3PWBA

Bovine trypsin variant x(tripleglu217ile227) in complex with small molecule inhibitor
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGEGCAQKNKPGIYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cationic trypsin
publication title Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
pubmed doi rcsb
source organism Bos taurus
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2010-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3pwbA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3pwbA02
2BY6X 2FEQH 2G52A 4FUHA 4J1YA 4JYVH 8LPRA 4IS5A 1O2MA 4Y76A 2FS8A 1TRNA 5JDUB 3EAJA 3BN9A 5TCAA 1NY22 1SGTA 1V2RT 1JMOH 1LCYA 1V2LT 3PLPA 1KYNA 1P11E 5EPNA 3S7KB 1BDAA 4B1TA 2HVXA 2QYIA 1TOMH 4ABDA 2BDYA 1C5QA 4DY7B 1RTKA 1UVTH 3SORA 1H1BA 5B6OA 3URCA 1S85A 2BY9X 5DKMA 1QA0A 1ANBA 2F9UA 2TGTA 5DP4A 2FLBH 3B9FH 1YLCA 2EI7A 3MI4A 1DANH 1V2ST 3ENSB 2VNTA 2WPMS 4U01A 1XUHA 2BDHA 1XUIA 1O0DH 4ZHMU 2P16A 1ETTH 1C2HA 3GICB 1ZHRA 2VIDA 3GCOA 1O3IA 5FBIA 1MQ6A 3VB3A 1O3KA 2ZFTA 3QLPH 3A80A 4A5TS 4DT7B 1EQ9A 2AEIH 1EKBB 3RXLA 1GGDC 2ASUB 1HCGA 2ZTZA 1BRBE 2HNTE 4NFEA 3LDXH 4X1SU 2CXVA 4BANB 1ARBA 3SUEA 4YOJA 1O3DA 3KGPA 4WH8A 1MTWA 2ZQ1A 4A92A 2ZDKA 1GWAA 2XCNA 2UUKB 5HMAA 6CHAC 1CGHA 3SHCH 4K8BA 1FPCH 2WYGA 1NT1A 4I32A 4BAOB 3LOXA 4YLQH 4YLUA 1UVSH 2ZU1A 3B23B 3RXAA 1QY6A 3UWJH 4E05H 1C2GA 2C8YB 3SN8A 2TIOA 4YT6H 4CREA 4ABGA 2ZGCA 4YOGA 1GJ5H 1TRYA 5EOKA 3FFGA 1A0JA 1O2LA 1SGPE 2BLOA 1O2OA 1VITH 1TGTA 5HM9A 3K6YA 4GUXA 3E91A 1ELTA 1ZPZA 1IOEA 1TMBH 2C4FH 2VJ1A 2XXLA 3QGNB 1TYNA 5C5OA 4XFQA 2A5KA 1O3FA 3V13A 1A7SA 1T8OA 3ZVBA 2ILNA 1K21H 4JK5A 2ZTXA 3NXPA 4X2YA 3MU0A 1O3GA 1A3EH 5HM2A 3GY7A 3TITA 1GMHG 4D9RA 4OS7A 5C1YA 1L2EA 3NWUA 1EASA 2XWAA 1C2MA 1KXCA 3U98H 4H4FA 5LH8A 3LU9B 3ODDA 1YPGH 3P70B 1O2NA 2QAAA 4YTAA 2NWNA 3ZZ7A 2SNWA 2WPJS 2OTVA 2JETC 3KIDU 5JB9S 1Z8IB 2ZO3H 5DP7A 2J2UA 2Z9JA 5EXLA 3OY5U 5GWZA 1TWXB 2QIQA 3PMJA 3MFJA 3DA9B 1TALA 1OXGA 1CQQA 4X6MA 1SGIB 3AASA 4X1NU 1ZJKA 3A85A 1Q31A 4XOJA 5E8EH 3GY3A 6LPRA 2XC4A 2P93A 5A0BA 2ZU3A 2BD3A 7KMEH 6GCHF 2ZCLP 4AFZA 2B9LA 4HFPB 1C2JA 1ELAA 1OWKA 2BXUH 5LPRA 2BVXH 1AUTC 1NFWA 4AFQA 3P92A 3SNEA 4YZUA 1TNJA 1AN1E 3VB5A 3SV7A 3KEEA 3LGUA 2FX6A 2JKHA 3SV8A 2DE9A 3PTNA 1CA0B 1AGJA 5EQRA 3ODFA 4CR9A 2QXJA 3MO9A 4NSVA 1C2FA 3A86A 2ZCKP 1SBWA 2AS9A 2R0LA 1H8IH 1GBMA 2FOEA 1GVZA 2VVVA 4BXSA 4YM9A 5C1XA 3OU0A 4WF8A 1DDJA 1SPJA 1DICA 2BD2A 5A09A 3M5MA 1FAKH 1BBRK 1INCA 2J95A 3RXGA 1MAYA 2P3TB 5EODA 1N8OB 4SGAE 1XVOA 1EX3A 1AFEH 1GG6B 4O03A 3RXBA 1NU7B 5G4BA 3D62A 1LQDB 1GHYH 1GDQA 1P05A 2CV3A 2FP7B 5K0HA 2OD3B 2FXRA 2NU3E 3EQ0H 1EAUA 1V2OT 1P3EA 3ZZ6A 4ABAA 1GMDF 3MNBA 1K9OE 2J94A 1LPGB 3A8AA 4Y10E 2ZQ2A 3ESTA 3A83A 1DT2A 2I6SA 1O5DH 1SR5C 3F9FA 4Y7BA 3QDZB 2ZDLA 1C1PA 1GCTB 1RIWC 1YC0A 1AWFH 4I7YH 1S6HA 2PKSC 4JZFH 1C5SA 4ESTE 2W3IA 2V35A 1H4WA 1AO5A 2WPKS 1GBHA 3BEFB 5BPEA 1O2IA 1T32A 5GJ4B 3STJA 4Y71A 4DG4A 1YCPH 3RXJA 1C1SA 2GCHF 3ZVGA 1C5YB 3A7WA 1BQYA 3RM2H 3S7HB 2QA9E 3TGKE 4WMFA 4E7RG 4UDWH 4TPYA 1ZJDA 2OC8A 1O3BA 2WV5A 1MCVA 1O2VA 4Y6DA 3SZNA 1DUAA 2STBE 1SGRE 3TJUA 3LONA 5FX5A 1C5ZB 2Z6BD 4H42U 5DP9A 5GPIB 4YESB 3LGTA 1AB9C 1PPEE 1UHBA 3DUXH 2PKAA 2ODPA 2P3FH 1P2KA 1CO7E 1C1OA 2HPQH 2Z3CA 1GDNA 1ZSJA 2AH4X 2ZI2H 1K1OA 1QB9A 1SLVB 1O2ZA 1CHGA 1EP5A 1D9IA 1GGDB 1Z8JB 1MZAA 2BDCA 5EQQA 1C2DA 3F9GA 4FVBA 1HJAC 1P2MA 2BLVA 1J16A 3L3TA 3I78A 2H1UA 1THPB 1GI0A 1P9SA 2ZCHP 3O8DA 6CHAB 1OX1A 3A89A 1G3CA 3GDSA 3L6PA 2WPLS 2A7JA 3ATKA 1ZYOA 1UVUH 3M61U 1GJ7B 1OSSA 1QJ6B 1CT4E 2NU4E 1GMCF 3CS7A 3T27A 1KTSB 1YPMH 1DITH 2O8LA 4BNRA 4Q7ZA 1C5XB 3KL6A 4I8GA 3A7XA 3OY6U 4MNVA 4X6OA 1SHYA 1C5LH 5GCHF 2ZGBH 1C1QA 2BLQA 2PW8H 3PM3A 1O39A 3QZRA 1FIWA 4NZQA 1EZXC 2R3UA 2ZTYA 3C1KA 1O2WA 4GAWA 1EZUC 1KXEA 1QURH 3ATWA 1ANDA 1A4WH 3A82A 4R0IA 4BXWA 1BMMH 2NU0E 2Q1JA 4X0WU 3K6ZA 4CR5A 1F2SE 2BTCE 2TPIZ 3SJOA 1DY9A 3U8RH 1ELDE 2H9HA 1G36A 4AG1A 3GDVA 2J9NA 4MDSA 4X2VA 1SQAA 1BJVA 1HFDA 3M3VA 5E0GA 2QC2A 2WPHS 3Q3KA 1L0ZA 2JETB 1O2JA 1ELBA 1MTVA 1FY1A 2OC0A 2ZPRA 1BITA 2Q6DA 1ESTA 2A5AA 4FUGA 4Y11E 3RXKA 1QL7A 3AAUA 1NFXA 1EATA 2A4OA 5T6GA 1SVPA 5EGMA 5ESBA 3UR9A 1L4DA 5DG6A 1O31A 1FONA 2OXSA 1V2UT 1AWHB 1P2OA 1P8VC 1OS8A 1V2PT 2FI4E 4LOYH 1ELFA 1MH0A 3M3TA 1LVYA 4JZEH 1AY6H 1HYLA 2AERH 2QF0A 4YO9A 1EPTA 1TQ0B 4BTIB 3SV6A 1HUTH 3UTUH 3LGVA 1ELCA 3MOCA 4H6TA 1SSXA 1JRSA 3UIRA 2PSXA 1O5CB 3TK5A 1C5TA 1GHVH 1WSSH 2G81E 2ZC9H 2W3KA 1F5KU 1PPZA 3BV9B 3SU2A 1UCYE 5I25A 4XSKU 1SGNE 1HAIH 2UWOA 4ZHAA 1WUNH 2R9PA 3MNXA 1O2YA 4IC6A 4ZKSU 3SJIA 1C9PA 4J2YB 2GD4B 1G9IE 2A4QA 1EAXA 3PO1C 4NG9H 2H9EH 5JYIA 1C1TA 1YGCH 3TK9A 1O3LA 1QR3E 3KQBA 4TWWA 4ZMAH 4FUIA 1IQJA 1HGTH 3ATMA 3LJOA 1KLJH 2GGVB 4UONA 4E06H 3VGCC 2BOKA 4GVUA 1W3CA 1W12U 2PV9B 3VB4A 3SW2B 1PJPA 4GLYA 1LHEH 3V0XA 3RXIA 1TABE 3SNAA 3ZYEA 3HGNA 1BTHH 1EAIA 2Y82A 4AN7A 4JYTA 3AAVA 1YLDA 2WINI 2R2WU 2FOCA 2G00A 2PGQB 1KXFA 2ZP0H 1ID5H 5FCKA 2P3UB 2PUQH 3SGBE 1RIWB 4LZ4B 5L6NH 2PKSB 3SU0A 1P01A 3P8FA 4Y8XA 4KKDA 1TNLA 1HPGA 2XBVA 2Z3EA 1OYQA 1UTQA 1ELVA 1SGEE 1T7CA 3ATLA 1AI8H 1QFKH 1TPAE 3QWCH 1N6YA 1FJSA 3LT3A 3EDXB 2XW9A 8ESTE 1NZQH 3UPEA 4ZH8A 2J34A 2FIRH 4DOQA 1TPOA 5FCRA 3F1SB 1XKBC 1C5OH 3BTFE 1ORFA 2P95A 3RXUA 3MMGA 3E8LA 1D6WA 2TGAA 3BF6H 4MQAA 2A2QH 1GL1A 2GX4A 1HB0B 2CGAA 2ZZUH 1AB9B 1Z6JH 1CHOF 1HAZB 4FUEA 4NSYA 3ZVDA 1JWTA 2BY5X 1GBJA 1YPHC 2H5DA 2ZHFH 1E34B 3M37A 3ZZCA 5DK1A 3RXFA 2VWNA 3F68H 1QJ7B 3BIUH 1DSUA 1N8OC 3A8BA 5AFZH 1JIRA 3UREA 1HV7A 3HK3B 4ISNA 1S5SA 1QHRB 1DX5M 4RKJB 1P57B 1W11U 2V0BA 1UJ1A 5C2ZA 3RMLH 3PWCA 1A3BH 1V6DA 4D76A 4BAMB 2B5TB 4KGAA 1P03A 1HJAB 2WUBA 3SJ9A 1ETRH 1NRSH 4D9QA 1H9LB 1ABJH 2VWLA 2ZKSA 1A61H 3LGYA 3TH3H 1K2I1 4TWYA 1PPBH 4OS2A 2Z9GA 1C1VH 1C1NA 2ALVA 3BTKE 2KAIA 2BD9A 2HPPH 3BG8A 3MNCA 2Z7FE 1SG8B 2O8TA 1CGIE 1TIOA 1JOUB 1RFNA 4UFGH 1V2KT 2FO9A 2FTMA 1B7XB 1NRQH 2O8MA 1WYKA 1EZSC 3IG6B 3BIVH 3RXSA 1AQ7A 1SC8U 1YKTA 2I6QA 3D65E 1FI8A 1GVLA 3M5OA 1XM1A 1ZRKA 1YPKH 2XTTB 3V3MA 5E0HA 1EZQA 3H7TA 1HJ9A 4AB9A 2ZFQH 3ZVCA 3EA7A 2AIQA 1IQHA 1BB0B 4ISLA 5TCCA 2ANYA 4FVDA 1BTWA 1NO9H 3T25A 2SGPE 3UFAA 2QXGA 1O30A 2BY7X 1EAWA 5IYTA 3PYHA 1A0HB 3SU3A 1G37A 3C27B 3LH3A 1WV7H 3SV2H 3Q3YA 1E0FD 5JB8S 1IAUA 3RU4T 1ZPCA 1CE5A 3KHVA 4TY6A 2Y5FA 3RXPA 1ANEA 1UMAH 3U9AH 3E0NB 4AZ2B 4ZXXH 1O2TA 3ZV9A 4GPGA 1YPLH 1GJAB 1FN8A 1V2QT 3O8RA 2QN5T 3E6PH 1PPHE 1HRTH 5C67A 4K3JA 1TB6H 2VIPA 2ZHEH 1OP2A 1TPPA 1A5HA 4HGCA 1KXDA 4XBDA 5E0JA 3EYDA 4K8YA 2GV6A 2D1JA 1TMUH 1G2MA 5IDKA 4IMZA 3KNXA 3PLKA 1DFPA 3T26A 4X6NA 1DPOA 2VU8E 1FUJA 1S81A 1BTZA 1XUFA 1W13U 3RXCA 6GCHG 3SQHE 1TBZH 3K9XB 3O8CA 2LPRA 2BD4A 1SOZA 5EPYA 3GYLB 1SGQE 4VGCC 1KLTA 3S9BA 2ANKH 4FU9A 4UFEH 5ESTE 3RMOH 1UTOA 1OP8A 3RXDA 1IQMA 3OSYA 3SU6A 1C5RA 1LMWB 3TIUA 3F9HA 5EXMA 3VEQB 1SGFG 3T2NA 4OS5A 1VCWA 4Z0KA 4AG2A 3MH6A 4FUJA 3RMNH 3PO1B 3BTME 2YNBA 1RTLA 1O3OA 1Y5UT 4X2WA 1G3DA 2GMTC 1GVKB 1SQTA 3ZZDA 1LVBA 2VWOA 1G3EA 3TU7H 5F03A 2ZDAH 1Z8RA 2FESH 3VGCB 1Q2WA 1Y3UA 2EEKA 3UUZA 2UUJB 1MMJN 1QA7A 2F9VA 3M5LA 1PYTD 4D8NA 2BQ6B 1H9IE 1YCPK 2GV7A 2UWLA 1K1LA 1BTYA 4MPWA 3UY9A 5LGOA 1YYY1 3RXEA 3Q3XA 4AX9H 4ZROA 4OS6A 3V12A 4XE4A 1ELEE 3M35A 1ZR0A 1LVMA 4K60A 1W2KH 5JBCS 1GMDG 2A4RA 1LHCH 3NUMA 3IWMA 1GI4A 3U1IB 1ACBE 1BA8B 1BOQA 1RS0A 1VZQH 5AHGH 2FMJA 5J4SA 5GIBA 2G5VA 2QXHA 2FTLE 3GY4A 1IQIA 1EXFA 4XBCA 1VJ9U 1QB1A 3H7OA 1C2KA 1GI7B 3KF2A 3RMMH 3BTGE 2ZGJA 1XX9A 1MAXA 4FUDA 4JCNA 3U1JB 1XMNB 2DE8A 2ZU2A 3KQCA 3LGWA 1O38A 1BMNH 1AIXH 2PLXA 1TNGA 4CRCA 2GCHG 4KTCA 1BIOA 2FODA 2Y7XA 1DUEA 3A7YA 1FNIA 1UK2A 1YM0A 5A0AE 3W95A 1AKSB 4QT8C 1C5PA 2SGDE 4ZXYH 1D3DB 1AZ8A 1O33A 4BTUB 3SJ8A 1WAYB 1PQ8A 4MNXA 1LHFH 5A8XA 1MD7A 4DW2U 1GHWH 3LH1A 2HOBA 3RC4A 1HAVA 2LNCA 2Z3DA 3GCTF 4WXIA 1O2QA 2A0QB 2BDIA 4LK4A 1ZLRA 2GKVE 4MG3A 1BHXF 1HDTH 3U69H 2FS9A 1C1RA 1A5IA 1O3JA 2B8OH 3LPRA 1P02A 2VB0A 1GCDA 1XXFA 1B5GH 1GHBF 4IC5A 4IMQA 1AZZA 2VGCB 1C2LA 1QRZA 4NIVA 5DGJA 1FY5A 1FXYA 4U32A 1K22H 1O32A 1V2VT 4XDEA 1YPEH 4KELA 1L1NA 3QTVH 3KCGH 1PFXC 4NA7A 7GCHF 1SL3A 3P8NA 3AW0A 4ABBA 4AB8A 1GI5A 3MU1A 4IW4E 1FDPA 3ZV8A 1FN6A 1XVMA 1OWIA 4LXBH 4ASHA 4F4OC 2BB4A 4HZHA 1PQAA 3BEUA 1GMCG 2GVFA 3SQEE 4WWYA 5K7RA 2ULLA 1O36A 1N1LA 1P3CA 1SOTA 1BMAA 4I8LA 1MTNC 2VIVA 3DFJA 3ZVAA 3PB1E 4A1TA 5GCHG 2O9QA 4FUBA 1HAXB 3N7OA 1FMGA 1GBIA 1BMLA 3NK8A 2SGQE 4I8KA 1WTGH 3F9EA 1RTFB 3MH5A 4ISIH 1NC6A 1C2IA 2ZGXH 1DVAH 2UUYA 2PHBA 1P2IA 3E1XB 1SGFA 5ETXA 3PV4A 3GY2A 4B2AA 5JBTA 5DPAA 2THFB 2ZFRH 1MU8B 4BAQB 1QIXB 3RXOA 1J8AA 4FUFA 1V2TT 1LKAA 2F91A 1GBAA 2Y80A 5BRRE 2WV4A 4U30A 1T8MA 5EQSA 1TE0A 5FPTA 1YPJH 2Z9LA 4FXGH 8KME2 4OGXA 3JZ1B 2ZHWH 1NTPA 2TBSA 2NU1E 1UCYH 4MPVA 2OQUA 1S0RA 1GBLA 2BX3A 3QGJA 4X1PU 4B71A 1TGSZ 4AYYB 3HATH 3KQDA 2PSYA 2BVRH 5LPEA 1YP9A 3RXRA 4DIHH 2QCYA 4X2XA 1GBBA 1W0YH 2ZF0H 4IBLH 1NPMA 1MQ5A 2D8WA 3QN7A 1S84A 1ZMLA 3GYMA 3BTTE 2BXTH 4MPUA 4MVNA 1TGBA 1SGDE 4UD9H 2JH6D 4VGCB 1IQEA 4JZIA 2PTCE 4B2BA 4TY7A 3ZYDA 1C5VA 1F0RA 1O3MA 1TMTH 2BZ6H 4KTUA 4E7NA 2GZ9A 4BOHA 1GJDB 1MBMA 3GDUA 3TNSA 2ZDNA 3TGJE 1KXAA 5A2MH 1V2NT 1GHAF 2BDGA 2ZIQH 3PWBA 1C1MA 1GBDA 1MCTA 2FI3E 1FY4A 3FVFB 1BRUP 1NN6A 4JK6A 1UTPA 2GMTB 2FWWA 3HKJB 4H6SB 3SUFA 1KDQA 5A0CA 1C5MD 1EPTC 3UWIA 5CE1A 3MWIU 5FAHA 2RG3A 1DY8A 1NS3A 5JBBS 1HAYB 1NFUA 1RJXB 3SNDA 4A6LA 1V2JT 4CH8B 3LKWA 4I31A 3SOSA 2D26C 4X8SH 1NROH 2CJIA 9LPRA 2VIQA 2BDBA 1C2EA 4A1VA 4CHAC 1CBWC 3S9CA 1FY8E 1WBGB 2Z94A 1OPHB 1K28D 3K65B 1A1RA 1DWCH 2BZAA 4IGDA 1MKWH 1GJ9B 3S69A 1IQFA 2B7DH 1GJBB 1P06A 2ZU5A 2TGDA 1O3PB 3QUMP 5J4QA 1O2GH 3GY8A 2A2XH 2J92A 3A84A 1NU9A 1F5LA 1GJ8B 2A31A 5DP6A 4CRAA 2G55A 3JZ2B 3TJVA 4X1RU 4INLA 1SFQB 3ATIA 4AFSA 1E36B 4O9VA 2ZHDA 1NM6A 3SO3A 3QO6A 3ELAH 4UFDH 4NFFA 3M5NA 3P6ZB 1O2RA 2F83A 4NA8A 1QQ4A 3LGIA 2UWPA 2ZECA 1LDTT 3FP6E 2SGAA 1P9UA 4INKA 1TPSA 1BBRE 1E38B 1Z6EA 2F3CE 4MTBA 1CHOG 1C5UA 3ZZ4A 3TJNA 1LO6A 2AGGX 2BD5A 3BTEE 3MH7A 4NCYA 4DURA 4HI3A 1F92A 2GZ7A 3PROA 1Y59T 3LC5A 1O34A 2BD7A 3R3GB 1HJ8A 3FAOA 2SGFE 3M7TA 3RXVA 1DWBH 1SQOA 1C4Y2 3TGIE 1A0LA 1J15A 1OKXA 1QTFA 3RXHA 2G4UA 8GCHF 4NGAH 5CMXH 2C8XB 2ESTE 1RD3B 2NU2E 2C8ZB 4OGYA 1SLWB 4X8VH 5FBEA 3UOPA 1UHBB 2PKAB 1O2XA 5FPYA 3URDA 2A4GA 2HNTC 2VWMA 1F0SA 2XWBI 2IPHA 1Z7KA 3MO3A 1VGCC 2F9OA 3SHAH 1ZMJA 1GJCB 3FP7E 4O3TA 2G8TA 7LPRA 1AVWA 1LPZB 2Z9IA 1GI2A 1W14U 1MTNB 2VINA 3HPTB 2ZNKH 1SHHB 2WUCA 1Y3YA 4B73A 1OWDA 5FPSA 1EB2A 1TNKA 1MZDA 2VVCA 3GY6A 5H4IB 1EOJA 2IN2A 3BTWE 2Y5GA 1J17T 1D3PB 1T8NA 2V3HH 1XXDA 1KIGH 1GDUA 4O97A 3MU8A 4NIWA 2F9PA 3M3SA 3MU4A 1FQ3A 3GCNA 1Y8TA 3R0FA 4FUCA 3BTHE 1NRRH 3SGQE 5EU8A 2A7HA 4Y7AA 1IQGA 1C5NH 1WTHD 1LHDH 1J9CH 4Q7XA 1GJ6A 2VGCC 2PUXB 2QF3A 1UK3A 1FLEE 3E16B 1OYTH 4X8UH 3MYWA 1TX8A 4JZDH 2G5NA 2TGPZ 4NZLA 2GP9B 2XCFA 1W7XH 1D3QB 3GCHC 4DIIH 1GJ4H 2ANMH 1W8BH 2W7UA 1ZOMA 4JYUH 4AGKA 2VH6A 4RSPA 1MU6B 1O3NA 3VPKA 1CT0E 2BQ7B 1GBKA 4MNYA 4CH2B 3HGPA 1XUGA 1ZTLA 1HAOH 2QV1A 3FANA 2OINA 1DE7H 1QL8A 1DXPA 3MU5A 5A8YA 1ELGA 3T62A 2XC5A 2FDAA 3M36A 1WQSA 3ZZ3A 1VITF 1YF4A 1Y5AT 2C3SA 3A8DA 3E0PB 1T4VH 3OX7U 3S9AA 1O3HA 3TLOA 2AFQB 4AFUA 4TPIZ 2A7CA 4K1EA 1HIAA 1G30B 2OBOA 4Q80A 3ZZ9A 2R0KA 1ZGIA 1AMHA 1DXWA 4IN2A 4LZ1H 2XBYA 4WMDA 2ZFSA 1CU1A 5F8ZA 1AD8H 3Q77A 1Y5BT 1JXPA 3RXQA 1EPTB 3Q00A 3EGKH 5FX6A 2PGBB 4DGJA 1D4PB 2YNAA 1DWDH 1TGNA 1F5RA 1GPZA 1O3EA 4Y0YE 3PLBA 2TRMA 4CBNA 1SB1H 2IJOB 3M7UA 4B75A 3PMAB 3RP2A 2B0FA 1LVOA 1FPHH 4CHAB 2GCTC 1CBWB 2Y81A 3UQVA 3Q76A 2EI8A 4GHQA 3B8JA 3ZZBA 1T31A 1D3TB 2HALA 2RA3A 4ZKNU 1CGJE 1AE5A 2GT7A 3TVJB 1QBNA 1ABIH 2XYAA 2HGTH 1GBEA 1K1NA 1S0QA 1W7GH 1XUJA 4KTSA 1HBTH 1MKXH 1ZGVA 3TH2H 1OP0A 1BTPA 3SI4H 1ZTJA 5I46H 5ABWA 1HAGE 4B2CA 4X8TH 2AIPA 1FAXA 2ZDVH 4GSOA 1L1JA 2J38A 2ZFFH 6ESTA 7ESTE 4R8TB 3QTOH 1C5WB 1C4U2 2OCVB 1IQNA 1CT2E 5GDSH 1YPHE 2Q6GA 5C20A 1MUEB 3M7QA 2FZZA 4M7GA 2AMPA 3OTJE 3LJJA 2PTNA 5C1UA 2Q6FA 3RDZA 1XUKA 5L2YH 1EUFA 3AW1A 1LHGH 4WY3A 1FZZA 4CRDA 2BLWA 3P8GA 4ISHH 1LKBA 1E35B 3H5CB 1DS2E 5F8XA 4ABJA 2YOLA 1Z71A 1JRTA 1CA8B 1Y3WA 2D2DA 1K1PA 1KTTB 2V6NA 4ZUHA 2UUFB 1NESE 4MNWA 1NRPH 5EXNA 3RXTA 3GOVB 1DLEA 3GCTG 1WOFA 2ZPSA 2CHAC 3P95A 1P2QA 5AFYH 4AORA 2BMGB 1GHBG 1SLUB 1G2LA 1Q3XA 1THSH 1M9UA 3PMBB 3DFLA 3S0NA 1TBRH 3P17H 3VXEH 4CBOA 1EB1H 2RA0A 3FZZA 4YT7H 2H5CA 3EA8A 1VGCB 2P8OC 3NPSA 4I8JA 1QJ1B 2FYQA 7GCHG 3UQOA 3FP8E 2OLGA 5AF9H 3CS0A 5C5NA 2XC0A 4UE7H 3P8OA 1VR1H 3FZDA 1EOLA 1TX7A 1GI1A 1ESBA 2OUAA 1AFQC 1HXFH 2VIOA 5JBAS 1GL0E 1O2UA 2IOTA 1GI3A 2KAIB 2Z9KA 2ANWA 2FOGA 2ALPA 1A46H 1GMHF 1HNEE 1UCYK 1P10A 4AOQA 3RC5A 1SI5H 2PFEA 5CHAC 1DLKB 2H2ZA 1O2KA 1BJUA 3BG4C 1TLDA 4CRFA 2P94A 4D7FA 2V3OH 2OQ5A 4TYDA 4K5ZA 1O5GH 1K1IA 5DP3A 3SU1A 3NCLA 2VVUA 5SGAE 3VB6A 4D7GA 2WYJA 4K2YA 1VJAU 1EJAA 1OWEA 5GXPA 1UTNA 1ESAA 4O3UA 3HK6B 1AU8A 2EC9H 4I8HA 5EW2H 1UO6A 2STAE 5A8ZA 2J4IA 1DSTA 1P0SH 1ZHMA 1B0FA 1QNJA 1B0EA 1GI9B 2C93B 3ZZAA 2XRCA 2WPIS 1N6XA 2CMYA 2RDLA 3GCHB 4ABIA 4BAHB 1GI6A 2DUCA 2XBXA 3SUGA 3SGAE 1HIAB 4ZKOU 2F9BH 1WQVH 3LIWA 5E2PA 1P2JA 3IITA 2Y6TA 1IHSH 1O3CA 2AYWA 1T4UH 4ABHA 3CP7A 1UTMA 3PMHB 1ARCA 2FX4A 4DJZB 2P59A 1RXPA 1U6QA 2BX4A 1UK4A 1PYTC 3RM0H 2XNIA 4GCHG 2ZG0H 3L33A 1C1UH 1SGYE 3TPIZ 2H9TH 1MTUA 2ZHQH 4AGJA 3GISB 3RU4E 4K69A 1G32B 1BRAA 4X6PA 3PTBA 3QX5H 5EW1H 4OS4A 4AYVB 3A88A 2VH0A 3V7TA 4ABEA 3HKIB 2HWLB 1L1GA 1YCPM 3TJOA 2AGEX 5F8TA 1QBOA 1GHAG 4MLFB 4JMYA 1MKWK 3UR6A 3SU4A 1T8LA 2QXIA 3W94A 5DO4H 1P09A 3I77A 3ZVFA 4Y0ZE 1G3BA 1KSNA 1VCPA 3RLYH 5JPMH 1HXEH 1DWEH 1HLTH 2OP9A 3TK6A 1ZHPA 2GCTB 1O2SA 3T5FH 1UVPA 2EI6A 4A7IB 3DD2H 2GDEH 1OWHA 2HLCA 5HYOA 1GBCA 4RKOB 2C90B 1V2WT 5AVDA 2PR3A 1IQLA 1BTUA 1F0UA 1GI8B 1X7AC 2ZU4A 4U2WA 3STIA 2FYRA 4GCHF 3SNBA 2EA3A 1NFYA 4BAKB 5C3NA 2BVSH 1JIMA 1XKAC 2OBQA 4MPXA 4GHTA 3UNQA 1BUIA 4DVAU 3I29A 4Z6AH 1RGQA 1P2NA 1TOCB 3MNSA 1BBRH 1F0TA 1O2PA 1KLIH 3UOUA 4XBBA 1YBWA 1IHTH 1EJMA 1O2HA 1C1WH 2QGRA 3SU5A 2BHGA 1BRCE 3RXMA 1FV9A 2FOFA 3AVZA 2C8WB 3A8CA 1PQ7A 1P12E 3SI3H 4Y8ZA 1UVOA 1GBTA 3DHKH 2Y7ZA 1PPCE 4NIXA 4B76A 3MHWU 1GBFA 5T3HA 4ZHLU 1GHZA 1S6FA 4THNH 4WMEA 2ZFPH 2FLRH 3NKKA 5FHTA 3NZIA 2R3YA 5T6DA 1QRXA 2A45B 1TA6A 1Z1JA 3VXFH 1C4V2 1O3AA 3D49H 3SBKA 1TBQH 2OC7A 4WH6A 2BOHB 2JH0D 2PWXA 3WY8A 3GY5A 1H9HE 5T6FA 5EG4A 3SV9A 2AMQA 1ANCA 2FPZA 2A32A 1TQ7B 3DT0H 1C9TA 1TGCA 4Q2KA 3F6UH 2M5TA 2ZEBA 2CHAB 2FOAA 2G51A 1QBVH 1NRNH 4DCDA 5L2ZH 3EA9A 5L30H 4Q7YA 2QY0B 4F49A 2FI5E 1E37B 1BT7A 2H6MA 3VFEA 1HAPH 1SLXB 3O8BA 8GCHG 2P8OB 2A5IA 3BTDE 1W0ZU 1HAHH 1O35A 2SGEE 1K1MA 4UEHH 5DP8A 1DM4B 4CRBA 2AGIX 1LQEA 4RN6A 1SMFE 1HAVB 1P04A 3E90B 2CF8H 2W5EA 3TNTA 2FOHA 1Z1IA 1AFQB 4OS1A 1TNHA 5DP5A 1QQUA 3CENA 1ZZZA 4K1TA 4KP0A 1AHTH 1ZSLA 5HGGA 2RCEA 2ZPQA 5E2OA 2Y5HA 1AUJA 2HNTF 2SFAA 3VB7A 3TH4H 2BD8A 4Y8YA 3BSQA 4SGBE 1OWJA 2AMDA 1KXBA 5HXFA 2G4TA 9ESTA 5CHAB 3BG4B 1FY3A 3LC3A 1CVWH 1TONA 4JZ1A 4YOIA 4INHA 1UTJA 2A1DB 1QGFA 4NIYA 2OC1A 1SGCA 2FOMB 2GT8A 1THRH 1AVXA 4ABFA 3UNSA 4PROA 1O5BB 2F9NA 1TNIA 4NWKA 4K1SA 3RUOA 1SFIA 1TRMA 1ZRBA 4ZAEA 1PPGE 3A7TA 2ZGHA 1A2CH 1O5AB 1TA2A 3MTYA 3SNCA 4A1XA 3UNRA 1F7ZA 4X1QU 2JH5D 1D6RA 2BQWB 2O8UA 1BZXE 4WVPE 1UTLM 1VCQA 1RRKA 1ZSKA 1MBQA 1KY9A 3A87A 1TAWA 5PTPA 1OOKB 1GHXH 1ZMNA 3EE0B 3QZQA 5FXLA 2W7SA 1IQKA 1EP6A 3ZVEA 1LTOA 4Y79A 3RC6A 2FOBA 4UFFH 2SNVA 4CRGA 3BEIB 3RLWH 1JBUH 3D23A 1O5FH 3KN2A 5DJ7A 1H8DH 3K2UA 4ISOA 2ODQA 1AE8H 4NA9H 1UTKA 4FU8A 4IN1A 1CA0C 3ITIA 1VITG 3A7ZA 1AVGH 1WCZA 3OYPA 1QRWA 2BY8X 2ZWLH 3U8OH 1TFXA 2ZA5A 1QCPA 2VIWA 1BHXB 3ZZ8A 1BCUH 1PQ5A 3E3TA 2R2MB 4NWLA 3MH4A 1CSOE 4B74A 2CF9H 1S82A 2XBWA 2BDAA 4ZKRU 5TJXA 1MKXK 1FIZA 2O8WA 1DOJA 3QK1A 3SUDA 1PPFE 3KQEA 1TX6A 1O5EH 4WXVA 5F6MA 1GG6C 1O37A 1MD8A 1S83A 1K1JA 1Z8GA 3MO6A 1LPKB 2HRVA 2K1QA 2CN0H 4I33A 2FM2A 3A7VA 1V2MT 4BTTB 1W10U 1Y3VA 1MTSA 1L4ZA 1J14A 1ETSH 2GTBA 1V3XA 1WU1A 3G01A 2BM2A 2ODYB 3BTQE 4FU7A 3T29A 5LPFA 2GZ8A 1ZPBA 2GDDA 1BTXA 1KDQB 2ZDMA 3SJKA 1A5GH 1AKSA 4WJG2 3RU4D 1GCTC 3ZZ5A 1EJNA 4HTCH 1QL9A 2BYAX 3A81A 2W26A 1ZTKA 3U8TH 1QB6A 1Y3XA 3T28A
chains in the Genus database with same CATH superfamily
2BY6X 2FEQH 2G52A 4FUHA 4J1YA 4JYVH 8LPRA 4IS5A 1O2MA 4Y76A 2FS8A 1TRNA 5JDUB 3EAJA 3BN9A 5TCAA 1NY22 1SGTA 1V2RT 1JMOH 1LCYA 1V2LT 3PLPA 1KYNA 1P11E 5EPNA 3S7KB 1BDAA 4B1TA 2HVXA 2QYIA 1TOMH 4ABDA 2BDYA 1C5QA 4DY7B 1RTKA 1UVTH 3SORA 1H1BA 5B6OA 1H8ED 3URCA 1S85A 2BY9X 2M2AA 5DKMA 1QA0A 1ANBA 2F9UA 2TGTA 5DP4A 2FLBH 3B9FH 1YLCA 2EI7A 3MI4A 1DANH 1V2ST 3ENSB 2VNTA 2WPMS 4U01A 1XUHA 2BDHA 1XUIA 1O0DH 4ZHMU 2P16A 1ETTH 1C2HA 3GICB 1ZHRA 2VIDA 3GCOA 1O3IA 5FBIA 1MQ6A 3VB3A 1O3KA 2ZFTA 3QLPH 3A80A 4A5TS 4DT7B 1EFRD 1EQ9A 2AEIH 1EKBB 3DSPA 3RXLA 3KYGA 2EQNA 1GGDC 2ASUB 1HCGA 2ZTZA 1BRBE 3UAIC 2HNTE 4NFEA 3LDXH 4X1SU 2CXVA 4BANB 1ARBA 3SUEA 4YOJA 1O3DA 4ZCNA 3KGPA 4WH8A 1MTWA 2ZQ1A 4A92A 2ZDKA 1GWAA 2XCNA 2UUKB 5HMAA 6CHAC 1CGHA 3SHCH 4K8BA 1FPCH 2IPQX 1NT1A 2WYGA 4I32A 4BAOB 3LOXA 4YLQH 4YLUA 1UVSH 2ZU1A 3B23B 3RXAA 1QY6A 3UWJH 4E05H 1C2GA 2C8YB 3SN8A 2TIOA 4YT6H 4CREA 4ABGA 2WSSD 2ZGCA 4YOGA 1GJ5H 1TRYA 5EOKA 3FFGA 1A0JA 1O2LA 1SGPE 2BLOA 1O2OA 1VITH 1TGTA 5HM9A 3K6YA 4GUXA 3E91A 1ELTA 1ZPZA 1IOEA 1TMBH 2C4FH 2VJ1A 2XXLA 3QGNB 1TYNA 5C5OA 4XFQA 2A5KA 1O3FA 3V13A 1A7SA 1T8OA 3ZVBA 2ILNA 1K21H 4JK5A 2ZTXA 3NXPA 4X2YA 3MU0A 1O3GA 1A3EH 5HM2A 2AHME 3GY7A 3TITA 1GMHG 4D9RA 4OS7A 5C1YA 1L2EA 3NWUA 3FOAA 1EASA 2XWAA 1C2MA 1KXCA 3U98H 4H4FA 5LH8A 3LU9B 3ODDA 1YPGH 3P70B 1O2NA 2QAAA 4YTAA 2NWNA 3ZZ7A 2SNWA 2WPJS 2OTVA 2JETC 3KIDU 5JB9S 1Z8IB 2ZO3H 5DP7A 2J2UA 2Z9JA 5EXLA 3OY5U 5GWZA 1TWXB 2QIQA 3PMJA 3MFJA 2K0QA 3DA9B 1TALA 1OXGA 1CQQA 4X6MA 1SGIB 3AASA 4X1NU 1ZJKA 3A85A 1Q31A 4XOJA 5E8EH 3GY3A 6LPRA 2XC4A 2P93A 5A0BA 2ZU3A 2BD3A 7KMEH 6GCHF 2ZCLP 4AFZA 5FL7D 2B9LA 4HFPB 1C2JA 1ELAA 1OWKA 2BXUH 5LPRA 2BVXH 1AUTC 1NFWA 4AFQA 3P92A 3SNEA 4YZUA 1TNJA 1AN1E 3VB5A 3SV7A 3KEEA 3LGUA 2FX6A 2JKHA 3SV8A 2DE9A 3PTNA 1CA0B 1AGJA 5EQRA 3ODFA 4CR9A 3N7DA 5C94A 2QXJA 3MO9A 4NSVA 1C2FA 3A86A 2ZCKP 1SBWA 2AS9A 2R0LA 1H8IH 1GBMA 2FOEA 1GVZA 2VVVA 4BXSA 4RT0A 4YM9A 5C1XA 3OU0A 4WF8A 2K8IA 1DDJA 1SPJA 1DICA 2BD2A 5A09A 2J98A 3M5MA 1FAKH 1BBRK 1INCA 2J95A 3RXGA 1MAYA 2P3TB 5EODA 1N8OB 4SGAE 1XVOA 4Q4LA 1EX3A 1AFEH 1GG6B 4O03A 3RXBA 1NU7B 5G4BA 3D62A 1LQDB 5CHBA 1GHYH 1GDQA 1P05A 2JJ2D 2CV3A 2FP7B 5K0HA 2OD3B 1NBME 2FXRA 2NU3E 3EQ0H 1EAUA 1V2OT 1P3EA 3ZZ6A 4ABAA 1GMDF 2F4LA 3MNBA 1K9OE 2J94A 1LPGB 3A8AA 4Y10E 2ZQ2A 3ESTA 3A83A 1DT2A 2I6SA 1O5DH 1SR5C 3F9FA 4Y7BA 3QDZB 2ZDLA 1C1PA 1GCTB 1RIWC 1YC0A 1AWFH 4I7YH 1S6HA 2PKSC 4JZFH 1C5SA 4ESTE 2W3IA 2V35A 1H4WA 1AO5A 2WPKS 5C17A 1GBHA 3BEFB 5BPEA 1O2IA 1T32A 5GJ4B 3STJA 4Y71A 4DG4A 1UW7A 1YCPH 3RXJA 1C1SA 2GCHF 3ZVGA 1C5YB 3A7WA 1BQYA 3RM2H 3S7HB 2QA9E 3TGKE 4WMFA 4E7RG 4UDWH 4TPYA 1ZJDA 4ACAA 2OC8A 1O3BA 2WV5A 1MCVA 1O2VA 4Y6DA 3SZNA 1DUAA 2STBE 1SGRE 3TJUA 3LONA 5FX5A 1C5ZB 2Z6BD 4H42U 5DP9A 5GPIB 4YESB 3LGTA 1AB9C 1PPEE 1UHBA 3DUXH 2PKAA 2ODPA 2P3FH 3MQKC 1P2KA 1CO7E 1C1OA 3F3BA 2HPQH 3FKSD 2Z3CA 1GDNA 1ZSJA 2AH4X 2ZI2H 1K1OA 1QB9A 1SLVB 2IJD1 1O2ZA 1CHGA 1EP5A 1D9IA 1GGDB 1Z8JB 1MZAA 2BDCA 5EQQA 1C2DA 3F9GA 4FVBA 1HJAC 1P2MA 2BLVA 1J16A 3L3TA 3I78A 5DSFA 2H1UA 1THPB 3WW7A 1GI0A 1P9SA 2ZCHP 3O8DA 6CHAB 1OX1A 3A89A 1G3CA 3GDSA 3L6PA 2WPLS 2A7JA 4ACBA 3ATKA 1ZYOA 1UVUH 3M61U 1GJ7B 1OSSA 3F2HA 1QJ6B 1CT4E 2NU4E 1GMCF 3CS7A 3T27A 1KTSB 1YPMH 3H09A 1DITH 2O8LA 4BNRA 4Q7ZA 1C5XB 3KL6A 4I8GA 3A7XA 3OY6U 4MNVA 4X6OA 1SHYA 1C5LH 5GCHF 2ZGBH 1C1QA 2WZQA 2BLQA 2PW8H 3PM3A 1O39A 3QZRA 1FIWA 4NZQA 1EZXC 2R3UA 2ZTYA 3C1KA 1O2WA 4GAWA 1EZUC 1KXEA 2KZ4A 1QURH 3ATWA 1ANDA 1A4WH 3A82A 5EJLA 4R0IA 4BXWA 1BMMH 2NU0E 2Q1JA 3DSOA 4X0WU 3K6ZA 4CR5A 1F2SE 2BTCE 2TPIZ 3SJOA 1DY9A 3U8RH 1ELDE 2H9HA 1G36A 4AG1A 3GDVA 2J9NA 1COWD 4MDSA 4X2VA 1SQAA 1BJVA 1HFDA 3M3VA 5E0GA 2QC2A 2WPHS 3Q3KA 1L0ZA 2JETB 1O2JA 1ELBA 1MTVA 1FY1A 2OC0A 2ZPRA 1BITA 2Q6DA 1ESTA 2A5AA 4FUGA 4Y11E 3RXKA 1QL7A 3AAUA 1NFXA 1EATA 2A4OA 5T6GA 1SVPA 5EGMA 5ESBA 3UR9A 1L4DA 5DG6A 1O31A 1FONA 2OXSA 1V2UT 1AWHB 1P2OA 1P8VC 1OS8A 1V2PT 2FI4E 4LOYH 4XD7D 3SYJA 1ELFA 1MH0A 3M3TA 1LVYA 4JZEH 1AY6H 1HYLA 2AERH 2QF0A 4YO9A 1EPTA 1K0HA 1TQ0B 4BTIB 3SV6A 1HUTH 3UTUH 3LGVA 1ELCA 3MOCA 4H6TA 1SSXA 1JRSA 3UIRA 2PSXA 1O5CB 3TK5A 1C5TA 1GHVH 1WSSH 2G81E 2ZC9H 2W3KA 1F5KU 1PPZA 3BV9B 3SU2A 1UCYE 5I25A 4XSKU 1SGNE 1HAIH 2UWOA 4ZHAA 1WUNH 2R9PA 3MNXA 1O2YA 4IC6A 4ZKSU 3SJIA 1C9PA 5EJZA 4J2YB 2GD4B 1G9IE 2A4QA 1EAXA 3PO1C 5CDFE 4NG9H 2H9EH 5JYIA 1C1TA 1YGCH 3TK9A 1O3LA 1QR3E 3KQBA 4TWWA 4ZMAH 4FUIA 1IQJA 1HGTH 3ATMA 3LJOA 1KLJH 2GGVB 4UONA 4E06H 3VGCC 2BOKA 4GVUA 1W3CA 1W12U 2PV9B 3VB4A 3SW2B 1PJPA 4GLYA 1LHEH 3V0XA 3RXIA 1TABE 3SNAA 3ZYEA 3HGNA 1BTHH 1EAIA 2Y82A 4AN7A 4JYTA 3AAVA 1YLDA 3U28C 2WINI 2R2WU 2FOCA 2G00A 2PGQB 1KXFA 2ZP0H 1ID5H 4B6FA 2P3UB 2PUQH 3SGBE 5FCKA 1RIWB 2WPDD 4LZ4B 5L6NH 2PKSB 3SU0A 1P01A 3P8FA 4Y8XA 4KKDA 1TNLA 1HPGA 2XBVA 2Z3EA 1OYQA 1UTQA 1ELVA 1SGEE 1T7CA 3ATLA 1AI8H 1QFKH 1TPAE 3QWCH 1N6YA 1FJSA 3LT3A 3EDXB 2XW9A 8ESTE 1NZQH 3UPEA 2L74A 4ZH8A 2J34A 2FIRH 4DOQA 1TPOA 5FCRA 3F1SB 1XKBC 1C5OH 3BTFE 1ORFA 2P95A 3RXUA 3MMGA 3E8LA 1D6WA 2TGAA 3BF6H 4MQAA 2A2QH 1GL1A 2GX4A 1HB0B 2CGAA 2ZZUH 1AB9B 1Z6JH 1CHOF 1HAZB 4FUEA 4NSYA 3ZVDA 1YWUA 1JWTA 2BY5X 1GBJA 1YPHC 2H5DA 2ZHFH 1E34B 3M37A 3ZZCA 5DK1A 3RXFA 3ZIAD 2VWNA 2YMSD 1QJ7B 1NBMD 3BIUH 1DSUA 3F68H 1N8OC 3A8BA 5AFZH 1JIRA 3UREA 1HV7A 3HK3B 4ISNA 1S5SA 1QHRB 1DX5M 4RKJB 1P57B 1W11U 2V0BA 1UJ1A 5C2ZA 3RMLH 3PWCA 1A3BH 1V6DA 4D76A 4BAMB 2B5TB 4KGAA 1P03A 1HJAB 2WUBA 3SJ9A 1H8HD 1ETRH 1NRSH 4D9QA 1H9LB 1ABJH 2VWLA 2ZKSA 1A61H 3LGYA 3TH3H 1K2I1 4TWYA 1PPBH 4OS2A 2Z9GA 1C1VH 1C1NA 2ALVA 3BTKE 2KAIA 1WXRA 2BD9A 2HPPH 3BG8A 4RI0A 3MNCA 2Z7FE 1SG8B 2O8TA 1CGIE 1TIOA 1JOUB 1RFNA 4UFGH 1V2KT 2FO9A 2FTMA 1B7XB 3F2GA 1NRQH 2O8MA 1WYKA 1EZSC 3IG6B 3BIVH 3RXSA 1AQ7A 1SC8U 1YKTA 2I6QA 3D65E 1FI8A 1GVLA 3M5OA 1XM1A 1ZRKA 1YPKH 2XTTB 3V3MA 5E0HA 1EZQA 3H7TA 1HJ9A 4AB9A 2ZFQH 3ZVCA 3EA7A 2AIQA 1IQHA 1BB0B 4ISLA 2KCPA 5TCCA 2ANYA 4FVDA 1BTWA 1NO9H 3T25A 2SGPE 3UFAA 2LP6A 2QXGA 1O30A 2BY7X 1EAWA 5IYTA 3PYHA 1A0HB 3SU3A 1G37A 3C27B 3LH3A 1WV7H 3SV2H 3Q3YA 1E0FD 5JB8S 1IAUA 3RU4T 1ZPCA 1CE5A 3KHVA 4M9FA 4TY6A 2Y5FA 3RXPA 1ANEA 1UMAH 3U9AH 3E0NB 4AZ2B 2HLDD 4ZXXH 1O2TA 3ZV9A 4GPGA 1YPLH 1GJAB 1FN8A 1V2QT 3O8RA 2QN5T 3E6PH 1PPHE 1HRTH 5C67A 4K3JA 1TB6H 2VIPA 2ZHEH 1OP2A 1TPPA 1A5HA 4HGCA 1KXDA 4XBDA 5E0JA 3EYDA 4K8YA 2GV6A 2D1JA 1TMUH 1G2MA 5IDKA 4IMZA 3KNXA 5DN6D 3PLKA 3N7EA 1DFPA 3T26A 4X6NA 1DPOA 2VU8E 1FUJA 1S81A 1BTZA 1XUFA 1W13U 3RXCA 3DSGA 6GCHG 3SQHE 1TBZH 3K9XB 3O8CA 2LPRA 2BD4A 1SOZA 5EPYA 3GYLB 1SGQE 4VGCC 1KLTA 2KCOA 3S9BA 2ANKH 4FU9A 4UFEH 5ESTE 3RMOH 1W0JD 1UTOA 1OP8A 3RXDA 1IQMA 3OSYA 3SU6A 1QZ8A 1C5RA 1LMWB 3TIUA 3F9HA 5EXMA 3VEQB 1SGFG 5KGOA 3T2NA 4OS5A 1VCWA 4Z0KA 2HVYB 4AG2A 3MH6A 4FUJA 3RMNH 3PO1B 3BTME 2YNBA 1RTLA 1O3OA 1Y5UT 4X2WA 1G3DA 2GMTC 1GVKB 1SQTA 3ZZDA 1LVBA 2VWOA 1G3EA 2RFKC 3TU7H 5F03A 2ZDAH 1Z8RA 2FESH 3VGCB 3AK5A 1Q2WA 4XRNA 1Y3UA 2EEKA 3UUZA 2UUJB 1MMJN 1QA7A 2F9VA 3M5LA 1PYTD 4D8NA 2BQ6B 1H9IE 1YCPK 2GV7A 2UWLA 2JIZD 1K1LA 1BTYA 4MPWA 3UY9A 5LGOA 1YYY1 3RXEA 3Q3XA 4AX9H 4ZROA 4F55A 4OS6A 3V12A 4XE4A 1ELEE 3M35A 1ZR0A 1LVMA 4K60A 1W2KH 3WWFA 1OHHD 5JBCS 1GMDG 2A4RA 1LHCH 3NUMA 3IWMA 1GI4A 3U1IB 1ACBE 1BA8B 1BOQA 1RS0A 1VZQH 5AHGH 2FMJA 5J4SA 5GIBA 2G5VA 1BMFD 2QXHA 2FTLE 3GY4A 1IQIA 1EXFA 2KCAA 4XBCA 1VJ9U 1QB1A 3H7OA 1C2KA 1GI7B 2KCYA 3KF2A 3RMMH 3BTGE 2ZGJA 1XX9A 1MAXA 4FUDA 4JCNA 3U1JB 1XMNB 2DE8A 2ZU2A 3KQCA 3LGWA 1O38A 1BMNH 1AIXH 2PLXA 1TNGA 4CRCA 2GCHG 4KTCA 1BIOA 2FODA 2Y7XA 1DUEA 3A7YA 1FNIA 1UK2A 1YM0A 5A0AE 3W95A 1AKSB 4QT8C 1C5PA 2SGDE 4ZXYH 1D3DB 1AZ8A 1O33A 4BTUB 3SJ8A 1WAYB 1PQ8A 4MNXA 1LHFH 5A8XA 1MD7A 4Z1MD 4DW2U 1GHWH 3LH1A 2F43B 2HOBA 3RC4A 1HAVA 2LNCA 2Z3DA 3GCTF 4WXIA 2J5UA 1O2QA 2A0QB 2BDIA 4LK4A 1ZLRA 2GKVE 4MG3A 1BHXF 1HDTH 3U69H 2FS9A 2W6ID 1C1RA 1A5IA 1O3JA 2B8OH 3LPRA 1P02A 2VB0A 1GCDA 1XXFA 1B5GH 1GHBF 4IC5A 4IMQA 1AZZA 2VGCB 1C2LA 1QRZA 4NIVA 5DGJA 1FY5A 1FXYA 4U32A 1K22H 1O32A 3DCLA 1V2VT 4XDEA 1YPEH 1E1RD 4KELA 1L1NA 3QTVH 3KCGH 1PFXC 4NA7A 7GCHF 1SL3A 3P8NA 3AW0A 4ABBA 4AB8A 1GI5A 3MU1A 4IW4E 1FDPA 3ZV8A 1FN6A 1XVMA 1OWIA 4LXBH 4ASHA 4F4OC 1MABB 2BB4A 1PQAA 4HZHA 3BEUA 1GMCG 2GVFA 3SQEE 4WWYA 5K7RA 2ULLA 1O36A 1N1LA 1P3CA 1SOTA 1BMAA 4I8LA 2WHXA 1YY3A 1MTNC 2VIVA 3DFJA 3ZVAA 3PB1E 4A1TA 5GCHG 2O9QA 4FUBA 1HAXB 2CK3D 3N7OA 1FMGA 1GBIA 1BMLA 3NK8A 2SGQE 4I8KA 3UB0A 1WTGH 3F9EA 1RTFB 5EIYA 3MH5A 4ISIH 1NC6A 1C2IA 2ZGXH 1DVAH 2UUYA 2PHBA 3OEHD 1P2IA 3E1XB 1SGFA 5ETXA 3PV4A 3GY2A 4B2AA 5JBTA 5DPAA 2THFB 2ZFRH 1MU8B 4BAQB 1QIXB 3RXOA 1J8AA 4FUFA 1V2TT 1LKAA 2F91A 1GBAA 2Y80A 5BRRE 5KEDA 2WV4A 4U30A 1T8MA 4Q63A 1TE0A 5EQSA 5FPTA 1YPJH 2Z9LA 4FXGH 8KME2 4OGXA 2L6OA 3JZ1B 2ZHWH 1NTPA 3FN8A 2TBSA 2NU1E 3PRDA 1UCYH 3F0OA 4MPVA 2OQUA 1S0RA 1GBLA 2BX3A 3QGJA 4X1PU 4B71A 1TGSZ 4AYYB 3HATH 3KQDA 2PSYA 2BVRH 5LPEA 1YP9A 3RXRA 4DIHH 2QCYA 4X2XA 1GBBA 1W0YH 2ZF0H 4IBLH 1NPMA 1MQ5A 2D8WA 3QN7A 1S84A 1ZMLA 3GYMA 3BTTE 2BXTH 4MPUA 4MVNA 1TGBA 1SGDE 4UD9H 2JH6D 4VGCB 1IQEA 4JZIA 2PTCE 4B2BA 4TY7A 3ZYDA 1C5VA 1F0RA 1O3MA 1TMTH 2BZ6H 4KTUA 4E7NA 2GZ9A 4BOHA 1GJDB 1MBMA 3GDUA 3TNSA 2ZDNA 3TGJE 1KXAA 5A2MH 1V2NT 1GHAF 2BDGA 3KQ5A 2ZIQH 3PWBA 1C1MA 1GBDA 1MCTA 2FI3E 1FY4A 3FVFB 1BRUP 1NN6A 4JK6A 4AC9A 4DT4A 1UTPA 2GMTB 2FWWA 3HKJB 4H6SB 3SUFA 4RT1A 1KDQA 5A0CA 1C5MD 1EPTC 3UWIA 5CE1A 3MWIU 5FAHA 2RG3A 1DY8A 1NS3A 5JBBS 1HAYB 1NFUA 1RJXB 3SNDA 4A6LA 3PV5A 1V2JT 4CH8B 3LKWA 4I31A 3SOSA 2D26C 4X8SH 1NROH 2CJIA 9LPRA 2VIQA 2BDBA 1C2EA 4A1VA 4CHAC 1CBWC 3S9CA 1FY8E 1WBGB 2Z94A 1OPHB 1K28D 3K65B 1A1RA 1DWCH 2BZAA 4IGDA 1MKWH 2J98B 1GJ9B 3S69A 1IQFA 2B7DH 1GJBB 1P06A 2ZU5A 2TGDA 1O3PB 3QUMP 5J4QA 1O2GH 3GY8A 2A2XH 2J92A 5KECA 3A84A 1NU9A 1F5LA 1GJ8B 2A31A 5DP6A 3F2FA 4CRAA 2KFWA 2G55A 3JZ2B 3TJVA 4X1RU 4INLA 1SFQB 3ATIA 4AFSA 1E36B 4O9VA 2KX4A 2ZHDA 1NM6A 3SO3A 3QO6A 3ELAH 4UFDH 3N99A 4NFFA 3M5NA 3P6ZB 1O2RA 2F83A 3OAAD 4NA8A 1E79D 1QQ4A 2UWPA 3LGIA 2ZECA 1LDTT 3FP6E 2SGAA 1P9UA 4INKA 1TPSA 1BBRE 1E38B 1Z6EA 2F3CE 4MTBA 1CHOG 1C5UA 3ZZ4A 3TJNA 1LO6A 2AGGX 2BD5A 3BTEE 3MH7A 4NCYA 4DURA 4HI3A 1F92A 2GZ7A 3PROA 1Y59T 3LC5A 1O34A 2BD7A 3R3GB 1HJ8A 3FAOA 2SGFE 3M7TA 3RXVA 1DWBH 1SQOA 1C4Y2 3TGIE 1A0LA 1J15A 1OKXA 1QTFA 3RXHA 2G4UA 8GCHF 4NGAH 5CMXH 2C8XB 2ESTE 1RD3B 2NU2E 2C8ZB 4OGYA 1SLWB 4X8VH 5FBEA 3UOPA 1UHBB 2PP6A 2PKAB 2W6JD 1O2XA 5FPYA 3URDA 2A4GA 1E1QD 2HNTC 2VWMA 1F0SA 2XWBI 2J97A 2IPHA 1Z7KA 3MO3A 1VGCC 2F9OA 3SHAH 1ZMJA 1GJCB 3FP7E 4O3TA 2G8TA 7LPRA 1AVWA 1LPZB 2Z9IA 1GI2A 1W14U 1MTNB 2VINA 3HPTB 2ZNKH 1SHHB 2WUCA 1Y3YA 4B73A 1OWDA 3PV2A 5FPSA 1EB2A 1TNKA 1MZDA 2VVCA 3GY6A 5H4IB 1EOJA 2IN2A 3BTWE 2Y5GA 1J17T 1D3PB 1T8NA 2V3HH 1XXDA 1KIGH 1GDUA 4O97A 3MU8A 4NIWA 2F9PA 3M3SA 3GS9A 3MU4A 1FQ3A 3GCNA 1Y8TA 3R0FA 4FUCA 3BTHE 1NRRH 3SGQE 5EU8A 2A7HA 4Y7AA 1IQGA 3EE7A 1C5NH 1WTHD 1LHDH 1J9CH 4Q7XA 1GJ6A 2VGCC 3KYFA 2PUXB 2QF3A 1UK3A 5C0TA 1FLEE 3E16B 1OYTH 4X8UH 3MYWA 1TX8A 4JZDH 2G5NA 2TGPZ 4NZLA 2GP9B 2XCFA 1W7XH 1D3QB 3GCHC 4DIIH 1GJ4H 2ANMH 1W8BH 2W7UA 1ZOMA 4JYUH 4AGKA 2VBCA 2VH6A 4RSPA 1MU6B 1O3NA 3VPKA 1CT0E 2BQ7B 4TSFD 1GBKA 4MNYA 4CH2B 3HGPA 1XUGA 1ZTLA 1HAOH 2QV1A 3FANA 2OINA 4OM9A 1DE7H 1QL8A 1DXPA 3MU5A 5A8YA 1ELGA 3T62A 2XC5A 2FDAA 3M36A 1WQSA 3ZZ3A 1VITF 1YF4A 5F53A 1Y5AT 2C3SA 3A8DA 3E0PB 1T4VH 3OX7U 3S9AA 1O3HA 3TLOA 2AFQB 4AFUA 4TPIZ 2A7CA 4K1EA 1HIAA 1G30B 2OBOA 4Q80A 3ZZ9A 2R0KA 5HIZA 1ZGIA 1AMHA 1DXWA 4IN2A 4LZ1H 2XBYA 4WMDA 2ZFSA 1CU1A 5F8ZA 1AD8H 3Q77A 1Y5BT 1JXPA 3RXQA 1EPTB 3Q00A 3EGKH 5FX6A 2PGBB 4DGJA 5IK2D 1D4PB 2WV9A 2YNAA 1DWDH 1TGNA 1F5RA 1GPZA 1O3EA 4Y0YE 3PLBA 2TRMA 4CBNA 1SB1H 1W0KD 2IJOB 3M7UA 4B75A 3PMAB 2JJ1D 3RP2A 2B0FA 1LVOA 1FPHH 4B6EA 4CHAB 2GCTC 1CBWB 2Y81A 3UQVA 3Q76A 2EI8A 4GHQA 3B8JA 3ZZBA 1T31A 1D3TB 2HALA 2RA3A 4ZKNU 1CGJE 4FOUC 1AE5A 2GT7A 3TVJB 2YMSC 1QBNA 1ABIH 2XYAA 4ASUD 2HGTH 1GBEA 1K1NA 1S0QA 1W7GH 1XUJA 4KTSA 1HBTH 1MKXH 1ZGVA 3TH2H 1OP0A 1BTPA 3SI4H 1ZTJA 5I46H 5ABWA 1HAGE 4B2CA 4X8TH 2AIPA 1FAXA 2ZDVH 3OEED 4GSOA 1L1JA 2J38A 2ZFFH 6ESTA 7ESTE 4R8TB 3QTOH 1C5WB 1C4U2 2OCVB 1IQNA 1CT2E 5GDSH 1YPHE 2Q6GA 2XOKD 5C20A 1MUEB 3M7QA 2FZZA 4M7GA 2AMPA 3OTJE 3LJJA 2PTNA 5C1UA 3FO8D 2Q6FA 3RDZA 3VG8A 1XUKA 5L2YH 1EUFA 3AW1A 1LHGH 4WY3A 1FZZA 4CRDA 2BLWA 3P8GA 1FX0B 4ISHH 1LKBA 1E35B 3H5CB 1DS2E 5F8XA 4ABJA 2YOLA 1Z71A 1JRTA 1CA8B 1Y3WA 2D2DA 1K1PA 1KTTB 2V6NA 4ZUHA 2UUFB 4F48B 1NESE 4MNWA 1NRPH 5EXNA 3RXTA 3GOVB 1DLEA 3GCTG 1WOFA 2ZPSA 2CHAC 3P95A 1P2QA 5AFYH 4AORA 2BMGB 1GHBG 1SLUB 1G2LA 1Q3XA 1THSH 1M9UA 3PMBB 3DFLA 3S0NA 2OK5A 1TBRH 3P17H 3VXEH 4CBOA 2QF4A 1EB1H 2RA0A 3FZZA 4YT7H 2H5CA 3EA8A 1VGCB 2P8OC 3NPSA 4I8JA 3OTPA 1QJ1B 2FYQA 7GCHG 3UQOA 3FP8E 2OLGA 1S6LA 5AF9H 3CS0A 5C5NA 2XC0A 4UE7H 2LELA 3P8OA 1VR1H 3FZDA 1EOLA 1TX7A 1GI1A 1ESBA 1YLNA 2OUAA 1AFQC 1HXFH 2VIOA 5JBAS 1GL0E 1O2UA 2IOTA 1GI3A 5C0UA 2KAIB 3SZEA 2Z9KA 2ANWA 5T1VA 2FOGA 2ALPA 1A46H 1GMHF 1HNEE 1UCYK 1P10A 4AOQA 3RC5A 1SI5H 2PFEA 5CHAC 1DLKB 2H2ZA 1O2KA 1BJUA 3BG4C 1TLDA 4CRFA 2P94A 4D7FA 2V3OH 2OQ5A 4TYDA 4K5ZA 1O5GH 1K1IA 5DP3A 3SU1A 3WWBA 3NCLA 2VVUA 5B6LA 5SGAE 3VB6A 4D7GA 2WYJA 4K2YA 1VJAU 1EJAA 1OWEA 5GXPA 1UTNA 1ESAA 4O3UA 3HK6B 1AU8A 2EC9H 4I8HA 5EW2H 1UO6A 2STAE 5A8ZA 2J4IA 1DSTA 1P0SH 1SKYE 1ZHMA 1B0FA 1QNJA 1B0EA 1GI9B 2C93B 1SQRA 3ZZAA 2XRCA 2WPIS 1N6XA 2CMYA 2RDLA 3GCHB 4ABIA 4BAHB 1GI6A 2DUCA 2XBXA 3SUGA 3SGAE 1HIAB 4ZKOU 2F9BH 1WQVH 3LIWA 5E2PA 5HKKD 1P2JA 3IITA 2Y6TA 1IHSH 1O3CA 2AYWA 1T4UH 4ABHA 3CP7A 1UTMA 3PMHB 2KM0A 1ARCA 2FX4A 4DJZB 2P59A 1RXPA 1U6QA 2BX4A 1UK4A 1PYTC 3RM0H 2XNIA 4GCHG 2ZG0H 3L33A 1C1UH 1SGYE 3TPIZ 2H9TH 1MTUA 2ZHQH 5GNDA 4AGJA 3GISB 3RU4E 4K69A 1G32B 1BRAA 4X6PA 3PTBA 3QX5H 5EW1H 4OS4A 4AYVB 1VKYA 3A88A 2VH0A 3V7TA 4ABEA 3HKIB 2HWLB 1L1GA 1YCPM 3TJOA 2AGEX 5F8TA 1QBOA 1GHAG 4MLFB 2V3MA 4JMYA 1MKWK 3UR6A 3SU4A 1T8LA 2QXIA 3W94A 5DO4H 1P09A 3I77A 3ZVFA 4Y0ZE 1G3BA 1KSNA 1VCPA 3RLYH 5JPMH 1HXEH 1DWEH 1HLTH 2OP9A 3TK6A 1ZHPA 2GCTB 1O2SA 3T5FH 1UVPA 2EI6A 4A7IB 3DD2H 2GDEH 1OWHA 2HLCA 5HYOA 1GBCA 4RKOB 2C90B 1V2WT 5AVDA 2PR3A 1IQLA 1BTUA 1F0UA 1GI8B 1X7AC 2ZU4A 4U2WA 3STIA 2FYRA 2YMSB 4GCHF 3SNBA 2EA3A 1NFYA 4BAKB 5C3NA 2BVSH 1JIMA 1XKAC 2OBQA 4MPXA 4GHTA 3UNQA 1BUIA 4DVAU 3I29A 4Z6AH 1RGQA 4P02A 1P2NA 1TOCB 3MNSA 1BBRH 1F0TA 1O2PA 1KLIH 3UOUA 4XBBA 3PRBA 1YBWA 1IHTH 1EJMA 1O2HA 1C1WH 2QGRA 3SU5A 2BHGA 1BRCE 3CNRA 3RXMA 1FV9A 3W1EA 2FOFA 3AVZA 2C8WB 3A8CA 1PQ7A 1P12E 3SI3H 4Y8ZA 1UVOA 1GBTA 3DHKH 2Y7ZA 1PPCE 4NIXA 4B76A 3MHWU 1GBFA 5T3HA 4ZHLU 1GHZA 1S6FA 4THNH 4WMEA 2ZFPH 2FLRH 3NKKA 5FHTA 3NZIA 2R3YA 5T6DA 1QRXA 2A45B 1TA6A 1Z1JA 3VXFH 1C4V2 3F0PA 1O3AA 3D49H 3SBKA 1TBQH 2OC7A 4WH6A 2BOHB 2JH0D 2PWXA 3WY8A 3GY5A 1H9HE 5T6FA 5EG4A 4I86A 3SV9A 2AMQA 1ANCA 2FPZA 2A32A 1TQ7B 3DT0H 1C9TA 1TGCA 4Q2KA 3F6UH 2M5TA 2ZEBA 3OE7D 2CHAB 2FOAA 2G51A 1QBVH 1NRNH 4DCDA 5L2ZH 1KMHB 2XNDD 2QF5A 3EA9A 5L30H 4Q7YA 3NRLA 2QY0B 4F49A 2GJGA 2FI5E 1E37B 1BT7A 1WDIA 2H6MA 3VFEA 1HAPH 1SLXB 3O8BA 8GCHG 2P8OB 2A5IA 3BTDE 1W0ZU 1HAHH 1O35A 2SGEE 1K1MA 4UEHH 5DP8A 1DM4B 4CRBA 2AGIX 1LQEA 4RN6A 1SMFE 1HAVB 1P04A 3E90B 2CF8H 2W5EA 3TNTA 2FOHA 1Z1IA 1AFQB 4OS1A 1TNHA 5DP5A 1QQUA 3CENA 1ZZZA 4K1TA 4KP0A 1AHTH 1ZSLA 5HGGA 2RCEA 2ZPQA 5E2OA 2Y5HA 1AUJA 2HNTF 2SFAA 3VB7A 3TH4H 2BD8A 4Y8YA 3BSQA 4SGBE 1OWJA 2AMDA 1KXBA 5HXFA 2G4TA 9ESTA 5CHAB 2KR7A 3BG4B 1FY3A 3LC3A 1CVWH 1TONA 4JZ1A 4YOIA 4INHA 1UTJA 2A1DB 1QGFA 4NIYA 2OC1A 1SGCA 2FOMB 2GT8A 1THRH 1AVXA 4ABFA 3UNSA 4PROA 1O5BB 2F9NA 1TNIA 4NWKA 4K1SA 3RUOA 1SFIA 1TRMA 1ZRBA 4ZAEA 1PPGE 3A7TA 2ZGHA 1A2CH 1O5AB 1TA2A 5EJ1A 3MTYA 3SNCA 3OFND 4A1XA 3UNRA 1F7ZA 4TT3D 2RDEA 4X1QU 2JH5D 1D6RA 2BQWB 2O8UA 1BZXE 4WVPE 1UTLM 1VCQA 2EY4C 1RRKA 1ZSKA 1MBQA 1KY9A 3A87A 4FETA 1TAWA 5PTPA 1OOKB 1GHXH 1ZMNA 4HG6A 3EE0B 3QZQA 5FXLA 2W7SA 1IQKA 1EP6A 3ZVEA 1LTOA 4Y79A 3RC6A 2FOBA 4UFFH 2SNVA 4CRGA 3BEIB 3RLWH 1JBUH 3D23A 2JDID 2V7QD 1O5FH 3KN2A 5DJ7A 1H8DH 3K2UA 4ISOA 2ODQA 1AE8H 4NA9H 1UTKA 4FU8A 4IN1A 1CA0C 3ITIA 1VITG 3A7ZA 1AVGH 1WCZA 3OYPA 1QRWA 2BY8X 2ZWLH 3U8OH 1TFXA 2ZA5A 1QCPA 2VIWA 1BHXB 3ZZ8A 1BCUH 1PQ5A 3E3TA 2R2MB 4NWLA 3MH4A 1CSOE 4B74A 2CF9H 1S82A 2XBWA 5HIYA 2BDAA 4ZKRU 5TJXA 1MKXK 1FIZA 2O8WA 4YXWD 1DOJA 3QK1A 3SUDA 1PPFE 3KQEA 1TX6A 1O5EH 4WXVA 5F6MA 1GG6C 1O37A 1MD8A 1S83A 1K1JA 1Z8GA 3MO6A 1LPKB 2HRVA 2K1QA 2CN0H 4I33A 2FM2A 4P00A 3A7VA 1V2MT 4BTTB 1W10U 1Y3VA 1MTSA 1L4ZA 1J14A 1ETSH 2GTBA 1V3XA 1WU1A 3G01A 2QE7D 2BM2A 2ODYB 3BTQE 4FU7A 3T29A 5LPFA 2GZ8A 1ZPBA 2GDDA 1BTXA 1KDQB 2ZDMA 3SJKA 1A5GH 1AKSA 4WJG2 3RU4D 1GCTC 3ZZ5A 1EJNA 4HTCH 1QL9A 2BYAX 3A81A 2W26A 1ZTKA 3U8TH 1QB6A 1Y3XA 3T28A
chains in the Genus database with same CATH topology
2BY6X 2FEQH 2G52A 4FUHA 4J1YA 4JYVH 8LPRA 4IS5A 1O2MA 4Y76A 2FS8A 1TRNA 5JDUB 3EAJA 3BN9A 5TCAA 1NY22 1SGTA 1V2RT 1JMOH 1LCYA 1V2LT 3PLPA 1KYNA 1P11E 5EPNA 3S7KB 1BDAA 4B1TA 2HVXA 2QYIA 1TOMH 4ABDA 2BDYA 1C5QA 4DY7B 1RTKA 1UVTH 3SORA 1H1BA 5B6OA 3URCA 1S85A 2BY9X 5DKMA 1QA0A 1ANBA 2F9UA 2TGTA 5DP4A 2FLBH 3B9FH 1YLCA 2EI7A 3MI4A 1DANH 1V2ST 3ENSB 2VNTA 2WPMS 4U01A 1XUHA 2BDHA 1XUIA 1O0DH 4ZHMU 2P16A 1ETTH 1C2HA 3GICB 1ZHRA 2VIDA 3GCOA 1O3IA 5FBIA 1MQ6A 3VB3A 1O3KA 2ZFTA 3QLPH 3A80A 4A5TS 4DT7B 1EQ9A 2AEIH 1EKBB 3RXLA 1GGDC 2ASUB 1HCGA 2ZTZA 1BRBE 2HNTE 4NFEA 3LDXH 4X1SU 2CXVA 4BANB 1ARBA 3SUEA 4YOJA 1O3DA 3KGPA 4WH8A 1MTWA 2ZQ1A 4A92A 2ZDKA 1GWAA 2XCNA 2UUKB 5HMAA 6CHAC 1CGHA 3SHCH 4K8BA 1FPCH 2WYGA 1NT1A 4I32A 4BAOB 3LOXA 4YLQH 4YLUA 1UVSH 2ZU1A 3B23B 3RXAA 1QY6A 3UWJH 4E05H 1C2GA 2C8YB 3SN8A 2TIOA 4YT6H 4CREA 4ABGA 2ZGCA 4YOGA 1GJ5H 1TRYA 5EOKA 3FFGA 1A0JA 1O2LA 1SGPE 2BLOA 1O2OA 1VITH 1TGTA 5HM9A 3K6YA 4GUXA 3E91A 1ELTA 1ZPZA 1IOEA 1TMBH 2C4FH 2VJ1A 2XXLA 3QGNB 1TYNA 5C5OA 4XFQA 2A5KA 1O3FA 3V13A 1A7SA 1T8OA 3ZVBA 2ILNA 1K21H 4JK5A 2ZTXA 3NXPA 4X2YA 3MU0A 1O3GA 1A3EH 5HM2A 3GY7A 3TITA 1GMHG 4D9RA 4OS7A 5C1YA 1L2EA 3NWUA 1EASA 2XWAA 1C2MA 1KXCA 3U98H 4H4FA 5LH8A 3LU9B 3ODDA 1YPGH 3P70B 1O2NA 2QAAA 4YTAA 2NWNA 3ZZ7A 2SNWA 2WPJS 2OTVA 2JETC 3KIDU 5JB9S 1Z8IB 2ZO3H 5DP7A 2J2UA 2Z9JA 5EXLA 3OY5U 5GWZA 1TWXB 2QIQA 3PMJA 3MFJA 3DA9B 1TALA 1OXGA 1CQQA 4X6MA 1SGIB 3AASA 4X1NU 1ZJKA 3A85A 1Q31A 4XOJA 5E8EH 3GY3A 6LPRA 2XC4A 2P93A 5A0BA 2ZU3A 2BD3A 7KMEH 6GCHF 2ZCLP 4AFZA 2B9LA 4HFPB 1C2JA 1ELAA 1OWKA 2BXUH 5LPRA 2BVXH 1AUTC 1NFWA 4AFQA 3P92A 3SNEA 4YZUA 1TNJA 1AN1E 3VB5A 3SV7A 3KEEA 3LGUA 2FX6A 2JKHA 3SV8A 2DE9A 3PTNA 1CA0B 1AGJA 5EQRA 3ODFA 4CR9A 2QXJA 3MO9A 4NSVA 1C2FA 3A86A 2ZCKP 1SBWA 2AS9A 2R0LA 1H8IH 1GBMA 2FOEA 1GVZA 2VVVA 4BXSA 4YM9A 5C1XA 3OU0A 4WF8A 1DDJA 1SPJA 1DICA 2BD2A 5A09A 3M5MA 1FAKH 1BBRK 1INCA 2J95A 3RXGA 1MAYA 2P3TB 5EODA 1N8OB 4SGAE 1XVOA 1EX3A 1AFEH 1GG6B 4O03A 3RXBA 1NU7B 5G4BA 3D62A 1LQDB 1GHYH 1GDQA 1P05A 2CV3A 2FP7B 5K0HA 2OD3B 2FXRA 2NU3E 3EQ0H 1EAUA 1V2OT 1P3EA 3ZZ6A 4ABAA 1GMDF 3MNBA 1K9OE 2J94A 1LPGB 3A8AA 4Y10E 2ZQ2A 3ESTA 3A83A 1DT2A 2I6SA 1O5DH 1SR5C 3F9FA 4Y7BA 3QDZB 2ZDLA 1C1PA 1GCTB 1RIWC 1YC0A 1AWFH 4I7YH 1S6HA 2PKSC 4JZFH 1C5SA 4ESTE 2W3IA 2V35A 1H4WA 1AO5A 2WPKS 1GBHA 3BEFB 5BPEA 1O2IA 1T32A 5GJ4B 3STJA 4Y71A 4DG4A 1YCPH 3RXJA 1C1SA 2GCHF 3ZVGA 1C5YB 3A7WA 1BQYA 3RM2H 3S7HB 2QA9E 3TGKE 4WMFA 4E7RG 4UDWH 4TPYA 1ZJDA 2OC8A 1O3BA 2WV5A 1MCVA 1O2VA 4Y6DA 3SZNA 1DUAA 2STBE 1SGRE 3TJUA 3LONA 5FX5A 1C5ZB 2Z6BD 4H42U 5DP9A 5GPIB 4YESB 3LGTA 1AB9C 1PPEE 1UHBA 3DUXH 2PKAA 2ODPA 2P3FH 1P2KA 1CO7E 1C1OA 2HPQH 2Z3CA 1GDNA 1ZSJA 2AH4X 2ZI2H 1K1OA 1QB9A 1SLVB 1O2ZA 1CHGA 1EP5A 1D9IA 1GGDB 1Z8JB 1MZAA 2BDCA 5EQQA 1C2DA 3F9GA 4FVBA 1HJAC 1P2MA 2BLVA 1J16A 3L3TA 3I78A 2H1UA 1THPB 1GI0A 1P9SA 2ZCHP 3O8DA 6CHAB 1OX1A 3A89A 1G3CA 3GDSA 3L6PA 2WPLS 2A7JA 3ATKA 1ZYOA 1UVUH 3M61U 1GJ7B 1OSSA 1QJ6B 1CT4E 2NU4E 1GMCF 3CS7A 3T27A 1KTSB 1YPMH 1DITH 2O8LA 4BNRA 4Q7ZA 1C5XB 3KL6A 4I8GA 3A7XA 3OY6U 4MNVA 4X6OA 1SHYA 1C5LH 5GCHF 2ZGBH 1C1QA 2BLQA 2PW8H 3PM3A 1O39A 3QZRA 1FIWA 4NZQA 1EZXC 2R3UA 2ZTYA 3C1KA 1O2WA 4GAWA 1EZUC 1KXEA 1QURH 3ATWA 1ANDA 1A4WH 3A82A 4R0IA 4BXWA 1BMMH 2NU0E 2Q1JA 4X0WU 3K6ZA 4CR5A 1F2SE 2BTCE 2TPIZ 3SJOA 1DY9A 3U8RH 1ELDE 2H9HA 1G36A 4AG1A 3GDVA 2J9NA 4MDSA 4X2VA 1SQAA 1BJVA 1HFDA 3M3VA 5E0GA 2QC2A 2WPHS 3Q3KA 1L0ZA 2JETB 1O2JA 1ELBA 1MTVA 1FY1A 2OC0A 2ZPRA 1BITA 2Q6DA 1ESTA 2A5AA 4FUGA 4Y11E 3RXKA 1QL7A 3AAUA 1NFXA 1EATA 2A4OA 5T6GA 1SVPA 5EGMA 5ESBA 3UR9A 1L4DA 5DG6A 1O31A 1FONA 2OXSA 1V2UT 1AWHB 1P2OA 1P8VC 1OS8A 1V2PT 2FI4E 4LOYH 1ELFA 1MH0A 3M3TA 1LVYA 4JZEH 1AY6H 1HYLA 2AERH 2QF0A 4YO9A 1EPTA 1TQ0B 4BTIB 3SV6A 1HUTH 3UTUH 3LGVA 1ELCA 3MOCA 4H6TA 1SSXA 1JRSA 3UIRA 2PSXA 1O5CB 3TK5A 1C5TA 1GHVH 1WSSH 2G81E 2ZC9H 2W3KA 1F5KU 1PPZA 3BV9B 3SU2A 1UCYE 5I25A 4XSKU 1SGNE 1HAIH 2UWOA 4ZHAA 1WUNH 2R9PA 3MNXA 1O2YA 4IC6A 4ZKSU 3SJIA 1C9PA 4J2YB 2GD4B 1G9IE 2A4QA 1EAXA 3PO1C 4NG9H 2H9EH 5JYIA 1C1TA 1YGCH 3TK9A 1O3LA 1QR3E 3KQBA 4TWWA 4ZMAH 4FUIA 1IQJA 1HGTH 3ATMA 3LJOA 1KLJH 2GGVB 4UONA 4E06H 3VGCC 2BOKA 4GVUA 1W3CA 1W12U 2PV9B 3VB4A 3SW2B 1PJPA 4GLYA 1LHEH 3V0XA 3RXIA 1TABE 3SNAA 3ZYEA 3HGNA 1BTHH 1EAIA 2Y82A 4AN7A 4JYTA 3AAVA 1YLDA 2WINI 2R2WU 2FOCA 2G00A 2PGQB 1KXFA 2ZP0H 1ID5H 5FCKA 2P3UB 2PUQH 3SGBE 1RIWB 4LZ4B 5L6NH 2PKSB 3SU0A 1P01A 3P8FA 4Y8XA 4KKDA 1TNLA 1HPGA 2XBVA 2Z3EA 1OYQA 1UTQA 1ELVA 1SGEE 1T7CA 3ATLA 1AI8H 1QFKH 1TPAE 3QWCH 1N6YA 1FJSA 3LT3A 3EDXB 2XW9A 8ESTE 1NZQH 3UPEA 4ZH8A 2J34A 2FIRH 4DOQA 1TPOA 5FCRA 3F1SB 1XKBC 1C5OH 3BTFE 1ORFA 2P95A 3RXUA 3MMGA 3E8LA 1D6WA 2TGAA 3BF6H 4MQAA 2A2QH 1GL1A 2GX4A 1HB0B 2CGAA 2ZZUH 1AB9B 1Z6JH 1CHOF 1HAZB 4FUEA 4NSYA 3ZVDA 1JWTA 2BY5X 1GBJA 1YPHC 2H5DA 2ZHFH 1E34B 3M37A 3ZZCA 5DK1A 3RXFA 2VWNA 3F68H 1QJ7B 3BIUH 1DSUA 1N8OC 3A8BA 5AFZH 1JIRA 3UREA 1HV7A 3HK3B 4ISNA 1S5SA 1QHRB 1DX5M 4RKJB 1P57B 1W11U 2V0BA 1UJ1A 5C2ZA 3RMLH 3PWCA 1A3BH 1V6DA 4D76A 4BAMB 2B5TB 4KGAA 1P03A 1HJAB 2WUBA 3SJ9A 1ETRH 1NRSH 4D9QA 1H9LB 1ABJH 2VWLA 2ZKSA 1A61H 3LGYA 3TH3H 1K2I1 4TWYA 1PPBH 4OS2A 2Z9GA 1C1VH 1C1NA 2ALVA 3BTKE 2KAIA 2BD9A 2HPPH 3BG8A 3MNCA 2Z7FE 1SG8B 2O8TA 1CGIE 1TIOA 1JOUB 1RFNA 4UFGH 1V2KT 2FO9A 2FTMA 1B7XB 1NRQH 2O8MA 1WYKA 1EZSC 3IG6B 3BIVH 3RXSA 1AQ7A 1SC8U 1YKTA 2I6QA 3D65E 1FI8A 1GVLA 3M5OA 1XM1A 1ZRKA 1YPKH 2XTTB 3V3MA 5E0HA 1EZQA 3H7TA 1HJ9A 4AB9A 2ZFQH 3ZVCA 3EA7A 2AIQA 1IQHA 1BB0B 4ISLA 5TCCA 2ANYA 4FVDA 1BTWA 1NO9H 3T25A 2SGPE 3UFAA 2QXGA 1O30A 2BY7X 1EAWA 5IYTA 3PYHA 1A0HB 3SU3A 1G37A 3C27B 3LH3A 1WV7H 3SV2H 3Q3YA 1E0FD 5JB8S 1IAUA 3RU4T 1ZPCA 1CE5A 3KHVA 4TY6A 2Y5FA 3RXPA 1ANEA 1UMAH 3U9AH 3E0NB 4AZ2B 4ZXXH 1O2TA 3ZV9A 4GPGA 1YPLH 1GJAB 1FN8A 1V2QT 3O8RA 2QN5T 3E6PH 1PPHE 1HRTH 5C67A 4K3JA 1TB6H 2VIPA 2ZHEH 1OP2A 1TPPA 1A5HA 4HGCA 1KXDA 4XBDA 5E0JA 3EYDA 4K8YA 2GV6A 2D1JA 1TMUH 1G2MA 5IDKA 4IMZA 3KNXA 3PLKA 1DFPA 3T26A 4X6NA 1DPOA 2VU8E 1FUJA 1S81A 1BTZA 1XUFA 1W13U 3RXCA 6GCHG 3SQHE 1TBZH 3K9XB 3O8CA 2LPRA 2BD4A 1SOZA 5EPYA 3GYLB 1SGQE 4VGCC 1KLTA 3S9BA 2ANKH 4FU9A 4UFEH 5ESTE 3RMOH 1UTOA 1OP8A 3RXDA 1IQMA 3OSYA 3SU6A 1C5RA 1LMWB 3TIUA 3F9HA 5EXMA 3VEQB 1SGFG 3T2NA 4OS5A 1VCWA 4Z0KA 4AG2A 3MH6A 4FUJA 3RMNH 3PO1B 3BTME 2YNBA 1RTLA 1O3OA 1Y5UT 4X2WA 1G3DA 2GMTC 1GVKB 1SQTA 3ZZDA 1LVBA 2VWOA 1G3EA 3TU7H 5F03A 2ZDAH 1Z8RA 2FESH 3VGCB 1Q2WA 1Y3UA 2EEKA 3UUZA 2UUJB 1MMJN 1QA7A 2F9VA 3M5LA 1PYTD 4D8NA 2BQ6B 1H9IE 1YCPK 2GV7A 2UWLA 1K1LA 1BTYA 4MPWA 3UY9A 5LGOA 1YYY1 3RXEA 3Q3XA 4AX9H 4ZROA 4OS6A 3V12A 4XE4A 1ELEE 3M35A 1ZR0A 1LVMA 4K60A 1W2KH 5JBCS 1GMDG 2A4RA 1LHCH 3NUMA 3IWMA 1GI4A 3U1IB 1ACBE 1BA8B 1BOQA 1RS0A 1VZQH 5AHGH 2FMJA 5J4SA 5GIBA 2G5VA 2QXHA 2FTLE 3GY4A 1IQIA 1EXFA 4XBCA 1VJ9U 1QB1A 3H7OA 1C2KA 1GI7B 3KF2A 3RMMH 3BTGE 2ZGJA 1XX9A 1MAXA 4FUDA 4JCNA 3U1JB 1XMNB 2DE8A 2ZU2A 3KQCA 3LGWA 1O38A 1BMNH 1AIXH 2PLXA 1TNGA 4CRCA 2GCHG 4KTCA 1BIOA 2FODA 2Y7XA 1DUEA 3A7YA 1FNIA 1UK2A 1YM0A 5A0AE 3W95A 1AKSB 4QT8C 1C5PA 2SGDE 4ZXYH 1D3DB 1AZ8A 1O33A 4BTUB 3SJ8A 1WAYB 1PQ8A 4MNXA 1LHFH 5A8XA 1MD7A 4DW2U 1GHWH 3LH1A 2HOBA 3RC4A 1HAVA 2LNCA 2Z3DA 3GCTF 4WXIA 1O2QA 2A0QB 2BDIA 4LK4A 1ZLRA 2GKVE 4MG3A 1BHXF 1HDTH 3U69H 2FS9A 1C1RA 1A5IA 1O3JA 2B8OH 3LPRA 1P02A 2VB0A 1GCDA 1XXFA 1B5GH 1GHBF 4IC5A 4IMQA 1AZZA 2VGCB 1C2LA 1QRZA 4NIVA 5DGJA 1FY5A 1FXYA 4U32A 1K22H 1O32A 1V2VT 4XDEA 1YPEH 4KELA 1L1NA 3QTVH 3KCGH 1PFXC 4NA7A 7GCHF 1SL3A 3P8NA 3AW0A 4ABBA 4AB8A 1GI5A 3MU1A 4IW4E 1FDPA 3ZV8A 1FN6A 1XVMA 1OWIA 4LXBH 4ASHA 4F4OC 2BB4A 4HZHA 1PQAA 3BEUA 1GMCG 2GVFA 3SQEE 4WWYA 5K7RA 2ULLA 1O36A 1N1LA 1P3CA 1SOTA 1BMAA 4I8LA 1MTNC 2VIVA 3DFJA 3ZVAA 3PB1E 4A1TA 5GCHG 2O9QA 4FUBA 1HAXB 3N7OA 1FMGA 1GBIA 1BMLA 3NK8A 2SGQE 4I8KA 1WTGH 3F9EA 1RTFB 3MH5A 4ISIH 1NC6A 1C2IA 2ZGXH 1DVAH 2UUYA 2PHBA 1P2IA