1DDJA

Crystal structure of human plasminogen catalytic domain
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
247
structure length
247
Chain Sequence
SFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDAGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Human plasminogen catalytic domain undergoes an unusual conformational change upon activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
molecule keywords PLASMINOGEN
total genus 52
structure length 247
sequence length 247
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.7: Plasmin.
pdb deposition date 1999-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ddjA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ddjA01
4Z6AH 4JCNA 4YESB 3R0FA 1OYQA 1GI3A 1GCTB 4X1NU 3MNXA 1CQQA 3PWCA 1K1MA 4B2CA 4AG1A 4K5ZA 1V2VT 2GZ7A 2VIWA 3WY8A 2PR3A 1TRMA 1MZAA 1K2I1 1SGYE 2F9OA 2FOEA 1CHOG 3ATKA 1BIOA 3LONA 2UWPA 2R9PA 1YKTA 3CS7A 3P17H 1XVMA 2PTNA 1L0ZA 1LVBA 1XUGA 1O5DH 3F9EA 3EE0B 3MO3A 1HLTH 1TAWA 1O2NA 1Y3WA 1AB9C 4OS2A 3GOVB 1C2HA 1ZLRA 2J92A 3LC5A 3TH2H 4ZUHA 1BZXE 3A89A 3KHVA 3C27B 3LPRA 1THPB 4CH2B 1H8IH 5CHAB 3QTVH 1OOKB 3T29A 2EA3A 2Y82A 4AFZA 4TPIZ 1L4ZA 2CGAA 1HAVB 5AVDA 4AFUA 4U2WA 3RXEA 2GP9B 3GY8A 1F0TA 3FAOA 1P0SH 4K1EA 4R8TB 4ZXYH 3SNCA 3ZVGA 3TGKE 2QV1A 3DD2H 1A7SA 1E0FD 1C2FA 2A7CA 5TCCA 1ZHMA 1P2OA 3RXRA 2WYJA 1HAXB 1MH0A 2VH6A 5GCHG 2AGGX 3OYPA 1B0EA 3O8BA 1FN6A 1GBKA 3RXDA 1ZYOA 1TA2A 1MZDA 2J38A 1MU8B 1PQ5A 1THRH 3TJUA 1DPOA 5AF9H 3BG4B 1AVWA 1ZR0A 1SGIB 5JB8S 3SV7A 1J15A 4AG2A 3IG6B 1DVAH 5DP3A 6CHAC 1DICA 4ABBA 4NFFA 1NROH 1EASA 1BJUA 1YPEH 1V2WT 3RMLH 2A32A 1NU9A 4DY7B 2Z9LA 4CRCA 3D49H 1C2LA 4LOYH 3LC3A 4BOHA 3QLPH 4LZ1H 1CHOF 1KXEA 2ZNKH 4MPUA 1YLCA 5HMAA 3RXSA 3MU1A 1XKAC 2B9LA 1NPMA 2ZDMA 4GCHG 3URCA 5E0HA 1Y3UA 6CHAB 2H1UA 3M7QA 3V7TA 1OS8A 1O3JA 1C5SA 1ELAA 2G5NA 2GTBA 1SGQE 2FOBA 1AVXA 3A83A 5DGJA 1ID5H 3SU3A 1EPTA 2CJIA 1K21H 3QO6A 2QCYA 4JZ1A 1UTQA 1BTXA 1K22H 4MQAA 2THFB 2ZDNA 3U8TH 1AZ8A 1HUTH 2A4GA 5DP7A 4IMZA 1C5NH 3ZZ8A 2Z9KA 1L1JA 1B0FA 2FPZA 2FTMA 3HKIB 1V2LT 1MTSA 3SOSA 1AWFH 3QZRA 3GY2A 2OBQA 3M3TA 4AB9A 1PPEE 5HGGA 2WV4A 3E0PB 2Z3EA 1T8LA 1C5ZB 5FCRA 6ESTA 3U69H 3MFJA 1XUIA 5FPTA 1PJPA 1HJAC 1XM1A 3QX5H 3RDZA 1JOUB 1C5TA 3BTQE 1ANEA 3KQBA 4FUCA 3K6ZA 3PV4A 1O5AB 2NU2E 3NUMA 4IBLH 5JDUB 1O39A 3SW2B 1EAXA 1V2TT 1AQ7A 2BLQA 5HM2A 3UR6A 2B5TB 3RXBA 4DIHH 1DWDH 4VGCB 2ZZUH 4B2AA 2C4FH 1BMNH 1SFQB 1S82A 2Q1JA 2O8TA 3MYWA 3U9AH 3E6PH 3DFJA 2WPMS 1O2UA 1RIWB 1G32B 1SBWA 2BM2A 3LT3A 2FLRH 1C5RA 1ABJH 2PFEA 1GMHG 1BBRK 4AFQA 1SGDE 3SUFA 1C2KA 1SL3A 1TQ7B 4FUHA 3M5OA 4QT8C 3RMOH 2ZP0H 2ALPA 1HAOH 3EA8A 1VJAU 1GBJA 1SGFA 4RSPA 5E2PA 1AUTC 3V0XA 3GY5A 1GBIA 1O5GH 2VGCC 3SJ9A 5I46H 2GD4B 2VH0A 1TQ0B 2VU8E 3UPEA 5C5OA 4ABFA 2ZA5A 1SGNE 1TGBA 2W7UA 1KY9A 1D6WA 1O31A 4JK5A 4Q7XA 1MBMA 1F5LA 2SGAA 1GJ6A 1CBWC 3IITA 3TH4H 1EATA 3HK6B 2Z9IA 2XTTB 2ASUB 1YF4A 1DSTA 3RXGA 5F8XA 1VCPA 1LVMA 1Y3XA 1HB0B 1GBDA 1XUJA 5L2ZH 5GDSH 4NIYA 1OWIA 5IYTA 3PLBA 5ESTE 3GY4A 3KEEA 2I6QA 2VWNA 1HRTH 3RMNH 1MD7A 1C5PA 5HXFA 3H7TA 4O3UA 3TJVA 1VZQH 2FOHA 2R2WU 2VIVA 1GHVH 1B5GH 1SI5H 4U01A 1HIAA 2A5KA 1J14A 1KXCA 2PKSC 3K6YA 1O2OA 1CHGA 1VITG 3MU8A 2BD7A 3RXMA 4YT6H 1H9HE 1K1OA 2FZZA 3BTGE 5J4QA 1ANCA 1C1WH 4MPXA 1EB2A 4NWLA 5CMXH 2BOHB 1O3PB 1Y5UT 4MTBA 4YT7H 1P12E 1BHXB 2OUAA 2G55A 4MNVA 1S81A 1V2RT 1O3FA 1UTKA 4YLUA 1DUAA 1N6XA 1ELTA 1O3BA 1Z8JB 1AIXH 1TALA 2BVSH 1PYTC 2H5DA 3QZQA 4K1SA 1L1NA 2D8WA 1QCPA 4K1TA 1NTPA 1WTHD 1P3CA 2BDHA 3H5CB 2TRMA 4ASHA 2FOGA 1P9SA 4NA8A 2C90B 1O30A 1ZMLA 2RA3A 1OWKA 3MU0A 1DUEA 1AE8H 1SLWB 1G2LA 5DP6A 1QQUA 2VB0A 2AERH 2BD4A 6GCHF 1NM6A 4YOGA 3OTJE 1HXFH 2A7HA 2PGQB 2W7SA 2XNIA 1W14U 1TMBH 4GHQA 2UWLA 4X2WA 5JPMH 2R0KA 1LHFH 3UWJH 1O33A 3ZVBA 3MHWU 4A1TA 4X6MA 2PKAB 3HK3B 1OPHB 3IWMA 3LGIA 2ODPA 3A7ZA 3ZZCA 2M5TA 3LKWA 4BAQB 3RXCA 2BD3A 4Q7ZA 2C8YB 2ODYB 2ZCLP 2O9QA 2UUFB 1FIZA 3RMMH 1F5RA 1YCPH 3NPSA 2ANYA 4E7RG 3MH7A 2JETB 1UVOA 3M5LA 2Q6GA 2ZHWH 4THNH 3W95A 1GHWH 5AFZH 3V13A 4BXWA 2V0BA 2OC8A 1GWAA 3GCHC 3SNEA 3GCNA 2P3TB 3GY7A 3SJKA 1GBFA 2Z9GA 1ZSKA 1NFYA 1DS2E 2AFQB 1JRTA 4UONA 5F6MA 4IC5A 1GI2A 4FXGH 4X2YA 2VNTA 1A0JA 4H42U 4Y0ZE 2Y6TA 1RD3B 5C1UA 1UMAH 1GHXH 1UTPA 3ZV9A 1DWBH 1BTPA 4X1PU 2A45B 1AZZA 1LVOA 1P03A 3C1KA 3M3VA 1NRPH 4BTIB 3ZZ9A 1LHGH 1L4DA 1TX7A 3FZZA 1ELGA 4NCYA 2BD5A 2SGPE 4NG9H 1PQ8A 2Y7XA 1O36A 1NY22 2ZWLH 2XW9A 3LGUA 1GMDF 3BEFB 1IQFA 2VVUA 4IN2A 1CVWH 2PW8H 5F03A 2ZKSA 4TWYA 4I8LA 1FONA 3M3SA 8GCHF 2FODA 2GCHF 3S9AA 1GBMA 4MDSA 1LMWB 4JYTA 3VEQB 3E0NB 1ESAA 4B76A 3OSYA 1QNJA 3OY6U 3TITA 1GCDA 1DOJA 4Q2KA 2TIOA 2ZFSA 1ZJKA 2GT7A 3RC6A 1BB0B 1XUHA 1WBGB 2VIQA 1LQDB 3PTBA 5FCKA 1P2KA 3KQEA 1SGTA 3TLOA 1IHTH 2Y7ZA 2ZGJA 2ZDAH 3KQCA 1NZQH 2PSXA 1HAYB 1Q2WA 3ZZ3A 1ZGVA 4PROA 1HIAB 1GGDC 2PHBA 2PKAA 2AS9A 1GMCG 1YPJH 4ISLA 1AUJA 1O2XA 2SGDE 1YLDA 1D6RA 1NFUA 2EI6A 1PQAA 4WWYA 5A0CA 7KMEH 1SLUB 4XBDA 2XYAA 3M5MA 1C1TA 2BQ6B 3D23A 1G2MA 2FX4A 1O3AA 2ZQ2A 2R2MB 1Z1IA 4K3JA 1C2MA 1C2EA 1W3CA 2OC0A 3MO9A 1LKBA 5E0JA 5T6FA 4FUDA 2ANKH 4I32A 3GDUA 3VGCB 3P8GA 2OBOA 3ZVCA 2ZGXH 4A5TS 4B73A 2ZFFH 2ZHQH 1L1GA 2FOAA 3PROA 2ALVA 3LH3A 1ZHPA 4UFGH 3P92A 1Z8RA 1V2ST 4HFPB 2H2ZA 1BMLA 1TNLA 1Y3VA 3MTYA 2W3IA 1UCYH 1AN1E 1V2PT 4GAWA 4WH6A 1VITF 2P93A 2W5EA 2CMYA 4DOQA 1F5KU 1F2SE 1O2LA 3LGWA 4M7GA 5FX5A 2NU1E 2TGPZ 2O8UA 3UNQA 1FDPA 5FBEA 2F9NA 2OQ5A 4I8GA 1BRUP 1ZRBA 1FY4A 3M7UA 3M36A 5FHTA 2IPHA 1ESTA 1TABE 3Q00A 4YTAA 4Y7BA 3MWIU 3TK5A 1O3HA 1QL8A 1SHYA 2ANWA 3RLYH 4XDEA 2D2DA 1ZMJA 5GWZA 2WUBA 1A2CH 1UTLM 1O5FH 3MH5A 4Y71A 1DXWA 1K1JA 1QBOA 3V12A 2JKHA 1MKXK 2ZGHA 3LIWA 2WPKS 3DT0H 1UTMA 5FPYA 4WF8A 1YBWA 2ZEBA 1S6FA 1QGFA 1Y8TA 4MNYA 3SU6A 2QA9E 4ABAA 1DITH 2G5VA 5LPFA 1BTWA 1EZUC 2A4RA 2ZIQH 3F9FA 2QXIA 4DIIH 1FY1A 4ABEA 1TRNA 2STAE 2K1QA 1Z7KA 1FZZA 2FMJA 1DFPA 2ZU5A 4IN1A 1UCYK 4ZKOU 3STJA 7GCHF 3T62A 3N7OA 4BAHB 3O8RA 1AFEH 3BTME 1O2HA 3RXTA 4FU7A 3KN2A 4ISNA 4CRGA 2XBXA 3A7VA 1LKAA 1ZJDA 1Z71A 3RXUA 3EAJA 1O2GH 4UFFH 4DVAU 2Z9JA 2P3UB 3U98H 1BBRE 1CO7E 3HATH 4MPWA 1O2WA 1T7CA 4GUXA 1BTYA 1UK4A 4O97A 1C2IA 2STBE 2ZU4A 1OP0A 2P8OC 1GJDB 1DM4B 4D76A 1GGDB 3BTKE 2ZFRH 3E91A 1AO5A 1G36A 2PUXB 4NA9H 1V6DA 2AMPA 1GJAB 4IC6A 4Z0KA 1PPHE 1S0QA 5JBTA 3ZZDA 1A5HA 4YZUA 3SJOA 1AKSB 2G00A 5SGAE 1B7XB 3BTWE 3LGVA 1J9CH 4I33A 3VXFH 4VGCC 4GSOA 5LPEA 1KXAA 3S9BA 3PLKA 1V2QT 1Y3YA 3NWUA 4INHA 1MAYA 5F8ZA 3SU1A 4XOJA 2IOTA 2GX4A 5JB9S 2BOKA 1P09A 1C5OH 1OP8A 1SOTA 1QIXB 4Y8YA 2Q6FA 1YPHC 1K28D 2ZFTA 1TRYA 1PYTD 4FUGA 1PPFE 3S9CA 3B8JA 1TBZH 1LPGB 3STIA 5K0HA 4OS6A 4RKJB 1GMHF 2PWXA 2BTCE 1HNEE 1J8AA 4X8SH 1ACBE 2WPIS 3A8AA 3TU7H 3SN8A 1NT1A 3S0NA 3SV2H 1EP5A 3BTHE 1MTWA 1F0UA 1TGSZ 1C4Y2 4ZH8A 3T25A 3BTFE 2Z6BD 3RXIA 3SNAA 1SGCA 3RXAA 1P8VC 1TYNA 3QGNB 1WU1A 3ZVFA 2QIQA 1W11U 4UFEH 2J95A 3A80A 3H7OA 1N8OC 5EQSA 1QTFA 2QF3A 3ZZ5A 4AORA 5A8XA 4H6TA 1EXFA 1RXPA 1QB1A 2TGTA 3UNSA 4E7NA 1D3TB 4A1VA 4AN7A 1PPZA 3SNDA 4WMFA 1GVKB 1ZSJA 2FOCA 1UVUH 3UOUA 3A7XA 1UJ1A 5EODA 1KXDA 2BDBA 2BLOA 2BY6X 4CH8B 2YNAA 1ZZZA 2CHAC 3QWCH 1A0HB 4DURA 3A7WA 2BHGA 4LZ4B 1HJ8A 5DPAA 1BA8B 3ATIA 8KME2 5C2ZA 1GI1A 9LPRA 1BCUH 2C8XB 4MNWA 4NSYA 2BDYA 1C5LH 2XWBI 2BZAA 2O8LA 2FXRA 4B75A 5G4BA 1O3EA 1N1LA 1O3MA 2HRVA 2GZ8A 1RFNA 2BD2A 3UQVA 1E34B 1FUJA 1P01A 3KQDA 1QFKH 3RLWH 2BX3A 2O8MA 1D4PB 4YOIA 2Z3DA 2GMTB 4DCDA 5HYOA 2J2UA 1OWHA 1FY8E 3P95A 5JBCS 1O3LA 5T6DA 2ZU2A 5A8ZA 2BY8X 2A2QH 3ZZ7A 2SNVA 3BV9B 2J34A 2GDEH 8LPRA 1O5CB 4X8TH 1TOCB 1A3BH 3D65E 1AI8H 2VIOA 2OD3B 1O3IA 3BSQA 4NZQA 1DDJA 1FMGA 1NRNH 1VCQA 4IW4E 2D1JA 2GZ9A 3RXHA 3GY3A 1MKWK 4ABIA 1SC8U 1GL0E 1C2JA 2QXGA 1UVPA 2XBYA 2OTVA 1C1SA 3CENA 3KGPA 4A7IB 2CF9H 2FM2A 4FVDA 4RN6A 1G9IE 4MNXA 3A86A 1HCGA 4BTUB 4CR9A 5FBIA 4X6PA 3I78A 2VINA 3GYMA 1S83A 1GI6A 1NFWA 2GMTC 3NCLA 1NC6A 1BBRH 1BMAA 3ZVEA 1WTGH 4FUFA 5GPIB 2EC9H 1C5QA 3BIUH 1SQAA 1EOLA 1FJSA 3RXPA 1NFXA 4GVUA 1O35A 4KTCA 3RP2A 2ULLA 1QBVH 1Y5AT 3UIRA 3RU4E 2QXHA 4WJG2 3G01A 3MNCA 1C1VH 2RA0A 1TGCA 3U1JB 5E0GA 1G3BA 2QAAA 3VFEA 4X0WU 1QRXA 2ZO3H 1LDTT 1NN6A 1P05A 2GCHG 4GPGA 1XUKA 3ZYEA 5DG6A 3KF2A 3VB5A 5EXNA 5BRRE 1ELVA 1MCVA 2F83A 5C1YA 3MNSA 3PB1E 1JWTA 1P57B 3GY6A 1EPTB 1A46H 1KYNA 1SLVB 4CBNA 1WCZA 2XXLA 3BTEE 4ISIH 1N6YA 1XXDA 2BY9X 3LDXH 3SGBE 1GDQA 4KKDA 5ESBA 4NWKA 2FP7B 1T4UH 4JZIA 1UO6A 1C9TA 2CV3A 2QGRA 2FOFA 2AGEX 1HAGE 4IMQA 4NZLA 5JYIA 3SJ8A 1MTNC 3RC4A 1GCTC 4F49A 1EZQA 4JK6A 2G4TA 2JETC 2ZG0H 2BXUH 2J4IA 1H4WA 1EPTC 2RG3A 4AYYB 3LU9B 2HVXA 3BTTE 1HDTH 1UTNA 2XCNA 4O03A 3A8CA 2BB4A 4JZFH 1GBLA 3Q3YA 4Y76A 1GMDG 4BAOB 2ZU1A 2FDAA 1CSOE 1XMNB 1HV7A 2F9BH 1O2KA 3E16B 1W10U 3RXKA 1YGCH 3A82A 1ELBA 1EAUA 3QDZB 4INKA 4ZHAA 1E37B 1MAXA 1MCTA 3GCTG 5C1XA 1DXPA 1EUFA 4AGKA 5DK1A 3MMGA 4JMYA 2J94A 1UCYE 4CREA 1NU7B 4IGDA 1HFDA 2BQ7B 5EU8A 1VITH 2FX6A 2BY7X 2P95A 1OKXA 1KSNA 4BTTB 4LXBH 1BRAA 3NZIA 1TPSA 1U6QA 1WYKA 3QN7A 4I7YH 3VB4A 1MKWH 5FAHA 2UWOA 2FI5E 4IS5A 4AGJA 2UUJB 1P2JA 3F9GA 3EA7A 2FS8A 5A09A 1HAZB 3QUMP 3SI4H 1EQ9A 1KDQB 1MD8A 1TX6A 2F9UA 1EJMA 1E36B 3AW1A 4I8KA 1AMHA 5EOKA 1YYY1 1KLTA 3GDVA 1P02A 1Z1JA 2A31A 1QURH 1WQVH 2GDDA 4Y8ZA 1G30B 1V2MT 3PTNA 3T26A 1DWEH 1P3EA 1LCYA 5ETXA 3T2NA 1AY6H 2V3OH 1C1OA 2UUYA 3TGIE 4Y11E 3KIDU 1SG8B 2F9VA 1CU1A 3OX7U 1RTLA 3ZZ4A 1AWHB 1GG6B 5GCHF 4DJZB 1GJ5H 1OWDA 4F4OC 1TWXB 1ZPZA 3SI3H 4TY6A 3W94A 2C8WB 1QL7A 3FVFB 3ODDA 3M7TA 3P8NA 1JIRA 1LQEA 4BAKB 2VJ1A 2Y81A 1C4V2 2R0LA 4HTCH 4FU8A 1H9LB 1EJAA 1FN8A 1JIMA 1Q3XA 1ZTLA 2FYQA 1A4WH 3PMJA 2A4OA 1IQLA 1EZXC 1AFQC 3HGNA 1OXGA 4DW2U 2LPRA 1TNIA 1XXFA 1TPPA 2BXTH 1M9UA 1F7ZA 2ZPRA 1ELDE 1HYLA 1ZSLA 3NXPA 3L33A 1TGTA 1C5WB 3RU4D 1FPCH 2FI3E 4U32A 1K1PA 1BMMH 1T31A 1IAUA 3MI4A 2A1DB 2Y5FA 2ODQA 1GJCB 5ABWA 1GJ8B 5GIBA 5A0BA 3LGYA 4YLQH 1GBEA 1F0RA 2P59A 3GCOA 1VR1H 4D7FA 2WYGA 2IJOB 4TY7A 3LJJA 1GI4A 1HAIH 4JYUH 4Y6DA 4XE4A 1W7GH 2AGIX 1SR5C 3RXLA 3MH4A 4K69A 2D26C 2EEKA 1MTVA 1GDUA 2ZPSA 1PFXC 3ZV8A 2NU4E 3QK1A 1OP2A 1DE7H 1LO6A 1INCA 1EAIA 3O8DA 2OP9A 3PMBB 4K60A 2BX4A 2DUCA 5T3HA 3E90B 1MMJN 1QL9A 5CE1A 3A87A 4Y79A 3VXEH 2ZGBH 4FUBA 1EKBB 2PSYA 1IOEA 3SV8A 1UTOA 4CR5A 1GI7B 2PTCE 3BEIB 3TVJB 2XBWA 1OSSA 3M37A 1NRQH 2Y5GA 3M5NA 4MVNA 2BDCA 3QGJA 1YPHE 2VWOA 1TIOA 4I8HA 7GCHG 2NU0E 4XBCA 3E1XB 3ODFA 1RGQA 1GBCA 3O8CA 1P2NA 1TNHA 4KGAA 2WV5A 1CA8B 3OU0A 1O2SA 2Y5HA 3RM2H 1GBAA 1WSSH 4OGYA 1NRSH 4TPYA 1HAVA 1AHTH 4WMDA 1TFXA 3U1IB 2VWLA 3MU5A 4FUEA 2CHAB 3UFAA 1K1NA 4I8JA 3UUZA 4ISHH 1QRWA 2G51A 4NGAH 1CBWB 3PO1C 1H1BA 2CXVA 3PMHB 3ZVDA 2Q6DA 2H9TH 1KLJH 3TIUA 1HBTH 5L2YH 3F1SB 4D7GA 1ZOMA 1UVTH 2FLBH 4WMEA 2BZ6H 2DE9A 1P9UA 3MU4A 2SGQE 1SGFG 4X6NA 1O0DH 2GCTC 1CA0C 1EX3A 3SHAH 1E35B 1YCPM 4E06H 3UTUH 2ZFPH 1AGJA 2JH0D 3P8OA 3SZNA 4X2VA 4B1TA 3PMAB 4K8YA 4A92A 1SFIA 2HLCA 1AD8H 3RXVA 1S0RA 2BDAA 2A2XH 2W3KA 3RC5A 4X2XA 1AE5A 1V3XA 1O3CA 1ANBA 3TNTA 1TONA 1O2RA 5EW1H 2A5IA 2ZGCA 1T8NA 3B23B 5JBAS 1VJ9U 1E38B 2IN2A 5HM9A 4ABJA 1UK3A 1WAYB 3GCTF 2GVFA 3GDSA 1C9PA 1W0ZU 2VIPA 2FWWA 3EDXB 1BHXF 1O37A 3T27A 1ESBA 1PQ7A 1EJNA 3BF6H 1MUEB 1H8DH 4TYDA 1ZRKA 1BTUA 3UY9A 3U8RH 1Q31A 4FUIA 2ANMH 1N8OB 1UVSH 3SORA 1YPKH 3F6UH 2HNTC 3OY5U 4FVBA 1ELEE 2BYAX 4OS7A 1GDNA 3E8LA 4MLFB 2HGTH 2P8OB 1GHBF 4SGAE 1YCPK 1G3EA 2XRCA 1DY8A 3LJOA 3BG8A 1A3EH 1IQIA 5FX6A 1TBQH 3I29A 5E2OA 1W2KH 1Y5BT 2FO9A 4OGXA 2WUCA 4KTUA 1UHBA 1TPOA 2B8OH 1SGPE 1IHSH 2QYIA 1O3NA 4KTSA 4BXSA 3SJIA 1QHRB 2PUQH 1F92A 2XC0A 1ETRH 2SGEE 4JZDH 1O2TA 2AMQA 1IQMA 1O2IA 1AVGH 3DUXH 1YC0A 5IDKA 2QF0A 1D3QB 1TOMH 1O32A 3SV9A 2ZHDA 1OWJA 2HNTE 4WXIA 2BD8A 3P6ZB 1O2JA 1C5VA 1MU6B 2BLVA 3ZZBA 2UUKB 3FP8E 4B74A 1TB6H 1RJXB 1V2NT 1SPJA 1DX5M 1TNJA 4X1QU 5E8EH 1C5XB 3ATMA 1S85A 2GT8A 1BTZA 2XCFA 3CP7A 2GGVB 1BRCE 2QC2A 2HNTF 2OLGA 1P2IA 2G52A 5A2MH 3RUOA 4MPVA 4X8UH 1CGIE 2F3CE 1IQGA 1EZSC 5TCAA 5DP9A 1MQ6A 3Q76A 4ESTE 1H9IE 5EQRA 3AAVA 1SLXB 3RXQA 3SU5A 4A1XA 1GJ4H 1HJ9A 2A5AA 2ESTE 4O3TA 1AU8A 3SQHE 1D3PB 2QN5T 1C5YB 2Z94A 3BEUA 3ITIA 1Y59T 4AB8A 1S5SA 3A85A 1V2OT 1ARCA 1BTHH 2WPLS 4ZMAH 1GMCF 1FPHH 1O5EH 4CBOA 3VB6A 3BTDE 1O3KA 2H6MA 3UR9A 4OS4A 4NSVA 4ZHMU 4A6LA 1BJVA 1PPGE 3A88A 3TNSA 3EA9A 3A84A 4CHAB 2JH6D 4NIWA 3PWBA 1V2UT 5EW2H 2H9HA 2ZI2H 1GVLA 3P8FA 4JZEH 4X1SU 2ZDKA 2ZDVH 2A0QB 1T4VH 1EB1H 1FIWA 2ZHFH 2VIDA 4NFEA 3SUGA 3S7HB 1ZHRA 2FTLE 1S84A 3KNXA 2ZFQH 2B7DH 3TJOA 1NRRH 4WH8A 4ZAEA 1RIWC 1QB6A 1RTFB 2ZECA 1ORFA 5AFYH 2A7JA 3FP6E 4AX9H 1MTNB 2PV9B 1CA0B 2GCTB 5CHAC 2VGCB 1BOQA 1A61H 3V3MA 1A1RA 1GL1A 5C3NA 1LTOA 3I77A 3K2UA 2J9NA 1K1IA 2FOMB 1HAPH 2H9EH 2HWLB 4INLA 1GJ9B 1MBQA 2TBSA 3SU4A 3LH1A 5EQQA 5DO4H 4DG4A 4YM9A 3PO1B 2V3HH 2BD9A 2P94A 1NESE 2ZQ1A 1SVPA 1FQ3A 2P16A 4GHTA 4B71A 3K9XB 3SGQE 1P04A 1RTKA 3U8OH 3SQEE 1VGCC 1Z6JH 3RU4T 4Q80A 2FEQH 1SHHB 1A5IA 2OXSA 1LHDH 1C1QA 1CE5A 2LNCA 4CHAC 1C4U2 1FI8A 1UK2A 1AB9B 2SNWA 1Z8GA 3TJNA 1X7AC 5J4SA 2FS9A 2WINI 4NA7A 3TH3H 3KL6A 1QQ4A 2BVRH 2B0FA 4K2YA 4AYVB 3UQOA 1KXFA 3RXFA 1NO9H 4E05H 1TNKA 2BMGB 2FESH 1UHBB 5BPEA 3SBKA 1QA7A 4ABGA 1A0LA 1DT2A 1OWEA 2XC4A 5EG4A 1FY3A 2A4QA 1QJ1B 1WQSA 1K9OE 4R0IA 3JZ2B 4UE7H 4J2YB 3FFGA 5DJ7A 3VB7A 1C1PA 3SGAE 2XWAA 3BIVH 1C1RA 2O8WA 1DY9A 1JXPA 1DLEA 1A5GH 4XSKU 1VCWA 1Z8IB 1DLKB 2KAIA 3A7TA 3PYHA 3LOXA 3CS0A 1XVOA 1O2VA 2H5CA 1DSUA 3ZYDA 2W26A 2ZTXA 3VGCC 5LPRA 2RCEA 3MO6A 1TA6A 2FI4E 1O2YA 1ZTKA 2FIRH 4BNRA 3Q3KA 3HKJB 4Y7AA 2ZTZA 2EI7A 5GXPA 2ZPQA 1SQOA 1IQNA 1W0YH 3QTOH 1GBTA 3BG4C 4ZKRU 3NK8A 3SU2A 2HOBA 2ZU3A 3JZ1B 3E3TA 1TE0A 3GCHB 1O38A 1C2GA 3GICB 3B9FH 1G3CA 2C93B 2HPPH 4ZKNU 2XBVA 1KIGH 5GJ4B 2ZF0H 1TNGA 3A81A 3PLPA 3ZZ6A 1HGTH 3HPTB 1P10A 1EP6A 5K7RA 1NS3A 1V2KT 2R3UA 3NKKA 2AEIH 3TPIZ 1AFQB 1O3GA 2G8TA 3LGTA 3A7YA 2NU3E 2P3FH 1JMOH 4Y10E 4ZHLU 5EXLA 3FZDA 1GJBB 1V2JT 3EYDA 3SV6A 3RXJA 1LPKB 8ESTE 3SUDA 1KXBA 1RS0A 3Q77A 3VPKA 5I25A 1GI5A 1TX8A 4ABDA 1TPAE 2YOLA 3TGJE 5EPYA 1YPMH 2C8ZB 2OINA 2V6NA 1GHZA 5C20A 3VB3A 2ZDLA 7LPRA 4D8NA 4I31A 4OS5A 4ZROA 1ARBA 1IQJA 2BY5X 1FAXA 4CRDA 3MNBA 4UEHH 3BN9A 1GHYH 2Z3CA 3MH6A 1QBNA 3ATWA 1ZMNA 1LHCH 3DA9B 1J16A 4HZHA 1FNIA 2EI8A 4CRAA 1JBUH 1OX1A 1WV7H 1SQTA 1ANDA 1O5BB 3F68H 1O2PA 1VGCB 1PPCE 4SGBE 4K8BA 5LGOA 1W7XH 4O9VA 4CRBA 2AIPA 2ILNA 2AIQA 3SO3A 2ZCKP 4RKOB 2XC5A 1GBBA 1K1LA 3AW0A 3RM0H 4FUJA 4KP0A 1XX9A 1CGJE 1SSXA 1TLDA 2BLWA 1BDAA 3DHKH 4JYVH 4B2BA 1L2EA 2AYWA 1Z6EA 2G4UA 1ZPCA 1JRSA 3DFLA 4X8VH 3A8BA 1LPZB 2TPIZ 2ZCHP 4AZ2B 1GBHA 5B6OA 2TGAA 1ABIH 4YOJA 2WPHS 3T5FH 1F0SA 2V35A 1W12U 4ISOA 4HGCA 1OYTH 1C1NA 4UFDH 2CN0H 1P2QA 2TGDA 4X6OA 1C5MD 3ATLA 4WVPE 1SGEE 5FPSA 4NIXA 3UOPA 4Y0YE 3RXOA 1KTSB 2GV6A 1SOZA 6LPRA 1J17T 1GVZA 5JBBS 3UWIA 3GYLB 3AVZA 3TK6A 1GI0A 3UREA 2F91A 3ENSB 1YM0A 1ETTH 1BUIA 3EGKH 1GPZA 1DWCH 1XUFA 2BVXH 4MG3A 5TJXA 4Y8XA 2HALA 4UD9H 6GCHG 4H6SB 1GJ7B 1XKBC 1YPGH 4GCHF 2QY0B 5EXMA 1SMFE 4X1RU 1LVYA 2OC1A 2G81E 1CT4E 3S7KB 1O2ZA 1P2MA 1QRZA 3ZZAA 5F8TA 3KCGH 4U30A 1RRKA 5PTPA 2RDLA 3L6PA 5L30H 1QY6A 4KELA 1HPGA 4WY3A 2OQUA 1QA0A 2PLXA 3SU0A 4DGJA 5FXLA 1TMUH 1ZPBA 2ZC9H 4UDWH 3SHCH 1KTTB 3Q3XA 1WOFA 1G37A 4XFQA 1IQKA 1HXEH 2JH5D 3SUEA 1MKXH 2BQWB 1IQEA 4ABHA 1ETSH 2R3YA 1O3OA 3T28A 3AAUA 1D3DB 1ELCA 5C67A 1AKSA 5L6NH 2KAIB 4Q7YA 1GHBG 2OC7A 5LH8A 2BDGA 2PKSB 1GI8B 2VVVA 2BDIA 3R3GB 3ELAH 3S69A 1LHEH 3FANA 1O2QA 1T8MA 1UTJA 1TBRH 2C3SA 1QB9A 2AMDA 4ZKSU 4AFSA 7ESTE 5H4IB 2SFAA 3M35A 1DANH 1BRBE 2F9PA 1HAHH 1BITA 3HGPA 3MOCA 1S6HA 2ZHEH 4AOQA 1ELFA 1T8OA 1THSH 1GHAG 1CGHA 1W13U 2GKVE 4J1YA 1P06A 1GHAF 1T32A 4D9QA 1O3DA 2CF8H 1WUNH 3K65B 1C5UA 1EOJA 3PM3A 3UNRA 2PGBB 1YPLH 4FU9A 1FAKH 1O2MA 1TMTH 4OS1A 5A0AE 1FV9A 1SGRE 1HJAB 4WXVA 4DT7B 2NWNA 3A8DA 2VVCA 1O34A 3FP7E 8GCHG 2WPJS 1KDQA 4CRFA 1ZGIA 4TWWA 1BQYA 9ESTA 3ESTA 1BT7A 1CT2E 2FYRA 1QJ7B 1TGNA 2OCVB 3URDA 5DP5A 1FXYA 4HI3A 1C1UH 3M61U 2Z7FE 2VWMA 5C5NA 1MTUA 1GI9B 1W8BH 3EQ0H 2I6SA 3F9HA 1FY5A 2DE8A 1GG6C 3AASA 1SB1H 3GISB 1EAWA 1FLEE 1ZTJA 4BAMB 5A8YA 1IQHA 2AH4X 1QR3E 3P70B 1PPBH 5DP4A 1G3DA 1D9IA 4ZXXH 2SGFE 5EPNA 5AHGH 4GLYA 4LK4A 4BANB 4NIVA 2Y80A 2QXJA 1C2DA 4D9RA 5EGMA 4H4FA 2YNBA 4XBBA 3SNBA 5DP8A 2ZTYA 3L3TA 3D62A 1QJ6B 2HPQH 4YO9A 1YP9A 1C1MA 3TK9A 1P11E 1KLIH 2GV7A 3ZVAA 5DKMA 1CT0E 1MQ5A 5T6GA
chains in the Genus database with same CATH superfamily
4Z6AH 4JCNA 4YESB 3R0FA 1OYQA 1GI3A 1UW7A 1GCTB 4X1NU 3MNXA 1CQQA 3PWCA 1K1MA 4B2CA 4AG1A 4K5ZA 1V2VT 2GZ7A 2VIWA 3WY8A 2PR3A 1TRMA 1MZAA 1K2I1 1SGYE 2F9OA 2FOEA 1CHOG 3ATKA 1BIOA 3LONA 2UWPA 2R9PA 1YKTA 2YMSD 3CS7A 2KCOA 3P17H 1XVMA 2PTNA 1L0ZA 1LVBA 1XUGA 1O5DH 3F9EA 3EE0B 3MO3A 1HLTH 1TAWA 1O2NA 1Y3WA 1AB9C 4OS2A 3GOVB 1C2HA 1ZLRA 2J92A 3LC5A 3TH2H 4ZUHA 1BZXE 3A89A 3KHVA 3C27B 3LPRA 4P02A 1THPB 4CH2B 1H8IH 5CHAB 3QTVH 1OOKB 3T29A 2EA3A 2Y82A 4AFZA 4TPIZ 2YMSC 1L4ZA 2CGAA 1HAVB 5AVDA 4AFUA 4U2WA 3RXEA 2GP9B 3GY8A 1F0TA 3FAOA 1P0SH 4K1EA 4R8TB 4ZXYH 3SNCA 3ZVGA 3TGKE 2QV1A 3DD2H 1A7SA 1E0FD 1C2FA 2A7CA 5TCCA 1ZHMA 1P2OA 3RXRA 2WYJA 1HAXB 1MH0A 2VH6A 5GCHG 2AGGX 3OYPA 2V7QD 1B0EA 3O8BA 1FN6A 1GBKA 3RXDA 1ZYOA 1TA2A 1MZDA 2J38A 1MU8B 1PQ5A 1THRH 3TJUA 1DPOA 5AF9H 3BG4B 1AVWA 1ZR0A 4I86A 1SGIB 5JB8S 3SV7A 1J15A 4AG2A 3IG6B 3F2HA 1DVAH 1BMFD 5DP3A 6CHAC 1DICA 4ABBA 4NFFA 2V3MA 1NROH 1EASA 2PP6A 1BJUA 1YPEH 1V2WT 3RMLH 2A32A 1NU9A 4DY7B 2Z9LA 4CRCA 3D49H 1C2LA 4LOYH 3LC3A 4BOHA 3QLPH 4LZ1H 1CHOF 1KXEA 2ZNKH 4MPUA 1YLCA 5HMAA 3RXSA 3MU1A 1XKAC 2B9LA 1NPMA 2KR7A 2ZDMA 4GCHG 3URCA 5E0HA 1Y3UA 6CHAB 2H1UA 3M7QA 3V7TA 1OS8A 1O3JA 1C5SA 1ELAA 2G5NA 2GTBA 1SGQE 2FOBA 1AVXA 3A83A 5DGJA 4HG6A 1ID5H 3SU3A 3EE7A 1EPTA 2CJIA 1K21H 3QO6A 2QCYA 4JZ1A 1UTQA 1BTXA 1K22H 2XOKD 4MQAA 2THFB 2ZDNA 3U8TH 1AZ8A 1HUTH 2A4GA 5DP7A 4IMZA 1C5NH 3ZZ8A 2Z9KA 1L1JA 1B0FA 2FPZA 2FTMA 3HKIB 1V2LT 1MTSA 3SOSA 1AWFH 3QZRA 3GY2A 2OBQA 3M3TA 4AB9A 1PPEE 5HGGA 2WV4A 3E0PB 2Z3EA 2JDID 1T8LA 1C5ZB 5FCRA 4M9FA 6ESTA 3U69H 3MFJA 1XUIA 5FPTA 2W6JD 1PJPA 1HJAC 1XM1A 3QX5H 3RDZA 1JOUB 1C5TA 3BTQE 1ANEA 3KQBA 4FUCA 3K6ZA 3PV4A 1O5AB 2NU2E 1VKYA 3NUMA 4IBLH 5JDUB 1O39A 3SW2B 1EAXA 1V2TT 1AQ7A 2BLQA 5HM2A 3UR6A 2B5TB 3RXBA 5EJLA 4DIHH 1DWDH 4VGCB 2ZZUH 4B2AA 2C4FH 1BMNH 1SFQB 1S82A 2Q1JA 2O8TA 3MYWA 3U9AH 3WWBA 3E6PH 3DFJA 2WPMS 1O2UA 1RIWB 2KCYA 1G32B 1SBWA 2BM2A 3LT3A 2FLRH 1C5RA 1ABJH 2PFEA 1GMHG 1BBRK 4AFQA 1SGDE 3SUFA 1C2KA 1SL3A 1TQ7B 4FUHA 3M5OA 4QT8C 3RMOH 2ZP0H 2ALPA 1HAOH 3EA8A 1VJAU 1GBJA 1SGFA 5GNDA 4RSPA 5E2PA 1AUTC 3V0XA 3GY5A 3PRBA 1GBIA 1O5GH 2VGCC 3SJ9A 5CDFE 5I46H 2GD4B 2VH0A 1TQ0B 2VU8E 3UPEA 5C5OA 4ABFA 1NBMD 2ZA5A 1SGNE 1TGBA 2W7UA 1KY9A 1D6WA 1O31A 4JK5A 4Q7XA 1MBMA 1F5LA 2SGAA 1GJ6A 1CBWC 3IITA 3TH4H 1EATA 3HK6B 2Z9IA 2XTTB 2ASUB 1YF4A 1DSTA 3RXGA 5F8XA 1VCPA 1LVMA 1Y3XA 1HB0B 1GBDA 1XUJA 5L2ZH 5GDSH 4NIYA 1OWIA 5IYTA 3PLBA 5ESTE 3GY4A 3KEEA 2I6QA 2VWNA 1HRTH 3RMNH 1MD7A 2L74A 1C5PA 5HXFA 3H7TA 1COWD 2JJ1D 4O3UA 3TJVA 3FO8D 1VZQH 2FOHA 2R2WU 5EJZA 2VIVA 1GHVH 1B5GH 1SI5H 4U01A 1HIAA 2A5KA 1J14A 1KXCA 2PKSC 3K6YA 1O2OA 1CHGA 1VITG 3MU8A 2BD7A 1SQRA 3RXMA 4YT6H 1H9HE 1K1OA 2FZZA 3BTGE 5J4QA 1ANCA 1C1WH 4MPXA 1EB2A 4NWLA 5CMXH 2BOHB 1O3PB 1Y5UT 4MTBA 4YT7H 1P12E 1BHXB 2OUAA 2G55A 4MNVA 1S81A 1V2RT 1O3FA 1UTKA 4YLUA 1DUAA 1N6XA 1ELTA 1O3BA 1Z8JB 1AIXH 1TALA 2BVSH 1PYTC 2H5DA 3QZQA 4TSFD 4K1SA 1L1NA 2D8WA 1QCPA 4K1TA 1NTPA 1WTHD 1P3CA 1W0KD 2BDHA 2JJ2D 3H5CB 2TRMA 3F2FA 4ASHA 2FOGA 1P9SA 4NA8A 2C90B 1O30A 1ZMLA 2RA3A 1OWKA 3MU0A 1DUEA 1AE8H 1SLWB 1G2LA 5DP6A 1QQUA 2VB0A 4RT1A 2AERH 2BD4A 6GCHF 1NM6A 4YOGA 3OTJE 1HXFH 2A7HA 2PGQB 2W7SA 2XNIA 1W14U 1TMBH 4GHQA 2UWLA 4X2WA 5JPMH 2R0KA 1LHFH 3UWJH 3FOAA 4ASUD 1O33A 3ZVBA 3MHWU 4A1TA 2AHME 1E1QD 4X6MA 2PKAB 3HK3B 1OPHB 3IWMA 3LGIA 2ODPA 3A7ZA 3ZZCA 2M5TA 3LKWA 4BAQB 4Q63A 3RXCA 2BD3A 4Q7ZA 2C8YB 2ODYB 2ZCLP 2O9QA 2UUFB 1FIZA 3RMMH 1F5RA 1YCPH 3NPSA 4FOUC 2ANYA 4E7RG 3MH7A 2JETB 1UVOA 3M5LA 3ZIAD 2Q6GA 2ZHWH 4THNH 3W95A 4ACAA 1GHWH 5AFZH 3V13A 4BXWA 2V0BA 2OC8A 1SKYE 1GWAA 3GCHC 3SNEA 3GCNA 2P3TB 3GY7A 3SJKA 1GBFA 2Z9GA 1ZSKA 1NFYA 1DS2E 2AFQB 1JRTA 4UONA 5F6MA 4IC5A 1GI2A 4FXGH 2OK5A 4X2YA 2VNTA 1A0JA 4H42U 4Y0ZE 2Y6TA 1RD3B 5C1UA 1UMAH 1GHXH 1UTPA 3ZV9A 1DWBH 1BTPA 4X1PU 2A45B 1AZZA 1LVOA 1P03A 3C1KA 3M3VA 1NRPH 4BTIB 3ZZ9A 1LHGH 1L4DA 1TX7A 3OE7D 3FZZA 1ELGA 4NCYA 2BD5A 2SGPE 4NG9H 1PQ8A 2Y7XA 1O36A 1NY22 2ZWLH 3UAIC 2XW9A 3LGUA 1GMDF 3BEFB 1IQFA 2VVUA 4IN2A 1CVWH 2PW8H 5F03A 2EQNA 2ZKSA 4TWYA 4I8LA 5T1VA 1FONA 3M3SA 8GCHF 2FODA 2GCHF 3S9AA 1GBMA 4MDSA 1LMWB 4JYTA 3VEQB 3E0NB 1ESAA 4B76A 5KECA 3OSYA 1QNJA 3OY6U 3TITA 1GCDA 1DOJA 4Q2KA 2TIOA 2ZFSA 1ZJKA 2GT7A 3RC6A 1BB0B 1XUHA 1WBGB 2VIQA 1LQDB 3PTBA 5FCKA 1P2KA 3KQEA 1SGTA 3TLOA 1IHTH 2LELA 2Y7ZA 2ZGJA 2ZDAH 3KQCA 1NZQH 2PSXA 1HAYB 3N7DA 1Q2WA 3ZZ3A 1ZGVA 4PROA 1HIAB 1GGDC 2PHBA 2PKAA 2AS9A 1GMCG 1YPJH 4ISLA 5EJ1A 1AUJA 1O2XA 2SGDE 1YLDA 1D6RA 1NFUA 2EI6A 1PQAA 4WWYA 2KZ4A 5A0CA 7KMEH 1SLUB 4XBDA 2XYAA 3M5MA 1C1TA 2KCAA 2BQ6B 3D23A 1G2MA 2FX4A 1O3AA 2ZQ2A 2R2MB 1Z1IA 4K3JA 1C2MA 1C2EA 1W3CA 2OC0A 5HKKD 3MO9A 1LKBA 5E0JA 5T6FA 2KM0A 4FUDA 2ANKH 4I32A 3GDUA 3VGCB 3P8GA 2OBOA 3OEED 2RFKC 3ZVCA 2ZGXH 4A5TS 4B73A 2ZFFH 2ZHQH 1L1GA 2FOAA 3PROA 2ALVA 3LH3A 1ZHPA 4UFGH 3P92A 1Z8RA 1V2ST 4HFPB 2J97A 2H2ZA 1BMLA 1TNLA 1Y3VA 3MTYA 2W3IA 1UCYH 1AN1E 1V2PT 4GAWA 4WH6A 1VITF 2P93A 2W5EA 2CMYA 4DOQA 1F5KU 1F2SE 1O2LA 2XNDD 3F0OA 3LGWA 4M7GA 5FX5A 2NU1E 2TGPZ 3PRDA 2O8UA 3UNQA 1FDPA 5FBEA 2F9NA 2OQ5A 4I8GA 1BRUP 1ZRBA 1FY4A 2RDEA 3M7UA 3M36A 5FHTA 2IPHA 1ESTA 1TABE 3Q00A 4YTAA 4Y7BA 3AK5A 3MWIU 3OEHD 1O3HA 3TK5A 1QL8A 1SHYA 5B6LA 2ANWA 3RLYH 4XDEA 2D2DA 1ZMJA 5GWZA 2WUBA 1A2CH 1UTLM 1O5FH 3MH5A 4Y71A 1DXWA 1K1JA 1QBOA 3V12A 2JKHA 1MKXK 2ZGHA 3LIWA 2WPKS 3DT0H 1UTMA 5FPYA 4WF8A 1YBWA 2ZEBA 1S6FA 1QGFA 1Y8TA 4MNYA 3SU6A 2QA9E 4ABAA 1DITH 2G5VA 5LPFA 1BTWA 1EZUC 4YXWD 2A4RA 2ZIQH 3F9FA 5DN6D 2QXIA 3DCLA 4DIIH 1FY1A 4ABEA 1TRNA 2STAE 2K1QA 1Z7KA 1FZZA 2FMJA 1DFPA 2ZU5A 4IN1A 1UCYK 4ZKOU 3STJA 7GCHF 3T62A 3N7OA 4BAHB 3O8RA 1AFEH 3BTME 1O2HA 3RXTA 4FU7A 3KN2A 4ISNA 4CRGA 2XBXA 3A7VA 1LKAA 1ZJDA 1Z71A 3RXUA 3EAJA 1O2GH 4UFFH 4DVAU 2Z9JA 2P3UB 3U98H 1BBRE 1CO7E 3HATH 4MPWA 1O2WA 1T7CA 4GUXA 1BTYA 4ACBA 1UK4A 4O97A 4OM9A 1C2IA 2STBE 2ZU4A 1OP0A 2P8OC 1GJDB 1DM4B 4D76A 1GGDB 3BTKE 2ZFRH 3E91A 1AO5A 1G36A 2PUXB 3WW7A 4NA9H 1V6DA 2EY4C 2AMPA 1GJAB 4IC6A 4Z0KA 1PPHE 1S0QA 5JBTA 3ZZDA 5C0UA 1A5HA 4YZUA 3SJOA 1AKSB 2G00A 5SGAE 1B7XB 3BTWE 3LGVA 1J9CH 4I33A 3VXFH 4VGCC 4GSOA 5LPEA 1KXAA 3S9BA 3PLKA 1V2QT 1Y3YA 3NWUA 4INHA 1MAYA 5F8ZA 3SU1A 4XOJA 2IOTA 2GX4A 5JB9S 2BOKA 2JIZD 1P09A 1C5OH 1OP8A 1SOTA 1QIXB 4Y8YA 2Q6FA 1YPHC 1K28D 2ZFTA 1TRYA 1PYTD 4FUGA 1PPFE 3S9CA 3B8JA 1TBZH 1LPGB 3STIA 5K0HA 4OS6A 4RKJB 1GMHF 2PWXA 2BTCE 1HNEE 1J8AA 4X8SH 1ACBE 2WPIS 3A8AA 3TU7H 3SN8A 1NT1A 3S0NA 3SV2H 1EP5A 3BTHE 3OTPA 1MTWA 1F0UA 1TGSZ 1C4Y2 4ZH8A 3T25A 3BTFE 2Z6BD 3RXIA 3SNAA 1SGCA 3RXAA 1P8VC 1TYNA 3QGNB 1WU1A 3ZVFA 2QIQA 1W11U 4UFEH 2J95A 3A80A 2J98B 3H7OA 1N8OC 5EQSA 1QTFA 2QF3A 3ZZ5A 4AORA 5A8XA 4H6TA 1EXFA 1RXPA 2J5UA 1QB1A 2TGTA 3UNSA 1D3TB 4E7NA 2HLDD 4A1VA 4AN7A 1PPZA 3SNDA 4WMFA 1GVKB 1ZSJA 2FOCA 1UVUH 3UOUA 3A7XA 1UJ1A 5EODA 1KXDA 2BDBA 2BLOA 2BY6X 4CH8B 2YNAA 1ZZZA 2CHAC 3QWCH 1A0HB 4DURA 3A7WA 2BHGA 4LZ4B 3DSPA 1HJ8A 5DPAA 1BA8B 3ATIA 8KME2 5C2ZA 1GI1A 9LPRA 1BCUH 2C8XB 4MNWA 4NSYA 2BDYA 2QF5A 1C5LH 2BZAA 2O8LA 2XWBI 2K8IA 2FXRA 4B75A 5G4BA 1O3EA 1N1LA 1O3MA 2HRVA 2GZ8A 1RFNA 2BD2A 3UQVA 1E34B 1FUJA 1P01A 3KQDA 1QFKH 3RLWH 2BX3A 2O8MA 1D4PB 4YOIA 2Z3DA 2GMTB 4DCDA 5HYOA 2J2UA 5KGOA 1OWHA 1FY8E 3P95A 5JBCS 1O3LA 5T6DA 2ZU2A 5A8ZA 2BY8X 2A2QH 3ZZ7A 2SNVA 3BV9B 2J34A 2GDEH 8LPRA 1O5CB 4X8TH 1TOCB 1A3BH 3D65E 1AI8H 2VIOA 2OD3B 1O3IA 2KFWA 2LP6A 3BSQA 4NZQA 1DDJA 1FMGA 1NRNH 1VCQA 4IW4E 2D1JA 2GZ9A 3RXHA 3GY3A 1MKWK 4ABIA 1SC8U 1GL0E 1C2JA 3DSGA 2QXGA 1UVPA 2XBYA 2OTVA 1C1SA 3CENA 3KGPA 4A7IB 2CF9H 2FM2A 4FVDA 4RN6A 1G9IE 4MNXA 3A86A 1HCGA 4BTUB 4CR9A 5FBIA 4X6PA 3I78A 2VINA 3GYMA 1S83A 1GI6A 1WXRA 1NFWA 2GMTC 3NCLA 4F55A 1NC6A 1BBRH 1BMAA 3ZVEA 1WTGH 4FUFA 5GPIB 2EC9H 1C5QA 3BIUH 1SQAA 1EOLA 1FJSA 3RXPA 3SYJA 5C17A 1NFXA 4GVUA 1O35A 4KTCA 3RP2A 2ULLA 1QBVH 1Y5AT 3UIRA 3RU4E 2QXHA 4WJG2 3G01A 3MNCA 1C1VH 2RA0A 1TGCA 3U1JB 5E0GA 1G3BA 2QAAA 3VFEA 4X0WU 1QRXA 2ZO3H 1LDTT 1NN6A 3F2GA 1P05A 3U28C 2GCHG 4GPGA 1XUKA 3ZYEA 2WZQA 5DG6A 3KF2A 4P00A 3VB5A 5EXNA 5BRRE 1ELVA 1MCVA 2F83A 5C1YA 3MNSA 4TT3D 3PB1E 1JWTA 1P57B 3GY6A 1EPTB 1A46H 1KYNA 1SLVB 4CBNA 1WCZA 2XXLA 3BTEE 4ISIH 1N6YA 1XXDA 2BY9X 3LDXH 3SGBE 1GDQA 4KKDA 5ESBA 4NWKA 2FP7B 1T4UH 4JZIA 1UO6A 1C9TA 2CV3A 2QGRA 2FOFA 2AGEX 1HAGE 4IMQA 4NZLA 5JYIA 3SJ8A 1MTNC 3RC4A 1GCTC 4F49A 1EZQA 4JK6A 2G4TA 2JETC 2ZG0H 2BXUH 2J4IA 1H4WA 1EPTC 2RG3A 3F0PA 4AYYB 3LU9B 2HVXA 3BTTE 1HDTH 1UTNA 2XCNA 4AC9A 4O03A 3A8CA 2BB4A 4JZFH 1GBLA 3Q3YA 4Y76A 1GMDG 4BAOB 2ZU1A 2FDAA 1CSOE 1XMNB 1HV7A 2F9BH 1O2KA 3E16B 2WHXA 1W10U 3RXKA 1YGCH 3A82A 1ELBA 1EAUA 3QDZB 4INKA 4ZHAA 1E37B 1MAXA 1MCTA 2YMSB 3GCTG 5C1XA 5C94A 1DXPA 1EUFA 4AGKA 5DK1A 3MMGA 4JMYA 2J94A 1UCYE 4CREA 1NU7B 4IGDA 1HFDA 2BQ7B 5EU8A 1VITH 2FX6A 2WPDD 2BY7X 2P95A 1OKXA 1KSNA 4BTTB 4LXBH 1BRAA 3NZIA 1TPSA 1U6QA 1WYKA 3QN7A 4I7YH 3VB4A 1MKWH 5FAHA 2UWOA 2FI5E 4IS5A 4AGJA 2UUJB 1P2JA 3F9GA 3EA7A 2FS8A 5A09A 1HAZB 3QUMP 1H8HD 4F48B 3SI4H 1EQ9A 1KDQB 1MD8A 1TX6A 2F9UA 1EJMA 1E36B 3AW1A 4I8KA 1AMHA 5EOKA 1YYY1 1KLTA 3GDVA 1P02A 3SZEA 1Z1JA 2A31A 1QURH 1WQVH 2GDDA 4Y8ZA 1G30B 1V2MT 3PTNA 3T26A 1DWEH 1P3EA 1LCYA 5ETXA 3T2NA 1AY6H 2V3OH 1C1OA 2UUYA 3TGIE 4Y11E 3KIDU 1SG8B 2F9VA 1CU1A 3OX7U 1RTLA 3ZZ4A 1AWHB 1GG6B 5GCHF 4DJZB 1GJ5H 1OWDA 4F4OC 1TWXB 1ZPZA 3SI3H 4TY6A 3W94A 2C8WB 1QL7A 1YWUA 3FVFB 3PV5A 3ODDA 3M7TA 3P8NA 1JIRA 1LQEA 4BAKB 2VJ1A 2Y81A 1C4V2 3N99A 1KMHB 2R0LA 3N7EA 4HTCH 3OFND 4FU8A 1H9LB 1EJAA 1FN8A 1JIMA 1Q3XA 1ZTLA 2FYQA 1A4WH 3PMJA 2QE7D 2A4OA 1IQLA 1EZXC 1AFQC 3HGNA 1OXGA 4DW2U 2LPRA 1TNIA 1XXFA 1TPPA 2BXTH 1M9UA 1F7ZA 2ZPRA 1ELDE 1HYLA 3NRLA 1ZSLA 3NXPA 3L33A 1TGTA 1C5WB 3RU4D 1FPCH 2FI3E 4U32A 1K1PA 1BMMH 1T31A 1IAUA 3MI4A 2A1DB 2Y5FA 2ODQA 1GJCB 5ABWA 1GJ8B 2IPQX 2WV9A 3KQ5A 5GIBA 5A0BA 3LGYA 2KCPA 4YLQH 1GBEA 1F0RA 2P59A 3GCOA 1VR1H 4D7FA 2WYGA 2IJOB 4TY7A 3LJJA 1GI4A 1HAIH 4JYUH 4Y6DA 4XE4A 1W7GH 2AGIX 1SR5C 3RXLA 3MH4A 1OHHD 4K69A 2D26C 2EEKA 1MTVA 1GDUA 2ZPSA 1PFXC 3ZV8A 2NU4E 3QK1A 1OP2A 1DE7H 1LO6A 1INCA 1EAIA 3O8DA 2OP9A 3PMBB 4K60A 2BX4A 2DUCA 5T3HA 3E90B 1MMJN 1QL9A 5CE1A 3A87A 4Y79A 3VXEH 2ZGBH 5FL7D 4FUBA 1EKBB 2PSYA 1IOEA 3SV8A 1UTOA 4CR5A 1GI7B 2PTCE 3BEIB 3TVJB 2XBWA 1OSSA 1E1RD 2WSSD 3M37A 1NRQH 2Y5GA 3M5NA 2KX4A 4MVNA 2BDCA 3QGJA 1YPHE 2VWOA 1NBME 1TIOA 4I8HA 7GCHG 2NU0E 4XBCA 3E1XB 3ODFA 1RGQA 1GBCA 3O8CA 1P2NA 1TNHA 4KGAA 2WV5A 1CA8B 3OU0A 1O2SA 2Y5HA 3RM2H 1GBAA 1WSSH 4OGYA 1NRSH 4TPYA 1HAVA 1AHTH 1QZ8A 4WMDA 1TFXA 3U1IB 2VWLA 3MU5A 4FUEA 2CHAB 3UFAA 1K1NA 4I8JA 3UUZA 4ISHH 1QRWA 2G51A 4NGAH 1CBWB 3PO1C 4RI0A 1H1BA 1EFRD 2CXVA 3PMHB 3ZVDA 2Q6DA 1FX0B 2H9TH 1KLJH 3KYGA 3TIUA 1HBTH 5L2YH 3F1SB 4D7GA 1ZOMA 1UVTH 2FLBH 4WMEA 2BZ6H 2DE9A 2K0QA 1P9UA 3MU4A 2SGQE 1SGFG 4X6NA 1O0DH 2GCTC 1CA0C 1EX3A 3SHAH 1E35B 1YCPM 4E06H 3UTUH 4ZCNA 2ZFPH 1AGJA 2JH0D 3P8OA 3SZNA 4X2VA 4B1TA 3PMAB 4K8YA 4A92A 1SFIA 2HLCA 1AD8H 3RXVA 5HIZA 1S0RA 2BDAA 2A2XH 3FKSD 2W3KA 3RC5A 4X2XA 1AE5A 1V3XA 1O3CA 1ANBA 3TNTA 1TONA 1O2RA 5EW1H 2A5IA 2ZGCA 1T8NA 3B23B 5JBAS 1VJ9U 1E38B 2IN2A 5HM9A 4ABJA 1UK3A 1WAYB 3GCTF 2GVFA 3GDSA 1C9PA 1W0ZU 2VIPA 2FWWA 3EDXB 1BHXF 1O37A 3T27A 1ESBA 1PQ7A 1EJNA 3BF6H 1MUEB 1H8DH 4TYDA 1ZRKA 2HVYB 1BTUA 3UY9A 3U8RH 1Q31A 4FUIA 2ANMH 1N8OB 1UVSH 3SORA 1YPKH 3F6UH 2HNTC 3OY5U 4FVBA 1ELEE 2BYAX 2F4LA 4OS7A 1GDNA 2J98A 3E8LA 4MLFB 4Q4LA 2HGTH 2P8OB 1GHBF 4SGAE 1YCPK 1G3EA 2XRCA 1DY8A 3LJOA 3BG8A 1A3EH 1IQIA 5FX6A 1TBQH 3I29A 5E2OA 1W2KH 1Y5BT 2FO9A 4OGXA 2WUCA 4KTUA 1UHBA 1TPOA 2B8OH 1SGPE 1IHSH 2QYIA 1O3NA 4KTSA 4BXSA 2VBCA 1QHRB 2PUQH 1F92A 2XC0A 3SJIA 1ETRH 2SGEE 4JZDH 1O2TA 2AMQA 1IQMA 1O2IA 1AVGH 3DUXH 1YC0A 5IDKA 2QF0A 1D3QB 1TOMH 1O32A 3SV9A 2ZHDA 1OWJA 2HNTE 4WXIA 2M2AA 2BD8A 3P6ZB 1O2JA 1C5VA 1MU6B 2BLVA 3ZZBA 2UUKB 1S6LA 3FN8A 3FP8E 4RT0A 4B74A 1TB6H 1RJXB 1V2NT 1SPJA 1DX5M 1TNJA 4X1QU 5E8EH 1C5XB 3ATMA 1S85A 2GT8A 1BTZA 2XCFA 3CP7A 2GGVB 1BRCE 2QC2A 2HNTF 2OLGA 1P2IA 2G52A 5A2MH 3RUOA 2QF4A 4MPVA 4X8UH 3GS9A 1CGIE 2F3CE 1IQGA 1EZSC 5TCAA 5DP9A 1MQ6A 3Q76A 4ESTE 1H9IE 5EQRA 1YLNA 3AAVA 1SLXB 3RXQA 3SU5A 4A1XA 1GJ4H 1HJ9A 5C0TA 2A5AA 2ESTE 4O3TA 1AU8A 3SQHE 1D3PB 2QN5T 1C5YB 2Z94A 3BEUA 3ITIA 1Y59T 4AB8A 4FETA 1S5SA 3A85A 5EIYA 1V2OT 1ARCA 1BTHH 2WPLS 4ZMAH 1GMCF 1FPHH 1O5EH 4CBOA 3VB6A 3BTDE 1O3KA 2H6MA 3UR9A 4OS4A 4NSVA 4ZHMU 4A6LA 1BJVA 1PPGE 3A88A 4XD7D 3EA9A 3A84A 3TNSA 4CHAB 2JH6D 4NIWA 3PWBA 1V2UT 5EW2H 2H9HA 2ZI2H 3WWFA 1GVLA 3P8FA 4JZEH 4X1SU 2ZDKA 1MABB 2ZDVH 2A0QB 1T4VH 1EB1H 1FIWA 2ZHFH 2VIDA 4NFEA 3SUGA 3S7HB 1ZHRA 2FTLE 1S84A 3KNXA 2ZFQH 2B7DH 3TJOA 1NRRH 4WH8A 4ZAEA 1RIWC 1QB6A 1RTFB 2ZECA 1ORFA 3VG8A 5AFYH 2A7JA 3FP6E 3W1EA 4AX9H 1MTNB 2PV9B 1CA0B 2GCTB 5CHAC 5F53A 2VGCB 1BOQA 1A61H 3V3MA 1A1RA 1GL1A 5C3NA 1LTOA 3I77A 3K2UA 2J9NA 1K1IA 2FOMB 1HAPH 2H9EH 2HWLB 4INLA 1GJ9B 1MBQA 2TBSA 3SU4A 3LH1A 1K0HA 5EQQA 5DO4H 4DG4A 4YM9A 3PO1B 2V3HH 2BD9A 2P94A 1NESE 2ZQ1A 1SVPA 1FQ3A 2P16A 4GHTA 4B71A 3K9XB 3SGQE 1P04A 1RTKA 3U8OH 3SQEE 1VGCC 1Z6JH 3RU4T 4Q80A 2FEQH 1SHHB 1A5IA 2OXSA 1LHDH 1C1QA 1CE5A 2LNCA 4CHAC 1C4U2 1FI8A 1UK2A 1AB9B 2SNWA 1Z8GA 3TJNA 1X7AC 5J4SA 2FS9A 2WINI 4NA7A 3TH3H 3KL6A 1QQ4A 2BVRH 2B0FA 4K2YA 4AYVB 3UQOA 1KXFA 3RXFA 1NO9H 4E05H 5DSFA 1TNKA 5HIYA 2BMGB 2FESH 1UHBB 5BPEA 3SBKA 1QA7A 4ABGA 1A0LA 1DT2A 3DSOA 1OWEA 2XC4A 5EG4A 1FY3A 2A4QA 1QJ1B 1WQSA 1K9OE 4R0IA 3JZ2B 4UE7H 4J2YB 3FFGA 5DJ7A 3VB7A 1C1PA 3SGAE 2XWAA 3BIVH 1C1RA 2O8WA 1DY9A 1JXPA 1DLEA 1A5GH 4XSKU 1VCWA 1Z8IB 1DLKB 2KAIA 3MQKC 3A7TA 3PYHA 3H09A 3LOXA 3CS0A 1XVOA 1O2VA 2H5CA 1DSUA 3ZYDA 2W26A 2ZTXA 3VGCC 5LPRA 2RCEA 3MO6A 1TA6A 2FI4E 1O2YA 1ZTKA 2FIRH 4BNRA 3Q3KA 3HKJB 4Y7AA 2ZTZA 2EI7A 5GXPA 2ZPQA 1SQOA 1IQNA 1W0YH 3QTOH 1GBTA 3BG4C 4ZKRU 3NK8A 3SU2A 2HOBA 2ZU3A 3JZ1B 3E3TA 1TE0A 3GCHB 1O38A 1C2GA 3GICB 3B9FH 1G3CA 2C93B 2HPPH 4ZKNU 2XBVA 4B6EA 1KIGH 5GJ4B 2ZF0H 1TNGA 3A81A 3PLPA 3ZZ6A 1HGTH 3HPTB 1P10A 1EP6A 5K7RA 1NS3A 1V2KT 2R3UA 3NKKA 2AEIH 3TPIZ 1AFQB 1O3GA 2G8TA 3LGTA 3A7YA 2NU3E 2P3FH 1JMOH 4Y10E 4ZHLU 5EXLA 3FZDA 1GJBB 1V2JT 3EYDA 3SV6A 3RXJA 1LPKB 8ESTE 3SUDA 1KXBA 1RS0A 3Q77A 3VPKA 4B6FA 5I25A 1GI5A 1TX8A 4ABDA 1TPAE 2YOLA 3TGJE 5EPYA 1YPMH 2C8ZB 2OINA 2V6NA 1GHZA 5C20A 3VB3A 2ZDLA 7LPRA 4D8NA 4I31A 4OS5A 5IK2D 4ZROA 1ARBA 1IQJA 2BY5X 1FAXA 2W6ID 4CRDA 3MNBA 4UEHH 3BN9A 1GHYH 2Z3CA 3MH6A 1QBNA 5KEDA 3ATWA 1ZMNA 1LHCH 3DA9B 1J16A 4HZHA 4DT4A 1FNIA 2EI8A 4CRAA 1JBUH 1OX1A 1WV7H 1SQTA 1ANDA 1O5BB 3F68H 1O2PA 1VGCB 1PPCE 4SGBE 4K8BA 5LGOA 1W7XH 4O9VA 4CRBA 2AIPA 2ILNA 2AIQA 3SO3A 2ZCKP 4RKOB 2XC5A 1GBBA 1K1LA 3AW0A 3RM0H 4FUJA 4KP0A 1XX9A 1CGJE 1SSXA 1TLDA 2BLWA 1BDAA 3DHKH 4JYVH 4B2BA 2GJGA 1L2EA 2AYWA 1Z6EA 2G4UA 1ZPCA 1JRSA 3DFLA 4X8VH 3A8BA 1LPZB 2TPIZ 2ZCHP 4AZ2B 1GBHA 5B6OA 2TGAA 3PV2A 1ABIH 4YOJA 2WPHS 4Z1MD 3T5FH 1F0SA 2V35A 1W12U 2L6OA 4ISOA 4HGCA 1OYTH 1C1NA 3F3BA 4UFDH 2CN0H 1P2QA 2TGDA 4X6OA 1C5MD 3ATLA 4WVPE 1SGEE 5FPSA 4NIXA 3UOPA 4Y0YE 3RXOA 1KTSB 2GV6A 1SOZA 6LPRA 1J17T 1GVZA 5JBBS 3UWIA 3GYLB 3AVZA 3TK6A 1GI0A 3UREA 2F91A 3ENSB 1YM0A 1ETTH 1BUIA 3EGKH 1GPZA 1DWCH 1XUFA 2BVXH 4MG3A 5TJXA 4Y8XA 2HALA 4UD9H 6GCHG 4H6SB 1GJ7B 1XKBC 1YPGH 4GCHF 2QY0B 5EXMA 1SMFE 4X1RU 1LVYA 2OC1A 2G81E 1CT4E 3S7KB 1O2ZA 1P2MA 1QRZA 3ZZAA 5F8TA 3KCGH 1W0JD 1YY3A 4U30A 1RRKA 5PTPA 2RDLA 3L6PA 5L30H 1QY6A 4KELA 1HPGA 4WY3A 2OQUA 1QA0A 2PLXA 3SU0A 4DGJA 5FXLA 1TMUH 1ZPBA 2ZC9H 4UDWH 3SHCH 1KTTB 3Q3XA 1WOFA 1G37A 3CNRA 4XFQA 1IQKA 2JH5D 1E79D 1HXEH 3SUEA 1MKXH 2BQWB 1IQEA 4ABHA 1ETSH 2R3YA 1O3OA 3T28A 3AAUA 1D3DB 1ELCA 5C67A 1AKSA 5L6NH 2KAIB 4Q7YA 1GHBG 2OC7A 5LH8A 2BDGA 2PKSB 1GI8B 1H8ED 2F43B 2VVVA 2BDIA 3R3GB 3ELAH 3S69A 1LHEH 3FANA 1O2QA 1T8MA 1UTJA 1TBRH 2C3SA 1QB9A 2AMDA 4ZKSU 4AFSA 7ESTE 5H4IB 2SFAA 3M35A 1DANH 1BRBE 2F9PA 1HAHH 1BITA 3HGPA 3MOCA 4XRNA 1S6HA 2ZHEH 4AOQA 1ELFA 1T8OA 1THSH 1GHAG 1CGHA 1W13U 2GKVE 4J1YA 1P06A 1GHAF 1T32A 4D9QA 1O3DA 2CF8H 5CHBA 1WUNH 3K65B 1C5UA 1EOJA 3PM3A 3UB0A 3UNRA 3OAAD 2PGBB 1YPLH 4FU9A 1FAKH 1O2MA 1WDIA 2IJD1 1TMTH 4OS1A 5A0AE 1FV9A 1SGRE 1HJAB 4WXVA 4DT7B 2NWNA 3A8DA 2VVCA 1O34A 3FP7E 8GCHG 2WPJS 1KDQA 4CRFA 1ZGIA 4TWWA 1BQYA 9ESTA 3ESTA 2CK3D 1BT7A 1CT2E 2FYRA 1QJ7B 1TGNA 2OCVB 3URDA 5DP5A 1FXYA 4HI3A 1C1UH 3M61U 2Z7FE 2VWMA 5C5NA 1MTUA 1GI9B 1W8BH 3EQ0H 2I6SA 3F9HA 1FY5A 2DE8A 1GG6C 3AASA 1SB1H 3GISB 1EAWA 1FLEE 1ZTJA 4BAMB 5A8YA 1IQHA 2AH4X 1QR3E 3P70B 1PPBH 5DP4A 1G3DA 1D9IA 4ZXXH 2SGFE 5EPNA 5AHGH 4GLYA 4LK4A 4BANB 4NIVA 2Y80A 3KYFA 2QXJA 1C2DA 4D9RA 5EGMA 4H4FA 2YNBA 4XBBA 3SNBA 5DP8A 2ZTYA 3L3TA 3D62A 1QJ6B 2HPQH 4YO9A 1YP9A 1C1MA 3TK9A 1P11E 1KLIH 2GV7A 3ZVAA 5DKMA 1CT0E 1MQ5A 5T6GA
chains in the Genus database with same CATH topology
4Z6AH 4JCNA 4YESB 3R0FA 1OYQA 1GI3A 1GCTB 4X1NU 3MNXA 1CQQA 3PWCA 1K1MA 4B2CA 4AG1A 4K5ZA 1V2VT 2GZ7A 2VIWA 3WY8A 2PR3A 1TRMA 1MZAA 1K2I1 1SGYE 2F9OA 2FOEA 1CHOG 3ATKA 1BIOA 3LONA 2UWPA 2R9PA 1YKTA 3CS7A 3P17H 1XVMA 2PTNA 1L0ZA 1LVBA 1XUGA 1O5DH 3F9EA 3EE0B 3MO3A 1HLTH 1TAWA 1O2NA 1Y3WA 1AB9C 4OS2A 3GOVB 1C2HA 1ZLRA 2J92A 3LC5A 3TH2H 4ZUHA 1BZXE 3A89A 3KHVA 3C27B 3LPRA 1THPB 4CH2B 1H8IH 5CHAB 3QTVH 1OOKB 3T29A 2EA3A 2Y82A 4AFZA 4TPIZ 1L4ZA 2CGAA 1HAVB 5AVDA 4AFUA 4U2WA 3RXEA 2GP9B 3GY8A 1F0TA 3FAOA 1P0SH 4K1EA 4R8TB 4ZXYH 3SNCA 3ZVGA 3TGKE 2QV1A 3DD2H 1A7SA 1E0FD 1C2FA 2A7CA 5TCCA 1ZHMA 1P2OA 3RXRA 2WYJA 1HAXB 1MH0A 2VH6A 5GCHG 2AGGX 3OYPA 1B0EA 3O8BA 1FN6A 1GBKA 3RXDA 1ZYOA 1TA2A 1MZDA 2J38A 1MU8B 1PQ5A 1THRH 3TJUA 1DPOA 5AF9H 3BG4B 1AVWA 1ZR0A 1SGIB 5JB8S 3SV7A 1J15A 4AG2A 3IG6B 1DVAH 5DP3A 6CHAC 1DICA 4ABBA 4NFFA 1NROH 1EASA 1BJUA 1YPEH 1V2WT 3RMLH 2A32A 1NU9A 4DY7B 2Z9LA 4CRCA 3D49H 1C2LA 4LOYH 3LC3A 4BOHA 3QLPH 4LZ1H 1CHOF 1KXEA 2ZNKH 4MPUA 1YLCA 5HMAA 3RXSA 3MU1A 1XKAC 2B9LA 1NPMA 2ZDMA 4GCHG 3URCA 5E0HA 1Y3UA 6CHAB 2H1UA 3M7QA 3V7TA 1OS8A 1O3JA 1C5SA 1ELAA 2G5NA 2GTBA 1SGQE 2FOBA 1AVXA 3A83A 5DGJA 1ID5H 3SU3A 1EPTA 2CJIA 1K21H 3QO6A 2QCYA 4JZ1A 1UTQA 1BTXA 1K22H 4MQAA 2THFB 2ZDNA 3U8TH 1AZ8A 1HUTH 2A4GA 5DP7A 4IMZA 1C5NH 3ZZ8A 2Z9KA 1L1JA 1B0FA 2FPZA 2FTMA 3HKIB 1V2LT 1MTSA 3SOSA 1AWFH 3QZRA 3GY2A 2OBQA 3M3TA 4AB9A 1PPEE 5HGGA 2WV4A 3E0PB 2Z3EA 1T8LA 1C5ZB 5FCRA 6ESTA 3U69H 3MFJA 1XUIA 5FPTA 1PJPA 1HJAC 1XM1A 3QX5H 3RDZA 1JOUB 1C5TA 3BTQE 1ANEA 3KQBA 4FUCA 3K6ZA 3PV4A 1O5AB 2NU2E 3NUMA 4IBLH 5JDUB 1O39A 3SW2B 1EAXA 1V2TT 1AQ7A 2BLQA 5HM2A 3UR6A 2B5TB 3RXBA 4DIHH 1DWDH 4VGCB 2ZZUH 4B2AA 2C4FH 1BMNH 1SFQB 1S82A 2Q1JA 2O8TA 3MYWA 3U9AH 3E6PH 3DFJA 2WPMS 1O2UA 1RIWB 1G32B 1SBWA 2BM2A 3LT3A 2FLRH 1C5RA 1ABJH 2PFEA 1GMHG 1BBRK 4AFQA 1SGDE 3SUFA 1C2KA 1SL3A 1TQ7B 4FUHA 3M5OA 4QT8C 3RMOH 2ZP0H 2ALPA 1HAOH 3EA8A 1VJAU 1GBJA 1SGFA 4RSPA 5E2PA 1AUTC 3V0XA 3GY5A 1GBIA 1O5GH 2VGCC 3SJ9A 5I46H 2GD4B 2VH0A 1TQ0B 2VU8E 3UPEA 5C5OA 4ABFA 2ZA5A 1SGNE 1TGBA 2W7UA 1KY9A 1D6WA 1O31A 4JK5A 4Q7XA 1MBMA 1F5LA 2SGAA 1GJ6A 1CBWC 3IITA 3TH4H 1EATA 3HK6B 2Z9IA 2XTTB 2ASUB 1YF4A 1DSTA 3RXGA 5F8XA 1VCPA 1LVMA 1Y3XA 1HB0B 1GBDA 1XUJA 5L2ZH 5GDSH 4NIYA 1OWIA 5IYTA 3PLBA 5ESTE 3GY4A 3KEEA 2I6QA 2VWNA 1HRTH 3RMNH 1MD7A 1C5PA 5HXFA 3H7TA 4O3UA 3TJVA 1VZQH 2FOHA 2R2WU 2VIVA 1GHVH 1B5GH 1SI5H 4U01A 1HIAA 2A5KA 1J14A 1KXCA 2PKSC 3K6YA 1O2OA 1CHGA 1VITG 3MU8A 2BD7A 3RXMA 4YT6H 1H9HE 1K1OA 2FZZA 3BTGE 5J4QA 1ANCA 1C1WH 4MPXA 1EB2A 4NWLA 5CMXH 2BOHB 1O3PB 1Y5UT 4MTBA 4YT7H 1P12E 1BHXB 2OUAA 2G55A 4MNVA 1S81A 1V2RT 1O3FA 1UTKA 4YLUA 1DUAA 1N6XA 1ELTA 1O3BA 1Z8JB 1AIXH 1TALA 2BVSH 1PYTC 2H5DA 3QZQA 4K1SA 1L1NA 2D8WA 1QCPA 4K1TA 1NTPA 1WTHD 1P3CA 2BDHA 3H5CB 2TRMA 4ASHA 2FOGA 1P9SA 4NA8A 2C90B 1O30A 1ZMLA 2RA3A 1OWKA 3MU0A 1DUEA 1AE8H 1SLWB 1G2LA 5DP6A 1QQUA 2VB0A 2AERH 2BD4A 6GCHF 1NM6A 4YOGA 3OTJE 1HXFH 2A7HA 2PGQB 2W7SA 2XNIA 1W14U 1TMBH 4GHQA 2UWLA 4X2WA 5JPMH 2R0KA 1LHFH 3UWJH 1O33A 3ZVBA 3MHWU 4A1TA 4X6MA 2PKAB 3HK3B 1OPHB 3IWMA 3LGIA 2ODPA 3A7ZA 3ZZCA 2M5TA 3LKWA 4BAQB 3RXCA 2BD3A 4Q7ZA 2C8YB 2ODYB 2ZCLP 2O9QA 2UUFB 1FIZA 3RMMH 1F5RA 1YCPH 3NPSA 2ANYA 4E7RG 3MH7A 2JETB 1UVOA 3M5LA 2Q6GA 2ZHWH 4THNH 3W95A 1GHWH 5AFZH 3V13A 4BXWA 2V0BA 2OC8A 1GWAA 3GCHC 3SNEA 3GCNA 2P3TB 3GY7A 3SJKA 1GBFA 2Z9GA 1ZSKA 1NFYA 1DS2E 2AFQB 1JRTA 4UONA 5F6MA 4IC5A 1GI2A 4FXGH 4X2YA 2VNTA 1A0JA 4H42U 4Y0ZE 2Y6TA 1RD3B 5C1UA 1UMAH 1GHXH 1UTPA 3ZV9A 1DWBH 1BTPA 4X1PU 2A45B 1AZZA 1LVOA 1P03A 3C1KA 3M3VA 1NRPH 4BTIB 3ZZ9A 1LHGH 1L4DA 1TX7A 3FZZA 1ELGA 4NCYA 2BD5A 2SGPE 4NG9H 1PQ8A 2Y7XA 1O36A 1NY22 2ZWLH 2XW9A 3LGUA 1GMDF 3BEFB 1IQFA 2VVUA 4IN2A 1CVWH 2PW8H 5F03A 2ZKSA 4TWYA 4I8LA 1FONA 3M3SA 8GCHF 2FODA 2GCHF 3S9AA 1GBMA 4MDSA 1LMWB 4JYTA 3VEQB 3E0NB 1ESAA 4B76A 3OSYA 1QNJA 3OY6U 3TITA 1GCDA 1DOJA 4Q2KA 2TIOA 2ZFSA 1ZJKA 2GT7A 3RC6A 1BB0B 1XUHA 1WBGB 2VIQA 1LQDB 3PTBA 5FCKA 1P2KA 3KQEA 1SGTA 3TLOA 1IHTH 2Y7ZA 2ZGJA 2ZDAH 3KQCA 1NZQH 2PSXA 1HAYB 1Q2WA 3ZZ3A 1ZGVA 4PROA 1HIAB 1GGDC 2PHBA 2PKAA 2AS9A 1GMCG 1YPJH 4ISLA 1AUJA 1O2XA 2SGDE 1YLDA 1D6RA 1NFUA 2EI6A 1PQAA 4WWYA 5A0CA 7KMEH 1SLUB 4XBDA 2XYAA 3M5MA 1C1TA 2BQ6B 3D23A 1G2MA 2FX4A 1O3AA 2ZQ2A 2R2MB 1Z1IA 4K3JA 1C2MA 1C2EA 1W3CA 2OC0A 3MO9A 1LKBA 5E0JA 5T6FA 4FUDA 2ANKH 4I32A 3GDUA 3VGCB 3P8GA 2OBOA 3ZVCA 2ZGXH 4A5TS 4B73A 2ZFFH 2ZHQH 1L1GA 2FOAA 3PROA 2ALVA 3LH3A 1ZHPA 4UFGH 3P92A 1Z8RA 1V2ST 4HFPB 2H2ZA 1BMLA 1TNLA 1Y3VA 3MTYA 2W3IA 1UCYH 1AN1E 1V2PT 4GAWA 4WH6A 1VITF 2P93A 2W5EA 2CMYA 4DOQA 1F5KU 1F2SE 1O2LA 3LGWA 4M7GA 5FX5A 2NU1E 2TGPZ 2O8UA 3UNQA 1FDPA 5FBEA 2F9NA 2OQ5A 4I8GA 1BRUP 1ZRBA 1FY4A 3M7UA 3M36A 5FHTA 2IPHA 1ESTA 1TABE 3Q00A 4YTAA 4Y7BA 3MWIU 3TK5A 1O3HA 1QL8A 1SHYA 2ANWA 3RLYH 4XDEA 2D2DA 1ZMJA 5GWZA 2WUBA 1A2CH 1UTLM 1O5FH 3MH5A 4Y71A 1DXWA 1K1JA 1QBOA 3V12A 2JKHA 1MKXK 2ZGHA 3LIWA 2WPKS 3DT0H 1UTMA 5FPYA 4WF8A 1YBWA 2ZEBA 1S6FA 1QGFA 1Y8TA 4MNYA 3SU6A 2QA9E 4ABAA 1DITH 2G5VA 5LPFA 1BTWA 1EZUC 2A4RA 2ZIQH 3F9FA 2QXIA 4DIIH 1FY1A 4ABEA 1TRNA 2STAE 2K1QA 1Z7KA 1FZZA 2FMJA 1DFPA 2ZU5A 4IN1A 1UCYK 4ZKOU 3STJA 7GCHF 3T62A 3N7OA 4BAHB 3O8RA 1AFEH 3BTME 1O2HA 3RXTA 4FU7A 3KN2A 4ISNA 4CRGA 2XBXA 3A7VA 1LKAA 1ZJDA 1Z71A 3RXUA 3EAJA 1O2GH 4UFFH 4DVAU 2Z9JA 2P3UB 3U98H 1BBRE 1CO7E 3HATH 4MPWA 1O2WA 1T7CA 4GUXA 1BTYA 1UK4A 4O97A 1C2IA 2STBE 2ZU4A 1OP0A 2P8OC 1GJDB 1DM4B 4D76A 1GGDB 3BTKE 2ZFRH 3E91A 1AO5A 1G36A 2PUXB 4NA9H 1V6DA 2AMPA 1GJAB 4IC6A 4Z0KA 1PPHE 1S0QA 5JBTA 3ZZDA 1A5HA 4YZUA 3SJOA 1AKSB 2G00A 5SGAE 1B7XB 3BTWE 3LGVA 1J9CH 4I33A 3VXFH 4VGCC 4GSOA 5LPEA 1KXAA 3S9BA 3PLKA 1V2QT 1Y3YA 3NWUA 4INHA 1MAYA 5F8ZA 3SU1A 4XOJA 2IOTA 2GX4A 5JB9S 2BOKA 1P09A 1C5OH 1OP8A 1SOTA 1QIXB 4Y8YA 2Q6FA 1YPHC 1K28D 2ZFTA 1TRYA 1PYTD 4FUGA 1PPFE 3S9CA 3B8JA 1TBZH 1LPGB 3STIA 5K0HA 4OS6A 4RKJB 1GMHF 2PWXA 2BTCE 1HNEE 1J8AA 4X8SH 1ACBE 2WPIS 3A8AA 3TU7H 3SN8A 1NT1A 3S0NA 3SV2H 1EP5A 3BTHE 1MTWA 1F0UA 1TGSZ 1C4Y2 4ZH8A 3T25A 3BTFE 2Z6BD 3RXIA 3SNAA 1SGCA 3RXAA 1P8VC 1TYNA 3QGNB 1WU1A 3ZVFA 2QIQA 1W11U 4UFEH 2J95A 3A80A 3H7OA 1N8OC 5EQSA 1QTFA 2QF3A 3ZZ5A 4AORA 5A8XA 4H6TA 1EXFA 1RXPA 1QB1A 2TGTA 3UNSA 4E7NA 1D3TB 4A1VA 4AN7A 1PPZA 3SNDA 4WMFA 1GVKB 1ZSJA 2FOCA 1UVUH 3UOUA 3A7XA 1UJ1A 5EODA 1KXDA 2BDBA 2BLOA 2BY6X 4CH8B 2YNAA 1ZZZA 2CHAC 3QWCH 1A0HB 4DURA 3A7WA 2BHGA 4LZ4B 1HJ8A 5DPAA 1BA8B 3ATIA 8KME2 5C2ZA 1GI1A 9LPRA 1BCUH 2C8XB 4MNWA 4NSYA 2BDYA 1C5LH 2XWBI 2BZAA 2O8LA 2FXRA 4B75A 5G4BA 1O3EA 1N1LA 1O3MA 2HRVA 2GZ8A 1RFNA 2BD2A 3UQVA 1E34B 1FUJA 1P01A 3KQDA 1QFKH 3RLWH 2BX3A 2O8MA 1D4PB 4YOIA 2Z3DA 2GMTB 4DCDA 5HYOA 2J2UA 1OWHA 1FY8E 3P95A 5JBCS 1O3LA 5T6DA 2ZU2A 5A8ZA 2BY8X 2A2QH 3ZZ7A 2SNVA 3BV9B 2J34A 2GDEH 8LPRA 1O5CB 4X8TH 1TOCB 1A3BH 3D65E 1AI8H 2VIOA 2OD3B 1O3IA 3BSQA 4NZQA 1DDJA 1FMGA 1NRNH 1VCQA 4IW4E 2D1JA 2GZ9A 3RXHA 3GY3A 1MKWK 4ABIA 1SC8U 1GL0E 1C2JA 2QXGA 1UVPA 2XBYA 2OTVA 1C1SA 3CENA 3KGPA 4A7IB 2CF9H 2FM2A 4FVDA 4RN6A 1G9IE 4MNXA 3A86A 1HCGA 4BTUB 4CR9A 5FBIA 4X6PA 3I78A 2VINA 3GYMA 1S83A 1GI6A 1NFWA 2GMTC 3NCLA 1NC6A 1BBRH 1BMAA 3ZVEA 1WTGH 4FUFA 5GPIB 2EC9H 1C5QA 3BIUH 1SQAA 1EOLA 1FJSA 3RXPA 1NFXA 4GVUA 1O35A 4KTCA 3RP2A 2ULLA 1QBVH 1Y5AT 3UIRA 3RU4E 2QXHA 4WJG2 3G01A 3MNCA 1C1VH 2RA0A 1TGCA 3U1JB 5E0GA 1G3BA 2QAAA 3VFEA 4X0WU 1QRXA 2ZO3H 1LDTT 1NN6A 1P05A 2GCHG 4GPGA 1XUKA 3ZYEA 5DG6A 3KF2A 3VB5A 5EXNA 5BRRE 1ELVA 1MCVA 2F83A 5C1YA 3MNSA 3PB1E 1JWTA 1P57B 3GY6A 1EPTB 1A46H 1KYNA 1SLVB 4CBNA 1WCZA 2XXLA 3BTEE 4ISIH 1N6YA 1XXDA 2BY9X 3LDXH 3SGBE 1GDQA 4KKDA 5ESBA 4NWKA 2FP7B 1T4UH 4JZIA 1UO6A 1C9TA 2CV3A 2QGRA 2FOFA 2AGEX 1HAGE 4IMQA 4NZLA 5JYIA 3SJ8A 1MTNC 3RC4A 1GCTC 4F49A 1EZQA 4JK6A 2G4TA 2JETC 2ZG0H 2BXUH 2J4IA 1H4WA 1EPTC 2RG3A 4AYYB 3LU9B 2HVXA 3BTTE 1HDTH 1UTNA 2XCNA 4O03A 3A8CA 2BB4A 4JZFH 1GBLA 3Q3YA 4Y76A 1GMDG 4BAOB 2ZU1A 2FDAA 1CSOE 1XMNB 1HV7A 2F9BH 1O2KA 3E16B 1W10U 3RXKA 1YGCH 3A82A 1ELBA