5C94A

Infectious bronchitis virus nsp9
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
116
structure length
116
Chain Sequence
GPLGSNNELMPHGVKTKACVAGVDQAHCSVESKCYYTSISGSSVVAAITSSNPNLKVASFLNEAGNQIYVDLDPPCKFGMKVGDKVEVVYLYFIKNTRSIVRGMVLGAISNVVVLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Non-structural protein 9
publication title Crystal structure of nsp9 from infectious bronchitis virus (IBV) at 2.44 Angstroms resolution
rcsb
source organism Avian infectious bronchitis virus
total genus 22
structure length 116
sequence length 116
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08710 nsp9 nsp9 replicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.250 Mainly Beta Beta Barrel Thrombin, subunit H Replicase NSP9 5c94A00
1UW7A 5HIYA 5C94A 1QZ8A 2J97A 5HIZA 2J98A 2J98B 3EE7A
chains in the Genus database with same CATH superfamily
3KHVA 3UUZA 1P03A 3LT3A 3W95A 2HPPH 4LK4A 2BQWB 1BMAA 4ISLA 4YTAA 3A8CA 3UIRA 3URDA 2W6JD 4X1RU 4X2WA 2ZFTA 5ABWA 3UWJH 5EG4A 4B71A 5GDSH 1UTMA 2P94A 2QXHA 2ZCHP 3A8BA 5K0HA 1VITF 2BVSH 2OK5A 1FZZA 4JZFH 8GCHG 5HXFA 2ZPRA 1BRCE 2XRCA 4YXWD 1QRZA 2WPDD 1MTNC 3RP2A 3MU8A 1GBTA 4ZKOU 1UCYK 2GDEH 3P8GA 4HG6A 1WAYB 2NU3E 2YNAA 3P17H 1EKBB 4X6PA 1NROH 3TH3H 5CHBA 3BG4B 4X6NA 4IS5A 1F92A 1GGDC 1CU1A 4FOUC 1NTPA 5E0JA 3S0NA 1ZPCA 2ODQA 3TGIE 1W7XH 4D9QA 1NFUA 4ZKNU 3SJIA 1DFPA 3GY6A 3N7OA 1ESTA 1OOKB 3ZZBA 1LKBA 4YOGA 3KQEA 1LHDH 4TPYA 1NM6A 1G3CA 1Y3UA 1IQJA 3MFJA 1N6YA 4U30A 1P3CA 1O3PB 1AZ8A 4VGCB 2ANMH 5CE1A 2W7SA 1GHVH 1TMTH 5KEDA 1SSXA 3ZZDA 1WQSA 1A61H 2KM0A 4M7GA 2A7JA 4BOHA 1U6QA 1LHFH 1AVWA 1UTNA 4GAWA 3BTKE 2D2DA 2PSYA 1BRUP 1SGTA 2V3HH 1COWD 1ELVA 4OS2A 1EPTC 2BD9A 2O8WA 1CT4E 4TY7A 1W10U 4FUJA 1EJMA 1NT1A 1P9SA 2BXUH 4K8YA 1SGYE 1O2PA 1EZSC 3E8LA 3NZIA 1GHBG 5EJ1A 4DY7B 3ZV8A 2Z94A 2YMSC 1P3EA 3E91A 3MWIU 3VB6A 1A0HB 2FOBA 1S82A 3BSQA 4ABHA 1MKWK 1G3DA 4X8VH 3QK1A 1ZPBA 2VBCA 4Q7YA 1FQ3A 2GD4B 2J34A 2BDCA 2TGDA 3FP6E 3EQ0H 3LJOA 1P0SH 1YP9A 2SNVA 5LH8A 1V6DA 1H9IE 1F0TA 1AO5A 1K1OA 5F8TA 3PV4A 3HATH 2XNDD 3SV2H 5FCKA 2A4GA 1V2PT 4Y8ZA 3ZZ6A 1AI8H 2BQ6B 1ABIH 2WINI 1KXCA 1TNKA 3DD2H 2AHME 1HLTH 3UWIA 4THNH 1IQNA 1EZUC 3RXBA 3H5CB 2BDGA 3BEIB 4O03A 3U1JB 4XBBA 3Q3KA 2Y82A 3SJ8A 2XC5A 2Y6TA 4AYVB 2Y5GA 2I6SA 1V2WT 2FOAA 1GI7B 1HIAB 4FU7A 2ZA5A 3K65B 2VVUA 3GCNA 1GHAF 1PPBH 2PUXB 3MO9A 1UVPA 3BN9A 1JRSA 1O2IA 1O36A 1T4VH 2PKAA 3CS7A 3DCLA 3PO1B 4U32A 1G3EA 4FXGH 3PTBA 3RMOH 3KIDU 1SG8B 1SGEE 1ELBA 1O3CA 4YOIA 1EX3A 1P05A 3U28C 4B2BA 3TK9A 1ELCA 3ATIA 2V0BA 1UVOA 1G3BA 3A7WA 5EW1H 1J16A 1GHWH 1KLJH 3SGBE 4WH6A 3OE7D 2GVFA 4MQAA 1S84A 3SO3A 2RDLA 3A86A 4BAOB 3D49H 3GDUA 3MYWA 3GDVA 1SGNE 2ZPSA 1FIZA 3TJVA 1IQMA 4E06H 1UCYE 1D9IA 2GZ9A 3ZZ8A 1C5UA 1O5AB 1E1RD 1WOFA 1L0ZA 2BTCE 3P70B 1QBOA 5HM9A 9ESTA 3T29A 2JIZD 3RLYH 1TX8A 4ZKRU 3RXEA 3SJKA 4B6FA 3TLOA 3RXSA 1GJBB 1D3QB 1FX0B 1LMWB 1SB1H 3LH3A 3W1EA 2BZ6H 1C5LH 1CSOE 3H7OA 4X0WU 2R2WU 1NO9H 2ALVA 1GL1A 4E7RG 3PMBB 1MCVA 3ZV9A 2BZAA 1UW7A 1W8BH 2FDAA 2WZQA 3P92A 1BMFD 1VKYA 1HXFH 2QA9E 2QCYA 1MMJN 4UFGH 3LGWA 3RXOA 1OWDA 2VWMA 2WPIS 4CH8B 1UCYH 2FI4E 2XC4A 3SOSA 3ATLA 4ZROA 3ITIA 1NFXA 1FMGA 3V7TA 4J1YA 4NSYA 4ZAEA 4X2VA 1LO6A 3U8RH 3M3VA 1O34A 2BD8A 1D3PB 5KECA 1E36B 2ZDLA 1EPTA 1O5BB 3PV5A 1MD7A 1K1JA 4Y7AA 5AFYH 1ESBA 4ACAA 1GCTB 3F3BA 5E0GA 3AVZA 2OBQA 1Q3XA 2IJOB 5DP8A 4SGAE 5EJZA 1C4Y2 1HJ9A 1BCUH 1KXAA 1HBTH 1ZHMA 1SGQE 3M5NA 4MDSA 4BAHB 3PWCA 1C2MA 2F91A 2J38A 5A8XA 1NPMA 5CHAC 4LZ1H 1LQEA 1V2MT 3S9CA 4JYUH 3PMAB 1P11E 2AH4X 1G37A 5IYTA 1GJCB 4NG9H 4P02A 5C1YA 3TK5A 4BAQB 1A1RA 2PKAB 3UB0A 1XUHA 4NZLA 5DGJA 3SV7A 1FY4A 1KSNA 1TNJA 3RMMH 2O9QA 2UUKB 1C5XB 1ETTH 3KGPA 1TAWA 2ILNA 2RA0A 2VB0A 1BMLA 1C2JA 4FUBA 5H4IB 2KCOA 3U8OH 1PJPA 1K9OE 1DVAH 3UNSA 2Z9JA 1QQ4A 1EAWA 1CGJE 3H09A 3ZVGA 4U2WA 2ZGBH 4H4FA 2OC8A 1O2LA 2ZFQH 2WPKS 2JETB 1C1MA 2LPRA 1TIOA 4Y71A 2GX4A 1OWKA 5FBIA 1C2GA 1MKWH 5DP4A 1KTSB 1TRMA 4HI3A 1QFKH 1GMHF 4CH2B 1O5EH 1YPHE 1QB9A 4BANB 1XX9A 2AS9A 2P3FH 4H6TA 2C8ZB 2CMYA 4AB9A 2ZC9H 1A46H 2PSXA 2ZTYA 3TU7H 3QTOH 1TRNA 4IMZA 4JK5A 3GISB 1RTKA 5GPIB 1O3JA 5TCAA 4ZHLU 2BY6X 1WV7H 1CGIE 3M61U 3ZVAA 1GG6C 5FAHA 1NC6A 3TVJB 1K1NA 4AORA 3SQHE 2VGCB 1ELDE 1AB9C 2QC2A 4WH8A 4I86A 4ZXYH 4E7NA 2G5VA 1IOEA 4JYTA 3C27B 3AASA 5EXMA 4X2XA 2ZDKA 5BRRE 3SNAA 1HB0B 3TK6A 3SV8A 1S81A 3AAUA 3MOCA 2EI6A 3EA7A 1L4DA 3M7QA 4KP0A 1BHXF 3KYGA 4NWLA 2BDIA 3B8JA 5T6DA 3F9FA 2ZGJA 1O2RA 1L1JA 2W26A 1DY9A 1QZ8A 3PMJA 1MAXA 1EB1H 3BTQE 1FAXA 2BY7X 2VNTA 2QXJA 1AKSA 3DSPA 2HOBA 1FY5A 1GMCG 4DGJA 1CO7E 1SQOA 1O39A 1TPSA 2A4QA 1UK4A 1NRSH 1ACBE 1ZMLA 4DIIH 4DIHH 2VWOA 2B9LA 1VJAU 2GCTC 3A7XA 5E2PA 3GY8A 1FDPA 4AZ2B 1XUKA 1T8NA 3PTNA 5HKKD 5T6FA 1OP2A 1DWCH 2FESH 2QY0B 5GIBA 4FUHA 1PPHE 1QB1A 3UY9A 1TOMH 3SU5A 1HAOH 3GS9A 1C1VH 1THPB 2BD2A 2P93A 1FI8A 4XDEA 3HKJB 2F9OA 5IDKA 5JB9S 5DSFA 1L4ZA 4XE4A 1MUEB 3RMNH 1K0HA 1T8OA 1C5OH 2C3SA 1ETSH 4ZKSU 5DP7A 1BJUA 1SGPE 1ANEA 3A83A 1QHRB 1DM4B 3U69H 1GPZA 1MBMA 1O2XA 4FU9A 1EOJA 4X1QU 3SNBA 1LVBA 2UWOA 4MLFB 3CNRA 5CDFE 1Q31A 2TPIZ 1GBEA 3WW7A 1QBVH 5HMAA 2HNTE 2ANYA 1N8OB 2PR3A 5EXLA 1C1PA 3D23A 1C1TA 3T28A 4KTUA 1CBWB 2C90B 4TSFD 2D26C 1W11U 1C2IA 5E2OA 1SFIA 5EXNA 1YGCH 1MTVA 3OAAD 4WVPE 3PRDA 1A3EH 2FM2A 1TGCA 2SGAA 1A0LA 4Q2KA 1TRYA 3PLKA 4D7GA 1Y5UT 3OYPA 2CHAB 1EOLA 4B2AA 1K28D 1RIWC 1YWUA 2SGDE 5LGOA 1VCPA 3ZZ7A 5IK2D 2ZU2A 3LGUA 2Q6GA 3RLWH 1O30A 2PGBB 3PB1E 4B2CA 5GJ4B 4XOJA 1C5RA 5F8XA 1NRRH 5HIZA 4DVAU 1WTHD 3BTEE 1SLUB 2CXVA 1GCDA 1CA0C 1XKBC 1CGHA 3QGNB 3QWCH 3W94A 1OP8A 3R0FA 1J15A 2QGRA 2CK3D 2FI5E 3SN8A 5E8EH 1FY8E 2P8OC 2YNBA 1C2KA 2FZZA 1AGJA 1HAHH 3V13A 3PROA 4X6MA 2ZG0H 2NU2E 1AHTH 1C5WB 1O5FH 2AEIH 3E1XB 3LGTA 4ESTE 1DITH 4H6SB 1OP0A 4OS7A 2XYAA 1LTOA 1UTJA 3LC3A 3MHWU 4CRCA 3RXPA 3PRBA 4RSPA 3I29A 1A5IA 2G81E 1RD3B 1DUAA 2TGPZ 4FUDA 4TWYA 4WMDA 4B75A 4NZQA 1ZJKA 3EA9A 4Y11E 5A8YA 2ZQ2A 4INLA 1IHSH 2UWPA 1W2KH 4XBDA 3SJOA 2GP9B 1KYNA 5FX6A 4XSKU 2Z9GA 4K2YA 1C5NH 2ZHDA 4MVNA 2BMGB 1O0DH 1AN1E 1MKXK 2L6OA 3VXFH 9LPRA 1AWFH 1TMBH 1TNLA 5A0CA 2AMQA 1A4WH 1O35A 1O2JA 1AVGH 5E0HA 2BDAA 3RXHA 4MPXA 1SOZA 5K7RA 2WV9A 4A1VA 1TGNA 2Z6BD 1NN6A 1OHHD 5C67A 3F9HA 3FZZA 3MU5A 2R0KA 4IGDA 1BTZA 2A7HA 2SGEE 2XXLA 2Z7FE 5FHTA 1OYTH 2UWLA 3E16B 5JBCS 1VJ9U 5JYIA 1S6HA 1LPGB 5ESBA 2ZHFH 1S0QA 1Y5AT 2XOKD 3TNSA 4K3JA 1O2TA 5SGAE 4K5ZA 3NCLA 2NWNA 2FLBH 1TX7A 1W12U 2Y81A 3UNQA 1GL0E 2KAIA 1GJDB 3QZRA 2SGQE 1KIGH 1PQ5A 3LJJA 1F0UA 1ZR0A 4ZH8A 1UTLM 1GHBF 4FUFA 2OCVB 4CRDA 6GCHG 2GT8A 3RXQA 1QA7A 1RRKA 4Q7ZA 5DG6A 4FU8A 4HTCH 4I33A 5FX5A 3BEUA 2JDID 3P95A 1F5RA 1V2UT 2Z3CA 1V2VT 3ELAH 3LPRA 1IAUA 1OWIA 2AGEX 2PKSB 1O31A 4FUGA 1SBWA 3VFEA 3A7YA 2R0LA 2ZIQH 2J97A 1GBHA 1A5GH 1Z1JA 3QO6A 3TITA 2JKHA 2RG3A 4INHA 1VITH 3SGQE 3PLBA 4YM9A 3RC4A 1EXFA 2HWLB 4XD7D 3ZVDA 2BY8X 1H8ED 4INKA 2KX4A 2XCFA 2KCAA 3NPSA 1ZHPA 4BNRA 3U8TH 3V0XA 1E0FD 4NGAH 4Q4LA 1GVZA 2VIDA 2FIRH 1LVOA 1T7CA 1AMHA 1KXDA 1PYTC 2C8YB 3RU4T 4B1TA 3RXTA 2G5NA 2ZKSA 2VIPA 3T62A 1E1QD 1SMFE 1F0SA 1MQ6A 1OKXA 4CRAA 1G9IE 3GCOA 4BTUB 1P09A 4AG2A 1P12E 1YPEH 3BTGE 1Z6JH 5JBAS 4NCYA 3M36A 3GCTG 2ZWLH 3BTWE 1P2NA 2BXTH 2VGCC 3LH1A 1TYNA 2WSSD 3F9EA 1FPCH 1D3TB 2OD3B 3RXLA 2ZEBA 1HRTH 3GY5A 4DOQA 1O3KA 2F9NA 4WMFA 3HKIB 1CHOG 2H9EH 2ZP0H 5HM2A 5GNDA 1SLXB 2H9HA 3SORA 4CREA 1GI9B 1KLTA 2A4RA 1BJVA 2PWXA 2HALA 1XM1A 2DE8A 4RT1A 3KYFA 3GICB 3MH4A 3RUOA 1AD8H 1MTSA 1PQ7A 1DLKB 1TBZH 2RDEA 4O3TA 5FXLA 4I32A 1V2QT 1KXBA 1O2UA 1TQ7B 2GZ7A 1XVOA 2VIOA 1H8HD 2L74A 2OC0A 3F68H 3T26A 1Z6EA 1NY22 1O2ZA 1UTOA 3MH5A 4B76A 1C5SA 3QGJA 3EAJA 1C5PA 7KMEH 3SUEA 3V3MA 2QF5A 2LNCA 4WMEA 1HDTH 1LKAA 1O3HA 2EI7A 3TH4H 1VGCB 1NU7B 2Q6FA 4OGXA 3FANA 1KLIH 1SLVB 4GCHG 4IN2A 5DJ7A 3VB4A 2FYRA 3QX5H 3KEEA 1RS0A 3IWMA 4NIVA 1OXGA 1DWEH 1FXYA 1CT0E 1C2EA 2J2UA 3MH7A 3SZNA 4CBOA 1ARBA 4KGAA 2AMPA 5EW2H 1MKXH 1UVTH 2M5TA 3T2NA 5DKMA 1FY1A 2I6QA 3P8NA 4AFZA 1C5TA 2EQNA 2J94A 4NSVA 1QNJA 1AFQB 1MTWA 2ZU5A 4KTCA 2SFAA 1AUTC 5EODA 3ODDA 1KDQA 1L1GA 1O3OA 1WCZA 3U98H 3ATWA 2A4OA 1T31A 4JK6A 1QY6A 1F5LA 4ABDA 3MNSA 1BMNH 3TJNA 1OSSA 2K1QA 8ESTE 2C93B 1TE0A 2ZO3H 1P01A 4UFDH 3S69A 1YCPM 4CBNA 2TGTA 2FMJA 5FBEA 1O2HA 1CBWC 4Q63A 4I8JA 3H7TA 4X8UH 1IQHA 1QB6A 3SI4H 3QTVH 4KKDA 1C1SA 5J4QA 5EIYA 1O2QA 4CRFA 1YM0A 5FPYA 2XWBI 1SQAA 4FVBA 5GWZA 5ETXA 4BAMB 1L1NA 1T8MA 1SGDE 2NU4E 1O2SA 1Y3YA 1VZQH 1TONA 1V2ST 1EASA 2C4FH 4F49A 1HAIH 2JH5D 1BBRK 1LDTT 2Y7XA 1M9UA 1P9UA 2XBYA 3GCHC 1DS2E 1EP6A 3KQCA 2P3TB 1HAXB 2BQ7B 1HXEH 3O8DA 2F3CE 3VB5A 1QRXA 2NU1E 5HYOA 3M37A 6CHAB 4IC6A 1O37A 1QTFA 1TA2A 1NBMD 2DE9A 1BTXA 1O3IA 4DW2U 3VGCC 4ABEA 3N99A 1HJAB 3M3TA 3UAIC 2SGFE 3MO3A 1WUNH 3EE0B 3FAOA 1V2OT 2OQ5A 3MNCA 5PTPA 1CE5A 1HUTH 1O2WA 3SV9A 1D3DB 1BZXE 5FL7D 5GXPA 5G4BA 3SBKA 2TRMA 1O3NA 5EPYA 1SC8U 3RXMA 3M35A 4ZXXH 2VWLA 4AG1A 3PYHA 1SGFA 1PPZA 3Q00A 2J98A 1P57B 2QN5T 4ISIH 4A92A 4CHAC 1O2KA 4JZEH 3SHAH 2GJGA 3RC5A 1GI4A 1P2OA 5L2ZH 3HGNA 1LVYA 1GVKB 4BTTB 1YPGH 3RXIA 1QL9A 2VVCA 2ZZUH 5F8ZA 8LPRA 1ID5H 3ODFA 1AFEH 3DUXH 2ULLA 4YLUA 2V35A 4A1TA 1FN8A 1JBUH 3L3TA 3GY4A 1GJ6A 1MTNB 1A5HA 4MPUA 1E79D 3A8AA 4R8TB 3FVFB 4NA7A 4K69A 1KY9A 1GJ8B 1ZGVA 2PHBA 1BIOA 1NS3A 2OLGA 3M5OA 1A2CH 1BITA 4KELA 3B9FH 1P2MA 3UQOA 3AW1A 2O8UA 2G4TA 2WPMS 3BV9B 1GGDB 4UFEH 3FN8A 1THRH 1YPKH 4BXSA 2BOKA 2KFWA 3OY5U 5C17A 3PMHB 1GMCF 1UK2A 1JRTA 3O8CA 2Y5FA 2H5DA 4P00A 2A2QH 1C1WH 4J2YB 2VH6A 2THFB 2OC7A 4JMYA 3E0NB 4YESB 1CHGA 3M3SA 1SQRA 3KQDA 4GHQA 2BDYA 2H5CA 2ZHQH 2VINA 1J17T 1O3MA 1SKYE 3AW0A 3BTME 1C5YB 1XXFA 2J95A 3O8BA 1NESE 1UHBA 1SFQB 1VR1H 1XVMA 2H9TH 2RCEA 4UFFH 5L2YH 3UTUH 2XBVA 1DOJA 1EZQA 2QF3A 3FOAA 1IQIA 1S6LA 1EPTB 1RXPA 1DLEA 1XUJA 2FPZA 2TIOA 3V12A 3KL6A 2VWNA 3BG4C 1C5VA 4JZ1A 3S7KB 3A80A 3UOPA 2BB4A 1Z1IA 2IPQX 1CA8B 3OX7U 3TPIZ 2HLCA 2WYJA 4B73A 2YMSB 5A0AE 1S85A 3GY7A 3BTHE 3HK3B 1PQAA 2BD3A 2ANWA 2QAAA 2C8WB 2GCHG 3IITA 3QN7A 3RM0H 1YPHC 4X1PU 4VGCC 1TBRH 4H42U 4E05H 3TGKE 3SU4A 1GBDA 1AU8A 1K1MA 4GHTA 3SJ9A 1BB0B 2CGAA 1YYY1 1V2TT 2EC9H 3SGAE 2YOLA 2R9PA 3TH2H 1GI2A 1DT2A 1W0JD 2J98B 3DHKH 2F83A 4FUIA 5LPRA 1A0JA 1V2RT 4X1SU 1C5QA 1KXFA 1GI1A 4AC9A 1NBME 4FVDA 2F9BH 1TNGA 3E6PH 1ZMJA 4Q80A 1PFXC 3K6YA 1WXRA 5DPAA 4MNXA 1V2JT 1JIMA 1WBGB 4RKOB 5C94A 1EATA 1ZRKA 1C2HA 4I8HA 1Q2WA 4I7YH 1ELEE 1MZAA 1YCPK 3I77A 1GI3A 2KCYA 2A1DB 1RTLA 1DUEA 2PLXA 4PROA 1C9TA 1XUIA 2XCNA 2M2AA 4TYDA 1BTHH 3RXFA 3AAVA 2BDHA 1CQQA 1IQKA 1LPKB 2W7UA 4B6EA 3QDZB 1TNIA 1P2IA 1K21H 2H6MA 3BEFB 4Y76A 3TNTA 4JZIA 3K2UA 1ABJH 1QA0A 2AIPA 1K1IA 2EA3A 4Z0KA 3NXPA 2QE7D 5FCRA 1VCQA 5EQSA 1JMOH 1BBRH 3FP7E 2AYWA 1K1PA 4Z6AH 1GJ5H 2CN0H 5EJLA 3SU0A 1YPMH 1UVSH 2AFQB 4X8SH 3A8DA 3O8RA 5LPFA 2SNWA 1RTFB 1HAGE 4ZCNA 2W3KA 4WY3A 4O3UA 3KNXA 2H2ZA 4YO9A 1FAKH 1SHYA 2STBE 4UEHH 2PP6A 1DANH 3QZQA 3KQ5A 2FODA 2ZFRH 2PUQH 2WPHS 3IG6B 1O5DH 1Y59T 2KZ4A 2ASUB 1C4U2 3SV6A 3OTPA 4K1TA 2R3YA 1P06A 1P8VC 3EYDA 2YMSD 1OWJA 3ATKA 2ZFPH 1MTUA 1GBIA 3OFND 4K60A 1QL8A 3ZYDA 3NK8A 3PO1C 1OWHA 2Z9IA 4ABAA 3N7DA 1WSSH 1E37B 4YT7H 1C1RA 2XC0A 1Y5BT 3TJUA 5HGGA 3SNEA 7ESTE 2HNTF 3CENA 3I78A 1HV7A 3HGPA 3SNCA 4DT4A 2ZCLP 4ABGA 3F2GA 4SGBE 1AKSB 1FN6A 2GZ8A 3T5FH 4DURA 5I25A 1ZGIA 4D8NA 5EU8A 4NIWA 2O8MA 3OTJE 2G00A 4MPWA 4ASUD 3GOVB 1P10A 2Y5HA 2V3MA 4Y0YE 3ZYEA 1T32A 3EA8A 3STIA 4QT8C 3RM2H 2PTNA 4AX9H 5EQRA 4RN6A 2J4IA 5GCHG 1SOTA 1BTUA 1T4UH 2HNTC 3PV2A 8GCHF 3LOXA 3MQKC 1B0FA 1AQ7A 1P02A 3HPTB 3SUFA 2FXRA 1IQLA 3K9XB 1XKAC 2OP9A 6GCHF 1O3LA 1ZRBA 5C1UA 1ESAA 5F6MA 5CHAB 4AGJA 3F2FA 3VXEH 2F4LA 3TJOA 4MPVA 1O2GH 1NRPH 3MNXA 3G01A 3NRLA 2TBSA 3RXCA 1YLDA 4X1NU 5C5NA 2Q6DA 1TBQH 3A82A 3RXVA 1SGIB 3FKSD 1MD8A 1LVMA 4B74A 1HAZB 1TQ0B 4D7FA 3PWBA 3OEED 5JDUB 1MABB 5A0BA 2BD4A 5DP9A 1GCTC 2G51A 4O97A 1W13U 4DJZB 2H1UA 1YPLH 2FOCA 1Z71A 6CHAC 1O3GA 4HGCA 3UPEA 4OS4A 2XNIA 4ZHAA 5CMXH 1DE7H 7GCHG 2V3OH 4MNVA 2ZFFH 2FI3E 2ZDAH 5EPNA 2ZGCA 4MTBA 3B23B 2ZECA 1TPPA 5JB8S 4BTIB 2FS8A 1FLEE 2PGQB 1DSTA 2XWAA 1DXWA 4NA8A 4JCNA 2WPJS 4Y6DA 1TOCB 1QQUA 1H4WA 4MNYA 4OS1A 3P8FA 3SHCH 1BTWA 3F0PA 4XFQA 1GI8B 1P2JA 1S5SA 1GMDG 1AZZA 4ABBA 2P59A 2K0QA 1QR3E 2C8XB 1OPHB 1GG6B 1CHOF 4HZHA 1LHEH 1G32B 3WWBA 1YCPH 3SU1A 1EJAA 2Z3DA 4XRNA 1TGSZ 1AB9B 2BY5X 2JETC 3JZ1B 4Y0ZE 1PPCE 1A3BH 1DX5M 1S0RA 2BY9X 5LPEA 2QF4A 6ESTA 1WTGH 5C3NA 3MO6A 4K1EA 1XUGA 1HIAA 1C1QA 1F5KU 1E35B 1O33A 2HRVA 3A81A 1Y3XA 1O3DA 3DFJA 1V2LT 3PM3A 3S7HB 1H9LB 1ZZZA 3ZZAA 1O2NA 1GI6A 5B6LA 1UO6A 3M5LA 4FUEA 2O8TA 3LGVA 1RFNA 3ZZ4A 1K1LA 3UFAA 4JZDH 2Y7ZA 3A7VA 1DDJA 3E90B 4JYVH 4Y8YA 1DY8A 5I46H 5T1VA 1THSH 1ZTKA 1FY3A 3M5MA 2Z9KA 1EFRD 4NIYA 4Y79A 2CF8H 3LGYA 1NU9A 1YKTA 2VIVA 3L6PA 3FZDA 3SYJA 1HAVA 2B8OH 2TGAA 3PLPA 1JOUB 2P16A 1WDIA 3RMLH 1QJ7B 1GJ9B 1L2EA 4GCHF 2J9NA 1NFYA 1ZTLA 1DSUA 1ELGA 1H8IH 4F4OC 2GCTB 2ZDNA 1TFXA 3UR6A 4CRBA 1EUFA 1QBNA 1CT2E 1KXEA 1BHXB 2AERH 2WUCA 5DP6A 1KMHB 2FLRH 4FUCA 1VITG 1QJ6B 2G4UA 4DT7B 1ZJDA 2VVVA 3F2HA 1ZSJA 4I8LA 3MU0A 1EJNA 2F9PA 3RU4D 3A88A 3FFGA 1EQ9A 3E0PB 4WJG2 1PPGE 8KME2 4ACBA 3RXKA 2ZQ1A 3Q76A 1GI0A 3RXJA 5FPSA 1NFWA 3C1KA 4AB8A 4AYYB 1GDQA 2WUBA 2ZCKP 1TNHA 1BTPA 2STAE 5DO4H 3DSOA 2KAIB 5DK1A 5B6OA 1GBFA 1CVWH 1V2KT 2VIWA 1J9CH 2LP6A 1GBCA 3SUGA 2UUYA 1G36A 2ZU3A 4MG3A 1AE5A 1FIWA 2FP7B 1YF4A 2W3IA 2FEQH 2GKVE 4IC5A 3SZEA 1EAIA 1D4PB 2CV3A 4IBLH 4Y10E 2ZU4A 1BOQA 3U9AH 5F03A 3M7TA 4OGYA 5JBTA 2FX6A 1EAUA 2GDDA 2EI8A 1G2MA 2PV9B 1ORFA 1Z8IB 2KCPA 1HFDA 2B7DH 4I31A 1SGFG 1UTQA 1EAXA 2ZFSA 3SQEE 2QXGA 1G30B 1RIWB 1GDUA 1MCTA 1PQ8A 3OSYA 4TPIZ 4UDWH 1ELFA 4KTSA 3ATMA 3WY8A 1V3XA 5J4SA 1UMAH 1QJ1B 2IN2A 2J5UA 1GJ4H 1O38A 5BPEA 2DUCA 3LGIA 2WHXA 2GMTB 3T27A 2ZGHA 1AVXA 1HAVB 1W0KD 5AVDA 3TGJE 5T3HA 1CA0B 1B5GH 1N1LA 1N8OC 1GI5A 2ZU1A 1B7XB 1DWBH 3KF2A 4K8BA 1GBKA 2QYIA 4A6LA 2OTVA 4UONA 1X7AC 2UUFB 2WV4A 1DPOA 3U1IB 4Y8XA 1ZYOA 2P8OB 4IN1A 5L30H 2HVYB 4WWYA 2Z9LA 1AIXH 1SVPA 2W5EA 2CHAC 3P8OA 1HCGA 3BF6H 3RXUA 1YPJH 1Z8GA 2PTCE 4AGKA 3SI3H 1QCPA 2J92A 4ASHA 1HGTH 3MMGA 2GGVB 2VH0A 4NIXA 2K8IA 5ESTE 1XUFA 2D1JA 2HPQH 2R3UA 1W14U 5DP5A 2ZNKH 2FO9A 3LKWA 3LU9B 1O5CB 4CR5A 3BIVH 1GHAG 3DFLA 3EGKH 2OC1A 1JXPA 5KGOA 3BTTE 4O9VA 5DN6D 4X2YA 2G55A 3ZVEA 4Z1MD 3VPKA 1GWAA 2QXIA 1FNIA 3SW2B 2FYQA 1V2NT 2R2MB 3URCA 4AFQA 3EDXB 1HJ8A 3DT0H 2FTLE 2FX4A 3LONA 4FETA 1EB2A 1GVLA 2ZDVH 4ZUHA 3RXAA 1D6RA 1W0ZU 3RU4E 4D9RA 4IW4E 2A7CA 1BTYA 4TY6A 1DICA 5EQQA 1C2DA 1UTKA 1E38B 4UD9H 3QLPH 4ISNA 4GPGA 1F2SE 2Y80A 1JIRA 1TGTA 1IQEA 2ZHWH 5A09A 2B0FA 4A1XA 1Y3VA 1UVUH 3LIWA 3SUDA 1GHYH 4F48B 2RFKC 3KCGH 4BAKB 3N7EA 5C0UA 1YLCA 1SI5H 1LCYA 3GYLB 4A5TS 1ZMNA 3BTFE 4RKJB 1JWTA 2WYGA 3LDXH 1AY6H 3KQBA 3F6UH 1HYLA 2XW9A 1FV9A 4U01A 1ANBA 2BLWA 1W3CA 3SU3A 1KDQB 2IJD1 4GVUA 1ZLRA 1TWXB 1YBWA 3NUMA 4NFEA 1MBQA 1O3EA 2FOMB 1WU1A 2GCHF 3HK6B 3BTDE 1ARCA 2GTBA 2PFEA 1EP5A 5FPTA 2AGIX 3RDZA 1MAYA 2ESTE 3MU4A 1IQGA 3ZZ5A 3JZ2B 2LELA 1H8DH 2ZPQA 1GJ7B 1GBMA 2ZF0H 2SGPE 4HFPB 1QIXB 5EGMA 2BVXH 4RI0A 2BLQA 5AHGH 1ETRH 1QGFA 1WQVH 4R0IA 4I8GA 3VEQB 1QRWA 2BDBA 4AFSA 3F1SB 1ZSLA 3RXDA 3S9BA 1W0YH 4MNWA 4WXIA 1F0RA 4X8TH 2XTTB 1P2QA 1SHHB 4OS5A 3UNRA 2BX4A 1GBAA 2D8WA 1TA6A 1TX6A 2Q1JA 3RC6A 2JH6D 1PPFE 3MNBA 4BXWA 4ZMAH 1SQTA 5JBBS 4Y7BA 5TJXA 2P3UB 3FP8E 1HAYB 2BOHB 2PKSC 2ZDMA 5JPMH 4YZUA 1O2MA 1XXDA 2IOTA 3SNDA 1MU6B 1TGBA 1UTPA 1BA8B 5C5OA 2OQUA 4F55A 1GBBA 1SLWB 1SPJA 4YLQH 2BVRH 2ANKH 1ANDA 2BLOA 2WPLS 1GBJA 1HPGA 1GDNA 6LPRA 1Z8JB 3ZZ9A 2F9UA 2VU8E 1SGRE 1LPZB 3A7TA 3Q3XA 1TLDA 3NKKA 4GSOA 1MH0A 3S9AA 1HAPH 3BG8A 1O5GH 2BLVA 3ZVBA 1D6WA 1LQDB 1ZHRA 1O3BA 1BBRE 2BYAX 1H1BA 3OY6U 4TT3D 3GDSA 3ZVCA 5C1XA 1ZSKA 3NWUA 4CR9A 1GMHG 3M7UA 7LPRA 3UREA 2BX3A 1O3AA 2B5TB 4ABFA 1LHGH 3KN2A 2FOEA 2UUJB 4YOJA 4D76A 2BHGA 2P95A 4DG4A 2FOHA 3TIUA 3RXRA 2GT7A 3ZIAD 1ZOMA 2JJ1D 1SR5C 3T25A 3FO8D 1C5ZB 1GJAB 1BRAA 5HIYA 1UJ1A 1C1UH 2EEKA 2FOFA 2KR7A 5A2MH 2ZTZA 2GV6A 4RT0A 1BQYA 2OINA 3VB7A 3UQVA 2ZGXH 2JJ2D 2AGGX 2O8LA 2A5AA 2V6NA 1GHXH 1MZDA 3GYMA 4WF8A 4NWKA 4GLYA 4NA9H 4LOYH 2OXSA 1LHCH 1INCA 3E3TA 1DWDH 2AMDA 4DCDA 1AUJA 1Z7KA 5T6GA 5L6NH 1C2FA 2AIQA 1C4V2 3A89A 3ZZCA 2RA3A 2XBXA 2A5IA 2A2XH 4ABIA 4Q7XA 1PYTD 1QL7A 1TPAE 1W7GH 4AFUA 3OU0A 4CRGA 1C9PA 2QIQA 1OYQA 1FPHH 1AWHB 2ZTXA 3P6ZB 3BIUH 5A8ZA 5GCHF 1TPOA 1FJSA 1UHBB 2A32A 2A45B 3QUMP 2ALPA 1MQ5A 3L33A 1QURH 1J8AA 1RGQA 3OEHD 1ANCA 3MU1A 4LXBH 3SU6A 2VJ1A 1O2YA 4UE7H 5C2ZA 1AE8H 3DSGA 5DP3A 2QV1A 4AN7A 1TABE 1VGCC 1EZXC 2FWWA 2VIQA 1ELTA 1RJXB 1DXPA 3A84A 1HNEE 2XBWA 2CF9H 2OBOA 3F0OA 4ZHMU 4WXVA 4I8KA 5EOKA 1NRNH 1SGCA 1N6XA 1OWEA 1OX1A 2FS9A 1XMNB 1YC0A 1ZTJA 5AF9H 4IMQA 1UK3A 1FONA 1ZPZA 1Y8TA 2A0QB 1BDAA 4ISOA 2JH0D 2BM2A 3ZZ3A 2ODYB 1BT7A 4GUXA 1T8LA 3Q3YA 3F9GA 1ELAA 2G8TA 1O3FA 1AFQC 4K1SA 5C20A 2G52A 1B0EA 2BD5A 4LZ4B 1P04A 2CJIA 3Q77A 2OUAA 1E34B 3CP7A 5F53A 1K22H 1C1NA 2GV7A 1VCWA 1P2KA 1NRQH 2FTMA 7GCHF 3MH6A 3GCHB 2ODPA 1TMUH 2HGTH 1BUIA 1GBLA 2A5KA 1G2LA 3GY3A 2HLDD 3UOUA 1WYKA 2GMTC 2NU0E 1BRBE 1C1OA 1IQFA 2F9VA 1O2VA 1K2I1 1KTTB 1OS8A 1Y3WA 2W6ID 3A87A 4OS6A 3VGCB 3STJA 4YT6H 1GMDF 3ZVFA 3MTYA 1O2OA 3D65E 4A7IB 1IHTH 1FUJA 1H9HE 1GHZA 3ESTA 1BMMH 2FOGA 3K6ZA 1YY3A 3ENSB 3D62A 1C5MD 1C2LA 1NZQH 3SU2A 5C0TA 3CS0A 1S83A 4CHAB 1SL3A 2ZI2H 3LC5A 1Z8RA 1PPEE 3MI4A 3VG8A 1A7SA 2PW8H 2IPHA 2WV5A 2BD7A 2EY4C 1MU8B 1J14A 1TALA 4XBCA 3RXGA 3UR9A 1F7ZA 5AFZH 2QF0A 3DA9B 2HVXA 3EE7A 3A85A 3WWFA 5TCCA 3GY2A 4NFFA 4AOQA 1O32A 4ABJA 2Z3EA 3R3GB 1HJAC 4TWWA 2ZHEH 3AK5A 4M9FA 4X6OA 2A31A 3A7ZA 3VB3A 2V7QD 4ISHH 1TB6H 1S6FA 2F43B 4OM9A 3GCTF 1YLNA
chains in the Genus database with same CATH topology
1UW7A 5HIYA 5C94A 1QZ8A 2J97A 5HIZA 2J98A 2J98B 3EE7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UW7 A;  5HIY A;  5C94 A;  1QZ8 A;  2J97 A;  5HIZ A;  2J98 A;  2J98 B;  3EE7 A; 
#chains in the Genus database with same CATH topology
 3KHV A;  3UUZ A;  1P03 A;  3LT3 A;  3W95 A;  2HPP H;  4LK4 A;  2BQW B;  1BMA A;  4ISL A;  4YTA A;  3A8C A;  3UIR A;  3URD A;  2W6J D;  4X1R U;  4X2W A;  2ZFT A;  5ABW A;  3UWJ H;  5EG4 A;  4B71 A;  5GDS H;  1UTM A;  2P94 A;  2QXH A;  2ZCH P;  3A8B A;  5K0H A;  1VIT F;  2BVS H;  2OK5 A;  1FZZ A;  4JZF H;  8GCH G;  5HXF A;  2ZPR A;  1BRC E;  2XRC A;  4YXW D;  1QRZ A;  2WPD D;  1MTN C;  3RP2 A;  3MU8 A;  1GBT A;  4ZKO U;  1UCY K;  2GDE H;  3P8G A;  4HG6 A;  1WAY B;  2NU3 E;  2YNA A;  3P17 H;  1EKB B;  4X6P A;  1NRO H;  3TH3 H;  5CHB A;  3BG4 B;  4X6N A;  4IS5 A;  1F92 A;  1GGD C;  1CU1 A;  4FOU C;  1NTP A;  5E0J A;  3S0N A;  1ZPC A;  2ODQ A;  3TGI E;  1W7X H;  4D9Q A;  1NFU A;  4ZKN U;  3SJI A;  1DFP A;  3GY6 A;  3N7O A;  1EST A;  1OOK B;  3ZZB A;  1LKB A;  4YOG A;  3KQE A;  1LHD H;  4TPY A;  1NM6 A;  1G3C A;  1Y3U A;  1IQJ A;  3MFJ A;  1N6Y A;  4U30 A;  1P3C A;  1O3P B;  1AZ8 A;  4VGC B;  2ANM H;  5CE1 A;  2W7S A;  1GHV H;  1TMT H;  5KED A;  1SSX A;  3ZZD A;  1WQS A;  1A61 H;  2KM0 A;  4M7G A;  2A7J A;  4BOH A;  1U6Q A;  1LHF H;  1AVW A;  1UTN A;  4GAW A;  3BTK E;  2D2D A;  2PSY A;  1BRU P;  1SGT A;  2V3H H;  1COW D;  1ELV A;  4OS2 A;  1EPT C;  2BD9 A;  2O8W A;  1CT4 E;  4TY7 A;  1W10 U;  4FUJ A;  1EJM A;  1NT1 A;  1P9S A;  2BXU H;  4K8Y A;  1SGY E;  1O2P A;  1EZS C;  3E8L A;  3NZI A;  1GHB G;  5EJ1 A;  4DY7 B;  3ZV8 A;  2Z94 A;  2YMS C;  1P3E A;  3E91 A;  3MWI U;  3VB6 A;  1A0H B;  2FOB A;  1S82 A;  3BSQ A;  4ABH A;  1MKW K;  1G3D A;  4X8V H;  3QK1 A;  1ZPB A;  2VBC A;  4Q7Y A;  1FQ3 A;  2GD4 B;  2J34 A;  2BDC A;  2TGD A;  3FP6 E;  3EQ0 H;  3LJO A;  1P0S H;  1YP9 A;  2SNV A;  5LH8 A;  1V6D A;  1H9I E;  1F0T A;  1AO5 A;  1K1O A;  5F8T A;  3PV4 A;  3HAT H;  2XND D;  3SV2 H;  5FCK A;  2A4G A;  1V2P T;  4Y8Z A;  3ZZ6 A;  1AI8 H;  2BQ6 B;  1ABI H;  2WIN I;  1KXC A;  1TNK A;  3DD2 H;  2AHM E;  1HLT H;  3UWI A;  4THN H;  1IQN A;  1EZU C;  3RXB A;  3H5C B;  2BDG A;  3BEI B;  4O03 A;  3U1J B;  4XBB A;  3Q3K A;  2Y82 A;  3SJ8 A;  2XC5 A;  2Y6T A;  4AYV B;  2Y5G A;  2I6S A;  1V2W T;  2FOA A;  1GI7 B;  1HIA B;  4FU7 A;  2ZA5 A;  3K65 B;  2VVU A;  3GCN A;  1GHA F;  1PPB H;  2PUX B;  3MO9 A;  1UVP A;  3BN9 A;  1JRS A;  1O2I A;  1O36 A;  1T4V H;  2PKA A;  3CS7 A;  3DCL A;  3PO1 B;  4U32 A;  1G3E A;  4FXG H;  3PTB A;  3RMO H;  3KID U;  1SG8 B;  1SGE E;  1ELB A;  1O3C A;  4YOI A;  1EX3 A;  1P05 A;  3U28 C;  4B2B A;  3TK9 A;  1ELC A;  3ATI A;  2V0B A;  1UVO A;  1G3B A;  3A7W A;  5EW1 H;  1J16 A;  1GHW H;  1KLJ H;  3SGB E;  4WH6 A;  3OE7 D;  2GVF A;  4MQA A;  1S84 A;  3SO3 A;  2RDL A;  3A86 A;  4BAO B;  3D49 H;  3GDU A;  3MYW A;  3GDV A;  1SGN E;  2ZPS A;  1FIZ A;  3TJV A;  1IQM A;  4E06 H;  1UCY E;  1D9I A;  2GZ9 A;  3ZZ8 A;  1C5U A;  1O5A B;  1E1R D;  1WOF A;  1L0Z A;  2BTC E;  3P70 B;  1QBO A;  5HM9 A;  9EST A;  3T29 A;  2JIZ D;  3RLY H;  1TX8 A;  4ZKR U;  3RXE A;  3SJK A;  4B6F A;  3TLO A;  3RXS A;  1GJB B;  1D3Q B;  1FX0 B;  1LMW B;  1SB1 H;  3LH3 A;  3W1E A;  2BZ6 H;  1C5L H;  1CSO E;  3H7O A;  4X0W U;  2R2W U;  1NO9 H;  2ALV A;  1GL1 A;  4E7R G;  3PMB B;  1MCV A;  3ZV9 A;  2BZA A;  1UW7 A;  1W8B H;  2FDA A;  2WZQ A;  3P92 A;  1BMF D;  1VKY A;  1HXF H;  2QA9 E;  2QCY A;  1MMJ N;  4UFG H;  3LGW A;  3RXO A;  1OWD A;  2VWM A;  2WPI S;  4CH8 B;  1UCY H;  2FI4 E;  2XC4 A;  3SOS A;  3ATL A;  4ZRO A;  3ITI A;  1NFX A;  1FMG A;  3V7T A;  4J1Y A;  4NSY A;  4ZAE A;  4X2V A;  1LO6 A;  3U8R H;  3M3V A;  1O34 A;  2BD8 A;  1D3P B;  5KEC A;  1E36 B;  2ZDL A;  1EPT A;  1O5B B;  3PV5 A;  1MD7 A;  1K1J A;  4Y7A A;  5AFY H;  1ESB A;  4ACA A;  1GCT B;  3F3B A;  5E0G A;  3AVZ A;  2OBQ A;  1Q3X A;  2IJO B;  5DP8 A;  4SGA E;  5EJZ A;  1C4Y 2;  1HJ9 A;  1BCU H;  1KXA A;  1HBT H;  1ZHM A;  1SGQ E;  3M5N A;  4MDS A;  4BAH B;  3PWC A;  1C2M A;  2F91 A;  2J38 A;  5A8X A;  1NPM A;  5CHA C;  4LZ1 H;  1LQE A;  1V2M T;  3S9C A;  4JYU H;  3PMA B;  1P11 E;  2AH4 X;  1G37 A;  5IYT A;  1GJC B;  4NG9 H;  4P02 A;  5C1Y A;  3TK5 A;  4BAQ B;  1A1R A;  2PKA B;  3UB0 A;  1XUH A;  4NZL A;  5DGJ A;  3SV7 A;  1FY4 A;  1KSN A;  1TNJ A;  3RMM H;  2O9Q A;  2UUK B;  1C5X B;  1ETT H;  3KGP A;  1TAW A;  2ILN A;  2RA0 A;  2VB0 A;  1BML A;  1C2J A;  4FUB A;  5H4I B;  2KCO A;  3U8O H;  1PJP A;  1K9O E;  1DVA H;  3UNS A;  2Z9J A;  1QQ4 A;  1EAW A;  1CGJ E;  3H09 A;  3ZVG A;  4U2W A;  2ZGB H;  4H4F A;  2OC8 A;  1O2L A;  2ZFQ H;  2WPK S;  2JET B;  1C1M A;  2LPR A;  1TIO A;  4Y71 A;  2GX4 A;  1OWK A;  5FBI A;  1C2G A;  1MKW H;  5DP4 A;  1KTS B;  1TRM A;  4HI3 A;  1QFK H;  1GMH F;  4CH2 B;  1O5E H;  1YPH E;  1QB9 A;  4BAN B;  1XX9 A;  2AS9 A;  2P3F H;  4H6T A;  2C8Z B;  2CMY A;  4AB9 A;  2ZC9 H;  1A46 H;  2PSX A;  2ZTY A;  3TU7 H;  3QTO H;  1TRN A;  4IMZ A;  4JK5 A;  3GIS B;  1RTK A;  5GPI B;  1O3J A;  5TCA A;  4ZHL U;  2BY6 X;  1WV7 H;  1CGI E;  3M61 U;  3ZVA A;  1GG6 C;  5FAH A;  1NC6 A;  3TVJ B;  1K1N A;  4AOR A;  3SQH E;  2VGC B;  1ELD E;  1AB9 C;  2QC2 A;  4WH8 A;  4I86 A;  4ZXY H;  4E7N A;  2G5V A;  1IOE A;  4JYT A;  3C27 B;  3AAS A;  5EXM A;  4X2X A;  2ZDK A;  5BRR E;  3SNA A;  1HB0 B;  3TK6 A;  3SV8 A;  1S81 A;  3AAU A;  3MOC A;  2EI6 A;  3EA7 A;  1L4D A;  3M7Q A;  4KP0 A;  1BHX F;  3KYG A;  4NWL A;  2BDI A;  3B8J A;  5T6D A;  3F9F A;  2ZGJ A;  1O2R A;  1L1J A;  2W26 A;  1DY9 A;  1QZ8 A;  3PMJ A;  1MAX A;  1EB1 H;  3BTQ E;  1FAX A;  2BY7 X;  2VNT A;  2QXJ A;  1AKS A;  3DSP A;  2HOB A;  1FY5 A;  1GMC G;  4DGJ A;  1CO7 E;  1SQO A;  1O39 A;  1TPS A;  2A4Q A;  1UK4 A;  1NRS H;  1ACB E;  1ZML A;  4DII H;  4DIH H;  2VWO A;  2B9L A;  1VJA U;  2GCT C;  3A7X A;  5E2P A;  3GY8 A;  1FDP A;  4AZ2 B;  1XUK A;  1T8N A;  3PTN A;  5HKK D;  5T6F A;  1OP2 A;  1DWC H;  2FES H;  2QY0 B;  5GIB A;  4FUH A;  1PPH E;  1QB1 A;  3UY9 A;  1TOM H;  3SU5 A;  1HAO H;  3GS9 A;  1C1V H;  1THP B;  2BD2 A;  2P93 A;  1FI8 A;  4XDE A;  3HKJ B;  2F9O A;  5IDK A;  5JB9 S;  5DSF A;  1L4Z A;  4XE4 A;  1MUE B;  3RMN H;  1K0H A;  1T8O A;  1C5O H;  2C3S A;  1ETS H;  4ZKS U;  5DP7 A;  1BJU A;  1SGP E;  1ANE A;  3A83 A;  1QHR B;  1DM4 B;  3U69 H;  1GPZ A;  1MBM A;  1O2X A;  4FU9 A;  1EOJ A;  4X1Q U;  3SNB A;  1LVB A;  2UWO A;  4MLF B;  3CNR A;  5CDF E;  1Q31 A;  2TPI Z;  1GBE A;  3WW7 A;  1QBV H;  5HMA A;  2HNT E;  2ANY A;  1N8O B;  2PR3 A;  5EXL A;  1C1P A;  3D23 A;  1C1T A;  3T28 A;  4KTU A;  1CBW B;  2C90 B;  4TSF D;  2D26 C;  1W11 U;  1C2I A;  5E2O A;  1SFI A;  5EXN A;  1YGC H;  1MTV A;  3OAA D;  4WVP E;  3PRD A;  1A3E H;  2FM2 A;  1TGC A;  2SGA A;  1A0L A;  4Q2K A;  1TRY A;  3PLK A;  4D7G A;  1Y5U T;  3OYP A;  2CHA B;  1EOL A;  4B2A A;  1K28 D;  1RIW C;  1YWU A;  2SGD E;  5LGO A;  1VCP A;  3ZZ7 A;  5IK2 D;  2ZU2 A;  3LGU A;  2Q6G A;  3RLW H;  1O30 A;  2PGB B;  3PB1 E;  4B2C A;  5GJ4 B;  4XOJ A;  1C5R A;  5F8X A;  1NRR H;  5HIZ A;  4DVA U;  1WTH D;  3BTE E;  1SLU B;  2CXV A;  1GCD A;  1CA0 C;  1XKB C;  1CGH A;  3QGN B;  3QWC H;  3W94 A;  1OP8 A;  3R0F A;  1J15 A;  2QGR A;  2CK3 D;  2FI5 E;  3SN8 A;  5E8E H;  1FY8 E;  2P8O C;  2YNB A;  1C2K A;  2FZZ A;  1AGJ A;  1HAH H;  3V13 A;  3PRO A;  4X6M A;  2ZG0 H;  2NU2 E;  1AHT H;  1C5W B;  1O5F H;  2AEI H;  3E1X B;  3LGT A;  4EST E;  1DIT H;  4H6S B;  1OP0 A;  4OS7 A;  2XYA A;  1LTO A;  1UTJ A;  3LC3 A;  3MHW U;  4CRC A;  3RXP A;  3PRB A;  4RSP A;  3I29 A;  1A5I A;  2G81 E;  1RD3 B;  1DUA A;  2TGP Z;  4FUD A;  4TWY A;  4WMD A;  4B75 A;  4NZQ A;  1ZJK A;  3EA9 A;  4Y11 E;  5A8Y A;  2ZQ2 A;  4INL A;  1IHS H;  2UWP A;  1W2K H;  4XBD A;  3SJO A;  2GP9 B;  1KYN A;  5FX6 A;  4XSK U;  2Z9G A;  4K2Y A;  1C5N H;  2ZHD A;  4MVN A;  2BMG B;  1O0D H;  1AN1 E;  1MKX K;  2L6O A;  3VXF H;  9LPR A;  1AWF H;  1TMB H;  1TNL A;  5A0C A;  2AMQ A;  1A4W H;  1O35 A;  1O2J A;  1AVG H;  5E0H A;  2BDA A;  3RXH A;  4MPX A;  1SOZ A;  5K7R A;  2WV9 A;  4A1V A;  1TGN A;  2Z6B D;  1NN6 A;  1OHH D;  5C67 A;  3F9H A;  3FZZ A;  3MU5 A;  2R0K A;  4IGD A;  1BTZ A;  2A7H A;  2SGE E;  2XXL A;  2Z7F E;  5FHT A;  1OYT H;  2UWL A;  3E16 B;  5JBC S;  1VJ9 U;  5JYI A;  1S6H A;  1LPG B;  5ESB A;  2ZHF H;  1S0Q A;  1Y5A T;  2XOK D;  3TNS A;  4K3J A;  1O2T A;  5SGA E;  4K5Z A;  3NCL A;  2NWN A;  2FLB H;  1TX7 A;  1W12 U;  2Y81 A;  3UNQ A;  1GL0 E;  2KAI A;  1GJD B;  3QZR A;  2SGQ E;  1KIG H;  1PQ5 A;  3LJJ A;  1F0U A;  1ZR0 A;  4ZH8 A;  1UTL M;  1GHB F;  4FUF A;  2OCV B;  4CRD A;  6GCH G;  2GT8 A;  3RXQ A;  1QA7 A;  1RRK A;  4Q7Z A;  5DG6 A;  4FU8 A;  4HTC H;  4I33 A;  5FX5 A;  3BEU A;  2JDI D;  3P95 A;  1F5R A;  1V2U T;  2Z3C A;  1V2V T;  3ELA H;  3LPR A;  1IAU A;  1OWI A;  2AGE X;  2PKS B;  1O31 A;  4FUG A;  1SBW A;  3VFE A;  3A7Y A;  2R0L A;  2ZIQ H;  2J97 A;  1GBH A;  1A5G H;  1Z1J A;  3QO6 A;  3TIT A;  2JKH A;  2RG3 A;  4INH A;  1VIT H;  3SGQ E;  3PLB A;  4YM9 A;  3RC4 A;  1EXF A;  2HWL B;  4XD7 D;  3ZVD A;  2BY8 X;  1H8E D;  4INK A;  2KX4 A;  2XCF A;  2KCA A;  3NPS A;  1ZHP A;  4BNR A;  3U8T H;  3V0X A;  1E0F D;  4NGA H;  4Q4L A;  1GVZ A;  2VID A;  2FIR H;  1LVO A;  1T7C A;  1AMH A;  1KXD A;  1PYT C;  2C8Y B;  3RU4 T;  4B1T A;  3RXT A;  2G5N A;  2ZKS A;  2VIP A;  3T62 A;  1E1Q D;  1SMF E;  1F0S A;  1MQ6 A;  1OKX A;  4CRA A;  1G9I E;  3GCO A;  4BTU B;  1P09 A;  4AG2 A;  1P12 E;  1YPE H;  3BTG E;  1Z6J H;  5JBA S;  4NCY A;  3M36 A;  3GCT G;  2ZWL H;  3BTW E;  1P2N A;  2BXT H;  2VGC C;  3LH1 A;  1TYN A;  2WSS D;  3F9E A;  1FPC H;  1D3T B;  2OD3 B;  3RXL A;  2ZEB A;  1HRT H;  3GY5 A;  4DOQ A;  1O3K A;  2F9N A;  4WMF A;  3HKI B;  1CHO G;  2H9E H;  2ZP0 H;  5HM2 A;  5GND A;  1SLX B;  2H9H A;  3SOR A;  4CRE A;  1GI9 B;  1KLT A;  2A4R A;  1BJV A;  2PWX A;  2HAL A;  1XM1 A;  2DE8 A;  4RT1 A;  3KYF A;  3GIC B;  3MH4 A;  3RUO A;  1AD8 H;  1MTS A;  1PQ7 A;  1DLK B;  1TBZ H;  2RDE A;  4O3T A;  5FXL A;  4I32 A;  1V2Q T;  1KXB A;  1O2U A;  1TQ7 B;  2GZ7 A;  1XVO A;  2VIO A;  1H8H D;  2L74 A;  2OC0 A;  3F68 H;  3T26 A;  1Z6E A;  1NY2 2;  1O2Z A;  1UTO A;  3MH5 A;  4B76 A;  1C5S A;  3QGJ A;  3EAJ A;  1C5P A;  7KME H;  3SUE A;  3V3M A;  2QF5 A;  2LNC A;  4WME A;  1HDT H;  1LKA A;  1O3H A;  2EI7 A;  3TH4 H;  1VGC B;  1NU7 B;  2Q6F A;  4OGX A;  3FAN A;  1KLI H;  1SLV B;  4GCH G;  4IN2 A;  5DJ7 A;  3VB4 A;  2FYR A;  3QX5 H;  3KEE A;  1RS0 A;  3IWM A;  4NIV A;  1OXG A;  1DWE H;  1FXY A;  1CT0 E;  1C2E A;  2J2U A;  3MH7 A;  3SZN A;  4CBO A;  1ARB A;  4KGA A;  2AMP A;  5EW2 H;  1MKX H;  1UVT H;  2M5T A;  3T2N A;  5DKM A;  1FY1 A;  2I6Q A;  3P8N A;  4AFZ A;  1C5T A;  2EQN A;  2J94 A;  4NSV A;  1QNJ A;  1AFQ B;  1MTW A;  2ZU5 A;  4KTC A;  2SFA A;  1AUT C;  5EOD A;  3ODD A;  1KDQ A;  1L1G A;  1O3O A;  1WCZ A;  3U98 H;  3ATW A;  2A4O A;  1T31 A;  4JK6 A;  1QY6 A;  1F5L A;  4ABD A;  3MNS A;  1BMN H;  3TJN A;  1OSS A;  2K1Q A;  8EST E;  2C93 B;  1TE0 A;  2ZO3 H;  1P01 A;  4UFD H;  3S69 A;  1YCP M;  4CBN A;  2TGT A;  2FMJ A;  5FBE A;  1O2H A;  1CBW C;  4Q63 A;  4I8J A;  3H7T A;  4X8U H;  1IQH A;  1QB6 A;  3SI4 H;  3QTV H;  4KKD A;  1C1S A;  5J4Q A;  5EIY A;  1O2Q A;  4CRF A;  1YM0 A;  5FPY A;  2XWB I;  1SQA A;  4FVB A;  5GWZ A;  5ETX A;  4BAM B;  1L1N A;  1T8M A;  1SGD E;  2NU4 E;  1O2S A;  1Y3Y A;  1VZQ H;  1TON A;  1V2S T;  1EAS A;  2C4F H;  4F49 A;  1HAI H;  2JH5 D;  1BBR K;  1LDT T;  2Y7X A;  1M9U A;  1P9U A;  2XBY A;  3GCH C;  1DS2 E;  1EP6 A;  3KQC A;  2P3T B;  1HAX B;  2BQ7 B;  1HXE H;  3O8D A;  2F3C E;  3VB5 A;  1QRX A;  2NU1 E;  5HYO A;  3M37 A;  6CHA B;  4IC6 A;  1O37 A;  1QTF A;  1TA2 A;  1NBM D;  2DE9 A;  1BTX A;  1O3I A;  4DW2 U;  3VGC C;  4ABE A;  3N99 A;  1HJA B;  3M3T A;  3UAI C;  2SGF E;  3MO3 A;  1WUN H;  3EE0 B;  3FAO A;  1V2O T;  2OQ5 A;  3MNC A;  5PTP A;  1CE5 A;  1HUT H;  1O2W A;  3SV9 A;  1D3D B;  1BZX E;  5FL7 D;  5GXP A;  5G4B A;  3SBK A;  2TRM A;  1O3N A;  5EPY A;  1SC8 U;  3RXM A;  3M35 A;  4ZXX H;  2VWL A;  4AG1 A;  3PYH A;  1SGF A;  1PPZ A;  3Q00 A;  2J98 A;  1P57 B;  2QN5 T;  4ISI H;  4A92 A;  4CHA C;  1O2K A;  4JZE H;  3SHA H;  2GJG A;  3RC5 A;  1GI4 A;  1P2O A;  5L2Z H;  3HGN A;  1LVY A;  1GVK B;  4BTT B;  1YPG H;  3RXI A;  1QL9 A;  2VVC A;  2ZZU H;  5F8Z A;  8LPR A;  1ID5 H;  3ODF A;  1AFE H;  3DUX H;  2ULL A;  4YLU A;  2V35 A;  4A1T A;  1FN8 A;  1JBU H;  3L3T A;  3GY4 A;  1GJ6 A;  1MTN B;  1A5H A;  4MPU A;  1E79 D;  3A8A A;  4R8T B;  3FVF B;  4NA7 A;  4K69 A;  1KY9 A;  1GJ8 B;  1ZGV A;  2PHB A;  1BIO A;  1NS3 A;  2OLG A;  3M5O A;  1A2C H;  1BIT A;  4KEL A;  3B9F H;  1P2M A;  3UQO A;  3AW1 A;  2O8U A;  2G4T A;  2WPM S;  3BV9 B;  1GGD B;  4UFE H;  3FN8 A;  1THR H;  1YPK H;  4BXS A;  2BOK A;  2KFW A;  3OY5 U;  5C17 A;  3PMH B;  1GMC F;  1UK2 A;  1JRT A;  3O8C A;  2Y5F A;  2H5D A;  4P00 A;  2A2Q H;  1C1W H;  4J2Y B;  2VH6 A;  2THF B;  2OC7 A;  4JMY A;  3E0N B;  4YES B;  1CHG A;  3M3S A;  1SQR A;  3KQD A;  4GHQ A;  2BDY A;  2H5C A;  2ZHQ H;  2VIN A;  1J17 T;  1O3M A;  1SKY E;  3AW0 A;  3BTM E;  1C5Y B;  1XXF A;  2J95 A;  3O8B A;  1NES E;  1UHB A;  1SFQ B;  1VR1 H;  1XVM A;  2H9T H;  2RCE A;  4UFF H;  5L2Y H;  3UTU H;  2XBV A;  1DOJ A;  1EZQ A;  2QF3 A;  3FOA A;  1IQI A;  1S6L A;  1EPT B;  1RXP A;  1DLE A;  1XUJ A;  2FPZ A;  2TIO A;  3V12 A;  3KL6 A;  2VWN A;  3BG4 C;  1C5V A;  4JZ1 A;  3S7K B;  3A80 A;  3UOP A;  2BB4 A;  1Z1I A;  2IPQ X;  1CA8 B;  3OX7 U;  3TPI Z;  2HLC A;  2WYJ A;  4B73 A;  2YMS B;  5A0A E;  1S85 A;  3GY7 A;  3BTH E;  3HK3 B;  1PQA A;  2BD3 A;  2ANW A;  2QAA A;  2C8W B;  2GCH G;  3IIT A;  3QN7 A;  3RM0 H;  1YPH C;  4X1P U;  4VGC C;  1TBR H;  4H42 U;  4E05 H;  3TGK E;  3SU4 A;  1GBD A;  1AU8 A;  1K1M A;  4GHT A;  3SJ9 A;  1BB0 B;  2CGA A;  1YYY 1;  1V2T T;  2EC9 H;  3SGA E;  2YOL A;  2R9P A;  3TH2 H;  1GI2 A;  1DT2 A;  1W0J D;  2J98 B;  3DHK H;  2F83 A;  4FUI A;  5LPR A;  1A0J A;  1V2R T;  4X1S U;  1C5Q A;  1KXF A;  1GI1 A;  4AC9 A;  1NBM E;  4FVD A;  2F9B H;  1TNG A;  3E6P H;  1ZMJ A;  4Q80 A;  1PFX C;  3K6Y A;  1WXR A;  5DPA A;  4MNX A;  1V2J T;  1JIM A;  1WBG B;  4RKO B;  5C94 A;  1EAT A;  1ZRK A;  1C2H A;  4I8H A;  1Q2W A;  4I7Y H;  1ELE E;  1MZA A;  1YCP K;  3I77 A;  1GI3 A;  2KCY A;  2A1D B;  1RTL A;  1DUE A;  2PLX A;  4PRO A;  1C9T A;  1XUI A;  2XCN A;  2M2A A;  4TYD A;  1BTH H;  3RXF A;  3AAV A;  2BDH A;  1CQQ A;  1IQK A;  1LPK B;  2W7U A;  4B6E A;  3QDZ B;  1TNI A;  1P2I A;  1K21 H;  2H6M A;  3BEF B;  4Y76 A;  3TNT A;  4JZI A;  3K2U A;  1ABJ H;  1QA0 A;  2AIP A;  1K1I A;  2EA3 A;  4Z0K A;  3NXP A;  2QE7 D;  5FCR A;  1VCQ A;  5EQS A;  1JMO H;  1BBR H;  3FP7 E;  2AYW A;  1K1P A;  4Z6A H;  1GJ5 H;  2CN0 H;  5EJL A;  3SU0 A;  1YPM H;  1UVS H;  2AFQ B;  4X8S H;  3A8D A;  3O8R A;  5LPF A;  2SNW A;  1RTF B;  1HAG E;  4ZCN A;  2W3K A;  4WY3 A;  4O3U A;  3KNX A;  2H2Z A;  4YO9 A;  1FAK H;  1SHY A;  2STB E;  4UEH H;  2PP6 A;  1DAN H;  3QZQ A;  3KQ5 A;  2FOD A;  2ZFR H;  2PUQ H;  2WPH S;  3IG6 B;  1O5D H;  1Y59 T;  2KZ4 A;  2ASU B;  1C4U 2;  3SV6 A;  3OTP A;  4K1T A;  2R3Y A;  1P06 A;  1P8V C;  3EYD A;  2YMS D;  1OWJ A;  3ATK A;  2ZFP H;  1MTU A;  1GBI A;  3OFN D;  4K60 A;  1QL8 A;  3ZYD A;  3NK8 A;  3PO1 C;  1OWH A;  2Z9I A;  4ABA A;  3N7D A;  1WSS H;  1E37 B;  4YT7 H;  1C1R A;  2XC0 A;  1Y5B T;  3TJU A;  5HGG A;  3SNE A;  7EST E;  2HNT F;  3CEN A;  3I78 A;  1HV7 A;  3HGP A;  3SNC A;  4DT4 A;  2ZCL P;  4ABG A;  3F2G A;  4SGB E;  1AKS B;  1FN6 A;  2GZ8 A;  3T5F H;  4DUR A;  5I25 A;  1ZGI A;  4D8N A;  5EU8 A;  4NIW A;  2O8M A;  3OTJ E;  2G00 A;  4MPW A;  4ASU D;  3GOV B;  1P10 A;  2Y5H A;  2V3M A;  4Y0Y E;  3ZYE A;  1T32 A;  3EA8 A;  3STI A;  4QT8 C;  3RM2 H;  2PTN A;  4AX9 H;  5EQR A;  4RN6 A;  2J4I A;  5GCH G;  1SOT A;  1BTU A;  1T4U H;  2HNT C;  3PV2 A;  8GCH F;  3LOX A;  3MQK C;  1B0F A;  1AQ7 A;  1P02 A;  3HPT B;  3SUF A;  2FXR A;  1IQL A;  3K9X B;  1XKA C;  2OP9 A;  6GCH F;  1O3L A;  1ZRB A;  5C1U A;  1ESA A;  5F6M A;  5CHA B;  4AGJ A;  3F2F A;  3VXE H;  2F4L A;  3TJO A;  4MPV A;  1O2G H;  1NRP H;  3MNX A;  3G01 A;  3NRL A;  2TBS A;  3RXC A;  1YLD A;  4X1N U;  5C5N A;  2Q6D A;  1TBQ H;  3A82 A;  3RXV A;  1SGI B;  3FKS D;  1MD8 A;  1LVM A;  4B74 A;  1HAZ B;  1TQ0 B;  4D7F A;  3PWB A;  3OEE D;  5JDU B;  1MAB B;  5A0B A;  2BD4 A;  5DP9 A;  1GCT C;  2G51 A;  4O97 A;  1W13 U;  4DJZ B;  2H1U A;  1YPL H;  2FOC A;  1Z71 A;  6CHA C;  1O3G A;  4HGC A;  3UPE A;  4OS4 A;  2XNI A;  4ZHA A;  5CMX H;  1DE7 H;  7GCH G;  2V3O H;  4MNV A;  2ZFF H;  2FI3 E;  2ZDA H;  5EPN A;  2ZGC A;  4MTB A;  3B23 B;  2ZEC A;  1TPP A;  5JB8 S;  4BTI B;  2FS8 A;  1FLE E;  2PGQ B;  1DST A;  2XWA A;  1DXW A;  4NA8 A;  4JCN A;  2WPJ S;  4Y6D A;  1TOC B;  1QQU A;  1H4W A;  4MNY A;  4OS1 A;  3P8F A;  3SHC H;  1BTW A;  3F0P A;  4XFQ A;  1GI8 B;  1P2J A;  1S5S A;  1GMD G;  1AZZ A;  4ABB A;  2P59 A;  2K0Q A;  1QR3 E;  2C8X B;  1OPH B;  1GG6 B;  1CHO F;  4HZH A;  1LHE H;  1G32 B;  3WWB A;  1YCP H;  3SU1 A;  1EJA A;  2Z3D A;  4XRN A;  1TGS Z;  1AB9 B;  2BY5 X;  2JET C;  3JZ1 B;  4Y0Z E;  1PPC E;  1A3B H;  1DX5 M;  1S0R A;  2BY9 X;  5LPE A;  2QF4 A;  6EST A;  1WTG H;  5C3N A;  3MO6 A;  4K1E A;  1XUG A;  1HIA A;  1C1Q A;  1F5K U;  1E35 B;  1O33 A;  2HRV A;  3A81 A;  1Y3X A;  1O3D A;  3DFJ A;  1V2L T;  3PM3 A;  3S7H B;  1H9L B;  1ZZZ A;  3ZZA A;  1O2N A;  1GI6 A;  5B6L A;  1UO6 A;  3M5L A;  4FUE A;  2O8T A;  3LGV A;  1RFN A;  3ZZ4 A;  1K1L A;  3UFA A;  4JZD H;  2Y7Z A;  3A7V A;  1DDJ A;  3E90 B;  4JYV H;  4Y8Y A;  1DY8 A;  5I46 H;  5T1V A;  1THS H;  1ZTK A;  1FY3 A;  3M5M A;  2Z9K A;  1EFR D;  4NIY A;  4Y79 A;  2CF8 H;  3LGY A;  1NU9 A;  1YKT A;  2VIV A;  3L6P A;  3FZD A;  3SYJ A;  1HAV A;  2B8O H;  2TGA A;  3PLP A;  1JOU B;  2P16 A;  1WDI A;  3RML H;  1QJ7 B;  1GJ9 B;  1L2E A;  4GCH F;  2J9N A;  1NFY A;  1ZTL A;  1DSU A;  1ELG A;  1H8I H;  4F4O C;  2GCT B;  2ZDN A;  1TFX A;  3UR6 A;  4CRB A;  1EUF A;  1QBN A;  1CT2 E;  1KXE A;  1BHX B;  2AER H;  2WUC A;  5DP6 A;  1KMH B;  2FLR H;  4FUC A;  1VIT G;  1QJ6 B;  2G4U A;  4DT7 B;  1ZJD A;  2VVV A;  3F2H A;  1ZSJ A;  4I8L A;  3MU0 A;  1EJN A;  2F9P A;  3RU4 D;  3A88 A;  3FFG A;  1EQ9 A;  3E0P B;  4WJG 2;  1PPG E;  8KME 2;  4ACB A;  3RXK A;  2ZQ1 A;  3Q76 A;  1GI0 A;  3RXJ A;  5FPS A;  1NFW A;  3C1K A;  4AB8 A;  4AYY B;  1GDQ A;  2WUB A;  2ZCK P;  1TNH A;  1BTP A;  2STA E;  5DO4 H;  3DSO A;  2KAI B;  5DK1 A;  5B6O A;  1GBF A;  1CVW H;  1V2K T;  2VIW A;  1J9C H;  2LP6 A;  1GBC A;  3SUG A;  2UUY A;  1G36 A;  2ZU3 A;  4MG3 A;  1AE5 A;  1FIW A;  2FP7 B;  1YF4 A;  2W3I A;  2FEQ H;  2GKV E;  4IC5 A;  3SZE A;  1EAI A;  1D4P B;  2CV3 A;  4IBL H;  4Y10 E;  2ZU4 A;  1BOQ A;  3U9A H;  5F03 A;  3M7T A;  4OGY A;  5JBT A;  2FX6 A;  1EAU A;  2GDD A;  2EI8 A;  1G2M A;  2PV9 B;  1ORF A;  1Z8I B;  2KCP A;  1HFD A;  2B7D H;  4I31 A;  1SGF G;  1UTQ A;  1EAX A;  2ZFS A;  3SQE E;  2QXG A;  1G30 B;  1RIW B;  1GDU A;  1MCT A;  1PQ8 A;  3OSY A;  4TPI Z;  4UDW H;  1ELF A;  4KTS A;  3ATM A;  3WY8 A;  1V3X A;  5J4S A;  1UMA H;  1QJ1 B;  2IN2 A;  2J5U A;  1GJ4 H;  1O38 A;  5BPE A;  2DUC A;  3LGI A;  2WHX A;  2GMT B;  3T27 A;  2ZGH A;  1AVX A;  1HAV B;  1W0K D;  5AVD A;  3TGJ E;  5T3H A;  1CA0 B;  1B5G H;  1N1L A;  1N8O C;  1GI5 A;  2ZU1 A;  1B7X B;  1DWB H;  3KF2 A;  4K8B A;  1GBK A;  2QYI A;  4A6L A;  2OTV A;  4UON A;  1X7A C;  2UUF B;  2WV4 A;  1DPO A;  3U1I B;  4Y8X A;  1ZYO A;  2P8O B;  4IN1 A;  5L30 H;  2HVY B;  4WWY A;  2Z9L A;  1AIX H;  1SVP A;  2W5E A;  2CHA C;  3P8O A;  1HCG A;  3BF6 H;  3RXU A;  1YPJ H;  1Z8G A;  2PTC E;  4AGK A;  3SI3 H;  1QCP A;  2J92 A;  4ASH A;  1HGT H;  3MMG A;  2GGV B;  2VH0 A;  4NIX A;  2K8I A;  5EST E;  1XUF A;  2D1J A;  2HPQ H;  2R3U A;  1W14 U;  5DP5 A;  2ZNK H;  2FO9 A;  3LKW A;  3LU9 B;  1O5C B;  4CR5 A;  3BIV H;  1GHA G;  3DFL A;  3EGK H;  2OC1 A;  1JXP A;  5KGO A;  3BTT E;  4O9V A;  5DN6 D;  4X2Y A;  2G55 A;  3ZVE A;  4Z1M D;  3VPK A;  1GWA A;  2QXI A;  1FNI A;  3SW2 B;  2FYQ A;  1V2N T;  2R2M B;  3URC A;  4AFQ A;  3EDX B;  1HJ8 A;  3DT0 H;  2FTL E;  2FX4 A;  3LON A;  4FET A;  1EB2 A;  1GVL A;  2ZDV H;  4ZUH A;  3RXA A;  1D6R A;  1W0Z U;  3RU4 E;  4D9R A;  4IW4 E;  2A7C A;  1BTY A;  4TY6 A;  1DIC A;  5EQQ A;  1C2D A;  1UTK A;  1E38 B;  4UD9 H;  3QLP H;  4ISN A;  4GPG A;  1F2S E;  2Y80 A;  1JIR A;  1TGT A;  1IQE A;  2ZHW H;  5A09 A;  2B0F A;  4A1X A;  1Y3V A;  1UVU H;  3LIW A;  3SUD A;  1GHY H;  4F48 B;  2RFK C;  3KCG H;  4BAK B;  3N7E A;  5C0U A;  1YLC A;  1SI5 H;  1LCY A;  3GYL B;  4A5T S;  1ZMN A;  3BTF E;  4RKJ B;  1JWT A;  2WYG A;  3LDX H;  1AY6 H;  3KQB A;  3F6U H;  1HYL A;  2XW9 A;  1FV9 A;  4U01 A;  1ANB A;  2BLW A;  1W3C A;  3SU3 A;  1KDQ B;  2IJD 1;  4GVU A;  1ZLR A;  1TWX B;  1YBW A;  3NUM A;  4NFE A;  1MBQ A;  1O3E A;  2FOM B;  1WU1 A;  2GCH F;  3HK6 B;  3BTD E;  1ARC A;  2GTB A;  2PFE A;  1EP5 A;  5FPT A;  2AGI X;  3RDZ A;  1MAY A;  2EST E;  3MU4 A;  1IQG A;  3ZZ5 A;  3JZ2 B;  2LEL A;  1H8D H;  2ZPQ A;  1GJ7 B;  1GBM A;  2ZF0 H;  2SGP E;  4HFP B;  1QIX B;  5EGM A;  2BVX H;  4RI0 A;  2BLQ A;  5AHG H;  1ETR H;  1QGF A;  1WQV H;  4R0I A;  4I8G A;  3VEQ B;  1QRW A;  2BDB A;  4AFS A;  3F1S B;  1ZSL A;  3RXD A;  3S9B A;  1W0Y H;  4MNW A;  4WXI A;  1F0R A;  4X8T H;  2XTT B;  1P2Q A;  1SHH B;  4OS5 A;  3UNR A;  2BX4 A;  1GBA A;  2D8W A;  1TA6 A;  1TX6 A;  2Q1J A;  3RC6 A;  2JH6 D;  1PPF E;  3MNB A;  4BXW A;  4ZMA H;  1SQT A;  5JBB S;  4Y7B A;  5TJX A;  2P3U B;  3FP8 E;  1HAY B;  2BOH B;  2PKS C;  2ZDM A;  5JPM H;  4YZU A;  1O2M A;  1XXD A;  2IOT A;  3SND A;  1MU6 B;  1TGB A;  1UTP A;  1BA8 B;  5C5O A;  2OQU A;  4F55 A;  1GBB A;  1SLW B;  1SPJ A;  4YLQ H;  2BVR H;  2ANK H;  1AND A;  2BLO A;  2WPL S;  1GBJ A;  1HPG A;  1GDN A;  6LPR A;  1Z8J B;  3ZZ9 A;  2F9U A;  2VU8 E;  1SGR E;  1LPZ B;  3A7T A;  3Q3X A;  1TLD A;  3NKK A;  4GSO A;  1MH0 A;  3S9A A;  1HAP H;  3BG8 A;  1O5G H;  2BLV A;  3ZVB A;  1D6W A;  1LQD B;  1ZHR A;  1O3B A;  1BBR E;  2BYA X;  1H1B A;  3OY6 U;  4TT3 D;  3GDS A;  3ZVC A;  5C1X A;  1ZSK A;  3NWU A;  4CR9 A;  1GMH G;  3M7U A;  7LPR A;  3URE A;  2BX3 A;  1O3A A;  2B5T B;  4ABF A;  1LHG H;  3KN2 A;  2FOE A;  2UUJ B;  4YOJ A;  4D76 A;  2BHG A;  2P95 A;  4DG4 A;  2FOH A;  3TIU A;  3RXR A;  2GT7 A;  3ZIA D;  1ZOM A;  2JJ1 D;  1SR5 C;  3T25 A;  3FO8 D;  1C5Z B;  1GJA B;  1BRA A;  5HIY A;  1UJ1 A;  1C1U H;  2EEK A;  2FOF A;  2KR7 A;  5A2M H;  2ZTZ A;  2GV6 A;  4RT0 A;  1BQY A;  2OIN A;  3VB7 A;  3UQV A;  2ZGX H;  2JJ2 D;  2AGG X;  2O8L A;  2A5A A;  2V6N A;  1GHX H;  1MZD A;  3GYM A;  4WF8 A;  4NWK A;  4GLY A;  4NA9 H;  4LOY H;  2OXS A;  1LHC H;  1INC A;  3E3T A;  1DWD H;  2AMD A;  4DCD A;  1AUJ A;  1Z7K A;  5T6G A;  5L6N H;  1C2F A;  2AIQ A;  1C4V 2;  3A89 A;  3ZZC A;  2RA3 A;  2XBX A;  2A5I A;  2A2X H;  4ABI A;  4Q7X A;  1PYT D;  1QL7 A;  1TPA E;  1W7G H;  4AFU A;  3OU0 A;  4CRG A;  1C9P A;  2QIQ A;  1OYQ A;  1FPH H;  1AWH B;  2ZTX A;  3P6Z B;  3BIU H;  5A8Z A;  5GCH F;  1TPO A;  1FJS A;  1UHB B;  2A32 A;  2A45 B;  3QUM P;  2ALP A;  1MQ5 A;  3L33 A;  1QUR H;  1J8A A;  1RGQ A;  3OEH D;  1ANC A;  3MU1 A;  4LXB H;  3SU6 A;  2VJ1 A;  1O2Y A;  4UE7 H;  5C2Z A;  1AE8 H;  3DSG A;  5DP3 A;  2QV1 A;  4AN7 A;  1TAB E;  1VGC C;  1EZX C;  2FWW A;  2VIQ A;  1ELT A;  1RJX B;  1DXP A;  3A84 A;  1HNE E;  2XBW A;  2CF9 H;  2OBO A;  3F0O A;  4ZHM U;  4WXV A;  4I8K A;  5EOK A;  1NRN H;  1SGC A;  1N6X A;  1OWE A;  1OX1 A;  2FS9 A;  1XMN B;  1YC0 A;  1ZTJ A;  5AF9 H;  4IMQ A;  1UK3 A;  1FON A;  1ZPZ A;  1Y8T A;  2A0Q B;  1BDA A;  4ISO A;  2JH0 D;  2BM2 A;  3ZZ3 A;  2ODY B;  1BT7 A;  4GUX A;  1T8L A;  3Q3Y A;  3F9G A;  1ELA A;  2G8T A;  1O3F A;  1AFQ C;  4K1S A;  5C20 A;  2G52 A;  1B0E A;  2BD5 A;  4LZ4 B;  1P04 A;  2CJI A;  3Q77 A;  2OUA A;  1E34 B;  3CP7 A;  5F53 A;  1K22 H;  1C1N A;  2GV7 A;  1VCW A;  1P2K A;  1NRQ H;  2FTM A;  7GCH F;  3MH6 A;  3GCH B;  2ODP A;  1TMU H;  2HGT H;  1BUI A;  1GBL A;  2A5K A;  1G2L A;  3GY3 A;  2HLD D;  3UOU A;  1WYK A;  2GMT C;  2NU0 E;  1BRB E;  1C1O A;  1IQF A;  2F9V A;  1O2V A;  1K2I 1;  1KTT B;  1OS8 A;  1Y3W A;  2W6I D;  3A87 A;  4OS6 A;  3VGC B;  3STJ A;  4YT6 H;  1GMD F;  3ZVF A;  3MTY A;  1O2O A;  3D65 E;  4A7I B;  1IHT H;  1FUJ A;  1H9H E;  1GHZ A;  3EST A;  1BMM H;  2FOG A;  3K6Z A;  1YY3 A;  3ENS B;  3D62 A;  1C5M D;  1C2L A;  1NZQ H;  3SU2 A;  5C0T A;  3CS0 A;  1S83 A;  4CHA B;  1SL3 A;  2ZI2 H;  3LC5 A;  1Z8R A;  1PPE E;  3MI4 A;  3VG8 A;  1A7S A;  2PW8 H;  2IPH A;  2WV5 A;  2BD7 A;  2EY4 C;  1MU8 B;  1J14 A;  1TAL A;  4XBC A;  3RXG A;  3UR9 A;  1F7Z A;  5AFZ H;  2QF0 A;  3DA9 B;  2HVX A;  3EE7 A;  3A85 A;  3WWF A;  5TCC A;  3GY2 A;  4NFF A;  4AOQ A;  1O32 A;  4ABJ A;  2Z3E A;  3R3G B;  1HJA C;  4TWW A;  2ZHE H;  3AK5 A;  4M9F A;  4X6O A;  2A31 A;  3A7Z A;  3VB3 A;  2V7Q D;  4ISH H;  1TB6 H;  1S6F A;  2F43 B;  4OM9 A;  3GCT F;  1YLN A; 
#chains in the Genus database with same CATH homology
 1UW7 A;  5HIY A;  5C94 A;  1QZ8 A;  2J97 A;  5HIZ A;  2J98 A;  2J98 B;  3EE7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...