4K60A

Crystal structure of human chymase in complex with fragment 6-bromo-1,3-dihydro-2h-indol-2-one
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
226
structure length
219
Chain Sequence
b'IIGGTECKPHSRPYMAYLEIVTNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGAAQGIVSYGRSDAKPPAVFTRISHYQPWINQILQAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chymase
publication title Discovery of Potent, Selective Chymase Inhibitors via Fragment Linking Strategies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 49
structure length 219
sequence length 226
ec nomenclature ec 3.4.21.39: Chymase.
pdb deposition date 2013-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4k60A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4k60A02
3O8RA 1C2KA 3E1XB 2ULLA 1F0SA 1LHCH 4CH2B 1T8LA 3GYMA 1TWXB 1LMWB 4JYUH 4X6NA 1O3JA 2C4FH 2ZFSA 3T25A 2F9BH 3S7HB 1DWEH 2WUBA 1EQ9A 3E3TA 1VZQH 3M5NA 2ZGCA 3HK3B 2ZPSA 3L6PA 1IAUA 1T4VH 2HNTF 2F9PA 3ZVGA 1EB2A 1O33A 4GHTA 1TABE 2VWLA 2ZG0H 4FXGH 4MNWA 4D9RA 2PKAA 5DPAA 3U8RH 2SGPE 2C8YB 3S69A 5GCHF 1P09A 1QR3E 5I25A 4DY7B 1O2XA 1EKBB 7GCHF 1A1RA 3K2UA 2BDGA 4OS6A 3T28A 2ALPA 4BAOB 3TJUA 1WUNH 1C1SA 2DE9A 3NPSA 1CGJE 2A4QA 1ZPZA 2J4IA 3CS0A 4D76A 4RKJB 1MMJN 1BA8B 1GHXH 4WMDA 4Y8XA 3Q76A 1HAVA 4HTCH 3P8OA 3D62A 5EXMA 3PMHB 5C1UA 2HRVA 4X6MA 3SW2B 2OP9A 5DK1A 1C1PA 5GCHG 1QJ6B 2A4RA 1H9HE 2PLXA 2FPZA 2G55A 4FVDA 7GCHG 1XKAC 1CBWC 1O5AB 5FAHA 3ZZ8A 3RU4E 3L33A 2I6SA 1P0SH 1QB6A 2SGAA 4ZKRU 3KL6A 2PKAB 1GI1A 4CHAB 2QCYA 5F8ZA 3E91A 2CN0H 4INLA 1INCA 1TLDA 1BJVA 2UUYA 1G2LA 1NESE 1RGQA 3M36A 1MQ5A 3Q77A 1PJPA 3T27A 1L2EA 5F6MA 5TJXA 3SU2A 4WY3A 3OYPA 5AVDA 1SGDE 4TYDA 2EEKA 3PYHA 1TBQH 4FUDA 2BY8X 9ESTA 1G3BA 2PSYA 1A0JA 2ZTZA 2C8XB 1BBRE 3BN9A 1AN1E 3SO3A 3TH2H 2Z3EA 1HAVB 1F0UA 1MAYA 4LOYH 2STAE 4H6TA 4MPXA 5ESTE 1UTOA 7KMEH 1MUEB 1V2LT 4YTAA 2R2WU 3H7TA 3PLKA 1O2IA 1OX1A 4A1TA 4CBNA 2EI7A 4UD9H 2D8WA 3F9HA 3VPKA 2G51A 1TMUH 4DOQA 2QGRA 2Y5HA 3FANA 3F1SB 4Q7ZA 5C5OA 3UNRA 4MNYA 4WWYA 3SJ9A 1KSNA 2A0QB 3EE0B 2TGDA 1CHOF 1MU6B 1ZPCA 1PPCE 1YC0A 2Q6GA 3A84A 1NFXA 1NRNH 2LPRA 4X2VA 3TIUA 1GJ9B 2SGDE 2BZAA 4AG1A 3KN2A 1SQOA 4OGXA 2XNIA 2CMYA 1MKWK 1SLWB 1N1LA 3SGAE 1M9UA 4YLUA 2PUQH 1CT2E 3F68H 1LHDH 2AH4X 4JYVH 1CHOG 3O8DA 2GVFA 1HDTH 1YP9A 1Q31A 3F9EA 1C1RA 2J94A 1BMNH 4WMEA 3DHKH 4MNVA 2G5VA 1AVGH 5LH8A 1XX9A 3M7UA 2A7JA 3S7KB 1G30B 3HKJB 2BM2A 1H8DH 1K1PA 3SQHE 1GVZA 1FIWA 1PFXC 1BUIA 1UVTH 3LPRA 5FPTA 2SNWA 1GJ5H 4IN2A 1HPGA 4A1XA 3FVFB 2ZU1A 3S9CA 2GV6A 1HBTH 1DWBH 2FOEA 3BF6H 4NWLA 3JZ2B 4Z0KA 1L4ZA 3NWUA 1XVOA 1QL7A 4ABBA 1C4V2 1HLTH 2ZDLA 1YPKH 1TNLA 5A8ZA 2P93A 2TGTA 1O3AA 1T4UH 2AEIH 5GWZA 3TPIZ 4YZUA 1EP5A 2PTNA 1HAIH 1K21H 1V3XA 2THFB 5H4IB 3MO3A 1TMBH 1UCYK 1LHFH 5K0HA 3LU9B 2Q1JA 1S83A 2PHBA 1TNHA 4ESTE 2GCTB 3ATMA 1KXFA 2FOBA 1LKAA 4MVNA 4UFFH 1V2JT 4FU8A 1HV7A 2Z94A 4XSKU 1YYY1 3UOPA 1ZSLA 2TPIZ 2FLRH 2EA3A 2XTTB 1O3MA 3IG6B 4XDEA 3RM0H 2GCTC 1NFWA 8LPRA 1NS3A 1SVPA 1UCYH 1DUEA 3SJKA 1T7CA 1QNJA 5FX5A 4E7RG 1Q2WA 4Y7BA 2QN5T 1C5TA 5SGAE 1GI9B 1LQEA 1Z1JA 2CV3A 2RCEA 3MU5A 3SI3H 4LXBH 1NO9H 1TMTH 1QRXA 2ZPRA 3CP7A 3KHVA 4AGJA 4FUEA 5EG4A 2GT7A 3UY9A 1J17T 1YGCH 4X2XA 1SHHB 4UE7H 1P9UA 1XXFA 2F9UA 2ZHDA 4KELA 3ZVCA 3RXSA 1O2ZA 4ZXXH 1C5PA 1GBTA 4GUXA 1DSTA 4Y79A 2FYQA 3U98H 1Z8JB 4IW4E 3SV7A 3KIDU 1H1BA 2OXSA 2AS9A 1W14U 1Y5BT 2PWXA 2FX4A 3PB1E 1VGCB 1TNGA 2CF8H 2WUCA 1HAPH 2W7SA 2Z6BD 3HPTB 5G4BA 4DW2U 4LZ4B 2ZKSA 1C2JA 2Z9KA 2VIQA 2OQ5A 2FODA 1GCDA 4XE4A 1UVUH 1BCUH 2BOKA 2ZTYA 2BY6X 3ATWA 2ZU2A 1TX6A 1CGIE 4Y8YA 5DP4A 1BOQA 1GJ8B 1OYTH 1GMHF 3M7TA 1V2PT 1P04A 1C5UA 2XBYA 2HALA 1LVOA 2IOTA 2ZFFH 1RTLA 1ELGA 2ZGJA 1B0EA 1TRYA 4Q7XA 1XMNB 1LKBA 4X0WU 1RIWC 1O38A 3ZZBA 5DKMA 5LGOA 5AFZH 2Y82A 1LCYA 1ACBE 1ETRH 5EW1H 1MTSA 1SGQE 1TGTA 3PMAB 1DS2E 1GMHG 2BVXH 2SFAA 1OWEA 1V2OT 1A5GH 1BBRK 1RTFB 5DP5A 5GJ4B 4X2WA 2PGQB 1DXWA 1BMLA 3SU4A 4AFZA 2VIVA 1YBWA 2VWOA 3BTDE 1SLVB 1O2QA 2A1DB 1QIXB 4X8UH 1ZTJA 1BTHH 4ISNA 1PQ5A 3TLOA 1O32A 3PLPA 1HYLA 3SUEA 2OC0A 4IC6A 1HJAC 2P3TB 3RMNH 2UUJB 1OKXA 1AZZA 1UVOA 1BBRH 1ZJKA 3HATH 4Q2KA 2FZZA 1AHTH 2ZU5A 3DT0H 3RXMA 4U30A 1OS8A 3BTWE 1GI5A 3PLBA 3RXFA 1EJNA 2ODYB 1GBFA 5DP9A 3QN7A 4D9QA 1SGYE 4ASHA 1ANDA 1O2WA 3EQ0H 1N8OB 4R0IA 1BJUA 4NG9H 1YPLH 3GCNA 4DIHH 1C9TA 4TWWA 2Y5GA 3RLWH 3BTKE 3ATLA 3MO9A 1MTWA 1GGDB 2BY9X 4H6SB 1GI3A 1EZQA 1P03A 3SOSA 1O2TA 1K9OE 1GI8B 1SGPE 2ZDKA 3RXLA 1ETSH 1S6HA 2BXUH 1PQAA 5HM2A 2W5EA 1FMGA 1J16A 2QIQA 1ELAA 1GGDC 5GIBA 2C93B 3BG4B 2JH5D 1IQJA 1TX8A 2QA9E 1C2LA 2BD4A 4IC5A 1C5VA 1YLCA 1DXPA 2IJOB 2B7DH 1Q3XA 3GOVB 5DP6A 1WAYB 1IQFA 2BY7X 2ODPA 2Z3DA 3BG4C 3KF2A 3LGVA 1ESBA 5HYOA 3A82A 2V3HH 3SU5A 4Z6AH 1TNIA 3V0XA 1W7XH 3RC5A 2XBXA 2AYWA 1P2OA 1MCTA 2AMPA 1ZYOA 4O3TA 5LPEA 1GHYH 1O5CB 2TGAA 4A5TS 3VB4A 2SNVA 2ILNA 2AGIX 4OS7A 1O2SA 1TALA 1Y59T 4BOHA 3MI4A 2QF0A 3RUOA 1W13U 2FX6A 4CRGA 3C1KA 2XW9A 3ZZ5A 2J95A 1C5LH 2OC8A 1AO5A 2WPMS 3EA8A 2P94A 1K22H 1XVMA 3A83A 2D1JA 1GDQA 3SUGA 1C2DA 6GCHF 3PM3A 1VITH 3QWCH 1DANH 1JRSA 1SL3A 3LKWA 3VB3A 1O3KA 1XUIA 2Z7FE 3V12A 1AD8H 3T5FH 5EPNA 2FDAA 5CMXH 4DG4A 3SGBE 2BLVA 3QUMP 4Y8ZA 2A4OA 4Y6DA 4MLFB 1YPEH 4BAMB 1GL0E 4YOJA 1FLEE 3QTVH 4PROA 1ZGIA 1HJ8A 2ZWLH 2SGQE 3H7OA 1XUJA 5FBEA 3RXIA 2G4UA 3SNCA 3V13A 6GCHG 1C2GA 1Y8TA 2NU0E 4ZH8A 1UHBB 1ZMJA 2VINA 4LZ1H 1HJ9A 2VJ1A 4K2YA 2F9OA 1GDNA 1EAUA 1BRBE 3I29A 1TRMA 1KDQA 3UOUA 1XUGA 3B9FH 3UQOA 2ASUB 1CE5A 1FPHH 3EDXB 3A7YA 2ZC9H 2G4TA 1TPSA 4MTBA 1TBZH 1ZZZA 1WTGH 3SU3A 2FP7B 3P8NA 2BDAA 2ZGHA 1G36A 4AORA 2B9LA 1QCPA 1DWCH 4I8HA 1HAYB 1G32B 4FVBA 1D3TB 1AI8H 2ZP0H 4Y0YE 6LPRA 2GGVB 3TK6A 5FCKA 1HAOH 1GMDF 1A46H 1P2KA 1SGIB 1Y3WA 3A86A 5CHAC 1PYTD 1LPGB 1BTPA 4WXVA 3QGNB 1GI6A 1LVMA 1W0YH 1ELVA 5JBCS 1BTWA 2Z9LA 3LH1A 2UUKB 5BRRE 5LPRA 1NU9A 1KDQB 1EATA 1UTNA 8GCHF 1DFPA 1AKSA 1E38B 2LNCA 1PPGE 1P02A 2A45B 3RM2H 3P17H 2CGAA 4K3JA 1GMDG 4HFPB 1WSSH 4DGJA 1EZXC 1JIRA 3SV9A 1Y3VA 1V2NT 3T29A 3ZZAA 4I7YH 1AE8H 5ETXA 3RC6A 2C8ZB 5AF9H 1C5ZB 2JETC 3VEQB 3A7WA 2JH6D 1F5KU 2ZDVH 2ZTXA 1WYKA 1QRWA 1ID5H 3STIA 2DE8A 2ZEBA 4FUIA 8GCHG 1UTQA 3MH6A 1TQ7B 3RXDA 2PV9B 1V2MT 2BHGA 1C4U2 2FM2A 1EXFA 8ESTE 2HWLB 1MBQA 3ZVEA 1GWAA 1G2MA 4UONA 4ZUHA 5EQQA 4WH8A 3T26A 1TPAE 1GVKB 1TYNA 1NC6A 3NK8A 2EI8A 4TY7A 2QC2A 3LT3A 1CO7E 2BLOA 3NXPA 1AKSB 4GCHF 1QBNA 3P92A 3RU4D 2V3OH 1AQ7A 3SV6A 1TQ0B 1O2PA 3TH4H 1CBWB 2R3UA 2RA0A 2ZF0H 1ORFA 5J4QA 3MU1A 4A6LA 1ELCA 3EA7A 5EGMA 5DO4H 1EPTA 1Y5UT 1O31A 1ZTKA 3SHAH 1ETTH 1TGSZ 1TOMH 4AB9A 1K1MA 3VGCB 3ZVAA 2P3FH 1LHEH 6ESTA 3TNSA 3MH5A 4NIYA 1BHXF 2O8MA 1YLDA 1EOJA 4H42U 4GCHG 2ANYA 1ZSJA 3VGCC 3BTME 2FI4E 3HK6B 3K6YA 1TNJA 2ZCKP 2OBQA 4AYVB 4ISIH 1YPHE 3ZVDA 3AW0A 1GJ6A 4BTIB 2VWMA 2AGEX 3LIWA 2A5KA 3D23A 4B1TA 2FLBH 4X6OA 4O97A 4XOJA 5HMAA 3A8BA 1BQYA 1QGFA 4OS1A 1ELTA 1QL9A 3A87A 3U69H 1W8BH 2P95A 2QXGA 3A80A 1TPPA 3LONA 1GMCF 1CSOE 4J2YB 4KTUA 1T8OA 1HIAA 2ZIQH 4JK6A 1NT1A 4SGBE 3QZRA 2ZNKH 3KGPA 1XKBC 1SOTA 4ZXYH 1PPEE 1SFIA 3RXRA 2WV4A 1HXEH 2ZFRH 1SR5C 4U01A 1FPCH 2XCNA 1ESAA 1EPTC 1G3DA 2BX3A 2V6NA 2W26A 4AYYB 2BD2A 1A4WH 2TBSA 4GVUA 4ABIA 3Q3XA 1BIOA 2PGBB 4NWKA 1TA6A 3SU1A 1IOEA 3MNCA 4BAHB 1GMCG 3E8LA 5T6DA 4E05H 1NY22 3D65E 3R0FA 1C1MA 3HGNA 2XBVA 3V7TA 1A3EH 1LQDB 1O3DA 1A0LA 4D8NA 5GXPA 1IQLA 4MNXA 1GPZA 1W0ZU 3FP8E 3VB7A 1BRUP 4A7IB 4JZDH 1FAXA 3LGTA 1E34B 3ZZ6A 2WV5A 1YKTA 5JYIA 1HIAB 2Y7ZA 1UTPA 3L3TA 4IS5A 3OU0A 3E0NB 1EZSC 4CRDA 1JWTA 4ABJA 5GDSH 3LGYA 1O2RA 1CQQA 2XC5A 5CE1A 4B73A 1D6WA 2Y5FA 4CRCA 4R8TB 4NIVA 2Z9JA 5F03A 1GJAB 1KXAA 1FN8A 1FI8A 1IQKA 5E0GA 1EX3A 3A7XA 4VGCB 1BT7A 2P8OB 1KXDA 1SLXB 1P2IA 2VIWA 5TCAA 2CF9H 5B6OA 4CREA 3UNSA 5A8XA 5A0BA 3LGUA 4K8YA 5TCCA 1ZHRA 4IGDA 2ZDMA 1THSH 2G81E 3ZZDA 1C5SA 4VGCC 1RD3B 1RTKA 2P8OC 4Y71A 4NIXA 3IWMA 4I8GA 2C8WB 1AVXA 3K6ZA 5C1YA 3MMGA 1V2UT 5C1XA 2FOMB 2P16A 4X2YA 1BTXA 3TGJE 1UTJA 5E2PA 3E6PH 3SJIA 2VH6A 1F0TA 4YESB 4CR5A 5DGJA 1NPMA 2OINA 1C4Y2 3F9FA 4K60A 3FZZA 4Y11E 3QGJA 1UK4A 1UK2A 1VCQA 1PPBH 1GBHA 2A2QH 3KNXA 1GHAF 4WXIA 3RXQA 1HNEE 5EQRA 1HAGE 2GT8A 3ATIA 2UWOA 2FESH 2VNTA 3LH3A 4KGAA 1ELBA 1W2KH 1VJ9U 5HGGA 1FQ3A 3SV8A 1LDTT 3UTUH 3SORA 1HAXB 2GX4A 2FTMA 1NFYA 1DY9A 3TVJB 1WQVH 1Z6JH 1GI4A 3M35A 1V2TT 1BITA 1W3CA 1MTVA 4O3UA 4WJG2 3ZVFA 3RXBA 2ANMH 1AE5A 2BLQA 3SNBA 1Y5AT 4IBLH 1JMOH 3S9BA 2UWLA 1BRAA 4ABDA 3BV9B 2OC7A 2SGEE 1S84A 1SMFE 3EAJA 1EAXA 2QV1A 1C2HA 3ZYDA 1TAWA 4TPIZ 3P95A 1SG8B 1AWFH 3BTFE 1CT4E 3RMOH 3RXAA 1P3EA 5AHGH 3S0NA 5AFYH 5FHTA 4K5ZA 3RXPA 1G37A 1BHXB 3ENSB 2ZHWH 1F5RA 1VCPA 5IDKA 2FOFA 3A89A 1V2ST 5E0HA 4KTSA 1O2MA 1AMHA 1QB9A 1CHGA 3W94A 1NTPA 2F9NA 3A85A 1FUJA 2J2UA 1UTLM 2FOCA 2WYJA 1SQAA 2BY5X 2PW8H 1GJDB 3SUFA 3U9AH 1A5HA 1JXPA 1OYQA 4LK4A 3SV2H 3TGKE 3UNQA 4B75A 1H8IH 1RIWB 1S0RA 1YM0A 2QXIA 2GTBA 2NU4E 2ZDNA 4GSOA 1YCPM 1A2CH 1DOJA 1WU1A 3GICB 2WYGA 1H9LB 5C5NA 1S81A 2HVXA 3F6UH 2ZZUH 3BTHE 2AMDA 1IQNA 1QBVH 1QA7A 4ABFA 4I33A 1LPZB 2BTCE 1AZ8A 1J14A 1KXEA 1QJ7B 1UJ1A 1GI7B 2HNTE 3ZV8A 8KME2 1ZRBA 2QXHA 1AUTC 1HB0B 2H5CA 2XRCA 2ZHEH 1C1TA 5F8TA 4CRBA 3SNEA 2AGGX 2VGCC 4JCNA 1HJAB 1UMAH 3PTBA 1AGJA 1YPJH 2ZCHP 3PO1B 2AFQB 2QY0B 2Q6FA 1YPMH 1IHSH 3GCTF 1YCPH 1KY9A 2GKVE 4OGYA 1T32A 3RXHA 4MDSA 3LJJA 1GHBF 1Y3XA 3PO1C 1EP6A 1O2UA 3AW1A 5FPYA 3SU0A 1UO6A 1NU7B 2BDCA 1C1OA 1GHWH 2AERH 4AN7A 4SGAE 2KAIA 2VB0A 3A81A 1SGEE 3GY8A 1F92A 3QO6A 4KP0A 2PTCE 1KXCA 4ISOA 2HLCA 2R0KA 1Z71A 3GCTG 4YOGA 2JKHA 1D4PB 1YPGH 5FXLA 2ALVA 1ABIH 2Y6TA 1NRQH 1GVLA 1GHBG 1WCZA 2ZHFH 5JB9S 5I46H 1EAWA 1D9IA 2D2DA 3TJVA 3DFJA 5JBAS 4DIIH 2HPQH 1SBWA 1SPJA 2BMGB 3OTJE 1C1WH 4AX9H 1ZJDA 4RKOB 1DSUA 2ODQA 3GDUA 2B8OH 2OTVA 1EJMA 2GZ7A 4AB8A 3Q3YA 1G3CA 1AFQC 4Y0ZE 1N6YA 1O2JA 2BQWB 4YOIA 1DLEA 6CHAC 1O5DH 1P12E 5L2YH 1EB1H 2H1UA 2NU2E 1T8NA 1ZPBA 2J9NA 1ZHPA 4A1VA 1JIMA 1P2JA 2O8LA 1ZGVA 2GD4B 3QX5H 4CRAA 1EJAA 1P10A 4NA9H 1P2QA 4BTTB 3BEUA 1BMMH 1MBMA 1P11E 2CJIA 2FMJA 1BMAA 2GCHF 3KQDA 3M3VA 1GBMA 4X1SU 2SGFE 1HCGA 2RG3A 2ZGBH 1QFKH 1L0ZA 1GBEA 1K1JA 3UFAA 1AY6H 2RDLA 1RRKA 3KQCA 1S0QA 3M7QA 4BXSA 1MD8A 2O8TA 2VVUA 1O3FA 2O8WA 4MPWA 1UK3A 1QA0A 1QBOA 1FIZA 1VITF 4WVPE 4D7GA 1SGRE 1SGFA 1OXGA 3BG8A 3MNXA 3I77A 1H9IE 2RA3A 1XM1A 4CR9A 3LC3A 1W11U 3NUMA 2Q6DA 4X1RU 1LO6A 1B0FA 3DUXH 3KCGH 1DY8A 3MNBA 2K1QA 2G8TA 4NIWA 4MPVA 1KYNA 2G52A 1EUFA 1SQTA 4ISLA 1C2MA 4JYTA 2BLWA 3RMMH 1O39A 1GBAA 1S85A 1KTTB 1PYTC 4DURA 1TRNA 1O5BB 3UWIA 4FUHA 2FYRA 1OP2A 3KQEA 5EXNA 4JZIA 4ZMAH 1A7SA 2QXJA 4Q80A 2A5IA 1JRTA 3OY6U 2BQ6B 2XCFA 2VIPA 1J15A 1DPOA 4D7FA 1DDJA 5L6NH 2BB4A 2HOBA 1AB9B 3LJOA 4TY6A 1SFQB 1OPHB 1RJXB 1A0HB 5CHAB 2ZI2H 1TOCB 1T8MA 5L2ZH 4ZHAA 1UTKA 2B5TB 1Z1IA 2P59A 3PTNA 1O2GH 2GZ9A 4I8KA 4K1EA 5PTPA 7ESTE 2BD3A 1AB9C 2BDHA 1OWJA 1PPZA 4J1YA 4X6PA 1J9CH 1AVWA 1BTYA 2W3KA 3GCHB 1DE7H 5FBIA 2G00A 1L4DA 4FUBA 1QHRB 3A8CA 3KEEA 1C5RA 3ELAH 1Z6EA 2GMTB 1GBDA 3TU7H 2A7HA 1UCYE 1GG6B 1HAHH 3GCHC 3O8BA 3QZQA 2JETB 4MQAA 3UQVA 4YT6H 1C5YB 1K2I1 1GJCB 4GLYA 3TK5A 2GMTC 2XBWA 5E0JA 2F83A 2BZ6H 4AFQA 1C5OH 2YNBA 2H2ZA 3RXOA 3FP6E 3MTYA 1GG6C 3E16B 5EQSA 3M3SA 2FS8A 1YPHC 4ABEA 5LPFA 1TONA 5FPSA 1QQUA 2A31A 2A4GA 4MG3A 1DICA 3JZ1B 3RMLH 2R9PA 2AMQA 4INHA 3ODDA 4Y76A 5A0CA 1FXYA 4NA8A 1HXFH 3I78A 3PV4A 2ZU4A 3GCOA 1XUFA 1MTUA 3OSYA 4O03A 3TGIE 3GDSA 3BIVH 1LTOA 3GYLB 3PROA 1GBJA 1IQGA 1SLUB 3Q00A 2HGTH 4AG2A 5EODA 4XBBA 4NZLA 4INKA 1D6RA 3HKIB 2VU8E 1W10U 1E37B 3VXFH 5A2MH 2OLGA 3P8FA 1O2NA 3URCA 1FY1A 3MWIU 3UUZA 1ZMLA 1MZDA 4I8JA 1YF4A 2Z3CA 3GY3A 1BTZA 1W12U 4Y7AA 1Z7KA 3RU4T 1GBLA 3GISB 4Y10E 2Y7XA 5E8EH 2TGPZ 2ZA5A 4B2CA 1L1GA 1FJSA 3RXKA 4DVAU 1O3EA 3TJOA 3OY5U 4ZROA 2YOLA 1IQEA 4NFFA 3ZZ7A 2FO9A 1CVWH 1P05A 2BDYA 4ZKSU 1W7GH 3GY5A 4I32A 4IN1A 3ZZ4A 2ZFPH 1BB0B 3RDZA 2WPLS 4B74A 3ZYEA 1O5EH 3TK9A 3BIUH 4WMFA 4X8VH 4HGCA 1NRRH 3UPEA 3DD2H 1SC8U 2H9TH 3K9XB 4E06H 1SSXA 2WPJS 2ZU3A 1GI2A 4A92A 5EU8A 2QF3A 4TWYA 1DM4B 1RXPA 1A3BH 1C5QA 4X8TH 3ZZ9A 2GZ8A 5HM9A 3E0PB 1GBBA 3MOCA 2BD9A 1E0FD 2H9EH 3Q3KA 3T62A 4K1TA 5T3HA 3TJNA 1EPTB 3E90B 3SU6A 1BTUA 2CHAB 1V2WT 1QRZA 1FY5A 1WV7H 3RXTA 1F0RA 4CHAC 3PWCA 3AVZA 4BANB 2EC9H 1SHYA 1ABJH 2CXVA 4U2WA 1SOZA 3S9AA 5A8YA 3PWBA 1GHZA 2AIQA 3EA9A 4JMYA 4YT7H 1O3CA 1HAZB 2CHAC 2XC4A 2G5NA 3ZVBA 1GL1A 3M61U 4FUCA 1O3BA 3FP7E 1UVPA 1C9PA 3PMBB 1D3PB 2A32A 1V2KT 3O8CA 1TGNA 1UTMA 2QYIA 1QL8A 2XWBI 2W7UA 4ZKOU 1IHTH 3CS7A 1RS0A 3OX7U 1P9SA 4B2AA 5DP7A 2A7CA 2IN2A 4CH8B 5FCRA 4BXWA 5EW2H 4MPUA 1OWIA 4M7GA 3ESTA 1LVYA 7LPRA 2D26C 3M5MA 1HUTH 1V6DA 2BOHB 4BTUB 2BYAX 1IQHA 2QAAA 4FUGA 4YO9A 3ZZCA 3MH7A 1V2QT 3BTEE 1EZUC 1PPHE 5ESBA 2A2XH 5A09A 2NWNA 2P3UB 1GBCA 2OBOA 1ZLRA 1Y3YA 1ZR0A 4B71A 1TIOA 1N6XA 1S82A 1K28D 5C67A 2XC0A 4IMZA 1SB1H 1V2RT 1TE0A 2BDIA 3ZV9A 2PR3A 2XXLA 3NZIA 3VFEA 1C2EA 1KIGH 3EGKH 3U8TH 3M5OA 1FZZA 1MKWH 3MU0A 1O3NA 4F4OC 4X1QU 3U8OH 1HFDA 1TGBA 1FONA 2BVRH 1E36B 5DG6A 3A7TA 1TNKA 4K1SA 1MKXK 1ZTLA 1OSSA 5DJ7A 1NRPH 3A7ZA 1O2OA 4FU7A 2FI3E 4O9VA 3SZNA 3WY8A 2BDBA 2GDDA 1MH0A 2H9HA 1GDUA 2B0FA 4DCDA 3RXJA 1P01A 2M5TA 4ISHH 1ZOMA 1WQSA 4CBOA 2STBE 4B76A 2ANKH 2VWNA 3QTOH 3SNDA 1F7ZA 2VVCA 1L1JA 1WBGB 1MKXH 2DUCA 4TPYA 3VB6A 3UIRA 3SQEE 1O2YA 1CT0E 5C20A 1P06A 3A8DA 2H5DA 4Q7YA 1GHVH 2JH0D 1B7XB 3HGPA 1P57B 1WTHD 1HGTH 2WINI 3PMJA 3B23B 3TITA 3SJOA 1C2IA 2FOAA 1ANBA 2UUFB 1GJ4H 3FFGA 3BSQA 3TNTA 1SI5H 1TB6H 1S5SA 2V0BA 3SJ8A 1GI0A 4WF8A 4QT8C 9LPRA 3VXEH 1AWHB 1O3LA 1K1NA 1LHGH 1GBIA 1GHAG 3BEFB 1P2NA 3EYDA 3F9GA 1DWDH 3LDXH 4H4FA 2A5AA 4NZQA 2OCVB 1QTFA 1O3GA 3UREA 2GDEH 1AU8A 1CA8B 2HNTC 2Z9IA 3G01A 3A8AA 1MD7A 2VH0A 2O8UA 1ELEE 2ESTE 4X1PU 5T6GA 3MU8A 3P70B 1ZRKA 5DP8A 3GY7A 5EPYA 4ABHA 1D3QB 1DUAA 1PQ7A 2C90B 5E2OA 2J92A 3MFJA 1AFEH 4JZFH 1QQ4A 4JZEH 1ANEA 3M3TA 2I6QA 1O2HA 1NM6A 1THPB 1O2LA 1O5GH 2Y80A 4NCYA 2W3IA 3LGIA 1SGTA 1T31A 3BTTE 3RXGA 4UFEH 1VR1H 1O34A 2BX4A 4XBCA 4I8LA 2VVVA 4RN6A 1SGCA 2Z9GA 1RFNA 5T6FA 2F9VA 2J38A 1ANCA 3T2NA 2PUXB 1L1NA 2AIPA 1KLIH 2FIRH 2F91A 2WPIS 1PPFE 1C5XB 1OWKA 2BQ7B 2FXRA 1VGCC 2VGCB 4IMQA 3SN8A 1K1OA 1O3PB 1YCPK 4K8BA 1MAXA 1THRH 2FOHA 3BEIB 2PKSB 2IPHA 4CRFA 4NSVA 4WH6A 4E7NA 1O0DH 2VIOA 1P8VC 3UR9A 1SGFG 4UDWH 1XUHA 1X7AC 1FY4A 1C5MD 2ZO3H 1HRTH 1TBRH 2ZQ1A 1OWDA 4FU9A 2PKSC 3ZZ3A 3CENA 3C27B 2FS9A 2ANWA 3FZDA 3QDZB 1K1LA 2WPKS 4NGAH 4AFSA 2R3YA 3NCLA 3AASA 2OQUA 3M5LA 3RXVA 3SNAA 2F3CE 2FI5E 3QLPH 5K7RA 3A88A 3RXEA 4AZ2B 2Y81A 1MCVA 3D49H 1O3OA 3N7OA 4OS4A 4JZ1A 3KQBA 1KXBA 2GV7A 3LGWA 5JDUB 5L30H 1O5FH 1DITH 2TIOA 2VIDA 3P8GA 1FY8E 1B5GH 4XFQA 5IYTA 3MYWA 3A7VA 4AGKA 4XBDA 5ABWA 4NSYA 2TRMA 1BRCE 1CGHA 1MZAA 3RLYH 1FDPA 3ATKA 3RXCA 1AFQB 4ZAEA 2ZFTA 3DFLA 1O30A 1FAKH 6CHAB 2NU3E 1O35A 4AFUA 3MHWU 4NA7A 1Z8IB 2WPHS 3STJA 1IQMA 1GBKA 2ZDAH 1VJAU 1ZSKA 3V3MA 1OWHA 5JPMH 4K69A 3VB5A 2KAIB 1TA2A 3AAVA 1N8OC 1XXDA 5C3NA 1G3EA 4FUJA 1LVBA 1FN6A 3U1IB 3DA9B 2ZPQA 3U1JB 1QY6A 3GY4A 1C5WB 1TPOA 1LPKB 4UFDH 3M37A 1GCTB 1OP8A 4ABGA 4BAQB 3ODFA 2BD5A 5FX6A 3LOXA 1SGNE 4F49A 1EAIA 1NN6A 1NROH 2GP9B 3RXUA 3K65B 3MO6A 4NFEA 2XWAA 1ARBA 4KTCA 4X1NU 3AAUA 1OOKB 1JBUH 3LC5A 1O36A 1EOLA 4DJZB 1VCWA 1ELDE 1D3DB 1O2VA 1CA0B 2OUAA 1GCTC 3UR6A 4YLQH 2OD3B 1MU8B 3IITA 5A0AE 2UWPA 1V2VT 4GPGA 3GDVA 5GPIB 1OP0A 1MTNB 2ZGXH 3NKKA 4OS5A 1C1UH 1AIXH 1DLKB 1FV9A 1CA0C 1UHBA 3SBKA 3GY6A 5EXLA 2V35A 1O2KA 1C5NH 2GCHG 2EI6A 2R2MB 4U32A 4THNH 1TX7A 1ELFA 1IQIA 2BXTH 4OS2A 1MTNC 2YNAA 2FTLE 3SI4H 4I31A 1NRSH 4JK5A 2FEQH 1QB1A 1DX5M 4GHQA 3P6ZB 4FUFA 4X8SH 1TFXA 1GJ7B 1XUKA 4RSPA 1C1NA 1DVAH 1QJ1B 1BZXE 1C2FA 1VITG 3TH3H 4UFGH 1J8AA 4HI3A 1MQ6A 1Z8RA 2ZFQH 3MNSA 1Y3UA 1DT2A 1KLJH 4AOQA 1ZHMA 2C3SA 4ZHMU 5JBTA 4B2BA 3H5CB 2PSXA 1ESTA 1S6FA 1JOUB 3BTQE 2XYAA 2BVSH 5HXFA 5BPEA 1FY3A 4ZKNU 3GY2A 3SHCH 3MH4A 2R0LA 4BAKB 2FWWA 4UEHH 1WOFA 1A5IA 3MU4A 3SGQE 4ZHLU 3SUDA 5JB8S 3B8JA 1NFUA 3R3GB 1U6QA 2J34A 3W95A 5C2ZA 1F5LA 1UVSH 1K1IA 1BDAA 1KTSB 1FNIA 1A61H 2BD8A 2ZCLP 2FOGA 3ITIA 3QK1A 1G9IE 1ARCA 1C1QA 1C1VH 2NU1E 5J4SA 1GJBB 1QURH 5EOKA 4KKDA 3RP2A 1O37A 3BTGE 4HZHA 2ZHQH 1EASA 5JBBS 3UWJH 4ABAA 1AUJA 1O3HA 1PQ8A 2BD7A 2ZECA 4DT7B 5DP3A 1CU1A 1KLTA 3FAOA 4GAWA 1P2MA 3URDA 1H4WA 1ZMNA 3RC4A 5F8XA 1E35B 4YM9A 2O9QA 2OC1A 2PFEA 2HPPH 1TGCA 4BNRA 1Z8GA 1NZQH 1P3CA 1F2SE 1O3IA 2ZQ2A 2H6MA
chains in the Genus database with same CATH superfamily
3O8RA 1C2KA 3E1XB 2ULLA 1F0SA 1LHCH 3AK5A 4CH2B 1T8LA 3GYMA 1TWXB 1LMWB 4JYUH 4X6NA 1O3JA 2C4FH 2ZFSA 5KEDA 3T25A 2F9BH 3S7HB 1DWEH 2KCYA 2WUBA 1EQ9A 3E3TA 1VZQH 3M5NA 2ZGCA 3HK3B 2ZPSA 3L6PA 1IAUA 1T4VH 2HNTF 2F9PA 3ZVGA 1EB2A 1O33A 4GHTA 1TABE 2VWLA 2ZG0H 4FXGH 4MNWA 4D9RA 2PKAA 5DPAA 3U8RH 2SGPE 2C8YB 3S69A 5GCHF 1P09A 1QR3E 5I25A 4ASUD 4DY7B 1O2XA 1EKBB 7GCHF 1A1RA 3K2UA 2BDGA 4OS6A 3T28A 2ALPA 4BAOB 3TJUA 1WUNH 1C1SA 2DE9A 3NPSA 1CGJE 2A4QA 1ZPZA 2J4IA 3CS0A 4D76A 4RKJB 1MMJN 1BA8B 1GHXH 4WMDA 4Y8XA 3Q76A 1HAVA 4HTCH 3P8OA 3D62A 5EXMA 3PMHB 5C1UA 2HRVA 4X6MA 3SW2B 2OP9A 5DK1A 1C1PA 2WPDD 5GCHG 1QJ6B 2A4RA 1H9HE 2PLXA 2FPZA 2G55A 4FVDA 7GCHG 1XKAC 1CBWC 1O5AB 5FAHA 3ZZ8A 3RU4E 3L33A 2I6SA 1P0SH 4Q63A 1QB6A 2SGAA 4ZKRU 3KL6A 2PKAB 1GI1A 4CHAB 2QCYA 5F8ZA 3E91A 2CN0H 4INLA 1INCA 1TLDA 1BJVA 2UUYA 1G2LA 1NESE 1RGQA 3M36A 1MQ5A 3Q77A 1PJPA 3T27A 1L2EA 5F6MA 5TJXA 3SU2A 4WY3A 3OYPA 5AVDA 1SGDE 4TYDA 2EEKA 3PYHA 1TBQH 4FUDA 2BY8X 9ESTA 1G3BA 2PSYA 1A0JA 3VG8A 2ZTZA 2C8XB 1BBRE 3BN9A 1AN1E 3PV5A 3SO3A 3TH2H 2Z3EA 1HAVB 1F0UA 1MAYA 4LOYH 2STAE 4H6TA 4MPXA 1SQRA 1UTOA 5ESTE 1MUEB 1V2LT 7KMEH 4YTAA 2R2WU 4B6EA 3H7TA 3PLKA 1O2IA 3WW7A 1OX1A 2EQNA 4A1TA 4CBNA 2EI7A 4UD9H 2D8WA 3F9HA 3VPKA 2G51A 1TMUH 4DOQA 2QGRA 2Y5HA 3FANA 3F1SB 4Q7ZA 5C5OA 3UNRA 4MNYA 4WWYA 1NBMD 3SJ9A 1KSNA 2A0QB 3EE0B 2TGDA 1CHOF 1MU6B 1ZPCA 1PPCE 1YC0A 2Q6GA 3A84A 1NFXA 1NRNH 2LPRA 4X2VA 3TIUA 5EJLA 1GJ9B 2SGDE 2BZAA 4AG1A 3KN2A 1SQOA 4OGXA 2XNIA 2CMYA 2W6ID 1MKWK 1SLWB 1N1LA 3SGAE 1M9UA 4YLUA 2PUQH 1CT2E 3F68H 1LHDH 2AH4X 4JYVH 1CHOG 3O8DA 2GVFA 1HDTH 1YP9A 1Q31A 3F9EA 1C1RA 3DSPA 2J94A 2J98B 1BMNH 4WMEA 3DHKH 4MNVA 2G5VA 1AVGH 2KCOA 5LH8A 1XX9A 3EE7A 3M7UA 2A7JA 3S7KB 1G30B 3HKJB 2BM2A 1H8DH 1K1PA 2GJGA 3SQHE 1GVZA 1FIWA 1PFXC 2J5UA 1BUIA 1UVTH 3LPRA 5FPTA 2SNWA 1GJ5H 4IN2A 1HPGA 4A1XA 3FVFB 2ZU1A 3S9CA 2GV6A 3WWFA 1HBTH 1DWBH 2FOEA 3BF6H 4NWLA 3JZ2B 4Z0KA 1L4ZA 2WV9A 1XVOA 1QL7A 3NWUA 2EY4C 4ABBA 1C4V2 1HLTH 2ZDLA 1YPKH 1TNLA 5A8ZA 2P93A 2TGTA 1O3AA 1T4UH 2AEIH 5GWZA 3TPIZ 4YZUA 1EP5A 2PTNA 1HAIH 1K21H 1V3XA 2THFB 5H4IB 3MO3A 1TMBH 1UCYK 1LHFH 5K0HA 3LU9B 2Q1JA 1S83A 2PHBA 1TNHA 4ESTE 2GCTB 3ATMA 4FOUC 1KXFA 2FOBA 1LKAA 4MVNA 4UFFH 1KMHB 1V2JT 4FU8A 1HV7A 2Z94A 4XSKU 1YYY1 3UOPA 1ZSLA 2L74A 2TPIZ 2FLRH 2EA3A 2XTTB 1O3MA 3IG6B 4XDEA 3RM0H 2GCTC 1NFWA 8LPRA 1NS3A 1SVPA 1UCYH 1DUEA 2CK3D 1T7CA 1QNJA 5FX5A 3SJKA 4E7RG 1Q2WA 4Y7BA 2QN5T 1C5TA 5SGAE 1GI9B 1LQEA 1Z1JA 3UB0A 2CV3A 2RCEA 3MU5A 3SI3H 4LXBH 1NO9H 1TMTH 1QRXA 2ZPRA 3CP7A 3KHVA 4AGJA 4FUEA 5EG4A 2GT7A 3UY9A 1J17T 1YGCH 4X2XA 2KFWA 1SHHB 4UE7H 1P9UA 1XXFA 2F9UA 2ZHDA 4KELA 3ZVCA 3RXSA 1O2ZA 4ZXXH 1C5PA 1GBTA 4GUXA 1DSTA 4Y79A 2FYQA 3U98H 1Z8JB 2YMSD 4IW4E 3SV7A 3KIDU 1H1BA 2OXSA 5HIZA 2AS9A 1W14U 1Y5BT 2PWXA 2FX4A 3PB1E 1VGCB 1TNGA 2CF8H 2WUCA 1HAPH 3FO8D 2W7SA 2Z6BD 3HPTB 5G4BA 4DW2U 4LZ4B 2ZKSA 1C2JA 2Z9KA 2VIQA 2OQ5A 2FODA 1GCDA 4XE4A 1UVUH 1BCUH 2BOKA 2ZTYA 2BY6X 3ATWA 2ZU2A 1TX6A 1CGIE 4Y8YA 5DP4A 1BOQA 1GJ8B 1OYTH 1GMHF 3M7TA 2IPQX 1V2PT 1P04A 1C5UA 2XBYA 2HALA 1LVOA 2IOTA 2ZFFH 1RTLA 1ELGA 2ZGJA 1B0EA 1TRYA 4Q7XA 1XMNB 1LKBA 4X0WU 4ZCNA 1RIWC 1O38A 3ZZBA 5DKMA 5LGOA 5AFZH 2Y82A 1LCYA 2KZ4A 1ACBE 1ETRH 5EW1H 1MTSA 1SGQE 1TGTA 3PMAB 1DS2E 1GMHG 2BVXH 2SFAA 1OWEA 1V2OT 1A5GH 1BBRK 1RTFB 5DP5A 5GJ4B 4X2WA 2PGQB 1DXWA 1BMLA 3SU4A 4AFZA 2VIVA 1YBWA 2VWOA 3BTDE 1SLVB 1O2QA 2A1DB 1QIXB 4X8UH 1ZTJA 1BTHH 4ISNA 1PQ5A 3TLOA 1O32A 3PLPA 1HYLA 3SUEA 2OC0A 4IC6A 1HJAC 2P3TB 3RMNH 2UUJB 4TSFD 1OKXA 1UVOA 1AZZA 1BBRH 1ZJKA 3HATH 4Q2KA 2FZZA 1AHTH 2ZU5A 3DT0H 3RXMA 4U30A 1OS8A 3BTWE 1GI5A 3PLBA 3RXFA 1EJNA 3KQ5A 2ODYB 1GBFA 5DP9A 2JIZD 3QN7A 4D9QA 1SGYE 4ASHA 1ANDA 1O2WA 2JJ1D 3EQ0H 1N8OB 4R0IA 1BJUA 1E1RD 4NG9H 1YPLH 3GCNA 4DIHH 1C9TA 4TWWA 2Y5GA 3RLWH 3BTKE 3ATLA 3MO9A 1MTWA 2KX4A 1GGDB 2BY9X 4H6SB 1GI3A 1EZQA 1P03A 3SOSA 1O2TA 1K9OE 1GI8B 1SGPE 2ZDKA 3RXLA 1ETSH 1S6HA 2BXUH 1PQAA 5HM2A 2W5EA 5GNDA 3U28C 1FMGA 1J16A 2QIQA 1ELAA 1GGDC 5GIBA 4YXWD 2C93B 3BG4B 2JH5D 1IQJA 1TX8A 2QA9E 1C2LA 2BD4A 4IC5A 1C5VA 1YLCA 1DXPA 3CNRA 2IJOB 2B7DH 1Q3XA 3GOVB 5DP6A 1WAYB 1IQFA 2BY7X 2ODPA 2Z3DA 3BG4C 3KF2A 3LGVA 1ESBA 5HYOA 3A82A 2V3HH 3SU5A 4Z6AH 1TNIA 3V0XA 2PP6A 1W7XH 3RC5A 2XBXA 2AYWA 1P2OA 1MCTA 2AMPA 1ZYOA 4O3TA 5LPEA 1GHYH 1O5CB 2TGAA 4A5TS 3VB4A 2SNVA 2ILNA 2AGIX 4OS7A 1O2SA 1TALA 1Y59T 4BOHA 3MI4A 2QF0A 3RUOA 1W13U 2FX6A 4CRGA 3C1KA 2XW9A 3ZZ5A 2J95A 1C5LH 2OC8A 1AO5A 2WPMS 3EA8A 2P94A 1K22H 1XVMA 3A83A 2D1JA 3N99A 1GDQA 3KYFA 3SUGA 1C2DA 6GCHF 3PM3A 1VITH 3QWCH 1DANH 1JRSA 1SL3A 3LKWA 3VB3A 1O3KA 2WZQA 1XUIA 2Z7FE 3V12A 1AD8H 3T5FH 5EPNA 2FDAA 5CMXH 4DG4A 3F2FA 3SGBE 2BLVA 3QUMP 4Y8ZA 2A4OA 4Y6DA 5C94A 4MLFB 4P02A 1YPEH 4BAMB 1GL0E 4YOJA 1FLEE 3QTVH 4PROA 1ZGIA 1HJ8A 2ZWLH 2SGQE 3H7OA 1XUJA 5FBEA 3RXIA 2G4UA 3SNCA 3V13A 6GCHG 1C2GA 1Y8TA 2NU0E 4ZH8A 5CDFE 1UHBB 1ZMJA 2VINA 4LZ1H 1S6LA 1HJ9A 2VJ1A 4K2YA 2F9OA 1GDNA 1EAUA 1BRBE 3I29A 1TRMA 1KDQA 3UOUA 1XUGA 3B9FH 5EJZA 3UQOA 2ASUB 1CE5A 1FPHH 3EDXB 3A7YA 2ZC9H 2G4TA 1TPSA 4MTBA 1TBZH 1ZZZA 1WTGH 3SU3A 2FP7B 3P8NA 2BDAA 2ZGHA 1G36A 4AORA 2B9LA 3FKSD 1QCPA 1DWCH 4I8HA 1HAYB 1G32B 4FVBA 1D3TB 1AI8H 2ZP0H 4Y0YE 6LPRA 2GGVB 3TK6A 5FCKA 1HAOH 1GMDF 1A46H 1P2KA 1SGIB 1Y3WA 3A86A 5CHAC 1PYTD 1LPGB 1BTPA 4WXVA 3QGNB 1GI6A 1LVMA 1W0YH 1ELVA 5JBCS 1BTWA 2Z9LA 3LH1A 2K0QA 2UUKB 5BRRE 5LPRA 1NU9A 1KDQB 1EATA 1UTNA 8GCHF 1DFPA 1AKSA 1WXRA 1E38B 2LNCA 1PPGE 1P02A 2A45B 3RM2H 3P17H 2CGAA 4K3JA 1GMDG 2KR7A 4HFPB 1WSSH 4DGJA 1EZXC 1JIRA 3SV9A 1Y3VA 1V2NT 3T29A 3ZZAA 4I7YH 1AE8H 5ETXA 3RC6A 2C8ZB 5AF9H 1C5ZB 2JETC 3VEQB 3A7WA 2JH6D 3FN8A 1F5KU 2ZDVH 2ZTXA 1WYKA 1QRWA 1ID5H 3GS9A 3STIA 2DE8A 2ZEBA 4FUIA 8GCHG 1UTQA 3MH6A 1TQ7B 3RXDA 2PV9B 1V2MT 2BHGA 1C4U2 2FM2A 2HVYB 1EXFA 8ESTE 2HWLB 1MBQA 3F2GA 1GWAA 3ZVEA 1G2MA 4UONA 4ZUHA 5EQQA 4WH8A 3T26A 1TPAE 1GVKB 1TYNA 1NC6A 3NK8A 2EI8A 4TY7A 2QC2A 3LT3A 1CO7E 2BLOA 3NXPA 1AKSB 4GCHF 1QBNA 3P92A 3RU4D 2V3OH 1AQ7A 3SV6A 1TQ0B 1O2PA 3TH4H 1CBWB 2R3UA 2RA0A 2ZF0H 1ORFA 3DSGA 5J4QA 3MU1A 4A6LA 1ELCA 3EA7A 5EGMA 5DO4H 1EPTA 1Y5UT 1O31A 1ZTKA 3SHAH 1ETTH 1TGSZ 1TOMH 4AB9A 1K1MA 3VGCB 3ZVAA 2P3FH 2VBCA 1LHEH 6ESTA 3TNSA 3MH5A 4NIYA 1BHXF 2O8MA 1YLDA 1EOJA 2XOKD 4H42U 4GCHG 2ANYA 1ZSJA 3VGCC 3BTME 2FI4E 3HK6B 3K6YA 1TNJA 2ZCKP 2OBQA 4AYVB 4ISIH 1YPHE 3ZVDA 3AW0A 1GJ6A 4BTIB 2VWMA 2AGEX 3LIWA 2A5KA 3D23A 4B1TA 2FLBH 4X6OA 4O97A 2KM0A 4XOJA 5HMAA 3A8BA 2KCAA 1BQYA 1QGFA 4OS1A 1ELTA 1QL9A 3A87A 3U69H 1E79D 1W8BH 2P95A 2QXGA 3A80A 1TPPA 3LONA 1GMCF 1CSOE 4J2YB 4KTUA 1T8OA 1HIAA 2ZIQH 4JK6A 1NT1A 4SGBE 3QZRA 2ZNKH 3KGPA 2F43B 1XKBC 1SOTA 2QF5A 1PPEE 1SFIA 4ZXYH 1YLNA 3RXRA 2WV4A 1HXEH 2ZFRH 1SR5C 4U01A 4Z1MD 1FPCH 2XCNA 1ESAA 1EPTC 1G3DA 2BX3A 2V6NA 2W26A 4AYYB 1H8HD 2KCPA 2BD2A 1A4WH 2TBSA 4GVUA 3Q3XA 1BIOA 2PGBB 4ABIA 5DSFA 4NWKA 1TA6A 3SU1A 1IOEA 3MNCA 4BAHB 1GMCG 3E8LA 5T6DA 4E05H 1NY22 3D65E 3R0FA 1C1MA 3H09A 3HGNA 2XBVA 3V7TA 1A3EH 3F3BA 1LQDB 1O3DA 1A0LA 4D8NA 4HG6A 1IQLA 4MNXA 1GPZA 1W0ZU 4F48B 5GXPA 3FP8E 4P00A 3VB7A 1BRUP 4A7IB 4JZDH 1FAXA 3LGTA 1E34B 3OFND 3ZZ6A 2WV5A 1YKTA 5JYIA 1HIAB 2Y7ZA 1UTPA 3L3TA 4IS5A 3OU0A 3E0NB 1EZSC 4CRDA 1JWTA 4ABJA 5GDSH 3LGYA 2K8IA 1O2RA 1CQQA 2XC5A 5CE1A 4B73A 3OEED 2XNDD 1D6WA 2Y5FA 4CRCA 4R8TB 4NIVA 1EFRD 2Z9JA 5F03A 1GJAB 1KXAA 1FN8A 1FI8A 1IQKA 5E0GA 1EX3A 3A7XA 4VGCB 1BT7A 2P8OB 1KXDA 1SLXB 1P2IA 2VIWA 5TCAA 2CF9H 5B6OA 4CREA 3UNSA 5A8XA 5A0BA 3LGUA 4K8YA 5TCCA 1ZHRA 4IGDA 5IK2D 2ZDMA 1THSH 2G81E 3ZZDA 1C5SA 4VGCC 1RD3B 1RTKA 2P8OC 4Y71A 4NIXA 3IWMA 4I8GA 2C8WB 1AVXA 3K6ZA 5C1YA 3MMGA 1V2UT 5C1XA 2FOMB 2P16A 4X2YA 1BTXA 3TGJE 1UTJA 5E2PA 3E6PH 3SJIA 2VH6A 1F0TA 4YESB 4CR5A 5DGJA 1NPMA 2OINA 1C4Y2 3F9FA 4K60A 2YMSB 3FZZA 4Y11E 3QGJA 5HIYA 1UK4A 1UK2A 1VCQA 1PPBH 1GBHA 2A2QH 3KNXA 1GHAF 4WXIA 3RXQA 1HNEE 5EQRA 1UW7A 1HAGE 2GT8A 3ATIA 2UWOA 3OE7D 2FESH 2VNTA 3LH3A 4KGAA 1ELBA 2YMSC 1W2KH 1VJ9U 5HGGA 1FQ3A 3SV8A 1LDTT 3UTUH 3SORA 1HAXB 2GX4A 2FTMA 1NFYA 1DY9A 3TVJB 1W0JD 1WQVH 1Z6JH 1GI4A 3M35A 3W1EA 1V2TT 1BITA 1W3CA 1MTVA 4O3UA 4WJG2 3ZVFA 3RXBA 2ANMH 1AE5A 2BLQA 4RI0A 3F0PA 3SNBA 1Y5AT 4IBLH 1JMOH 3S9BA 2UWLA 1BRAA 4M9FA 4ABDA 3BV9B 2OC7A 2SGEE 1S84A 1SMFE 3EAJA 1EAXA 2QV1A 1C2HA 3ZYDA 1TAWA 2AHME 4TPIZ 3P95A 2RFKC 1SG8B 1AWFH 2QF4A 3BTFE 1CT4E 3RMOH 3RXAA 1P3EA 5AHGH 3OAAD 3S0NA 5AFYH 5FHTA 4K5ZA 4RT1A 3RXPA 1G37A 1BHXB 3ENSB 2ZHWH 1F5RA 1VCPA 5IDKA 2FOFA 3A89A 1V2ST 5E0HA 4KTSA 1O2MA 1AMHA 1QB9A 1CHGA 5C0UA 3W94A 1NTPA 2F9NA 3A85A 1FUJA 2J2UA 1UTLM 2FOCA 2WYJA 1SQAA 2BY5X 2PW8H 1GJDB 3SUFA 3U9AH 1A5HA 1JXPA 1OYQA 4LK4A 3SV2H 3TGKE 3UNQA 4B75A 2J97A 1H8IH 1RIWB 1S0RA 1YM0A 2QXIA 2GTBA 2NU4E 2L6OA 2ZDNA 4GSOA 1YCPM 5KECA 1A2CH 3OEHD 1DOJA 1WU1A 3GICB 2WYGA 1H9LB 5C5NA 1S81A 2HVXA 1E1QD 3F6UH 2ZZUH 3BTHE 2AMDA 1IQNA 1QBVH 1QA7A 4ABFA 4I33A 1LPZB 2BTCE 1AZ8A 1J14A 1KXEA 1QJ7B 2WHXA 1UJ1A 1GI7B 2HNTE 3ZV8A 8KME2 1ZRBA 2QXHA 1AUTC 1HB0B 2H5CA 2XRCA 2ZHEH 1C1TA 3PRBA 5F8TA 4CRBA 3SNEA 2AGGX 3OTPA 2VGCC 4JCNA 1HJAB 1UMAH 3PTBA 1AGJA 1YPJH 2ZCHP 3PO1B 2AFQB 2QY0B 2Q6FA 1YPMH 1IHSH 3GCTF 1YCPH 1KY9A 2GKVE 4OGYA 1T32A 3RXHA 4MDSA 3LJJA 1GHBF 1Y3XA 3PO1C 1EP6A 1O2UA 3AW1A 5FPYA 3SU0A 1UO6A 1COWD 1NU7B 3SZEA 2BDCA 1C1OA 1GHWH 2AERH 4AN7A 4SGAE 2KAIA 2VB0A 3A81A 1SGEE 3GY8A 1F92A 3QO6A 4KP0A 2PTCE 1KXCA 4ISOA 2HLCA 2R0KA 1Z71A 3GCTG 4YOGA 2JKHA 1D4PB 1YPGH 5FXLA 2ALVA 1ABIH 2Y6TA 4F55A 1NRQH 1GVLA 1GHBG 1WCZA 2ZHFH 5JB9S 5I46H 1EAWA 1D9IA 2D2DA 3TJVA 3DFJA 5JBAS 4DIIH 2HPQH 1SBWA 1SPJA 2BMGB 3OTJE 1C1WH 4AX9H 1ZJDA 4RKOB 1DSUA 2ODQA 3GDUA 2B8OH 2OTVA 1EJMA 2GZ7A 4AB8A 3Q3YA 1G3CA 1AFQC 4Y0ZE 1N6YA 1O2JA 2BQWB 4YOIA 1DLEA 2WSSD 6CHAC 1O5DH 1P12E 5L2YH 1EB1H 2H1UA 2NU2E 2HLDD 1T8NA 1ZPBA 2J9NA 1ZHPA 4A1VA 1JIMA 1P2JA 2O8LA 1ZGVA 2GD4B 4XRNA 3QX5H 4CRAA 1EJAA 1P10A 4NA9H 1P2QA 3N7EA 4BTTB 3BEUA 1BMMH 1MBMA 1P11E 2CJIA 2FMJA 1BMAA 2GCHF 3KQDA 3M3VA 1GBMA 4X1SU 2SGFE 1HCGA 2RG3A 2ZGBH 1QFKH 1L0ZA 1GBEA 1K1JA 3UFAA 1AY6H 2RDLA 1RRKA 3KQCA 1S0QA 3M7QA 4BXSA 1MD8A 2O8TA 2VVUA 1O3FA 2O8WA 4MPWA 1UK3A 1QA0A 1QBOA 1FIZA 1VITF 4WVPE 4D7GA 1SGRE 1SGFA 1OXGA 3BG8A 3MNXA 2JJ2D 3I77A 1H9IE 2RA3A 1XM1A 4CR9A 3DSOA 3LC3A 1W11U 3NUMA 2Q6DA 4X1RU 1LO6A 1B0FA 3DUXH 3KCGH 1DY8A 3MNBA 2K1QA 2G8TA 4NIWA 4MPVA 1KYNA 2G52A 1EUFA 1SQTA 2LP6A 4ISLA 1C2MA 4JYTA 2BLWA 3RMMH 1O39A 1GBAA 1S85A 1KTTB 1PYTC 4DURA 1TRNA 1O5BB 3UWIA 4FUHA 2FYRA 1OP2A 4OM9A 3KQEA 5EXNA 4JZIA 4ZMAH 1A7SA 2QXJA 4Q80A 2A5IA 1JRTA 3OY6U 2BQ6B 2XCFA 2VIPA 1J15A 1DPOA 4D7FA 1DDJA 5L6NH 3ZIAD 2BB4A 2HOBA 1AB9B 3LJOA 4TY6A 1SFQB 1OPHB 1RJXB 1A0HB 5CHAB 2ZI2H 1TOCB 1T8MA 5L2ZH 4ZHAA 1UTKA 2B5TB 1Z1IA 2P59A 3PTNA 1O2GH 2GZ9A 4I8KA 4K1EA 5PTPA 7ESTE 2BD3A 4TT3D 1AB9C 2BDHA 3DCLA 1OWJA 1PPZA 1QZ8A 4J1YA 4X6PA 1J9CH 1AVWA 1BTYA 2W3KA 3GCHB 1DE7H 5FBIA 2G00A 1L4DA 4FUBA 1QHRB 3A8CA 3KEEA 1WDIA 1C5RA 3ELAH 1Z6EA 2GMTB 1GBDA 3TU7H 2A7HA 1UCYE 1GG6B 1HAHH 3GCHC 3O8BA 3QZQA 2JETB 4MQAA 3UQVA 4YT6H 3F2HA 1C5YB 1K2I1 1GJCB 4GLYA 3TK5A 2GMTC 2XBWA 5E0JA 2F83A 2BZ6H 4AFQA 1C5OH 2YNBA 2H2ZA 3RXOA 3FP6E 3MTYA 1GG6C 3E16B 5EQSA 3M3SA 2FS8A 1YPHC 4ABEA 5LPFA 1TONA 5FPSA 1QQUA 2A31A 2A4GA 4MG3A 1DICA 3JZ1B 3RMLH 2R9PA 2AMQA 4INHA 3ODDA 4Y76A 5A0CA 1FXYA 4NA8A 1HXFH 3I78A 3PV4A 2ZU4A 3GCOA 1XUFA 1MTUA 3OSYA 4O03A 3TGIE 5F53A 3GDSA 3BIVH 1LTOA 3GYLB 3PROA 1GBJA 1IQGA 1SLUB 3Q00A 2HGTH 4AG2A 5EODA 4XBBA 4NZLA 4INKA 1D6RA 3HKIB 2VU8E 1W10U 1E37B 3VXFH 5A2MH 2OLGA 3P8FA 1O2NA 3URCA 1FY1A 3MWIU 3UUZA 1ZMLA 1MZDA 4I8JA 1YF4A 2Z3CA 3GY3A 1BTZA 1W12U 4Y7AA 1Z7KA 3RU4T 1GBLA 3GISB 4Y10E 2Y7XA 5C0TA 5E8EH 2TGPZ 2ZA5A 4B2CA 1L1GA 1FJSA 3RXKA 4DVAU 1O3EA 3TJOA 3OY5U 4ZROA 2YOLA 1IQEA 4NFFA 3ZZ7A 4XD7D 2FO9A 1CVWH 1P05A 2BDYA 4ZKSU 1W7GH 3GY5A 4I32A 4IN1A 3ZZ4A 2ZFPH 1BB0B 3RDZA 2WPLS 4B74A 3ZYEA 1O5EH 3TK9A 3BIUH 4WMFA 4X8VH 4HGCA 1NRRH 3UPEA 3DD2H 1SC8U 2H9TH 3K9XB 4E06H 1SSXA 2WPJS 2ZU3A 1GI2A 4A92A 5EU8A 2QF3A 4TWYA 1DM4B 1RXPA 1A3BH 1C5QA 4X8TH 3ZZ9A 2GZ8A 5HM9A 3E0PB 1GBBA 3MOCA 2BD9A 1E0FD 2H9EH 3Q3KA 3T62A 4K1TA 5T3HA 2V3MA 3TJNA 1EPTB 3E90B 3SU6A 1BTUA 2CHAB 1V2WT 1QRZA 1FY5A 1WV7H 3RXTA 1F0RA 4CHAC 3PWCA 3AVZA 4BANB 2EC9H 1SHYA 1ABJH 2CXVA 4U2WA 1SOZA 3S9AA 5A8YA 3PWBA 1GHZA 2AIQA 3EA9A 4JMYA 5C17A 4YT7H 1O3CA 1HAZB 5CHBA 2CHAC 2XC4A 2G5NA 3ZVBA 5KGOA 1GL1A 3M61U 4FUCA 2J98A 1O3BA 3FP7E 1UVPA 1C9PA 3PMBB 1D3PB 3SYJA 2A32A 1V2KT 3O8CA 1TGNA 1UTMA 2QYIA 1QL8A 2XWBI 2W7UA 4ZKOU 1IHTH 3CS7A 1RS0A 3OX7U 1P9SA 4B2AA 5DP7A 2A7CA 2IN2A 4CH8B 5FCRA 4BXWA 5EW2H 4MPUA 1OWIA 4M7GA 3ESTA 1LVYA 7LPRA 2D26C 3M5MA 1HUTH 1V6DA 2BOHB 4BTUB 1SKYE 1IQHA 2BYAX 2QAAA 4FUGA 4YO9A 3ZZCA 3MH7A 1K0HA 1NBME 1V2QT 3BTEE 1EZUC 1PPHE 5ESBA 2A2XH 5A09A 2NWNA 2P3UB 3MQKC 1GBCA 2OBOA 1ZLRA 1Y3YA 1ZR0A 4B71A 1TIOA 1N6XA 1S82A 1K28D 5C67A 2XC0A 4IMZA 1SB1H 1V2RT 1TE0A 2BDIA 3ZV9A 2PR3A 2XXLA 3NZIA 3VFEA 1C2EA 1KIGH 3EGKH 3U8TH 3M5OA 1FZZA 1MKWH 3MU0A 1O3NA 4F4OC 4X1QU 3U8OH 1HFDA 1TGBA 1FONA 2BVRH 1E36B 5DG6A 3A7TA 1TNKA 4K1SA 1MKXK 1ZTLA 1OSSA 5DJ7A 2W6JD 1NRPH 3A7ZA 2V7QD 1O2OA 4FU7A 2FI3E 4O9VA 3SZNA 3WY8A 2BDBA 2GDDA 1MH0A 2H9HA 1GDUA 2B0FA 5HKKD 4DCDA 1H8ED 3RXJA 1P01A 2M5TA 4ISHH 1ZOMA 1WQSA 4CBOA 2STBE 4B76A 2ANKH 2VWNA 4B6FA 3QTOH 3SNDA 1F7ZA 2VVCA 1L1JA 1WBGB 1MKXH 2DUCA 4TPYA 3VB6A 3UIRA 3SQEE 1O2YA 1CT0E 5C20A 1P06A 3A8DA 2RDEA 2H5DA 4Q7YA 1GHVH 2JH0D 1B7XB 3HGPA 2IJD1 1P57B 1WTHD 1HGTH 2WINI 3PMJA 3B23B 3TITA 3SJOA 1C2IA 2FOAA 1ANBA 2UUFB 1GJ4H 3FFGA 1FX0B 3BSQA 3TNTA 1SI5H 1TB6H 1S5SA 2V0BA 3SJ8A 1GI0A 2LELA 4WF8A 4QT8C 9LPRA 3VXEH 1AWHB 1O3LA 1K1NA 1LHGH 1GBIA 1GHAG 3BEFB 1P2NA 3EYDA 3F9GA 1DWDH 3LDXH 4H4FA 2A5AA 4NZQA 2OCVB 1QTFA 1O3GA 3UREA 2GDEH 1AU8A 1CA8B 2HNTC 2Z9IA 3G01A 3A8AA 1MD7A 2VH0A 2O8UA 1ELEE 2ESTE 4X1PU 5T6GA 3MU8A 3P70B 1ZRKA 5DP8A 3GY7A 3N7DA 5EPYA 4ABHA 1D3QB 1DUAA 2QE7D 1PQ7A 2C90B 5E2OA 2J92A 3MFJA 3PV2A 1AFEH 4JZFH 1QQ4A 4JZEH 4DT4A 1ANEA 3M3TA 2I6QA 1O2HA 1NM6A 1THPB 4ACAA 1O2LA 1O5GH 2Y80A 4NCYA 4FETA 2W3IA 5FL7D 3LGIA 1SGTA 5DN6D 1T31A 3BTTE 3RXGA 4UFEH 1VR1H 2JDID 1O34A 2BX4A 4XBCA 4I8LA 2VVVA 4RN6A 1SGCA 2Z9GA 1RFNA 5T6FA 2F9VA 2J38A 3NRLA 1ANCA 3T2NA 2PUXB 1L1NA 3UAIC 2AIPA 1KLIH 2FIRH 2F91A 2WPIS 1PPFE 1C5XB 1OWKA 2BQ7B 2FXRA 1VGCC 1BMFD 2VGCB 4IMQA 3SN8A 1K1OA 1O3PB 1YCPK 4K8BA 1MAXA 1THRH 2FOHA 3BEIB 3KYGA 2PKSB 2IPHA 4CRFA 4NSVA 4WH6A 4E7NA 1O0DH 5T1VA 4RT0A 5EJ1A 2VIOA 1P8VC 3UR9A 1SGFG 4UDWH 1XUHA 1X7AC 1FY4A 1C5MD 2ZO3H 1HRTH 1TBRH 2ZQ1A 1OWDA 4FU9A 2PKSC 1YY3A 3ZZ3A 3CENA 3C27B 2FS9A 2ANWA 3FZDA 3QDZB 4Q4LA 1K1LA 2WPKS 4NGAH 4AFSA 2R3YA 3NCLA 3AASA 2OQUA 3M5LA 3RXVA 3SNAA 2F3CE 2FI5E 3QLPH 5K7RA 3A88A 3RXEA 4AZ2B 2Y81A 1MCVA 3D49H 1O3OA 3N7OA 4OS4A 4JZ1A 3KQBA 1KXBA 2GV7A 3LGWA 5JDUB 5L30H 1O5FH 4ACBA 1DITH 2TIOA 2VIDA 3P8GA 1FY8E 1B5GH 4XFQA 5IYTA 3WWBA 2F4LA 3MYWA 3A7VA 4AGKA 4XBDA 5ABWA 4NSYA 2TRMA 1BRCE 1CGHA 1MZAA 3RLYH 1FDPA 3ATKA 3RXCA 1AFQB 4ZAEA 2ZFTA 3DFLA 1O30A 1FAKH 6CHAB 5EIYA 2NU3E 4AC9A 1O35A 4AFUA 3MHWU 4NA7A 1Z8IB 2WPHS 3STJA 1IQMA 1GBKA 2ZDAH 1VJAU 1ZSKA 3V3MA 1OWHA 5JPMH 4K69A 3VB5A 5B6LA 2KAIB 1TA2A 3AAVA 1N8OC 1XXDA 3PRDA 5C3NA 1G3EA 4FUJA 1LVBA 1FN6A 3U1IB 3DA9B 2ZPQA 3U1JB 1QY6A 3GY4A 1C5WB 1MABB 1TPOA 1LPKB 2OK5A 4UFDH 3M37A 1GCTB 1OP8A 4ABGA 4BAQB 3ODFA 2BD5A 5FX6A 3LOXA 1SGNE 4F49A 1EAIA 1NN6A 1NROH 2GP9B 3RXUA 3K65B 3MO6A 4NFEA 2XWAA 1ARBA 4KTCA 2M2AA 4X1NU 3AAUA 1OOKB 1JBUH 3LC5A 1O36A 1EOLA 4DJZB 1VCWA 1ELDE 1D3DB 1O2VA 1CA0B 1W0KD 2OUAA 1GCTC 3UR6A 4YLQH 2OD3B 1MU8B 3IITA 5A0AE 2UWPA 1V2VT 4GPGA 3GDVA 5GPIB 1OP0A 1MTNB 2ZGXH 3NKKA 4OS5A 1C1UH 1AIXH 1DLKB 1FV9A 1CA0C 1UHBA 3SBKA 3GY6A 5EXLA 2V35A 1O2KA 1YWUA 1C5NH 2GCHG 2EI6A 2R2MB 3FOAA 4U32A 4THNH 1TX7A 1ELFA 1IQIA 2BXTH 4OS2A 1MTNC 2YNAA 2FTLE 3SI4H 4I31A 1NRSH 4JK5A 2FEQH 1QB1A 1DX5M 4GHQA 3P6ZB 4FUFA 4X8SH 1TFXA 1GJ7B 1XUKA 4RSPA 1C1NA 1DVAH 1VKYA 1QJ1B 1BZXE 1C2FA 1VITG 3TH3H 4UFGH 1J8AA 4HI3A 1MQ6A 1Z8RA 2ZFQH 3MNSA 1Y3UA 1DT2A 1KLJH 4AOQA 1ZHMA 2C3SA 4ZHMU 4I86A 5JBTA 4B2BA 3H5CB 2PSXA 1ESTA 1S6FA 1JOUB 3BTQE 2XYAA 2BVSH 5HXFA 5BPEA 1FY3A 4ZKNU 3GY2A 3SHCH 3MH4A 2R0LA 4BAKB 2FWWA 4UEHH 1WOFA 1A5IA 3MU4A 3SGQE 4ZHLU 3F0OA 3SUDA 5JB8S 3B8JA 1NFUA 3R3GB 1U6QA 1OHHD 2J34A 3W95A 5C2ZA 1F5LA 1UVSH 1K1IA 1BDAA 1KTSB 1FNIA 1A61H 2BD8A 2ZCLP 2FOGA 3ITIA 3QK1A 1G9IE 1ARCA 1C1QA 1C1VH 2NU1E 5J4SA 1GJBB 1QURH 5EOKA 4KKDA 3RP2A 1O37A 3BTGE 4HZHA 2ZHQH 1EASA 5JBBS 3UWJH 4ABAA 1AUJA 1O3HA 1PQ8A 2BD7A 2ZECA 4DT7B 5DP3A 1CU1A 1KLTA 3FAOA 4GAWA 1P2MA 3URDA 1H4WA 1ZMNA 3RC4A 5F8XA 1E35B 4YM9A 2O9QA 2OC1A 2PFEA 2HPPH 1TGCA 4BNRA 1Z8GA 1NZQH 1P3CA 1F2SE 1O3IA 2ZQ2A 2H6MA
chains in the Genus database with same CATH topology
3O8RA 1C2KA 3E1XB 2ULLA 1F0SA 1LHCH 4CH2B 1T8LA 3GYMA 1TWXB 1LMWB 4JYUH 4X6NA 1O3JA 2C4FH 2ZFSA 3T25A 2F9BH 3S7HB 1DWEH 2WUBA 1EQ9A 3E3TA 1VZQH 3M5NA 2ZGCA 3HK3B 2ZPSA 3L6PA 1IAUA 1T4VH 2HNTF 2F9PA 3ZVGA 1EB2A 1O33A 4GHTA 1TABE 2VWLA 2ZG0H 4FXGH 4MNWA 4D9RA 2PKAA 5DPAA 3U8RH 2SGPE 2C8YB 3S69A 5GCHF 1P09A 1QR3E 5I25A 4DY7B 1O2XA 1EKBB 7GCHF 1A1RA 3K2UA 2BDGA 4OS6A 3T28A 2ALPA 4BAOB 3TJUA 1WUNH 1C1SA 2DE9A 3NPSA 1CGJE 2A4QA 1ZPZA 2J4IA 3CS0A 4D76A 4RKJB 1MMJN 1BA8B 1GHXH 4WMDA 4Y8XA 3Q76A 1HAVA 4HTCH 3P8OA 3D62A 5EXMA 3PMHB 5C1UA 2HRVA 4X6MA 3SW2B 2OP9A 5DK1A 1C1PA 5GCHG 1QJ6B 2A4RA 1H9HE 2PLXA 2FPZA 2G55A 4FVDA 7GCHG 1XKAC 1CBWC 1O5AB 5FAHA 3ZZ8A 3RU4E 3L33A 2I6SA 1P0SH 1QB6A 2SGAA 4ZKRU 3KL6A 2PKAB 1GI1A 4CHAB 2QCYA 5F8ZA 3E91A 2CN0H 4INLA 1INCA 1TLDA 1BJVA 2UUYA 1G2LA 1NESE 1RGQA 3M36A 1MQ5A 3Q77A 1PJPA 3T27A 1L2EA 5F6MA 5TJXA 3SU2A 4WY3A 3OYPA 5AVDA 1SGDE 4TYDA 2EEKA 3PYHA 1TBQH 4FUDA 2BY8X 9ESTA 1G3BA 2PSYA 1A0JA 2ZTZA 2C8XB 1BBRE 3BN9A 1AN1E 3SO3A 3TH2H 2Z3EA 1HAVB 1F0UA 1MAYA 4LOYH 2STAE 4H6TA 4MPXA 5ESTE 1UTOA 7KMEH 1MUEB 1V2LT 4YTAA 2R2WU 3H7TA 3PLKA 1O2IA 1OX1A 4A1TA 4CBNA 2EI7A 4UD9H 2D8WA 3F9HA 3VPKA 2G51A 1TMUH 4DOQA 2QGRA 2Y5HA 3FANA 3F1SB 4Q7ZA 5C5OA 3UNRA 4MNYA 4WWYA 3SJ9A 1KSNA 2A0QB 3EE0B 2TGDA 1CHOF 1MU6B 1ZPCA 1PPCE 1YC0A 2Q6GA 3A84A 1NFXA 1NRNH 2LPRA 4X2VA 3TIUA 1GJ9B 2SGDE 2BZAA 4AG1A 3KN2A 1SQOA 4OGXA 2XNIA 2CMYA 1MKWK 1SLWB 1N1LA 3SGAE 1M9UA 4YLUA 2PUQH 1CT2E 3F68H 1LHDH 2AH4X 4JYVH 1CHOG 3O8DA 2GVFA 1HDTH 1YP9A 1Q31A 3F9EA 1C1RA 2J94A 1BMNH 4WMEA 3DHKH 4MNVA 2G5VA 1AVGH 5LH8A 1XX9A 3M7UA 2A7JA 3S7KB 1G30B 3HKJB 2BM2A 1H8DH 1K1PA 3SQHE 1GVZA 1FIWA 1PFXC 1BUIA 1UVTH 3LPRA 5FPTA 2SNWA 1GJ5H 4IN2A 1HPGA 4A1XA 3FVFB 2ZU1A 3S9CA 2GV6A 1HBTH 1DWBH 2FOEA 3BF6H 4NWLA 3JZ2B 4Z0KA 1L4ZA 3NWUA 1XVOA 1QL7A 4ABBA 1C4V2 1HLTH 2ZDLA 1YPKH 1TNLA 5A8ZA 2P93A 2TGTA 1O3AA 1T4UH 2AEIH 5GWZA 3TPIZ 4YZUA 1EP5A 2PTNA 1HAIH 1K21H 1V3XA 2THFB 5H4IB 3MO3A 1TMBH 1UCYK 1LHFH 5K0HA 3LU9B 2Q1JA 1S83A 2PHBA 1TNHA 4ESTE 2GCTB 3ATMA 1KXFA 2FOBA 1LKAA 4MVNA 4UFFH 1V2JT 4FU8A 1HV7A 2Z94A 4XSKU 1YYY1 3UOPA 1ZSLA 2TPIZ 2FLRH 2EA3A 2XTTB 1O3MA 3IG6B 4XDEA 3RM0H 2GCTC 1NFWA 8LPRA 1NS3A 1SVPA 1UCYH 1DUEA 3SJKA 1T7CA 1QNJA 5FX5A 4E7RG 1Q2WA 4Y7BA 2QN5T 1C5TA 5SGAE 1GI9B 1LQEA 1Z1JA 2CV3A 2RCEA 3MU5A 3SI3H 4LXBH 1NO9H 1TMTH 1QRXA 2ZPRA 3CP7A 3KHVA 4AGJA 4FUEA 5EG4A 2GT7A 3UY9A 1J17T 1YGCH 4X2XA 1SHHB 4UE7H 1P9UA 1XXFA 2F9UA 2ZHDA 4KELA 3ZVCA 3RXSA 1O2ZA 4ZXXH 1C5PA 1GBTA 4GUXA 1DSTA 4Y79A 2FYQA 3U98H 1Z8JB 4IW4E 3SV7A 3KIDU 1H1BA 2OXSA 2AS9A 1W14U 1Y5BT 2PWXA 2FX4A 3PB1E 1VGCB 1TNGA 2CF8H 2WUCA 1HAPH 2W7SA 2Z6BD 3HPTB 5G4BA 4DW2U 4LZ4B 2ZKSA 1C2JA 2Z9KA 2VIQA 2OQ5A 2FODA 1GCDA 4XE4A 1UVUH 1BCUH 2BOKA 2ZTYA 2BY6X 3ATWA 2ZU2A 1TX6A 1CGIE 4Y8YA 5DP4A 1BOQA 1GJ8B 1OYTH 1GMHF 3M7TA 1V2PT 1P04A 1C5UA 2XBYA 2HALA 1LVOA 2IOTA 2ZFFH 1RTLA 1ELGA 2ZGJA 1B0EA 1TRYA 4Q7XA 1XMNB 1LKBA 4X0WU 1RIWC 1O38A 3ZZBA 5DKMA 5LGOA 5AFZH 2Y82A 1LCYA 1ACBE 1ETRH 5EW1H 1MTSA 1SGQE 1TGTA 3PMAB 1DS2E 1GMHG 2BVXH 2SFAA 1OWEA 1V2OT 1A5GH 1BBRK 1RTFB 5DP5A 5GJ4B 4X2WA 2PGQB 1DXWA 1BMLA 3SU4A 4AFZA 2VIVA 1YBWA 2VWOA 3BTDE 1SLVB 1O2QA 2A1DB 1QIXB 4X8UH 1ZTJA 1BTHH 4ISNA 1PQ5A 3TLOA 1O32A 3PLPA 1HYLA 3SUEA 2OC0A 4IC6A 1HJAC 2P3TB 3RMNH 2UUJB 1OKXA 1AZZA 1UVOA 1BBRH 1ZJKA 3HATH 4Q2KA 2FZZA 1AHTH 2ZU5A 3DT0H 3RXMA 4U30A 1OS8A 3BTWE 1GI5A 3PLBA 3RXFA 1EJNA 2ODYB 1GBFA 5DP9A 3QN7A 4D9QA 1SGYE 4ASHA 1ANDA 1O2WA 3EQ0H 1N8OB 4R0IA 1BJUA 4NG9H 1YPLH 3GCNA 4DIHH 1C9TA 4TWWA 2Y5GA 3RLWH 3BTKE 3ATLA 3MO9A 1MTWA 1GGDB 2BY9X 4H6SB 1GI3A 1EZQA 1P03A 3SOSA 1O2TA 1K9OE 1GI8B 1SGPE 2ZDKA 3RXLA 1ETSH 1S6HA 2BXUH 1PQAA 5HM2A 2W5EA 1FMGA 1J16A 2QIQA 1ELAA 1GGDC 5GIBA 2C93B 3BG4B 2JH5D 1IQJA 1TX8A 2QA9E 1C2LA 2BD4A 4IC5A 1C5VA 1YLCA 1DXPA 2IJOB 2B7DH 1Q3XA 3GOVB 5DP6A 1WAYB 1IQFA 2BY7X 2ODPA 2Z3DA 3BG4C 3KF2A 3LGVA 1ESBA 5HYOA 3A82A 2V3HH 3SU5A 4Z6AH 1TNIA 3V0XA 1W7XH 3RC5A 2XBXA 2AYWA 1P2OA 1MCTA 2AMPA 1ZYOA 4O3TA 5LPEA 1GHYH 1O5CB 2TGAA 4A5TS 3VB4A 2SNVA 2ILNA 2AGIX 4OS7A 1O2SA 1TALA 1Y59T 4BOHA 3MI4A 2QF0A 3RUOA 1W13U 2FX6A 4CRGA 3C1KA 2XW9A 3ZZ5A 2J95A 1C5LH 2OC8A 1AO5A 2WPMS 3EA8A 2P94A 1K22H 1XVMA 3A83A 2D1JA 1GDQA 3SUGA 1C2DA 6GCHF 3PM3A 1VITH 3QWCH 1DANH 1JRSA 1SL3A 3LKWA 3VB3A 1O3KA 1XUIA 2Z7FE 3V12A 1AD8H 3T5FH 5EPNA 2FDAA 5CMXH 4DG4A 3SGBE 2BLVA 3QUMP 4Y8ZA 2A4OA 4Y6DA 4MLFB 1YPEH 4BAMB 1GL0E 4YOJA 1FLEE 3QTVH 4PROA 1ZGIA 1HJ8A 2ZWLH 2SGQE 3H7OA 1XUJA 5FBEA 3RXIA 2G4UA 3SNCA 3V13A 6GCHG 1C2GA 1Y8TA 2NU0E 4ZH8A 1UHBB 1ZMJA 2VINA 4LZ1H 1HJ9A 2VJ1A 4K2YA 2F9OA 1GDNA 1EAUA 1BRBE 3I29A 1TRMA 1KDQA 3UOUA 1XUGA 3B9FH 3UQOA 2ASUB 1CE5A 1FPHH 3EDXB 3A7YA 2ZC9H 2G4TA 1TPSA 4MTBA 1TBZH 1ZZZA 1WTGH 3SU3A 2FP7B 3P8NA 2BDAA 2ZGHA 1G36A 4AORA 2B9LA 1QCPA 1DWCH 4I8HA 1HAYB 1G32B 4FVBA 1D3TB 1AI8H 2ZP0H 4Y0YE 6LPRA 2GGVB 3TK6A 5FCKA 1HAOH 1GMDF 1A46H 1P2KA 1SGIB 1Y3WA 3A86A 5CHAC 1PYTD 1LPGB 1BTPA 4WXVA 3QGNB 1GI6A 1LVMA 1W0YH 1ELVA 5JBCS 1BTWA 2Z9LA 3LH1A 2UUKB 5BRRE 5LPRA 1NU9A 1KDQB 1EATA 1UTNA 8GCHF 1DFPA 1AKSA 1E38B 2LNCA 1PPGE 1P02A 2A45B 3RM2H 3P17H 2CGAA 4K3JA 1GMDG 4HFPB 1WSSH 4DGJA 1EZXC 1JIRA 3SV9A 1Y3VA 1V2NT 3T29A 3ZZAA 4I7YH 1AE8H 5ETXA 3RC6A 2C8ZB 5AF9H 1C5ZB 2JETC 3VEQB 3A7WA 2JH6D 1F5KU 2ZDVH 2ZTXA 1WYKA 1QRWA 1ID5H 3STIA 2DE8A 2ZEBA 4FUIA 8GCHG 1UTQA 3MH6A 1TQ7B 3RXDA 2PV9B 1V2MT 2BHGA 1C4U2 2FM2A 1EXFA 8ESTE 2HWLB 1MBQA 3ZVEA 1GWAA 1G2MA 4UONA 4ZUHA 5EQQA 4WH8A 3T26A 1TPAE 1GVKB 1TYNA 1NC6A 3NK8A 2EI8A 4TY7A 2QC2A 3LT3A 1CO7E 2BLOA 3NXPA 1AKSB 4GCHF 1QBNA 3P92A 3RU4D 2V3OH 1AQ7A 3SV6A 1TQ0B 1O2PA 3TH4H 1CBWB 2R3UA 2RA0A 2ZF0H 1ORFA 5J4QA 3MU1A 4A6LA 1ELCA 3EA7A 5EGMA 5DO4H 1EPTA 1Y5UT 1O31A 1ZTKA 3SHAH 1ETTH 1TGSZ 1TOMH 4AB9A 1K1MA 3VGCB 3ZVAA 2P3FH 1LHEH 6ESTA 3TNSA 3MH5A 4NIYA 1BHXF 2O8MA 1YLDA 1EOJA 4H42U 4GCHG 2ANYA 1ZSJA 3VGCC 3BTME 2FI4E 3HK6B 3K6YA 1TNJA 2ZCKP 2OBQA 4AYVB 4ISIH 1YPHE 3ZVDA 3AW0A 1GJ6A 4BTIB 2VWMA 2AGEX 3LIWA 2A5KA 3D23A 4B1TA 2FLBH 4X6OA 4O97A 4XOJA 5HMAA 3A8BA 1BQYA 1QGFA 4OS1A 1ELTA 1QL9A 3A87A 3U69H 1W8BH 2P95A 2QXGA 3A80A 1TPPA 3LONA 1GMCF 1CSOE 4J2YB 4KTUA 1T8OA 1HIAA 2ZIQH 4JK6A 1NT1A 4SGBE 3QZRA 2ZNKH 3KGPA 1XKBC 1SOTA 4ZXYH 1PPEE 1SFIA 3RXRA 2WV4A 1HXEH 2ZFRH 1SR5C 4U01A 1FPCH 2XCNA 1ESAA 1EPTC 1G3DA 2BX3A 2V6NA 2W26A 4AYYB 2BD2A 1A4WH 2TBSA 4GVUA 4ABIA 3Q3XA 1BIOA 2PGBB 4NWKA 1TA6A 3SU1A 1IOEA 3MNCA 4BAHB 1GMCG 3E8LA 5T6DA 4E05H 1NY22 3D65E 3R0FA 1C1MA 3HGNA 2XBVA 3V7TA 1A3EH 1LQDB 1O3DA 1A0LA 4D8NA 5GXPA 1IQLA 4MNXA 1GPZA 1W0ZU 3FP8E 3VB7A 1BRUP 4A7IB 4JZDH 1FAXA 3LGTA 1E34B 3ZZ6A 2WV5A 1YKTA 5JYIA 1HIAB 2Y7ZA 1UTPA 3L3TA 4IS5A 3OU0A 3E0NB 1EZSC 4CRDA 1JWTA 4ABJA 5GDSH 3LGYA 1O2RA 1CQQA 2XC5A 5CE1A 4B73A 1D6WA 2Y5FA 4CRCA 4R8TB 4NIVA 2Z9JA 5F03A 1GJAB 1KXAA 1FN8A 1FI8A 1IQKA 5E0GA 1EX3A 3A7XA 4VGCB 1BT7A 2P8OB 1KXDA 1SLXB 1P2IA 2VIWA 5TCAA 2CF9H 5B6OA 4CREA 3UNSA 5A8XA 5A0BA 3LGUA 4K8YA 5TCCA 1ZHRA 4IGDA 2ZDMA 1THSH 2G81E 3ZZDA 1C5SA 4VGCC 1RD3B 1RTKA 2P8OC 4Y71A 4NIXA 3IWMA 4I8GA 2C8WB 1AVXA 3K6ZA 5C1YA 3MMGA 1V2UT 5C1XA 2FOMB 2P16A 4X2YA 1BTXA 3TGJE 1UTJA 5E2PA 3E6PH 3SJIA 2VH6A 1F0TA 4YESB 4CR5A 5DGJA 1NPMA 2OINA 1C4Y2 3F9FA 4K60A 3FZZA 4Y11E 3QGJA 1UK4A 1UK2A 1VCQA 1PPBH 1GBHA 2A2QH 3KNXA 1GHAF 4WXIA 3RXQA 1HNEE 5EQRA 1HAGE 2GT8A 3ATIA 2UWOA 2FESH 2VNTA 3LH3A 4KGAA 1ELBA 1W2KH 1VJ9U 5HGGA 1FQ3A 3SV8A 1LDTT 3UTUH 3SORA 1HAXB 2GX4A 2FTMA 1NFYA 1DY9A 3TVJB 1WQVH 1Z6JH 1GI4A 3M35A 1V2TT 1BITA 1W3CA 1MTVA 4O3UA 4WJG2 3ZVFA 3RXBA 2ANMH 1AE5A 2BLQA 3SNBA 1Y5AT 4IBLH 1JMOH 3S9BA 2UWLA 1BRAA 4ABDA 3BV9B 2OC7A 2SGEE 1S84A 1SMFE 3EAJA 1EAXA 2QV1A 1C2HA 3ZYDA 1TAWA 4TPIZ 3P95A 1SG8B 1AWFH 3BTFE 1CT4E 3RMOH 3RXAA 1P3EA 5AHGH 3S0NA 5AFYH 5FHTA 4K5ZA 3RXPA 1G37A 1BHXB 3ENSB 2ZHWH 1F5RA 1VCPA 5IDKA 2FOFA 3A89A 1V2ST 5E0HA 4KTSA 1O2MA 1AMHA 1QB9A 1CHGA 3W94A 1NTPA 2F9NA 3A85A 1FUJA 2J2UA