1DDJA

Crystal structure of human plasminogen catalytic domain
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
247
structure length
247
Chain Sequence
SFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDAGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Blood clotting
molecule keywords PLASMINOGEN
publication title Human plasminogen catalytic domain undergoes an unusual conformational change upon activation.
pubmed doi rcsb
source organism Homo sapiens
total genus 52
structure length 247
sequence length 247
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.7: Plasmin.
pdb deposition date 1999-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ddjA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ddjA01
1LO6A 2BLVA 2FTMA 4AFSA 1EPTC 3DFLA 1NM6A 5GWZA 2QF0A 3M3TA 4B2BA 4NSVA 1CBWB 3LKWA 1A46H 3LGWA 2TBSA 3WY8A 1ZPCA 1Y5BT 4YO9A 7GCHF 3BEIB 2FS8A 1O35A 1O5EH 4XDEA 3LIWA 4NZLA 1KIGH 5GPIB 4DIHH 1B7XB 4CHAC 4E05H 2FIRH 1KXEA 2HLCA 3U98H 3AAUA 1TQ7B 5EW2H 3QX5H 1MKXH 5C3NA 1ZGIA 4THNH 2J9NA 4I32A 5DP8A 4WMEA 1XKBC 2QAAA 4Y11E 2QXJA 3EGKH 1G3CA 4XBCA 1HAVB 2P8OB 1V2ST 1Y8TA 4K1SA 1O39A 1TMUH 1AMHA 4ABBA 3T25A 2ZDMA 1C2IA 2OLGA 4XBDA 2GMTB 5A2MH 1CO7E 2ANWA 3S0NA 4Q80A 1V2JT 2ZWLH 4XFQA 2W3KA 2STAE 3PMBB 1ETTH 4XOJA 1XM1A 1MUEB 1QJ1B 1THSH 2F9UA 4IBLH 4OS4A 2ZGCA 3U8TH 1SLVB 2ZO3H 3ODDA 2EEKA 3SV7A 3P70B 1CQQA 1V2PT 3A82A 3RXCA 1GJ8B 1HAXB 5ETXA 4K60A 1GJDB 5C2ZA 2C8YB 2Y80A 1ZGVA 5E0GA 1QRWA 4R8TB 1AB9B 2UWOA 2CGAA 2A1DB 2A5KA 3L3TA 5A8YA 1QBOA 5TCAA 3SQEE 1QGFA 1GI9B 2J95A 3SU4A 4NIWA 1A1RA 4I8GA 1SGPE 4ESTE 3HK3B 1O5AB 3CENA 5L2YH 4KTSA 1TRNA 1W11U 3GCHB 3VB7A 3LGTA 3E0NB 1O3FA 2A5AA 4ABFA 4CRDA 5C1XA 4NWKA 1ARCA 1TNHA 2FI5E 5JBBS 3ZV8A 1MTNC 1SSXA 1PPZA 1CT0E 1ZMLA 2RA3A 2XC0A 4I8JA 2WPHS 1HAZB 4OS5A 1GDQA 1TPSA 1SMFE 4GPGA 1C1WH 1FQ3A 3SBKA 1BHXB 4E7RG 1O2HA 1XVOA 2D8WA 2ZHEH 4ISOA 4O3UA 5GCHF 3ZZBA 3PROA 2ZPRA 1C2LA 4X6NA 1YPLH 4X8UH 1P0SH 4WWYA 4ZMAH 1P2MA 3TNSA 1O2TA 1D9IA 1TX8A 1OWHA 3OY6U 4DCDA 3LGYA 2TGDA 3Q00A 2Q1JA 4OS1A 1ELCA 1JOUB 2CJIA 3BG4B 1WQSA 2P59A 3PLKA 1OS8A 1DVAH 1J14A 3TLOA 1NZQH 2A2QH 3DUXH 1C5SA 1EB2A 1AVWA 4MNVA 3F9EA 3ZZAA 1NRNH 2XWAA 2A32A 1GMCF 3QGJA 2FYRA 1JRSA 2QN5T 4MNWA 1GMHG 1FIWA 1ORFA 1H4WA 3B8JA 1HAGE 2DE9A 1VJAU 1AHTH 4IW4E 5E2PA 2ODQA 1SGCA 1OWIA 1T4UH 4VGCC 2V0BA 2QCYA 4NA7A 7LPRA 3GDSA 1THPB 4TPIZ 1HAHH 2SGFE 3QUMP 2G4UA 1Z8RA 1S0RA 4OGYA 1LHEH 1TFXA 1SLUB 1O3OA 1XXDA 2BQWB 3IWMA 2WPIS 1TRMA 1BCUH 1P9SA 3SU3A 1YPKH 4FU7A 1QFKH 1YLCA 3MNBA 4CBOA 1EAWA 1INCA 2GCHF 1O3LA 3TPIZ 3UNSA 1A5HA 1E37B 1XXFA 1SLXB 3M37A 5JBAS 4YT7H 1WCZA 1TGCA 5L2ZH 1ZSKA 3IG6B 4KP0A 1WU1A 1DWDH 1LKBA 2BX4A 2FEQH 4DW2U 1C1NA 4RN6A 2O8MA 1AY6H 1RGQA 2Z9JA 2VWNA 2ZA5A 1C2FA 5FPSA 1IQLA 2AH4X 4FUFA 1OKXA 2QV1A 1C5OH 5HXFA 1EPTA 1BA8B 1SI5H 4U30A 3UR9A 2Y7ZA 1ZTJA 3SV2H 3DD2H 3PTNA 5L30H 1Q2WA 1TOCB 1ZZZA 3TK6A 2WUBA 3MMGA 1BJVA 1C2EA 1EP5A 3SHCH 1GBMA 1O3KA 1HGTH 1NROH 4X1PU 2P3TB 2H9EH 3ATMA 2XRCA 2H1UA 4HI3A 1JXPA 1SGDE 2A4GA 2OTVA 3A88A 5GJ4B 1YCPK 1DICA 3DFJA 3KNXA 3ESTA 6CHAC 1TGBA 4NA9H 3RXQA 2EI6A 3RXTA 5DGJA 4XE4A 4H42U 4X1QU 2NU3E 1C2MA 4B1TA 1EUFA 4Y7AA 1BTHH 1SOZA 1E34B 1BTYA 3S7HB 2BD9A 2GT7A 1BTXA 1ESTA 1HAOH 3K2UA 4GUXA 1O2JA 1W0ZU 1F5LA 4O97A 4ZHLU 3SI4H 1D6RA 5DP5A 1BRUP 1P57B 1LVOA 2A45B 2BLOA 1Z8IB 4AOQA 3SJKA 3I78A 3PWCA 2SNVA 2PKAA 5AVDA 5T6GA 1TPAE 1RTLA 2VH0A 1A0LA 3SU6A 2VJ1A 2HPPH 3QO6A 5PTPA 1IAUA 3KN2A 1O38A 1O32A 3GY3A 4NG9H 1DPOA 1QL9A 3MU5A 3TK9A 2AGIX 5DPAA 1C1MA 1ESAA 2XXLA 1DS2E 2AMPA 2R9PA 2YOLA 1O3GA 1FDPA 1MD7A 5I25A 2XC4A 1C1VH 2BD5A 3A83A 3SUGA 1KTTB 4ABAA 2GV7A 1NTPA 1UTOA 3URDA 3ELAH 2DE8A 1B0EA 3RXKA 1H8DH 1CA0B 1MKWK 2BM2A 1DWBH 2VWMA 4CRCA 1D3TB 1AI8H 1Z6EA 3LH1A 5TJXA 4AFQA 2BY6X 1FY4A 1GBAA 5EPNA 5G4BA 1Z6JH 4ZAEA 4JZ1A 3BF6H 1SG8B 1GBTA 1ZHPA 1C4U2 4CHAB 3MFJA 2XCFA 3ZVBA 4DG4A 3PMAB 2ZCKP 3GY6A 1KDQA 2G55A 2G4TA 4X2WA 1TYNA 2BHGA 2ZTYA 2WUCA 1HB0B 1UK2A 5BPEA 2Z7FE 2UUFB 1XUFA 5EGMA 5AF9H 2ALVA 1QCPA 1TX6A 2PKAB 1OPHB 4UFGH 4YT6H 7KMEH 1HNEE 3MTYA 1M9UA 4JYUH 4AB8A 2O8UA 1D3PB 1LPKB 3GICB 1Y5AT 4E06H 2ZFTA 1LVYA 4BAHB 1GL0E 2OQUA 4X2YA 1OWDA 1HAIH 3RXLA 1V2KT 2ZU5A 1UTJA 1C2JA 1HIAB 5C5NA 1Z71A 3OTJE 1Q31A 3EA9A 2WPKS 2KAIA 1GMHF 2ODPA 3H7TA 2ZGBH 3STJA 1SFQB 1BTPA 1F5RA 2Y5GA 2A4OA 3CS7A 1SGFA 1LHDH 3PYHA 3E8LA 5FCRA 3KCGH 3V13A 1WUNH 2ZP0H 1P03A 2O8LA 2SGDE 2ZTZA 1IOEA 3NUMA 4Y8XA 3GCNA 4NSYA 1H9HE 1UO6A 2BMGB 3EYDA 1S6HA 1DFPA 4JK6A 4FUDA 2STBE 1WSSH 1FPCH 5EU8A 2Y5FA 2GVFA 1N8OC 5E0HA 3SNBA 2AGEX 5J4QA 1KDQB 1KXDA 1MTSA 1MTNB 3FP6E 4UFFH 1DWEH 4TWWA 1P2JA 1K2I1 1LHCH 2VIVA 2FDAA 1IQIA 2XBWA 9LPRA 5JB8S 1T8OA 1ZTKA 3UIRA 2JETC 4JYVH 1FNIA 3A8AA 3ZVFA 1O2LA 3CP7A 8GCHG 1O33A 2ZI2H 5FXLA 5FBIA 3RC4A 1Y59T 1LHGH 3ZZ3A 3RMOH 4CH2B 2NU1E 5AFZH 1ABJH 1H8IH 3NZIA 4GCHG 2Q6FA 1ZJKA 1RS0A 4DOQA 3U1IB 2VNTA 2FM2A 2GT8A 4Y79A 1IQJA 2V6NA 2G81E 2XBYA 2QC2A 2V3HH 3LGVA 1C5QA 1EB1H 5CMXH 2YNBA 1MD8A 1BJUA 5DP7A 3U9AH 1GI0A 5FCKA 8LPRA 2TGPZ 1GHBG 2AFQB 5EPYA 4IS5A 4AZ2B 2QXHA 2TGTA 1NN6A 2UWLA 1GGDC 3SU0A 1NFWA 1F0UA 1CHOF 2F91A 4IMZA 4WJG2 1KTSB 1G37A 4NCYA 4VGCB 1AKSA 1DUEA 1OWEA 3FZDA 1YPGH 1CA8B 4Y71A 4CRGA 2B8OH 1OP2A 3E6PH 1QIXB 1XKAC 1MZAA 3T2NA 3SNAA 1YYY1 2FZZA 1ZTLA 4FU8A 1CGHA 3LGUA 1A61H 1EZXC 2BY8X 1AU8A 3PMJA 2Z9KA 2J92A 3B23B 1IQFA 2GCTC 2K1QA 4TYDA 3RXHA 1NO9H 3KGPA 3HGPA 1YCPH 1YLDA 5T6DA 1C5WB 2A7HA 3F1SB 1L4DA 4JCNA 4YTAA 3SUEA 1MZDA 1W8BH 3C1KA 4U01A 3TGJE 1FI8A 4WF8A 1AE5A 3RU4T 1QL8A 4CRBA 3LU9B 1BOQA 4Z0KA 3BN9A 2FI3E 1IHTH 3LC3A 2GV6A 2ZGJA 1ELVA 4M7GA 4ABJA 3RU4D 1DWCH 2F3CE 2Z3DA 1KLTA 2ZU4A 3SQHE 5C67A 1JIMA 3TJVA 3ZZCA 3A80A 3M5NA 1SGTA 6CHAB 4MPUA 1C1UH 2ZHQH 1ZMJA 4YOIA 3BIVH 3MU8A 1QURH 1ESBA 2GDEH 4DJZB 1XUJA 1WYKA 3A86A 2H5DA 3MNXA 1XUIA 3ITIA 3OYPA 1AKSB 3TIUA 5LGOA 3ATIA 1XX9A 5C5OA 1QL7A 5EODA 1O2IA 2IOTA 2HOBA 4JMYA 1ZPZA 1A2CH 3AASA 1GBBA 3BSQA 2A7CA 4JZEH 4KKDA 1MKWH 4WXIA 2P3UB 2BLWA 4WVPE 3PV4A 1C5RA 2OBQA 1Z8GA 3SU5A 1V6DA 4B75A 2F83A 3A8BA 3BTKE 2VU8E 3PM3A 1UTQA 5FX6A 5A8XA 2VIWA 2FPZA 4A1VA 1HRTH 2QXIA 1YKTA 3VXFH 1GI6A 4K1EA 2A5IA 1GMDF 3M35A 2YNAA 3L33A 2G51A 1O2SA 3KEEA 3A89A 1AWHB 2ESTE 1V2VT 4I8LA 1C1PA 1AGJA 1S0QA 4MNYA 3IITA 5HGGA 4AG1A 2C93B 2ZPSA 1TX7A 5A0CA 1ZOMA 3DT0H 3RM0H 1KY9A 1O2MA 2ZGHA 1FXYA 3SGAE 1AO5A 2UUJB 4D7GA 1MU8B 2AIPA 2ANMH 3V12A 2BYAX 2OQ5A 2B9LA 2G5NA 1BMAA 2H2ZA 1MQ5A 2F9VA 1TBQH 4LOYH 1HYLA 1N6YA 2ZDLA 4X1NU 1C2GA 2OC1A 6GCHG 4H6TA 1LCYA 3MWIU 2PR3A 2VVUA 3JZ1B 4NIVA 2FX6A 1P12E 3UREA 1SPJA 2ANYA 4B73A 1GJ6A 2FMJA 2PV9B 3Q77A 1W12U 3EA8A 3FANA 2F9PA 4MLFB 3K6ZA 3VFEA 1EX3A 3BEUA 4BTIB 3F9GA 4UFEH 5ESTE 3P8OA 3C27B 5EQQA 2ZGXH 2OC8A 4TY6A 1IQNA 1YPJH 3GCTF 1S81A 3ATKA 3Q3YA 3UWIA 4A6LA 4DVAU 5TCCA 1P2NA 1XUHA 1HCGA 4LZ1H 3A7VA 2HNTF 3UUZA 1S85A 3SGBE 1CHGA 1EASA 4ZUHA 2AS9A 2FOFA 1DDJA 2O9QA 3UOUA 5A8ZA 1FY5A 5J4SA 1EZSC 1UTLM 3PMHB 3RLWH 5BRRE 2AMDA 3SJOA 1HJ8A 4JZIA 4CR5A 1HUTH 1ACBE 1G2MA 1HV7A 4ZKOU 4IN1A 3HKIB 1V2OT 2ZTXA 4MNXA 2V3OH 3SJ8A 4IGDA 5ABWA 1GI3A 1Y3UA 2ZPQA 2VB0A 1A0HB 1FMGA 3GY8A 1RIWB 1N8OB 3OY5U 5K0HA 1W7XH 2BXTH 1BMMH 1ELGA 1QJ6B 2ODYB 3RXVA 1VJ9U 1A0JA 5IYTA 2R3UA 3LDXH 3NKKA 2HWLB 2OC0A 5GIBA 1EP6A 5SGAE 3UOPA 4Y6DA 1O37A 1FN6A 2Z3CA 2JETB 1SQAA 4I31A 4Q7YA 3K65B 1C2KA 2BLQA 3BEFB 3MNCA 1Y3WA 2QA9E 3DA9B 2VIPA 1RD3B 1T8MA 1HJAC 1OXGA 1VITH 1VGCC 4LK4A 2R2MB 4AG2A 1ZYOA 1GJCB 4X8SH 5DP3A 2SGQE 3LT3A 1GHAG 2FO9A 1RFNA 4IC6A 3TJUA 2FOCA 3NK8A 2GZ8A 3RP2A 2ZG0H 3ZZ5A 4AFUA 1JRTA 2J94A 4NIYA 3SW2B 2F9NA 1GHZA 5FAHA 3F6UH 8KME2 4RSPA 1K1NA 1P02A 1V3XA 3TJOA 2CN0H 3S7KB 1C5YB 1GGDB 2OINA 1NRSH 1E38B 1L2EA 2JH5D 3M7UA 1DXWA 3OX7U 1UJ1A 2RG3A 1VITG 2TRMA 3NPSA 1LTOA 1PFXC 4X1SU 3MU1A 1O5FH 2G5VA 2Z94A 4GVUA 3K6YA 1E0FD 1YM0A 2BDIA 5F6MA 2GGVB 3NWUA 2OBOA 2PUXB 4YZUA 2SGPE 4NFEA 1ABIH 2VVCA 1Y5UT 1A5GH 1C1QA 1CVWH 2GCTB 1GVLA 5DP6A 2AERH 3A7XA 1BMLA 3GCOA 1OX1A 4YOJA 1GBFA 4D76A 1DUAA 3A7YA 1SB1H 4O3TA 1FY3A 3UQOA 3BTME 4IMQA 1ZHMA 1FPHH 3O8DA 3VB4A 3GOVB 2EC9H 1GVZA 1T8NA 1O2VA 4Q7ZA 1EJMA 4Y7BA 1SGFG 1BITA 2RCEA 1BIOA 1C5VA 1X7AC 1ANBA 1W7GH 2QIQA 2XW9A 2ZU3A 1NRPH 2PTCE 4D9QA 1BRBE 3MU0A 3VPKA 2BX3A 2VGCB 3MU4A 1GG6B 1P3EA 1O3AA 5ESBA 1NFXA 5DG6A 2QXGA 6GCHF 1GI4A 2FOGA 1AFQC 2P16A 1ZMNA 3U1JB 3ZVCA 3E1XB 4GHQA 1S83A 4BOHA 3RMLH 3MYWA 3UY9A 3P8GA 2P94A 1BBRE 1OWKA 2BB4A 1C5PA 3BIUH 1UTPA 1D3QB 3LOXA 2BXUH 1C1SA 4Q7XA 1O2KA 2ZDKA 4ASHA 2Z6BD 2BD7A 1K1PA 1SFIA 5GXPA 1J9CH 2CHAC 1LVMA 2NU4E 2PKSB 1O2NA 2GKVE 4I8KA 1O5DH 4NFFA 3GY5A 5AFYH 5EXNA 3PLBA 4ZHMU 2ZCLP 2GP9B 1FLEE 2BY7X 1EPTB 3GY2A 1CGJE 1CBWC 4DY7B 1GHYH 4TPYA 1GBCA 5FPYA 5HMAA 2ZFRH 2Y5HA 3A8DA 3TU7H 1T8LA 1J8AA 1BRCE 2FS9A 4ZROA 4AORA 3GDUA 2FOHA 1MQ6A 2FOBA 2LNCA 1UK4A 2FOMB 3SORA 5F8XA 9ESTA 1C5NH 3SNEA 1IQGA 1EAUA 3BTTE 1V2QT 4FXGH 3D62A 1EZQA 1XVMA 1GBKA 3GYLB 1YC0A 1L1NA 1TPPA 3E90B 1S5SA 1JIRA 1K1JA 3HK6B 1ZJDA 2A31A 1BMNH 2ZHWH 4WMDA 3SJIA 2P93A 1BUIA 1XUKA 4AN7A 1C5LH 2GD4B 1FZZA 4ISNA 4DGJA 3VB5A 2IN2A 1QNJA 1SC8U 4FUJA 1MKXK 3TVJB 1GI5A 3S9AA 3QZQA 1N1LA 2PSYA 1LDTT 4D9RA 1TNLA 1AQ7A 1G9IE 1AVXA 2RDLA 1C4Y2 2FOEA 1V2LT 1CU1A 1O3JA 1YGCH 1C4V2 4AGKA 2QF3A 4GHTA 3TNTA 3QTOH 5C1YA 1V2TT 4LZ4B 2H6MA 4BXWA 2ZZUH 4FUIA 4ZHAA 1GL1A 5HYOA 5DK1A 2BZAA 1DITH 3LJOA 1O2YA 4I7YH 1OP0A 1YP9A 5L6NH 3SV6A 4AYYB 3BTGE 3E0PB 1AUJA 2Y81A 1JMOH 1W2KH 3RM2H 3TGIE 1QBNA 1UCYE 1SGYE 4GSOA 4K2YA 4Y8YA 5IDKA 1SQOA 2R0LA 3ZVEA 2VVVA 5CE1A 3GCHC 1TLDA 7GCHG 2A2XH 2XC5A 1A3BH 1H9IE 2GZ7A 3FP7E 2NU0E 4YESB 4MPWA 1D3DB 5DP9A 1K22H 4BTUB 2HNTC 2B5TB 1TIOA 2B7DH 3A81A 1AZZA 2FLRH 3RXIA 2FYQA 3FZZA 1LHFH 3SGQE 1HAYB 3TITA 1NFUA 2C8ZB 3STIA 3D49H 1FY8E 4LXBH 3QDZB 4X2XA 3T27A 5A0AE 1GHVH 2BD2A 1O3EA 2WV4A 1MMJN 5FHTA 3EA7A 2D1JA 1DE7H 5LPEA 1C1TA 2C4FH 4U2WA 4DIIH 1OWJA 3BG8A 3KQBA 1QA0A 2I6SA 1YPMH 1L1JA 1FJSA 4JZFH 2OXSA 3FAOA 1Q3XA 1W3CA 1RRKA 1P05A 1P9UA 2J34A 2ZKSA 3A7WA 2EA3A 4F4OC 1XUGA 2BD8A 1DXPA 1EATA 1QQ4A 4WMFA 2KAIB 2CF9H 3TH4H 1QJ7B 1BTZA 4CBNA 4CRFA 3MI4A 3S9BA 1K1MA 3BV9B 2ZFPH 1E36B 1P2OA 1SOTA 4UE7H 1AVGH 5EQSA 3RXSA 2FLBH 4TY7A 2BDBA 1VGCB 3M5MA 1H9LB 1NESE 3SU2A 1ELDE 1MAYA 3PTBA 4X8TH 3U8RH 1WV7H 4Z6AH 1VCQA 1FIZA 2A4QA 3SJ9A 2BOHB 2WINI 4GLYA 1GI2A 5JYIA 1GBEA 4MDSA 2ASUB 1O3MA 2IPHA 1P06A 1AE8H 1O30A 2BDGA 1C5ZB 1MU6B 1BTUA 1SLWB 1SQTA 1PPHE 1DSUA 3AW0A 1AN1E 1QRXA 4WY3A 2FODA 3P92A 2J2UA 2SNWA 1Y3VA 3RXFA 3K9XB 4HZHA 3TH2H 1SGQE 3MNSA 4D8NA 4J1YA 3MO3A 4OS7A 1GJ4H 5GCHG 4AX9H 1ETRH 1V2MT 1QTFA 1S6FA 1TWXB 2AMQA 1SVPA 5EXLA 4BXSA 1AZ8A 5E2OA 1NU9A 1FUJA 3VB3A 2TGAA 1GHXH 1J16A 1C2HA 4X1RU 2QY0B 4MPVA 5DKMA 3Q3XA 3KHVA 5CHAC 1EOJA 1FV9A 3QK1A 3SZNA 1J17T 2P3FH 3BTDE 2F9OA 3M5LA 2W26A 2UUKB 1V2UT 1GI7B 2Y7XA 5AHGH 3M3VA 4JYTA 2BVRH 4WH6A 1GMCG 3HATH 1HJ9A 1TNJA 1G36A 1BQYA 5B6OA 4KGAA 4RKJB 1TABE 2H9TH 2TPIZ 3M5OA 1LQEA 1TA2A 1IQMA 2OCVB 4INHA 1GBIA 1O2PA 4PROA 3T62A 3KQCA 1AFQB 1SR5C 3P95A 4QT8C 1GJ7B 2ZDAH 5FX5A 1TOMH 1JWTA 4H6SB 5A0BA 2HALA 3HPTB 5C20A 3ZVAA 2ZQ2A 3E16B 2CV3A 3GY4A 2W5EA 1ANEA 1QY6A 2G52A 1PYTD 4CRAA 1NT1A 1UVPA 1NC6A 1E35B 3RXMA 1EXFA 1PPCE 2AEIH 3GY7A 3UPEA 1O34A 1P2KA 1QB1A 2SFAA 3UWJH 1WAYB 3LC5A 1KXFA 1ZSLA 4FUBA 1CA0C 1QR3E 3KQEA 4INLA 1DLEA 4YLUA 3R3GB 1V2RT 4HGCA 1O2WA 5E8EH 1KXBA 5EW1H 4ISLA 1DOJA 3D23A 3UNRA 1F0TA 3ZZDA 3PB1E 1HDTH 2EI8A 2ZF0H 2ZECA 5DJ7A 3PWBA 2RA0A 2Y6TA 6LPRA 4FU9A 2CMYA 3MO6A 4Y0YE 1RTFB 1DANH 2J38A 2PSXA 4KTCA 3T28A 1Z1JA 3ZYEA 1DLKB 1A3EH 4AFZA 8GCHF 1QB6A 3RMNH 3SN8A 4Y8ZA 1PPEE 3BTWE 1TQ0B 2VWOA 2ZCHP 1T7CA 4YOGA 3I77A 3S9CA 1ZLRA 4GCHF 1CGIE 3RXOA 4B2CA 4E7NA 3LPRA 4B71A 5T3HA 1U6QA 4SGBE 1GPZA 3HKJB 1O2RA 1GJ9B 2EI7A 2H5CA 2O8TA 1SL3A 4UONA 4I8HA 2GTBA 7ESTE 2CF8H 4FUCA 4DURA 1G30B 1MTUA 2HPQH 2ZHDA 1GHBF 3FFGA 3N7OA 1J15A 4A92A 1G3BA 1C1OA 1QQUA 1SBWA 4CREA 1GBHA 2XBVA 1TONA 1KSNA 4ZKRU 2ZIQH 5E0JA 1TALA 3BTEE 3VGCC 3RC5A 1OSSA 3E91A 2D26C 1BHXF 4ZKSU 3SOSA 8ESTE 1ETSH 4MPXA 5LPRA 1HFDA 1O3HA 5T6FA 1GCTC 1PQ7A 4D7FA 5I46H 1TMBH 3RU4E 4O9VA 4BAMB 2BVXH 2R0KA 4ZXXH 3MHWU 5LH8A 1LPGB 1RTKA 1C9PA 1YF4A 1B5GH 1TGNA 3H5CB 1LKAA 1NU7B 1C2DA 4Y10E 2PGQB 1BBRK 3GISB 3UQVA 2ZQ1A 2PLXA 4GAWA 3RXBA 1CSOE 1EAXA 1UTMA 3LJJA 1O3IA 1MCTA 1SHYA 1ARBA 1ELFA 1O2OA 1GJBB 2BTCE 1V2NT 5HM2A 1QA7A 3ZVGA 3L6PA 4J2YB 5EQRA 4X6MA 4WH8A 1NS3A 3RXPA 1SGNE 3PO1C 1EZUC 1FONA 1T31A 1UVUH 2AGGX 4JZDH 1C5MD 1KLIH 1GVKB 1TBZH 4XSKU 3RXEA 1LQDB 4K8BA 4F49A 3UFAA 1F92A 4X2VA 1VR1H 4AB9A 3QLPH 3RUOA 3BTFE 2A4RA 1G32B 2WPMS 2ZHFH 3O8BA 1TGTA 1MTVA 4X6OA 3W95A 1KXAA 2G00A 2XYAA 1UVTH 1PPFE 4CH8B 4YM9A 1MAXA 2THFB 1OYTH 1Z1IA 1K1OA 1W14U 2FWWA 3AVZA 3OU0A 3RXRA 1K1LA 3SHAH 1KXCA 2Z9LA 1TBRH 1L4ZA 2GZ9A 3TGKE 5A09A 2W7SA 4BAOB 1GBJA 5K7RA 4ABEA 2NU2E 3UR6A 2UWPA 4BANB 1G2LA 3CS0A 1C5XB 2O8WA 3URCA 3M61U 3O8RA 2BY5X 3P8FA 1NRQH 3ZYDA 3EQ0H 1IQEA 1O5BB 1QHRB 1OP8A 1P3CA 3M7QA 4Y76A 3NCLA 1HAPH 4NGAH 4ABGA 1F5KU 2FTLE 3VB6A 1ZRKA 5JBTA 4A1TA 1A5IA 1SGIB 3VXEH 1EAIA 1ID5H 3TK5A 2ULLA 4BAQB 3PLPA 4A5TS 4AGJA 1XMNB 2SGEE 1MCVA 4KELA 3TH3H 1D4PB 3F68H 5GDSH 4K1TA 3SV8A 1TA6A 4Q2KA 3U69H 5DO4H 1Z7KA 1Z8JB 1QB9A 1HXFH 1UCYK 1EJAA 1NFYA 1TMTH 3SV9A 4NA8A 5CHAB 1O2XA 1HPGA 3P6ZB 3EAJA 1ZRBA 1O2ZA 2DUCA 3QGNB 2ZEBA 4K3JA 3ZVDA 1PYTC 1ELTA 2SGAA 1GWAA 1PQ8A 3ZV9A 1WBGB 1DT2A 1GJ5H 4UDWH 2ZC9H 4WXVA 1CE5A 2ZFQH 1H1BA 4ZKNU 3VEQB 2BD3A 2BD4A 3SNDA 2PFEA 3UNQA 1CHOG 3Q3KA 1FN8A 2HGTH 1TNKA 4UEHH 1NRRH 2BDAA 1DY9A 2A0QB 4FUGA 1F0SA 1UTNA 1WTGH 3AW1A 4UFDH 1FAKH 1O3NA 1PQ5A 2WPJS 3BTQE 4UD9H 2G8TA 4JK5A 1NPMA 3KL6A 2WV5A 4HFPB 1O2GH 2CXVA 1K21H 5JDUB 3ZZ4A 1HIAA 3P17H 4RKOB 1YPEH 2ANKH 1L1GA 1AFEH 2C8XB 1WOFA 2GX4A 4NWLA 2HNTE 5F03A 4H4FA 1FY1A 1YBWA 3GDVA 2PGBB 4K8YA 1TNIA 1O0DH 1OOKB 3FVFB 4ABDA 3QWCH 1P10A 1GCDA 2Y82A 4O03A 3MOCA 5JPMH 2P8OC 1O5CB 1EJNA 3SNCA 1UVOA 3V0XA 1THRH 1F2SE 4AYVB 1F0RA 5JB9S 1RJXB 5EOKA 3MH4A 3U8OH 1Y3XA 3P8NA 2GMTC 3RC6A 1W10U 2VIOA 2XCNA 4DT7B 2FP7B 1ELAA 1P01A 3MH7A 4FUEA 4FUHA 1IQHA 1QRZA 3HGNA 1EOLA 1O2QA 2BVSH 1T32A 1P09A 1TPOA 2ZNKH 4ZH8A 1AIXH 1ELBA 4I33A 2BY9X 3AAVA 4MQAA 1BZXE 1C5UA 4K69A 1PPBH 3LONA 2OUAA 1P2QA 4NIXA 3M36A 3I29A 1GDUA 2PW8H 2AIQA 3MH5A 2UUYA 1GHWH 1IQKA 2V35A 3T26A 1UHBA 1UMAH 1BT7A 1AB9C 1D6WA 5DP4A 1GHAF 3MO9A 2IJOB 3KIDU 4BAKB 4HTCH 3S69A 3SI3H 1PJPA 2OC7A 1GI1A 2BOKA 2NWNA 3RXJA 1FAXA 3RDZA 2C8WB 3LGIA 1LPZB 4BNRA 3F9FA 1BB0B 1ANCA 1GDNA 4X6PA 1ZPBA 3B9FH 5FPTA 4OS6A 5F8TA 1PPGE 1VCPA 1O3DA 1GJAB 2D2DA 4FVBA 1EQ9A 1G3EA 2BQ6B 1ZR0A 2VINA 2WYJA 1VITF 2WPLS 3A84A 3VGCB 1O3BA 2JKHA 2QGRA 1GMDG 3RXUA 1SHHB 4BTTB 4X8VH 1DX5M 1BBRH 3UTUH 1AD8H 2BQ7B 3QN7A 3M7TA 2M5TA 1O3PB 1YCPM 2Z9GA 4NZQA 2ILNA 4CR9A 1O31A 1GCTB 2FXRA 1SGEE 2XBXA 5FBEA 2R3YA 5JBCS 1P8VC 2W7UA 1RIWC 1TRYA 2I6QA 1B0FA 2R2WU 4R0IA 3ZZ8A 3G01A 5EXMA 1W13U 4FVDA 6ESTA 2ZDNA 1C9TA 2C3SA 1MH0A 4A7IB 4TWYA 4YLQH 1OYQA 4SGAE 1CT2E 1G3DA 1K28D 1O36A 3RMMH 2J4IA 1DY8A 2HRVA 1TGSZ 3F9HA 3TJNA 3QTVH 1HXEH 4ABHA 2W3IA 1DSTA 3BG4C 1CT4E 4ISHH 2ZFSA 3ZZ9A 2P95A 1NY22 1VCWA 3ODFA 1HBTH 1QBVH 2BDHA 3A85A 3EE0B 1MTWA 3A8CA 1LVBA 1V2WT 1W0YH 1P04A 1S82A 4B2AA 1SGRE 1ZSJA 1YPHE 2XTTB 1GBDA 3R0FA 3ZZ6A 4ABIA 1UK3A 1UHBB 4B76A 2GDDA 1VZQH 3PO1B 1PQAA 1HJAB 3SU1A 2ZDVH 1KLJH 2AYWA 1DM4B 2B0FA 3D65E 4X0WU 3Q76A 1LMWB 2PTNA 3A7ZA 4B74A 1O5GH 1C5TA 2FX4A 3GCTG 2Z9IA 4INKA 2ZU2A 3LH3A 4OGXA 1EKBB 2VIDA 4A1XA 5HM9A 1JBUH 1Y3YA 5EG4A 2XWBI 2PUQH 1N6XA 1IHSH 1AWFH 3QZRA 2BDCA 1WTHD 1ANDA 2PHBA 2BZ6H 3T5FH 1GI8B 1UTKA 3FP8E 4ZXYH 4OS2A 2JH0D 4K5ZA 2TIOA 1T4VH 1ZHRA 3SUDA 2ZFFH 2Q6GA 1AUTC 2FOAA 2ZU1A 1S84A 1UVSH 3RLYH 5H4IB 2OP9A 1P2IA 1A7SA 1K1IA 3SUFA 1ELEE 1P11E 1F7ZA 2H9HA 1BTWA 1UCYH 1KYNA 2A7JA 3BTHE 4MVNA 1BRAA 1TAWA 2ALPA 1L0ZA 4Y0ZE 1TE0A 3W94A 3RXAA 3RXGA 3OSYA 2JH6D 2LPRA 3KQDA 2F9BH 4XBBA 2BDYA 3KF2A 3V3MA 1YPHC 1TNGA 2VWLA 1O3CA 2VGCC 2FESH 1GG6C 1HAVA 3H7OA 3NXPA 1C1RA 1WQVH 1MBQA 3A7TA 1MBMA 3ZZ7A 1HLTH 2OD3B 1GBLA 2WYGA 3E3TA 3DHKH 4U32A 3ENSB 5LPFA 4MTBA 2XNIA 3V7TA 2PWXA 4ISIH 2HVXA 3M3SA 4KTUA 1K9OE 2FI4E 5C1UA 2Q6DA 3RXDA 1TB6H 3ATLA 5F8ZA 3EDXB 3JZ2B 4IN2A 3GYMA 3O8CA 2Z3EA 2C90B 4IC5A 2GCHG 3MH6A 4MG3A 1O2UA 2CHAB 2PKSC 2QYIA 1BDAA 2VIQA 3SO3A 3A87A 3ATWA 1RXPA 3T29A 1A4WH 2VH6A
chains in the Genus database with same CATH superfamily
1LO6A 2BLVA 2FTMA 4AFSA 1EPTC 3DFLA 1NM6A 5GWZA 2QF0A 3M3TA 4B2BA 4NSVA 1CBWB 3LKWA 1A46H 3LGWA 2TBSA 3WY8A 1ZPCA 1Y5BT 4YO9A 7GCHF 3BEIB 2FS8A 1O35A 1O5EH 4XDEA 3LIWA 4NZLA 1KIGH 5GPIB 4DIHH 1B7XB 4CHAC 4E05H 2FIRH 1KXEA 2HLCA 3U98H 3AAUA 1TQ7B 5EW2H 3QX5H 1MKXH 5C3NA 1ZGIA 4THNH 2J9NA 4I32A 5DP8A 4WMEA 1XKBC 2QAAA 4Y11E 2QXJA 3EGKH 1G3CA 4XBCA 1HAVB 2P8OB 1V2ST 1Y8TA 3N7DA 4K1SA 1O39A 1TMUH 1AMHA 4ABBA 3F2GA 3T25A 2ZDMA 1C2IA 5T1VA 2OLGA 4XBDA 2GMTB 5A2MH 1CO7E 2ANWA 3S0NA 4Q80A 1V2JT 2ZWLH 4XFQA 2W3KA 2STAE 3PMBB 1ETTH 2LP6A 4XOJA 1XM1A 1MUEB 1QJ1B 1THSH 2F9UA 3OTPA 3UAIC 4IBLH 1NBME 4OS4A 2ZGCA 3U8TH 1SLVB 2ZO3H 3ODDA 2EEKA 3SV7A 3P70B 1CQQA 1V2PT 3A82A 3RXCA 1WXRA 1GJ8B 1HAXB 5ETXA 4K60A 1GJDB 5C2ZA 2C8YB 2Y80A 1ZGVA 5E0GA 1QRWA 4R8TB 1AB9B 2UWOA 2CGAA 2A1DB 2A5KA 3L3TA 3F0PA 5A8YA 1QBOA 5TCAA 3SQEE 1QGFA 1GI9B 2J95A 3SU4A 4NIWA 1A1RA 4I8GA 1SGPE 4ESTE 3HK3B 1O5AB 3CENA 3ZIAD 5L2YH 4KTSA 1TRNA 1W11U 3GCHB 3VB7A 3LGTA 3E0NB 1O3FA 2A5AA 4ABFA 4CRDA 5C1XA 4NWKA 1ARCA 1TNHA 2FI5E 5JBBS 3ZV8A 1MTNC 1SSXA 1PPZA 1CT0E 1ZMLA 2RA3A 2XC0A 4I8JA 2WPHS 1HAZB 4OS5A 1GDQA 1TPSA 1SMFE 4GPGA 3F0OA 1C1WH 1FQ3A 3SBKA 1BHXB 4E7RG 1O2HA 1XVOA 2D8WA 2ZHEH 4ISOA 4O3UA 5GCHF 3ZZBA 3PROA 2ZPRA 1C2LA 4X6NA 1YPLH 4X8UH 1P0SH 4WWYA 4ZMAH 1P2MA 3TNSA 1O2TA 1YY3A 1D9IA 3KQ5A 1TX8A 3EE7A 1OWHA 3OY6U 3OFND 1S6LA 4DCDA 3LGYA 2TGDA 3Q00A 2Q1JA 4OS1A 1ELCA 1JOUB 2CJIA 3BG4B 1WQSA 2P59A 3PLKA 1OS8A 1DVAH 1J14A 3TLOA 1NZQH 3GS9A 2A2QH 4RI0A 3CNRA 3DUXH 1C5SA 1EB2A 1AVWA 4MNVA 3F9EA 3ZZAA 1NRNH 2XWAA 2A32A 1GMCF 3QGJA 2FYRA 1JRSA 2QN5T 4MNWA 1GMHG 1FIWA 1ORFA 1H4WA 3B8JA 1HAGE 2DE9A 4ACBA 1VJAU 1AHTH 4IW4E 5E2PA 2L6OA 2ODQA 1SGCA 1OWIA 1T4UH 4VGCC 2V0BA 2QCYA 4NA7A 7LPRA 3GDSA 1THPB 2IPQX 4TPIZ 1HAHH 2SGFE 3QUMP 2G4UA 1Z8RA 1S0RA 4OGYA 1LHEH 1TFXA 1SLUB 1O3OA 1XXDA 2BQWB 3IWMA 2WPIS 1TRMA 1BCUH 1P9SA 3SU3A 1YPKH 4FU7A 1QFKH 1YLCA 3MNBA 4CBOA 1EAWA 1INCA 2GCHF 1O3LA 3TPIZ 3UNSA 1A5HA 1E37B 1XXFA 1SLXB 3M37A 5JBAS 4YT7H 1WCZA 1TGCA 4Q4LA 1ZSKA 5L2ZH 3IG6B 4KP0A 1WU1A 1DWDH 1LKBA 2BX4A 2FEQH 4DW2U 1C1NA 4RN6A 2O8MA 1AY6H 1RGQA 2Z9JA 5C0UA 2VWNA 2ZA5A 1C2FA 5FPSA 4I86A 1IQLA 2AH4X 4FUFA 1OKXA 2QV1A 1C5OH 5HXFA 1EPTA 1BA8B 1SI5H 4U30A 3UR9A 2Y7ZA 1ZTJA 3SV2H 3DD2H 3PTNA 5L30H 1Q2WA 1TOCB 1ZZZA 3TK6A 2WUBA 3MMGA 1BJVA 1C2EA 1EP5A 3SHCH 1GBMA 1O3KA 1HGTH 1NROH 4X1PU 2P3TB 2H9EH 3ATMA 2XRCA 2H1UA 4HI3A 1JXPA 1SGDE 2A4GA 2OTVA 3A88A 5GJ4B 1YCPK 1DICA 3DFJA 3KNXA 3ESTA 2YMSB 6CHAC 1TGBA 4NA9H 3RXQA 2EI6A 3RXTA 5DGJA 4XE4A 4H42U 4X1QU 2NU3E 3WW7A 1C2MA 4B1TA 1EUFA 4Y7AA 2KX4A 1BTHH 1SOZA 1E34B 1BTYA 3S7HB 2BD9A 2GT7A 1BTXA 1ESTA 1HAOH 5EJLA 3K2UA 4GUXA 1O2JA 1W0ZU 1F5LA 4O97A 4ZHLU 3SI4H 1D6RA 5DP5A 1BRUP 1P57B 1LVOA 4Q63A 2A45B 2BLOA 1Z8IB 4AOQA 3SJKA 3I78A 3PWCA 2SNVA 2PKAA 5AVDA 5T6GA 1TPAE 1RTLA 2VH0A 1A0LA 3SU6A 2VJ1A 4AC9A 2HPPH 3QO6A 5PTPA 1IAUA 3KN2A 1O38A 1O32A 3GY3A 4NG9H 1DPOA 1QL9A 3MU5A 3TK9A 2AGIX 5DPAA 1C1MA 1ESAA 2XXLA 1DS2E 2AMPA 2R9PA 2YOLA 1O3GA 1FDPA 2WPDD 1MD7A 5I25A 2XC4A 1C1VH 2BD5A 3A83A 3SUGA 2KFWA 1KTTB 4ABAA 2GV7A 1NTPA 1UTOA 3URDA 3ELAH 2DE8A 1B0EA 3RXKA 1H8DH 1CA0B 1MKWK 2BM2A 1DWBH 2VWMA 4CRCA 1D3TB 1AI8H 1Z6EA 2PP6A 3LH1A 5TJXA 4AFQA 2BY6X 1FY4A 1GBAA 5EPNA 5G4BA 1Z6JH 4ZAEA 4JZ1A 1K0HA 3BF6H 1SG8B 1GBTA 1ZHPA 1C4U2 1FX0B 4CHAB 3MFJA 2XCFA 3ZVBA 4DG4A 3PMAB 2ZCKP 3GY6A 1KDQA 2G55A 2G4TA 4X2WA 1TYNA 2BHGA 2ZTYA 2WUCA 1HB0B 1UK2A 5BPEA 2Z7FE 2UUFB 1XUFA 2HLDD 3FKSD 5EGMA 5AF9H 2ALVA 1QCPA 1TX6A 2PKAB 1OPHB 4UFGH 2WSSD 4YT6H 7KMEH 1HNEE 3MTYA 1M9UA 4JYUH 4AB8A 2O8UA 1D3PB 1LPKB 3GICB 1Y5AT 4E06H 2ZFTA 1LVYA 4BAHB 1GL0E 2OQUA 4X2YA 1OWDA 1HAIH 3OE7D 3RXLA 1V2KT 2ZU5A 1UTJA 1C2JA 1HIAB 5C5NA 1Z71A 3OTJE 1Q31A 3EA9A 2WPKS 2KAIA 1GMHF 2ODPA 3H7TA 2ZGBH 3STJA 1SFQB 1BTPA 1F5RA 2Y5GA 2A4OA 3CS7A 1SGFA 1LHDH 3PYHA 3E8LA 5FCRA 3KCGH 3V13A 1WUNH 2ZP0H 1P03A 2O8LA 2SGDE 2ZTZA 1IOEA 3NUMA 4Y8XA 3GCNA 4NSYA 1H9HE 1UO6A 3F2FA 2BMGB 3EYDA 1S6HA 1DFPA 4JK6A 4FUDA 2STBE 1WSSH 1FPCH 2W6ID 5EU8A 2Y5FA 2GVFA 1N8OC 5E0HA 3SNBA 5HKKD 2AGEX 5J4QA 1KDQB 1KXDA 1MTSA 1MTNB 3FP6E 4UFFH 1DWEH 4TWWA 1P2JA 1K2I1 1LHCH 2VIVA 2FDAA 1IQIA 2XBWA 9LPRA 5JB8S 1T8OA 1ZTKA 3UIRA 2JETC 4JYVH 1FNIA 3A8AA 3ZVFA 1O2LA 3CP7A 8GCHG 1O33A 2ZI2H 3FOAA 5FXLA 5FBIA 3RC4A 1Y59T 1LHGH 3ZZ3A 3RMOH 4CH2B 2NU1E 5AFZH 1ABJH 1H8IH 3NZIA 4GCHG 2Q6FA 1ZJKA 1RS0A 4DOQA 3U1IB 2VNTA 2FM2A 2GT8A 4Y79A 1IQJA 2V6NA 2G81E 3KYFA 2XBYA 2QC2A 2V3HH 3LGVA 1C5QA 1EB1H 5CMXH 2YNBA 1MD8A 1BJUA 5DP7A 3U9AH 1GI0A 5FCKA 8LPRA 2TGPZ 1GHBG 2AFQB 5EPYA 4IS5A 4AZ2B 2QXHA 2TGTA 1NN6A 2UWLA 1GGDC 3SU0A 1NFWA 1F0UA 1CHOF 2F91A 4IMZA 4WJG2 1KTSB 1UW7A 1G37A 4NCYA 4VGCB 1AKSA 1DUEA 1OWEA 3FZDA 1YPGH 1CA8B 3N7EA 4Y71A 2B8OH 4CRGA 2KCYA 4P02A 1OP2A 3E6PH 1QIXB 1XKAC 1MZAA 3T2NA 3SNAA 1YYY1 3F3BA 2FZZA 1ZTLA 2F4LA 4FU8A 1CGHA 3LGUA 1A61H 1EZXC 2BY8X 1AU8A 3PMJA 2Z9KA 2J92A 3B23B 1IQFA 2GCTC 2K1QA 4TYDA 3RXHA 1NO9H 3KGPA 3HGPA 1YCPH 1YLDA 5T6DA 1C5WB 2A7HA 3F1SB 1L4DA 4JCNA 4YTAA 3SUEA 1MZDA 3FO8D 1W8BH 3C1KA 4U01A 3TGJE 1FI8A 4WF8A 1AE5A 3RU4T 1QL8A 4CRBA 3LU9B 1BOQA 4Z0KA 3BN9A 2FI3E 1IHTH 3LC3A 2GV6A 2ZGJA 1ELVA 4M7GA 4ABJA 3RU4D 1DWCH 2F3CE 2F43B 1KLTA 2Z3DA 5F53A 2ZU4A 3SQHE 5C67A 1JIMA 3TJVA 3ZZCA 3A80A 3M5NA 1SGTA 6CHAB 4MPUA 1C1UH 2ZHQH 1ZMJA 4YOIA 3BIVH 3MU8A 1QURH 1ESBA 2GDEH 4DJZB 1XUJA 1WYKA 3A86A 5GNDA 2H5DA 3MNXA 1XUIA 3ITIA 3OYPA 1AKSB 3TIUA 5LGOA 3ATIA 1XX9A 5C5OA 1QL7A 5EODA 1O2IA 2IOTA 2HOBA 4JMYA 1ZPZA 1A2CH 3AASA 1GBBA 3BSQA 2A7CA 4JZEH 4KKDA 1MKWH 4WXIA 3OEED 2P3UB 2BLWA 4WVPE 3PV4A 1C5RA 2OBQA 1Z8GA 3SU5A 1V6DA 4B75A 2F83A 3A8BA 3BTKE 2VU8E 3PM3A 1UTQA 2WV9A 5FX6A 5HIYA 5A8XA 2VIWA 2FPZA 4A1VA 1HRTH 2QXIA 1YKTA 3VXFH 1GI6A 4XD7D 4K1EA 2A5IA 1GMDF 3M35A 2YNAA 3L33A 2G51A 1O2SA 3KEEA 3A89A 1AWHB 2ESTE 1V2VT 4I8LA 1C1PA 1AGJA 1S0QA 4MNYA 3IITA 5HGGA 4AG1A 2C93B 3U28C 2ZPSA 1TX7A 5A0CA 1ZOMA 3DT0H 3RM0H 1KY9A 1O2MA 2ZGHA 1FXYA 3SGAE 1AO5A 2UUJB 4D7GA 1MU8B 2AIPA 2ANMH 4F48B 3V12A 2BYAX 2OQ5A 2B9LA 2G5NA 1BMAA 2H2ZA 1MQ5A 2F9VA 1TBQH 4LOYH 1HYLA 1N6YA 2ZDLA 3H09A 4X1NU 1C2GA 2OC1A 6GCHG 4H6TA 1LCYA 3MWIU 2PR3A 2VVUA 3JZ1B 4NIVA 2FX6A 1P12E 3UREA 1SPJA 2ANYA 4B73A 1GJ6A 2FMJA 2PV9B 3Q77A 1W12U 5CHBA 3EA8A 3FANA 2F9PA 4MLFB 3K6ZA 3VFEA 1EX3A 3BEUA 4BTIB 3F9GA 4UFEH 5ESTE 3P8OA 3C27B 5EQQA 2ZGXH 2OC8A 4TY6A 1SKYE 1IQNA 1YPJH 3GCTF 1S81A 3F2HA 3ATKA 3Q3YA 3UWIA 4A6LA 4DVAU 5TCCA 1P2NA 1XUHA 1HCGA 4LZ1H 3A7VA 2HNTF 3UUZA 1S85A 3SGBE 1CHGA 5C17A 1EASA 4ZUHA 2AS9A 2FOFA 1DDJA 2O9QA 3UOUA 5A8ZA 1FY5A 5J4SA 1EZSC 1UTLM 3PMHB 3RLWH 5BRRE 2AMDA 3SJOA 1HJ8A 4JZIA 4CR5A 1HUTH 3PV2A 1ACBE 1G2MA 1HV7A 4ZKOU 4IN1A 3HKIB 1V2OT 2ZTXA 4MNXA 2V3OH 3SJ8A 4IGDA 5ABWA 1GI3A 1Y3UA 2ZPQA 2VB0A 1A0HB 1FMGA 3GY8A 1RIWB 1N8OB 3OY5U 5K0HA 1W7XH 2BXTH 1BMMH 1ELGA 1QJ6B 2ODYB 3RXVA 1VJ9U 1A0JA 5IYTA 2R3UA 3LDXH 3NKKA 2HWLB 2OC0A 5GIBA 1EP6A 5SGAE 3UOPA 4Y6DA 1O37A 1FN6A 2Z3CA 2JETB 1SQAA 4I31A 4Q7YA 3K65B 2CK3D 1C2KA 2BLQA 3BEFB 3MNCA 1Y3WA 2QA9E 3DA9B 2VIPA 1RD3B 1T8MA 1HJAC 1OXGA 1VITH 1VGCC 4LK4A 2R2MB 5DSFA 4AG2A 1ZYOA 1GJCB 4X8SH 5DP3A 2SGQE 3LT3A 2L74A 1GHAG 2FO9A 1RFNA 4IC6A 3TJUA 2FOCA 3NK8A 2GZ8A 3RP2A 2ZG0H 3ZZ5A 4AFUA 1JRTA 2J94A 4NIYA 3SW2B 2F9NA 1GHZA 5FAHA 3F6UH 8KME2 4RSPA 1K1NA 1P02A 1V3XA 3TJOA 2CN0H 3S7KB 1C5YB 1GGDB 2OINA 1NRSH 1E38B 1L2EA 2JH5D 3M7UA 1DXWA 3OX7U 1UJ1A 2RG3A 1VITG 2TRMA 3NPSA 1LTOA 1PFXC 2RDEA 4X1SU 3MU1A 1O5FH 2G5VA 2Z94A 4GVUA 3K6YA 1E0FD 1YM0A 2BDIA 5F6MA 2GGVB 3NWUA 2OBOA 2PUXB 4YZUA 2SGPE 4NFEA 1ABIH 2VVCA 1Y5UT 1A5GH 1C1QA 1CVWH 2GCTB 1GVLA 5DP6A 2AERH 3A7XA 1BMLA 3GCOA 1OX1A 4YOJA 1GBFA 4D76A 1DUAA 3A7YA 1SB1H 4O3TA 1FY3A 3UQOA 4F55A 3BTME 4IMQA 1ZHMA 5HIZA 1FPHH 3O8DA 3VB4A 3GOVB 2EC9H 1GVZA 1T8NA 2QF5A 1O2VA 4Q7ZA 1EJMA 4Y7BA 1SGFG 1BITA 2RCEA 4TT3D 1BIOA 1C5VA 1X7AC 1ANBA 1W7GH 2QIQA 2XW9A 2ZU3A 1NRPH 2PTCE 4D9QA 1BRBE 3MU0A 3VPKA 2BX3A 2VGCB 3MU4A 1GG6B 1P3EA 1O3AA 5ESBA 1NFXA 3OAAD 2M2AA 5DG6A 4Z1MD 2QXGA 6GCHF 1GI4A 2FOGA 1AFQC 4FETA 2P16A 4DT4A 1ZMNA 3U1JB 3ZVCA 2YMSD 3E1XB 1QZ8A 4GHQA 1S83A 4BOHA 1H8ED 4RT1A 3RMLH 3MYWA 3UY9A 3P8GA 2P94A 1BBRE 1OWKA 2BB4A 1C5PA 3BIUH 1UTPA 4XRNA 4B6EA 1D3QB 3LOXA 4ACAA 2BXUH 1C1SA 4Q7XA 1O2KA 2ZDKA 4ASHA 2Z6BD 2BD7A 1K1PA 1SFIA 5GXPA 2J98A 1J9CH 2CHAC 1LVMA 2NU4E 2PKSB 1O2NA 2GKVE 4I8KA 1O5DH 4NFFA 3GY5A 5AFYH 5EXNA 3PLBA 4ZHMU 2ZCLP 2GP9B 1FLEE 2BY7X 1EPTB 3GY2A 1CGJE 1CBWC 4DY7B 1GHYH 4TPYA 1GBCA 5FPYA 5HMAA 2ZFRH 2Y5HA 3A8DA 3TU7H 1T8LA 1J8AA 1BRCE 2FS9A 4ZROA 4AORA 5B6LA 3GDUA 2FOHA 1MQ6A 2FOBA 2LNCA 1UK4A 2FOMB 3SORA 5F8XA 9ESTA 1C5NH 3SNEA 1IQGA 1EAUA 3BTTE 1V2QT 4FXGH 3D62A 1EZQA 1XVMA 2KCOA 1GBKA 3GYLB 1YC0A 1L1NA 1TPPA 3E90B 3DSPA 3WWBA 1S5SA 1JIRA 1K1JA 3HK6B 1ZJDA 2A31A 1BMNH 2ZHWH 4WMDA 3SJIA 5DN6D 2P93A 1BUIA 1XUKA 4AN7A 1C5LH 2GD4B 1FZZA 4ISNA 2J5UA 4DGJA 3VB5A 2IN2A 1QNJA 1SC8U 4FUJA 1MKXK 3TVJB 4M9FA 1GI5A 2EY4C 3S9AA 3QZQA 1N1LA 2PSYA 1LDTT 4D9RA 1TNLA 1AQ7A 1G9IE 1AVXA 2RDLA 3KYGA 1C4Y2 2FOEA 1V2LT 1CU1A 1O3JA 1YGCH 2J98B 1C4V2 4AGKA 2QF3A 4GHTA 3TNTA 3QTOH 5C1YA 1V2TT 4LZ4B 2H6MA 4BXWA 2ZZUH 4FUIA 4TSFD 4ZHAA 1GL1A 5HYOA 5DK1A 2BZAA 1DITH 3LJOA 1O2YA 4I7YH 1OP0A 1YP9A 5L6NH 3SV6A 4AYYB 3BTGE 3E0PB 1AUJA 2Y81A 1JMOH 1W2KH 3RM2H 3TGIE 1QBNA 1UCYE 1SGYE 4GSOA 4K2YA 4Y8YA 5IDKA 1SQOA 2R0LA 3ZVEA 2VVVA 5CE1A 3GCHC 1TLDA 7GCHG 2A2XH 2XC5A 1A3BH 1H9IE 2GZ7A 3FP7E 2NU0E 4YESB 4MPWA 1D3DB 5DP9A 1K22H 4BTUB 2HNTC 2B5TB 1TIOA 2B7DH 3A81A 1AZZA 2FLRH 3RXIA 2FYQA 3FZZA 1LHFH 3SGQE 1HAYB 5FL7D 1H8HD 3TITA 1NFUA 2C8ZB 3STIA 3D49H 1FY8E 4LXBH 3QDZB 4X2XA 3T27A 3UB0A 5A0AE 1GHVH 2BD2A 1O3EA 2WV4A 1MMJN 5FHTA 3EA7A 2D1JA 1DE7H 5LPEA 1C1TA 1EFRD 2C4FH 2XNDD 4U2WA 4DIIH 1OWJA 3BG8A 3KQBA 2GJGA 1QA0A 2I6SA 1YPMH 1L1JA 1FJSA 4JZFH 2OXSA 3FAOA 1Q3XA 1W3CA 1RRKA 1P05A 1P9UA 2J34A 2ZKSA 3A7WA 2EA3A 4F4OC 1XUGA 2BD8A 1DXPA 1EATA 1QQ4A 4WMFA 2KAIB 2CF9H 3TH4H 1QJ7B 1BTZA 4CBNA 4CRFA 2QE7D 3MI4A 3S9BA 1K1MA 3BV9B 2ZFPH 1E36B 1P2OA 1SOTA 4UE7H 1AVGH 5EQSA 3RXSA 2FLBH 4TY7A 2BDBA 1VGCB 3M5MA 1H9LB 1NESE 3SU2A 4YXWD 1ELDE 1MAYA 3PTBA 4X8TH 3U8RH 1WV7H 4Z6AH 1VCQA 1FIZA 2A4QA 3SJ9A 2BOHB 2WINI 4GLYA 1GI2A 5JYIA 1E1RD 2K0QA 3SZEA 1GBEA 4MDSA 2ASUB 1O3MA 2IPHA 1P06A 1AE8H 1NBMD 1O30A 2BDGA 1C5ZB 1MU6B 1BTUA 1SLWB 1SQTA 1PPHE 1DSUA 3AW0A 2HVYB 1AN1E 1QRXA 4WY3A 2FODA 3P92A 2J2UA 2SNWA 1Y3VA 3RXFA 3K9XB 4P00A 4HZHA 3TH2H 1SGQE 3MNSA 4D8NA 4J1YA 3MO3A 4OS7A 1GJ4H 5GCHG 4AX9H 2VBCA 1ETRH 1V2MT 1QTFA 1S6FA 1TWXB 2AMQA 1WDIA 1SVPA 1YLNA 2KCPA 5EXLA 4BXSA 1AZ8A 5E2OA 1NU9A 1FUJA 3VB3A 2TGAA 1GHXH 1J16A 1C2HA 4X1RU 2QY0B 4MPVA 5DKMA 3Q3XA 3KHVA 5CHAC 1EOJA 1FV9A 3QK1A 3SZNA 1J17T 2P3FH 3BTDE 2F9OA 3M5LA 2W26A 2UUKB 1V2UT 4OM9A 1GI7B 1COWD 2Y7XA 5AHGH 3M3VA 4JYTA 2BVRH 4WH6A 1GMCG 3HATH 1YWUA 1HJ9A 1TNJA 1G36A 1BQYA 5B6OA 4KGAA 4RKJB 4ZCNA 2OK5A 1TABE 2H9TH 2TPIZ 3M5OA 1LQEA 1TA2A 1IQMA 2OCVB 4INHA 1GBIA 1O2PA 4PROA 3T62A 3KQCA 1AFQB 1SR5C 3P95A 4QT8C 1GJ7B 2ZDAH 5FX5A 1TOMH 1JWTA 4H6SB 5EJZA 2KCAA 5A0BA 2HALA 3HPTB 5C20A 3ZVAA 2ZQ2A 3E16B 2CV3A 3GY4A 2W5EA 3DSGA 1ANEA 1QY6A 2J97A 2G52A 1PYTD 4CRAA 1NT1A 1UVPA 1NC6A 1E35B 3RXMA 1EXFA 3AK5A 1PPCE 2AEIH 3GY7A 3UPEA 1O34A 1P2KA 1QB1A 2SFAA 3UWJH 1WAYB 3LC5A 1KXFA 1ZSLA 4FUBA 1CA0C 1QR3E 3KQEA 4RT0A 4INLA 5IK2D 1DLEA 4YLUA 3R3GB 1V2RT 3SYJA 4HGCA 2EQNA 1O2WA 1E1QD 2XOKD 5E8EH 1KXBA 5EW1H 4ISLA 1DOJA 3D23A 3UNRA 1F0TA 3ZZDA 3PB1E 1HDTH 2EI8A 2ZF0H 2ZECA 5DJ7A 3PWBA 2RA0A 2Y6TA 6LPRA 4FU9A 2CMYA 3MO6A 4Y0YE 1RTFB 1DANH 2J38A 2PSXA 4KTCA 3T28A 1Z1JA 3ZYEA 1DLKB 2JJ2D 3DCLA 1A3EH 4AFZA 8GCHF 1QB6A 3RMNH 3SN8A 4Y8ZA 1PPEE 3BTWE 1TQ0B 2VWOA 2ZCHP 1T7CA 4YOGA 3I77A 3S9CA 1ZLRA 4GCHF 1CGIE 3RXOA 4B2CA 4E7NA 3LPRA 4B71A 5T3HA 1U6QA 2KM0A 4SGBE 1GPZA 5C94A 3HKJB 1O2RA 1GJ9B 2EI7A 2H5CA 2O8TA 1SL3A 4UONA 4I8HA 2GTBA 3PV5A 7ESTE 2CF8H 4FUCA 4DURA 1G30B 1MTUA 2HPQH 2ZHDA 1GHBF 3VG8A 3FFGA 3N7OA 1J15A 4A92A 1G3BA 4ASUD 1C1OA 1QQUA 3W1EA 1SBWA 4CREA 1GBHA 2XBVA 1TONA 1KSNA 4ZKRU 2ZIQH 5E0JA 1TALA 2LELA 3BTEE 3VGCC 3RC5A 1OSSA 3E91A 2D26C 1BHXF 4ZKSU 3SOSA 8ESTE 1ETSH 2V7QD 4MPXA 5LPRA 1HFDA 1O3HA 5T6FA 1GCTC 1PQ7A 4D7FA 5I46H 1TMBH 3RU4E 4O9VA 4BAMB 2BVXH 2R0KA 4ZXXH 3MHWU 5LH8A 1LPGB 1RTKA 1C9PA 1YF4A 1B5GH 5KGOA 1TGNA 3H5CB 1LKAA 1NU7B 1C2DA 4Y10E 2PGQB 3MQKC 1BBRK 3GISB 3UQVA 2ZQ1A 2PLXA 4GAWA 3RXBA 1CSOE 1EAXA 1UTMA 3LJJA 1O3IA 1MCTA 1SHYA 1ARBA 1ELFA 1O2OA 1GJBB 2BTCE 1V2NT 5HM2A 1QA7A 2AHME 3ZVGA 3L6PA 4J2YB 5EQRA 4X6MA 4WH8A 1NS3A 3RXPA 1SGNE 3PO1C 1EZUC 1FONA 1T31A 1UVUH 2AGGX 4JZDH 1C5MD 1KLIH 1GVKB 2KR7A 1TBZH 4XSKU 3RXEA 1LQDB 4K8BA 4F49A 3UFAA 1F92A 4X2VA 1VR1H 4AB9A 3QLPH 3RUOA 3BTFE 2A4RA 1G32B 2WPMS 2ZHFH 3O8BA 1TGTA 1MTVA 2JDID 4X6OA 3W95A 1KXAA 2G00A 2XYAA 1UVTH 1PPFE 4CH8B 4YM9A 1MAXA 2THFB 1OYTH 1Z1IA 1K1OA 1W14U 2FWWA 3AVZA 3OU0A 3RXRA 1K1LA 3SHAH 1KXCA 2Z9LA 1TBRH 1L4ZA 2GZ9A 3TGKE 5A09A 2W7SA 4BAOB 1GBJA 5K7RA 4ABEA 2NU2E 3UR6A 2UWPA 4BANB 1G2LA 3CS0A 1C5XB 2O8WA 3URCA 3M61U 3O8RA 2BY5X 3NRLA 3P8FA 1NRQH 3ZYDA 5C0TA 3EQ0H 1IQEA 1O5BB 1QHRB 1OP8A 1P3CA 3M7QA 4Y76A 3NCLA 1HAPH 4NGAH 4ABGA 1F5KU 2FTLE 3VB6A 5EIYA 1ZRKA 5JBTA 2QF4A 4A1TA 1A5IA 1SGIB 3VXEH 1EAIA 1ID5H 3TK5A 2ULLA 4BAQB 3PLPA 4A5TS 4AGJA 1XMNB 2SGEE 1MCVA 4KELA 3TH3H 1D4PB 3F68H 5GDSH 4K1TA 3SV8A 1TA6A 2JIZD 4Q2KA 3U69H 5DO4H 1Z7KA 1Z8JB 1QB9A 1HXFH 1UCYK 1EJAA 1NFYA 4B6FA 1TMTH 3SV9A 4NA8A 5CHAB 1O2XA 1HPGA 3P6ZB 3EAJA 1ZRBA 1O2ZA 2DUCA 3QGNB 2ZEBA 4K3JA 3ZVDA 1PYTC 1ELTA 2SGAA 1GWAA 1PQ8A 3ZV9A 1WBGB 1DT2A 1GJ5H 2K8IA 4UDWH 2ZC9H 4WXVA 1CE5A 2ZFQH 1H1BA 4ZKNU 3VEQB 2BD3A 2BD4A 3SNDA 2PFEA 3UNQA 1CHOG 1E79D 1FN8A 3Q3KA 1MABB 2HGTH 1TNKA 4UEHH 1NRRH 2BDAA 1DY9A 2A0QB 4FUGA 1F0SA 1UTNA 1WTGH 3AW1A 4UFDH 1FAKH 1O3NA 1PQ5A 2WPJS 3BTQE 4UD9H 2G8TA 4JK5A 1NPMA 2WHXA 3KL6A 2WV5A 4HFPB 1O2GH 3PRBA 2CXVA 1K21H 5JDUB 3ZZ4A 1HIAA 3P17H 4RKOB 1YPEH 2ANKH 1L1GA 1AFEH 2C8XB 1WOFA 2GX4A 1OHHD 4NWLA 2HNTE 5F03A 4H4FA 1FY1A 1YBWA 3GDVA 2PGBB 4K8YA 1TNIA 1O0DH 1OOKB 3FVFB 4ABDA 3QWCH 1P10A 1GCDA 2Y82A 4O03A 3MOCA 5JPMH 4HG6A 2P8OC 1O5CB 1EJNA 3SNCA 1UVOA 3V0XA 1THRH 1F2SE 4AYVB 1F0RA 5JB9S 1RJXB 5EOKA 3MH4A 3U8OH 1Y3XA 3P8NA 2GMTC 3RC6A 1W10U 2VIOA 2XCNA 4DT7B 2FP7B 1ELAA 1P01A 3MH7A 4FUEA 4FUHA 1IQHA 1QRZA 3HGNA 1EOLA 1O2QA 2BVSH 1T32A 1P09A 1TPOA 2ZNKH 2W6JD 4ZH8A 1AIXH 1ELBA 4I33A 2BY9X 3AAVA 4MQAA 1BZXE 1C5UA 4K69A 1PPBH 3LONA 2OUAA 1P2QA 4NIXA 3M36A 3I29A 1GDUA 2KZ4A 2JJ1D 2PW8H 2AIQA 3FN8A 3MH5A 2UUYA 1GHWH 1IQKA 2V35A 3T26A 3WWFA 1UHBA 1UMAH 1BT7A 1AB9C 1D6WA 5KECA 5DP4A 1GHAF 3MO9A 2IJOB 3KIDU 4BAKB 4HTCH 3S69A 3SI3H 1PJPA 2OC7A 1SQRA 1GI1A 2BOKA 2NWNA 3RXJA 1FAXA 3RDZA 2C8WB 3LGIA 1LPZB 4BNRA 3F9FA 1BB0B 1ANCA 1GDNA 4X6PA 1ZPBA 3B9FH 5FPTA 4OS6A 5F8TA 1PPGE 1VCPA 1O3DA 1GJAB 2D2DA 4FVBA 1EQ9A 1G3EA 2BQ6B 1ZR0A 2VINA 2WYJA 3OEHD 1VITF 2WPLS 3A84A 3VGCB 1O3BA 2JKHA 2QGRA 1GMDG 3RXUA 1SHHB 4BTTB 4X8VH 1DX5M 1BBRH 3UTUH 1AD8H 2BQ7B 3QN7A 3M7TA 2M5TA 1O3PB 1YCPM 2Z9GA 4NZQA 2ILNA 4CR9A 1O31A 1GCTB 2FXRA 1SGEE 2XBXA 5FBEA 2R3YA 5JBCS 1P8VC 2W7UA 1RIWC 1TRYA 2I6QA 1B0FA 2R2WU 4R0IA 3ZZ8A 3G01A 5EXMA 1W13U 4FVDA 6ESTA 5EJ1A 2ZDNA 1C9TA 2C3SA 1MH0A 4A7IB 4TWYA 4YLQH 1OYQA 4SGAE 3DSOA 1CT2E 1G3DA 1K28D 1O36A 3RMMH 2J4IA 1DY8A 2HRVA 2RFKC 1TGSZ 3F9HA 3TJNA 3QTVH 1HXEH 4ABHA 5KEDA 2W3IA 1DSTA 3BG4C 1CT4E 4ISHH 2ZFSA 3ZZ9A 2P95A 1NY22 1VCWA 3ODFA 1HBTH 1QBVH 2BDHA 3A85A 3EE0B 1MTWA 3A8CA 1LVBA 1V2WT 1W0YH 1P04A 1S82A 4B2AA 1SGRE 1ZSJA 1YPHE 2XTTB 1GBDA 3R0FA 3ZZ6A 4ABIA 1UK3A 1W0JD 1UHBB 4B76A 2GDDA 1VZQH 3PO1B 1PQAA 1HJAB 3SU1A 2ZDVH 1KLJH 2AYWA 2IJD1 1DM4B 2B0FA 3D65E 3N99A 4X0WU 3Q76A 1LMWB 2PTNA 3A7ZA 4B74A 1O5GH 2V3MA 1C5TA 2FX4A 3GCTG 2Z9IA 4INKA 2ZU2A 3LH3A 4OGXA 1EKBB 2VIDA 4A1XA 5HM9A 1JBUH 1Y3YA 5EG4A 2XWBI 2PUQH 1N6XA 1IHSH 1AWFH 3QZRA 2BDCA 1WTHD 1ANDA 2PHBA 2BZ6H 3T5FH 1GI8B 1UTKA 3FP8E 4ZXYH 4OS2A 2JH0D 4K5ZA 2TIOA 1T4VH 1ZHRA 3SUDA 2ZFFH 2Q6GA 1AUTC 2FOAA 2ZU1A 4FOUC 1S84A 5CDFE 1UVSH 3RLYH 5H4IB 2OP9A 1P2IA 1A7SA 1K1IA 3SUFA 1ELEE 1P11E 1F7ZA 2H9HA 1BTWA 1UCYH 1KYNA 2A7JA 2YMSC 3BTHE 4MVNA 1BRAA 1TAWA 2ALPA 1L0ZA 4Y0ZE 1TE0A 3W94A 3RXAA 3RXGA 3OSYA 2JH6D 2LPRA 3KQDA 2F9BH 4XBBA 2BDYA 3KF2A 3V3MA 1VKYA 1YPHC 1TNGA 2VWLA 1O3CA 2VGCC 2FESH 1GG6C 1HAVA 3H7OA 3NXPA 1C1RA 1WQVH 1MBQA 3A7TA 1KMHB 1MBMA 3ZZ7A 1HLTH 2OD3B 1GBLA 2WYGA 3E3TA 2WZQA 3DHKH 4U32A 3ENSB 1BMFD 5LPFA 4MTBA 2XNIA 3V7TA 2PWXA 1W0KD 4ISIH 2HVXA 3M3SA 4KTUA 1K9OE 2FI4E 5C1UA 2Q6DA 3RXDA 1TB6H 3ATLA 5F8ZA 3EDXB 3JZ2B 4IN2A 3GYMA 3O8CA 2Z3EA 2C90B 4IC5A 2GCHG 3MH6A 4MG3A 1O2UA 2CHAB 2PKSC 2QYIA 1BDAA 2VIQA 3SO3A 3A87A 3ATWA 1RXPA 3T29A 3PRDA 1A4WH 2VH6A
chains in the Genus database with same CATH topology
1LO6A 2BLVA 2FTMA 4AFSA 1EPTC 3DFLA 1NM6A 5GWZA 2QF0A 3M3TA 4B2BA 4NSVA 1CBWB 3LKWA 1A46H 3LGWA 2TBSA 3WY8A 1ZPCA 1Y5BT 4YO9A 7GCHF 3BEIB 2FS8A 1O35A 1O5EH 4XDEA 3LIWA 4NZLA 1KIGH 5GPIB 4DIHH 1B7XB 4CHAC 4E05H 2FIRH 1KXEA 2HLCA 3U98H 3AAUA 1TQ7B 5EW2H 3QX5H 1MKXH 5C3NA 1ZGIA 4THNH 2J9NA 4I32A 5DP8A 4WMEA 1XKBC 2QAAA 4Y11E 2QXJA 3EGKH 1G3CA 4XBCA 1HAVB 2P8OB 1V2ST 1Y8TA 4K1SA 1O39A 1TMUH 1AMHA 4ABBA 3T25A 2ZDMA 1C2IA 2OLGA 4XBDA 2GMTB 5A2MH 1CO7E 2ANWA 3S0NA 4Q80A 1V2JT 2ZWLH 4XFQA 2W3KA 2STAE 3PMBB 1ETTH 4XOJA 1XM1A 1MUEB 1QJ1B 1THSH 2F9UA 4IBLH 4OS4A 2ZGCA 3U8TH 1SLVB 2ZO3H 3ODDA 2EEKA 3SV7A 3P70B 1CQQA 1V2PT 3A82A 3RXCA 1GJ8B 1HAXB 5ETXA 4K60A 1GJDB 5C2ZA 2C8YB 2Y80A 1ZGVA 5E0GA 1QRWA 4R8TB 1AB9B 2UWOA 2CGAA 2A1DB 2A5KA 3L3TA 5A8YA 1QBOA 5TCAA 3SQEE 1QGFA 1GI9B 2J95A 3SU4A 4NIWA 1A1RA 4I8GA 1SGPE 4ESTE 3HK3B 1O5AB 3CENA 5L2YH 4KTSA 1TRNA 1W11U 3GCHB 3VB7A 3LGTA 3E0NB 1O3FA 2A5AA 4ABFA 4CRDA 5C1XA 4NWKA 1ARCA 1TNHA 2FI5E 5JBBS 3ZV8A 1MTNC 1SSXA 1PPZA 1CT0E 1ZMLA 2RA3A 2XC0A 4I8JA 2WPHS 1HAZB 4OS5A 1GDQA 1TPSA 1SMFE 4GPGA 1C1WH 1FQ3A 3SBKA 1BHXB 4E7RG 1O2HA 1XVOA 2D8WA 2ZHEH 4ISOA 4O3UA 5GCHF 3ZZBA 3PROA 2ZPRA 1C2LA 4X6NA 1YPLH 4X8UH 1P0SH 4WWYA 4ZMAH 1P2MA 3TNSA 1O2TA 1D9IA 1TX8A 1OWHA 3OY6U 4DCDA 3LGYA 2TGDA 3Q00A 2Q1JA 4OS1A 1ELCA 1JOUB 2CJIA 3BG4B 1WQSA 2P59A 3PLKA 1OS8A 1DVAH 1J14A 3TLOA 1NZQH 2A2QH 3DUXH 1C5SA 1EB2A 1AVWA 4MNVA 3F9EA 3ZZAA 1NRNH 2XWAA 2A32A 1GMCF 3QGJA 2FYRA 1JRSA 2QN5T 4MNWA 1GMHG 1FIWA 1ORFA 1H4WA 3B8JA 1HAGE 2DE9A 1VJAU 1AHTH 4IW4E 5E2PA 2ODQA 1SGCA 1OWIA 1T4UH 4VGCC 2V0BA 2QCYA 4NA7A 7LPRA 3GDSA 1THPB 4TPIZ 1HAHH 2SGFE 3QUMP 2G4UA 1Z8RA 1S0RA 4OGYA 1LHEH 1TFXA 1SLUB 1O3OA 1XXDA 2BQWB 3IWMA 2WPIS 1TRMA 1BCUH 1P9SA 3SU3A 1YPKH 4FU7A 1QFKH 1YLCA 3MNBA 4CBOA 1EAWA 1INCA 2GCHF 1O3LA 3TPIZ 3UNSA 1A5HA 1E37B 1XXFA 1SLXB 3M37A 5JBAS 4YT7H 1WCZA 1TGCA 5L2ZH 1ZSKA 3IG6B 4KP0A 1WU1A 1DWDH 1LKBA 2BX4A 2FEQH 4DW2U 1C1NA 4RN6A 2O8MA 1AY6H 1RGQA 2Z9JA 2VWNA 2ZA5A 1C2FA 5FPSA 1IQLA 2AH4X 4FUFA 1OKXA 2QV1A 1C5OH 5HXFA 1EPTA 1BA8B 1SI5H 4U30A 3UR9A 2Y7ZA 1ZTJA 3SV2H 3DD2H 3PTNA 5L30H 1Q2WA 1TOCB 1ZZZA 3TK6A 2WUBA 3MMGA 1BJVA 1C2EA 1EP5A 3SHCH 1GBMA 1O3KA 1HGTH 1NROH 4X1PU 2P3TB 2H9EH 3ATMA 2XRCA 2H1UA 4HI3A 1JXPA 1SGDE 2A4GA 2OTVA 3A88A 5GJ4B 1YCPK 1DICA 3DFJA 3KNXA 3ESTA 6CHAC 1TGBA 4NA9H 3RXQA 2EI6A 3RXTA 5DGJA 4XE4A 4H42U 4X1QU 2NU3E 1C2MA 4B1TA 1EUFA 4Y7AA 1BTHH 1SOZA 1E34B 1BTYA 3S7HB 2BD9A 2GT7A 1BTXA 1ESTA 1HAOH 3K2UA 4GUXA 1O2JA 1W0ZU 1F5LA 4O97A 4ZHLU 3SI4H 1D6RA 5DP5A 1BRUP 1P57B 1LVOA 2A45B 2BLOA 1Z8IB 4AOQA 3SJKA 3I78A 3PWCA 2SNVA 2PKAA 5AVDA 5T6GA 1TPAE 1RTLA 2VH0A 1A0LA 3SU6A 2VJ1A 2HPPH 3QO6A 5PTPA 1IAUA 3KN2A 1O38A 1O32A 3GY3A 4NG9H 1DPOA 1QL9A 3MU5A 3TK9A 2AGIX 5DPAA 1C1MA 1ESAA 2XXLA 1DS2E 2AMPA 2R9PA 2YOLA 1O3GA 1FDPA 1MD7A 5I25A 2XC4A 1C1VH 2BD5A 3A83A 3SUGA 1KTTB 4ABAA 2GV7A 1NTPA 1UTOA 3URDA 3ELAH 2DE8A 1B0EA 3RXKA 1H8DH 1CA0B 1MKWK 2BM2A 1DWBH 2VWMA 4CRCA 1D3TB 1AI8H 1Z6EA 3LH1A 5TJXA 4AFQA 2BY6X 1FY4A 1GBAA 5EPNA 5G4BA 1Z6JH 4ZAEA 4JZ1A 3BF6H 1SG8B 1GBTA 1ZHPA 1C4U2 4CHAB 3MFJA 2XCFA 3ZVBA 4DG4A 3PMAB 2ZCKP 3GY6A 1KDQA 2G55A 2G4TA 4X2WA 1TYNA 2BHGA 2ZTYA 2WUCA 1HB0B 1UK2A 5BPEA 2Z7FE 2UUFB 1XUFA 5EGMA 5AF9H 2ALVA 1QCPA 1TX6A 2PKAB 1OPHB 4UFGH 4YT6H 7KMEH 1HNEE 3MTYA 1M9UA 4JYUH 4AB8A 2O8UA 1D3PB 1LPKB 3GICB 1Y5AT 4E06H 2ZFTA 1LVYA 4BAHB 1GL0E 2OQUA 4X2YA 1OWDA 1HAIH 3RXLA 1V2KT 2ZU5A 1UTJA 1C2JA 1HIAB 5C5NA 1Z71A 3OTJE 1Q31A 3EA9A 2WPKS 2KAIA 1GMHF 2ODPA 3H7TA 2ZGBH 3STJA 1SFQB 1BTPA 1F5RA 2Y5GA 2A4OA 3CS7A 1SGFA 1LHDH 3PYHA 3E8LA 5FCRA 3KCGH 3V13A 1WUNH 2ZP0H 1P03A 2O8LA 2SGDE 2ZTZA 1IOEA 3NUMA 4Y8XA 3GCNA 4NSYA 1H9HE 1UO6A 2BMGB 3EYDA 1S6HA 1DFPA 4JK6A 4FUDA 2STBE 1WSSH 1FPCH 5EU8A 2Y5FA 2GVFA 1N8OC 5E0HA 3SNBA 2AGEX 5J4QA 1KDQB 1KXDA 1MTSA 1MTNB 3FP6E 4UFFH 1DWEH 4TWWA 1P2JA 1K2I1 1LHCH 2VIVA 2FDAA 1IQIA 2XBWA 9LPRA 5JB8S 1T8OA 1ZTKA 3UIRA 2JETC 4JYVH 1FNIA 3A8AA 3ZVFA 1O2LA 3CP7A 8GCHG 1O33A 2ZI2H 5FXLA 5FBIA 3RC4A 1Y59T 1LHGH 3ZZ3A 3RMOH 4CH2B 2NU1E 5AFZH 1ABJH 1H8IH 3NZIA 4GCHG 2Q6FA 1ZJKA 1RS0A 4DOQA 3U1IB 2VNTA 2FM2A 2GT8A 4Y79A 1IQJA 2V6NA 2G81E 2XBYA 2QC2A 2V3HH 3LGVA 1C5QA 1EB1H 5CMXH 2YNBA 1MD8A 1BJUA 5DP7A 3U9AH 1GI0A 5FCKA 8LPRA 2TGPZ 1GHBG 2AFQB 5EPYA 4IS5A 4AZ2B 2QXHA 2TGTA 1NN6A 2UWLA 1GGDC 3SU0A 1NFWA 1F0UA 1CHOF 2F91A 4IMZA 4WJG2 1KTSB 1G37A 4NCYA 4VGCB 1AKSA 1DUEA 1OWEA 3FZDA 1YPGH 1CA8B 4Y71A 4CRGA 2B8OH 1OP2A 3E6PH 1QIXB 1XKAC 1MZAA 3T2NA 3SNAA 1YYY1 2FZZA 1ZTLA 4FU8A 1CGHA 3LGUA 1A61H 1EZXC 2BY8X 1AU8A 3PMJA 2Z9KA 2J92A 3B23B 1IQFA 2GCTC 2K1QA 4TYDA 3RXHA 1NO9H 3KGPA 3HGPA 1YCPH 1YLDA 5T6DA 1C5WB 2A7HA 3F1SB 1L4DA 4JCNA 4YTAA 3SUEA 1MZDA 1W8BH 3C1KA 4U01A 3TGJE 1FI8A 4WF8A 1AE5A 3RU4T 1QL8A 4CRBA 3LU9B 1BOQA 4Z0KA 3BN9A 2FI3E 1IHTH 3LC3A 2GV6A 2ZGJA 1ELVA 4M7GA 4ABJA 3RU4D 1DWCH 2F3CE 2Z3DA 1KLTA 2ZU4A 3SQHE 5C67A 1JIMA 3TJVA 3ZZCA 3A80A 3M5NA 1SGTA 6CHAB 4MPUA 1C1UH 2ZHQH 1ZMJA 4YOIA 3BIVH 3MU8A 1QURH 1ESBA 2GDEH 4DJZB 1XUJA 1WYKA 3A86A 2H5DA 3MNXA 1XUIA 3ITIA 3OYPA 1AKSB 3TIUA 5LGOA 3ATIA 1XX9A 5C5OA 1QL7A 5EODA 1O2IA 2IOTA 2HOBA 4JMYA 1ZPZA 1A2CH 3AASA 1GBBA 3BSQA 2A7CA 4JZEH 4KKDA 1MKWH 4WXIA 2P3UB 2BLWA 4WVPE 3PV4A 1C5RA 2OBQA 1Z8GA 3SU5A 1V6DA 4B75A 2F83A 3A8BA 3BTKE 2VU8E 3PM3A 1UTQA 5FX6A 5A8XA 2VIWA 2FPZA 4A1VA 1HRTH 2QXIA 1YKTA 3VXFH 1GI6A 4K1EA 2A5IA 1GMDF 3M35A 2YNAA 3L33A 2G51A 1O2SA 3KEEA 3A89A 1AWHB 2ESTE 1V2VT 4I8LA 1C1PA 1AGJA 1S0QA 4MNYA 3IITA 5HGGA 4AG1A 2C93B 2ZPSA 1TX7A 5A0CA 1ZOMA 3DT0H 3RM0H 1KY9A 1O2MA 2ZGHA 1FXYA 3SGAE 1AO5A 2UUJB 4D7GA 1MU8B 2AIPA 2ANMH 3V12A 2BYAX 2OQ5A 2B9LA 2G5NA 1BMAA 2H2ZA 1MQ5A 2F9VA 1TBQH 4LOYH 1HYLA 1N6YA 2ZDLA 4X1NU 1C2GA 2OC1A 6GCHG 4H6TA 1LCYA 3MWIU 2PR3A 2VVUA 3JZ1B 4NIVA 2FX6A 1P12E 3UREA 1SPJA 2ANYA 4B73A 1GJ6A 2FMJA 2PV9B 3Q77A 1W12U 3EA8A 3FANA 2F9PA 4MLFB 3K6ZA 3VFEA 1EX3A 3BEUA 4BTIB 3F9GA 4UFEH 5ESTE 3P8OA 3C27B 5EQQA 2ZGXH 2OC8A 4TY6A 1IQNA 1YPJH 3GCTF 1S81A 3ATKA 3Q3YA 3UWIA 4A6LA 4DVAU 5TCCA 1P2NA 1XUHA 1HCGA 4LZ1H 3A7VA 2HNTF 3UUZA 1S85A 3SGBE 1CHGA 1EASA 4ZUHA 2AS9A 2FOFA 1DDJA 2O9QA 3UOUA 5A8ZA 1FY5A 5J4SA 1EZSC 1UTLM 3PMHB 3RLWH 5BRRE 2AMDA 3SJOA 1HJ8A 4JZIA 4CR5A 1HUTH 1ACBE 1G2MA 1HV7A 4ZKOU 4IN1A 3HKIB 1V2OT 2ZTXA 4MNXA 2V3OH 3SJ8A 4IGDA 5ABWA 1GI3A 1Y3UA 2ZPQA 2VB0A 1A0HB 1FMGA 3GY8A 1RIWB 1N8OB 3OY5U 5K0HA 1W7XH 2BXTH 1BMMH 1ELGA 1QJ6B 2ODYB 3RXVA 1VJ9U 1A0JA 5IYTA 2R3UA 3LDXH 3NKKA 2HWLB 2OC0A 5GIBA 1EP6A 5SGAE 3UOPA 4Y6DA 1O37A 1FN6A 2Z3CA 2JETB 1SQAA 4I31A 4Q7YA 3K65B 1C2KA 2BLQA 3BEFB 3MNCA 1Y3WA 2QA9E 3DA9B 2VIPA 1RD3B 1T8MA 1HJAC 1OXGA 1VITH 1VGCC 4LK4A 2R2MB 4AG2A 1ZYOA 1GJCB 4X8SH 5DP3A 2SGQE 3LT3A 1GHAG 2FO9A 1RFNA 4IC6A 3TJUA 2FOCA 3NK8A 2GZ8A 3RP2A 2ZG0H 3ZZ5A 4AFUA 1JRTA 2J94A 4NIYA 3SW2B 2F9NA 1GHZA 5FAHA 3F6UH 8KME2 4RSPA 1K1NA 1P02A 1V3XA 3TJOA 2CN0H 3S7KB 1C5YB 1GGDB 2OINA 1NRSH 1E38B 1L2EA 2JH5D 3M7UA 1DXWA 3OX7U 1UJ1A 2RG3A 1VITG 2TRMA 3NPSA 1LTOA 1PFXC 4X1SU 3MU1A 1O5FH 2G5VA 2Z94A 4GVUA 3K6YA 1E0FD 1YM0A 2BDIA 5F6MA 2GGVB 3NWUA 2OBOA 2PUXB 4YZUA 2SGPE 4NFEA 1ABIH 2VVCA 1Y5UT 1A5GH 1C1QA 1CVWH 2GCTB 1GVLA 5DP6A 2AERH 3A7XA 1BMLA 3GCOA 1OX1A 4YOJA 1GBFA 4D76A 1DUAA 3A7YA 1SB1H 4O3TA 1FY3A 3UQOA 3BTME 4IMQA 1ZHMA 1FPHH 3O8DA 3VB4A 3GOVB 2EC9H 1GVZA 1T8NA 1O2VA 4Q7ZA 1EJMA 4Y7BA 1SGFG 1BITA 2RCEA 1BIOA 1C5VA 1X7AC 1ANBA 1W7GH 2QIQA 2XW9A 2ZU3A 1NRPH 2PTCE 4D9QA 1BRBE 3MU0A 3VPKA 2BX3A 2VGCB 3MU4A 1GG6B 1P3EA 1O3AA 5ESBA 1NFXA 5DG6A 2QXGA 6GCHF 1GI4A 2FOGA 1AFQC 2P16A 1ZMNA 3U1JB 3ZVCA 3E1XB 4GHQA 1S83A 4BOHA 3RMLH 3MYWA 3UY9A 3P8GA 2P94A 1BBRE 1OWKA 2BB4A 1C5PA 3BIUH 1UTPA 1D3QB 3LOXA 2BXUH 1C1SA 4Q7XA 1O2KA 2ZDKA 4ASHA 2Z6BD 2BD7A 1K1PA 1SFIA 5GXPA 1J9CH 2CHAC 1LVMA 2NU4E 2PKSB 1O2NA 2GKVE 4I8KA 1O5DH 4NFFA 3GY5A 5AFYH 5EXNA 3PLBA 4ZHMU 2ZCLP 2GP9B 1FLEE 2BY7X 1EPTB 3GY2A 1CGJE 1CBWC 4DY7B 1GHYH 4TPYA 1GBCA 5FPYA 5HMAA 2ZFRH 2Y5HA 3A8DA 3TU7H 1T8LA 1J8AA 1BRCE 2FS9A