1GBT A;  3PM3 A;  2FWW A;  4YLQ H;  1BTH H;  2IPH A;  4K1S A;  1SB1 H;  4INH A;  1YPM H;  4FU8 A;  1O3K A;  1IQH A;  9EST A;  1BRU P;  1J9C H;  1GMH G;  1QTF A;  1W14 U;  1ABI H;  1GG6 C;  1LQE A;  4A1T A;  1DS2 E;  1JIR A;  2VWL A;  1TOM H;  4MG3 A;  1K1O A;  5FPY A;  1TOC B;  2B8O H;  2A4Q A;  1PPB H;  3S9A A;  1GBH A;  1MU6 B;  4I8G A;  4HGC A;  3BTE E;  2DE9 A;  4NA9 H;  4U30 A;  1ZJD A;  2QC2 A;  1MTV A;  2WPI S;  1YLC A;  4ABB A;  1UMA H;  2LPR A;  5E2O A;  1VGC C;  1QRW A;  2QXI A;  2BB4 A;  2JJ2 D;  1PYT D;  3PLK A;  3TGJ E;  1GBB A;  1C1M A;  1TNL A;  1WQS A;  2SNV A;  1ZZZ A;  1AVX A;  4O9V A;  4ASU D;  2VGC C;  2W3K A;  2FP7 B;  2OC0 A;  1TB6 H;  2LEL A;  2TBS A;  3V7T A;  2BXU H;  4FU9 A;  1FY5 A;  1BMF D;  1O34 A;  3MMG A;  4DY7 B;  2F9V A;  2HPP H;  1NS3 A;  1C1R A;  2QIQ A;  3I29 A;  3GCH B;  3K6Z A;  2FOH A;  2C8Z B;  4XE4 A;  3WW7 A;  3LGU A;  1MD8 A;  3Q00 A;  1EJA A;  4BAO B;  1QJ7 B;  2PLX A;  3TGK E;  1MTN B;  1V2S T;  5EGM A;  2PKS B;  2OC8 A;  1EX3 A;  2O8M A;  2BD3 A;  1GHB F;  5EW1 H;  1PPG E;  1V2T T;  1Z1I A;  1C5U A;  1C5W B;  2AER H;  1O37 A;  2KZ4 A;  1BHX B;  2V0B A;  1O2V A;  2GJG A;  4MPX A;  3OFN D;  3Q77 A;  1HBT H;  3MH7 A;  5T6G A;  2VID A;  3QO6 A;  3URC A;  3EDX B;  1W11 U;  1TGT A;  5A8Y A;  2F9B H;  1KY9 A;  2Y80 A;  1S81 A;  1ANB A;  1O35 A;  2D8W A;  3GCH C;  1TYN A;  3M36 A;  2UUF B;  1IQG A;  1IOE A;  3SV2 H;  5EPY A;  3UR9 A;  5FCK A;  2BZA A;  1IAU A;  4ABE A;  4CBN A;  1NFY A;  1K1P A;  2VNT A;  2ZU4 A;  3A85 A;  1HXE H;  1K22 H;  3UTU H;  1CA0 B;  2NU2 E;  2OUA A;  4Q63 A;  3QGJ A;  1C2D A;  4K1T A;  3EA8 A;  4K2Y A;  5F53 A;  3UFA A;  5KEC A;  2BY7 X;  2P95 A;  1GHV H;  3MOC A;  3SU4 A;  2VIP A;  1QB9 A;  1HV7 A;  2NU4 E;  1TRM A;  3ENS B;  3F9E A;  3S7H B;  2Z9I A;  1LVM A;  2BDH A;  1NRN H;  4B6E A;  5B6O A;  1GVZ A;  3PTB A;  5H4I B;  1A1R A;  1HAX B;  1SKY E;  1Z71 A;  1YCP H;  1ZMN A;  1MBM A;  2ZWL H;  4OM9 A;  1TRN A;  1HPG A;  3P17 H;  2GKV E;  2ANM H;  1YLD A;  4NSV A;  5FX6 A;  1YGC H;  1QL8 A;  3UR6 A;  1O2I A;  2EST E;  1CT2 E;  1XUJ A;  3SU6 A;  1GHA F;  3N99 A;  1LQD B;  2VB0 A;  1CA0 C;  1G9I E;  6GCH G;  2WPM S;  1O3F A;  4ZHA A;  3UQV A;  4D7F A;  2QYI A;  3SU0 A;  1OYT H;  1UO6 A;  3MO9 A;  1TX7 A;  1TIO A;  4DII H;  4CRE A;  4AFS A;  4OS5 A;  4A7I B;  1SFI A;  1C4Y 2;  3MNX A;  1NC6 A;  2Y82 A;  2ZU5 A;  2YMS B;  3RLW H;  2BX4 A;  2ZU2 A;  3ZZ3 A;  2M5T A;  1E1Q D;  1ZML A;  1BRC E;  1J14 A;  1VCW A;  5EOK A;  3TGI E;  2K8I A;  3KCG H;  2FI5 E;  3A8B A;  1NRO H;  1O31 A;  3BG4 B;  1W0J D;  3GDU A;  1AND A;  3PLP A;  2VVU A;  3RU4 T;  2ZGC A;  2XCF A;  3E0N B;  1AQ7 A;  1ELD E;  2BTC E;  4CR5 A;  1IHT H;  3A8A A;  7LPR A;  1G3D A;  2KCA A;  4B76 A;  3QWC H;  2AS9 A;  1GWA A;  2G4U A;  3RXK A;  2G81 E;  2JIZ D;  1TE0 A;  4TY7 A;  3E91 A;  2HGT H;  1SG8 B;  2SGQ E;  3K2U A;  3T29 A;  2VIW A;  4GAW A;  3A86 A;  1EJN A;  1GJ4 H;  2LP6 A;  4ACA A;  1EPT A;  3M5M A;  4AG2 A;  1NU7 B;  3LGV A;  3CS7 A;  3OU0 A;  1BHX F;  4NIW A;  1Z1J A;  2J9N A;  2R3U A;  3VB5 A;  1TGS Z;  1IQM A;  3PV2 A;  3RMO H;  3DA9 B;  5GXP A;  1DT2 A;  2PR3 A;  5T1V A;  5JB9 S;  1O2L A;  3CS0 A;  4O03 A;  3H5C B;  2R3Y A;  8GCH G;  1O2Z A;  3RML H;  2OC1 A;  1ANC A;  4U32 A;  1HJA B;  4YOJ A;  3U69 H;  1P9U A;  1L4Z A;  5FPS A;  1O2S A;  4XD7 D;  1YPE H;  3M5O A;  2FX6 A;  3GOV B;  4JYU H;  5F8X A;  2O8U A;  5FPT A;  2HWL B;  1O3E A;  3PV5 A;  5E0G A;  4HG6 A;  2G52 A;  3EE7 A;  5E8E H;  1AUJ A;  3SW2 B;  1S6H A;  3LGT A;  2XBW A;  3ELA H;  2FDA A;  2WPJ S;  1A3B H;  3MU5 A;  1H1B A;  1RIW B;  2FYR A;  1BML A;  1TMU H;  2G55 A;  3U8R H;  5CHA B;  1ZSL A;  1DE7 H;  3KQE A;  2FS9 A;  3M3V A;  1TGB A;  4K1E A;  4WY3 A;  1UJ1 A;  5C17 A;  1BJV A;  1X7A C;  3E3T A;  1ZRB A;  3URE A;  4KP0 A;  1A0H B;  4Y71 A;  1KDQ B;  1ZR0 A;  2ZHE H;  1XUK A;  1ZJK A;  1HAG E;  1AHT H;  2XOK D;  4X6O A;  1NRR H;  1QB1 A;  1V2K T;  4DJZ B;  8EST E;  1P06 A;  5L2Y H;  2UWP A;  2WUC A;  3T27 A;  3PWB A;  1C1P A;  5DPA A;  1HAV B;  3BTH E;  4CRD A;  3F9H A;  2C3S A;  3RXC A;  2ZHF H;  1ZSJ A;  3MH6 A;  1UTM A;  1E35 B;  4ZUH A;  3DHK H;  1D3D B;  2FM2 A;  2XYA A;  5DG6 A;  2B9L A;  4IN2 A;  2G5V A;  2Q6D A;  3GY4 A;  3L6P A;  2CK3 D;  4K5Z A;  4NIV A;  4B71 A;  1C2J A;  3TJU A;  3UNR A;  1GI9 B;  1MKW H;  3L3T A;  4K8B A;  2UUY A;  1QB6 A;  3AAS A;  2ZPQ A;  1ZRK A;  3SZN A;  4AX9 H;  5TCC A;  3ZV8 A;  2D1J A;  5A09 A;  4LZ4 B;  3QX5 H;  3F9F A;  2KM0 A;  2RFK C;  4IMQ A;  1AFQ C;  1XMN B;  1OKX A;  1T31 A;  5L2Z H;  1KIG H;  2QE7 D;  1BRA A;  3GY3 A;  1V2L T;  4NA7 A;  2HLD D;  3TH3 H;  1B7X B;  1TNI A;  4NFF A;  4TYD A;  3ZVE A;  1GBD A;  4UFE H;  3AAV A;  4XRN A;  1TX6 A;  1AB9 B;  3SZE A;  3P8N A;  1GI2 A;  1UW7 A;  4ZKO U;  3LJO A;  4THN H;  1O5A B;  1GL0 E;  1ESA A;  4IS5 A;  1PPZ A;  5EXL A;  1C5Y B;  4FUI A;  2FTL E;  1YM0 A;  3S9C A;  2FOB A;  5DP3 A;  3F1S B;  1A7S A;  3MU8 A;  1CA8 B;  1Z7K A;  4J2Y B;  2Y5F A;  3HK6 B;  2OD3 B;  1OWJ A;  3F68 H;  3LJJ A;  2PGB B;  1P04 A;  3UWI A;  2ALV A;  4F55 A;  3KF2 A;  4X6M A;  2WZQ A;  4BOH A;  6LPR A;  1E0F D;  1UTL M;  2R0K A;  1P05 A;  5DP8 A;  1UTP A;  1DST A;  1LDT T;  1HAY B;  1O3I A;  4ZH8 A;  1BUI A;  1TA2 A;  1L1J A;  2QGR A;  3VXF H;  4I8H A;  3A84 A;  1SHY A;  3QN7 A;  1GGD C;  4DIH H;  3RXQ A;  3WWF A;  2HOB A;  1FY4 A;  1GHW H;  1NBM D;  3GDS A;  4TY6 A;  2YOL A;  4MNY A;  1FPC H;  4YLU A;  5J4S A;  3BTW E;  4RT0 A;  5GCH G;  1AFE H;  1U6Q A;  7KME H;  1GDU A;  2H5C A;  1BJU A;  3VG8 A;  1GVL A;  2FPZ A;  1H8E D;  3I78 A;  1EZQ A;  1HNE E;  1SPJ A;  5JB8 S;  3SBK A;  4JCN A;  1YF4 A;  5BPE A;  1O5C B;  1K9O E;  3BG8 A;  1C2L A;  1QIX B;  4EST E;  1WAY B;  2WPH S;  2ZCH P;  2GDE H;  3ZVC A;  2A4G A;  1DPO A;  1SQA A;  4BTU B;  4GVU A;  1T8L A;  3BIV H;  4WMD A;  1BBR K;  2GVF A;  2F9O A;  1BRB E;  1SOZ A;  1SGR E;  3FZD A;  2ANY A;  2W5E A;  2ZTZ A;  1YP9 A;  1C2G A;  1C2K A;  2EEK A;  3F6U H;  4UD9 H;  3KNX A;  3NRL A;  3A7W A;  1L0Z A;  1EAU A;  1GMD G;  3A80 A;  2XXL A;  1WUN H;  1UVT H;  3GY7 A;  4KTC A;  1C5P A;  2XNI A;  1K1M A;  2G4T A;  1Z6J H;  5HGG A;  1CBW C;  5GPI B;  4FUB A;  3SJO A;  1VJ9 U;  5EQS A;  3SUE A;  2BMG B;  2RA0 A;  5EJL A;  3O8D A;  4ZAE A;  8KME 2;  4MLF B;  1TAW A;  1C1N A;  2I6Q A;  3F3B A;  3RXO A;  3KID U;  4VGC B;  1BCU H;  1W8B H;  2QF5 A;  2Q1J A;  3I77 A;  2W7U A;  1OX1 A;  1GJ5 H;  1FON A;  3FP7 E;  1C5O H;  4DGJ A;  2A1D B;  1MAB B;  2VBC A;  1P2O A;  2EQN A;  2Z9L A;  4UFG H;  3VGC B;  1LPG B;  3KL6 A;  4WF8 A;  4YOI A;  1SHH B;  3BV9 B;  1WDI A;  2P94 A;  1KXC A;  4CRG A;  4A1X A;  2P3U B;  1FN6 A;  3PB1 E;  1TRY A;  1EXF A;  3UPE A;  1AMH A;  1P10 A;  3ODD A;  4Y76 A;  2F83 A;  1WBG B;  2ZDN A;  4FVB A;  1FJS A;  3T25 A;  4NSY A;  1SOT A;  2GZ8 A;  4Q7Y A;  2XW9 A;  1T32 A;  2AFQ B;  3VB6 A;  4B2A A;  1WTG H;  1AZZ A;  4INL A;  3EA7 A;  1LKB A;  1KMH B;  4VGC C;  5AVD A;  3H09 A;  3RXU A;  1BIT A;  4IC6 A;  3TH2 H;  1LHF H;  1QL7 A;  3IWM A;  4JYV H;  1FV9 A;  3HPT B;  2HVY B;  1GBF A;  1C1W H;  4JYT A;  1GJD B;  2BD9 A;  3SGB E;  3VGC C;  1P03 A;  4J1Y A;  1GMC G;  3TVJ B;  1GG6 B;  3GY2 A;  3AW0 A;  4KKD A;  5F8T A;  3MH5 A;  3PO1 C;  1MZA A;  1F0T A;  4O97 A;  1BBR E;  1HGT H;  3F2F A;  2OIN A;  2PKA A;  3M5L A;  4ZRO A;  1RJX B;  5L30 H;  1QL9 A;  4WVP E;  2WSS D;  3LON A;  3TJO A;  1RD3 B;  1SFQ B;  3URD A;  1UCY K;  1AWH B;  4A6L A;  3SNA A;  3UB0 A;  4X1R U;  2VWO A;  2Y81 A;  1O2O A;  3ZYE A;  5BRR E;  4DCD A;  1NRQ H;  4KTU A;  1CU1 A;  3E0P B;  3MU4 A;  1W10 U;  4RKO B;  2CV3 A;  3D62 A;  3MH4 A;  4INK A;  2QF3 A;  3R3G B;  4QT8 C;  4A5T S;  4CR9 A;  2YNA A;  1QFK H;  2QY0 B;  1HYL A;  1BA8 B;  2VGC B;  2DUC A;  1S0R A;  1XM1 A;  1FY3 A;  1QA7 A;  5KGO A;  1YCP K;  3SUG A;  4OGX A;  2KAI B;  5F8Z A;  4WJG 2;  1JIM A;  1TPO A;  3OTJ E;  4WH6 A;  4FVD A;  1AU8 A;  1C9T A;  1P2M A;  3MNS A;  2XND D;  1BMM H;  1EOJ A;  1QJ1 B;  4BXW A;  3TK5 A;  4FUE A;  1V2R T;  1HJ9 A;  4YTA A;  1FXY A;  3PV4 A;  1GPZ A;  4WH8 A;  2WYJ A;  1Q2W A;  4FUF A;  3QUM P;  3ZVD A;  2FOD A;  2G5N A;  1K1I A;  4GLY A;  2F43 B;  3EGK H;  2ZFQ H;  2SGP E;  1EPT C;  3BSQ A;  3RUO A;  4HFP B;  3SI4 H;  4OS6 A;  3SJI A;  2ZHD A;  3EYD A;  1YCP M;  2BZ6 H;  3ZZC A;  2Y5G A;  2GX4 A;  4OS7 A;  1NU9 A;  3SYJ A;  1V6D A;  3DT0 H;  3PRB A;  2FMJ A;  1GL1 A;  1O38 A;  1OP8 A;  2C8Y B;  3DFL A;  3RC5 A;  1EP6 A;  1UHB B;  1TWX B;  2BVS H;  1QGF A;  3GIS B;  2BOH B;  1A46 H;  4P00 A;  1CVW H;  4AFZ A;  4ZMA H;  1S6L A;  3QZR A;  3TIT A;  2JH0 D;  1SGY E;  1YKT A;  1GDQ A;  1BIO A;  5ESB A;  3TK6 A;  3KYG A;  1ZPB A;  1UVU H;  2ZGJ A;  4FUG A;  4A92 A;  2Y5H A;  2AMD A;  1FY1 A;  2OC7 A;  1UCY E;  1MMJ N;  2AMQ A;  3K9X B;  3W95 A;  3MWI U;  1ORF A;  1HIA A;  4X8V H;  3B8J A;  3RM0 H;  3K6Y A;  2A4R A;  2OQ5 A;  1LTO A;  1CGI E;  3TJN A;  2TGP Z;  1AGJ A;  1NRS H;  2R2M B;  2ZFP H;  3AAU A;  3S9B A;  2OCV B;  3SGQ E;  3TNT A;  4R0I A;  4BAN B;  1LHD H;  2CHA B;  2D2D A;  1O3C A;  4GCH G;  4BNR A;  4I8K A;  3PTN A;  1ZTJ A;  4NWK A;  2HLC A;  4X8U H;  3SGA E;  2QV1 A;  3T62 A;  2R2W U;  1DWE H;  2RG3 A;  1YWU A;  2ZDK A;  3M35 A;  1GI4 A;  5A8Z A;  1M9U A;  2Y7Z A;  3QTO H;  1Q3X A;  3RXV A;  1N8O B;  3U1I B;  1V3X A;  2O8T A;  1Y3W A;  1JMO H;  2ZI2 H;  3NWU A;  1QA0 A;  3BN9 A;  1HFD A;  3F0P A;  1GMD F;  3RXM A;  4AOQ A;  3Q3X A;  1EJM A;  1QHR B;  1O2U A;  1P02 A;  1N6Y A;  1H9L B;  1EAW A;  1CO7 E;  3RP2 A;  4A1V A;  1TBZ H;  1E37 B;  2BY5 X;  1O2N A;  3U98 H;  2CHA C;  3A7Y A;  2XRC A;  2JJ1 D;  2V7Q D;  4RT1 A;  4YXW D;  1NN6 A;  1C5M D;  1A5I A;  1G2M A;  4BXS A;  2BHG A;  4MDS A;  4DVA U;  1D6R A;  3SU2 A;  2GV7 A;  4ZKN U;  3KQC A;  5CHB A;  4AGK A;  3G01 A;  2A7J A;  5JYI A;  1N8O C;  3A8C A;  2PUX B;  1OS8 A;  2C8X B;  3W1E A;  5GWZ A;  3KEE A;  2EI8 A;  2PUQ H;  3QZQ A;  3RXR A;  1OWE A;  4CRC A;  1RRK A;  4I32 A;  4YT7 H;  1SC8 U;  4WXV A;  5TCA A;  1G37 A;  2VIV A;  2ZDL A;  2AH4 X;  2GP9 B;  3LT3 A;  2BY9 X;  1DM4 B;  2F4L A;  5K0H A;  3MYW A;  3ATK A;  3IIT A;  3Q3Y A;  4SGB E;  1LVO A;  2VJ1 A;  1OSS A;  1ABJ H;  1C4V 2;  1F5K U;  3ZZA A;  1SGC A;  2BY6 X;  3GYL B;  5C20 A;  1AKS A;  1MAX A;  1QJ6 B;  3BEF B;  1DDJ A;  1JRS A;  1O5D H;  1C5X B;  1DAN H;  5PTP A;  1A61 H;  1C2F A;  5LGO A;  3JZ1 B;  3D49 H;  1FIZ A;  2FZZ A;  3KGP A;  4JK5 A;  3GCO A;  2ZDM A;  3FO8 D;  5EW2 H;  2RDE A;  1CGH A;  1J16 A;  5FXL A;  1IQE A;  1BTX A;  4UEH H;  4YT6 H;  3M7T A;  3P6Z B;  1BTU A;  3Q76 A;  1OHH D;  1F2S E;  1NY2 2;  4K69 A;  2SNW A;  5DJ7 A;  1VIT H;  2BDY A;  1TGC A;  1FDP A;  2IJO B;  1DXW A;  3UUZ A;  1T4V H;  2ZTX A;  1AIX H;  5J4Q A;  7GCH F;  2RA3 A;  3O8R A;  1DXP A;  4GPG A;  5DSF A;  3ZVB A;  1OOK B;  1GBJ A;  1KYN A;  1GVK B;  3NK8 A;  1W3C A;  4M9F A;  1YPL H;  6CHA B;  2EY4 C;  4FXG H;  1F0S A;  4O3T A;  5T6D A;  4XDE A;  4ABG A;  2SGF E;  1XXD A;  1S83 A;  1IHS H;  4IGD A;  1D9I A;  1EZS C;  4KEL A;  5E0H A;  5HKK D;  1TON A;  3P92 A;  2NWN A;  4JZF H;  1KSN A;  1DY9 A;  2FS8 A;  4FUH A;  2IN2 A;  4IC5 A;  1Z8J B;  1MH0 A;  1S84 A;  4UFD H;  2C4F H;  3FN8 A;  1DFP A;  5E0J A;  2TGT A;  3STI A;  2ZFF H;  1MQ5 A;  1GMH F;  4CH8 B;  3LH3 A;  3ZVF A;  1AZ8 A;  3SO3 A;  1CQQ A;  2CGA A;  1K28 D;  1QQ4 A;  2BD4 A;  1ZTK A;  3DUX H;  2HVX A;  3OEE D;  5HIZ A;  2BQ6 B;  1LVB A;  2UWL A;  4ABI A;  2JET B;  4ACB A;  2PSX A;  1WTH D;  1O3G A;  5C1Y A;  1O2J A;  1QBV H;  1UTN A;  3PMJ A;  4ZCN A;  5HXF A;  2W6I D;  4ASH A;  3RXL A;  3U8T H;  6CHA C;  1SR5 C;  3SQH E;  2ZC9 H;  3JZ2 B;  5A0C A;  1BTP A;  2ZEC A;  1IQL A;  1TAL A;  1P2N A;  1SMF E;  3LGW A;  1O5B B;  5IK2 D;  3PMA B;  3EAJ A;  5E2P A;  4LK4 A;  3SU1 A;  2THF B;  1GJ7 B;  5JDU B;  5SGA E;  1O2W A;  1QRX A;  3KYF A;  1TPA E;  4AN7 A;  1C5T A;  2FOC A;  2KR7 A;  5GJ4 B;  1SL3 A;  4H42 U;  3WWB A;  2YMS D;  1SGI B;  1Y3X A;  1SGF A;  4KGA A;  5G4B A;  4DT7 B;  2ZGH A;  4RI0 A;  1XKA C;  2JET C;  1NFW A;  3FZZ A;  4JMY A;  1BMA A;  1ELV A;  3BTG E;  1SGE E;  3N7O A;  3V13 A;  1AFQ B;  2STB E;  4Y0Z E;  1A3E H;  3RU4 E;  1YYY 1;  1E34 B;  1EST A;  2TGA A;  1EFR D;  1MKX K;  2H6M A;  2J98 B;  3CP7 A;  2QXG A;  4ABH A;  3O8C A;  5EST E;  1O33 A;  2Z3E A;  4WWY A;  1O2K A;  1K1L A;  4Y0Y E;  3A7Z A;  1SQO A;  1PQ8 A;  1S5S A;  5F6M A;  1LO6 A;  4AFQ A;  1G32 B;  4WME A;  4X8T H;  3P95 A;  4LXB H;  1FPH H;  1D6W A;  1GI3 A;  2AIP A;  3OY6 U;  4BAK B;  4IMZ A;  3ZZ6 A;  4GCH F;  1ZPZ A;  3ZVG A;  4Z0K A;  3SV7 A;  3GY8 A;  3UWJ H;  2ZKS A;  1EUF A;  2QXJ A;  2HNT E;  3DSO A;  5LH8 A;  2UWO A;  5FX5 A;  1WXR A;  5T6F A;  1H9I E;  3MU1 A;  1ZGI A;  2GD4 B;  3UIR A;  2H9T H;  1F5L A;  1W2K H;  2V6N A;  3SHA H;  5A8X A;  1GBC A;  2GDD A;  3LGI A;  1MQ6 A;  2ASU B;  2FYQ A;  4ISO A;  1GJ8 B;  1TX8 A;  1VJA U;  4YO9 A;  2SGD E;  5GIB A;  1O0D H;  2KCY A;  1OYQ A;  1TA6 A;  4JZI A;  1DLK B;  1WU1 A;  1CHO G;  1FX0 B;  2VH0 A;  1O2Y A;  3SV8 A;  1TBR H;  4D9R A;  2BYA X;  1CT0 E;  1GBE A;  5DP6 A;  3B9F H;  2BXT H;  2OK5 A;  4XFQ A;  1GGD B;  1PPH E;  3P70 B;  4WMF A;  3UNQ A;  3ZVA A;  3GDV A;  4XBD A;  2BM2 A;  3IG6 B;  1XX9 A;  1AWF H;  1KLI H;  3BTQ E;  3OX7 U;  3ITI A;  1ELA A;  3M7Q A;  6EST A;  2A5A A;  2WHX A;  2A4O A;  1J8A A;  4O3U A;  2AGG X;  4KTS A;  1HAI H;  3T5F H;  2R0L A;  3SNC A;  4F48 B;  3AVZ A;  2H1U A;  2SGA A;  2ZFS A;  1GCD A;  4OGY A;  1ANE A;  2FI3 E;  1YPH C;  4XSK U;  1O36 A;  1OP0 A;  4I7Y H;  1DWC H;  2AGE X;  4DOQ A;  6GCH F;  1MTW A;  2CN0 H;  5CDF E;  4GHT A;  1A2C H;  2STA E;  3PRO A;  3TK9 A;  1FQ3 A;  3BF6 H;  3ZZ7 A;  2C93 B;  4BAM B;  2A32 A;  3RC4 A;  4CHA B;  1SLU B;  1F92 A;  3T28 A;  2ZGB H;  5T3H A;  2OTV A;  3ZYD A;  1O3H A;  1O32 A;  3RXD A;  3F2H A;  4RKJ B;  4BTI B;  3SN8 A;  1FY8 E;  3OEH D;  4D76 A;  1XUG A;  4MTB A;  2FOA A;  1L1G A;  2ZO3 H;  2ZNK H;  3KHV A;  3KQD A;  4I8J A;  2WPK S;  3VFE A;  4GHQ A;  4ABD A;  4R8T B;  3W94 A;  1THS H;  5JBA S;  1ZHM A;  2ODY B;  4CRF A;  4X2X A;  3MO6 A;  1V2P T;  2WPD D;  4XOJ A;  1CBW B;  2ZEB A;  2K1Q A;  4MNW A;  1BOQ A;  3E8L A;  1O39 A;  2J97 A;  2Z6B D;  1O3A A;  4AYV B;  4AOR A;  3E1X B;  5FCR A;  2A2X H;  2Q6G A;  1UK4 A;  1GHB G;  1C1U H;  4CHA C;  2J34 A;  1BZX E;  2BX3 A;  2O8W A;  2VIN A;  1B0E A;  3OTP A;  1DX5 M;  3STJ A;  1XVO A;  1THR H;  2QXH A;  1C2E A;  3E6P H;  2BVR H;  4AB9 A;  2Q6F A;  1J17 T;  3RMM H;  1T8N A;  3RXS A;  1TBQ H;  1S0Q A;  5C67 A;  4JZD H;  1VKY A;  4NWL A;  1E1R D;  5AHG H;  4AG1 A;  1P9S A;  4NGA H;  5C5N A;  3MQK C;  3EQ0 H;  3A7X A;  2J4I A;  2P3T B;  3SND A;  3FAO A;  1NO9 H;  3P8O A;  2ZU3 A;  1TPP A;  2PP6 A;  1P3E A;  1ZGV A;  2Z3D A;  2GMT C;  5IDK A;  1F5R A;  3GYM A;  3RXG A;  1YPG H;  1NBM E;  1BDA A;  1P09 A;  1C1T A;  2OQU A;  4I8L A;  4IW4 E;  8GCH F;  1GI5 A;  2BD5 A;  4H4F A;  1ZLR A;  3BEU A;  4TPY A;  1GJB B;  3L33 A;  4JK6 A;  4P02 A;  3S69 A;  2YNB A;  2OP9 A;  5DP5 A;  4Q2K A;  4ZHM U;  1JWT A;  1GBM A;  3HKI B;  1QR3 E;  5CMX H;  1EOL A;  1HAZ B;  2WV9 A;  3MTY A;  5GDS H;  1S82 A;  4IBL H;  1IQI A;  4ISL A;  2CMY A;  1YBW A;  2GZ7 A;  1GBL A;  4AC9 A;  2ZPS A;  3PO1 B;  1F7Z A;  4B2B A;  4RSP A;  2ZHW H;  1QBO A;  4Y7A A;  5FAH A;  5JBT A;  1DUE A;  4NFE A;  4OS1 A;  3SNB A;  2WIN I;  1O3D A;  4BTT B;  2AMP A;  5HIY A;  1MTS A;  2Z3C A;  2SGE E;  3MNB A;  1V2Q T;  4ZXY H;  1XUF A;  2H2Z A;  2ZF0 H;  3S0N A;  1LHG H;  3R0F A;  1GHA G;  3UQO A;  1JRT A;  1LVY A;  4B2C A;  1V2V T;  2W3I A;  1THP B;  2BDI A;  5EJ1 A;  4NIX A;  1DIT H;  5FBI A;  5ABW A;  1EQ9 A;  3QDZ B;  5DKM A;  1C2M A;  2XC4 A;  1VIT G;  2VVV A;  3UNS A;  4UON A;  2F91 A;  1SGN E;  1KXB A;  1GBK A;  1T8O A;  3SJK A;  1MCV A;  2ZFT A;  4GSO A;  2A0Q B;  2XBV A;  1GDN A;  3FAN A;  3KQ5 A;  2GV6 A;  1P2Q A;  3T26 A;  1RTK A;  2A2Q H;  4AGJ A;  3BTF E;  1SGF G;  3U9A H;  4UDW H;  2PWX A;  2V3H H;  2UUJ B;  1EKB B;  1KDQ A;  3ATM A;  5C1X A;  1EPT B;  1LKA A;  1SGQ E;  4NA8 A;  3VB3 A;  1SBW A;  1JOU B;  1HAH H;  4NZQ A;  3ZZ5 A;  1WCZ A;  1HAV A;  3EE0 B;  1FUJ A;  3F0O A;  1K1N A;  2GTB A;  5DP9 A;  2TRM A;  3C1K A;  1AN1 E;  3LU9 B;  4B6F A;  1TMT H;  3BTT E;  2HAL A;  4Y8Y A;  4ISI H;  4X0W U;  2TPI Z;  4MNX A;  5L6N H;  3NZI A;  1KLJ H;  1GJC B;  1CHO F;  1INC A;  3AW1 A;  1D3P B;  3N7D A;  4CBO A;  2BLW A;  2Z7F E;  3BTM E;  1DSU A;  1XKB C;  1LMW B;  3LPR A;  5A2M H;  3SI3 H;  4Y79 A;  1TNK A;  2ZP0 H;  1P57 B;  4Y8Z A;  2FES H;  3RXJ A;  3RM2 H;  3LGY A;  1BBR H;  1HLT H;  2V3O H;  2ZFR H;  1C5N H;  4X2V A;  3GCT G;  4UE7 H;  3UOU A;  1ELE E;  3CEN A;  1MZD A;  1F0R A;  3TPI Z;  1EP5 A;  1HAP H;  2TIO A;  3RMN H;  1E79 D;  3A7T A;  3RXP A;  4CH2 B;  4NIY A;  2PTC E;  1QUR H;  1Z6E A;  4F4O C;  5AF9 H;  1UVO A;  1H8H D;  3SQE E;  5EXN A;  2FOG A;  2FXR A;  3K65 B;  1C5R A;  4X2Y A;  3LOX A;  1C1S A;  3SOS A;  1SGP E;  3FP8 E;  1EAT A;  2G8T A;  1O2T A;  2BQW B;  2BVX H;  2C8W B;  2FLB H;  1EAX A;  4X1N U;  2BLV A;  2VWN A;  4AZ2 B;  3PYH A;  3ZV9 A;  1W13 U;  1GI8 B;  3U8O H;  1B5G H;  2PHB A;  1VCQ A;  1FMG A;  2B5T B;  3TU7 H;  2IPQ X;  1UTQ A;  5GCH F;  3A83 A;  1OWI A;  2CJI A;  4X6N A;  1GI6 A;  4ZXX H;  1HXF H;  1H9H E;  4NG9 H;  1GJ6 A;  1ETS H;  1LHC H;  1O2P A;  1SGT A;  1C2I A;  3MO3 A;  4H6S B;  1VZQ H;  4U2W A;  1FIW A;  1D3T B;  4HI3 A;  1FZZ A;  1GI0 A;  2ODP A;  1YC0 A;  3M7U A;  1RTF B;  1CHG A;  1Y5U T;  1A0J A;  3M61 U;  2F3C E;  2J95 A;  4Z1M D;  2IOT A;  1GHZ A;  2NU0 E;  4MNV A;  3H7O A;  1TLD A;  2H9H A;  1C5S A;  1QBN A;  3NKK A;  1W7X H;  1QY6 A;  1HRT H;  2R9P A;  5FL7 D;  1DVA H;  4U01 A;  1AE5 A;  1C9P A;  1BB0 B;  1T8M A;  2LNC A;  5A0A E;  1G30 B;  3A8D A;  3NXP A;  3AK5 A;  5JBC S;  3EA9 A;  2SFA A;  4I31 A;  4MPV A;  4HTC H;  4I86 A;  4E7N A;  1FI8 A;  3P8G A;  2BOK A;  2ZQ2 A;  2IJD 1;  3A87 A;  1O2Q A;  5DGJ A;  2J94 A;  4M7G A;  1MTN C;  1UCY H;  2PKS C;  5EIY A;  2GCT B;  1P11 E;  3HK3 B;  3NCL A;  1G3E A;  1D3Q B;  1EAS A;  1W0K D;  1S6F A;  1FLE E;  3FP6 E;  3D23 A;  3CNR A;  2EI6 A;  3FKS D;  1YY3 A;  3DD2 H;  1BTW A;  3VXE H;  1XUH A;  2A7C A;  3VEQ B;  3NUM A;  1IQJ A;  1O3B A;  3PMB B;  2JH6 D;  1UTO A;  1Z8R A;  4UFF H;  1ELF A;  5GND A;  1QRZ A;  3A81 A;  1JXP A;  2XC0 A;  3RXI A;  1OPH B;  1KXD A;  2W6J D;  2XWB I;  4I33 A;  2ZGX H;  9LPR A;  5K7R A;  1TNJ A;  1O5G H;  1TQ7 B;  2XWA A;  1G3C A;  4MVN A;  2UUK B;  2BDC A;  1ESB A;  1Y3U A;  2BLO A;  1DWB H;  1TQ0 B;  1AI8 H;  1ELB A;  2FEQ H;  2GCT C;  3BTD E;  2VIO A;  1PQA A;  1KTS B;  3ZZD A;  3ATI A;  1OP2 A;  2C90 B;  1BQY A;  1H8I H;  4ZKS U;  1EZU C;  1A0L A;  1DIC A;  4Y7B A;  1HDT H;  1TPS A;  2OLG A;  4K60 A;  1DOJ A;  1P2K A;  1O2X A;  2QA9 E;  1VIT F;  2ZDV H;  1GMC F;  2AIQ A;  2KFW A;  3QLP H;  1MKW K;  1TNG A;  2P8O B;  3MFJ A;  2EC9 H;  2RCE A;  5ETX A;  3EST A;  4DUR A;  1J15 A;  2ALP A;  1T4U H;  4BAQ B;  1O3M A;  3GS9 A;  2L74 A;  3DFJ A;  1A4W H;  3LC5 A;  2AHM E;  5IYT A;  1GI1 A;  3GY5 A;  4DG4 A;  1FN8 A;  5C94 A;  3M5N A;  1RXP A;  3RXT A;  3PRD A;  1L1N A;  4YES B;  1O30 A;  2BY8 X;  1OWH A;  2PFE A;  2OXS A;  2XBY A;  3OY5 U;  1HJ8 A;  1IQN A;  1NM6 A;  1GJ9 B;  1K1J A;  1HUT H;  3BIU H;  3D65 E;  1EB2 A;  1UTJ A;  1UK3 A;  3RXB A;  1O5E H;  1UVP A;  2FLR H;  1AUT C;  3P8F A;  5LPF A;  1NTP A;  1O2G H;  4XBC A;  3M37 A; 
#chains in the Genus database with same CATH homology
 3EE7 A;  1UW7 A;  1QZ8 A;  2J97 A;  5HIZ A;  5HIY A;  5C94 A;  2J98 A;  2J98 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...