4K60A

Crystal structure of human chymase in complex with fragment 6-bromo-1,3-dihydro-2h-indol-2-one
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
226
structure length
219
Chain Sequence
IIGGTECKPHSRPYMAYLEIVTNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGAAQGIVSYGRSDAKPPAVFTRISHYQPWINQILQAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Chymase
publication title Discovery of Potent, Selective Chymase Inhibitors via Fragment Linking Strategies.
pubmed doi rcsb
source organism Homo sapiens
total genus 49
structure length 219
sequence length 226
ec nomenclature ec 3.4.21.39: Chymase.
pdb deposition date 2013-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4k60A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4k60A02
2RA3A 1V2ST 2D26C 3KQCA 2OLGA 3MH6A 3RXPA 1C2HA 2H6MA 2WYGA 5F8ZA 1P03A 4Y0YE 3ZVCA 1DT2A 7GCHG 2FEQH 1ZR0A 1P2NA 4J1YA 5GCHF 1ELVA 1K1IA 4Z0KA 3URCA 1TMTH 1QBVH 2GMTC 1O38A 3K6ZA 1BQYA 4AGJA 2GP9B 1GGDC 3JZ2B 3SW2B 3PV4A 5IYTA 3OY5U 5ABWA 1O31A 2P95A 1GJ4H 1Q3XA 1CT4E 1VJAU 2ZG0H 3D62A 1XVOA 2FOGA 3PLBA 1F0UA 3A84A 1T31A 3BTFE 5E2OA 3BF6H 1HAVB 1PPGE 4CRCA 1NFUA 1DLEA 4I33A 5CHAC 3A81A 4A1XA 1H1BA 1GHXH 1L1NA 3RXJA 2ZPRA 3BTQE 3PWCA 5HM2A 2Q6DA 1CT0E 2HNTF 2Z9JA 1AY6H 1TYNA 2XBYA 3D65E 3O8RA 5J4SA 3U69H 3AAVA 1EASA 3MU5A 3F68H 2XCNA 1C5OH 1TNGA 2H5DA 2Y5HA 1S81A 2IPHA 1HCGA 1O3MA 4O9VA 1HAXB 4ABIA 3L3TA 3TNSA 1UTNA 3FZZA 1UHBA 3LGUA 1QB9A 4BTIB 1H9LB 1DOJA 2FO9A 1O5GH 1P12E 1LVBA 3HPTB 2AIPA 2BDIA 1SGNE 4XOJA 1FMGA 3P8GA 2KAIA 3F9HA 1KLTA 1ZJDA 1WTGH 3MMGA 3U9AH 5EW2H 3SGAE 2XC4A 1O3KA 1FXYA 3GCOA 1B0EA 2BDHA 1YPHE 2A2XH 4CHAC 2PUXB 1E0FD 3QZRA 1A4WH 1YGCH 1C5TA 1GCTB 1NFXA 3M5NA 5CE1A 1MU6B 3U8OH 1GBAA 1YC0A 2ZCHP 3A83A 1E36B 4O3TA 1FIWA 1Z6EA 4DURA 1O39A 2PR3A 4LXBH 3OX7U 1G3BA 3TGJE 1OP0A 1PPBH 2ZA5A 2JH0D 2VH6A 1F7ZA 5JBAS 3ATKA 1QRXA 1OPHB 4NWKA 5TJXA 1GJCB 3M37A 1GG6B 1RS0A 2BZ6H 2B9LA 2WUBA 3LC5A 2GGVB 4AFZA 4BAQB 1WQSA 3NXPA 5DP8A 3E1XB 3I29A 1GG6C 2BVSH 2BD2A 2C8YB 5ESBA 3U1JB 2Y5FA 1ZPBA 1F2SE 1O3GA 3DFJA 5EQRA 3HATH 3Q3YA 1V2JT 1GMDF 1OOKB 1QB6A 2SNVA 2Z9IA 2ZPQA 3NPSA 1W0ZU 1OWJA 4AB9A 1Y3YA 3OU0A 1UTJA 1K1JA 4WJG2 3QWCH 1N8OC 1O3AA 2NU1E 4INHA 1CHGA 2V3OH 4MTBA 3TK9A 4CR9A 1RRKA 1B7XB 1A5GH 1ELBA 2XBVA 3MH7A 3SOSA 1K1LA 2ZFRH 3FANA 1INCA 3TGKE 4AG1A 4XE4A 1FN6A 4AOQA 1SGFG 1O5CB 4TYDA 1AN1E 1KDQA 1RFNA 3SJKA 1YPJH 4NA9H 4NFEA 2BY5X 2SGDE 2G8TA 2A1DB 1ARBA 3Q76A 4ABEA 3LC3A 2WINI 3M5OA 1CGHA 3MOCA 2D8WA 1QL8A 2P16A 2V0BA 1A1RA 3ZZ5A 1BBRK 1C5XB 1AVXA 1LHCH 2BQ7B 1KXFA 1PJPA 3SU4A 3RXBA 1QA7A 1BB0B 4IC6A 4WH6A 3E16B 1RD3B 1ZHPA 1Z8JB 3RMLH 3UNRA 4ZKOU 1UJ1A 3UQVA 1UHBB 5T3HA 2Z94A 1HXEH 1XM1A 3ZV8A 3TGIE 1ACBE 1YPLH 1KSNA 3QLPH 2OBQA 3SU3A 3UUZA 1XKAC 1TGBA 3RXVA 1C2EA 1HAIH 3FVFB 3GY5A 5C1YA 2KAIB 2PTNA 2SGFE 2ZKSA 1P9SA 4SGBE 4K60A 2TGDA 4WMEA 4BTTB 1L1GA 4DT7B 2J94A 1O3FA 3KQEA 5DGJA 1LCYA 2JETB 4XSKU 1DANH 3KQDA 3MFJA 2ZHQH 3CENA 1IQGA 1EZSC 2CF8H 1Y5UT 4JK5A 3NZIA 4K5ZA 3RU4T 4Y8ZA 1GJ6A 2ZCLP 3TH2H 4ABDA 4X1PU 1WAYB 1BA8B 2OD3B 2VIQA 2ZDLA 4NWLA 1O3NA 2R0LA 1GI5A 3ZV9A 4NIXA 1G37A 5A8ZA 3SI4H 2PWXA 3RXSA 1YPMH 1CHOG 4UONA 2A32A 1O2QA 2F9BH 3F9FA 2W7SA 4FU8A 3MNSA 1CT2E 2VWOA 5DP4A 4KTCA 3SHAH 1TNHA 1C2DA 5JBCS 1YLCA 2XBWA 2SGAA 1MCTA 3N7OA 3PTBA 1AVWA 1GDQA 1OWHA 3V0XA 4INKA 4UE7H 1Z8IB 1SGTA 3VB5A 2J95A 2STBE 3SNAA 2NWNA 1QNJA 2TBSA 1NM6A 5L2YH 1Z8RA 2FWWA 2FYQA 1L1JA 2I6SA 4LOYH 1TNJA 3KQBA 3UR9A 2FESH 3RXOA 2NU2E 4Y8XA 1C2LA 1RTLA 2IN2A 1LHGH 3UWIA 3E0NB 3LGWA 1SLXB 3SNCA 3K65B 4BTUB 3GCTG 3SU2A 7LPRA 3UOPA 3VPKA 2XCFA 3FP6E 1RGQA 1KDQB 5DJ7A 3ZVEA 1O36A 1FQ3A 1L4ZA 3VGCB 1UVOA 1OWKA 1SVPA 4IMZA 4KP0A 1TONA 4JZIA 4D7GA 3PO1B 2BLWA 3EYDA 4XBCA 5F6MA 3GY3A 2AGIX 2ZQ2A 3IITA 5AFZH 4X2WA 1O3EA 5JBBS 1HFDA 3V7TA 5DG6A 2PKAB 1EAXA 1ZMJA 2ZCKP 1RIWC 1W7XH 4TWYA 4H6TA 2TGTA 1YPEH 2Y80A 1SGFA 2ZDAH 4JYTA 5AF9H 1HJAC 1FZZA 1GVLA 1VGCC 3QTVH 1ZLRA 1MTNB 4IW4E 1AFQC 1DUAA 1PPFE 4Q7XA 3RC4A 3ODFA 4K69A 4NG9H 1GBCA 2P8OC 3M36A 1TNKA 5HYOA 1BZXE 2OC7A 3SV9A 3U8TH 1KXCA 2ZFTA 1GDUA 2BTCE 3V3MA 1MD7A 1E34B 4YLQH 1D6RA 2QN5T 4UFGH 4O3UA 1JXPA 1ESBA 4YZUA 4ISIH 1HGTH 1NZQH 1YP9A 2HPQH 1RJXB 1SG8B 2PKSC 4F49A 1O35A 1SB1H 1F5RA 1GI6A 1O2GH 1H9IE 3BEIB 3RXHA 1GBLA 2ZDKA 1IHTH 1NC6A 2EI6A 2VVCA 1YBWA 3JZ1B 3FFGA 1SPJA 1GBHA 4D76A 6CHAC 3W95A 3RXCA 4YESB 4ZHAA 3ENSB 1V2NT 1GVZA 1N1LA 1F0SA 1MKWK 4CRDA 5E0HA 3S9AA 2ZU4A 4M7GA 5C20A 3QDZB 2ODPA 1Y5BT 1LVOA 3M3SA 2QXJA 2BXUH 1BMLA 2BMGB 2FOBA 4B2BA 3LH1A 1A61H 5T6GA 1GHAF 1G2LA 4WY3A 4IC5A 3Q3XA 3F9EA 2TPIZ 1BTPA 2G00A 2J92A 4WF8A 1MAXA 4ABHA 1QCPA 1XUHA 2VVUA 1V2WT 4JCNA 1F0TA 3M7QA 4MPWA 1DUEA 1NTPA 3A85A 1FAXA 1B5GH 1C5LH 5E0GA 3HGPA 3RU4E 1F5KU 3SV2H 1JIMA 1PPZA 3CP7A 1UMAH 2P94A 4HI3A 1HYLA 2AERH 1C4U2 1P2IA 2OBOA 1HXFH 2ODQA 1YPHC 3U8RH 1O2ZA 3HK3B 1TBRH 1MTSA 1THPB 1F0RA 2RG3A 1U6QA 4HTCH 3UNSA 2G81E 2Q6GA 4E7NA 3HKJB 2FZZA 4IN2A 4RKOB 4B2AA 1C2JA 1BJVA 2Y7ZA 3RDZA 4ZMAH 3EA7A 1SLWB 3SORA 2Z7FE 1TX7A 2FLRH 1BHXB 1MBQA 2F9VA 3STJA 3RXLA 5ESTE 3SZNA 1C1OA 2BDBA 3KN2A 1O2VA 4FU7A 7ESTE 4TPIZ 2GCTB 3VXEH 3GY7A 4MPVA 4YTAA 2W7UA 1O2UA 4A7IB 1H4WA 1O3HA 4GCHG 2RCEA 1V2TT 4ASHA 1UO6A 3A89A 2GCTC 1TMBH 3NWUA 1GBIA 2JH6D 4UFFH 2A7CA 1TA2A 1DWDH 2FYRA 1SOTA 2AS9A 1AZZA 1O5FH 1TAWA 3WY8A 8GCHF 4X6MA 4WXVA 1QA0A 4B75A 4A6LA 3ZZDA 4NA7A 1WTHD 2PFEA 2BOHB 4I32A 2GCHG 3RP2A 1C1QA 3SV6A 1OSSA 1V2MT 1GJDB 3OYPA 5EXNA 1BMNH 3RLYH 2C90B 1T7CA 1O37A 4I8KA 1O2SA 1HAPH 4JYUH 4CRAA 2C3SA 5DPAA 1TNLA 3M35A 3BTDE 3E8LA 3PMHB 1SHYA 1LHDH 4X6PA 4ZXYH 3GY2A 3QGNB 3QUMP 1QBOA 2C8WB 3LKWA 2ZP0H 5JPMH 2EC9H 1TA6A 4YT6H 1C5VA 3A88A 3BN9A 4O97A 3I77A 2HALA 4VGCC 1EOJA 1E37B 1C5SA 1GHWH 2VVVA 3L6PA 1DXPA 2Z9KA 1O5EH 3T2NA 1CA0C 5C67A 1IQKA 4SGAE 3U98H 4THNH 3T26A 1ZTLA 2VGCC 4X1NU 4H4FA 2EEKA 3E3TA 3A8AA 4IMQA 3CS7A 1GBTA 3O8CA 4UFDH 2ODYB 3TNTA 1OS8A 2FTMA 4LZ4B 4TY6A 1P57B 1KTTB 1OX1A 2Y6TA 2GVFA 1TNIA 2ZEBA 4I8HA 1O34A 3RU4D 1UTQA 4DIIH 1P2OA 2ALPA 4FUCA 1HAZB 2BD3A 1GBJA 2GDEH 2QA9E 3A86A 2QC2A 4X2XA 1GHVH 2H9TH 1DWBH 5HGGA 1UCYK 1JBUH 2DE9A 4Y10E 2XWBI 5E0JA 3URDA 1EZXC 4FUDA 1NRPH 4MG3A 3SNEA 3TJUA 1G2MA 2AMQA 3DA9B 2GX4A 1DY8A 4U01A 4ABFA 1TOCB 3RXFA 2PUQH 3P17H 4K8YA 4K8BA 3NK8A 3Q3KA 2FOCA 1P06A 4YOIA 3QK1A 4FVBA 1NT1A 3MWIU 2H9HA 4WVPE 1P3EA 2ZHFH 3A87A 1GMCF 1L4DA 1ESTA 4NZLA 1A0JA 6ESTA 2RA0A 4KGAA 3BTKE 3MU8A 2IOTA 2PV9B 4FVDA 2IJOB 3A80A 1UTOA 1VITH 3K6YA 2QIQA 5FCRA 4INLA 3MI4A 1ETTH 1CVWH 3PMAB 1QB1A 1BT7A 2J9NA 2FPZA 1O2YA 3GY6A 1K2I1 1GI7B 3Q00A 1NRSH 1UK4A 5EGMA 1Y5AT 4NIYA 4UFEH 1UVTH 1DY9A 1P8VC 4OGXA 1C9PA 2A5AA 1D3QB 5EODA 1GJ9B 1JRTA 1OXGA 1S0RA 1GHBG 1O32A 4MPUA 3VEQB 5HXFA 2HGTH 4AX9H 5IDKA 4B74A 2G55A 2OC1A 2HNTE 1VITG 1D4PB 3HGNA 3PMJA 5L30H 2F3CE 1X7AC 5EQSA 4H6SB 3EA9A 3QTOH 2BM2A 3HK6B 3B9FH 3S7KB 1W8BH 2BY6X 1YPKH 1SGDE 1O2PA 1ZHMA 2FMJA 4FU9A 4YM9A 1XUIA 5G4BA 3PB1E 1C2GA 4A1TA 4MNWA 3RM2H 4GHTA 4OS4A 3PLPA 1A7SA 2BDYA 1EQ9A 1GCTC 1YCPH 1J15A 1H8IH 3LDXH 8KME2 2A4OA 4DG4A 3UWJH 4HGCA 2GDDA 1KXEA 1O3LA 3PM3A 2HOBA 3I78A 2WV5A 1YLDA 1F92A 2VJ1A 4FUBA 2QAAA 1ELGA 2BDGA 1IOEA 1O2IA 1WU1A 3RXQA 3ITIA 5E8EH 3TJVA 1OWEA 1P10A 1PQ7A 1ZMNA 2QF3A 1ZTJA 2BLVA 7GCHF 1SGRE 3F1SB 2ZDMA 2ZDVH 3GOVB 2HVXA 2CF9H 1Q2WA 2Y5GA 1EAUA 2FX4A 1ZTKA 3P92A 2HLCA 1GBKA 4X2VA 1ABJH 1VCPA 1ELAA 3LJJA 1CQQA 1O3CA 5GPIB 1AHTH 1ZSKA 1C5YB 2QGRA 1GJ7B 1ZMLA 1PQ5A 2AFQB 1G3CA 1MZAA 3IWMA 1T4UH 2ZECA 1K28D 2Q1JA 3BTHE 2WYJA 1C2FA 1DSTA 2TGAA 4FUHA 1GPZA 2FS9A 1TGSZ 3PLKA 2K1QA 3MU0A 2ZQ1A 1EP6A 3V13A 2NU3E 2CMYA 2Y7XA 4OS5A 3V12A 1IQJA 4YO9A 1MH0A 3SUGA 1GBMA 3S9BA 1O2WA 1YKTA 2FI3E 2XTTB 1TPSA 2PKAA 5AVDA 4Z6AH 1UVUH 1O3DA 4MLFB 5T6DA 4DW2U 3SU6A 3RXTA 1TPPA 1LMWB 6LPRA 4I8JA 1ABIH 3STIA 3SQHE 1DE7H 6GCHG 2XNIA 1MQ6A 1LTOA 1MU8B 2LNCA 1O2XA 1RTKA 1SBWA 5JB9S 2WPMS 3SU1A 3LT3A 1AO5A 4ISLA 4X6OA 4IGDA 2UWOA 1SC8U 2WPHS 2Z3CA 1N6YA 1WYKA 3TLOA 1ZRKA 4BAKB 1TALA 1D9IA 1HJ9A 1EUFA 1LO6A 3M5LA 1A2CH 1WBGB 3LH3A 3EE0B 2PSYA 4NFFA 2R2MB 1KXAA 2B8OH 1NU9A 4KTUA 1G30B 1H8DH 4NA8A 4MNVA 1S5SA 2AEIH 1ZRBA 3BEFB 2P59A 2Z3DA 3RXDA 5FAHA 1O3PB 3SUEA 4K1TA 2XRCA 1DFPA 1CBWB 2EI7A 1HAOH 1GBEA 1V2LT 4AFSA 1THSH 3GISB 5HM9A 2QXIA 1YF4A 1SGCA 3T62A 4BAOB 2C8XB 1QR3E 1UVPA 2JETC 5EOKA 3ZYDA 1QJ1B 2O9QA 3SU0A 1SLUB 4ISNA 1ELEE 3OY6U 2SGEE 1HB0B 1WCZA 5F03A 2BVRH 1P05A 1O5AB 1K9OE 1J8AA 2ANKH 2UUYA 1MZDA 1GI8B 1NO9H 5A0CA 3UOUA 2BQWB 5JDUB 3VB3A 1FPHH 4UEHH 3TPIZ 1S0QA 3BIUH 1PPEE 1QBNA 4YOJA 1SFIA 2A0QB 1TX6A 1RTFB 1THRH 1FY4A 1KIGH 1SSXA 3QZQA 3GY4A 1OWDA 4X2YA 1D3DB 1IQIA 1VCWA 2FTLE 5E2PA 1QFKH 4GSOA 1XMNB 2STAE 3P95A 1NRRH 3GYMA 5EPNA 2OTVA 4B76A 9LPRA 3ZZAA 1Z8GA 1A0LA 1Q31A 3P8NA 1W0YH 3HKIB 3UNQA 1TABE 1C5QA 2G4TA 1A3BH 1GBBA 3ZZCA 1P2QA 5DK1A 1T8LA 1BDAA 3A8BA 4Y7BA 4AG2A 1IQFA 1V2OT 1C5UA 1C2IA 8LPRA 1FY5A 4MVNA 1EAIA 5A8XA 1DVAH 1XUFA 2VNTA 1EX3A 1CE5A 3KEEA 1SGYE 4TWWA 1GMHG 5TCCA 1A0HB 1DDJA 1O30A 3ZZ7A 4F4OC 1UTPA 5K0HA 3RUOA 3A7YA 4NIVA 2WPIS 3KHVA 3ZVFA 4Y7AA 2FOEA 1IQLA 4AN7A 1AB9B 4K1EA 1QHRB 4DY7B 5A0BA 1O33A 1BIOA 3LGYA 4D9QA 1V2KT 1ETRH 4FXGH 1O2RA 2ULLA 1C1NA 1TLDA 5GJ4B 1O5DH 1O2OA 3C27B 3VGCC 1AB9C 2H9EH 1PQAA 3F9GA 4ZUHA 3O8BA 1P09A 4JK6A 5A8YA 2UUFB 2ZWLH 2CV3A 5GXPA 2BY9X 3U1IB 1NU7B 3PO1C 1HAYB 5L6NH 1AZ8A 3SUDA 3TH4H 3RMOH 1LPGB 1SFQB 1ZSJA 1MKXK 4XBBA 1BMMH 1LPKB 1TIOA 2BX3A 1OP8A 1TGTA 5DP9A 5B6OA 2JH5D 3VB6A 2WV4A 1T8OA 2ZTXA 1BBRH 3GCHB 4OS2A 3EDXB 2F9OA 1E38B 1AFEH 4FUGA 1LVYA 3RXKA 1MD8A 3SNBA 1FUJA 1EJAA 2NU0E 4U30A 1TMUH 1EPTA 1AMHA 1MTNC 2JKHA 2UWLA 3UQOA 2ANYA 4NCYA 2AGGX 3KGPA 3AW0A 1RXPA 1JIRA 3QO6A 1IQEA 1SGIB 1BRUP 3S9CA 4ABAA 1BITA 1V2PT 3ZZ4A 3M3TA 1MMJN 1LHFH 1WQVH 1QRZA 2BHGA 4I8GA 3KCGH 2ZFQH 1QIXB 5PTPA 4B71A 4GPGA 2CHAB 1JRSA 3SJ9A 1L2EA 3DHKH 4X8UH 4Q2KA 1C5NH 1A5HA 1EJNA 2J38A 4E7RG 2CJIA 3QX5H 2ZU5A 3M61U 1HBTH 1IQMA 2BY7X 1V2RT 2A2QH 4IN1A 2TRMA 1S84A 1O2NA 1GDNA 3ZVDA 1CHOF 3UR6A 5EW1H 1DM4B 3ZZ6A 3RXUA 4ZROA 5FXLA 1AE8H 3RC6A 1QQUA 1Z71A 1AI8H 1NN6A 3KF2A 3KNXA 2EA3A 1SQTA 2ZHEH 5EXLA 2AH4X 1FONA 1FDPA 4RN6A 3GCNA 1P0SH 3A7ZA 5GCHG 1FY8E 1W10U 5LPRA 1G3DA 3VB4A 1AIXH 1F5LA 2Z9GA 1PYTD 2GV7A 3UFAA 2W3KA 2EI8A 1PPCE 1HNEE 4E05H 2D2DA 1P2MA 3SO3A 2WPLS 1C2MA 3MO3A 1K1NA 1HAGE 4FUFA 3E0PB 2ASUB 9ESTA 1KXBA 4OS1A 1WV7H 3BV9B 2OC8A 2P3FH 1C5MD 1DLKB 1O3JA 1P2KA 2FOMB 3GCTF 3MO6A 4D8NA 2ZZUH 1P2JA 3DD2H 4X8SH 1G3EA 3BG4B 2P3UB 2VU8E 3D49H 4Q7YA 2PGQB 4XBDA 3UTUH 2G51A 1O2KA 2F9UA 1LHEH 1VCQA 1YM0A 1NFWA 1OYQA 1OWIA 4NZQA 3H7OA 3MNBA 3SQEE 2UUJB 2VB0A 4ABGA 3FZDA 3ZVGA 1XVMA 3T25A 4ESTE 1EKBB 1GL0E 5JB8S 1TRMA 3SJIA 3EA8A 4WMFA 4GLYA 1UK3A 1FAKH 1UK2A 1T8MA 5C1XA 4E06H 1CA8B 3RXEA 3TJNA 3RLWH 2XYAA 1TB6H 3H5CB 1NY22 3ZZ3A 5GWZA 3E90B 1GBFA 4X1RU 3RXRA 4DGJA 4B73A 1SGPE 4YOGA 3G01A 2OC0A 2ZO3H 3BTTE 1MTWA 2QXGA 2SGPE 1ELTA 5BRRE 1O2HA 4BNRA 1EPTB 3E6PH 5J4QA 3T27A 5GDSH 2PTCE 3GICB 2Z9LA 2G52A 1FLEE 1HJ8A 5LPFA 3GDVA 5DKMA 2O8LA 2A4RA 1ELDE 1ELFA 2OINA 1E35B 1W2KH 5GIBA 4ZKRU 3R0FA 3LONA 3PYHA 2GZ9A 2PGBB 1DITH 2G5VA 2F91A 3ZZ9A 2W5EA 1EAWA 1VR1H 2A45B 1IQNA 4Y79A 4JYVH 5CMXH 4D7FA 2W26A 2XW9A 5EG4A 5HMAA 3ZVBA 1N6XA 4GHQA 1XX9A 2B7DH 1DS2E 3A7XA 4CH8B 3F6UH 2FS8A 2ZGHA 4ZAEA 5FCKA 2F9PA 3MNXA 1LQDB 5EU8A 3BTWE 2CN0H 4X1SU 2ZF0H 4BAHB 1Y8TA 2ZDNA 1Z7KA 2VIVA 4BAMB 3IG6B 1K22H 1BBRE 2B0FA 5K7RA 4HZHA 4K2YA 2RDLA 2VWNA 2ZHWH 1MKWH 1Z6JH 2AMPA 1FJSA 2YNBA 4AFQA 3GDSA 3AW1A 1AWHB 3RXIA 1LQEA 4K1SA 1GMDG 2GMTB 1KY9A 1SQAA 2OQ5A 1GGDB 4GVUA 1K1PA 2A31A 4BOHA 4PROA 2WPJS 1BUIA 2UUKB 1ANCA 1C4V2 4X0WU 4HFPB 3SJ8A 4ZXXH 5FBEA 4A1VA 3ATLA 2FI5E 1C1PA 1HIAA 3LOXA 2ZFPH 4Q80A 1GWAA 1KXDA 1FI8A 1TRYA 2XC5A 5CHAB 3MTYA 3ZZ8A 2OCVB 1P3CA 3MYWA 4Q7ZA 1BTXA 1EOLA 3A82A 2ZGJA 1TGCA 4YT7H 1J9CH 4DIHH 4R0IA 1H9HE 2BD5A 4WXIA 1Y3WA 3ATMA 2P3TB 2VWMA 2VH0A 3P8FA 3PMBB 3A8DA 3B23B 1G36A 1YCPM 1G9IE 4GCHF 2M5TA 1AQ7A 2WUCA 1C2KA 4B2CA 1FIZA 1BJUA 2OXSA 2GT7A 2XWAA 1QTFA 1JWTA 5A2MH 4NGAH 5FBIA 2R3UA 2ALVA 2FODA 1LDTT 3A8CA 5BPEA 4Y71A 4A5TS 4CRBA 3MH5A 1ANBA 3MHWU 5A0AE 4MPXA 2OP9A 1BRBE 1EJMA 1WSSH 2GCHF 3SV7A 3S0NA 5FX6A 1EZQA 1SHHB 3PWBA 3OSYA 1BHXF 4AGKA 1Z1IA 2V6NA 4CHAB 5ETXA 5I25A 1GHYH 2ZNKH 1PYTC 1WOFA 1HUTH 2FI4E 4IBLH 1BTHH 4ZKNU 1QGFA 1T32A 1KTSB 2R2WU 1PPHE 3M3VA 3UY9A 1LPZB 1EATA 2ZIQH 4OS6A 1OYTH 1AUTC 2AIQA 1EB1H 2B5TB 1GHZA 1NFYA 2O8TA 1ZJKA 1ANEA 3MNCA 1DICA 3EAJA 4ABBA 5JBTA 1HLTH 2R3YA 1CSOE 2BYAX 1PFXC 2O8MA 1A46H 1HV7A 1GCDA 4KELA 4DOQA 5SGAE 1A3EH 1GL1A 1DSUA 2VIPA 4X6NA 3SI3H 1TE0A 4QT8C 3GYLB 3DT0H 4I8LA 3S7HB 4XDEA 1FPCH 1XKBC 3T29A 2A7JA 3K2UA 4CR5A 3LJOA 1GJ5H 2AGEX 4JZEH 2ZTYA 1C1TA 2TIOA 4ZHMU 4Y76A 8ESTE 1D3TB 1ZGIA 2BZAA 3CS0A 1QURH 2SGQE 4RKJB 4XFQA 2OQUA 5AHGH 2ZHDA 3SU5A 5LGOA 1FNIA 1CU1A 1SMFE 2D1JA 3FP8E 2BQ6B 1N8OB 1KLIH 3TH3H 2W3IA 1J14A 3UREA 4I7YH 2Z3EA 3ATWA 1FV9A 3DFLA 1QJ7B 1ZPZA 2FDAA 4X8VH 4D9RA 1A5IA 2H1UA 2G4UA 4I31A 3MO9A 1UCYH 1IQHA 1HIAB 1D3PB 1DX5M 1OKXA 2R9PA 4RSPA 4JMYA 3EGKH 1HDTH 5C5OA 1C1VH 2ZFFH 4H42U 3SBKA 3SNDA 3TK6A 3RXMA 1FY1A 4R8TB 4ZKSU 3KIDU 1SOZA 1HPGA 1O2JA 3TVJB 3TITA 2Q6FA 2QYIA 3BSQA 3TU7H 3SHCH 1W12U 2THFB 3QN7A 2H2ZA 1LKAA 2BDCA 1GI0A 2ESTE 3GDUA 4MNYA 2GKVE 3SV8A 2ZGCA 1ZPCA 1AU8A 1S6HA 1W13U 1HAHH 4NIWA 2YNAA 3TIUA 1ELCA 2I6QA 1K1MA 4AORA 3L33A 3O8DA 2UWPA 2A7HA 4IS5A 2FOAA 1JMOH 1AWFH 3NCLA 3T5FH 1GHBF 4B1TA 1C5ZB 1QRWA 1KLJH 5EXMA 3K9XB 2F83A 4FUIA 2AYWA 4GUXA 1VITF 1G32B 1DXWA 1V2VT 4OGYA 1C5WB 3RXAA 1XUJA 1CBWC 3P70B 1O3IA 1VZQH 1GI9B 2VIOA 1C1UH 1MAYA 3B8JA 2GV6A 1QY6A 4MDSA 1MUEB 1EB2A 1P02A 1DPOA 4A92A 1EXFA 5L2ZH 4X8TH 2FM2A 3VFEA 1V2UT 4WWYA 2ANMH 3BTME 4MNXA 3UPEA 2PHBA 3ELAH 3KL6A 5JYIA 1AUJA 4ISOA 3A7TA 1XXFA 2GZ7A 4WMDA 4YLUA 3NKKA 3ZYEA 2NU4E 5TCAA 5EPYA 1C1SA 1TQ0B 2QCYA 3UIRA 2TGPZ 2QV1A 1KYNA 1J16A 2WPKS 2BD9A 1ZOMA 5LPEA 2DUCA 1EZUC 1K1OA 1YYY1 1GHAG 5A09A 1TPOA 1UTLM 2P93A 1TWXB 2FIRH 2A5KA 4TPYA 3BEUA 2V3HH 1S6FA 3GY8A 1NPMA 1AGJA 3BG8A 3D23A 3SJOA 1BMAA 2GD4B 2ZU3A 1TRNA 2VIDA 3M7TA 1GI2A 2BOKA 1SGQE 2PW8H 3A7VA 3H7TA 1AKSA 1SLVB 2GTBA 5FHTA 1C1WH 2BLOA 3RMMH 2VINA 1Y3VA 1PQ8A 1W11U 4Y8YA 2FP7B 1HRTH 4AZ2B 1ZSLA 3MH4A 1BTZA 1FN8A 1TBZH 2QF0A 1Y59T 2VIWA 1DWCH 2BY8X 1IHSH 2XBXA 5I46H 3FAOA 2V35A 1SL3A 5T6FA 2ILNA 1LKBA 5DP3A 1MTVA 1D6WA 1MTUA 1Z1JA 2ZI2H 2FXRA 3MU4A 2DE8A 3SGBE 3PROA 1O2LA 4BANB 4Y11E 1S82A 2QXHA 1SQOA 5DP6A 1YPGH 1LVMA 3VXFH 6GCHF 1UTMA 1RIWB 1P9UA 1S83A 2SNWA 4AYVB 5C2ZA 3T28A 5F8XA 1K21H 8GCHG 3EQ0H 1HJAB 2FX6A 1MCVA 1VGCB 4Y6DA 1AFQB 3QGJA 2J4IA 2ZU2A 3AASA 3GCHC 1MQ5A 5FPYA 2A5IA 2O8UA 4JZDH 1CO7E 4OS7A 1AE5A 2P8OB 4X1QU 4FUEA 2CXVA 3SGQE 4U2WA 5DP5A 4CREA 1Y3UA 4KKDA 1O3BA 1GJAB 2FOFA 2PSXA 2ZFSA 1OP2A 2BD4A 2GT8A 1TBQH 1NESE 1UCYE 2BVXH 2ZGBH 1WUNH 4O03A 2C8ZB 2XC0A 2VWLA 2C4FH 2YOLA 2BD7A 2PKSB 2FLBH 1BRCE 1NRNH 2HWLB 1V3XA 3LIWA 1V6DA 2CHAC 1T4VH 3BTEE 3RM0H 2ZGXH 2Z6BD 1TQ7B 4GAWA 4DJZB 1C4Y2 4BXSA 1CGIE 2A4QA 1AVGH 6CHAB 1QJ6B 1ANDA 1BTUA 4U32A 2ANWA 1J17T 3M7UA 3RMNH 4CBNA 2BD8A 2SFAA 3TJOA 5C3NA 5AFYH 1O5BB 5FX5A 1ESAA 5F8TA 1Y3XA 1ARCA 2BDAA 1O3OA 2ZC9H 1C1RA 1FY3A 4UD9H 5C1UA 2J2UA 3OTJE 4JZFH 1ZGVA 3LGVA 5DP7A 1ZYOA 1GI4A 3LPRA 1M9UA 3A7WA 3W94A 2HNTC 4JZ1A 1C5RA 4MQAA 3AVZA 2R0KA 2C93B 1QL7A 1C5PA 2ZTZA 2AMDA 2H5CA 7KMEH 2BLQA 2G5NA 3ZZBA 3LGIA 2Y82A 1XXDA 3PTNA 2GZ8A 3AAUA 1AKSB 1GBDA 1C1MA 1XUKA 4NSVA 1TFXA 2F9NA 1GI1A 4CBOA 5EQQA 1JOUB 1HAVA 1P01A 1BOQA 2FOHA 1GJBB 1B0FA 1GMHF 1W14U 3R3GB 4WH8A 2BX4A 1NRQH 4BXWA 3SN8A 4AYYB 2CGAA 3M5MA 3LGTA 1GMCG 3ATIA 4TY7A 3BG4C 1V2QT 4CH2B 1SI5H 4CRGA 5LH8A 2HRVA 1ID5H 1TPAE 2PLXA 3TK5A 3RC5A 1VJ9U 1XUGA 1EP5A 1SR5C 1O2MA 3VB7A 1MBMA 4AFUA 1GVKB 1ZZZA 4NSYA 4KTSA 2ZU1A 1SGEE 1W3CA 2Y81A 1ETSH 1QL9A 4LZ1H 3LU9B 1GJ8B 1BTYA 4K3JA 1T8NA 4ABJA 5H4IB 2LPRA 3NUMA 3P6ZB 1CGJE 2O8WA 3BTGE 5FPSA 3ESTA 4J2YB 3RXGA 2HPPH 1TGNA 1MKXH 2XXLA 1BTWA 2BB4A 3E91A 1BCUH 5FPTA 2ZPSA 3FP7E 3Q77A 3S69A 1QQ4A 1BRAA 4ZHLU 2A4GA 2BXTH 1UVSH 3MU1A 1EPTC 3ODDA 3P8OA 5DO4H 1DWEH 1YCPK 1P11E 4CRFA 1ORFA 1C9TA 4LK4A 3BIVH 3C1KA 3SUFA 1AD8H 1L0ZA 2QY0B 4DVAU 1O0DH 2J34A 4VGCB 1W7GH 1NS3A 1UTKA 1O2TA 4UDWH 2OUAA 4ZH8A 1ZHRA 4AB8A 1GI3A 5C5NA 1CA0B 1NROH 1P04A 4Y0ZE 2VGCB 4FUJA 4ISHH 3ZVAA 1IAUA 3DUXH 1TOMH 1TX8A 4DCDA 1S85A
chains in the Genus database with same CATH superfamily
2RA3A 1V2ST 2D26C 3KQCA 2OLGA 3MH6A 3RXPA 1C2HA 2H6MA 2WYGA 1S6LA 5F8ZA 2HLDD 1P03A 4Y0YE 3ZVCA 1DT2A 7GCHG 2FEQH 1ZR0A 1P2NA 4J1YA 5GCHF 1ELVA 1K1IA 4Z0KA 3URCA 1WXRA 1TMTH 1QBVH 2GMTC 1O38A 3K6ZA 1BQYA 2W6JD 4AGJA 2GP9B 1GGDC 3JZ2B 3SW2B 3PV4A 5IYTA 3OY5U 5ABWA 2F4LA 1O31A 2P95A 1GJ4H 1Q3XA 1OHHD 1CT4E 4F55A 1VJAU 2ZG0H 3D62A 1XVOA 2FOGA 3PLBA 4XRNA 1F0UA 3A84A 1T31A 3F2FA 3BTFE 5E2OA 3BF6H 1HAVB 1PPGE 4CRCA 1NFUA 1DLEA 4I33A 5CHAC 3A81A 5B6LA 4A1XA 1H1BA 1GHXH 1L1NA 3RXJA 2ZPRA 3BTQE 3PWCA 5HM2A 2Q6DA 1CT0E 2HNTF 2OK5A 2Z9JA 1AY6H 1TYNA 2XBYA 3D65E 3O8RA 5J4SA 3U69H 3AAVA 1EASA 3MU5A 3F68H 2XCNA 1C5OH 1TNGA 2H5DA 2Y5HA 1S81A 2IPHA 1HCGA 1O3MA 4O9VA 1HAXB 4ABIA 3L3TA 3TNSA 1UTNA 3FZZA 1UHBA 3LGUA 1QB9A 3H09A 4BTIB 1H9LB 1DOJA 2FO9A 1O5GH 1P12E 1LVBA 2J98B 3HPTB 2AIPA 2BDIA 3NRLA 1SGNE 4XOJA 1FMGA 3P8GA 2KAIA 3F9HA 1KLTA 1ZJDA 3FN8A 1WTGH 3MMGA 3U9AH 5EW2H 3F2HA 3SGAE 2XC4A 1O3KA 1FXYA 3GCOA 1B0EA 2BDHA 1YPHE 2A2XH 4CHAC 2PUXB 1E0FD 3QZRA 1A4WH 1YGCH 1C5TA 5DN6D 1GCTB 1NFXA 3M5NA 5CE1A 1MU6B 3U8OH 1GBAA 1YC0A 2ZCHP 3A83A 1E36B 4O3TA 1FIWA 1Z6EA 4DURA 1O39A 2PR3A 4LXBH 4TSFD 3OX7U 1G3BA 3TGJE 1OP0A 1PPBH 2ZA5A 2JH0D 2VH6A 1E79D 1F7ZA 5JBAS 3ATKA 1QRXA 1OPHB 4NWKA 5TJXA 1GJCB 3M37A 1GG6B 1RS0A 2BZ6H 2B9LA 1EFRD 2WUBA 4WH8A 3LC5A 2GGVB 4AFZA 4BAQB 1WQSA 3NXPA 5DP8A 3E1XB 3I29A 1GG6C 2WZQA 2BVSH 2BD2A 2GJGA 2C8YB 5ESBA 3U1JB 2Y5FA 1ZPBA 5FL7D 1F2SE 1O3GA 3DFJA 5EQRA 3HATH 3Q3YA 1V2JT 1GMDF 1OOKB 1QB6A 2SNVA 2Z9IA 2ZPQA 3NPSA 1W0ZU 1OWJA 4AB9A 1Y3YA 3OU0A 1UTJA 1K1JA 4WJG2 3QWCH 1N8OC 1O3AA 2NU1E 4INHA 1CHGA 5EJLA 2V3OH 4MTBA 3TK9A 4CR9A 1RRKA 1B7XB 1A5GH 1ELBA 2XBVA 3MH7A 3SOSA 1K1LA 2ZFRH 3FANA 1INCA 3TGKE 4AG1A 4XE4A 1FN6A 4AOQA 1SGFG 1O5CB 4TYDA 3AK5A 1AN1E 1KDQA 1RFNA 3SJKA 1YPJH 4NA9H 4NFEA 2BY5X 5C94A 2SGDE 2G8TA 2A1DB 1ARBA 3Q76A 4ABEA 3LC3A 2WINI 3M5OA 1CGHA 1UW7A 3MOCA 2D8WA 1QL8A 2WSSD 2P16A 2V0BA 1A1RA 3ZZ5A 1BBRK 1C5XB 1AVXA 1YLNA 1LHCH 2BQ7B 1KXFA 1PJPA 3SU4A 3RXBA 1QA7A 1BB0B 4IC6A 4WH6A 3E16B 1RD3B 1ZHPA 4TT3D 1Z8JB 3RMLH 3UNRA 4ZKOU 1UJ1A 3UQVA 1UHBB 5T3HA 2Z94A 1HXEH 1XM1A 3ZV8A 3TGIE 1ACBE 1YPLH 1KSNA 3QLPH 2OBQA 3SU3A 3UUZA 1XKAC 1TGBA 3RXVA 1C2EA 1HAIH 3FVFB 3GY5A 5C1YA 2KAIB 2PTNA 2SGFE 2ZKSA 2EQNA 1P9SA 4SGBE 4K60A 1SQRA 2TGDA 4WMEA 4BTTB 1L1GA 4DT7B 2J94A 1O3FA 3KQEA 5DGJA 1LCYA 2JETB 4XSKU 1DANH 3KQDA 3MFJA 2ZHQH 3CENA 1IQGA 1EZSC 2CF8H 1Y5UT 4JK5A 3NZIA 4K5ZA 3RU4T 4Y8ZA 1GJ6A 2ZCLP 3TH2H 4ABDA 4X1PU 1WAYB 1BA8B 2OD3B 2VIQA 2ZDLA 4NWLA 1O3NA 2R0LA 1GI5A 3ZV9A 4NIXA 1G37A 5A8ZA 3SI4H 2PWXA 3RXSA 1YPMH 1CHOG 4UONA 2A32A 1O2QA 2F9BH 3F9FA 2W7SA 4FU8A 3MNSA 1CT2E 2VWOA 5DP4A 4KTCA 3SHAH 1TNHA 1C2DA 5JBCS 1YLCA 2XBWA 2SGAA 1MCTA 3N7OA 3PTBA 1AVWA 1GDQA 1OWHA 3V0XA 4INKA 4UE7H 1Z8IB 1SGTA 3VB5A 2J95A 2STBE 3SNAA 2NWNA 1QNJA 2TBSA 1NM6A 3SYJA 5L2YH 1Z8RA 2FWWA 2FYQA 1L1JA 2I6SA 4Z1MD 4LOYH 1TNJA 4DT4A 3KQBA 3UR9A 2FESH 3RXOA 2NU2E 4Y8XA 1C2LA 3F2GA 1RTLA 2IN2A 1LHGH 3UWIA 3E0NB 3LGWA 1SLXB 3SNCA 3K65B 4BTUB 3GCTG 3SU2A 7LPRA 3UOPA 3VPKA 2XCFA 3FP6E 1RGQA 2EY4C 1KDQB 5DJ7A 3ZVEA 1O36A 1FQ3A 1L4ZA 3VGCB 1UVOA 1OWKA 1SVPA 4IMZA 4KP0A 1TONA 5T1VA 4JZIA 4D7GA 3PO1B 2BLWA 3EYDA 4XBCA 5F6MA 3GY3A 2AGIX 2ZQ2A 3IITA 5AFZH 4X2WA 1O3EA 5JBBS 1HFDA 3V7TA 5DG6A 2PKAB 1EAXA 1ZMJA 2ZCKP 2M2AA 1RIWC 1W7XH 4TWYA 4H6TA 2TGTA 1YPEH 2Y80A 1SGFA 2ZDAH 4JYTA 5AF9H 1HJAC 1FZZA 1GVLA 1VGCC 3QTVH 1ZLRA 1MTNB 4IW4E 1AFQC 1DUAA 1PPFE 4Q7XA 3RC4A 3ODFA 2IJD1 4K69A 4NG9H 1GBCA 2P8OC 3M36A 3N7DA 1TNKA 5HYOA 1BZXE 2OC7A 3SV9A 3U8TH 1KXCA 2ZFTA 1GDUA 2J97A 2BTCE 1MD7A 3V3MA 1E34B 4YLQH 1D6RA 2QN5T 4UFGH 4O3UA 1JXPA 1ESBA 4YZUA 4ISIH 1HGTH 5DSFA 1NZQH 1YP9A 2HPQH 1RJXB 1SG8B 2PKSC 4F49A 1O35A 1SB1H 1F5RA 1GI6A 1O2GH 2F43B 1H9IE 3BEIB 3RXHA 1GBLA 2ZDKA 1IHTH 1NC6A 2EI6A 2VVCA 1YBWA 3JZ1B 3FFGA 1SPJA 1GBHA 4D76A 6CHAC 3W95A 3RXCA 4YESB 4ZHAA 3ENSB 1V2NT 1GVZA 1N1LA 1F0SA 1MKWK 4CRDA 5E0HA 3S9AA 2ZU4A 4M7GA 5C20A 3QDZB 2ODPA 1Y5BT 1LVOA 3M3SA 2QXJA 2BXUH 1BMLA 2BMGB 2FOBA 4B2BA 3LH1A 1A61H 5T6GA 1GHAF 1G2LA 4WY3A 4IC5A 3Q3XA 3F9EA 2TPIZ 1BTPA 2G00A 2J92A 4WF8A 5EJZA 1MAXA 4ABHA 1QCPA 1XUHA 2VVUA 1V2WT 4JCNA 1F0TA 3M7QA 4MPWA 1DUEA 1NTPA 3A85A 1FAXA 1B5GH 1C5LH 5E0GA 3HGPA 3RU4E 1F5KU 3SV2H 1JIMA 1PPZA 3CP7A 1UMAH 2JIZD 2P94A 4HI3A 1HYLA 2AERH 1C4U2 1P2IA 2OBOA 1HXFH 2ODQA 1YPHC 3U8RH 1O2ZA 3HK3B 1TBRH 1MTSA 1THPB 1F0RA 2RG3A 1U6QA 4HTCH 3UNSA 2G81E 2Q6GA 4E7NA 3HKJB 2FZZA 4IN2A 4RKOB 4B2AA 1C2JA 1BJVA 2Y7ZA 3RDZA 4ZMAH 3EA7A 1SLWB 3SORA 2Z7FE 1TX7A 2FLRH 1BHXB 1MBQA 2F9VA 3STJA 3RXLA 5ESTE 3SZNA 1C1OA 2BDBA 3KN2A 1O2VA 4FU7A 7ESTE 4TPIZ 2GCTB 3VXEH 3GY7A 4MPVA 4YTAA 2W7UA 1O2UA 4A7IB 1H4WA 1O3HA 2L6OA 5C0TA 4GCHG 2RCEA 1V2TT 2J98A 4ASHA 1UO6A 3A89A 2GCTC 1TMBH 3NWUA 1GBIA 2JH6D 4UFFH 2KM0A 2A7CA 1TA2A 1DWDH 2FYRA 1SOTA 2AS9A 1AZZA 1O5FH 1TAWA 3GS9A 3OTPA 3WY8A 8GCHF 4X6MA 4WXVA 1QA0A 4B75A 4A6LA 3ZZDA 4NA7A 1WTHD 2PFEA 5C17A 2BOHB 4I32A 2GCHG 3RP2A 1C1QA 3SV6A 1OSSA 1V2MT 1GJDB 3OYPA 5EXNA 1BMNH 3RLYH 2C90B 1T7CA 1O37A 4I8KA 1O2SA 1HAPH 4JYUH 4CRAA 2C3SA 5DPAA 1TNLA 3M35A 3BTDE 3E8LA 3PMHB 1SHYA 1LHDH 4X6PA 4ZXYH 3GY2A 3QGNB 3QUMP 1QBOA 2C8WB 3LKWA 2ZP0H 5JPMH 2EC9H 1TA6A 4YT6H 1C5VA 3A88A 3BN9A 4O97A 3I77A 2HALA 4VGCC 1EOJA 1E37B 1C5SA 1GHWH 2VVVA 3L6PA 1DXPA 2Z9KA 1O5EH 3T2NA 1CA0C 5C67A 1IQKA 4SGAE 3U98H 4THNH 3T26A 1ZTLA 2VGCC 4X1NU 4H4FA 2EEKA 3E3TA 3A8AA 4IMQA 3CS7A 1GBTA 3O8CA 4UFDH 2ODYB 3TNTA 1OS8A 2V7QD 2FTMA 4LZ4B 4TY6A 1P57B 1KTTB 1OX1A 2Y6TA 2GVFA 1TNIA 2ZEBA 4I8HA 1O34A 3RU4D 1UTQA 4DIIH 1P2OA 2ALPA 4FUCA 1HAZB 2BD3A 1GBJA 2GDEH 2QA9E 3A86A 2QC2A 4X2XA 1GHVH 2H9TH 1DWBH 5HGGA 1UCYK 1JBUH 2DE9A 4Y10E 2XWBI 5E0JA 3URDA 1EZXC 4FUDA 1NRPH 4MG3A 3SNEA 3TJUA 1G2MA 2AMQA 4P02A 3DA9B 2GX4A 1DY8A 4U01A 4ABFA 1TOCB 3RXFA 2PUQH 3P17H 4K8YA 4K8BA 3NK8A 3Q3KA 2FOCA 1P06A 4YOIA 3QK1A 4FVBA 1NT1A 3MWIU 2H9HA 4WVPE 1P3EA 2ZHFH 3A87A 1GMCF 1L4DA 1ESTA 4NZLA 1A0JA 6ESTA 2RA0A 4KGAA 3BTKE 3MU8A 2IOTA 2PV9B 4RI0A 4FVDA 2IJOB 3A80A 1UTOA 1VITH 3K6YA 2QIQA 2IPQX 5FCRA 4INLA 3MI4A 1ETTH 1CVWH 3PMAB 1QB1A 1BT7A 2J9NA 2FPZA 4Q63A 1O2YA 3GY6A 1K2I1 1GI7B 3Q00A 1NRSH 1UK4A 5EGMA 2KZ4A 1Y5AT 3OEED 4NIYA 1UVTH 4UFEH 1DY9A 1P8VC 4OGXA 1NBMD 1C9PA 2A5AA 1D3QB 5EODA 1GJ9B 1JRTA 1OXGA 1S0RA 1GHBG 1O32A 4MPUA 3VEQB 5HXFA 2HGTH 4AX9H 5IDKA 4B74A 2G55A 2OC1A 3OAAD 2HNTE 1VITG 1D4PB 3HGNA 3PMJA 5L30H 2F3CE 1X7AC 5EQSA 4H6SB 3EA9A 3QTOH 2BM2A 3HK6B 3B9FH 3S7KB 1W8BH 2BY6X 1YPKH 1SGDE 1O2PA 1ZHMA 2FMJA 4FU9A 4YM9A 1XUIA 5G4BA 3PB1E 1C2GA 4A1TA 4MNWA 3RM2H 4GHTA 2KCOA 4OS4A 1MABB 3PLPA 1A7SA 2BDYA 1EQ9A 1GCTC 1YCPH 1J15A 1H8IH 3LDXH 8KME2 2KCPA 2A4OA 4DG4A 3UWJH 4HGCA 2GDDA 1KXEA 3PRDA 1O3LA 3PM3A 2HOBA 3I78A 3DSOA 2WV5A 1YLDA 1F92A 2VJ1A 4FUBA 2QAAA 2QF5A 1ELGA 2BDGA 1IOEA 1O2IA 1WU1A 3RXQA 3ITIA 5E8EH 3TJVA 1OWEA 1P10A 2RFKC 1PQ7A 1ZMNA 2QF3A 3OE7D 1ZTJA 2BLVA 7GCHF 1SGRE 3F1SB 2ZDMA 2ZDVH 3GOVB 2HVXA 2CF9H 1Q2WA 2Y5GA 1EAUA 2FX4A 1ZTKA 3P92A 2HLCA 1GBKA 4X2VA 1ABJH 1VCPA 1ELAA 3LJJA 1CQQA 1O3CA 5GPIB 1AHTH 1ZSKA 2RDEA 1C5YB 2QGRA 1GJ7B 2VBCA 1ZMLA 1PQ5A 2AFQB 1G3CA 1MZAA 3IWMA 1T4UH 2ZECA 1K28D 2Q1JA 3BTHE 2WYJA 1C2FA 1DSTA 2TGAA 4FUHA 1GPZA 2FS9A 1TGSZ 3PLKA 2K1QA 3DCLA 3MU0A 2ZQ1A 1EP6A 3V13A 2NU3E 2CMYA 2Y7XA 4OS5A 3V12A 1IQJA 4YO9A 1MH0A 3SUGA 1GBMA 3S9BA 1O2WA 1YKTA 2WV9A 2FI3E 2XTTB 1TPSA 2PKAA 5AVDA 4Z6AH 1UVUH 1O3DA 4MLFB 5T6DA 4DW2U 3SU6A 3DSGA 3RXTA 1TPPA 1LMWB 6LPRA 3CNRA 1ABIH 4I8JA 3STIA 3SQHE 1DE7H 6GCHG 2XNIA 1MQ6A 1LTOA 1MU8B 2LNCA 1O2XA 1RTKA 1SBWA 5JB9S 2WPMS 3SU1A 3LT3A 1AO5A 4ISLA 4X6OA 4IGDA 2UWOA 1SC8U 2JDID 2WPHS 1N6YA 1WYKA 2Z3CA 1ZRKA 3TLOA 4BAKB 1TALA 1D9IA 1HJ9A 4FETA 1EUFA 1LO6A 1WDIA 3M5LA 1A2CH 1WBGB 3LH3A 3EE0B 2PSYA 4NFFA 2R2MB 1KXAA 2B8OH 1NU9A 4KTUA 1G30B 1H8DH 4NA8A 4MNVA 1S5SA 3KQ5A 2AEIH 1ZRBA 2YMSB 3BEFB 2P59A 2Z3DA 3RXDA 4RT1A 5FAHA 1O3PB 3SUEA 4K1TA 2XRCA 1DFPA 1CBWB 2EI7A 1HAOH 1GBEA 1V2LT 4AFSA 1THSH 5HKKD 3GISB 5HM9A 2QXIA 1YF4A 1SGCA 3T62A 4BAOB 2C8XB 1QR3E 1UVPA 2JETC 5EOKA 3ZYDA 2K8IA 1QJ1B 2O9QA 3SU0A 1SLUB 4ISNA 1ELEE 3OY6U 2SGEE 1HB0B 1WCZA 5F03A 2BVRH 1P05A 1O5AB 1K9OE 1J8AA 1FX0B 2ANKH 2UUYA 1MZDA 1GI8B 1NO9H 5A0CA 3UOUA 2BQWB 5JDUB 3VB3A 1FPHH 4UEHH 3TPIZ 1S0QA 3BIUH 1PPEE 1QBNA 4YOJA 1SFIA 2A0QB 1TX6A 1RTFB 1THRH 1FY4A 1KIGH 1SSXA 3QZQA 3GY4A 1OWDA 4X2YA 1D3DB 1IQIA 1VCWA 2FTLE 5E2PA 1QFKH 4GSOA 1XMNB 2STAE 3P95A 1NRRH 3GYMA 5EPNA 2OTVA 4B76A 9LPRA 1BMFD 3ZZAA 1Z8GA 1A0LA 1Q31A 3P8NA 1W0YH 3HKIB 3UNQA 1TABE 1C5QA 2G4TA 5HIYA 1A3BH 4HG6A 1GBBA 3ZZCA 1P2QA 5DK1A 1T8LA 1BDAA 3A8BA 4Y7BA 4AG2A 1IQFA 1V2OT 1C5UA 3FOAA 1C2IA 8LPRA 1FY5A 2PP6A 4MVNA 1EAIA 5A8XA 1DVAH 1XUFA 2VNTA 4ACAA 1EX3A 1CE5A 3KEEA 1SGYE 4TWWA 1GMHG 5TCCA 1A0HB 1DDJA 1O30A 3ZZ7A 4F4OC 1UTPA 5K0HA 3RUOA 3A7YA 4NIVA 2WPIS 3KHVA 3ZVFA 2K0QA 4Y7AA 2FOEA 1IQLA 4AN7A 1AB9B 4K1EA 1QHRB 4DY7B 5A0BA 1O33A 1BIOA 3LGYA 4D9QA 1V2KT 5C0UA 1ETRH 4FXGH 1O2RA 1H8ED 2ULLA 1C1NA 1TLDA 5GJ4B 1O5DH 1O2OA 3C27B 3VGCC 1AB9C 2H9EH 1PQAA 3F9GA 4ZUHA 3O8BA 1P09A 4JK6A 5A8YA 2UUFB 2ZWLH 2CV3A 5GXPA 2BY9X 3U1IB 1NU7B 3PO1C 1HAYB 5L6NH 1AZ8A 3SUDA 3TH4H 3RMOH 1LPGB 1SFQB 1ZSJA 1MKXK 4XBBA 1BMMH 1LPKB 1TIOA 2BX3A 1OP8A 1TGTA 5DP9A 5B6OA 2JH5D 3VB6A 2WV4A 1T8OA 2ZTXA 1BBRH 3GCHB 4OS2A 3EDXB 2F9OA 1E38B 1AFEH 4FUGA 1LVYA 3RXKA 1MD8A 3SNBA 1FUJA 1EJAA 2NU0E 4U30A 1TMUH 1EPTA 1AMHA 1MTNC 2JKHA 2UWLA 3UQOA 2ANYA 4NCYA 2AGGX 3KGPA 3AW0A 1RXPA 1JIRA 3QO6A 1IQEA 1SGIB 1BRUP 3S9CA 4ABAA 1BITA 1V2PT 3OEHD 3M3TA 3ZZ4A 1MMJN 1LHFH 1WQVH 1QRZA 2BHGA 4I8GA 3KCGH 2ZFQH 1QIXB 5PTPA 4B71A 4GPGA 2CHAB 1JRSA 2KFWA 3SJ9A 1L2EA 3DHKH 4X8UH 4Q2KA 1C5NH 1A5HA 1EJNA 2J38A 5CDFE 4RT0A 4E7RG 2CJIA 3QX5H 2ZU5A 3M61U 1HBTH 1IQMA 2BY7X 1V2RT 2A2QH 4IN1A 2TRMA 1S84A 1O2NA 1GDNA 3ZVDA 3WWFA 1CHOF 3UR6A 5EW1H 3N7EA 1DM4B 3ZZ6A 3RXUA 4ZROA 5FXLA 1AE8H 3RC6A 3U28C 1QQUA 1Z71A 1AI8H 1NN6A 3KF2A 3N99A 3KNXA 2EA3A 1SQTA 2ZHEH 5EXLA 2AH4X 1FONA 3PV5A 1FDPA 4RN6A 3GCNA 1P0SH 3A7ZA 5HIZA 5GCHG 1FY8E 1W10U 5LPRA 1G3DA 3VB4A 1AIXH 1F5LA 2Z9GA 1PYTD 2L74A 2GV7A 3UFAA 2W3KA 2EI8A 1PPCE 1HNEE 4E05H 2D2DA 1P2MA 3SO3A 2WPLS 1C2MA 3MO3A 1K1NA 1HAGE 4FUFA 3E0PB 2ASUB 9ESTA 1KXBA 4OS1A 1WV7H 3BV9B 3FKSD 2OC8A 2P3FH 1C5MD 1DLKB 5IK2D 1O3JA 1P2KA 2FOMB 1K0HA 3GCTF 3MO6A 4D8NA 2ZZUH 1P2JA 3DD2H 4X8SH 1G3EA 3BG4B 2P3UB 2VU8E 3D49H 4Q7YA 2PGQB 4XBDA 3UTUH 1W0KD 2G51A 1O2KA 2F9UA 1LHEH 1VCQA 1YM0A 1NFWA 1OYQA 1OWIA 4NZQA 3H7OA 3MNBA 3SQEE 2UUJB 2VB0A 4ABGA 3FZDA 3ZVGA 1XVMA 3T25A 4ESTE 1EKBB 1GL0E 5JB8S 1TRMA 1YWUA 3SJIA 3EA8A 4WMFA 4GLYA 1UK3A 1FAKH 1UK2A 1T8MA 5KEDA 5C1XA 4E06H 1CA8B 5KECA 3RXEA 3TJNA 3RLWH 2XYAA 1TB6H 3H5CB 1NY22 3ZZ3A 5GWZA 3E90B 1GBFA 4X1RU 3RXRA 4DGJA 4B73A 1SGPE 4YOGA 3G01A 2OC0A 2ZO3H 3BTTE 1MTWA 2QXGA 2SGPE 1ELTA 5BRRE 1O2HA 4BNRA 1EPTB 3E6PH 5J4QA 3T27A 5GDSH 2PTCE 3KYGA 3GICB 2Z9LA 2G52A 1FLEE 1HJ8A 5LPFA 3GDVA 5DKMA 2O8LA 2A4RA 1ELDE 1E1QD 1ELFA 2OINA 2WHXA 4FOUC 1E35B 1W2KH 5GIBA 4ZKRU 3R0FA 3LONA 2QF4A 3PYHA 2GZ9A 2PGBB 1DITH 2G5VA 2F91A 3ZZ9A 2W5EA 1EAWA 1VR1H 2A45B 1IQNA 4Y79A 4JYVH 5CMXH 4D7FA 2W26A 2XW9A 5EG4A 5HMAA 3ZVBA 1N6XA 4GHQA 1XX9A 2B7DH 1DS2E 3A7XA 4CH8B 3F6UH 2FS8A 2ZGHA 4ZAEA 5FCKA 2F9PA 3MNXA 1LQDB 5EU8A 3BTWE 2CN0H 4X1SU 2ZF0H 4BAHB 1Y8TA 2V3MA 2ZDNA 1Z7KA 2VIVA 4BAMB 3IG6B 1K22H 1BBRE 2B0FA 5K7RA 4HZHA 2YMSD 4K2YA 2RDLA 2VWNA 3EE7A 2ZHWH 1MKWH 1Z6JH 2AMPA 1FJSA 2YNBA 4AFQA 3GDSA 3AW1A 1AWHB 3RXIA 1LQEA 4K1SA 1GMDG 2GMTB 1KY9A 1SQAA 2OQ5A 1GGDB 3OFND 4GVUA 1K1PA 2A31A 4BOHA 4PROA 2WPJS 1BUIA 2UUKB 1ANCA 1C4V2 4X0WU 4HFPB 3SJ8A 4ZXXH 5FBEA 4A1VA 3ATLA 2FI5E 1C1PA 1HIAA 3LOXA 2ZFPH 4Q80A 1GWAA 1KXDA 1FI8A 1TRYA 2XC5A 5CHAB 3MTYA 3ZZ8A 2OCVB 1P3CA 3MYWA 4Q7ZA 1BTXA 1EOLA 3A82A 2ZGJA 1TGCA 4YT7H 1J9CH 4DIHH 4R0IA 1H9HE 1E1RD 2BD5A 1H8HD 4WXIA 5KGOA 3PRBA 1Y3WA 3ATMA 2P3TB 2VWMA 2VH0A 3P8FA 3PMBB 3A8DA 3B23B 1G36A 1YCPM 1G9IE 4GCHF 2M5TA 1AQ7A 2WUCA 1C2KA 4B2CA 1FIZA 1BJUA 2OXSA 2GT7A 2XWAA 1QTFA 1JWTA 5A2MH 4NGAH 3SZEA 5FBIA 3UB0A 2R3UA 2ALVA 2FODA 1LDTT 3A8CA 5BPEA 4Y71A 4A5TS 4CRBA 3MH5A 1ANBA 3MHWU 5A0AE 4MPXA 2OP9A 1BRBE 1EJMA 1WSSH 2GCHF 3SV7A 3S0NA 5FX6A 1EZQA 1SHHB 3PWBA 3OSYA 1BHXF 4AGKA 1Z1IA 2V6NA 4CHAB 5ETXA 5I25A 1GHYH 2ZNKH 4B6FA 1PYTC 1WOFA 3VG8A 1HUTH 2FI4E 4IBLH 1BTHH 4ZKNU 1QGFA 1T32A 1KTSB 2R2WU 1PPHE 3M3VA 3UY9A 3W1EA 1LPZB 1EATA 2ZIQH 4OS6A 1OYTH 1AUTC 2AIQA 1EB1H 2B5TB 1GHZA 1NFYA 2O8TA 2AHME 1ZJKA 1ANEA 3MNCA 1DICA 3EAJA 4ABBA 5JBTA 1HLTH 2R3YA 1CSOE 2BYAX 1PFXC 2O8MA 1A46H 1HV7A 1GCDA 4KELA 4DOQA 5SGAE 1A3EH 1GL1A 1DSUA 2VIPA 4X6NA 3SI3H 1TE0A 4QT8C 3GYLB 3DT0H 4I8LA 3S7HB 4XDEA 1FPCH 1XKBC 3T29A 2A7JA 3K2UA 4CR5A 3LJOA 1GJ5H 2AGEX 4JZEH 2ZTYA 1C1TA 2KCYA 2TIOA 4ZHMU 4Y76A 8ESTE 1D3TB 1ZGIA 2BZAA 3FO8D 4ZCNA 3CS0A 1QURH 2SGQE 4RKJB 4B6EA 4XFQA 2OQUA 5AHGH 2ZHDA 3KYFA 3SU5A 5LGOA 1FNIA 1CU1A 1SMFE 2D1JA 3FP8E 2BQ6B 1N8OB 1KLIH 3TH3H 2W3IA 1J14A 3UREA 4I7YH 2Z3EA 3ATWA 1FV9A 3DFLA 1QJ7B 1ZPZA 2FDAA 2KR7A 4X8VH 4D9RA 1A5IA 2H1UA 2G4UA 4I31A 3MO9A 1UCYH 1IQHA 1HIAB 1D3PB 1DX5M 1OKXA 2R9PA 4XD7D 4RSPA 4JMYA 3EGKH 1HDTH 5C5OA 1C1VH 2ZFFH 4H42U 3SBKA 3SNDA 3TK6A 3UAIC 3RXMA 1FY1A 2JJ1D 4R8TB 4ZKSU 3KIDU 1SOZA 1HPGA 1O2JA 3TVJB 3TITA 2Q6FA 2QYIA 3F3BA 3BSQA 3TU7H 3SHCH 1W12U 2THFB 3QN7A 2H2ZA 1LKAA 2BDCA 1GI0A 5GNDA 2ESTE 3GDUA 4MNYA 2GKVE 3SV8A 2ZGCA 1ZPCA 1AU8A 1S6HA 1W13U 1HAHH 4NIWA 2YNAA 2KCAA 3TIUA 1ELCA 2I6QA 1K1MA 4AORA 3L33A 3O8DA 2UWPA 2A7HA 4IS5A 2FOAA 1JMOH 1AWFH 3NCLA 3T5FH 1GHBF 4B1TA 1C5ZB 1QRWA 1KLJH 5EXMA 3K9XB 2F83A 4FUIA 2AYWA 4GUXA 1VITF 2YMSC 1G32B 1DXWA 1V2VT 4OGYA 1C5WB 3RXAA 1XUJA 1CBWC 4F48B 3P70B 1O3IA 1VZQH 1GI9B 2VIOA 5F53A 1C1UH 1MAYA 3B8JA 2GV6A 1QY6A 4MDSA 1MUEB 1EB2A 3ZIAD 1P02A 1DPOA 4A92A 1EXFA 5L2ZH 4X8TH 2FM2A 3VFEA 1V2UT 4WWYA 2ANMH 3BTME 4MNXA 3UPEA 2PHBA 3ELAH 3KL6A 5JYIA 1AUJA 2XNDD 4ISOA 3A7TA 1XXFA 2GZ7A 4WMDA 4YLUA 3NKKA 3ZYEA 2NU4E 5TCAA 5EPYA 1C1SA 1TQ0B 2QCYA 3UIRA 2TGPZ 2QV1A 1KYNA 1J16A 2WPKS 2BD9A 1ZOMA 5LPEA 2DUCA 1EZUC 1K1OA 1YYY1 1GHAG 5A09A 1TPOA 1UTLM 2P93A 1TWXB 2FIRH 2A5KA 4TPYA 3BEUA 2V3HH 1S6FA 2WPDD 3GY8A 1NPMA 1AGJA 3BG8A 3D23A 3SJOA 1BMAA 2GD4B 2ZU3A 1TRNA 2VIDA 3WW7A 3M7TA 1GI2A 2BOKA 1SGQE 2PW8H 3A7VA 3H7TA 1AKSA 1SLVB 2GTBA 5FHTA 1C1WH 2BLOA 3RMMH 4ACBA 2VINA 1Y3VA 1PQ8A 1W11U 4Y8YA 2FP7B 1HRTH 4AZ2B 1ZSLA 3MH4A 1BTZA 1FN8A 4ASUD 1TBZH 2QF0A 5CHBA 1Y59T 2VIWA 1DWCH 2BY8X 1IHSH 2XBXA 5I46H 3FAOA 2V35A 1SL3A 5T6FA 2ILNA 1LKBA 5DP3A 1MTVA 1D6WA 4P00A 1MTUA 1Z1JA 2ZI2H 2FXRA 3MU4A 2DE8A 3SGBE 3PROA 1O2LA 4BANB 4Y11E 1S82A 2QXHA 1SQOA 5DP6A 1YPGH 1LVMA 3VXFH 6GCHF 1UTMA 1RIWB 1P9UA 1S83A 2SNWA 4AYVB 5C2ZA 3T28A 5F8XA 1K21H 8GCHG 3EQ0H 1HJAB 2FX6A 1MCVA 1VGCB 1VKYA 4Y6DA 1AFQB 3QGJA 2J4IA 2ZU2A 3AASA 3GCHC 1MQ5A 5FPYA 2A5IA 2O8UA 4JZDH 1CO7E 4OS7A 1AE5A 2P8OB 2HVYB 4X1QU 4FUEA 2CXVA 3SGQE 4U2WA 1COWD 5DP5A 4CREA 1Y3UA 4KKDA 1O3BA 1GJAB 2FOFA 2PSXA 2ZFSA 4I86A 1OP2A 2BD4A 2GT8A 1TBQH 1NESE 1UCYE 3WWBA 2BVXH 2ZGBH 1WUNH 4O03A 2C8ZB 2XC0A 2VWLA 2C4FH 1KMHB 2YOLA 2BD7A 1W0JD 2PKSB 4YXWD 2FLBH 1BRCE 1NRNH 2XOKD 2HWLB 1V3XA 3LIWA 1V6DA 2CHAC 1T4VH 3BTEE 3RM0H 2ZGXH 2Z6BD 1TQ7B 4GAWA 4DJZB 1C4Y2 4BXSA 1CGIE 2A4QA 2QE7D 1AVGH 6CHAB 1QJ6B 1ANDA 4OM9A 1BTUA 4U32A 2ANWA 1J17T 3M7UA 3RMNH 4CBNA 2BD8A 2SFAA 3TJOA 5C3NA 4AC9A 5AFYH 1O5BB 5FX5A 1ESAA 5F8TA 1Y3XA 1ARCA 2BDAA 1O3OA 2ZC9H 1C1RA 1FY3A 4UD9H 5C1UA 2J2UA 3OTJE 4JZFH 1ZGVA 2J5UA 3LGVA 5DP7A 1ZYOA 5EIYA 1GI4A 1SKYE 3F0OA 3LPRA 1M9UA 3A7WA 3W94A 2HNTC 4JZ1A 1C5RA 4MQAA 3AVZA 2R0KA 2W6ID 2C93B 1QL7A 1C5PA 2ZTZA 2AMDA 2H5CA 7KMEH 2BLQA 2G5NA 3ZZBA 3LGIA 2Y82A 1XXDA 3PTNA 2GZ8A 3AAUA 1AKSB 1GBDA 1C1MA 1XUKA 4NSVA 1TFXA 2F9NA 1GI1A 4CBOA 5EQQA 1JOUB 1HAVA 1P01A 1BOQA 2FOHA 1GJBB 1B0FA 1GMHF 1W14U 3F0PA 3R3GB 2BX4A 1NRQH 4BXWA 3SN8A 4AYYB 5EJ1A 2CGAA 3M5MA 3LGTA 1GMCG 3ATIA 4TY7A 3BG4C 1V2QT 4CH2B 1SI5H 4CRGA 5LH8A 2HRVA 1ID5H 1TPAE 2PLXA 3TK5A 3RC5A 1VJ9U 1XUGA 1EP5A 1SR5C 1O2MA 3PV2A 3VB7A 1MBMA 2KX4A 4AFUA 1GVKB 1ZZZA 1QZ8A 4NSYA 4KTSA 2ZU1A 2LP6A 1SGEE 1W3CA 2Y81A 1ETSH 1YY3A 1QL9A 4LZ1H 3LU9B 1GJ8B 1BTYA 4K3JA 1T8NA 4ABJA 5H4IB 2LPRA 3NUMA 3P6ZB 1CGJE 2O8WA 3BTGE 5FPSA 3ESTA 4J2YB 3RXGA 2HPPH 1TGNA 1MKXH 2XXLA 1BTWA 2BB4A 3E91A 1BCUH 5FPTA 2ZPSA 3FP7E 3Q77A 3S69A 1QQ4A 1BRAA 4ZHLU 2A4GA 2BXTH 1UVSH 3MU1A 1EPTC 3ODDA 3P8OA 5DO4H 1DWEH 1YCPK 1P11E 4CRFA 1ORFA 1C9TA 2JJ2D 4LK4A 1NBME 3BIVH 3C1KA 3SUFA 1AD8H 1L0ZA 2QY0B 4DVAU 1O0DH 4M9FA 2J34A 2CK3D 4VGCB 1W7GH 1NS3A 1UTKA 3DSPA 1O2TA 4UDWH 2LELA 2OUAA 1ZHRA 4ZH8A 4AB8A 1GI3A 5C5NA 1CA0B 1NROH 1P04A 4Y0ZE 2VGCB 4FUJA 4ISHH 3ZVAA 3MQKC 4Q4LA 1IAUA 3DUXH 1TOMH 1TX8A 4DCDA 1S85A
chains in the Genus database with same CATH topology
2RA3A 1V2ST 2D26C 3KQCA 2OLGA 3MH6A 3RXPA 1C2HA 2H6MA 2WYGA 5F8ZA 1P03A 4Y0YE 3ZVCA 1DT2A 7GCHG 2FEQH 1ZR0A 1P2NA 4J1YA 5GCHF 1ELVA 1K1IA 4Z0KA 3URCA 1TMTH 1QBVH 2GMTC 1O38A 3K6ZA 1BQYA 4AGJA 2GP9B 1GGDC 3JZ2B 3SW2B 3PV4A 5IYTA 3OY5U 5ABWA 1O31A 2P95A 1GJ4H 1Q3XA 1CT4E 1VJAU 2ZG0H 3D62A 1XVOA 2FOGA 3PLBA 1F0UA 3A84A 1T31A 3BTFE 5E2OA 3BF6H 1HAVB 1PPGE 4CRCA 1NFUA 1DLEA 4I33A 5CHAC 3A81A 4A1XA 1H1BA 1GHXH 1L1NA 3RXJA 2ZPRA 3BTQE 3PWCA 5HM2A 2Q6DA 1CT0E 2HNTF 2Z9JA 1AY6H 1TYNA 2XBYA 3D65E 3O8RA 5J4SA 3U69H 3AAVA 1EASA 3MU5A 3F68H 2XCNA 1C5OH 1TNGA 2H5DA 2Y5HA 1S81A 2IPHA 1HCGA 1O3MA 4O9VA 1HAXB 4ABIA 3L3TA 3TNSA 1UTNA 3FZZA 1UHBA 3LGUA 1QB9A 4BTIB 1H9LB 1DOJA 2FO9A 1O5GH 1P12E 1LVBA 3HPTB 2AIPA 2BDIA 1SGNE 4XOJA 1FMGA 3P8GA 2KAIA 3F9HA 1KLTA 1ZJDA 1WTGH 3MMGA 3U9AH 5EW2H 3SGAE 2XC4A 1O3KA 1FXYA 3GCOA 1B0EA 2BDHA 1YPHE 2A2XH 4CHAC 2PUXB 1E0FD 3QZRA 1A4WH 1YGCH 1C5TA 1GCTB 1NFXA 3M5NA 5CE1A 1MU6B 3U8OH 1GBAA 1YC0A 2ZCHP 3A83A 1E36B 4O3TA 1FIWA 1Z6EA 4DURA 1O39A 2PR3A 4LXBH 3OX7U 1G3BA 3TGJE 1OP0A 1PPBH 2ZA5A 2JH0D 2VH6A 1F7ZA 5JBAS 3ATKA 1QRXA 1OPHB 4NWKA 5TJXA 1GJCB 3M37A 1GG6B 1RS0A 2BZ6H 2B9LA 2WUBA 3LC5A 2GGVB 4AFZA 4BAQB 1WQSA 3NXPA 5DP8A 3E1XB 3I29A 1GG6C 2BVSH 2BD2A 2C8YB 5ESBA 3U1JB 2Y5FA 1ZPBA 1F2SE 1O3GA 3DFJA 5EQRA 3HATH 3Q3YA 1V2JT 1GMDF 1OOKB 1QB6A 2SNVA 2Z9IA 2ZPQA 3NPSA 1W0ZU 1OWJA 4AB9A 1Y3YA 3OU0A 1UTJA 1K1JA 4WJG2 3QWCH 1N8OC 1O3AA 2NU1E 4INHA 1CHGA 2V3OH 4MTBA 3TK9A 4CR9A 1RRKA 1B7XB 1A5GH 1ELBA 2XBVA 3MH7A 3SOSA 1K1LA 2ZFRH 3FANA 1INCA 3TGKE 4AG1A 4XE4A 1FN6A 4AOQA 1SGFG 1O5CB 4TYDA 1AN1E 1KDQA 1RFNA 3SJKA 1YPJH 4NA9H 4NFEA 2BY5X 2SGDE 2G8TA 2A1DB 1ARBA 3Q76A 4ABEA 3LC3A 2WINI 3M5OA 1CGHA 3MOCA 2D8WA 1QL8A 2P16A 2V0BA 1A1RA 3ZZ5A 1BBRK 1C5XB 1AVXA 1LHCH 2BQ7B 1KXFA 1PJPA 3SU4A 3RXBA 1QA7A 1BB0B 4IC6A 4WH6A 3E16B 1RD3B 1ZHPA 1Z8JB 3RMLH 3UNRA 4ZKOU 1UJ1A 3UQVA 1UHBB 5T3HA 2Z94A 1HXEH 1XM1A 3ZV8A 3TGIE 1ACBE 1YPLH 1KSNA 3QLPH 2OBQA 3SU3A 3UUZA 1XKAC 1TGBA 3RXVA 1C2EA 1HAIH 3FVFB 3GY5A 5C1YA 2KAIB 2PTNA 2SGFE 2ZKSA 1P9SA 4SGBE 4K60A 2TGDA 4WMEA 4BTTB 1L1GA 4DT7B 2J94A 1O3FA 3KQEA 5DGJA 1LCYA 2JETB 4XSKU 1DANH 3KQDA 3MFJA 2ZHQH 3CENA 1IQGA 1EZSC 2CF8H 1Y5UT 4JK5A 3NZIA 4K5ZA 3RU4T 4Y8ZA 1GJ6A 2ZCLP 3TH2H 4ABDA 4X1PU 1WAYB 1BA8B 2OD3B 2VIQA 2ZDLA 4NWLA 1O3NA 2R0LA 1GI5A 3ZV9A 4NIXA 1G37A 5A8ZA 3SI4H 2PWXA 3RXSA 1YPMH 1CHOG 4UONA 2A32A 1O2QA 2F9BH 3F9FA 2W7SA 4FU8A 3MNSA 1CT2E 2VWOA 5DP4A 4KTCA 3SHAH 1TNHA 1C2DA 5JBCS 1YLCA 2XBWA 2SGAA 1MCTA 3N7OA 3PTBA 1AVWA 1GDQA 1OWHA 3V0XA 4INKA 4UE7H 1Z8IB 1SGTA 3VB5A 2J95A 2STBE 3SNAA 2NWNA 1QNJA 2TBSA 1NM6A 5L2YH 1Z8RA 2FWWA 2FYQA 1L1JA 2I6SA 4LOYH 1TNJA 3KQBA 3UR9A 2FESH 3RXOA 2NU2E 4Y8XA 1C2LA 1RTLA 2IN2A 1LHGH 3UWIA 3E0NB 3LGWA 1SLXB 3SNCA 3K65B 4BTUB 3GCTG 3SU2A 7LPRA 3UOPA 3VPKA 2XCFA 3FP6E 1RGQA 1KDQB 5DJ7A 3ZVEA 1O36A 1FQ3A 1L4ZA 3VGCB 1UVOA 1OWKA 1SVPA 4IMZA 4KP0A 1TONA 4JZIA 4D7GA 3PO1B 2BLWA 3EYDA 4XBCA 5F6MA 3GY3A 2AGIX 2ZQ2A 3IITA 5AFZH 4X2WA 1O3EA 5JBBS 1HFDA 3V7TA 5DG6A 2PKAB 1EAXA 1ZMJA 2ZCKP 1RIWC 1W7XH 4TWYA 4H6TA 2TGTA 1YPEH 2Y80A 1SGFA 2ZDAH 4JYTA 5AF9H 1HJAC 1FZZA 1GVLA 1VGCC 3QTVH 1ZLRA 1MTNB 4IW4E 1AFQC 1DUAA 1PPFE 4Q7XA 3RC4A 3ODFA 4K69A 4NG9H 1GBCA 2P8OC 3M36A 1TNKA 5HYOA 1BZXE 2OC7A 3SV9A 3U8TH 1KXCA 2ZFTA 1GDUA 2BTCE 3V3MA 1MD7A 1E34B 4YLQH 1D6RA 2QN5T 4UFGH 4O3UA 1JXPA 1ESBA 4YZUA 4ISIH 1HGTH 1NZQH 1YP9A 2HPQH 1RJXB 1SG8B 2PKSC 4F49A 1O35A 1SB1H 1F5RA 1GI6A 1O2GH 1H9IE 3BEIB 3RXHA 1GBLA 2ZDKA 1IHTH 1NC6A 2EI6A 2VVCA 1YBWA 3JZ1B 3FFGA 1SPJA 1GBHA 4D76A 6CHAC 3W95A 3RXCA 4YESB 4ZHAA 3ENSB 1V2NT 1GVZA 1N1LA 1F0SA 1MKWK 4CRDA 5E0HA 3S9AA 2ZU4A 4M7GA 5C20A 3QDZB 2ODPA 1Y5BT 1LVOA 3M3SA 2QXJA 2BXUH 1BMLA 2BMGB 2FOBA 4B2BA 3LH1A 1A61H 5T6GA 1GHAF 1G2LA 4WY3A 4IC5A 3Q3XA 3F9EA 2TPIZ 1BTPA 2G00A 2J92A 4WF8A 1MAXA 4ABHA 1QCPA 1XUHA 2VVUA 1V2WT 4JCNA 1F0TA 3M7QA 4MPWA 1DUEA 1NTPA 3A85A 1FAXA 1B5GH 1C5LH 5E0GA 3HGPA 3RU4E 1F5KU 3SV2H 1JIMA 1PPZA 3CP7A 1UMAH 2P94A 4HI3A 1HYLA 2AERH 1C4U2 1P2IA 2OBOA 1HXFH 2ODQA 1YPHC 3U8RH 1O2ZA 3HK3B 1TBRH 1MTSA 1THPB 1F0RA 2RG3A 1U6QA 4HTCH 3UNSA 2G81E 2Q6GA 4E7NA 3HKJB 2FZZA 4IN2A 4RKOB 4B2AA 1C2JA 1BJVA 2Y7ZA 3RDZA 4ZMAH 3EA7A 1SLWB 3SORA 2Z7FE 1TX7A 2FLRH 1BHXB 1MBQA 2F9VA 3STJA 3RXLA 5ESTE 3SZNA 1C1OA 2BDBA 3KN2A 1O2VA 4FU7A 7ESTE 4TPIZ 2GCTB 3VXEH 3GY7A 4MPVA 4YTAA 2W7UA 1O2UA 4A7IB 1H4WA 1O3HA 4GCHG 2RCEA 1V2TT 4ASHA 1UO6A 3A89A 2GCTC 1TMBH 3NWUA 1GBIA 2JH6D 4UFFH 2A7CA 1TA2A 1DWDH 2FYRA 1SOTA 2AS9A 1AZZA 1O5FH 1TAWA 3WY8A 8GCHF 4X6MA 4WXVA 1QA0A 4B75A 4A6LA 3ZZDA 4NA7A 1WTHD 2PFEA 2BOHB 4I32A 2GCHG 3RP2A 1C1QA 3SV6A 1OSSA 1V2MT 1GJDB 3OYPA 5EXNA 1BMNH 3RLYH 2C90B 1T7CA 1O37A 4I8KA 1O2SA 1HAPH 4JYUH 4CRAA 2C3SA 5DPAA 1TNLA 3M35A 3BTDE 3E8LA 3PMHB 1SHYA 1LHDH 4X6PA 4ZXYH 3GY2A 3QGNB 3QUMP 1QBOA 2C8WB 3LKWA 2ZP0H 5JPMH 2EC9H 1TA6A 4YT6H 1C5VA 3A88A 3BN9A 4O97A 3I77A 2HALA 4VGCC 1EOJA 1E37B 1C5SA 1GHWH 2VVVA 3L6PA 1DXPA 2Z9KA 1O5EH 3T2NA 1CA0C 5C67A 1IQKA 4SGAE 3U98H 4THNH 3T26A 1ZTLA 2VGCC 4X1NU 4H4FA 2EEKA 3E3TA 3A8AA 4IMQA 3CS7A 1GBTA 3O8CA 4UFDH 2ODYB 3TNTA 1OS8A 2FTMA 4LZ4B 4TY6A 1P57B 1KTTB 1OX1A 2Y6TA 2GVFA 1TNIA 2ZEBA 4I8HA 1O34A 3RU4D 1UTQA 4DIIH 1P2OA 2ALPA 4FUCA 1HAZB 2BD3A 1GBJA 2GDEH 2QA9E 3A86A 2QC2A 4X2XA 1GHVH 2H9TH 1DWBH 5HGGA 1UCYK 1JBUH 2DE9A 4Y10E 2XWBI 5E0JA 3URDA 1EZXC 4FUDA 1NRPH 4MG3A 3SNEA 3TJUA 1G2MA 2AMQA 3DA9B 2GX4A 1DY8A 4U01A 4ABFA 1TOCB 3RXFA 2PUQH 3P17H 4K8YA 4K8BA 3NK8A 3Q3KA 2FOCA 1P06A 4YOIA 3QK1A 4FVBA 1NT1A 3MWIU 2H9HA 4WVPE 1P3EA 2ZHFH 3A87A 1GMCF 1L4DA 1ESTA 4NZLA 1A0JA 6ESTA 2RA0A 4KGAA 3BTKE 3MU8A 2IOTA 2PV9B 4FVDA 2IJOB 3A80A 1UTOA 1VITH 3K6YA 2QIQA 5FCRA 4INLA 3MI4A 1ETTH 1CVWH 3PMAB 1QB1A 1BT7A 2J9NA 2FPZA 1O2YA 3GY6A 1K2I1 1GI7B 3Q00A 1NRSH 1UK4A 5EGMA 1Y5AT 4NIYA 4UFEH 1UVTH 1DY9A 1P8VC 4OGXA 1C9PA 2A5AA 1D3QB 5EODA 1GJ9B 1JRTA 1OXGA 1S0RA 1GHBG 1O32A 4MPUA 3VEQB 5HXFA 2HGTH 4AX9H 5IDKA 4B74A 2G55A 2OC1A 2HNTE 1VITG 1D4PB 3HGNA 3PMJA 5L30H 2F3CE 1X7AC 5EQSA 4H6SB 3EA9A 3QTOH 2BM2A 3HK6B 3B9FH 3S7KB 1W8BH 2BY6X 1YPKH 1SGDE 1O2PA 1ZHMA 2FMJA 4FU9A 4YM9A 1XUIA 5G4BA 3PB1E 1C2GA 4A1TA 4MNWA 3RM2H 4GHTA 4OS4A 3PLPA 1A7SA 2BDYA 1EQ9A 1GCTC 1YCPH 1J15A 1H8IH 3LDXH 8KME2 2A4OA 4DG4A 3UWJH 4HGCA 2GDDA 1KXEA 1O3LA 3PM3A 2HOBA 3I78A 2WV5A 1YLDA 1F92A 2VJ1A 4FUBA 2QAAA 1ELGA 2BDGA 1IOEA 1O2IA 1WU1A 3RXQA 3ITIA 5E8EH 3TJVA 1OWEA 1P10A 1PQ7A 1ZMNA 2QF3A 1ZTJA 2BLVA 7GCHF 1SGRE 3F1SB 2ZDMA 2ZDVH 3GOVB 2HVXA 2CF9H 1Q2WA 2Y5GA 1EAUA 2FX4A 1ZTKA 3P92A 2HLCA 1GBKA 4X2VA 1ABJH 1VCPA 1ELAA 3LJJA 1CQQA 1O3CA 5GPIB 1AHTH 1ZSKA 1C5YB 2QGRA 1GJ7B 1ZMLA 1PQ5A 2AFQB 1G3CA 1MZAA 3IWMA 1T4UH 2ZECA 1K28D 2Q1JA 3BTHE 2WYJA 1C2FA 1DSTA 2TGAA 4FUHA 1GPZA 2FS9A 1TGSZ 3PLKA 2K1QA 3MU0A 2ZQ1A 1EP6A 3V13A 2NU3E 2CMYA 2Y7XA 4OS5A 3V12A 1IQJA 4YO9A 1MH0A 3SUGA 1GBMA 3S9BA 1O2WA 1YKTA 2FI3E 2XTTB 1TPSA 2PKAA 5AVDA 4Z6AH 1UVUH 1O3DA 4MLFB 5T6DA 4DW2U 3SU6A 3RXTA 1TPPA 1LMWB 6LPRA 4I8JA 1ABIH 3STIA 3SQHE 1DE7H 6GCHG 2XNIA 1MQ6A 1LTOA 1MU8B 2LNCA 1O2XA 1RTKA 1SBWA 5JB9S 2WPMS 3SU1A 3LT3A 1AO5A 4ISLA 4X6OA 4IGDA 2UWOA 1SC8U 2WPHS 2Z3CA 1N6YA 1WYKA 3TLOA 1ZRKA 4BAKB 1TALA 1D9IA 1HJ9A 1EUFA 1LO6A 3M5LA 1A2CH 1WBGB 3LH3A 3EE0B 2PSYA 4NFFA 2R2MB 1KXAA 2B8OH 1NU9A 4KTUA 1G30B 1H8DH 4NA8A 4MNVA 1S5SA 2AEIH 1ZRBA 3BEFB 2P59A 2Z3DA 3RXDA 5FAHA 1O3PB 3SUEA 4K1TA 2XRCA 1DFPA 1CBWB 2EI7A 1HAOH 1GBEA 1V2LT 4AFSA 1THSH 3GISB 5HM9A 2QXIA 1YF4A 1SGCA 3T62A 4BAOB 2C8XB 1QR3E 1UVPA 2JETC 5EOKA 3ZYDA 1QJ1B 2O9QA 3SU0A 1SLUB 4ISNA 1ELEE 3OY6U 2SGEE 1HB0B 1WCZA 5F03A 2BVRH 1P05A 1O5AB 1K9OE 1J8AA 2ANKH 2UUYA 1MZDA 1GI8B 1NO9H 5A0CA 3UOUA 2BQWB 5JDUB 3VB3A 1FPHH 4UEHH 3TPIZ 1S0QA 3BIUH 1PPEE 1QBNA 4YOJA 1SFIA 2A0QB 1TX6A 1RTFB 1THRH 1FY4A 1KIGH 1SSXA 3QZQA 3GY4A 1OWDA 4X2YA 1D3DB 1IQIA 1VCWA 2FTLE 5E2PA 1QFKH 4GSOA 1XMNB 2STAE 3P95A 1NRRH 3GYMA 5EPNA 2OTVA 4B76A