4K60A

Crystal structure of human chymase in complex with fragment 6-bromo-1,3-dihydro-2h-indol-2-one
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
226
structure length
219
Chain Sequence
IIGGTECKPHSRPYMAYLEIVTNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGAAQGIVSYGRSDAKPPAVFTRISHYQPWINQILQAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chymase
publication title Discovery of Potent, Selective Chymase Inhibitors via Fragment Linking Strategies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 49
structure length 219
sequence length 226
ec nomenclature ec 3.4.21.39: Chymase.
pdb deposition date 2013-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4k60A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4k60A02
2Y7ZA 1WTHD 1OWKA 4ZMAH 1T4UH 2O8TA 3QO6A 1C1QA 3ZV8A 4O9VA 5J4QA 1V2TT 1BTYA 1E35B 1DT2A 1CE5A 1S84A 1RIWC 1E36B 3BV9B 2AGEX 3GDSA 1QJ7B 3A89A 1V2QT 1F0UA 3UR9A 1YGCH 1GVLA 3SNBA 3QLPH 1EJNA 4AYVB 3U9AH 1GJBB 4E7RG 4Y7AA 5E0HA 1GJ8B 2BVSH 2ZTZA 1BTUA 2FS8A 3STIA 1C5TA 5CMXH 3GY2A 2PGBB 1ANCA 1S82A 2ZCKP 1ELCA 1YP9A 1C5XB 1RJXB 4K60A 6GCHG 3PLKA 2A4RA 2CXVA 1Z1JA 4DVAU 3TJNA 4R8TB 4ZKNU 3M5LA 1SGCA 3UWIA 3FFGA 3IWMA 4MNXA 3TLOA 3QK1A 3CS7A 3SJ8A 1HAXB 2G5VA 1INCA 1BA8B 2OLGA 1FPCH 1GJCB 1P2NA 2OUAA 4I8GA 4B73A 3RC6A 3MOCA 1OYTH 4F49A 2F9VA 1G37A 1GGDB 1O2XA 1OPHB 2W3KA 5H4IB 2V6NA 3A7YA 1FIWA 1K9OE 4WY3A 1N8OC 3BTFE 2EI6A 3BTHE 3PTNA 1D3TB 4WWYA 1WSSH 3PTBA 2WPHS 1K22H 4X2YA 1UVTH 1RTFB 2OBOA 4INLA 4MQAA 1Y5BT 3AW0A 4YTAA 2NU3E 3SJKA 6LPRA 1N6XA 2WV4A 5F03A 2ZU3A 5FBEA 2PKAB 1V2WT 2HNTC 2QXGA 3SNDA 2W7UA 4ISNA 1FY4A 3TJUA 1VITG 1P9UA 2A5KA 1K1JA 2FYQA 2BY6X 3LDXH 4NZLA 3SUEA 1O3MA 3T62A 1YPGH 1SC8U 4J1YA 2IN2A 3MI4A 1FY3A 4MVNA 8KME2 2CHAB 4ZKOU 5ESBA 1KDQB 7LPRA 1O2RA 1V2JT 1H1BA 2Z3DA 3SU2A 1A46H 3SV9A 1DSUA 2V3HH 1VCPA 1J16A 5CHAC 1QB6A 4JZEH 2PHBA 1GBKA 3RMOH 4JMYA 4XFQA 2FOGA 3SV2H 1TBRH 3QUMP 4DG4A 2WPLS 5DP9A 1J17T 3NXPA 1ZTLA 2HPPH 2ZGHA 3K2UA 3A81A 1NN6A 2HNTE 2JH5D 1FI8A 4WMFA 3MYWA 5FXLA 3BN9A 1V2PT 2UWPA 1RTKA 3ZZAA 3SJOA 2H5CA 4UE7H 3TVJB 2JETC 3NPSA 3ZVDA 1V6DA 2FLBH 1IQHA 4DW2U 1RIWB 2ZFRH 3U98H 2LPRA 4X6PA 2W5EA 1UTMA 4Y71A 1YPHC 1AHTH 1MD7A 1SBWA 2OTVA 1O2ZA 3O8DA 1H8DH 3ELAH 2P95A 3SN8A 1J14A 1AY6H 5GCHG 1C2EA 3M3SA 2P3FH 5TCCA 2ZA5A 1C5PA 1RD3B 5C2ZA 4X1SU 5GJ4B 3TK5A 3KGPA 2BD7A 3AVZA 2QN5T 1TOCB 1GI0A 5EU8A 3LIWA 3H5CB 2QC2A 1QBOA 2FI5E 3GICB 1QURH 3TK9A 4BTIB 1SLWB 1K2I1 2KAIA 4I33A 1A4WH 4X1QU 1Z6EA 1BOQA 3TH2H 1D4PB 1D3QB 1F5KU 1UTLM 3BG8A 4BAOB 3MH6A 2VNTA 1SFQB 1TA2A 4SGBE 1ZJDA 4F4OC 1N8OB 1V2ST 1A0LA 4IBLH 1P3EA 4O97A 3DHKH 4K1TA 1RRKA 3MU4A 3RXCA 1AKSB 1H4WA 2FOHA 4DJZB 1ZMLA 5EG4A 1HNEE 1LPKB 3RU4E 1EB1H 5FPSA 2J4IA 3FANA 2ZHWH 3RU4D 1OWHA 2BOKA 2WPMS 4IW4E 5DP5A 1FONA 1HYLA 1TIOA 1D9IA 1ZMJA 1NFYA 4GHQA 3O8RA 5AHGH 1BMMH 1DFPA 3R0FA 4MNVA 3RXJA 1AMHA 1UTNA 3CS0A 1THRH 2QY0B 4NFEA 1O3BA 1ZPZA 3SW2B 4GCHG 4NWLA 3FP7E 3FAOA 2BY8X 4NIXA 3F6UH 3HGPA 1G2LA 5F8XA 2GMTC 2VWLA 3SGBE 1QL8A 4U2WA 5DPAA 4ZROA 4ZKSU 4FUIA 2FMJA 5AFYH 2CJIA 3PV4A 3Q3KA 1GMHG 4DURA 1O5BB 2VWOA 4UFFH 3L6PA 2GVFA 4JCNA 3S9CA 3UOUA 5CHAB 1LVBA 2UWOA 2A4GA 2NU0E 4X8TH 3TIUA 2SGQE 1J8AA 4K1SA 1O30A 2HVXA 1W0ZU 3BTDE 2BYAX 2J95A 2R0LA 1CA8B 3R3GB 1TBQH 1GDUA 2R2WU 4FUFA 2G5NA 1WCZA 2AS9A 3MH5A 1RTLA 4KKDA 5HGGA 2ANWA 4H6TA 5LGOA 1B0EA 1O5DH 1K1OA 2XBWA 3GDUA 4GPGA 4B74A 2QGRA 3ZVEA 3B8JA 3LPRA 2UUFB 2F9BH 3A80A 4CR5A 1FAXA 1ELAA 3NKKA 1TNKA 1ID5H 5AVDA 1QTFA 2STAE 1D3PB 3QZQA 1S5SA 4ABDA 1C5RA 1F7ZA 5AFZH 1TGNA 5EPYA 1SGRE 5J4SA 1Q31A 4CBNA 4AGKA 4YM9A 1DSTA 1NTPA 1BITA 1T32A 1HB0B 4MDSA 1CT0E 1H8IH 1F0SA 2VH0A 1RXPA 4OS4A 1O38A 5AF9H 4Q7XA 1C1TA 3M61U 4JK6A 4AORA 1QBVH 5GXPA 3U8RH 2H1UA 4D9RA 1HGTH 1KTSB 1EJMA 3M5MA 3D65E 4XBBA 4VGCB 4ABFA 2ODYB 1VCWA 1V2OT 3SHAH 3KQDA 4NA9H 4IMQA 1NROH 1GI2A 3RXFA 4YOJA 2D1JA 1G2MA 4Y8YA 3ZZ4A 4AGJA 1A5IA 4CRDA 5T6FA 1W2KH 4CRGA 4A92A 2VINA 1O0DH 2V0BA 4O3UA 3RXSA 4RKJB 4QT8C 1AIXH 1LQDB 3ODFA 1F0RA 1D3DB 1JBUH 3RLWH 3RXAA 2C8YB 1GMCG 5C67A 2GZ7A 1DS2E 1HDTH 4DIHH 3T5FH 1KXFA 1ARBA 1FZZA 4Y79A 1XMNB 1HV7A 2G52A 1ELEE 1SHYA 1TGTA 5A8YA 1SGTA 1OWJA 1P11E 2GP9B 1P2MA 1V3XA 1P04A 1L1NA 1HXFH 2ZGJA 3RXTA 1MAXA 1AQ7A 1OXGA 1KY9A 4NCYA 1SLUB 1Y3XA 2H6MA 5F8ZA 1T8OA 4JK5A 5A8ZA 3U69H 4BOHA 5GDSH 1UCYH 4K2YA 2DE8A 1BTWA 4XBDA 2BMGB 1ZHRA 1GI8B 3OSYA 3LT3A 1IQLA 1O3AA 3OTJE 1TWXB 2ANMH 3MU8A 5ESTE 1W13U 2BLQA 4FUHA 1GWAA 4FUGA 4CBOA 4ISLA 3PYHA 3RXPA 3TU7H 1MTUA 1PPHE 3GYLB 2STBE 3PMBB 1F92A 2Y5FA 1ZTJA 2BX4A 3RXVA 3URCA 2GT8A 2OBQA 2A1DB 1KIGH 2SNWA 1FN8A 2Z9KA 3P17H 3A86A 2AYWA 1IQNA 1IQMA 2FS9A 3UWJH 1HJ8A 1MQ6A 1SR5C 2BY7X 1ZJKA 2A7JA 1SGNE 2UUKB 3ATWA 3E0NB 4AOQA 1C1RA 2A32A 1O2GH 1EP5A 4Y10E 5DG6A 3RUOA 5JBBS 3PMAB 2Z9GA 8GCHF 1Z8IB 1C2GA 2FO9A 1DXPA 1DLKB 1GHVH 1ZHPA 2CF8H 1T8LA 1TX6A 3GCOA 1KLTA 2J92A 2H9TH 1KTTB 1P06A 1Q3XA 3P8NA 4K3JA 4X8UH 2ZEBA 4FUJA 2B7DH 3M5NA 2O8LA 4Y11E 1TRYA 3MH7A 2F9NA 5K0HA 1A5GH 2Z9IA 3NUMA 2BD9A 1O32A 2TGPZ 1EZXC 1ABIH 1THSH 1TMUH 1Y3VA 1Z1IA 1P10A 1H9HE 3QTVH 4AG1A 5EQRA 3S69A 3PO1C 4JYTA 1UVUH 4A7IB 4DIIH 4NG9H 4GUXA 1NU9A 2VJ1A 3BTQE 1NM6A 2TRMA 1GJ6A 1JWTA 1O5AB 1TA6A 1O2WA 3S0NA 3DFJA 3K65B 3M3VA 3BIVH 1SL3A 2OP9A 1LVMA 2C8ZB 3PLPA 1FJSA 1TFXA 6CHAC 2H5DA 1HAVA 1UCYE 1QCPA 2BDGA 1O3FA 2R0KA 5EXMA 1NO9H 3A8DA 1DOJA 1LDTT 1QQUA 4B76A 1GI9B 1GVZA 2FOAA 3MFJA 1EOJA 8LPRA 4HI3A 5C1YA 1UTPA 4NSVA 3ESTA 1AFQC 3QTOH 1ESAA 2ZP0H 3AAVA 1MKWH 2B9LA 1O35A 4D8NA 1QB1A 1UCYK 1VITH 1DLEA 1C4U2 4ZHLU 1WV7H 2BX3A 2JH6D 3A84A 5EW1H 3TNSA 3P95A 5TJXA 1KXCA 1LHEH 1UHBA 2G55A 3GCTF 3SV6A 1GBMA 1GG6B 2GGVB 1MTWA 1A0JA 4JZFH 5GIBA 2ZFQH 1Y3YA 4AZ2B 3VB6A 1GHBF 1IQJA 1P02A 3QN7A 1FMGA 4LZ4B 3GY3A 3RP2A 1UTOA 4HFPB 1IQEA 2TPIZ 2ZFFH 2PTNA 2ZFPH 1B5GH 1O2SA 3T26A 1WOFA 1XUGA 3NCLA 1AN1E 1QL9A 3D49H 4JYVH 3ATIA 1C5UA 2BY9X 4ZHMU 2ZHFH 4ABJA 3MO6A 2FIRH 3E0PB 2J94A 2BD4A 4Y76A 2G00A 2H2ZA 4ASHA 1SLVB 1ACBE 1ELDE 1FUJA 1EASA 1Y5UT 1TNLA 1XUJA 2GV7A 2PTCE 2J34A 1ARCA 1G36A 1OWDA 3EE0B 5FPYA 2ZWLH 3RXBA 2XTTB 1C5SA 3HK6B 5DP6A 1W7GH 2J38A 1O3LA 1HAGE 3RXKA 2QYIA 3ODDA 3SNEA 3LJJA 1EAWA 2B0FA 3E6PH 2BZAA 3FZDA 1J9CH 1C5MD 1HJ9A 3OY5U 1C1PA 1IQFA 4A1VA 3G01A 3M7QA 2C4FH 2PFEA 5PTPA 1AFEH 2VIQA 2OC7A 1FN6A 3VXFH 4YOGA 3SI4H 4X1PU 2R2MB 1PPGE 2AFQB 4MPUA 3HKIB 1SMFE 4JZDH 1GBJA 1LMWB 3UR6A 1SGYE 2TGAA 1G32B 1BJVA 1WTGH 4XSKU 3MO3A 1W0YH 1ETTH 4OGYA 1C5ZB 4ABHA 2AIPA 2ZCHP 1ESBA 1GHAG 1LPZB 1C1NA 5IYTA 2C8XB 2ZDKA 2FDAA 1S0QA 3P8OA 3V7TA 1UTJA 3BSQA 2PLXA 1K1LA 6CHAB 1AZZA 1C4Y2 3EA7A 1Y59T 4Y0ZE 1EZUC 1GHXH 1SQTA 1TQ0B 3BIUH 4HTCH 1AFQB 1E38B 3VB5A 5HXFA 3GISB 1KXDA 1BT7A 3LONA 1GPZA 1RGQA 3ENSB 3MMGA 2AEIH 3RM0H 2D2DA 1WQSA 1YLDA 2GKVE 1XM1A 4UONA 3LH1A 3VFEA 1O5EH 2ZU1A 1GI6A 3LJOA 1T8NA 2SGDE 5DJ7A 5C5NA 2XW9A 1NFXA 2R3YA 1CBWC 1Y5AT 1O2JA 5B6OA 2BD3A 1C5VA 2BY5X 4WXIA 1AE5A 2ESTE 1K21H 1L2EA 4UDWH 4WXVA 1UK3A 3A7XA 4X1RU 1EQ9A 1VJAU 3OU0A 2ZU4A 3TGKE 2BD8A 4INKA 1KLJH 1TX7A 2H9EH 3T29A 3TJVA 3F68H 1AE8H 1BMNH 2FPZA 4X6NA 4KTSA 2OC0A 5A2MH 5T6DA 2P8OC 1WAYB 1FAKH 1BCUH 2BZ6H 3A8CA 3UTUH 6GCHF 2DE9A 3SGQE 6ESTA 1H9LB 1P2QA 3EA9A 5I25A 4AX9H 1TE0A 4ISHH 3VB7A 3B23B 2WPKS 3OX7U 2FOEA 1O39A 2FOCA 2HWLB 4IN1A 4DT7B 2BDCA 4K8BA 5IDKA 1HPGA 1TX8A 3GY4A 1NRNH 4WH6A 4Z0KA 1BRUP 2ZZUH 2A0QB 1EX3A 2VGCC 1ZHMA 3C27B 4BAKB 3SNCA 4J2YB 3F9GA 1BUIA 3BTTE 1GJ4H 1QY6A 2P93A 4AN7A 1GCDA 1OP0A 2KAIB 1O2VA 3E91A 4R0IA 3MNCA 2HGTH 1CA0C 5EOKA 1TRNA 1NRQH 1EJAA 1O3GA 4CR9A 7KMEH 1SQAA 3SJIA 1O2KA 5EPNA 1UVPA 2ZPQA 2C93B 3LC5A 1P2OA 4X2VA 3DUXH 4ABAA 2ZFSA 4Y0YE 1CHOG 4A6LA 1VITF 1ZMNA 3MU1A 3TITA 2P94A 1GL0E 3VPKA 1ZYOA 5F8TA 1AUJA 1EAUA 1GI3A 2FP7B 2ALVA 1GMDF 5HM9A 2F9UA 1OWEA 2D26C 5LH8A 3ZVCA 4OS5A 1ANBA 1XUIA 3O8BA 4GSOA 2RA3A 4MPXA 4MPVA 4A1TA 3LH3A 3BTGE 1PQ8A 2OD3B 3KF2A 5BRRE 1C1SA 2A7HA 4H4FA 1YPHE 4MTBA 5DO4H 3H7TA 3SBKA 1LPGB 1VCQA 1S83A 1C2HA 1DWCH 1KYNA 3UY9A 3P8GA 1CQQA 2ZC9H 1U6QA 1IHTH 1TMTH 1TQ7B 1P8VC 4BNRA 1BJUA 4AYYB 4KTCA 3MNXA 3RU4T 1CBWB 4CRBA 1QFKH 3F1SB 4BXSA 1C2LA 1GBIA 1P09A 2FWWA 2WV5A 3SU0A 1HAZB 3E3TA 2QXIA 1UVOA 1BDAA 2BDIA 1C1WH 4TPYA 4OS1A 4BTTB 2J2UA 4OS7A 2XNIA 3LU9B 3EA8A 5EXLA 4WVPE 2A7CA 1OS8A 5GCHF 2A2XH 1OP8A 4ZH8A 4ABBA 1MH0A 1HIAA 1NRSH 1O2UA 1P2JA 4RKOB 2P8OB 1HAIH 1UTKA 2NU2E 1V2UT 3OY6U 1O3JA 4CREA 4D76A 1LKBA 1XKBC 1GI4A 2HNTF 1Z8JB 4CRCA 2YOLA 3TNTA 1C5QA 2ZGCA 4MNYA 1O3HA 5C3NA 4NA7A 5FAHA 1FDPA 7GCHG 4X0WU 1KXAA 4ZKRU 3VXEH 2GX4A 2CMYA 1S0RA 2XBVA 2AGGX 2ZIQH 4NGAH 1HRTH 2JETB 4HZHA 4B1TA 1FQ3A 2VGCB 4FUBA 4NSYA 1QJ6B 1O2QA 2ZG0H 2I6SA 3SI3H 1O2PA 1ZSKA 1MZDA 1AO5A 2OC1A 1OX1A 3Q00A 2ZHDA 2QF0A 2TBSA 1AD8H 5CE1A 4H42U 2O8MA 1L4ZA 1DE7H 4SGAE 4YZUA 3SV8A 2J9NA 3MHWU 2XXLA 2FOMB 1SI5H 3P70B 1ZOMA 3DFLA 1EZSC 5EODA 1O2HA 3PM3A 1VJ9U 2XC4A 5L30H 3UUZA 4GCHF 1MD8A 1M9UA 3TK6A 2A4QA 3M35A 1TGBA 1O3OA 1PQAA 3SU6A 1P2KA 1GMHF 4YO9A 1C1UH 3NWUA 3A88A 4NIYA 1C2MA 4TWYA 3S9AA 1QL7A 5EQQA 1YPLH 2R9PA 1K1IA 1O2MA 4B2CA 2TIOA 1QA0A 3E8LA 2HOBA 2OINA 4YT6H 1BRBE 3TH3H 8GCHG 1V2RT 5HMAA 1GHWH 5LPFA 1ZSLA 4KELA 1EPTC 3SV7A 1CGIE 1CGHA 2NU4E 4B2BA 1ELFA 4Y7BA 1YYY1 4AFSA 1C9TA 3T28A 5FCKA 3IG6B 1AGJA 2PV9B 1PPCE 3OYPA 1YPEH 3LGYA 1GBDA 1O2LA 1SGFA 1BBRH 1GBFA 2Q6GA 1C2IA 1GBAA 2FI4E 2HLCA 3KIDU 1PPFE 1C1OA 3P92A 4JZIA 2RDLA 2OQ5A 1DDJA 1G3EA 4U32A 4FU8A 2GMTB 1WU1A 2GDEH 1BRCE 1XX9A 2FZZA 2Z94A 4ISOA 3VGCC 4ABIA 5FHTA 3MO9A 1JRSA 5E2PA 4UEHH 3S7KB 3UQVA 1X7AC 2GCHG 4LOYH 1KXBA 2FTMA 5JB8S 4CRAA 1DWDH 1ORFA 1Z8RA 3V0XA 1EAIA 3AASA 3UPEA 5A0BA 3CP7A 1DWEH 3RXMA 4BTUB 2M5TA 1XUFA 4FU7A 3LGVA 1T8MA 2VVCA 2ZGXH 4XE4A 2BLWA 1DUEA 4NA8A 5L2YH 3O8CA 4KGAA 1F0TA 3PROA 2XYAA 2RCEA 8ESTE 4XDEA 3MNSA 3BTWE 4AG2A 3UFAA 3SQHE 3W94A 4Y8XA 2BLVA 1TB6H 4ESTE 4GVUA 1QJ1B 1LHFH 1LVOA 1O3DA 1QBNA 3KL6A 5A0CA 1P12E 2BDBA 2FOBA 2AH4X 2IOTA 1AB9C 2D8WA 2XCFA 1QR3E 2Y7XA 3SQEE 5JYIA 3RXOA 1P05A 1OKXA 4TY7A 1GMCF 2Z9JA 2BTCE 3H7OA 5ABWA 2GD4B 4YESB 2ASUB 1OOKB 1TONA 2Y81A 3GCTG 1HXEH 3UNQA 1OSSA 2JKHA 1CO7E 1HAVB 1FY5A 2A45B 1GI1A 3SHCH 4OS6A 3EDXB 3KQCA 2PWXA 2ZFTA 1DPOA 3EGKH 4WH8A 1W10U 2VU8E 1Y3UA 4THNH 3M7UA 3RLYH 3SGAE 4K69A 3RXQA 2IPHA 1PPEE 3LGIA 4NFFA 3K9XB 3NZIA 2YNBA 2ZDNA 5LPEA 2QIQA 1G3CA 4MPWA 1UHBB 3NK8A 1HUTH 2VB0A 1BBRE 4BANB 1IQKA 1DUAA 4RN6A 1QNJA 2C90B 4XOJA 1AWFH 1CSOE 1PFXC 3SOSA 2IJOB 3SU4A 3ATLA 3ZV9A 1C1MA 1GBCA 4X1NU 1E37B 3ZVGA 4X8VH 3QX5H 1KLIH 1QRXA 1ZTKA 2VIPA 5E2OA 3M5OA 3IITA 1Z7KA 1YCPH 4O03A 1TNGA 1SGIB 3GY5A 4TYDA 3A83A 3RXDA 1FPHH 3GY7A 3KN2A 5C20A 3BG4C 2P59A 1MBMA 4CHAC 3MU5A 1HBTH 3HATH 4I8JA 1PPBH 1NFWA 2R3UA 1SB1H 3VGCB 2ZNKH 3SU1A 1P3CA 1WQVH 2ODQA 5EGMA 1O3KA 2I6QA 2BVRH 1EPTA 1LHDH 1ANEA 1MZAA 2AIQA 1QGFA 2TGTA 3KHVA 4X2XA 3UIRA 2Q1JA 1PQ7A 1JMOH 1GL1A 3A8BA 1SGEE 5JB9S 1BIOA 1GCTC 1D6RA 4I7YH 3A85A 1TNJA 4LK4A 1BTHH 1A5HA 5DP4A 1F2SE 1TPSA 1UMAH 4ZHAA 1TGCA 2WYJA 2VWNA 2BOHB 1W14U 4GLYA 1KXEA 3ZZCA 1O2NA 2XWBI 2QV1A 4ZUHA 3UNSA 3PWCA 1O3NA 2VVVA 2ZU2A 4IC5A 2HRVA 1AB9B 2C8WB 3LGWA 3MU0A 4Q2KA 3ZZDA 1NS3A 1IOEA 5C1XA 1V2MT 2JH0D 3ITIA 2BQWB 3L33A 1ELBA 1JOUB 1BQYA 4D7FA 2FLRH 1QA7A 2XBXA 1MUEB 1Y3WA 2Y5GA 2A5AA 4TWWA 5L6NH 2ZHEH 3S7HB 1HAHH 2BM2A 5C1UA 4Y6DA 2QXJA 2F9PA 2P16A 1AVXA 1K1PA 1O3CA 2BD5A 3GDVA 4CH8B 1V2KT 1TNHA 2FOFA 1FY1A 2Y5HA 4CH2B 1MU6B 3PO1B 1ELTA 1E0FD 1ZGVA 1PQ5A 1C2FA 1C5LH 1EKBB 2TGDA 2BQ6B 3M7TA 1NT1A 1TALA 2ZTYA 1TYNA 5EW2H 2ZQ2A 2P3UB 1UTQA 1TLDA 2RA0A 1CVWH 1LTOA 1GJAB 4AB8A 1O5FH 1SGQE 3B9FH 3BEIB 3UREA 1FXYA 4IC6A 5C5OA 2FX4A 1UJ1A 2BD2A 1XXFA 2ZU5A 2BDYA 1MKWK 2F3CE 1Z71A 2XWAA 2PR3A 7ESTE 5SGAE 1YCPK 1GJDB 4A5TS 4JZ1A 2PKSC 3UNRA 3BEFB 2O8WA 2GCTC 3T27A 1GDNA 2EC9H 3FZZA 5FBIA 3BEUA 2K1QA 2PW8H 1L1GA 3ZYDA 4AFUA 3RMLH 3U1IB 3U8TH 4YT7H 4FU9A 1G9IE 2NU1E 3M36A 1XVMA 1EATA 1N1LA 3BG4B 3L3TA 4CHAB 1YCPM 3MTYA 3RM2H 5FX5A 3CENA 1ABJH 2O8UA 2YNAA 3GCNA 3Q76A 1C2DA 1MKXH 3E1XB 1VGCC 3ZVAA 1O2OA 1T4VH 1FV9A 4X6MA 1K1MA 4YLUA 2WUCA 1ZRKA 2C3SA 1L0ZA 1DVAH 1TRMA 1MTVA 3AW1A 4NIVA 3JZ2B 3ATMA 5DK1A 1HFDA 5K7RA 4K1EA 3ZZBA 1A3EH 1DICA 1C4V2 3ZZ5A 2QAAA 1V2VT 3QDZB 1GCTB 1THPB 3F9EA 3SUDA 3LOXA 3SU5A 1A0HB 1GMDG 5A09A 1F5RA 2ZECA 2QCYA 4E05H 2V35A 3M3TA 1MQ5A 1TABE 1MU8B 2ZDAH 2G51A 2GZ9A 2ANYA 1W8BH 2QF3A 5A0AE 5T6GA 1GHAF 1ZPBA 1RFNA 3PB1E 3A7WA 3HPTB 2PKAA 4GHTA 4Q80A 1CU1A 2Z9LA 1YLCA 2UUJB 1C5WB 1TGSZ 4ABGA 2ZCLP 2VIVA 3TH4H 2GZ8A 4ISIH 4I8HA 3URDA 2F9OA 4I8LA 1P03A 2W26A 1TNIA 1BHXB 1YPMH 3SUGA 3EYDA 2WYGA 4AB9A 3AAUA 4I31A 4X6OA 1AU8A 4BAHB 3E90B 1KDQA 1BZXE 3BF6H 3A87A 4X2WA 3SJ9A 3ZVFA 1EZQA 5A8XA 2OXSA 2H9HA 2PGQB 2AMDA 2W3IA 2UWLA 4A1XA 4U30A 4B71A 1NESE 3MH4A 3BTEE 4IS5A 3KQEA 1A1RA 4WMDA 1FNIA 1JXPA 4E06H 1CHGA 1QIXB 2EEKA 2XC5A 1SGDE 1ZLRA 3N7OA 1S6HA 2PSYA 1A3BH 1CT4E 1IHSH 1SFIA 3I77A 2Z3CA 1GHZA 1DY9A 2FYRA 3ZZ8A 3HK3B 3QGJA 2GV6A 1EOLA 2ODPA 2WUBA 2ZI2H 2ZKSA 1GJ5H 4AFZA 3JZ1B 3PWBA 2FODA 2OCVB 1BHXF 1DY8A 1VZQH 3VB4A 1HAPH 4VGCC 1W7XH 1YF4A 3M37A 1TPOA 3KEEA 2PKSB 3PMJA 3DA9B 2GTBA 1CT2E 2GCTB 3QGNB 1EUFA 1LQEA 5T3HA 1GBEA 4BAQB 1HIAB 3KCGH 1IQIA 1AZ8A 1MKXK 4UFDH 3RXIA 1C5YB 1G3DA 2HALA 5DP7A 2ZHQH 2FX6A 1FLEE 3S9BA 1LVYA 1GBTA 1VGCB 1L1JA 4FVBA 4K8YA 1UO6A 1BMLA 3PMHB 4B2AA 3E16B 1W12U 4BAMB 2THFB 2CN0H 2SGAA 2Z3EA 1MBQA 4LZ1H 1ESTA 4FUDA 1DXWA 1HCGA 2VH6A 2BDAA 4WJG2 3SNAA 2FXRA 1WYKA 3LGTA 1DITH 5JBCS 4TY6A 5JPMH 5E8EH 4DOQA 5LPRA 4MG3A 4WF8A 3RC5A 4RSPA 1F5LA 2SNVA 4UFGH 2PSXA 1BTXA 1YC0A 1YM0A 3SZNA 4K5ZA 2BHGA 1CHOF 1AKSA 1SVPA 5DKMA 3P8FA 3V13A 4Z6AH 1S6FA 1NFUA 2GT7A 5ETXA 1J15A 2ZDLA 2F91A 4D9QA 4IGDA 2V3OH 3VB3A 4U01A 5HYOA 4YOIA 3SUFA 3UOPA 3LKWA 4BXWA 3A7VA 2W7SA 4MNWA 2Y80A 1GVKB 2Z6BD 4KTUA 1TMBH 2ZPRA 4INHA 3RXGA 1SSXA 1AVWA 4Q7ZA 3STJA 1SGFG 3D62A 1XUKA 2UUYA 1XVOA 3ZYEA 3LGUA 1B7XB 3TPIZ 4IN2A 1MTNC 1CA0B 2BQ7B 1B0FA 1QRZA 4I32A 2VVUA 3FVFB 1Q2WA 3RXEA 1VR1H 1HJAC 1ZPCA 4MLFB 1L4DA 1O34A 1SGPE 1FIZA 1WUNH 3ZZ7A 1A61H 1YKTA 5E0GA 1O5GH 5E0JA 2ZQ1A 1BRAA 1SPJA 1C5NH 3RXRA 1T7CA 1AI8H 3TGJE 4Q7YA 1KSNA 1G3BA 2O9QA 2XCNA 1UK2A 3KNXA 2ALPA 1P01A 1HAOH 1UK4A 2NWNA 4YLQH 2CV3A 3C1KA 5BPEA 2EI8A 1HAYB 5JBTA 3RMMH 1GBHA 3F9FA 1MTSA 3I78A 3ZZ9A 2PUXB 1O5CB 3RDZA 1PYTC 1P9SA 1V2LT 3RXUA 1NU7B 2ZPSA 1O37A 2XRCA 3GCHC 4E7NA 1Z8GA 7GCHF 1N6YA 1K1NA 4GAWA 3UQOA 1C1VH 2HPQH 5JDUB 1EXFA 2FEQH 1O33A 1S81A 3RMNH 1P0SH 1XUHA 1SOZA 2ZDMA 5L2ZH 3TJOA 1ELVA 2OQUA 5TCAA 4PROA 1ETRH 2FM2A 1Y8TA 2DUCA 1OWIA 4XBCA 1OP2A 1GBBA 2G4UA 5DP8A 1EP6A 1GI7B 1BB0B 1SQOA 4HGCA 3EAJA 1QHRB 3MWIU 2A2QH 1TBZH 4OGXA 2Q6DA 3A7TA 5DGJA 1W3CA 3EQ0H 3PLBA 3SORA 2AMQA 1YBWA 3KQBA 1GG6C 4UD9H 4DY7B 4M7GA 2QA9E 1H9IE 3FP8E 3SU3A 3U8OH 4DGJA 3U1JB 1O31A 1C5OH 3F9HA 2AMPA 1W11U 2ZTXA 4NZQA 5FPTA 1GBLA 2BDHA 1PYTD 1LCYA 1OYQA 5GWZA 1WBGB 2SGFE 4UFEH 1ZSJA 3RC4A 1O3EA 3Q3YA 1NPMA 2XC0A 2ZDVH 3TGIE 4CRFA 2ANKH 2SGEE 3ZZ3A 4AFQA 1QRWA 5F6MA 4B75A 4ZXYH 1SHHB 1TOMH 3A8AA 1NY22 1YPKH 1JIMA 5GPIB 3FP6E 1AUTC 3DT0H 1MTNB 1DANH 1MAYA 3V3MA 4WMEA 4KP0A 2Z7FE 1CGJE 1PJPA 3I29A 1RS0A 3A82A 4FUEA 1IAUA 1SLXB 2B8OH 1HJAB 2CF9H 1GI5A 1DM4B 5I46H 1MMJN 1LKAA 2ILNA 3A7ZA 2EI7A 3D23A 2ZGBH 3Q77A 2SFAA 1GHBG 1ZR0A 1EB2A 3BTKE 3GY8A 5JBAS 1UVSH 4ZXXH 3WY8A 2A4OA 1K28D 1V2NT 2BXUH 2P3TB 3LC3A 1E34B 4ZAEA 9LPRA 5EQSA 2GCHF 2ZO3H 2ULLA 4ABEA 2GDDA 1SG8B 1C2KA 3Q3XA 2F83A 1GJ7B 1G30B 3QWCH 1O36A 1PPZA 1A7SA 1LHGH 4H6SB 1C9PA 1D6WA 2XBYA 3QZRA 4NIWA 1NZQH 1GDQA 2FTLE 1P57B 2WPIS 1SOTA 1LO6A 2CGAA 2VIOA 1EPTB 4FVDA 1IQGA 2LNCA 4FXGH 1NRRH 3RXHA 3HGNA 3GCHB 3K6YA 3T25A 3DD2H 1BBRK 2BLOA 5FX6A 1DX5M 1JIRA 2BXTH 4O3TA 2B5TB 1EAXA 4FUCA 2G4TA 1GGDC 1MCTA 1TAWA 1ZGIA 4LXBH 3GOVB 1Z6JH 3ZZ6A 3ZVBA 1JRTA 3HKJB 4X8SH 3BTME 1BTPA 1XKAC 3V12A 1ETSH 5DP3A 1O2TA 1AVGH 2AERH 5HM2A 1DWBH 2FESH 2FI3E 2PUQH 1NRPH 2A31A 1C2JA 2BVXH 2VIWA 2VIDA 1HLTH 3P6ZB 4NWKA 1YPJH 1GHYH 1T31A 3K6ZA 1AWHB 1FY8E 4JYUH 1O2IA 1O3PB 2SGPE 3MNBA 4D7GA 4I8KA 1GJ9B 3T2NA 1O2YA 4DCDA 1ZRBA 2G81E 2CHAC 1BMAA 2WPJS 1TPPA 2A5IA 1P2IA 3GY6A 3RXLA 1LHCH 1ANDA 2EA3A 5EXNA 1S85A 3SO3A 1QB9A 2AGIX 2VWMA 1ZZZA 2RG3A 3VEQB 1MCVA 5FCRA 1ELGA 1QQ4A 1NC6A 1A2CH 2BB4A 4TPIZ 5G4BA 1BTZA 2OC8A 2Y6TA 3ATKA 2WINI 1TPAE 2ZF0H 3GYMA 2Q6FA 2QXHA 1XXDA 2Y82A 2G8TA 1O3IA 4OS2A 4Y8ZA 9ESTA 3W95A 4IMZA
chains in the Genus database with same CATH superfamily
2Y7ZA 1WTHD 3VG8A 1OWKA 4ZMAH 1T4UH 1KMHB 2O8TA 3QO6A 1YLNA 1C1QA 3ZV8A 4O9VA 5J4QA 1V2TT 1BTYA 1E35B 1DT2A 1CE5A 1S84A 1RIWC 1E36B 3BV9B 2AGEX 3GDSA 1QJ7B 3A89A 1V2QT 1F0UA 3UR9A 1YGCH 1GVLA 3SNBA 3QLPH 5FL7D 1EJNA 4AYVB 3U9AH 1GJBB 4E7RG 4Y7AA 3U28C 5E0HA 1GJ8B 2BVSH 2ZTZA 1BTUA 2FS8A 3STIA 1C5TA 5CMXH 2RFKC 3GY2A 2PGBB 1ANCA 1S82A 2ZCKP 1ELCA 1YP9A 1C5XB 1RJXB 4K60A 6GCHG 2W6JD 2K8IA 3PLKA 2A4RA 2CXVA 1Z1JA 4DVAU 3TJNA 4R8TB 2XNDD 4ZKNU 3M5LA 1SGCA 3UWIA 3FFGA 3IWMA 4MNXA 3TLOA 3QK1A 3CS7A 3SJ8A 1HAXB 2G5VA 1INCA 1BA8B 2OLGA 1FPCH 1GJCB 1P2NA 2OUAA 4I8GA 4B73A 3RC6A 3MOCA 1OYTH 4F49A 2F9VA 1G37A 1GGDB 1O2XA 1OPHB 2W3KA 5H4IB 2V6NA 3A7YA 1FIWA 1K9OE 4WY3A 1H8ED 1N8OC 3BTFE 2EI6A 3BTHE 3PTNA 1D3TB 4WWYA 1WSSH 3PTBA 2WPHS 1K22H 4X2YA 1UVTH 1RTFB 2OBOA 4INLA 4MQAA 1Y5BT 3AW0A 4YTAA 2NU3E 3SJKA 6LPRA 1N6XA 2WV4A 5F03A 2ZU3A 5FBEA 3WW7A 2PKAB 1V2WT 2HNTC 2QXGA 3SNDA 2W7UA 4ISNA 1FY4A 3TJUA 1VITG 4ZCNA 1P9UA 2A5KA 1K1JA 2FYQA 2BY6X 3LDXH 4NZLA 3SUEA 1O3MA 3T62A 1YPGH 1SC8U 3SZEA 4J1YA 2IN2A 3MI4A 1FY3A 4MVNA 8KME2 2CHAB 4ZKOU 5ESBA 1KDQB 7LPRA 1O2RA 1V2JT 1H1BA 2Z3DA 3SU2A 1A46H 3SV9A 1WDIA 1DSUA 2V3HH 1VCPA 1J16A 5CHAC 1QB6A 4JZEH 2PHBA 1GBKA 3RMOH 4JMYA 4XFQA 2FOGA 3SV2H 1TBRH 3QUMP 3W1EA 4DG4A 2WPLS 5DP9A 2HVYB 1J17T 3NXPA 1ZTLA 2HPPH 2ZGHA 4YXWD 3K2UA 3UAIC 3A81A 1NN6A 2HNTE 2JH5D 1FI8A 4WMFA 2VBCA 3MYWA 5FXLA 3BN9A 1V2PT 2UWPA 1RTKA 3ZZAA 3SJOA 2H5CA 4UE7H 3TVJB 2JETC 3NPSA 3ZVDA 1V6DA 2FLBH 1IQHA 4DW2U 1RIWB 2ZFRH 3U98H 2LPRA 4X6PA 2W5EA 1UTMA 4Y71A 1YPHC 1AHTH 1MD7A 1SBWA 2OTVA 1O2ZA 3O8DA 1H8DH 5C0UA 3ELAH 2P95A 3SN8A 5KGOA 1J14A 1AY6H 5GCHG 1C2EA 3M3SA 2M2AA 2P3FH 5TCCA 2ZA5A 1C5PA 3F0OA 1RD3B 5C2ZA 4X1SU 5GJ4B 3TK5A 1FX0B 3KGPA 2BD7A 3AVZA 2QN5T 1TOCB 1GI0A 5EU8A 3LIWA 3H5CB 2QC2A 1QBOA 2FI5E 3GICB 1QURH 3TK9A 4BTIB 1SLWB 1K2I1 2KAIA 4I33A 1A4WH 4X1QU 1Z6EA 1BOQA 3TH2H 1D4PB 1D3QB 1F5KU 1UTLM 3BG8A 4BAOB 3MH6A 2VNTA 1SFQB 1TA2A 4SGBE 3N7EA 1ZJDA 4F4OC 1N8OB 1V2ST 1A0LA 4IBLH 1P3EA 4O97A 3DHKH 4K1TA 1RRKA 5EJZA 3MU4A 3RXCA 1AKSB 1H4WA 2FOHA 4DJZB 1ZMLA 5EG4A 1HNEE 1LPKB 3RU4E 1EB1H 3FO8D 5FPSA 2J4IA 3FANA 2ZHWH 3RU4D 1OWHA 2BOKA 2WPMS 4IW4E 5DP5A 1FONA 1HYLA 1TIOA 1D9IA 1ZMJA 1NFYA 4GHQA 3O8RA 5AHGH 1BMMH 1DFPA 3R0FA 4MNVA 2OK5A 3RXJA 1AMHA 1UTNA 3CS0A 1THRH 2QY0B 5DSFA 4NFEA 1O3BA 1ZPZA 5C94A 3SW2B 4GCHG 4NWLA 3FP7E 3FAOA 2BY8X 4NIXA 3F6UH 3HGPA 1G2LA 5F8XA 2GMTC 1MABB 2VWLA 1QL8A 3SGBE 4U2WA 5DPAA 4ZROA 4ZKSU 4FUIA 2FMJA 5AFYH 2CJIA 3PV4A 3Q3KA 1GMHG 4DURA 1O5BB 2VWOA 4UFFH 3L6PA 2GVFA 4JCNA 3S9CA 3UOUA 5CHAB 1LVBA 2UWOA 2A4GA 2NU0E 4X8TH 3TIUA 2SGQE 1J8AA 4K1SA 1O30A 2HVXA 1W0ZU 3BTDE 2BYAX 2J95A 2R0LA 1CA8B 3R3GB 2L6OA 1TBQH 1GDUA 2R2WU 4FUFA 2G5NA 1WCZA 2AS9A 3MH5A 1RTLA 4KKDA 5HGGA 2ANWA 4H6TA 5LGOA 1B0EA 1O5DH 1K1OA 2XBWA 3GDUA 4GPGA 4B74A 2QGRA 3ZVEA 3B8JA 3LPRA 2UUFB 2F9BH 3A80A 4CR5A 1FAXA 1ELAA 3NKKA 1TNKA 1ID5H 5HKKD 5AVDA 1QTFA 2STAE 1D3PB 3QZQA 1S5SA 4ABDA 1C5RA 1F7ZA 5AFZH 1TGNA 5EPYA 1SGRE 5J4SA 1Q31A 4CBNA 4AGKA 4YM9A 1DSTA 1NTPA 1BITA 1T32A 2JDID 1HB0B 4MDSA 1CT0E 1H8IH 1F0SA 2VH0A 1RXPA 4OS4A 1O38A 5AF9H 4Q7XA 1C1TA 3M61U 4JK6A 4AORA 1QBVH 5GXPA 3U8RH 2H1UA 4D9RA 1HGTH 1KTSB 1EJMA 3M5MA 3D65E 3H09A 4XBBA 4VGCB 4ABFA 2ODYB 1VCWA 1V2OT 3SHAH 2WHXA 3KQDA 4NA9H 5T1VA 4IMQA 1NROH 1GI2A 3RXFA 4YOJA 2D1JA 1G2MA 2L74A 4Y8YA 3ZZ4A 4AGJA 1A5IA 4CRDA 5T6FA 1W2KH 4CRGA 4A92A 2VINA 1O0DH 2V0BA 4O3UA 3RXSA 4RKJB 4QT8C 1AIXH 1LQDB 3ODFA 1F0RA 1D3DB 1JBUH 3RLWH 3NRLA 3RXAA 2C8YB 1GMCG 5C67A 2GZ7A 1DS2E 1HDTH 4DIHH 3T5FH 1KXFA 1ARBA 1FZZA 4Y79A 1XMNB 1HV7A 2G52A 1ELEE 1SHYA 1TGTA 5A8YA 5IK2D 1SGTA 1OWJA 1P11E 2GP9B 1P2MA 1V3XA 1P04A 1L1NA 3PV2A 1HXFH 2ZGJA 3RXTA 1MAXA 1AQ7A 1OXGA 1KY9A 5F53A 4NCYA 1SLUB 1Y3XA 2H6MA 5F8ZA 1T8OA 4JK5A 5A8ZA 3U69H 4BOHA 5GDSH 1UCYH 4K2YA 2DE8A 1BTWA 4XBDA 2BMGB 1ZHRA 1GI8B 3OSYA 3LT3A 1IQLA 1O3AA 3OTJE 1TWXB 2ANMH 3MU8A 5ESTE 1W13U 2BLQA 4FUHA 1GWAA 4FUGA 4CBOA 4ISLA 3PYHA 4OM9A 3RXPA 3TU7H 1MTUA 1E1RD 1PPHE 3AK5A 3GYLB 2STBE 3PMBB 1F92A 2Y5FA 1ZTJA 2BX4A 3RXVA 3URCA 2GT8A 2OBQA 2A1DB 1KIGH 2SNWA 1FN8A 2Z9KA 3P17H 3A86A 2AYWA 1IQNA 1IQMA 2FS9A 2KCPA 3UWJH 1HJ8A 1MQ6A 1SR5C 2BY7X 1ZJKA 2A7JA 1SGNE 2UUKB 3ATWA 3E0NB 4AOQA 1C1RA 2A32A 1O2GH 1EP5A 4Y10E 5DG6A 3RUOA 5JBBS 3PMAB 2Z9GA 8GCHF 2V7QD 3DSPA 1Z8IB 1C2GA 2FO9A 1DXPA 1DLKB 1GHVH 1ZHPA 2CF8H 5C0TA 1T8LA 1TX6A 3GCOA 1KLTA 2J92A 2H9TH 1KTTB 1P06A 1Q3XA 3P8NA 4K3JA 4X8UH 2ZEBA 4FUJA 2B7DH 3M5NA 2O8LA 4Y11E 1TRYA 3MH7A 4ABIA 1OHHD 2F9NA 5K0HA 1A5GH 2Z9IA 3NUMA 2BD9A 1O32A 2TGPZ 1EZXC 1ABIH 1THSH 1TMUH 1Y3VA 1Z1IA 1P10A 1H9HE 3QTVH 4AG1A 5EQRA 3S69A 3PO1C 4JYTA 1UVUH 4A7IB 4DIIH 4NG9H 4GUXA 1NU9A 2VJ1A 3BTQE 1NM6A 2TRMA 1GJ6A 1JWTA 1O5AB 1TA6A 1O2WA 5KEDA 3S0NA 3DFJA 3K65B 3KYFA 3M3VA 3BIVH 1SL3A 2OP9A 1LVMA 2C8ZB 3PLPA 1FJSA 1TFXA 6CHAC 2H5DA 1HAVA 1UCYE 1QCPA 2BDGA 1O3FA 2R0KA 5EXMA 1NO9H 3A8DA 1H8HD 1DOJA 1LDTT 1QQUA 4B76A 1GI9B 1GVZA 2FOAA 3MFJA 1EOJA 8LPRA 4HI3A 5C1YA 1UTPA 4NSVA 3ESTA 1AFQC 3QTOH 1ESAA 2ZP0H 3AAVA 1MKWH 2B9LA 1O35A 4D8NA 2IJD1 1QB1A 1UCYK 1VITH 1DLEA 1C4U2 4ZHLU 1WV7H 2BX3A 2JH6D 4ACBA 3A84A 3KQ5A 5EW1H 3TNSA 3P95A 5TJXA 1KXCA 1LHEH 1UHBA 2G55A 3GCTF 3SV6A 1GBMA 1GG6B 2GGVB 1MTWA 3OEED 4RT1A 1A0JA 4JZFH 5GIBA 2ZFQH 1Y3YA 4AZ2B 3VB6A 1GHBF 1IQJA 1P02A 3QN7A 1FMGA 5GNDA 4LZ4B 3GY3A 3RP2A 1UTOA 4HFPB 1IQEA 2TPIZ 2WSSD 2ZFFH 2PTNA 2ZFPH 2LP6A 1B5GH 1O2SA 3T26A 1WOFA 1XUGA 3NCLA 1AN1E 1QL9A 3D49H 4JYVH 3ATIA 1C5UA 2BY9X 4ZHMU 2ZHFH 4ABJA 2QF4A 3MO6A 2FIRH 3E0PB 2J94A 2BD4A 4Y76A 2G00A 2H2ZA 4ASHA 1SLVB 3WWFA 1ACBE 1ELDE 1FUJA 4M9FA 1EASA 1Y5UT 3FKSD 1TNLA 1XUJA 2GV7A 2PTCE 2J34A 1ARCA 1G36A 1OWDA 3EE0B 5FPYA 2ZWLH 3RXBA 2XTTB 1C5SA 3HK6B 5DP6A 1W7GH 2J38A 1O3LA 1HAGE 3RXKA 2QYIA 3ODDA 3SNEA 3LJJA 1EAWA 2B0FA 3E6PH 2BZAA 3FZDA 1J9CH 1C5MD 1HJ9A 2RDEA 3OY5U 1C1PA 1IQFA 4A1VA 3G01A 3M7QA 2C4FH 2PFEA 5PTPA 1AFEH 2VIQA 2OC7A 1FN6A 3VXFH 4YOGA 3SI4H 4X1PU 1NBME 1WXRA 2EY4C 2R2MB 1PPGE 2AFQB 1NBMD 4MPUA 3HKIB 1SMFE 4JZDH 1GBJA 1LMWB 3UR6A 1SGYE 2TGAA 1G32B 3N7DA 1BJVA 1WTGH 4XSKU 1QZ8A 3MO3A 1W0YH 1ETTH 4OGYA 1C5ZB 4ABHA 2AIPA 2ZCHP 1ESBA 1GHAG 1LPZB 1C1NA 5IYTA 2C8XB 2ZDKA 2FDAA 1S0QA 3P8OA 3V7TA 1UTJA 3DSOA 3BSQA 2PLXA 1K1LA 6CHAB 1AZZA 1C4Y2 3EA7A 1Y59T 4Y0ZE 1EZUC 1GHXH 1SQTA 1TQ0B 3BIUH 4HTCH 1AFQB 1E38B 3VB5A 5HXFA 3GISB 1KXDA 1BT7A 3LONA 1GPZA 1RGQA 3ENSB 3MMGA 2AEIH 3RM0H 2D2DA 1WQSA 1YLDA 2GKVE 1XM1A 4UONA 3LH1A 3VFEA 1O5EH 2ZU1A 1GI6A 3LJOA 1T8NA 2SGDE 5DJ7A 5C5NA 2XW9A 1NFXA 2R3YA 1CBWC 1Y5AT 1O2JA 5B6OA 2BD3A 1C5VA 2BY5X 4WXIA 1AE5A 2ESTE 1K21H 1L2EA 4UDWH 4WXVA 1UK3A 2YMSC 3A7XA 5CDFE 4X1RU 1EQ9A 1VJAU 3OU0A 2ZU4A 3TGKE 2BD8A 4INKA 1KLJH 1TX7A 2H9EH 3T29A 3TJVA 3F68H 1AE8H 1BMNH 2FPZA 4X6NA 4KTSA 2OC0A 5A2MH 5T6DA 2P8OC 1WAYB 1FAKH 1BCUH 2BZ6H 3A8CA 3UTUH 6GCHF 2DE9A 3SGQE 6ESTA 1H9LB 1P2QA 3EA9A 5I25A 4AX9H 1TE0A 4ISHH 3VB7A 1SKYE 3B23B 2WPKS 3OX7U 2FOEA 1O39A 2FOCA 2HWLB 4IN1A 4DT7B 2BDCA 4K8BA 5IDKA 1HPGA 1TX8A 3GY4A 1NRNH 4WH6A 4Z0KA 3ZIAD 1BRUP 2HLDD 2ZZUH 4FOUC 2A0QB 1EX3A 2VGCC 3FOAA 1ZHMA 3C27B 4BAKB 3SNCA 4J2YB 3F9GA 1BUIA 3BTTE 1GJ4H 1QY6A 2P93A 4AN7A 1GCDA 1OP0A 2KAIB 1O2VA 3E91A 2YMSD 4R0IA 3MNCA 2HGTH 1CA0C 5EOKA 1TRNA 1NRQH 1EJAA 1O3GA 4CR9A 7KMEH 1SQAA 3SJIA 1O2KA 5EPNA 1UVPA 2ZPQA 2C93B 3LC5A 1P2OA 4X2VA 3DUXH 4ABAA 2ZFSA 4Y0YE 4HG6A 1CHOG 4A6LA 1VITF 1ZMNA 3FN8A 3WWBA 3MU1A 3TITA 2P94A 1GL0E 3VPKA 1ZYOA 5F8TA 1AUJA 1EAUA 1GI3A 2FP7B 2ALVA 1GMDF 5HM9A 2F9UA 1OWEA 2D26C 5LH8A 3ZVCA 2GJGA 4OS5A 1ANBA 1XUIA 3O8BA 4GSOA 2RA3A 4MPXA 1SQRA 4MPVA 4A1TA 3LH3A 3BTGE 1PQ8A 3DSGA 2OD3B 3KF2A 5BRRE 1C1SA 2A7HA 4H4FA 1YPHE 4MTBA 5DO4H 3H7TA 3SBKA 5EJ1A 1LPGB 1VCQA 1S83A 1C2HA 1DWCH 1KYNA 3UY9A 3DCLA 3P8GA 1CQQA 2ZC9H 1U6QA 1IHTH 1TMTH 1TQ7B 1P8VC 4BNRA 1BJUA 4AYYB 4KTCA 3MNXA 3RU4T 1CBWB 4CRBA 1QFKH 3F1SB 4BXSA 1C2LA 1GBIA 1P09A 2FWWA 2WV5A 3PV5A 3SU0A 1HAZB 2YMSB 3E3TA 2QXIA 1UVOA 1BDAA 2BDIA 1C1WH 4TPYA 4OS1A 4BTTB 2KCAA 2J2UA 4OS7A 2XNIA 3LU9B 3EA8A 5EXLA 4WVPE 4B6EA 2A7CA 1OS8A 5GCHF 2WZQA 2A2XH 1OP8A 4ZH8A 4ABBA 1MH0A 1HIAA 1NRSH 1O2UA 1P2JA 4RKOB 2P8OB 1HAIH 1UTKA 2NU2E 1V2UT 3OY6U 1O3JA 4CREA 4D76A 1LKBA 1XKBC 1GI4A 2HNTF 1Z8JB 4CRCA 2YOLA 3TNTA 1C5QA 2ZGCA 4MNYA 1O3HA 5C3NA 4NA7A 5EIYA 3OEHD 5FAHA 1FDPA 7GCHG 4X0WU 1KXAA 4ZKRU 3VXEH 2GX4A 2CMYA 1S0RA 2XBVA 2AGGX 2ZIQH 4NGAH 1HRTH 2JETB 4HZHA 4B1TA 1FQ3A 2VGCB 4FUBA 4NSYA 1QJ6B 1O2QA 2ZG0H 2I6SA 4P00A 3SI3H 1O2PA 1ZSKA 1MZDA 1AO5A 2OC1A 1OX1A 3Q00A 2ZHDA 2QF0A 2TBSA 2KR7A 1AD8H 5CE1A 4H42U 2O8MA 1L4ZA 1DE7H 4SGAE 4YZUA 3SV8A 2J9NA 4ACAA 3MHWU 2XXLA 2FOMB 1SI5H 3P70B 1ZOMA 3DFLA 1EZSC 5EODA 1O2HA 1YY3A 3PM3A 1VJ9U 2XC4A 5L30H 3UUZA 4GCHF 1MD8A 1M9UA 3TK6A 2A4QA 3M35A 1TGBA 1O3OA 1PQAA 3SU6A 1P2KA 1GMHF 4TT3D 4YO9A 1C1UH 3NWUA 3A88A 2K0QA 1C2MA 4NIYA 4TWYA 3S9AA 1QL7A 5EQQA 3CNRA 1YPLH 2R9PA 1K1IA 1O2MA 4B2CA 2TIOA 1QA0A 3E8LA 2HOBA 2OINA 4YT6H 1BRBE 3TH3H 8GCHG 1V2RT 5HMAA 1GHWH 5LPFA 1ZSLA 4KELA 1EPTC 3SV7A 1CGIE 1CGHA 3N99A 2KX4A 2NU4E 4B2BA 1ELFA 4Y7BA 4XRNA 1YYY1 4AFSA 1C9TA 3T28A 5FCKA 3IG6B 1AGJA 2PV9B 1PPCE 3OYPA 1YPEH 3LGYA 1GBDA 1O2LA 1SGFA 1BBRH 1GBFA 2Q6GA 1C2IA 1GBAA 2FI4E 2HLCA 3KIDU 1PPFE 1C1OA 3P92A 4JZIA 2W6ID 2RDLA 2OQ5A 1DDJA 1G3EA 4U32A 4FU8A 2GMTB 1WU1A 2GDEH 1BRCE 1XX9A 2FZZA 2KM0A 2Z94A 1E79D 4ISOA 5FHTA 3MO9A 3VGCC 1JRSA 5E2PA 4UEHH 3S7KB 3UQVA 1X7AC 2GCHG 4LOYH 1KXBA 2FTMA 5JB8S 3OAAD 1DWDH 4CRAA 1ORFA 1Z8RA 3V0XA 1EAIA 3AASA 3UPEA 5A0BA 3CP7A 1DWEH 3RXMA 4BTUB 2M5TA 1XUFA 4FU7A 3LGVA 1T8MA 2VVCA 2ZGXH 4XE4A 2BLWA 3OE7D 1DUEA 4NA8A 5L2YH 3O8CA 4KGAA 1F0TA 3PROA 2XYAA 2RCEA 8ESTE 4XDEA 3MNSA 2EQNA 3BTWE 4AG2A 3UFAA 3SQHE 3W94A 4Y8XA 2BLVA 1TB6H 4ESTE 4GVUA 1QJ1B 1LHFH 1LVOA 1O3DA 1QBNA 3KL6A 5A0CA 1P12E 2BDBA 2FOBA 2AH4X 2IOTA 1AB9C 2D8WA 2XCFA 1QR3E 2Y7XA 3SQEE 5JYIA 3RXOA 1P05A 1OKXA 4TY7A 1GMCF 2Z9JA 2BTCE 3H7OA 5ABWA 2GD4B 4Q63A 4YESB 2J97A 2ASUB 1OOKB 1TONA 2Y81A 3GCTG 1HXEH 3UNQA 1OSSA 2JKHA 1CO7E 1HAVB 1FY5A 2F43B 2A45B 1GI1A 3SHCH 4OS6A 3EDXB 3KQCA 2PWXA 2ZFTA 1DPOA 3EGKH 3F2FA 4WH8A 1W10U 2VU8E 1Y3UA 4THNH 3M7UA 3RLYH 3SGAE 4K69A 3RXQA 2IPHA 5KECA 1PPEE 3LGIA 4NFFA 2WPDD 3K9XB 3NZIA 2YNBA 2ZDNA 5LPEA 2QE7D 2QIQA 1G3CA 4MPWA 1UHBB 3NK8A 1HUTH 2VB0A 1BBRE 4BANB 1IQKA 1DUAA 4RN6A 1QNJA 2C90B 4XOJA 1AWFH 1CSOE 1PFXC 3F2GA 3SOSA 2IJOB 3SU4A 3ATLA 3ZV9A 1C1MA 1GBCA 4X1NU 1E37B 3ZVGA 4X8VH 2WV9A 5HIYA 3QX5H 1KLIH 1QRXA 1ZTKA 2VIPA 5E2OA 3M5OA 3IITA 1Z7KA 5C17A 1YCPH 4O03A 1TNGA 1SGIB 3GY5A 4TYDA 3A83A 3RXDA 5CHBA 1FPHH 3GY7A 3KN2A 2XOKD 5C20A 3BG4C 2P59A 1MBMA 4CHAC 3MU5A 3GS9A 1HBTH 3HATH 4I8JA 1PPBH 1NFWA 2R3UA 1SB1H 3VGCB 2ZNKH 3SU1A 1P3CA 1WQVH 2ODQA 5EGMA 2J98A 3SYJA 1O3KA 2I6QA 2BVRH 1EPTA 1LHDH 1ANEA 1MZAA 4P02A 2AIQA 1QGFA 2TGTA 3KHVA 4X2XA 3UIRA 2Q1JA 1PQ7A 1JMOH 1GL1A 3A8BA 1SGEE 5JB9S 2AHME 1BIOA 1GCTC 1D6RA 4I7YH 3A85A 1TNJA 4LK4A 1BTHH 1A5HA 5DP4A 1F2SE 1TPSA 1UMAH 4ZHAA 1TGCA 2WYJA 2VWNA 2BOHB 1W14U 4GLYA 1KXEA 3F3BA 3ZZCA 1O2NA 5EJLA 2XWBI 2QV1A 4ZUHA 3UNSA 3PWCA 1O3NA 2VVVA 2ZU2A 4IC5A 2HRVA 1AB9B 2F4LA 2C8WB 3LGWA 3MU0A 4Q2KA 3ZZDA 1NS3A 1IOEA 5C1XA 1V2MT 2JH0D 3ITIA 2BQWB 3L33A 3KYGA 1ELBA 1JOUB 1BQYA 4D7FA 2FLRH 1QA7A 2XBXA 1MUEB 1Y3WA 2Y5GA 2A5AA 4TWWA 5L6NH 2ZHEH 3S7HB 1HAHH 2BM2A 5C1UA 4Y6DA 2QXJA 2F9PA 2P16A 1AVXA 1K1PA 1O3CA 2BD5A 3GDVA 4CH8B 1V2KT 2JJ1D 1TNHA 2FOFA 1FY1A 2Y5HA 4CH2B 1MU6B 3PO1B 1ELTA 1E0FD 1ZGVA 1PQ5A 1C2FA 1C5LH 1EKBB 2TGDA 2BQ6B 3M7TA 1NT1A 1TALA 2ZTYA 4Z1MD 1TYNA 5EW2H 2ZQ2A 2P3UB 1UTQA 1TLDA 2RA0A 1CVWH 1LTOA 1GJAB 4AB8A 1O5FH 1SGQE 3B9FH 3BEIB 3UREA 1FXYA 4IC6A 5C5OA 2FX4A 1UJ1A 2J5UA 2BD2A 1XXFA 2ZU5A 2BDYA 1MKWK 2F3CE 1Z71A 2XWAA 2PR3A 7ESTE 5SGAE 1YCPK 1GJDB 4A5TS 4JZ1A 2PKSC 3UNRA 1COWD 3BEFB 2O8WA 2GCTC 3T27A 1GDNA 2EC9H 3FZZA 5FBIA 3BEUA 2K1QA 2KCOA 1L1GA 2IPQX 2PW8H 3ZYDA 4AFUA 3RMLH 3U1IB 3U8TH 4YT7H 4FU9A 1G9IE 2NU1E 3M36A 1XVMA 1EATA 1N1LA 3BG4B 3L3TA 4CHAB 1YCPM 3MTYA 3RM2H 5FX5A 3CENA 1ABJH 2O8UA 2YNAA 3GCNA 3Q76A 1C2DA 1MKXH 3E1XB 1VGCC 3ZVAA 1O2OA 1T4VH 1FV9A 4X6MA 1K1MA 4YLUA 2WUCA 1ZRKA 2C3SA 1L0ZA 1DVAH 1TRMA 1MTVA 3PRBA 3AW1A 4NIVA 3JZ2B 3ATMA 5DK1A 1HFDA 5K7RA 4K1EA 3ZZBA 1A3EH 1DICA 1C4V2 3ZZ5A 2QAAA 1V2VT 4RT0A 3QDZB 1GCTB 1THPB 3F9EA 3SUDA 3LOXA 3SU5A 1A0HB 1GMDG 5A09A 1F5RA 2ZECA 2QCYA 4E05H 2V35A 3M3TA 1MQ5A 1TABE 1MU8B 2ZDAH 2G51A 2GZ9A 2ANYA 1W8BH 2QF3A 5A0AE 5T6GA 1GHAF 1ZPBA 1RFNA 3PB1E 4ASUD 3A7WA 3HPTB 2PKAA 4GHTA 3MQKC 4Q80A 1CU1A 2Z9LA 1YLCA 2UUJB 1C5WB 1TGSZ 5HIZA 4ABGA 2ZCLP 2VIVA 3TH4H 2GZ8A 4ISIH 4I8HA 3URDA 2F9OA 4I8LA 1P03A 2W26A 1TNIA 2V3MA 1BHXB 1YPMH 3SUGA 3EYDA 2WYGA 4AB9A 3AAUA 4I31A 4X6OA 1AU8A 4BAHB 3E90B 1KDQA 1BZXE 3BF6H 3A87A 4X2WA 3SJ9A 3ZVFA 2KFWA 1EZQA 5A8XA 4XD7D 2OXSA 2H9HA 1VKYA 2PGQB 2AMDA 2W3IA 2UWLA 4A1XA 4U30A 4B71A 1NESE 3MH4A 3BTEE 4IS5A 3KQEA 1A1RA 4WMDA 3OTPA 1FNIA 1JXPA 4E06H 1CHGA 1QIXB 2EEKA 2XC5A 1SGDE 1ZLRA 3N7OA 1S6HA 2PSYA 1A3BH 3EE7A 1CT4E 1IHSH 1SFIA 3I77A 2Z3CA 1GHZA 1DY9A 2FYRA 3ZZ8A 3HK3B 3QGJA 2GV6A 1EOLA 2ODPA 2WUBA 2ZI2H 2ZKSA 1GJ5H 4AFZA 3JZ1B 3PWBA 2FODA 2OCVB 1BHXF 1DY8A 1VZQH 3VB4A 1HAPH 4VGCC 1W7XH 1YF4A 3M37A 1TPOA 3KEEA 2PKSB 5B6LA 3PMJA 3DA9B 2GTBA 1CT2E 2GCTB 3QGNB 1EUFA 1LQEA 5T3HA 4F55A 4I86A 1GBEA 4BAQB 1HIAB 3KCGH 1IQIA 1AZ8A 1MKXK 4UFDH 3RXIA 1C5YB 1W0JD 4RI0A 3F0PA 1G3DA 2HALA 5DP7A 2ZHQH 2FX6A 1FLEE 3S9BA 1LVYA 1GBTA 1VGCB 1L1JA 4FVBA 4K8YA 1UO6A 1BMLA 3PMHB 4B2AA 3E16B 1W12U 4BAMB 2THFB 2CN0H 2SGAA 2Z3EA 1MBQA 4LZ1H 1ESTA 4FUDA 1DXWA 1HCGA 2VH6A 2BDAA 4FETA 4WJG2 3SNAA 2FXRA 1WYKA 3LGTA 1DITH 5JBCS 4TY6A 5JPMH 5E8EH 4DOQA 5LPRA 4MG3A 4WF8A 3RC5A 4RSPA 1F5LA 2SNVA 4UFGH 2PSXA 1BTXA 1YC0A 1YM0A 3SZNA 4K5ZA 2BHGA 1CHOF 1AKSA 2KCYA 1SVPA 5DKMA 3P8FA 2JIZD 3V13A 4Z6AH 1S6FA 1NFUA 2GT7A 5ETXA 1J15A 2ZDLA 2F91A 4D9QA 4IGDA 2V3OH 3VB3A 4U01A 5HYOA 4YOIA 3SUFA 3UOPA 4F48B 3LKWA 4BXWA 3A7VA 2W7SA 4MNWA 2Y80A 1GVKB 2Z6BD 4KTUA 1TMBH 2ZPRA 4INHA 3RXGA 1SSXA 1AVWA 4Q7ZA 3STJA 1SGFG 3D62A 1XUKA 2UUYA 1XVOA 3ZYEA 3LGUA 1B7XB 3TPIZ 4IN2A 1MTNC 1CA0B 2BQ7B 1B0FA 1QRZA 4I32A 2VVUA 3FVFB 1Q2WA 3RXEA 1VR1H 1HJAC 1ZPCA 4MLFB 1L4DA 2QF5A 1O34A 1SGPE 1FIZA 1WUNH 3ZZ7A 1A61H 1YKTA 5E0GA 1O5GH 5E0JA 2ZQ1A 1BRAA 1SPJA 1C5NH 3RXRA 1T7CA 1AI8H 3TGJE 4Q7YA 1KSNA 1G3BA 2O9QA 2XCNA 1UK2A 3KNXA 2ALPA 1P01A 1HAOH 1UK4A 2NWNA 4YLQH 2CV3A 3C1KA 5BPEA 2EI8A 1HAYB 5JBTA 3RMMH 1GBHA 3F9FA 1MTSA 3I78A 3ZZ9A 2PUXB 1O5CB 3RDZA 1PYTC 1P9SA 1V2LT 3RXUA 1NU7B 2ZPSA 1O37A 2XRCA 3GCHC 4E7NA 4B6FA 1Z8GA 3F2HA 7GCHF 1N6YA 1K1NA 4GAWA 3UQOA 1C1VH 2HPQH 5JDUB 1EXFA 2FEQH 1O33A 1S81A 3RMNH 1P0SH 1XUHA 1SOZA 5DN6D 2ZDMA 5L2ZH 3TJOA 1ELVA 2OQUA 5TCAA 4PROA 1ETRH 2FM2A 1Y8TA 2DUCA 1OWIA 4XBCA 1OP2A 1GBBA 2G4UA 5DP8A 1EP6A 1GI7B 2CK3D 1BB0B 1SQOA 4HGCA 3EAJA 1QHRB 3MWIU 2A2QH 1TBZH 4OGXA 2Q6DA 3A7TA 5DGJA 1W3CA 3EQ0H 3PLBA 3SORA 2AMQA 1YBWA 3KQBA 1GG6C 4UD9H 4DY7B 4M7GA 1K0HA 2QA9E 1H9IE 3FP8E 3SU3A 3U8OH 4DGJA 3U1JB 1O31A 1C5OH 3F9HA 2AMPA 1W11U 2ZTXA 4NZQA 5FPTA 1GBLA 2BDHA 1PYTD 1LCYA 1OYQA 5GWZA 1WBGB 2SGFE 4UFEH 4AC9A 1ZSJA 3RC4A 1O3EA 3Q3YA 1NPMA 2XC0A 2KZ4A 2ZDVH 3TGIE 4CRFA 2ANKH 2SGEE 3ZZ3A 4AFQA 1QRWA 5F6MA 4B75A 4ZXYH 1SHHB 3OFND 1TOMH 3A8AA 1NY22 1YPKH 1JIMA 5GPIB 3FP6E 1AUTC 3DT0H 1E1QD 1MTNB 1DANH 3UB0A 1MAYA 3V3MA 4WMEA 4KP0A 2Z7FE 1CGJE 1PJPA 3I29A 1RS0A 3A82A 4FUEA 1IAUA 1SLXB 2B8OH 1HJAB 2CF9H 1GI5A 1DM4B 5I46H 1MMJN 1LKAA 2ILNA 3A7ZA 2EI7A 3D23A 2ZGBH 3Q77A 2SFAA 1GHBG 1ZR0A 1S6LA 1EB2A 3BTKE 3GY8A 5JBAS 1UVSH 4ZXXH 3WY8A 2A4OA 1K28D 1V2NT 2BXUH 2P3TB 3LC3A 1E34B 4ZAEA 9LPRA 5EQSA 2GCHF 2ZO3H 2ULLA 4ABEA 2GDDA 1SG8B 1C2KA 3Q3XA 2F83A 1GJ7B 1G30B 3QWCH 1O36A 1PPZA 1A7SA 1LHGH 4H6SB 1C9PA 1D6WA 2XBYA 3QZRA 4NIWA 1NZQH 1GDQA 2FTLE 1P57B 2WPIS 1SOTA 2J98B 1LO6A 2CGAA 2VIOA 2PP6A 1EPTB 4FVDA 1IQGA 2LNCA 4FXGH 1NRRH 3RXHA 3HGNA 3GCHB 3K6YA 3T25A 3DD2H 1BBRK 2BLOA 5FX6A 1DX5M 2JJ2D 1JIRA 2BXTH 4O3TA 2B5TB 1UW7A 1EAXA 4FUCA 2G4TA 1GGDC 1MCTA 1TAWA 1ZGIA 4LXBH 3GOVB 1Z6JH 1W0KD 3ZZ6A 1BMFD 3ZVBA 1JRTA 3HKJB 4X8SH 3BTME 1BTPA 1XKAC 3V12A 1ETSH 5DP3A 1O2TA 1AVGH 2AERH 5HM2A 1DWBH 2FESH 2FI3E 2PUQH 1NRPH 2A31A 1C2JA 2BVXH 2VIWA 2VIDA 3PRDA 1HLTH 3P6ZB 4NWKA 1YPJH 1GHYH 1T31A 3K6ZA 1AWHB 1FY8E 4JYUH 1O2IA 1O3PB 2SGPE 3MNBA 4D7GA 4I8KA 4DT4A 1GJ9B 3T2NA 1O2YA 2LELA 4TSFD 4DCDA 1ZRBA 2G81E 2CHAC 1BMAA 2WPJS 1TPPA 2A5IA 1P2IA 3GY6A 3RXLA 1LHCH 1ANDA 1YWUA 2EA3A 5EXNA 1S85A 4Q4LA 3SO3A 1QB9A 2AGIX 2VWMA 1ZZZA 2RG3A 1EFRD 3VEQB 1MCVA 5FCRA 1ELGA 1QQ4A 1NC6A 1A2CH 2BB4A 4TPIZ 5G4BA 1BTZA 2OC8A 2Y6TA 3ATKA 2WINI 1TPAE 2ZF0H 3GYMA 2Q6FA 2QXHA 1XXDA 2Y82A 2G8TA 1O3IA 4OS2A 4Y8ZA 9ESTA 3W95A 4IMZA
chains in the Genus database with same CATH topology
2Y7ZA 1WTHD 1OWKA 4ZMAH 1T4UH 2O8TA 3QO6A 1C1QA 3ZV8A 4O9VA 5J4QA 1V2TT 1BTYA 1E35B 1DT2A 1CE5A 1S84A 1RIWC 1E36B 3BV9B 2AGEX 3GDSA 1QJ7B 3A89A 1V2QT 1F0UA 3UR9A 1YGCH 1GVLA 3SNBA 3QLPH 1EJNA 4AYVB 3U9AH 1GJBB 4E7RG 4Y7AA 5E0HA 1GJ8B 2BVSH 2ZTZA 1BTUA 2FS8A 3STIA 1C5TA 5CMXH 3GY2A 2PGBB 1ANCA 1S82A 2ZCKP 1ELCA 1YP9A 1C5XB 1RJXB 4K60A 6GCHG 3PLKA 2A4RA 2CXVA 1Z1JA 4DVAU 3TJNA 4R8TB 4ZKNU 3M5LA 1SGCA 3UWIA 3FFGA 3IWMA 4MNXA 3TLOA 3QK1A 3CS7A 3SJ8A 1HAXB 2G5VA 1INCA 1BA8B 2OLGA 1FPCH 1GJCB 1P2NA 2OUAA 4I8GA 4B73A 3RC6A 3MOCA 1OYTH 4F49A 2F9VA 1G37A 1GGDB 1O2XA 1OPHB 2W3KA 5H4IB 2V6NA 3A7YA 1FIWA 1K9OE 4WY3A 1N8OC 3BTFE 2EI6A 3BTHE 3PTNA 1D3TB 4WWYA 1WSSH 3PTBA 2WPHS 1K22H 4X2YA 1UVTH 1RTFB 2OBOA 4INLA 4MQAA 1Y5BT 3AW0A 4YTAA 2NU3E 3SJKA 6LPRA 1N6XA 2WV4A 5F03A 2ZU3A 5FBEA 2PKAB 1V2WT 2HNTC 2QXGA 3SNDA 2W7UA 4ISNA 1FY4A 3TJUA 1VITG 1P9UA 2A5KA 1K1JA 2FYQA 2BY6X 3LDXH 4NZLA 3SUEA 1O3MA 3T62A 1YPGH 1SC8U 4J1YA 2IN2A 3MI4A 1FY3A 4MVNA 8KME2 2CHAB 4ZKOU 5ESBA 1KDQB 7LPRA 1O2RA 1V2JT 1H1BA 2Z3DA 3SU2A 1A46H 3SV9A 1DSUA 2V3HH 1VCPA 1J16A 5CHAC 1QB6A 4JZEH 2PHBA 1GBKA 3RMOH 4JMYA 4XFQA 2FOGA 3SV2H 1TBRH 3QUMP 4DG4A 2WPLS 5DP9A 1J17T 3NXPA 1ZTLA 2HPPH 2ZGHA 3K2UA 3A81A 1NN6A 2HNTE 2JH5D 1FI8A 4WMFA 3MYWA 5FXLA 3BN9A 1V2PT 2UWPA 1RTKA 3ZZAA 3SJOA 2H5CA 4UE7H 3TVJB 2JETC 3NPSA 3ZVDA 1V6DA 2FLBH 1IQHA 4DW2U 1RIWB 2ZFRH 3U98H 2LPRA 4X6PA 2W5EA 1UTMA 4Y71A 1YPHC 1AHTH 1MD7A 1SBWA 2OTVA 1O2ZA 3O8DA 1H8DH 3ELAH 2P95A 3SN8A 1J14A 1AY6H 5GCHG 1C2EA 3M3SA 2P3FH 5TCCA 2ZA5A 1C5PA 1RD3B 5C2ZA 4X1SU 5GJ4B 3TK5A 3KGPA 2BD7A 3AVZA 2QN5T 1TOCB 1GI0A 5EU8A 3LIWA 3H5CB 2QC2A 1QBOA 2FI5E 3GICB 1QURH 3TK9A 4BTIB 1SLWB 1K2I1 2KAIA 4I33A 1A4WH 4X1QU 1Z6EA 1BOQA 3TH2H 1D4PB 1D3QB 1F5KU 1UTLM 3BG8A 4BAOB 3MH6A 2VNTA 1SFQB 1TA2A 4SGBE 1ZJDA 4F4OC 1N8OB 1V2ST 1A0LA 4IBLH 1P3EA 4O97A 3DHKH 4K1TA 1RRKA 3MU4A 3RXCA 1AKSB 1H4WA 2FOHA 4DJZB 1ZMLA 5EG4A 1HNEE 1LPKB 3RU4E 1EB1H 5FPSA 2J4IA 3FANA 2ZHWH 3RU4D 1OWHA 2BOKA 2WPMS 4IW4E 5DP5A 1FONA 1HYLA 1TIOA 1D9IA 1ZMJA 1NFYA 4GHQA 3O8RA 5AHGH 1BMMH 1DFPA 3R0FA 4MNVA 3RXJA 1AMHA 1UTNA 3CS0A 1THRH 2QY0B 4NFEA 1O3BA 1ZPZA 3SW2B 4GCHG 4NWLA 3FP7E 3FAOA 2BY8X 4NIXA 3F6UH 3HGPA 1G2LA 5F8XA 2GMTC 2VWLA 3SGBE 1QL8A 4U2WA 5DPAA 4ZROA 4ZKSU 4FUIA 2FMJA 5AFYH 2CJIA 3PV4A 3Q3KA 1GMHG 4DURA 1O5BB 2VWOA 4UFFH 3L6PA 2GVFA 4JCNA 3S9CA 3UOUA 5CHAB 1LVBA 2UWOA 2A4GA 2NU0E 4X8TH 3TIUA 2SGQE 1J8AA 4K1SA 1O30A 2HVXA 1W0ZU 3BTDE 2BYAX 2J95A 2R0LA 1CA8B 3R3GB 1TBQH 1GDUA 2R2WU 4FUFA 2G5NA 1WCZA 2AS9A 3MH5A 1RTLA 4KKDA 5HGGA 2ANWA 4H6TA 5LGOA 1B0EA 1O5DH 1K1OA 2XBWA 3GDUA 4GPGA 4B74A 2QGRA 3ZVEA 3B8JA 3LPRA 2UUFB 2F9BH 3A80A 4CR5A 1FAXA 1ELAA 3NKKA 1TNKA 1ID5H 5AVDA 1QTFA 2STAE 1D3PB 3QZQA 1S5SA 4ABDA 1C5RA 1F7ZA 5AFZH 1TGNA 5EPYA 1SGRE 5J4SA 1Q31A 4CBNA 4AGKA 4YM9A 1DSTA 1NTPA 1BITA 1T32A 1HB0B 4MDSA 1CT0E 1H8IH 1F0SA 2VH0A 1RXPA 4OS4A 1O38A 5AF9H 4Q7XA 1C1TA 3M61U 4JK6A 4AORA 1QBVH 5GXPA 3U8RH 2H1UA 4D9RA 1HGTH 1KTSB 1EJMA 3M5MA 3D65E 4XBBA 4VGCB 4ABFA 2ODYB 1VCWA 1V2OT 3SHAH 3KQDA 4NA9H 4IMQA 1NROH 1GI2A 3RXFA 4YOJA 2D1JA 1G2MA 4Y8YA 3ZZ4A 4AGJA 1A5IA 4CRDA 5T6FA 1W2KH 4CRGA 4A92A 2VINA 1O0DH 2V0BA 4O3UA 3RXSA 4RKJB 4QT8C 1AIXH 1LQDB 3ODFA 1F0RA 1D3DB 1JBUH 3RLWH 3RXAA 2C8YB 1GMCG 5C67A 2GZ7A 1DS2E 1HDTH 4DIHH 3T5FH 1KXFA 1ARBA 1FZZA 4Y79A 1XMNB 1HV7A 2G52A 1ELEE 1SHYA 1TGTA 5A8YA 1SGTA 1OWJA 1P11E 2GP9B 1P2MA 1V3XA 1P04A 1L1NA 1HXFH 2ZGJA 3RXTA 1MAXA 1AQ7A 1OXGA 1KY9A 4NCYA 1SLUB 1Y3XA 2H6MA 5F8ZA 1T8OA 4JK5A 5A8ZA 3U69H 4BOHA 5GDSH 1UCYH 4K2YA 2DE8A 1BTWA 4XBDA 2BMGB 1ZHRA 1GI8B 3OSYA 3LT3A 1IQLA 1O3AA 3OTJE 1TWXB 2ANMH 3MU8A 5ESTE 1W13U 2BLQA 4FUHA 1GWAA 4FUGA 4CBOA 4ISLA 3PYHA 3RXPA 3TU7H 1MTUA 1PPHE 3GYLB 2STBE 3PMBB 1F92A 2Y5FA 1ZTJA 2BX4A 3RXVA 3URCA 2GT8A 2OBQA 2A1DB 1KIGH 2SNWA 1FN8A 2Z9KA 3P17H 3A86A 2AYWA 1IQNA 1IQMA 2FS9A 3UWJH 1HJ8A 1MQ6A 1SR5C 2BY7X 1ZJKA 2A7JA 1SGNE 2UUKB 3ATWA 3E0NB 4AOQA 1C1RA 2A32A 1O2GH 1EP5A 4Y10E 5DG6A 3RUOA 5JBBS 3PMAB 2Z9GA 8GCHF 1Z8IB 1C2GA 2FO9A 1DXPA 1DLKB 1GHVH 1ZHPA 2CF8H 1T8LA 1TX6A 3GCOA 1KLTA 2J92A 2H9TH 1KTTB 1P06A 1Q3XA 3P8NA 4K3JA 4X8UH 2ZEBA 4FUJA 2B7DH 3M5NA 2O8LA 4Y11E 1TRYA 3MH7A 2F9NA 5K0HA 1A5GH 2Z9IA 3NUMA 2BD9A 1O32A 2TGPZ 1EZXC 1ABIH 1THSH 1TMUH 1Y3VA 1Z1IA 1P10A 1H9HE 3QTVH 4AG1A 5EQRA 3S69A 3PO1C 4JYTA 1UVUH 4A7IB 4DIIH 4NG9H 4GUXA 1NU9A 2VJ1A 3BTQE 1NM6A 2TRMA 1GJ6A 1JWTA 1O5AB 1TA6A 1O2WA 3S0NA 3DFJA 3K65B 3M3VA 3BIVH 1SL3A 2OP9A 1LVMA 2C8ZB 3PLPA 1FJSA 1TFXA 6CHAC 2H5DA 1HAVA 1UCYE 1QCPA 2BDGA 1O3FA 2R0KA 5EXMA 1NO9H 3A8DA 1DOJA 1LDTT 1QQUA 4B76A 1GI9B 1GVZA 2FOAA 3MFJA 1EOJA 8LPRA 4HI3A 5C1YA 1UTPA 4NSVA 3ESTA 1AFQC 3QTOH 1ESAA 2ZP0H 3AAVA 1MKWH 2B9LA 1O35A 4D8NA 1QB1A 1UCYK 1VITH 1DLEA 1C4U2 4ZHLU 1WV7H 2BX3A 2JH6D 3A84A 5EW1H 3TNSA 3P95A 5TJXA 1KXCA 1LHEH 1UHBA 2G55A 3GCTF 3SV6A 1GBMA 1GG6B 2GGVB 1MTWA 1A0JA 4JZFH 5GIBA 2ZFQH 1Y3YA 4AZ2B 3VB6A 1GHBF 1IQJA 1P02A 3QN7A 1FMGA 4LZ4B 3GY3A 3RP2A 1UTOA 4HFPB 1IQEA 2TPIZ 2ZFFH 2PTNA 2ZFPH 1B5GH 1O2SA 3T26A 1WOFA 1XUGA 3NCLA 1AN1E 1QL9A 3D49H 4JYVH 3ATIA 1C5UA 2BY9X 4ZHMU 2ZHFH 4ABJA 3MO6A 2FIRH 3E0PB 2J94A 2BD4A 4Y76A 2G00A 2H2ZA 4ASHA 1SLVB 1ACBE 1ELDE 1FUJA 1EASA 1Y5UT 1TNLA 1XUJA 2GV7A 2PTCE 2J34A 1ARCA 1G36A 1OWDA 3EE0B 5FPYA 2ZWLH 3RXBA 2XTTB 1C5SA 3HK6B 5DP6A 1W7GH 2J38A 1O3LA 1HAGE 3RXKA 2QYIA 3ODDA 3SNEA 3LJJA 1EAWA 2B0FA 3E6PH 2BZAA 3FZDA 1J9CH 1C5MD 1HJ9A 3OY5U 1C1PA 1IQFA 4A1VA 3G01A 3M7QA 2C4FH 2PFEA 5PTPA 1AFEH 2VIQA 2OC7A 1FN6A 3VXFH 4YOGA 3SI4H 4X1PU 2R2MB 1PPGE 2AFQB 4MPUA 3HKIB 1SMFE 4JZDH 1GBJA 1LMWB 3UR6A 1SGYE 2TGAA 1G32B 1BJVA 1WTGH 4XSKU 3MO3A 1W0YH 1ETTH 4OGYA 1C5ZB 4ABHA 2AIPA 2ZCHP 1ESBA 1GHAG 1LPZB 1C1NA 5IYTA 2C8XB 2ZDKA 2FDAA 1S0QA 3P8OA 3V7TA 1UTJA 3BSQA 2PLXA 1K1LA 6CHAB 1AZZA 1C4Y2 3EA7A 1Y59T 4Y0ZE 1EZUC 1GHXH 1SQTA 1TQ0B 3BIUH 4HTCH 1AFQB 1E38B 3VB5A 5HXFA 3GISB 1KXDA 1BT7A 3LONA 1GPZA 1RGQA 3ENSB 3MMGA 2AEIH 3RM0H 2D2DA 1WQSA 1YLDA 2GKVE 1XM1A 4UONA 3LH1A 3VFEA 1O5EH 2ZU1A 1GI6A 3LJOA 1T8NA 2SGDE 5DJ7A 5C5NA 2XW9A 1NFXA 2R3YA 1CBWC 1Y5AT 1O2JA 5B6OA 2BD3A 1C5VA 2BY5X 4WXIA 1AE5A 2ESTE 1K21H 1L2EA 4UDWH 4WXVA 1UK3A 3A7XA 4X1RU 1EQ9A 1VJAU 3OU0A 2ZU4A 3TGKE 2BD8A 4INKA 1KLJH 1TX7A 2H9EH 3T29A 3TJVA 3F68H 1AE8H 1BMNH 2FPZA 4X6NA 4KTSA 2OC0A 5A2MH 5T6DA 2P8OC 1WAYB 1FAKH 1BCUH 2BZ6H 3A8CA 3UTUH 6GCHF 2DE9A 3SGQE 6ESTA 1H9LB 1P2QA 3EA9A 5I25A 4AX9H 1TE0A 4ISHH 3VB7A 3B23B 2WPKS 3OX7U 2FOEA 1O39A 2FOCA 2HWLB 4IN1A 4DT7B 2BDCA 4K8BA 5IDKA 1HPGA 1TX8A 3GY4A 1NRNH 4WH6A 4Z0KA 1BRUP 2ZZUH 2A0QB 1EX3A 2VGCC 1ZHMA 3C27B 4BAKB 3SNCA 4J2YB 3F9GA 1BUIA 3BTTE 1GJ4H 1QY6A 2P93A 4AN7A 1GCDA 1OP0A 2KAIB 1O2VA 3E91A 4R0IA 3MNCA 2HGTH 1CA0C 5EOKA 1TRNA 1NRQH 1EJAA 1O3GA 4CR9A 7KMEH 1SQAA 3SJIA 1O2KA 5EPNA 1UVPA 2ZPQA 2C93B 3LC5A 1P2OA 4X2VA 3DUXH 4ABAA 2ZFSA 4Y0YE 1CHOG 4A6LA 1VITF 1ZMNA 3MU1A 3TITA 2P94A 1GL0E 3VPKA 1ZYOA 5F8TA 1AUJA 1EAUA 1GI3A 2FP7B 2ALVA 1GMDF 5HM9A 2F9UA 1OWEA 2D26C 5LH8A 3ZVCA 4OS5A 1ANBA 1XUIA 3O8BA 4GSOA 2RA3A 4MPXA 4MPVA 4A1TA 3LH3A 3BTGE 1PQ8A 2OD3B 3KF2A 5BRRE 1C1SA 2A7HA 4H4FA 1YPHE 4MTBA 5DO4H 3H7TA 3SBKA 1LPGB 1VCQA 1S83A 1C2HA 1DWCH 1KYNA 3UY9A 3P8GA 1CQQA 2ZC9H 1U6QA 1IHTH 1TMTH 1TQ7B 1P8VC 4BNRA 1BJUA 4AYYB 4KTCA 3MNXA 3RU4T 1CBWB 4CRBA 1QFKH 3F1SB 4BXSA 1C2LA 1GBIA 1P09A 2FWWA 2WV5A 3SU0A 1HAZB 3E3TA 2QXIA 1UVOA 1BDAA 2BDIA 1C1WH 4TPYA 4OS1A 4BTTB 2J2UA 4OS7A 2XNIA 3LU9B 3EA8A 5EXLA 4WVPE 2A7CA 1OS8A 5GCHF 2A2XH 1OP8A 4ZH8A 4ABBA 1MH0A 1HIAA 1NRSH 1O2UA 1P2JA 4RKOB 2P8OB 1HAIH 1UTKA 2NU2E 1V2UT 3OY6U 1O3JA 4CREA 4D76A 1LKBA 1XKBC 1GI4A 2HNTF 1Z8JB 4CRCA 2YOLA 3TNTA 1C5QA 2ZGCA 4MNYA 1O3HA 5C3NA 4NA7A 5FAHA 1FDPA 7GCHG 4X0WU 1KXAA 4ZKRU 3VXEH 2GX4A 2CMYA 1S0RA 2XBVA 2AGGX 2ZIQH 4NGAH 1HRTH 2JETB 4HZHA 4B1TA 1FQ3A 2VGCB 4FUBA 4NSYA 1QJ6B 1O2QA 2ZG0H 2I6SA 3SI3H 1O2PA 1ZSKA 1MZDA 1AO5A 2OC1A 1OX1A 3Q00A 2ZHDA 2QF