1LKAA

Porcine pancreatic elastase/ca-complex
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Elastase 1
publication title Metal binding to porcine pancreatic elastase: calcium or not calcium.
pubmed doi rcsb
total genus 61
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2002-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1lkaA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1lkaA01
1C5UA 2Z9LA 3BTWE 1C2DA 1F0RA 3RXUA 3VB4A 5A0CA 3GY6A 1GG6B 1F7ZA 1WUNH 2FO9A 2XRCA 1AB9C 1MTWA 1INCA 1AY6H 1D6WA 5DK1A 3HGNA 1GBDA 2H5CA 1HB0B 2EI7A 3GY2A 1ELTA 1LHGH 2Z94A 1NS3A 4YOGA 5GIBA 4WY3A 1UTOA 3PMBB 2UUKB 3P8GA 1NC6A 1NFWA 1C1SA 5AF9H 2GCTB 2BQ7B 1O2QA 5BPEA 1O2NA 2GV7A 1ZGIA 4XBCA 5E0HA 2ZGCA 2SGAA 1ZRKA 1HAGE 1YGCH 1OYQA 4ZXXH 3VB7A 1NZQH 1QQ4A 1GBLA 2NU4E 1AUJA 1L1GA 2D26C 1DICA 1LVMA 1BCUH 1YM0A 1GJ7B 1ETRH 1OWEA 1BBRE 1YLDA 1XVMA 1SPJA 1GBAA 1MZDA 1VCPA 4J2YB 4GUXA 1W0YH 1DLKB 4YLUA 5L2ZH 3PMAB 2ZDNA 5JBBS 4X8SH 1TE0A 1O2LA 2ODQA 5A8YA 3UPEA 1TNIA 1UK3A 2HWLB 1GJ9B 2A0QB 2OC0A 2GTBA 1LVYA 2Y81A 1ZHMA 1G3CA 2WUBA 2VWLA 1HIAB 2BXUH 2A7CA 5JYIA 1GBJA 2FLRH 1HUTH 3KIDU 2NU0E 2UUJB 5EQSA 1W12U 2OD3B 2FTMA 2YOLA 1YPHC 2QXIA 1IOEA 3QO6A 2ZGBH 1FJSA 4NSYA 3LGYA 2A4OA 1HJAB 1G3BA 1LDTT 4NIYA 4ABIA 2QIQA 2A5AA 3ZZ4A 4GVUA 1FI8A 2DE9A 2OLGA 5DPAA 2CF8H 1TLDA 1VCQA 1TB6H 2P93A 4ZAEA 1RS0A 2WV5A 1KXCA 3SV2H 3SJOA 1LHEH 2VNTA 3HGPA 5EOKA 1MTNC 1CT0E 4AZ2B 4FUHA 1BRUP 1GJBB 3NPSA 1OP0A 1DSUA 1QJ6B 1P2JA 1D6RA 1QURH 3ESTA 4A6LA 4A92A 2ALPA 3AASA 4YLQH 1AWHB 3A7YA 4UFFH 2F91A 1C5ZB 2Q6GA 3RMNH 5T6FA 4NZLA 4BTUB 1T8MA 1YPKH 4BXSA 3KGPA 2BY7X 2J94A 3U98H 3OX7U 4NIWA 3LGIA 2C90B 1Y3UA 4UFEH 4CRFA 4E7NA 3FP7E 1V2MT 2FS9A 2G00A 4ISNA 3MH5A 1WBGB 3M3SA 3DFJA 4YT6H 1UVUH 3VPKA 4CHAC 3JZ1B 3SV6A 2A2QH 1PQ5A 1GMDF 1SC8U 3BSQA 1C2GA 5E2OA 1C2KA 2ZDKA 1OWHA 3DD2H 2ANWA 2SNWA 3IWMA 2Q6FA 4RN6A 1LPZB 3SV7A 1K2I1 4NFEA 1XUJA 2VINA 2TPIZ 1O2WA 1BTWA 1ELBA 4AFUA 5HGGA 2XW9A 1YCPK 4X2XA 3LDXH 2AERH 2TGDA 4CBNA 4U2WA 1OSSA 2M5TA 2P3TB 3SU1A 1ZLRA 1O5DH 1P10A 4A1XA 1GGDB 1C5MD 1SLVB 1GBKA 3LPRA 2F9BH 2KAIB 2ZU1A 1TA6A 2ODPA 3TGKE 1CHOF 1SGYE 2PGBB 3BV9B 5E2PA 2OBOA 4X8TH 3ATKA 4Y76A 1V2RT 1FV9A 3UNRA 1BB0B 1SQAA 2CJIA 3M61U 2H9TH 4DOQA 5ESBA 4FU7A 3HKIB 4OS5A 2F9OA 5FX6A 2CN0H 2WYGA 1MMJN 2FMJA 6GCHG 5JBCS 4IS5A 1B0EA 2XBXA 5LPRA 2R2MB 2ANKH 2HNTF 4XBDA 1ZGVA 3ZVBA 4WMFA 3TVJB 3KQCA 1H9HE 3FZZA 3ZV8A 1FPCH 1K28D 2Q6DA 2QAAA 2P94A 1RD3B 1TMUH 1DS2E 1O2SA 1XX9A 2VIVA 2RA0A 3OSYA 1DLEA 4Y71A 3TJVA 2PHBA 2XC0A 2C8WB 2BD4A 1JBUH 2VWMA 1Y5BT 3I78A 3SHAH 2ZWLH 1K1MA 1D3PB 2FXRA 2HPPH 1L4ZA 1RXPA 1EAIA 4CRDA 1GL0E 3MOCA 1KIGH 2FESH 2HNTC 4A1TA 1L2EA 2CMYA 2PKAB 4ZXYH 3ZVFA 1DPOA 4YO9A 5LPFA 1TPPA 4I8GA 1H9IE 2QY0B 3P8FA 3SNBA 3GY8A 1BBRK 4J1YA 3S7KB 1HAZB 1Y5UT 2ZGXH 4YM9A 1SLUB 1QNJA 5GDSH 5IYTA 1NESE 4NA9H 4TY7A 4NIXA 3RXEA 5F8ZA 2VWOA 1WAYB 1D4PB 2A31A 2CGAA 4JYTA 3WY8A 3SUEA 4VGCB 5C20A 1DWDH 3KL6A 3O8CA 1X7AC 1SGPE 1ZSJA 1O2HA 1GPZA 1O30A 1O3KA 1C2LA 3SUGA 4GLYA 4K1EA 1XUKA 3DT0H 2QYIA 1EZQA 1YPGH 2A7HA 1CGHA 3ZYDA 4K2YA 5I46H 4F49A 1AE8H 3RP2A 3MI4A 5SGAE 1AI8H 4IC6A 2JH0D 3RC4A 4B76A 1EPTB 2C4FH 3I29A 3BG8A 1QR3E 1NY22 3QZRA 1QBVH 2YNAA 2G4UA 5FCRA 3NUMA 1YPHE 4X2WA 4ZKSU 1O0DH 2FODA 1OOKB 2WPIS 2H9EH 1BITA 3K2UA 3SOSA 3UOPA 1PQ8A 2ULLA 3I77A 1A1RA 1NO9H 2SGPE 2BQ6B 1F92A 4NA8A 4ZH8A 5L2YH 1LMWB 2OINA 1AE5A 1GI6A 3A8DA 1T4VH 1GJAB 1V2JT 2AIQA 2Q1JA 4WMEA 4ABEA 1TBQH 4ZHLU 1O5EH 3SU0A 2WINI 2FI5E 3TJUA 5C1YA 1QL9A 4AB8A 5T6GA 3MNBA 4LZ1H 1XUHA 3P8OA 3SO3A 1ESBA 4CH2B 2BVSH 1FIZA 2H6MA 2O8LA 1LKBA 3NXPA 1B7XB 4AGKA 2ILNA 3GCHC 3UQVA 1O36A 1OWKA 1O2TA 4INKA 3PMJA 2NU3E 4O03A 4YZUA 2HPQH 1DY8A 1HV7A 3GOVB 3EQ0H 3RU4E 3ZZCA 2EI8A 4Y8XA 2FTLE 4CH8B 3ZZ5A 1TNLA 2P8OC 3Q00A 5DO4H 1AZZA 3PYHA 1TRNA 3F9FA 1IQHA 2D1JA 1QGFA 6ESTA 4THNH 1ELFA 1SGTA 2ZGHA 2TRMA 2ZGJA 1O33A 1E0FD 2BB4A 1HXFH 1ETSH 1TALA 1UHBB 1A4WH 3BEUA 2O8UA 2BQWB 3QTVH 2QV1A 1J8AA 3RMOH 1VJAU 1OWJA 2HOBA 2CHAB 4UD9H 3K6YA 3NCLA 1SGRE 3BTKE 1GJ6A 3UREA 1Z1JA 3GDVA 1BTPA 4KTCA 1O37A 4WH6A 3MNCA 3PLBA 2EA3A 3RMLH 3SHCH 3FP8E 3AW1A 1UCYH 1FY5A 2AEIH 1AD8H 1VITG 3BEFB 4OGXA 1V2WT 3URDA 4K69A 1PPEE 1RIWB 5EXNA 3BIUH 4FUJA 1EOLA 2Z9GA 1C5NH 3F9EA 2C8ZB 4MTBA 1IQFA 1GBBA 2WV4A 1B0FA 1HAIH 4INHA 1IHSH 4XE4A 1H8IH 4K5ZA 4LK4A 1S6HA 2GDDA 4XDEA 2QN5T 5E0JA 1DM4B 1J16A 3BTDE 2GMTB 2BD3A 3QZQA 2C8XB 3SJIA 1ABJH 2R9PA 3PO1C 2BM2A 5DP9A 4D7FA 2UUYA 3S0NA 1C1MA 2GCHF 1C5TA 2ZP0H 4OGYA 3LH3A 1OPHB 4MPVA 2FWWA 4ABJA 2HVXA 2ZPRA 4JCNA 1O3EA 2BDAA 1IQJA 3UQOA 3GDUA 1BHXF 9ESTA 3SJKA 3BG4C 3KCGH 1ARCA 3A80A 3GYMA 4MPXA 3SBKA 5TCCA 1IQEA 5F03A 4BANB 2FS8A 1NRRH 1EATA 2Y82A 1TQ7B 2PUQH 3RU4T 1SGEE 2FZZA 1O3JA 2H5DA 1A5GH 1AHTH 1J17T 1O35A 2GKVE 3TGJE 5CHAB 2GZ9A 5J4QA 1P03A 3BTTE 4FVBA 4ISOA 2SGDE 1SHHB 1MUEB 5EQRA 1O2MA 1TPSA 2UWLA 1HBTH 1EX3A 4X6OA 4TPIZ 1P9UA 2FYQA 1A0JA 4CREA 4CRBA 1PPFE 3PMHB 2R3UA 3M3VA 1EOJA 1S5SA 1ZYOA 3BTGE 2BD8A 4K3JA 5FPYA 1GWAA 2XC4A 5EODA 1FY4A 3RXBA 3L6PA 2VGCC 2P16A 5GXPA 1SOZA 3RM0H 4FUCA 4ZROA 3K6ZA 2EI6A 3LU9B 3TH2H 3BTEE 1HAPH 1L4DA 3RXOA 3M37A 1C4U2 4IN2A 1ZMLA 2BY5X 4JMYA 1YP9A 5EPNA 3RXRA 1W2KH 2ZKSA 1FAKH 1T8LA 2Y6TA 2FOHA 3UR6A 1KYNA 2WPHS 1Z8RA 2BDBA 2KAIA 5L30H 1A0HB 4AFSA 5EU8A 3T29A 3GCTG 3M7TA 1AFEH 2K1QA 2AYWA 1C5YB 1LQEA 2BLOA 2QC2A 3SN8A 1YCPM 1Z71A 3UY9A 2ZDVH 4I31A 1C2FA 3M5MA 4I8JA 1C5SA 5HXFA 2JETB 3V0XA 2BTCE 1LHFH 1P3EA 5FBEA 1ZPBA 3O8DA 1ABIH 1FY1A 3SQHE 1GMHG 2ZIQH 4LXBH 3BN9A 4X1SU 2G5NA 1NFUA 4DJZB 3KHVA 1AGJA 1NTPA 2ZHDA 1V2VT 3PWBA 5GPIB 1KLJH 2V6NA 2HRVA 2VIWA 4IN1A 3SGBE 2AGGX 2ZEBA 1CGJE 1W7GH 1ZSLA 4ZMAH 3RLWH 3MH6A 1EJAA 4K8YA 3LC5A 1K1LA 2VB0A 1GHWH 4WXVA 2OC8A 3SI3H 1KXBA 1CT4E 2SGEE 4Y8ZA 2BY9X 1ZTLA 1KXDA 1TGSZ 2AS9A 2Z9KA 4Y79A 4F4OC 2ZFFH 3C1KA 2RG3A 1IQGA 1FIWA 3D65E 4B2BA 4Q7ZA 2PKAA 2OC7A 1H1BA 2QXJA 1DWCH 2ZQ2A 4ISHH 1S82A 2B0FA 4K8BA 1SVPA 3MU4A 1QJ7B 2H2ZA 3A7WA 1P05A 3CS0A 5E0GA 3RXPA 3ZZAA 5DP7A 5A09A 1F2SE 4NWKA 1Y3YA 1KLTA 3SORA 5E8EH 2ZFPH 4CR9A 1T31A 5TJXA 3A83A 2PKSC 3DA9B 1PQAA 1ZMJA 1ANCA 2BD7A 5T6DA 1MD8A 3EGKH 3T27A 1G2MA 2GZ7A 2J34A 3L3TA 5PTPA 3NK8A 1UVPA 1MZAA 5CE1A 1GMCG 3ITIA 2Z3EA 3MFJA 3URCA 1VCWA 1BDAA 4GCHG 2QA9E 2ZHFH 1D9IA 1C2EA 1LQDB 5IDKA 1SSXA 4RSPA 1GI8B 2PWXA 1UO6A 3CENA 1KDQB 1OKXA 1DT2A 5FHTA 1C5QA 4OS6A 4Q7YA 3UR9A 3SUFA 3AAUA 3ZVEA 1EJNA 4TPYA 3V12A 5FXLA 1GCTC 2Y7XA 1KLIH 4WJG2 4K1SA 3LGVA 1O3DA 1P12E 2BY8X 3F9GA 4BAQB 4FXGH 3ZZBA 5GJ4B 4X6MA 1BRAA 3A81A 1G37A 4NWLA 1EZXC 5C67A 2PFEA 1YPJH 1NFXA 2OUAA 4GAWA 2ZI2H 2XWAA 4LOYH 4X1RU 6CHAC 4FUBA 2OP9A 1C1QA 1GBFA 2BDIA 1ZPCA 2G8TA 3U1JB 1QCPA 4GSOA 4HI3A 5T3HA 1XUGA 4Y7BA 1BJVA 4E7RG 1O2KA 2ZHQH 1E35B 2BD9A 4WMDA 1UTQA 1QHRB 4Y8YA 3VGCC 1GJDB 3Q3YA 2NU2E 2AMPA 3OTJE 1JIRA 2GD4B 2FLBH 4TYDA 1T8OA 3ATWA 1N8OB 2STBE 4MNVA 4RKJB 1OWDA 5K0HA 3SJ9A 4AYVB 2TGAA 3FAOA 1UHBA 4X6NA 1Q31A 1SGFG 1AB9B 2G81E 1AFQC 4HTCH 4KGAA 3OYPA 5JBTA 4YT7H 1OWIA 1QL7A 2GX4A 2GT8A 1OP8A 2PGQB 1BRBE 1HJ9A 3PLKA 1SLXB 2VIDA 2G4TA 1T32A 1UTNA 3LONA 2ZECA 1NU9A 1G3EA 4Z6AH 2STAE 2C93B 1P2QA 1K1PA 3NKKA 3SU4A 4CBOA 3SV8A 3VB3A 2SGQE 1N6XA 3RXFA 4MPWA 1E34B 1HAXB 1BRCE 1SL3A 3BTHE 3ZZ3A 1LPGB 3A86A 1TGBA 3F6UH 2TIOA 4FU8A 4IGDA 4K60A 1P2MA 2ANMH 1GHAF 1ORFA 2Z6BD 1GMHF 2ZFRH 4B71A 1VGCC 3RXJA 7GCHG 1CHGA 1BJUA 3GY3A 1XUFA 1WOFA 3QDZB 3L33A 3VB5A 3PTNA 2FX4A 1O3HA 2OCVB 4AG1A 1IQIA 3RDZA 2C8YB 1P11E 3HK3B 1RTKA 2UUFB 1MH0A 1LHDH 1ANBA 1KSNA 3BF6H 3LOXA 1C2JA 5A8XA 4CRAA 2QF0A 4I32A 4B73A 1XKAC 3LT3A 1F5RA 8KME2 5A2MH 3FFGA 1Z8GA 1WU1A 1G30B 1UTKA 2A7JA 2P95A 1QFKH 1A2CH 1NFYA 1BT7A 3GYLB 1UVTH 4ABGA 3STJA 3TU7H 1AUTC 1P0SH 1ZOMA 1C9TA 4BAHB 1P01A 7KMEH 4Y6DA 4ABDA 2Y80A 1MKWH 1ZSKA 1C5LH 2IPHA 1SLWB 3P8NA 1S6FA 4ZHMU 1A0LA 4I7YH 4H6SB 1MU6B 3RLYH 1P2KA 1V2QT 2PR3A 1O3MA 4B2AA 5EXMA 1VZQH 1CGIE 2ZPSA 2SNVA 2OC1A 4B74A 1MTNB 4UE7H 4FU9A 1W10U 1SFIA 1HLTH 1K21H 3E91A 3N7OA 3V13A 2AFQB 3EA8A 2FEQH 1SGFA 1OS8A 2ZNKH 5HMAA 3EE0B 4I33A 1DX5M 5GCHG 1P2IA 4JYVH 3IG6B 5AHGH 2NU1E 3U69H 3VXFH 1KXFA 2CHAC 2OXSA 2HLCA 5JDUB 3A87A 3QGNB 1EP6A 1MD7A 1PPBH 1VR1H 1V2OT 1PYTD 1UK2A 1Z8IB 1A7SA 4MDSA 1ETTH 2J9NA 4BNRA 1N1LA 4ABAA 1CBWC 3U8RH 2W26A 3S69A 3SW2B 3A8AA 1GJ8B 3ZVCA 1P8VC 2PTCE 1SOTA 1TNJA 1SGCA 2QCYA 3ZZ7A 4CHAB 1O3PB 4UONA 2ZU5A 1CQQA 3E0NB 3RXIA 3UTUH 5AFZH 3FP6E 3PTBA 1XVOA 1DE7H 2OQ5A 4NSVA 1Z1IA 4YOIA 3TLOA 1V6DA 2BY6X 3QTOH 1O2IA 4NZQA 1P9SA 1O2RA 1FMGA 1JOUB 2ZHEH 2VH6A 1FY8E 2AMDA 1O2YA 1THSH 3QUMP 3RXTA 2P3UB 3T2NA 1EB1H 3MO6A 1HAVB 1L1NA 1FXYA 1AKSA 4XSKU 1UCYE 1L0ZA 1C5WB 2ZA5A 1GHZA 2R2WU 1H4WA 3T28A 3A7XA 1GHBG 2GP9B 4R0IA 4OS2A 4X2YA 2Z9IA 4MNYA 2VIQA 1TNGA 1HFDA 2B5TB 1UJ1A 2Y7ZA 4U01A 5C5OA 1O5FH 2QGRA 1O2OA 1TBRH 2BDGA 1GI1A 1YLCA 1BIOA 1LPKB 2Z7FE 4AORA 2GDEH 1QY6A 2JKHA 1S83A 4MQAA 2FX6A 1VITH 3GISB 2VVVA 3E1XB 3M36A 1FQ3A 4OS7A 2LNCA 1Y3VA 4NG9H 2FOAA 4JZFH 5F6MA 1EAUA 1A3BH 4MLFB 3QX5H 2EC9H 1C1UH 5L6NH 3MH7A 2ASUB 3PLPA 3PROA 4CR5A 2CV3A 3IITA 3BTQE 1RJXB 1MKXH 2ZU4A 2GT7A 4JYUH 4FUGA 5AFYH 1QA0A 1O39A 5AVDA 1GBEA 2JH5D 3VFEA 1ELGA 1NROH 3LGUA 1ZPZA 4ASHA 1HDTH 4JZ1A 5C5NA 2FP7B 1QB1A 1TONA 4TWWA 1BTYA 1C5PA 3ZVDA 1TQ0B 4B75A 4ESTE 2ZCLP 3CP7A 3UNSA 1GI3A 2WUCA 2YNBA 3RUOA 6GCHF 3SGAE 3PM3A 4AOQA 1NRQH 1SI5H 1J15A 3SNCA 1BTZA 1HIAA 2O8WA 3K9XB 4H42U 3P17H 1ID5H 1ANDA 1UTJA 2PSXA 1WCZA 2PV9B 1ZHRA 5F8XA 4TY6A 3Q76A 2SGFE 5F8TA 3G01A 2F9NA 1JIMA 2A2XH 1HCGA 1W8BH 2FI4E 1GI9B 5HM9A 4KELA 1IQMA 3ZVAA 1JRSA 5LGOA 3QLPH 1MCTA 1GHXH 1CA0C 1GJ4H 4ZKRU 3QWCH 2V35A 1H8DH 3T25A 4D9RA 4X8VH 1A5HA 1O3OA 4YTAA 3RMMH 1ESTA 2PTNA 4CRCA 4Y10E 4Y7AA 5JB9S 1EKBB 1EUFA 1KY9A 4Y0YE 1FZZA 3V7TA 4AG2A 2FM2A 1GG6C 2HGTH 1PQ7A 1GVZA 3DHKH 2A5KA 4JK6A 2I6QA 1V2UT 1RRKA 3V3MA 4NGAH 1O3GA 1GL1A 4JZIA 2UWPA 5EGMA 1G2LA 3KEEA 1QRWA 3BTFE 1PFXC 1CU1A 1MQ5A 4Y11E 2GCTC 3O8RA 3TJOA 1BMMH 1MBMA 2C3SA 2ZDAH 3GICB 2WPJS 3Q3KA 1NPMA 1S84A 3FVFB 4BAMB 3M35A 3MNSA 2ZG0H 3GCHB 4HFPB 5A0AE 1TA2A 1Z6EA 2W5EA 4FUEA 2P3FH 1RGQA 2OBQA 4WF8A 4Z0KA 3R0FA 1YBWA 2NWNA 3Q77A 4BOHA 3U9AH 4IMZA 3P95A 2P8OB 5C3NA 3M3TA 4D76A 1C1OA 3E90B 3ELAH 3FANA 3GDSA 2AIPA 5FX5A 4O9VA 3T26A 1Q3XA 2A45B 1SB1H 2FYRA 4ZKOU 3KQDA 1S0QA 4H4FA 1E37B 6LPRA 4GPGA 3B23B 1FN8A 3H7TA 1V2KT 2Y5FA 2TBSA 1MBQA 2J4IA 2GZ8A 2XWBI 2J95A 4ABFA 3A7TA 1O3IA 3JZ2B 4MPUA 3RXCA 5C1UA 4B1TA 1UMAH 3NZIA 3RXLA 2A4GA 1AU8A 1EAWA 1P57B 1EZUC 5TCAA 1AIXH 2XYAA 4Q7XA 1F5KU 1HJAC 1U6QA 2CF9H 4JZEH 4ISIH 1MAYA 1UCYK 3KN2A 2ODYB 1O2JA 1F0TA 1TRMA 1S0RA 1TNHA 1XXFA 4O3UA 3D62A 1ZTJA 5DP3A 4ABBA 1FDPA 3W94A 1FAXA 1MU8B 1UTPA 3E8LA 1TOMH 1GMDG 1QIXB 1GI7B 2PW8H 2BVXH 2XTTB 1ARBA 3ZZ9A 3RC6A 1BTUA 2XBVA 1ANEA 1HAYB 3TJNA 1P09A 4XFQA 1BUIA 4AFQA 2I6SA 1V2ST 1TX8A 3E3TA 4I8LA 3UFAA 3TK5A 1BOQA 1HRTH 2BD2A 1QRZA 1C1RA 2GVFA 4HGCA 3PO1B 4XBBA 3RXGA 5C1XA 8GCHG 5JBAS 1GDUA 1EXFA 1GI4A 1MTSA 5EXLA 1S81A 2AGEX 3A89A 4M7GA 4YESB 3HK6B 3E0PB 1VITF 1YPLH 4BXWA 2G51A 2QXGA 5DP6A 1EB2A 2XBYA 4HZHA 2BVRH 4YOJA 2OTVA 4TWYA 3UWJH 3SGQE 1LVOA 2Z3CA 3BG4B 1CSOE 1CHOG 4JK5A 1AO5A 3KQBA 2VVUA 1O5AB 3HATH 2BDHA 1W3CA 2G52A 2WPLS 1HYLA 1VJ9U 3SU5A 2F83A 1CT2E 5EPYA 8ESTE 1O3CA 3TH3H 1HAOH 1J14A 1EAXA 2A1DB 3LIWA 3RU4D 3S9BA 1NU7B 1O38A 3ODFA 2FI3E 2BMGB 2ZFSA 1CA8B 1O3LA 1YCPH 1PPGE 1GVKB 2D2DA 1SGQE 1S85A 2BZAA 1XMNB 1O5BB 1BHXB 3O8BA 2BXTH 3LJJA 1TFXA 3PWCA 1EQ9A 3KNXA 1C1TA 1EPTA 2G5VA 3A88A 1GGDC 2ZDLA 4DIHH 1TGCA 2VGCB 4INLA 4WWYA 3B9FH 4IC5A 2WPKS 3MWIU 4WXIA 1K1JA 1A46H 1A3EH 1AVGH 1W11U 1HAVA 1ELDE 1BA8B 3SNDA 1UTMA 3ATLA 1DVAH 1GI5A 1G9IE 1THRH 4BTTB 4O97A 5J4SA 3SNEA 2F3CE 3UNQA 3QN7A 1Z8JB 2P59A 1AQ7A 1QB6A 1GHVH 3T5FH 3U1IB 1XKBC 1Z7KA 1F5LA 3KQEA 4IMQA 1FONA 2RCEA 4MVNA 3MHWU 2BDYA 1DOJA 5DP8A 2D8WA 1C1NA 8LPRA 3B8JA 2F9UA 1ELEE 1YPMH 4DY7B 3DFLA 1SGDE 4UFGH 1A61H 5FPTA 4NFFA 4NA7A 1FNIA 2WPMS 4R8TB 2LPRA 3NWUA 1K1NA 4DURA 1TX7A 4Y0ZE 1RFNA 2Z3DA 1YYY1 2HALA 4ZUHA 5EW1H 2BOHB 1TYNA 1BBRH 1W14U 1FPHH 3EYDA 1W7XH 3TPIZ 4OS4A 1YKTA 7LPRA 2ZCHP 1OP2A 1P2OA 1TGTA 1SFQB 2ZTZA 3MU5A 3ATMA 1HJ8A 3OU0A 4X1NU 3SJ8A 2BD5A 3GCTF 4DVAU 4VGCC 3ENSB 2ZO3H 1GDQA 4OS1A 1FUJA 1C2MA 2AGIX 3C27B 1GJ5H 2ZZUH 1MTUA 1N6YA 4Q80A 3TK9A 1QJ1B 1LTOA 3TGIE 1ZHPA 3RXSA 1AMHA 1JXPA 3EA7A 1YF4A 4WVPE 1DXPA 1C5RA 1P04A 2ZTYA 4ISLA 3D49H 1EPTC 1K1OA 1BZXE 4PROA 4BTIB 1DUEA 2ZU2A 3TH4H 2FDAA 1EZSC 1JWTA 4KTSA 1DITH 5DP4A 2H9HA 2ZU3A 1SQOA 1GBCA 2PKSB 3H7OA 3UIRA 2FOGA 3K65B 3PB1E 3RXAA 5HYOA 2IOTA 1QBNA 3PV4A 1UTLM 3RXKA 5DG6A 3MNXA 3A84A 8GCHF 1O2ZA 1G36A 3MMGA 1C2HA 4IBLH 3A8CA 1YPEH 4D8NA 1L1JA 3GCOA 1SQTA 3TIUA 3A8BA 1TAWA 3LC3A 3AVZA 1FN6A 1Q2WA 1UVSH 2IJOB 3ODDA 2B9LA 2RA3A 3M7QA 1NRPH 3S9AA 3MU8A 1Z6JH 4SGBE 3STIA 4BAOB 2H1UA 2PSYA 1ZRBA 3A7ZA 4MNWA 1OX1A 3LJOA 4DG4A 2ZF0H 1GCTB 4ABHA 1ELVA 1BQYA 3F68H 1Y3WA 1Y8TA 3SZNA 4LZ4B 3SQEE 1GBHA 1PJPA 3MO9A 1PPHE 1LCYA 1V2PT 2BZ6H 4QT8C 3HPTB 1O3AA 5JB8S 1TABE 1LKAA 1F0SA 4A7IB 4BAKB 2OQUA 1JRTA 1P2NA 2PUXB 4X0WU 2BYAX 2IN2A 3ZZDA 1GMCF 3RXHA 5FAHA 6CHAB 4KP0A 1GBMA 2J92A 5ETXA 4GCHF 1JMOH 3GCNA 1O5CB 1O5GH 1HAHH 1Y59T 1AN1E 3M5LA 4GHTA 1OXGA 3A85A 1DDJA 1WTHD 2VH0A 1DFPA 3UUZA 2GGVB 3VGCB 1BTHH 2BDCA 1E38B 3OY6U 3VB6A 1BMLA 1QTFA 3EA9A 4UEHH 1C1VH 4ZHAA 3CS7A 1J9CH 2R3YA 3LKWA 3P92A 4X6PA 5DGJA 4WH8A 4X8UH 3EDXB 3QK1A 1SGNE 2FPZA 2GCHG 3TITA 3F9HA 1CO7E 3RXDA 3HKJB 1PPCE 4FUDA 3UWIA 1RIWC 3BEIB 4U32A 1AFQB 1TPOA 5JPMH 1HPGA 1DWEH 2ALVA 4X1QU 9LPRA 2GV6A 3S9CA 1UVOA 4CRGA 2XC5A 2XXLA 1OYTH 4D9QA 3U8TH 1TMBH 1O2GH 1O2UA 3ZVGA 3R3GB 3AAVA 2R0LA 3A7VA 1TOCB 1RTFB 3SNAA 3ZZ6A 4FUIA 3A82A 1BMNH 3GY5A 3ZYEA 1C4Y2 2GMTC 4DIIH 3D23A 2VIPA 3M5OA 1W13U 3LH1A 5EG4A 1P02A 1VGCB 1ZZZA 1A5IA 1WV7H 4JZDH 4ZKNU 3S7HB 3SI4H 2Z9JA 1BTXA 5DJ7A 1O2XA 1C1PA 1GBTA 3SU3A 1NRSH 2FIRH 1GI0A 1K1IA 1SBWA 4KKDA 2VIOA 2Y5HA 2VJ1A 1Y3XA 4XOJA 2XCNA 1EJMA 3RC5A 1LHCH 2J2UA 1XXDA 1ZJKA 3RXMA 1D3DB 1F0UA 1SMFE 1TNKA 1LVBA 5C2ZA 5CHAC 2F9VA 5H4IB 2A32A 3ZV9A 5EQQA 3OY5U 4FVDA 3AW0A 3TK6A 3H5CB 5FCKA 1FY3A 4E05H 1QB9A 1ZTKA 1HNEE 1D3QB 3UOUA 1O3NA 2XCFA 2VU8E 1SR5C 3VEQB 3U8OH 7GCHF 1DUAA 1PPZA 1W0ZU 2BLWA 3GY7A 1PYTC 2BOKA 3ZZ8A 3RXQA 1T7CA 5DKMA 5CMXH 1T8NA 1KTSB 1MKWK 1WSSH 5K7RA 1KTTB 1AVXA 2BX3A 5FPSA 2ZDMA 1IQKA 3TNSA 1YC0A 1M9UA 3SV9A 4UFDH 1SHYA 1V2TT 3MH4A 1G3DA 1O32A 2PLXA 1DXWA 3DUXH 1O3BA 3P70B 2BX4A 4AGJA 1DWBH 4U30A 2VWNA 1C5OH 1NM6A 1MAXA 3LGWA 1IQLA 5EW2H 2BLQA 1MTVA 2ZPQA 4KTUA 3SU6A 1RTLA 3MU0A 1KDQA 2ZCKP 1Y5AT 2ZTXA 5LH8A 2O9QA 1O2VA 1AZ8A 3Q3XA 4K1TA 1CBWB 4GHQA 1TIOA 2FOMB 3SU2A 3BTME 1O2PA 4NIVA 1ACBE 2DUCA 2QXHA 4A5TS 2JETC 3MYWA 1G32B 3GY4A 1QRXA 4Q2KA 1WTGH 1GDNA 4NCYA 2V0BA 5BRRE 3M5NA 3EAJA 3KF2A 1LO6A 4B2CA 2J38A 5ESTE 5I25A 1V2NT 3P6ZB 2UWOA 5GCHF 4E06H 1UK4A 2ANYA 5LPEA 2ZC9H 4FUFA 1ZMNA 2A4QA 1EASA 2FOEA 2CXVA 1IHTH 2FOFA 3M7UA 1CVWH 3VXEH 2ZQ1A 1ESAA 3MTYA 1GJCB 4AYYB 3TNTA 1P06A 3E16B 2ESTE 1GVLA 5HM2A 1GBIA 2O8TA 2BHGA 4X2VA 3SUDA 1QBOA 1ZJDA 1AWFH 1KXAA 1QQUA 2R0KA 2ZFQH 2W3KA 4AFZA 2AH4X 3MU1A 4I8KA 2A5IA 1QL8A 3ATIA 1DSTA 3T62A 1NRNH 1HXEH 3RM2H 3MO3A 3FZDA 2TGTA 2A4RA 4IW4E 1WQVH 2RDLA 3QGJA 1C5XB 2V3OH 5DP5A 4H6TA 2F9PA 1BMAA 3W95A 1HGTH 1NN6A 2HNTE 5ABWA 4O3TA 1THPB 4AB9A 1ELCA 1IQNA 4X1PU 2O8MA 3E6PH 1SG8B 1MQ6A 1C2IA 1GI2A 1GHBF 3RXVA 1ZR0A 5A8ZA 1XM1A 2FOBA 2QF3A 5A0BA 4AN7A 1GCDA 1MKXK 2ZFTA 1MCVA 7ESTE 1KXEA 4RKOB 2DE8A 1TMTH 1T4UH 1O34A 4DW2U 4A1VA 1NT1A 1C4V2 2B8OH 2V3HH 2XBWA 1SGIB 4DT7B 1O3FA 1XUIA 1TBZH 1C5VA 1TWXB 1P3CA 4MNXA 2BLVA 4SGAE 4D7GA 1H9LB 1C1WH 1EP5A 1TPAE 1K22H 2THFB 4UDWH 4AX9H 2G55A 2W3IA 2XNIA 1TX6A 1WQSA 4DGJA 1D3TB 3BIVH 1TGNA 2TGPZ 1O31A 1V3XA 5GWZA 5B6OA 3F1SB 1V2LT 5G4BA 1IAUA 1FLEE 1QA7A 4I8HA 1C9PA 5FBIA 2EEKA 3LGTA 2W7SA 1CE5A 2SFAA 1DANH 2B7DH 2W7UA 1DY9A 1ELAA 1CA0B 2AMQA 1AKSB 2WYJA 1B5GH 1TRYA 2VVCA 4MG3A 1E36B 2FOCA 1GHYH 2ZHWH 1GHAG 1K9OE 4DCDA 2JH6D 1AVWA 2Y5GA 1WYKA 1N8OC
chains in the Genus database with same CATH superfamily
1C5UA 2Z9LA 3BTWE 1C2DA 1F0RA 3RXUA 3VB4A 5A0CA 3GY6A 1GG6B 1F7ZA 1WUNH 2FO9A 2XRCA 1AB9C 1MTWA 1INCA 1AY6H 1D6WA 5DK1A 3HGNA 1GBDA 2H5CA 1HB0B 2EI7A 3GY2A 1ELTA 1LHGH 2Z94A 1NS3A 4YOGA 5GIBA 4WY3A 1UTOA 3PMBB 2UUKB 3P8GA 1NC6A 1NFWA 1C1SA 5AF9H 2GCTB 2BQ7B 1O2QA 5BPEA 1O2NA 2GV7A 1ZGIA 4XBCA 5E0HA 2RDEA 2ZGCA 2SGAA 1ZRKA 1HAGE 1YGCH 1OYQA 4ZXXH 3VB7A 1NZQH 1QQ4A 1GBLA 2NU4E 1YLNA 1AUJA 1L1GA 2D26C 1DICA 1LVMA 1BCUH 1YM0A 1GJ7B 1ETRH 1OWEA 1BBRE 1YLDA 1XVMA 1SPJA 3ZIAD 1GBAA 1MZDA 1VCPA 4J2YB 4GUXA 1W0YH 1DLKB 4YLUA 5L2ZH 3PMAB 2ZDNA 5JBBS 4X8SH 1TE0A 1O2LA 2ODQA 5A8YA 3UPEA 1TNIA 1UK3A 2HWLB 1GJ9B 2A0QB 2OC0A 2GTBA 1LVYA 2Y81A 1ZHMA 1G3CA 2WUBA 2VWLA 1HIAB 2BXUH 2A7CA 5JYIA 1GBJA 2FLRH 1HUTH 3KIDU 2NU0E 2UUJB 5EQSA 1W12U 2OD3B 2FTMA 3OFND 3FKSD 2PP6A 5KECA 2YOLA 1YPHC 2QXIA 1IOEA 3QO6A 2ZGBH 1FJSA 2EY4C 4NSYA 3LGYA 2A4OA 1HJAB 1G3BA 1LDTT 4NIYA 4ABIA 2QIQA 2A5AA 3ZZ4A 4GVUA 1FI8A 2DE9A 2OLGA 2W6JD 3EE7A 5DPAA 2CF8H 1TLDA 1VCQA 1TB6H 2JDID 2P93A 4ZAEA 1RS0A 2WV5A 1KXCA 3SV2H 3SJOA 1LHEH 2VNTA 3HGPA 5EJ1A 5EOKA 4HG6A 1MTNC 1CT0E 4AZ2B 4FUHA 4B6FA 1BRUP 1GJBB 3NPSA 1OP0A 1DSUA 1QJ6B 1P2JA 1D6RA 1QURH 3ESTA 4A6LA 4A92A 2ALPA 3AASA 4YLQH 1AWHB 3A7YA 4UFFH 2F91A 1C5ZB 2Q6GA 3RMNH 5T6FA 4NZLA 4BTUB 1T8MA 1YPKH 4BXSA 3KGPA 2BY7X 2J94A 3U98H 3OX7U 4NIWA 3LGIA 2C90B 2J97A 1Y3UA 4UFEH 4CRFA 4E7NA 3FP7E 3WWBA 1V2MT 2FS9A 2G00A 4ISNA 3MH5A 1WBGB 3M3SA 4FETA 3DFJA 1KMHB 4YT6H 1UVUH 3VPKA 4CHAC 3JZ1B 3SV6A 2A2QH 1PQ5A 1GMDF 1SC8U 5EIYA 3BSQA 1C2GA 5E2OA 1C2KA 3OEED 2ZDKA 1OWHA 3DD2H 2ANWA 2SNWA 3IWMA 2Q6FA 4RN6A 1LPZB 4RI0A 3SV7A 1K2I1 4NFEA 1XUJA 2VINA 2TPIZ 1O2WA 1BTWA 1ELBA 4AFUA 5HGGA 2XW9A 1YCPK 1E1RD 4X2XA 3LDXH 2AERH 2TGDA 4CBNA 4U2WA 1OSSA 2M5TA 2P3TB 4ASUD 3SU1A 1ZLRA 1O5DH 1P10A 4A1XA 1GGDB 1C5MD 1SLVB 1GBKA 3LPRA 2F9BH 2KAIB 4F55A 2ZU1A 1TA6A 2ODPA 3TGKE 1CHOF 1SGYE 2PGBB 3BV9B 5E2PA 2OBOA 4X8TH 3ATKA 4Y76A 1V2RT 1FV9A 3UNRA 1BB0B 1SQAA 2CJIA 3M61U 3KYGA 2H9TH 4DOQA 5ESBA 4FU7A 3N99A 3HKIB 4OS5A 2F9OA 5FX6A 2CN0H 5B6LA 2WYGA 1MMJN 2FMJA 6GCHG 5JBCS 4IS5A 1B0EA 2XBXA 5LPRA 2R2MB 2ANKH 2HNTF 4XBDA 1ZGVA 3ZVBA 4WMFA 3TVJB 3KQCA 1H9HE 3FZZA 3ZV8A 1FPCH 3DCLA 1K28D 2Q6DA 2QAAA 2P94A 1RD3B 1TMUH 1DS2E 1O2SA 1XX9A 2VIVA 2RA0A 3OSYA 1DLEA 4Y71A 3TJVA 2PHBA 2XC0A 2C8WB 2BD4A 1JBUH 2VWMA 1Y5BT 3I78A 3SHAH 2ZWLH 1K1MA 1D3PB 2FXRA 2HPPH 1L4ZA 1RXPA 1EAIA 4CRDA 1GL0E 3MOCA 1KIGH 2FESH 2HNTC 4A1TA 1L2EA 2CMYA 2PKAB 4ZXYH 1YWUA 3ZVFA 1DPOA 4YO9A 5LPFA 1TPPA 4I8GA 1H9IE 2QY0B 3P8FA 3SNBA 3GY8A 1BBRK 4J1YA 3S7KB 5KGOA 1HAZB 2KX4A 1Y5UT 2ZGXH 4YM9A 1SLUB 1QNJA 5GDSH 5IYTA 1NESE 4NA9H 4TY7A 4NIXA 3RXEA 5F8ZA 2VWOA 1WAYB 1D4PB 2A31A 2CGAA 4JYTA 3WY8A 3SUEA 4VGCB 5C20A 1DWDH 3KL6A 3O8CA 1X7AC 1SGPE 1ZSJA 1O2HA 1GPZA 1O30A 1O3KA 1C2LA 3SUGA 4GLYA 4K1EA 1NBME 1XUKA 3DT0H 2QYIA 1EZQA 1YPGH 2J98A 2A7HA 1CGHA 3ZYDA 2L6OA 4K2YA 5I46H 4F49A 1AE8H 3RP2A 3MI4A 5SGAE 1AI8H 4IC6A 5DN6D 2JH0D 3RC4A 4B76A 1EPTB 2C4FH 3I29A 4Q4LA 3BG8A 1QR3E 1NY22 3QZRA 1QBVH 2YNAA 2G4UA 5FCRA 3NUMA 1YPHE 4X2WA 4ZKSU 1FX0B 4XRNA 1O0DH 2FODA 1OOKB 2WPIS 2H9EH 1BITA 3K2UA 3SOSA 3UOPA 1PQ8A 2ULLA 3I77A 1A1RA 1NO9H 2SGPE 2BQ6B 1F92A 4NA8A 4ZH8A 5L2YH 1LMWB 2OINA 1AE5A 1GI6A 2KR7A 3A8DA 1T4VH 1GJAB 1V2JT 2AIQA 2Q1JA 4WMEA 4ABEA 1TBQH 4ZHLU 1O5EH 3SU0A 2WINI 2FI5E 3TJUA 5C1YA 1QL9A 4AB8A 5T6GA 3MNBA 4LZ1H 1XUHA 3P8OA 3SO3A 1ESBA 4CH2B 2BVSH 1FIZA 2H6MA 2O8LA 1LKBA 3NXPA 1B7XB 4AGKA 2ILNA 3GCHC 3UQVA 1O36A 1OWKA 1O2TA 3F2HA 1EFRD 3PMJA 2NU3E 4INKA 4O03A 4YZUA 2HPQH 1DY8A 1HV7A 3GOVB 3EQ0H 3RU4E 3ZZCA 2EI8A 4Y8XA 2FTLE 4CH8B 3ZZ5A 1TNLA 2P8OC 3Q00A 5DO4H 1AZZA 3PYHA 1TRNA 3F9FA 1IQHA 2D1JA 1QGFA 6ESTA 4THNH 1ELFA 1SGTA 2ZGHA 2TRMA 2ZGJA 1O33A 1E0FD 2BB4A 1HXFH 1ETSH 1TALA 1UHBB 1A4WH 3BEUA 2O8UA 2BQWB 3QTVH 2QV1A 1J8AA 3RMOH 1VJAU 1OWJA 2HOBA 2CHAB 4UD9H 3K6YA 3NCLA 1SGRE 3BTKE 1GJ6A 3UREA 4ACBA 1Z1JA 3GDVA 1BTPA 4KTCA 1H8ED 1O37A 4WH6A 3MNCA 3PLBA 2EA3A 3RMLH 3SHCH 3FP8E 3AW1A 1UCYH 1FY5A 2AEIH 1AD8H 1VITG 3BEFB 4OGXA 1V2WT 3URDA 4K69A 4OM9A 1PPEE 1RIWB 1E79D 5EXNA 3BIUH 4FUJA 1EOLA 2Z9GA 2K8IA 1C5NH 3F9EA 2C8ZB 4MTBA 1IQFA 1K0HA 1GBBA 2WV4A 1B0FA 1HAIH 4INHA 1IHSH 4XE4A 1H8IH 4K5ZA 4LK4A 1S6HA 2GDDA 4XDEA 2QN5T 5E0JA 1DM4B 1J16A 3BTDE 2OK5A 2GMTB 2BD3A 3QZQA 2C8XB 3SJIA 1ABJH 2R9PA 3PO1C 2BM2A 5DP9A 4D7FA 2UUYA 1H8HD 3S0NA 1C1MA 2GCHF 1C5TA 2ZP0H 3OE7D 4OGYA 1MABB 3LH3A 1OPHB 4MPVA 2FWWA 4ABJA 2HVXA 2ZPRA 4JCNA 1O3EA 2BDAA 1IQJA 3UQOA 3GDUA 1BHXF 9ESTA 3SJKA 3BG4C 2WSSD 3KCGH 1ARCA 3A80A 3GYMA 4MPXA 3SBKA 5TCCA 1IQEA 5F03A 4BANB 2FS8A 1NRRH 1EATA 2Y82A 1TQ7B 2PUQH 3RU4T 1SGEE 2FZZA 1O3JA 2H5DA 1A5GH 1AHTH 1J17T 1O35A 2GKVE 3TGJE 5CHAB 2GZ9A 5J4QA 1P03A 3BTTE 4FVBA 4ISOA 2SGDE 1SHHB 1MUEB 4XD7D 5EQRA 1O2MA 1TPSA 2UWLA 1HBTH 1EX3A 4X6OA 4TPIZ 1P9UA 2FYQA 1A0JA 4CREA 4CRBA 1PPFE 3PMHB 2R3UA 3M3VA 1EOJA 2KCPA 1S5SA 1ZYOA 2YMSB 3BTGE 2BD8A 4K3JA 5FPYA 1GWAA 2XC4A 5EODA 1FY4A 3RXBA 3L6PA 2VGCC 2P16A 1S6LA 5GXPA 1SOZA 3RM0H 4FUCA 4ZROA 2KCOA 3K6ZA 5EJLA 2EI6A 3LU9B 3TH2H 3BTEE 1HAPH 1L4DA 3RXOA 3M37A 1C4U2 4IN2A 1ZMLA 2BY5X 4JMYA 1YP9A 5EPNA 3RXRA 1W2KH 2ZKSA 1FAKH 1T8LA 2Y6TA 2FOHA 3UR6A 1KYNA 2WPHS 1Z8RA 2BDBA 2KAIA 3NRLA 3VG8A 5L30H 1A0HB 4AFSA 5EU8A 3CNRA 4RT1A 3T29A 3GCTG 3M7TA 1AFEH 2K1QA 2AYWA 1C5YB 1LQEA 2BLOA 4TSFD 4F48B 2XOKD 2QC2A 3SN8A 1YCPM 1Z71A 3UY9A 2ZDVH 4I31A 1C2FA 3M5MA 3DSGA 1C5SA 4I8JA 5HXFA 2JETB 3V0XA 2BTCE 1LHFH 1P3EA 5FBEA 1ZPBA 3O8DA 1ABIH 1FY1A 3SQHE 1GMHG 2ZIQH 4LXBH 3BN9A 4X1SU 2G5NA 1NFUA 4DJZB 3KHVA 1AGJA 1NTPA 2ZHDA 1V2VT 3PWBA 5GPIB 1KLJH 2V6NA 2HRVA 2VIWA 4IN1A 3PRDA 3SGBE 2AGGX 2ZEBA 1CGJE 1W7GH 1ZSLA 4ZMAH 3RLWH 3MH6A 1EJAA 4K8YA 3LC5A 1K1LA 2VB0A 1GHWH 4WXVA 2OC8A 3SI3H 1KXBA 1CT4E 2SGEE 4Y8ZA 2BY9X 2LELA 1ZTLA 1KXDA 1TGSZ 2AS9A 2Z9KA 4Y79A 4F4OC 2ZFFH 3C1KA 2RG3A 1IQGA 1FIWA 3D65E 4B2BA 4Q7ZA 2PKAA 1E1QD 2OC7A 1H1BA 2QXJA 1DWCH 2ZQ2A 4ISHH 3F0OA 1S82A 2B0FA 4K8BA 1SVPA 3MU4A 1QJ7B 2H2ZA 3A7WA 1P05A 3CS0A 5E0GA 3RXPA 3ZZAA 5IK2D 5DP7A 5A09A 1F2SE 4NWKA 5C0TA 1Y3YA 1KLTA 3SORA 5E8EH 2ZFPH 4CR9A 1T31A 5TJXA 3A83A 2PKSC 3DA9B 1PQAA 5HKKD 1ZMJA 1ANCA 2BD7A 5T6DA 1MD8A 3EGKH 3T27A 1G2MA 2GZ7A 2J34A 3L3TA 5PTPA 3NK8A 1UVPA 1MZAA 5CE1A 1GMCG 3ITIA 2Z3EA 3W1EA 3MFJA 3URCA 1VCWA 1BDAA 4GCHG 2QA9E 2ZHFH 1D9IA 1C2EA 1LQDB 5IDKA 1SSXA 4RSPA 1GI8B 2PWXA 1UO6A 3CENA 1KDQB 3UB0A 1OKXA 1DT2A 5FHTA 1C5QA 4Z1MD 4OS6A 4Q7YA 3UR9A 3SUFA 3AAUA 3ZVEA 1EJNA 4TPYA 3V12A 5FXLA 1GCTC 2Y7XA 1KLIH 4WJG2 4K1SA 3LGVA 1O3DA 1P12E 2BY8X 3F9GA 4BAQB 3PRBA 4FXGH 3ZZBA 5GJ4B 4X6MA 1BRAA 3A81A 1G37A 4NWLA 1EZXC 5C67A 2PFEA 1YPJH 1NFXA 2OUAA 4GAWA 2ZI2H 2XWAA 3KQ5A 4LOYH 4X1RU 6CHAC 4FUBA 2OP9A 1C1QA 1GBFA 2BDIA 1ZPCA 3PV5A 2G8TA 3U1JB 1QCPA 4GSOA 4HI3A 3F3BA 5T3HA 1XUGA 4Y7BA 1BJVA 1QZ8A 4E7RG 1O2KA 2ZHQH 1E35B 2BD9A 4WMDA 1UTQA 1QHRB 4Y8YA 3VGCC 1GJDB 3Q3YA 2NU2E 2AMPA 3OTJE 4ACAA 1JIRA 2GD4B 2FLBH 4TYDA 1T8OA 3ATWA 1N8OB 2STBE 4MNVA 4RKJB 1OWDA 5K0HA 3SJ9A 4AYVB 2TGAA 3FAOA 1UHBA 4X6NA 1Q31A 1SGFG 1AB9B 2G81E 1AFQC 4HTCH 4KGAA 3OYPA 5JBTA 4YT7H 1OWIA 1QL7A 2GX4A 2GT8A 1OP8A 2PGQB 1BRBE 1HJ9A 3PLKA 1SLXB 2VIDA 3OEHD 2G4TA 1T32A 1UTNA 3LONA 2ZECA 1NU9A 1G3EA 4Z6AH 2STAE 2C93B 1P2QA 1K1PA 3NKKA 3SU4A 4CBOA 3SV8A 3VB3A 2SGQE 1N6XA 3RXFA 4MPWA 1E34B 1HAXB 1BRCE 1SL3A 3BTHE 3ZZ3A 1LPGB 3A86A 1TGBA 3F6UH 2TIOA 4FU8A 4IGDA 4K60A 3U28C 1P2MA 2ANMH 1GHAF 1ORFA 2Z6BD 1GMHF 2ZFRH 1WDIA 4B71A 1VGCC 3RXJA 7GCHG 1CHGA 1BJUA 2JIZD 3GY3A 1XUFA 1WOFA 3QDZB 3L33A 3VB5A 3PTNA 2FX4A 1O3HA 2OCVB 4AG1A 1IQIA 3RDZA 3FOAA 2LP6A 2C8YB 1P11E 1SQRA 3HK3B 1RTKA 2UUFB 1MH0A 1LHDH 1ANBA 1KSNA 3BF6H 3LOXA 1C2JA 5A8XA 4CRAA 2QF0A 4I32A 4B73A 1XKAC 3LT3A 1F5RA 8KME2 5A2MH 3FFGA 1Z8GA 1WU1A 1G30B 1UTKA 2A7JA 2P95A 1QFKH 1A2CH 1NFYA 1BT7A 3GYLB 1UVTH 4ABGA 3STJA 3TU7H 1AUTC 2WV9A 1P0SH 1ZOMA 1C9TA 4BAHB 1P01A 7KMEH 4Y6DA 4ABDA 2Y80A 1MKWH 1ZSKA 1C5LH 2IPHA 1SLWB 3P8NA 1S6FA 4ZHMU 1A0LA 4I7YH 4H6SB 1MU6B 3RLYH 1P2KA 1V2QT 2PR3A 1O3MA 4B2AA 5EXMA 1VZQH 1CGIE 2ZPSA 2SNVA 2OC1A 4B74A 1MTNB 4UE7H 4FU9A 1W10U 1SFIA 1HLTH 1K21H 3E91A 3N7OA 3V13A 2AFQB 3EA8A 2FEQH 1SGFA 1OS8A 2ZNKH 5HMAA 3EE0B 4I33A 1DX5M 5GCHG 1P2IA 4JYVH 2IJD1 3IG6B 5AHGH 2NU1E 3U69H 3VXFH 1KXFA 2CHAC 2OXSA 2HLCA 2KCYA 5JDUB 3A87A 3QGNB 1EP6A 1MD7A 1PPBH 2YMSD 1VR1H 1V2OT 1PYTD 1UK2A 1Z8IB 1A7SA 4MDSA 1ETTH 2J9NA 4BNRA 1N1LA 4ABAA 2KFWA 1CBWC 3U8RH 2W26A 3S69A 3SW2B 3A8AA 1GJ8B 4YXWD 3ZVCA 1P8VC 2PTCE 1SOTA 1TNJA 1SGCA 2QCYA 3ZZ7A 4CHAB 1O3PB 4UONA 2ZU5A 1CQQA 3E0NB 3RXIA 3UTUH 5AFZH 3FP6E 3PTBA 1XVOA 1DE7H 2OQ5A 4NSVA 1Z1IA 4YOIA 3TLOA 1V6DA 2BY6X 3QTOH 1O2IA 4NZQA 1P9SA 1O2RA 1FMGA 1JOUB 2ZHEH 2VH6A 2QF5A 1FY8E 2AMDA 1O2YA 1THSH 3QUMP 3RXTA 2P3UB 3T2NA 1EB1H 3MO6A 1HAVB 1L1NA 1FXYA 5FL7D 1AKSA 4XSKU 1UCYE 1L0ZA 1C5WB 2ZA5A 1GHZA 2R2WU 1H4WA 3T28A 3WWFA 3A7XA 1GHBG 2IPQX 2GP9B 4R0IA 4OS2A 4X2YA 2Z9IA 4MNYA 2VIQA 1TNGA 1HFDA 2B5TB 1UJ1A 2Y7ZA 4U01A 5C5OA 1O5FH 2QGRA 1O2OA 1TBRH 2BDGA 1GI1A 1YLCA 1BIOA 1LPKB 3F2GA 1BMFD 2Z7FE 4AORA 2GDEH 5KEDA 1QY6A 2JKHA 1S83A 4MQAA 2FX6A 1VITH 3GISB 2VVVA 3E1XB 4I86A 3M36A 1FQ3A 4OS7A 2LNCA 1Y3VA 4NG9H 2FOAA 4JZFH 5F6MA 1EAUA 1A3BH 4MLFB 3QX5H 2EC9H 1C1UH 5L6NH 3MH7A 2ASUB 3PLPA 3PROA 4CR5A 2CV3A 3IITA 3BTQE 1RJXB 1MKXH 2ZU4A 2GJGA 2GT7A 4FUGA 4JYUH 5AFYH 1QA0A 1O39A 5AVDA 1GBEA 2JH5D 3VFEA 1ELGA 1NROH 3LGUA 1ZPZA 4ASHA 1HDTH 4JZ1A 5C5NA 2FP7B 1QB1A 1TONA 4TWWA 5DSFA 1BTYA 1C5PA 3ZVDA 1TQ0B 4B75A 4ESTE 2ZCLP 3CP7A 4RT0A 3UNSA 1GI3A 2WUCA 2YNBA 3RUOA 6GCHF 3SGAE 3PM3A 4AOQA 1NRQH 1SI5H 1J15A 3SNCA 1BTZA 1HIAA 2M2AA 2O8WA 3K9XB 4H42U 3P17H 1ID5H 1ANDA 3F2FA 1UTJA 2PSXA 1WCZA 2PV9B 1ZHRA 5F8XA 4TY6A 3Q76A 2SGFE 5F8TA 3G01A 2F9NA 1JIMA 2A2XH 1HCGA 1W8BH 2FI4E 1GI9B 5HM9A 4KELA 1IQMA 3ZVAA 1JRSA 5LGOA 3OTPA 3QLPH 1MCTA 1GHXH 1CA0C 1GJ4H 4ZKRU 3QWCH 2V35A 1H8DH 3T25A 4D9RA 4X8VH 1A5HA 1O3OA 4YTAA 5F53A 3RMMH 1ESTA 2PTNA 4CRCA 4Y10E 4Y7AA 5JB9S 1EKBB 1EUFA 1KY9A 4Y0YE 1FZZA 3PV2A 3V7TA 4AG2A 2FM2A 4AC9A 1GG6C 2HGTH 1PQ7A 1GVZA 3DHKH 2A5KA 4JK6A 2I6QA 1V2UT 1RRKA 3V3MA 4NGAH 3N7EA 1O3GA 1GL1A 4JZIA 2UWPA 5EGMA 1G2LA 3KEEA 1QRWA 3BTFE 1PFXC 1CU1A 1MQ5A 4Y11E 2GCTC 3O8RA 3TJOA 1BMMH 1MBMA 2C3SA 2ZDAH 3GICB 2WPJS 3Q3KA 3F0PA 1NPMA 1S84A 3FVFB 4BAMB 3M35A 3MNSA 2ZG0H 3GCHB 4HFPB 5A0AE 1TA2A 1Z6EA 3H09A 2W5EA 4FUEA 2P3FH 1W0JD 1RGQA 2OBQA 4WF8A 4Z0KA 3R0FA 1YBWA 2NWNA 3Q77A 4BOHA 3FO8D 3U9AH 4IMZA 3P95A 2P8OB 5C3NA 3M3TA 4D76A 1C1OA 3E90B 3ELAH 3FANA 3GDSA 2AIPA 5FX5A 3UAIC 4O9VA 3T26A 1Q3XA 2A45B 1SB1H 2FYRA 4ZKOU 3KQDA 1S0QA 4H4FA 1E37B 6LPRA 4GPGA 3B23B 1FN8A 3H7TA 1V2KT 2Y5FA 2TBSA 1MBQA 2J4IA 2GZ8A 2XWBI 2J95A 4ABFA 3A7TA 1O3IA 3JZ2B 4MPUA 3RXCA 5C1UA 4B1TA 1UMAH 3NZIA 3RXLA 2A4GA 1AU8A 1EAWA 1P57B 1EZUC 5TCAA 4TT3D 1AIXH 2XYAA 4Q7XA 2J98B 2KZ4A 1F5KU 1HJAC 1U6QA 1UW7A 2CF9H 4JZEH 4ISIH 1MAYA 1UCYK 3KN2A 2ODYB 1O2JA 1F0TA 1TRMA 1S0RA 1TNHA 1W0KD 1XXFA 4O3UA 5CHBA 3D62A 1ZTJA 5DP3A 2KM0A 4ABBA 1FDPA 2EQNA 3W94A 1FAXA 5GNDA 1MU8B 1UTPA 3E8LA 1TOMH 1GMDG 1QIXB 1GI7B 2PW8H 2BVXH 2XTTB 1ARBA 3ZZ9A 3RC6A 1BTUA 2XBVA 1ANEA 1HAYB 3TJNA 1P09A 4XFQA 1BUIA 3WW7A 4AFQA 2I6SA 1V2ST 1TX8A 3E3TA 4I8LA 3UFAA 3TK5A 1BOQA 1HRTH 2BD2A 1QRZA 1C1RA 2GVFA 4HGCA 3PO1B 4XBBA 3RXGA 5C1XA 8GCHG 5JBAS 1GDUA 1EXFA 1GI4A 1MTSA 5EXLA 1S81A 2AGEX 3A89A 4M7GA 4YESB 3HK6B 3E0PB 1VITF 1YPLH 4BXWA 2G51A 2QXGA 5DP6A 1EB2A 2XBYA 4HZHA 2W6ID 2BVRH 4YOJA 2OTVA 4TWYA 3UWJH 3SGQE 1LVOA 2Z3CA 3BG4B 3GS9A 1CSOE 1CHOG 4JK5A 1AO5A 3KQBA 2VVUA 1O5AB 3HATH 2BDHA 1W3CA 2G52A 2WPLS 1HYLA 1VJ9U 3SU5A 2F83A 1CT2E 5EPYA 8ESTE 1O3CA 5T1VA 3TH3H 1HAOH 1J14A 1EAXA 2A1DB 2KCAA 3LIWA 3RU4D 3S9BA 1NU7B 1O38A 3ODFA 2FI3E 2BMGB 2ZFSA 1CA8B 1O3LA 1YCPH 1PPGE 1GVKB 2D2DA 1SGQE 1S85A 2BZAA 1XMNB 1O5BB 1BHXB 3O8BA 2AHME 2BXTH 3LJJA 1TFXA 3PWCA 1EQ9A 3KNXA 1C1TA 1EPTA 2G5VA 3A88A 1GGDC 5HIYA 2ZDLA 2QE7D 4DIHH 1TGCA 2VGCB 4INLA 4WWYA 3B9FH 3AK5A 4IC5A 2WPKS 3FN8A 3MWIU 4WXIA 1K1JA 1A46H 1A3EH 1AVGH 1W11U 1HAVA 1ELDE 1BA8B 1SKYE 3SNDA 1UTMA 3ATLA 1DVAH 1GI5A 1G9IE 1THRH 3KYFA 4BTTB 4O97A 5J4SA 3SNEA 2F3CE 2RFKC 3UNQA 3QN7A 1Z8JB 2P59A 1AQ7A 1QB6A 1GHVH 3T5FH 3U1IB 3SZEA 1XKBC 1Z7KA 1F5LA 3KQEA 4IMQA 1FONA 2RCEA 4MVNA 3MHWU 2BDYA 4FOUC 1DOJA 5DP8A 2D8WA 1C1NA 8LPRA 3B8JA 2F9UA 1ELEE 1YPMH 4DY7B 3DFLA 1SGDE 4UFGH 1A61H 5FPTA 4NFFA 4NA7A 1FNIA 2WPMS 4R8TB 2LPRA 3NWUA 1K1NA 4DURA 1TX7A 4Y0ZE 1RFNA 2Z3DA 1YYY1 2HALA 4ZUHA 5EW1H 2BOHB 1TYNA 1BBRH 1W14U 1FPHH 3EYDA 1W7XH 3TPIZ 4OS4A 1YKTA 7LPRA 5HIZA 2ZCHP 1OP2A 1P2OA 1TGTA 1SFQB 2ZTZA 3MU5A 3ATMA 1HJ8A 3OU0A 4X1NU 3SJ8A 2BD5A 3GCTF 4DVAU 4VGCC 2QF4A 3ENSB 2ZO3H 1GDQA 4OS1A 1FUJA 1C2MA 2AGIX 3C27B 1GJ5H 2ZZUH 1MTUA 1N6YA 4Q80A 3TK9A 1QJ1B 1LTOA 2JJ2D 3TGIE 1ZHPA 3RXSA 1AMHA 1JXPA 3EA7A 1YF4A 4WVPE 1DXPA 2L74A 1C5RA 1P04A 2ZTYA 4ISLA 3D49H 1EPTC 1K1OA 1BZXE 4PROA 4BTIB 1DUEA 2ZU2A 3TH4H 2FDAA 3MQKC 1EZSC 1JWTA 4KTSA 1DITH 5DP4A 2H9HA 2ZU3A 1SQOA 1GBCA 2PKSB 3H7OA 3UIRA 2FOGA 3K65B 3PB1E 3RXAA 5HYOA 2IOTA 1QBNA 3PV4A 1UTLM 3RXKA 5DG6A 3MNXA 3A84A 8GCHF 1O2ZA 1G36A 3MMGA 1C2HA 2K0QA 3A8CA 4IBLH 3SYJA 1YPEH 4D8NA 1L1JA 3GCOA 1SQTA 3TIUA 3A8BA 1TAWA 3LC3A 3AVZA 1FN6A 1Q2WA 1UVSH 2IJOB 3ODDA 2B9LA 2RA3A 3M7QA 1NRPH 3S9AA 3MU8A 1Z6JH 4SGBE 3STIA 4BAOB 2H1UA 2PSYA 1ZRBA 3A7ZA 4MNWA 1OX1A 3LJOA 4DG4A 2ZF0H 1GCTB 4ABHA 1ELVA 1BQYA 3F68H 1Y3WA 1Y8TA 3SZNA 4LZ4B 3SQEE 1GBHA 1PJPA 3MO9A 1PPHE 1LCYA 1V2PT 2BZ6H 4QT8C 3HPTB 1O3AA 5JB8S 1TABE 1LKAA 1F0SA 5C17A 4A7IB 4BAKB 2OQUA 1JRTA 1P2NA 2PUXB 4X0WU 2BYAX 2IN2A 3ZZDA 1GMCF 3RXHA 5FAHA 6CHAB 4KP0A 1GBMA 2J92A 5ETXA 4GCHF 1JMOH 3GCNA 1O5CB 1O5GH 1HAHH 1Y59T 1AN1E 3M5LA 4GHTA 1OXGA 3A85A 1DDJA 1WTHD 2VH0A 1DFPA 3UUZA 2GGVB 3VGCB 1BTHH 2BDCA 1E38B 2V3MA 3OY6U 3VB6A 1BMLA 1QTFA 3EA9A 4UEHH 1C1VH 4ZHAA 3CS7A 1J9CH 2R3YA 3LKWA 3P92A 4X6PA 5DGJA 4WH8A 4X8UH 3EDXB 3QK1A 1SGNE 2FPZA 2GCHG 3TITA 3F9HA 1CO7E 3RXDA 3HKJB 1PPCE 4FUDA 3UWIA 1RIWC 3BEIB 4U32A 1AFQB 1TPOA 5JPMH 1HPGA 1DWEH 2ALVA 4X1QU 9LPRA 2GV6A 3S9CA 1UVOA 4CRGA 2XC5A 2XXLA 1OYTH 4D9QA 3U8TH 1TMBH 1O2GH 1O2UA 3ZVGA 3R3GB 3AAVA 2R0LA 3A7VA 1TOCB 1RTFB 3SNAA 3ZZ6A 4FUIA 3A82A 1WXRA 1BMNH 3GY5A 3ZYEA 1C4Y2 2GMTC 2JJ1D 4DIIH 3D23A 2VIPA 3M5OA 2F4LA 1W13U 3LH1A 5EG4A 1P02A 1VGCB 1ZZZA 1A5IA 1WV7H 4JZDH 3OAAD 4ZKNU 3S7HB 3SI4H 2Z9JA 5C0UA 1BTXA 5DJ7A 1O2XA 1C1PA 1GBTA 3SU3A 1NRSH 2FIRH 1GI0A 1K1IA 1SBWA 4KKDA 2VIOA 2Y5HA 2VJ1A 1Y3XA 4XOJA 2XCNA 1EJMA 3RC5A 1LHCH 2J2UA 1XXDA 1ZJKA 3RXMA 1D3DB 1F0UA 1SMFE 1TNKA 1LVBA 5C2ZA 2WZQA 5CHAC 2F9VA 5H4IB 2A32A 3ZV9A 5EQQA 3OY5U 4FVDA 3AW0A 3TK6A 3H5CB 5FCKA 1FY3A 4E05H 1QB9A 1ZTKA 1HNEE 1D3QB 3UOUA 1O3NA 2XCFA 2VU8E 1SR5C 3VEQB 3U8OH 7GCHF 1DUAA 1PPZA 5EJZA 1W0ZU 2BLWA 2YMSC 3GY7A 1PYTC 2BOKA 3ZZ8A 3RXQA 1T7CA 5DKMA 5CMXH 1T8NA 1KTSB 1MKWK 1WSSH 5K7RA 1YY3A 3DSOA 1KTTB 1AVXA 2BX3A 5FPSA 2ZDMA 1IQKA 1COWD 3TNSA 1YC0A 1M9UA 4ZCNA 3SV9A 1VKYA 4UFDH 1SHYA 1V2TT 3MH4A 1G3DA 1O32A 2PLXA 1DXWA 3DUXH 1O3BA 3P70B 2BX4A 4AGJA 1DWBH 4U30A 2VWNA 2VBCA 1C5OH 1NM6A 1MAXA 4P02A 3LGWA 1IQLA 5EW2H 2BLQA 2WHXA 1MTVA 2ZPQA 4KTUA 3SU6A 1RTLA 2F43B 3MU0A 1KDQA 2ZCKP 1Y5AT 2ZTXA 5LH8A 2O9QA 1O2VA 1AZ8A 3Q3XA 4K1TA 4DT4A 1CBWB 4GHQA 1TIOA 2FOMB 3SU2A 3BTME 1O2PA 4NIVA 1ACBE 2DUCA 2QXHA 4A5TS 2JETC 2XNDD 3MYWA 1G32B 3GY4A 1QRXA 4Q2KA 1WTGH 1GDNA 4NCYA 4Q63A 2V0BA 5BRRE 3M5NA 3EAJA 3KF2A 1LO6A 4B2CA 2J38A 5ESTE 5I25A 1V2NT 3P6ZB 2UWOA 5GCHF 4E06H 1UK4A 2ANYA 5LPEA 2ZC9H 4FUFA 1ZMNA 2A4QA 1EASA 2FOEA 2CXVA 1IHTH 2FOFA 3M7UA 1CVWH 3VXEH 2ZQ1A 1ESAA 3MTYA 2WPDD 1GJCB 1OHHD 4AYYB 3TNTA 1P06A 2HLDD 3E16B 2ESTE 1GVLA 5HM2A 1GBIA 2O8TA 2BHGA 4X2VA 3SUDA 1QBOA 1ZJDA 1AWFH 1KXAA 1QQUA 5CDFE 2R0KA 2ZFQH 2W3KA 4AFZA 2AH4X 3MU1A 4I8KA 2A5IA 1QL8A 2CK3D 1DSTA 3ATIA 3T62A 1NRNH 1HXEH 3RM2H 3MO3A 3FZDA 2TGTA 2A4RA 4IW4E 1WQVH 2RDLA 3QGJA 1C5XB 2V3OH 5DP5A 4H6TA 2F9PA 1BMAA 3W95A 1HGTH 1NN6A 2HNTE 5ABWA 3N7DA 4O3TA 1THPB 4AB9A 1ELCA 1IQNA 4M9FA 4X1PU 2O8MA 4B6EA 3E6PH 1SG8B 1MQ6A 1C2IA 1GI2A 1GHBF 3RXVA 1ZR0A 5A8ZA 1XM1A 2FOBA 2QF3A 5A0BA 4AN7A 1GCDA 1MKXK 2ZFTA 1MCVA 7ESTE 1KXEA 4RKOB 2DE8A 2J5UA 1TMTH 1T4UH 1O34A 4DW2U 4A1VA 1NT1A 1C4V2 2B8OH 2V3HH 2XBWA 1SGIB 4DT7B 1O3FA 1XUIA 1TBZH 1C5VA 1TWXB 1P3CA 4MNXA 2BLVA 4SGAE 1NBMD 1H9LB 4D7GA 1C1WH 1EP5A 3DSPA 1TPAE 1K22H 2THFB 4UDWH 4AX9H 2G55A 2W3IA 2XNIA 4P00A 1TX6A 1WQSA 4DGJA 1D3TB 3BIVH 1TGNA 2TGPZ 1O31A 1V3XA 5GWZA 5B6OA 2HVYB 3F1SB 1V2LT 5G4BA 1IAUA 1FLEE 1QA7A 4I8HA 1C9PA 5FBIA 2EEKA 3LGTA 2W7SA 1CE5A 2SFAA 1DANH 2B7DH 2V7QD 2W7UA 1DY9A 1ELAA 1CA0B 2AMQA 1AKSB 2WYJA 1B5GH 1TRYA 2VVCA 4MG3A 1E36B 2FOCA 1GHYH 2ZHWH 1GHAG 1K9OE 4DCDA 2JH6D 1AVWA 2Y5GA 1WYKA 1N8OC 5C94A
chains in the Genus database with same CATH topology
1C5UA 2Z9LA 3BTWE 1C2DA 1F0RA 3RXUA 3VB4A 5A0CA 3GY6A 1GG6B 1F7ZA 1WUNH 2FO9A 2XRCA 1AB9C 1MTWA 1INCA 1AY6H 1D6WA 5DK1A 3HGNA 1GBDA 2H5CA 1HB0B 2EI7A 3GY2A 1ELTA 1LHGH 2Z94A 1NS3A 4YOGA 5GIBA 4WY3A 1UTOA 3PMBB 2UUKB 3P8GA 1NC6A 1NFWA 1C1SA 5AF9H 2GCTB 2BQ7B 1O2QA 5BPEA 1O2NA 2GV7A 1ZGIA 4XBCA 5E0HA 2ZGCA 2SGAA 1ZRKA 1HAGE 1YGCH 1OYQA 4ZXXH 3VB7A 1NZQH 1QQ4A 1GBLA 2NU4E 1AUJA 1L1GA 2D26C 1DICA 1LVMA 1BCUH 1YM0A 1GJ7B 1ETRH 1OWEA 1BBRE 1YLDA 1XVMA 1SPJA 1GBAA 1MZDA 1VCPA 4J2YB 4GUXA 1W0YH 1DLKB 4YLUA 5L2ZH 3PMAB 2ZDNA 5JBBS 4X8SH 1TE0A 1O2LA 2ODQA 5A8YA 3UPEA 1TNIA 1UK3A 2HWLB 1GJ9B 2A0QB 2OC0A 2GTBA 1LVYA 2Y81A 1ZHMA 1G3CA 2WUBA 2VWLA 1HIAB 2BXUH 2A7CA 5JYIA 1GBJA 2FLRH 1HUTH 3KIDU 2NU0E 2UUJB 5EQSA 1W12U 2OD3B 2FTMA 2YOLA 1YPHC 2QXIA 1IOEA 3QO6A 2ZGBH 1FJSA 4NSYA 3LGYA 2A4OA 1HJAB 1G3BA 1LDTT 4NIYA 4ABIA 2QIQA 2A5AA 3ZZ4A 4GVUA 1FI8A 2DE9A 2OLGA 5DPAA 2CF8H 1TLDA 1VCQA 1TB6H 2P93A 4ZAEA 1RS0A 2WV5A 1KXCA 3SV2H 3SJOA 1LHEH 2VNTA 3HGPA 5EOKA 1MTNC 1CT0E 4AZ2B 4FUHA 1BRUP 1GJBB 3NPSA 1OP0A 1DSUA 1QJ6B 1P2JA 1D6RA 1QURH 3ESTA 4A6LA 4A92A 2ALPA 3AASA 4YLQH 1AWHB 3A7YA 4UFFH 2F91A 1C5ZB 2Q6GA 3RMNH 5T6FA 4NZLA 4BTUB 1T8MA 1YPKH 4BXSA 3KGPA 2BY7X 2J94A 3U98H 3OX7U 4NIWA 3LGIA 2C90B 1Y3UA 4UFEH 4CRFA 4E7NA 3FP7E 1V2MT 2FS9A 2G00A 4ISNA 3MH5A 1WBGB 3M3SA 3DFJA 4YT6H 1UVUH 3VPKA 4CHAC 3JZ1B 3SV6A 2A2QH 1PQ5A 1GMDF 1SC8U 3BSQA 1C2GA 5E2OA 1C2KA 2ZDKA 1OWHA 3DD2H 2ANWA 2SNWA 3IWMA 2Q6FA 4RN6A 1LPZB 3SV7A 1K2I1 4NFEA 1XUJA 2VINA 2TPIZ 1O2WA 1BTWA 1ELBA 4AFUA 5HGGA 2XW9A 1YCPK 4X2XA 3LDXH 2AERH 2TGDA 4CBNA 4U2WA 1OSSA 2M5TA 2P3TB 3SU1A 1ZLRA 1O5DH 1P10A 4A1XA 1GGDB 1C5MD 1SLVB 1GBKA 3LPRA 2F9BH 2KAIB 2ZU1A 1TA6A 2ODPA 3TGKE 1CHOF 1SGYE 2PGBB 3BV9B 5E2PA 2OBOA 4X8TH 3ATKA 4Y76A 1V2RT 1FV9A 3UNRA 1BB0B 1SQAA 2CJIA 3M61U 2H9TH 4DOQA 5ESBA 4FU7A 3HKIB 4OS5A 2F9OA 5FX6A 2CN0H 2WYGA 1MMJN 2FMJA 6GCHG 5JBCS 4IS5A 1B0EA 2XBXA 5LPRA 2R2MB 2ANKH 2HNTF 4XBDA 1ZGVA 3ZVBA 4WMFA 3TVJB 3KQCA 1H9HE 3FZZA 3ZV8A 1FPCH 1K28D 2Q6DA 2QAAA 2P94A 1RD3B 1TMUH 1DS2E 1O2SA 1XX9A 2VIVA 2RA0A 3OSYA 1DLEA 4Y71A 3TJVA 2PHBA 2XC0A 2C8WB 2BD4A 1JBUH 2VWMA 1Y5BT 3I78A 3SHAH 2ZWLH 1K1MA 1D3PB 2FXRA 2HPPH 1L4ZA 1RXPA 1EAIA 4CRDA 1GL0E 3MOCA 1KIGH 2FESH 2HNTC 4A1TA 1L2EA 2CMYA 2PKAB 4ZXYH 3ZVFA 1DPOA 4YO9A 5LPFA 1TPPA 4I8GA 1H9IE 2QY0B 3P8FA 3SNBA 3GY8A 1BBRK 4J1YA 3S7KB 1HAZB 1Y5UT 2ZGXH 4YM9A 1SLUB 1QNJA 5GDSH 5IYTA 1NESE 4NA9H 4TY7A 4NIXA 3RXEA 5F8ZA 2VWOA 1WAYB 1D4PB 2A31A 2CGAA 4JYTA 3WY8A 3SUEA 4VGCB 5C20A 1DWDH 3KL6A 3O8CA 1X7AC 1SGPE 1ZSJA 1O2HA 1GPZA 1O30A 1O3KA 1C2LA 3SUGA 4GLYA 4K1EA 1XUKA 3DT0H 2QYIA 1EZQA 1YPGH 2A7HA 1CGHA 3ZYDA 4K2YA 5I46H 4F49A 1AE8H 3RP2A 3MI4A 5SGAE 1AI8H 4IC6A 2JH0D 3RC4A 4B76A 1EPTB 2C4FH 3I29A 3BG8A 1QR3E 1NY22 3QZRA 1QBVH 2YNAA 2G4UA 5FCRA 3NUMA 1YPHE 4X2WA 4ZKSU 1O0DH 2FODA 1OOKB 2WPIS 2H9EH 1BITA 3K2UA 3SOSA 3UOPA 1PQ8A 2ULLA 3I77A 1A1RA 1NO9H 2SGPE 2BQ6B 1F92A 4NA8A 4ZH8A 5L2YH 1LMWB 2OINA 1AE5A 1GI6A 3A8DA 1T4VH 1GJAB 1V2JT 2AIQA 2Q1JA 4WMEA 4ABEA 1TBQH 4ZHLU 1O5EH 3SU0A 2WINI 2FI5E 3TJUA 5C1YA 1QL9A 4AB8A 5T6GA 3MNBA 4LZ1H 1XUHA 3P8OA 3SO3A 1ESBA 4CH2B 2BVSH 1FIZA 2H6MA 2O8LA 1LKBA 3NXPA 1B7XB 4AGKA 2ILNA 3GCHC 3UQVA 1O36A 1OWKA 1O2TA 4INKA 3PMJA 2NU3E 4O03A 4YZUA 2HPQH 1DY8A 1HV7A 3GOVB 3EQ0H 3RU4E 3ZZCA 2EI8A 4Y8XA 2FTLE 4CH8B 3ZZ5A 1TNLA 2P8OC 3Q00A 5DO4H 1AZZA 3PYHA 1TRNA 3F9FA 1IQHA 2D1JA 1QGFA 6ESTA 4THNH 1ELFA 1SGTA 2ZGHA 2TRMA 2ZGJA 1O33A 1E0FD 2BB4A 1HXFH 1ETSH 1TALA 1UHBB 1A4WH 3BEUA 2O8UA 2BQWB 3QTVH 2QV1A 1J8AA 3RMOH 1VJAU 1OWJA 2HOBA 2CHAB 4UD9H 3K6YA 3NCLA 1SGRE 3BTKE 1GJ6A 3UREA 1Z1JA 3GDVA 1BTPA 4KTCA 1O37A 4WH6A 3MNCA 3PLBA 2EA3A 3RMLH 3SHCH 3FP8E 3AW1A 1UCYH 1FY5A 2AEIH 1AD8H 1VITG 3BEFB 4OGXA 1V2WT 3URDA 4K69A 1PPEE 1RIWB 5EXNA 3BIUH 4FUJA 1EOLA 2Z9GA 1C5NH 3F9EA 2C8ZB 4MTBA 1IQFA 1GBBA 2WV4A 1B0FA 1HAIH 4INHA 1IHSH 4XE4A 1H8IH 4K5ZA 4LK4A 1S6HA 2GDDA 4XDEA 2QN5T 5E0JA 1DM4B 1J16A 3BTDE 2GMTB 2BD3A 3QZQA 2C8XB 3SJIA 1ABJH 2R9PA 3PO1C 2BM2A 5DP9A 4D7FA 2UUYA 3S0NA 1C1MA 2GCHF 1C5TA 2ZP0H 4OGYA 3LH3A 1OPHB 4MPVA 2FWWA 4ABJA 2HVXA 2ZPRA 4JCNA 1O3EA 2BDAA 1IQJA 3UQOA 3GDUA 1BHXF 9ESTA 3SJKA 3BG4C 3KCGH 1ARCA 3A80A 3GYMA 4MPXA 3SBKA 5TCCA 1IQEA 5F03A 4BANB 2FS8A 1NRRH 1EATA 2Y82A 1TQ7B 2PUQH 3RU4T 1SGEE 2FZZA 1O3JA 2H5DA 1A5GH 1AHTH 1J17T 1O35A 2GKVE 3TGJE 5CHAB 2GZ9A 5J4QA 1P03A 3BTTE 4FVBA 4ISOA 2SGDE 1SHHB 1MUEB 5EQRA 1O2MA 1TPSA 2UWLA 1HBTH 1EX3A 4X6OA 4TPIZ 1P9UA 2FYQA 1A0JA 4CREA 4CRBA 1PPFE 3PMHB 2R3UA 3M3VA 1EOJA 1S5SA 1ZYOA 3BTGE 2BD8A 4K3JA 5FPYA 1GWAA 2XC4A 5EODA 1FY4A 3RXBA 3L6PA 2VGCC 2P16A 5GXPA 1SOZA 3RM0H 4FUCA 4ZROA 3K6ZA 2EI6A 3LU9B 3TH2H 3BTEE 1HAPH 1L4DA 3RXOA 3M37A 1C4U2 4IN2A 1ZMLA 2BY5X 4JMYA 1YP9A 5EPNA 3RXRA 1W2KH 2ZKSA 1FAKH 1T8LA 2Y6TA 2FOHA 3UR6A 1KYNA 2WPHS 1Z8RA 2BDBA 2KAIA 5L30H 1A0HB 4AFSA 5EU8A 3T29A 3GCTG 3M7TA 1AFEH 2K1QA 2AYWA 1C5YB 1LQEA 2BLOA 2QC2A 3SN8A 1YCPM 1Z71A 3UY9A 2ZDVH 4I31A 1C2FA 3M5MA 4I8JA 1C5SA 5HXFA 2JETB 3V0XA 2BTCE 1LHFH 1P3EA 5FBEA 1ZPBA 3O8DA 1ABIH 1FY1A 3SQHE 1GMHG 2ZIQH 4LXBH 3BN9A 4X1SU 2G5NA 1NFUA 4DJZB 3KHVA 1AGJA 1NTPA 2ZHDA 1V2VT 3PWBA 5GPIB 1KLJH 2V6NA 2HRVA 2VIWA 4IN1A 3SGBE 2AGGX 2ZEBA 1CGJE 1W7GH 1ZSLA 4ZMAH 3RLWH 3MH6A 1EJAA 4K8YA 3LC5A 1K1LA 2VB0A 1GHWH 4WXVA 2OC8A 3SI3H 1KXBA 1CT4E 2SGEE 4Y8ZA 2BY9X 1ZTLA 1KXDA 1TGSZ 2AS9A 2Z9KA 4Y79A 4F4OC 2ZFFH 3C1KA 2RG3A 1IQGA 1FIWA 3D65E 4B2BA 4Q7ZA 2PKAA 2OC7A 1H1BA 2QXJA 1DWCH 2ZQ2A 4ISHH 1S82A 2B0FA 4K8BA 1SVPA 3MU4A 1QJ7B 2H2ZA 3A7WA 1P05A 3CS0A 5E0GA 3RXPA 3ZZAA 5DP7A 5A09A 1F2SE 4NWKA 1Y3YA 1KLTA 3SORA 5E8EH 2ZFPH 4CR9A 1T31A 5TJXA 3A83A 2PKSC 3DA9B 1PQAA 1ZMJA 1ANCA 2BD7A 5T6DA 1MD8A 3EGKH 3T27A 1G2MA 2GZ7A 2J34A 3L3TA 5PTPA 3NK8A 1UVPA 1MZAA 5CE1A 1GMCG 3ITIA 2Z3EA 3MFJA 3URCA 1VCWA 1BDAA 4GCHG 2QA9E 2ZHFH 1D9IA 1C2EA 1LQDB 5IDKA 1SSXA 4RSPA 1GI8B 2PWXA 1UO6A 3CENA 1KDQB 1OKXA 1DT2A 5FHTA 1C5QA 4OS6A 4Q7YA 3UR9A 3SUFA 3AAUA 3ZVEA 1EJNA 4TPYA 3V12A 5FXLA 1GCTC 2Y7XA 1KLIH 4WJG2 4K1SA 3LGVA 1O3DA 1P12E 2BY8X 3F9GA 4BAQB 4FXGH 3ZZBA 5GJ4B 4X6MA 1BRAA 3A81A 1G37A 4NWLA 1EZXC 5C67A 2PFEA 1YPJH 1NFXA 2OUAA 4GAWA 2ZI2H 2XWAA 4LOYH 4X1RU 6CHAC 4FUBA 2OP9A 1C1QA 1GBFA 2BDIA 1ZPCA 2G8TA 3U1JB 1QCPA 4GSOA 4HI3A 5T3HA 1XUGA 4Y7BA 1BJVA 4E7RG 1O2KA 2ZHQH 1E35B 2BD9A 4WMDA 1UTQA 1QHRB 4Y8YA 3VGCC 1GJDB 3Q3YA 2NU2E 2AMPA 3OTJE 1JIRA 2GD4B 2FLBH 4TYDA 1T8OA 3ATWA 1N8OB 2STBE 4MNVA 4RKJB 1OWDA 5K0HA 3SJ9A 4AYVB 2TGAA 3FAOA 1UHBA 4X6NA 1Q31A 1SGFG 1AB9B 2G81E 1AFQC 4HTCH 4KGAA 3OYPA 5JBTA 4YT7H 1OWIA 1QL7A 2GX4A 2GT8A 1OP8A 2PGQB 1BRBE 1HJ9A 3PLKA 1SLXB 2VIDA 2G4TA 1T32A 1UTNA 3LONA 2ZECA 1NU9A 1G3EA 4Z6AH 2STAE 2C93B 1P2QA 1K1PA 3NKKA 3SU4A 4CBOA 3SV8A 3VB3A 2SGQE 1N6XA 3RXFA 4MPWA 1E34B 1HAXB 1BRCE 1SL3A 3BTHE 3ZZ3A 1LPGB 3A86A 1TGBA 3F6UH 2TIOA 4FU8A 4IGDA 4K60A 1P2MA 2ANMH 1GHAF 1ORFA 2Z6BD 1GMHF 2ZFRH 4B71A 1VGCC 3RXJA 7GCHG 1CHGA 1BJUA 3GY3A 1XUFA 1WOFA 3QDZB 3L33A 3VB5A 3PTNA 2FX4A 1O3HA 2OCVB 4AG1A 1IQIA 3RDZA 2C8YB 1P11E 3HK3B 1RTKA 2UUFB 1MH0A 1LHDH 1ANBA 1KSNA 3BF6H 3LOXA 1C2JA 5A8XA 4CRAA 2QF0A 4I32A 4B73A 1XKAC 3LT3A 1F5RA 8KME2 5A2MH 3FFGA 1Z8GA 1WU1A 1G30B 1UTKA 2A7JA 2P95A 1QFKH 1A2CH 1NFYA 1BT7A 3GYLB 1UVTH 4ABGA 3STJA 3TU7H 1AUTC 1P0SH 1ZOMA 1C9TA 4BAHB 1P01A 7KMEH 4Y6DA 4ABDA 2Y80A 1MKWH 1ZSKA 1C5LH 2IPHA 1SLWB 3P8NA 1S6FA 4ZHMU 1A0LA 4I7YH 4H6SB 1MU6B 3RLYH 1P2KA 1V2QT 2PR3A 1O3MA 4B2AA 5EXMA 1VZQH 1CGIE 2ZPSA 2SNVA 2OC1A 4B74A 1MTNB 4UE7H 4FU9A 1W10U 1SFIA 1HLTH 1K21H 3E91A 3N7OA 3V13A 2AFQB 3EA8A 2FEQH 1SGFA 1OS8A 2ZNKH 5HMAA 3EE0B 4I33A 1DX5M 5GCHG 1P2IA 4JYVH 3IG6B 5AHGH 2NU1E 3U69H 3VXFH 1KXFA 2CHAC 2OXSA 2HLCA 5JDUB 3A87A 3QGNB 1EP6A 1MD7A 1PPBH 1VR1H 1V2OT 1PYTD 1UK2A 1Z8IB 1A7SA 4MDSA 1ETTH 2J9NA 4BNRA 1N1LA 4ABAA 1CBWC 3U8RH 2W26A 3S69A 3SW2B 3A8AA 1GJ8B 3ZVCA 1P8VC 2PTCE 1SOTA 1TNJA 1SGCA 2QCYA 3ZZ7A 4CHAB 1O3PB 4UONA 2ZU5A 1CQQA