1LKAA

Porcine pancreatic elastase/ca-complex
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
240
structure length
240
Chain Sequence
b'VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Elastase 1
publication title Metal binding to porcine pancreatic elastase: calcium or not calcium.
pubmed doi rcsb
molecule tags Hydrolase
total genus 61
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2002-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1lkaA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1lkaA01
4HGCA 1MMJN 2JETB 2Z6BD 2C3SA 4FUBA 3D62A 3ZZ5A 3H7OA 4BAQB 2OC7A 1IHSH 3URDA 6CHAB 5FPYA 2ZGXH 4AFUA 9LPRA 1K1IA 1P0SH 2VVVA 3M7TA 1O3EA 3UWIA 1QB6A 3UNQA 2ZHQH 1EB2A 2BD4A 1UTQA 1B0EA 1OP0A 2TRMA 1THSH 2A5IA 3A8DA 1AU8A 1K1NA 3ODDA 3HK6B 4AFSA 2NU4E 1MAYA 4H42U 1E37B 3CENA 1TNHA 3F9EA 2FOCA 1O2IA 3H5CB 2XBVA 4X6NA 3T25A 2D1JA 1D6RA 1A0JA 1MBMA 4LZ4B 1XUJA 1O2SA 4GLYA 1NRNH 1XUGA 4KTUA 5CMXH 1JOUB 3PM3A 1GGDB 1PPZA 1Z8IB 4CR5A 1BJVA 3BEFB 5IDKA 2FS8A 4FUDA 5JDUB 1WQSA 2ZEBA 8KME2 1EOJA 1IQKA 1SG8B 1GBHA 1QRWA 3KQCA 5DP8A 5L6NH 4WF8A 3HATH 3BF6H 1K1MA 4ABEA 2QXHA 1V2KT 2QXIA 1NU9A 3P8GA 3MNXA 2ZDKA 4X8TH 1C1OA 3A81A 3PMAB 1HNEE 1YPEH 2OTVA 3STIA 5A8XA 1KXAA 4FU8A 1QGFA 4WMFA 3ZZCA 3M37A 2SFAA 2OXSA 1YYY1 1ZMJA 1XUFA 1CA0B 1Z6JH 1BCUH 2R9PA 1OPHB 1TABE 1NS3A 1W11U 4TWWA 1XVOA 4MQAA 4Y7BA 1TX7A 2CV3A 1C5TA 2PHBA 3SU3A 1DE7H 1B7XB 1KLIH 1NRPH 1O3NA 1O30A 2UWPA 1WUNH 1J9CH 2XC5A 4NWKA 3SUEA 4X8SH 1Y3YA 4I8HA 5LPRA 2ZI2H 3BTEE 3DHKH 1JWTA 1UMAH 2Q1JA 2H2ZA 1TPAE 4Y0ZE 1F0RA 1HFDA 4X6MA 2BDAA 1NZQH 2G5NA 1D4PB 4RKOB 5DPAA 1IHTH 4DGJA 2Y82A 1O2GH 1NRSH 1NROH 2VB0A 4FUHA 2XYAA 1CT2E 4A6LA 2ZF0H 4B76A 3RM2H 2P93A 2GD4B 3SBKA 1YBWA 1O3BA 2W26A 4JZIA 1O2HA 1O3LA 1GBAA 1QA0A 1F5LA 1L0ZA 3K6ZA 3PYHA 4X6PA 1GI3A 3A80A 3SNCA 1C5XB 5AF9H 1KYNA 1SLUB 2G8TA 2VWLA 2ZGHA 4SGBE 2BZ6H 1TQ0B 4IBLH 1QURH 3MU1A 2P8OB 1SQTA 1V2OT 2PTNA 1GI8B 1V2MT 3TJUA 1TGSZ 1NFXA 1A0HB 4WH6A 4B74A 4ABHA 3GCNA 3A86A 3TK5A 1PPCE 1C1RA 5CHAB 4Y10E 1ARCA 1MKXH 3Q3KA 1AUJA 1UK4A 2ZZUH 3NUMA 1T7CA 1V2ST 1VCQA 3EYDA 5EXNA 4LK4A 3AASA 4GCHF 1Y5BT 4FUCA 1AQ7A 1PPBH 5A2MH 3PTNA 3UQVA 4BNRA 1O2UA 5C1XA 3RMOH 4DW2U 5JBCS 1KDQA 1A1RA 1MQ6A 1CBWC 3C27B 4Q2KA 3E0PB 1BHXF 3GCHC 4NIVA 3OY6U 1K1JA 3PROA 1N6XA 3T5FH 1UHBA 2VU8E 1O3DA 1XUKA 3P8OA 1FY3A 1V2QT 4O03A 2GT8A 1BMLA 3GDUA 4R0IA 1O2XA 5BRRE 1TGTA 3LGYA 2C4FH 1XVMA 3RM0H 1E35B 3E0NB 4NIWA 1MTVA 3EA8A 1O36A 1EZUC 3OU0A 3O8CA 3R3GB 4DVAU 3RXVA 5LPFA 1O3AA 3GY8A 1TNLA 4X1SU 1YPMH 3RXRA 1TPPA 1YPJH 1E0FD 1VITF 1ZRKA 2ZFTA 1QFKH 1PPFE 4CREA 3I29A 1FAXA 1FN8A 1GJDB 3NK8A 1ZSLA 1YCPK 1MTWA 1C4V2 4BTIB 2A4OA 1AO5A 3S9CA 1O31A 1O37A 2PFEA 1GHBF 1LVMA 2Q6DA 5ABWA 3LC3A 3VFEA 3RMMH 3RLWH 4JYUH 1TOMH 1K28D 2C8ZB 1KIGH 1ABIH 4Y71A 4E05H 1YLCA 2O8MA 3BEIB 4UDWH 1YPHC 2WPLS 5EPYA 1FIWA 5F03A 4B2BA 2A32A 5C20A 2ZWLH 2KAIA 3BG4C 2HALA 3T29A 1KSNA 1QY6A 2BY8X 2BQWB 1UVOA 3VB7A 2O8UA 2H6MA 1T8LA 2QGRA 4ABGA 1WSSH 6GCHF 2XNIA 2BLVA 3MHWU 2J95A 2Z3DA 4NCYA 8GCHF 1J14A 2FOMB 1ZSKA 4U2WA 3V7TA 3ZZBA 1P2QA 2HWLB 1GJ7B 4FVBA 3BIVH 3L6PA 3TH3H 2OD3B 1MBQA 4CRGA 2I6SA 4K60A 4CRCA 4D8NA 2P3FH 2BMGB 1HAPH 3TITA 2J34A 1QL8A 4AOQA 1ZPCA 1CA8B 3ZZ3A 1ZHPA 2D2DA 3M7QA 4FUEA 2H5CA 1QB9A 2ASUB 2Y7ZA 2FTLE 2ZA5A 4FUGA 3MH7A 2AIPA 1THRH 1P2KA 2IPHA 4OS6A 1GJ8B 3QO6A 1TNIA 1P57B 1GVZA 3Q77A 2BLOA 4AGJA 4DJZB 2VH6A 5E0JA 3TIUA 2C8WB 5EPNA 2BD8A 1HAZB 5C5NA 1OOKB 1T4UH 1TRMA 2G5VA 1EOLA 1GBLA 3U1JB 1AIXH 3ENSB 3TK9A 1ZGVA 1C2JA 1W0ZU 3MNCA 4MNVA 1O2KA 3SQHE 1PYTC 1TA2A 2Z94A 1O3GA 5K7RA 3NXPA 1TBQH 1HYLA 2B8OH 2Z9LA 5JBAS 3Q00A 1GHYH 3PV4A 1W7GH 2K1QA 3BG4B 1OWHA 2ZHFH 1O38A 1S0RA 3D49H 1E34B 1NY22 4LZ1H 2DUCA 3RXSA 3TJVA 3RLYH 2PSYA 4DURA 1AZ8A 2G4TA 1SL3A 1QL9A 1TYNA 2SGFE 1FONA 4XE4A 3PLBA 1O2TA 1Z1IA 1UVPA 4AG2A 1YPLH 1V2LT 1GBIA 1OWKA 2ZCKP 3V12A 3O8BA 2CHAC 2RA0A 1XUHA 3UY9A 2ZDNA 2VIDA 5AFZH 3MU8A 1GCTC 2SNWA 1BDAA 1NFYA 1MKWK 4NSYA 4ZHAA 4AYVB 5L30H 1O3MA 2ZGCA 2Z9IA 5H4IB 1V2RT 1XXFA 3VPKA 5T6DA 1ESBA 2GCTC 1EAUA 2V35A 2ZPQA 1QRZA 1SGEE 5DP6A 2VWMA 4JZ1A 4X1NU 3FZDA 2GV7A 1CGIE 5DO4H 1BMMH 1S0QA 2D26C 1UCYH 2F9NA 3SU4A 1C4Y2 1CHGA 5EG4A 2GP9B 3A7ZA 2XTTB 3QZQA 3ZV9A 6ESTA 2ILNA 4Y8YA 2BY5X 3ZZAA 4IW4E 1LHEH 1DOJA 4Y11E 2NU2E 2HPPH 1X7AC 2TIOA 1AB9B 4FU7A 1IQEA 2FTMA 3P17H 1V3XA 2FOBA 1P05A 2HRVA 3QUMP 1ELEE 1P04A 3A7VA 1C9TA 3OTJE 3SOSA 2ZCHP 2O9QA 3UPEA 1LVBA 4I8KA 1GBDA 2A4QA 1XKAC 1GMHF 1P09A 1BRAA 1ELAA 2QAAA 2ZU1A 2WV5A 4CBNA 2TBSA 1G36A 1DWDH 4ZKRU 3U69H 1GI7B 1F0UA 4INHA 1GCTB 5GCHF 4GVUA 3DFLA 1XMNB 1WBGB 3MH5A 3A87A 3PMJA 2J4IA 1SSXA 4JK5A 3E3TA 1YCPM 3HPTB 2AIQA 1BTUA 1TE0A 1SVPA 3QTOH 4AB9A 1PQ5A 2C8YB 1RGQA 3M61U 1AN1E 3I77A 3RUOA 2GCTB 4X0WU 1YKTA 1A5GH 2P16A 5EXMA 1C5YB 2FEQH 5A0AE 2G55A 4D76A 3K65B 4A5TS 1TBZH 4IMQA 1G3BA 1O0DH 2BY9X 2ZPRA 5FCRA 3W94A 4UD9H 1B0FA 3VB6A 1OWJA 1C1NA 1GHXH 3LU9B 4K8BA 1EPTB 4Y6DA 1GJ5H 1MKXK 3AW1A 3BTTE 1UVUH 1ZTKA 4BXSA 2VWNA 1T8OA 1TOCB 3SUFA 3A8BA 2XCNA 2ANWA 2F9OA 2ZO3H 3V0XA 1FY1A 1AVWA 4F49A 4TYDA 3RXLA 4ZKOU 1AY6H 4UFEH 1GDQA 1ANDA 3I78A 3U8OH 1C5QA 2C8XB 4I33A 4E7RG 1C5NH 1O2PA 3SZNA 2XW9A 4CR9A 1GG6C 1ZOMA 1AKSB 3VXEH 2FZZA 3SHCH 1EB1H 1Y5AT 2XWBI 1VJAU 4ASHA 2UWOA 1HAGE 1AMHA 3PWCA 1LVOA 2J38A 2WUBA 1O2MA 1TB6H 3ATIA 4CRAA 3F9FA 3S0NA 2P95A 4BTTB 4KELA 4NWLA 1SQOA 1DFPA 3AVZA 2B7DH 1BTXA 2ZCLP 5AVDA 2VIWA 1BRCE 2ZDLA 5FCKA 1ZGIA 1F92A 1OWDA 1ID5H 2ZDAH 2FLBH 4Z0KA 1L1JA 1O5FH 3S69A 1JRTA 3RU4T 1GJBB 5EU8A 5DP4A 2UUYA 1TWXB 7GCHG 1BITA 4CBOA 5EQQA 3WY8A 4H6SB 1LTOA 4JZFH 1Y3WA 1GHZA 1QJ7B 2ZKSA 3EE0B 1RS0A 2GV6A 3GCTF 3KHVA 4CH2B 2BOKA 3BTWE 1O5CB 2LPRA 3TNSA 2BLQA 1O33A 1THPB 1O2LA 2O8LA 3MU4A 4KTCA 3RC4A 3TPIZ 4AN7A 4CRDA 3A89A 1CU1A 1T32A 1P03A 2R2MB 3SNBA 1ZLRA 1GG6B 1HAOH 3P95A 1Y3UA 3M5LA 3R0FA 1TGCA 2HLCA 4B75A 4IC5A 1P01A 2Z9KA 2TGDA 2FI4E 3SGQE 1EJAA 3ZZ9A 2G4UA 3GDSA 1C5LH 1CA0C 5EQSA 3UR9A 2SGAA 1ZHRA 1G2LA 4DG4A 1FNIA 1GHWH 4TPYA 1ELTA 2PUXB 4MTBA 1ETSH 2FOEA 3QN7A 2ZTYA 4ABIA 3BV9B 1DDJA 4K1TA 4ZAEA 3LH3A 1WQVH 1GMDG 1OXGA 4XSKU 5AFYH 3FANA 3A84A 1GBMA 5FHTA 1UTMA 1MQ5A 2XC0A 3RXPA 3BTKE 2VNTA 3B23B 1ZJDA 3UOUA 5GDSH 1H4WA 1TBRH 1KXCA 1V2WT 5T3HA 1H9HE 4SGAE 2CF9H 1SGRE 2GZ7A 2CGAA 1LHGH 1S85A 4YOJA 3LGWA 4ZKSU 1S6FA 3EAJA 1JBUH 1O3CA 1WOFA 3A7TA 2Y5HA 7LPRA 1G3DA 1UTNA 1WU1A 3SNDA 4JZEH 3SU1A 2VJ1A 1NESE 2QF0A 1SGCA 5GWZA 3TJNA 1O3IA 3FP7E 1SLVB 2JH0D 2ZTXA 2B5TB 2Z3EA 3GOVB 2ZFFH 4DOQA 1ELVA 5HMAA 5FXLA 2A4GA 2P8OC 3RXKA 1VCWA 2A5AA 3FVFB 4ZKNU 4BTUB 4H6TA 1K2I1 5CHAC 3ZYDA 1ETTH 2AMPA 1AFQC 4B2CA 1ZHMA 1TNKA 1V6DA 2OC8A 1LDTT 2RDLA 3FP6E 1VZQH 3LC5A 3K6YA 4MPUA 3DA9B 1VITH 1GI0A 4IN2A 2SGPE 4AORA 1ZMLA 2QXJA 1S83A 4ZXXH 1ANCA 4NA7A 2QXGA 2HVXA 2GCHG 1YM0A 2WINI 5FPTA 1H9IE 1DS2E 2PKAB 3AAVA 1C5PA 4ABJA 1ACBE 1A7SA 1A3EH 3GCOA 2STAE 4YESB 1DSUA 1E36B 3RXMA 5DKMA 2BD3A 3IITA 3OY5U 3L3TA 2ZQ2A 2BQ6B 1UTLM 4JYVH 2BB4A 2ZC9H 2Q6FA 1UCYK 2BY7X 1MU8B 1TLDA 1PFXC 2AGIX 1Y59T 3GICB 3QWCH 1W10U 1TMBH 5EW1H 2CJIA 1OKXA 2FOAA 3QDZB 3QX5H 3MO6A 4BANB 4D7FA 1LCYA 2BDIA 1HV7A 1EXFA 1GI1A 3GY4A 4ISIH 1WCZA 4Y8ZA 2BD7A 1T8MA 2FLRH 1AGJA 1MCTA 3EA7A 5T6GA 1LQEA 2R0LA 1WAYB 4YLUA 2TGPZ 4HZHA 5HXFA 5A0BA 1AFQB 4GUXA 1CHOG 1XUIA 4ABDA 1C5ZB 2ZFRH 3T26A 2GDDA 1LKAA 1FUJA 2RG3A 3MO9A 1BRUP 5F8XA 4AFQA 1IQFA 1OP2A 5JBTA 5BPEA 3E6PH 4B73A 1GBBA 1A3BH 1DUEA 1Q31A 2QN5T 1UTKA 3SU5A 1ELCA 1BBRH 1EAXA 3SGAE 4MNWA 1GHVH 4E06H 2W7SA 4U01A 1GHAG 3MTYA 3PWBA 3NWUA 1EPTA 4FUIA 3U8RH 1GJ6A 3M3SA 1QBNA 3MU5A 2PLXA 2BHGA 2F91A 7KMEH 2OUAA 2D8WA 3M3VA 5DP3A 3RXTA 4OS2A 5I25A 2WYJA 3LPRA 3RDZA 3LDXH 5L2YH 1EJNA 1BBRE 2EEKA 1HPGA 1AHTH 1GI5A 1HXEH 4UFFH 1EQ9A 3MH6A 3FP8E 1UTOA 1O3JA 4H4FA 3E1XB 1BQYA 1GI2A 1NC6A 5DP5A 1MUEB 3UWJH 3P8FA 3LONA 1LPGB 1S84A 1P2OA 1AKSA 1IQLA 2YNBA 3M5NA 1MTNC 1MH0A 3TGKE 1HAYB 1G2MA 3RXQA 4O3TA 1NO9H 2FS9A 3F6UH 1RJXB 5EQRA 5FX6A 1QRXA 4XOJA 2P3UB 1GJ4H 4JZDH 2ZHDA 2V6NA 1P2JA 1O39A 1H8IH 4XBCA 1MD7A 1KTSB 2Y80A 2PSXA 2H9TH 2PV9B 4YT6H 1J15A 3TGIE 3O8RA 1GHBG 2BX3A 1WTGH 5DGJA 4KKDA 3EQ0H 3SUDA 1GDUA 3BG8A 1PYTD 4I8JA 2AH4X 1DVAH 2EC9H 3F9HA 3LIWA 3UIRA 1DPOA 4MNXA 2HPQH 1J17T 1C5SA 1YGCH 1W2KH 3RMLH 3VEQB 2BXTH 1SGYE 3ZZ6A 3W95A 1UTJA 2WPHS 3BSQA 2ZGBH 4JMYA 1W13U 2W3KA 3ITIA 1ZTJA 5JB8S 2BVSH 1LHFH 2AGGX 3RXGA 4I8LA 1MU6B 1GJAB 3ZVEA 3RXDA 2PW8H 1O2YA 2F9VA 2G81E 1O5EH 4YT7H 5JYIA 1C2KA 2LNCA 1HJAC 3DUXH 1DSTA 4PROA 1N8OB 1W8BH 3RXIA 1F0SA 1BTZA 1T31A 2BD9A 4JCNA 1Y3VA 1MTNB 2WPJS 2FESH 2HNTC 4X1RU 3SN8A 1P2MA 1O5GH 3HGNA 3SJOA 3KN2A 3PTBA 4D9RA 4X8VH 3SJ9A 2JH6D 1XX9A 1TONA 3SV2H 1GMCF 1GBJA 2FPZA 4Y7AA 4OS4A 1S6HA 4WH8A 1MCVA 1ZJKA 5A0CA 4CRFA 1SQAA 1DY8A 4J1YA 1AB9C 1P2NA 3SNAA 1YC0A 3BTME 4UONA 1OYQA 1SGIB 1VJ9U 1CE5A 4K1SA 3AW0A 4RKJB 3KGPA 4MPXA 1C5UA 1ORFA 1G37A 1K1LA 1PJPA 1TNJA 1LVYA 2G51A 4XBDA 3FZZA 4WMEA 2Q6GA 3SGBE 4JK6A 3T27A 3KIDU 4OS7A 2WPKS 4OS5A 1S81A 4KTSA 3QK1A 1C4U2 2FOGA 1TX6A 4AX9H 1SBWA 1Y3XA 1HAHH 4BAOB 1ESAA 1V2UT 4K1EA 1HJAB 4ZROA 1C1UH 4THNH 1QNJA 3MNBA 2TPIZ 2R3YA 3MYWA 2UUFB 1BB0B 4KGAA 1DLEA 3A8CA 2FIRH 3N7OA 4X6OA 1O5AB 2A1DB 4ZXYH 4NFFA 4FU9A 2P3TB 1YF4A 1K21H 1FLEE 2J2UA 3DFJA 1CSOE 1DITH 2PR3A 3MI4A 3LOXA 3MO3A 1PPHE 1C2FA 2OBOA 1ZPBA 2ANKH 2XWAA 1UVTH 4Y8XA 3ELAH 4GSOA 2FX4A 1O5BB 1HIAB 4X1PU 1IQHA 1HB0B 4YOIA 3ODFA 2DE8A 1VR1H 3BEUA 1CT4E 2PKAA 1EPTC 2Y5GA 3SI3H 2FODA 1SPJA 2GT7A 4VGCB 1UCYE 4TY7A 8LPRA 3T28A 5G4BA 2V3OH 3LKWA 5HM2A 3LT3A 2GKVE 2UWLA 4J2YB 1DX5M 5FX5A 3U1IB 1P3CA 2TGAA 3ZVCA 2ZG0H 1OYTH 4INLA 5FPSA 2ZHWH 1ETRH 1QJ6B 1K1PA 2BQ7B 1GCDA 2A7CA 5JB9S 3A7XA 1V2NT 4WJG2 1GMHG 1BZXE 1A2CH 3TH4H 3SI4H 1HXFH 2FMJA 3TJOA 3P6ZB 2R0KA 2GX4A 2O8TA 3CP7A 1K9OE 2BVRH 2FI3E 4MG3A 1RRKA 3A8AA 3BTHE 2BLWA 4RN6A 1NRQH 3MWIU 2YNAA 1TX8A 1W3CA 5GJ4B 2FI5E 1C5MD 4AB8A 1HDTH 1D3DB 1EX3A 1JMOH 3SW2B 1BTYA 4JYTA 1GBKA 2F9UA 3A85A 1P8VC 5B6OA 4Y76A 1TRYA 1Z8JB 1YPKH 4Y0YE 1HJ8A 1RTLA 2PKSC 2J92A 4LXBH 2XBWA 2A7HA 4AFZA 3MU0A 4BAKB 2Z7FE 2VVCA 1J8AA 4X2WA 1CGJE 3B9FH 1BTWA 2IOTA 1C1MA 4B71A 1GBCA 2EI6A 3SJ8A 2A4RA 1IOEA 1G3CA 4WXIA 2BZAA 1DXPA 1MD8A 2IJOB 2ANMH 3M35A 3VXFH 1KXEA 1CGHA 4IGDA 4GHQA 1BBRK 1FAKH 3UNRA 4AYYB 2ZECA 4X1QU 5CE1A 4BOHA 5DK1A 4HI3A 4E7NA 1HBTH 4UFGH 1Z6EA 4A1XA 1AWHB 1JXPA 3BTDE 1FZZA 1FPHH 1GL1A 1O34A 3RXHA 1W14U 3ATLA 2FOFA 1MTUA 1OS8A 1Q2WA 1KXBA 3V3MA 7ESTE 4I32A 4FUJA 1D6WA 4OGXA 1ZRBA 2HNTF 1SGTA 4U30A 4X2XA 3PO1B 2FO9A 2V0BA 1QTFA 3VB4A 2PKSB 4ISNA 1ARBA 4K69A 3QGNB 1D3TB 3S7KB 4KP0A 3ZV8A 1QIXB 1LPZB 1FDPA 2QIQA 1C1SA 2UUKB 2OINA 1G30B 2ZFPH 1BMAA 1Q3XA 7GCHF 5EOKA 2RA3A 2XBYA 5E2PA 3B8JA 3D65E 3KL6A 1B5GH 3RXJA 3TLOA 3LH1A 3UQOA 4TY6A 5ESTE 1BUIA 5C1UA 2ZDVH 2ODYB 1JIMA 4XDEA 1ZMNA 2CF8H 1FY5A 1GJCB 1TFXA 2VIPA 3GCTG 4LOYH 3ZZDA 2BM2A 2PUQH 2AGEX 1EZXC 5ETXA 4A1VA 2BDBA 1Z1JA 1GVKB 1GL0E 1QQ4A 4A1TA 1GVLA 2AMQA 4QT8C 3SV9A 2P59A 5C1YA 3ZVFA 2WYGA 1P06A 4ZUHA 1AE5A 3Q76A 2ZU5A 3GY2A 2XXLA 1O2RA 4NZLA 1ZPZA 1BJUA 5FBIA 1BTPA 4WMDA 3TGJE 4WXVA 1LKBA 3ZYEA 1NN6A 4K2YA 3SQEE 2PWXA 3OYPA 1F7ZA 5J4SA 1KY9A 1DWBH 3EA9A 3MMGA 2EI8A 1BIOA 1GMDF 1RFNA 1FN6A 1QBVH 3RXBA 2VINA 1SFIA 4A7IB 1O32A 3ZVGA 1WV7H 1QHRB 3M5OA 2VIVA 2M5TA 1BHXB 3RXFA 1UO6A 1Z71A 1Z8GA 1NT1A 4OS1A 1TGNA 4I8GA 4WVPE 1RIWB 5A8ZA 4X2VA 1O3HA 1Y5UT 2C90B 1C2IA 4F4OC 3UUZA 1K1OA 1S82A 1HGTH 1N1LA 3UNSA 6LPRA 4MLFB 5E0HA 1FY8E 1MKWH 3OX7U 4Z6AH 3JZ2B 1C5WB 1K22H 2OLGA 4NA9H 3CS0A 5T6FA 2J94A 3K2UA 3KNXA 1LQDB 1SB1H 2AEIH 3BTGE 3STJA 3TH2H 2H5DA 3MH4A 1LHDH 4X2YA 1HRTH 5K0HA 4XFQA 1Z7KA 1Y8TA 2F3CE 4CRBA 1OWEA 1L1NA 1KTTB 3M3TA 5J4QA 1L4DA 1NFWA 3P92A 1GWAA 4ZMAH 2Y6TA 1O35A 1EATA 1C5OH 2TGTA 2F83A 3VGCC 1A5IA 3SV8A 2ZU2A 4M7GA 1IQGA 3QGJA 2NU3E 1ZTLA 5E0GA 5DG6A 1LMWB 1C2HA 3GY5A 3KCGH 2XCFA 3M7UA 1FPCH 1WTHD 1W0YH 1ANBA 1SHHB 2GCHF 1RD3B 2JKHA 2BVXH 1A61H 3PMHB 1HIAA 4D7GA 1FV9A 1OSSA 2Z9JA 3F9GA 1SLWB 2WV4A 2ESTE 4MPVA 4ISLA 1P9UA 3VB5A 2ZNKH 1O2OA 3PLPA 2NU0E 2BD5A 2W3IA 1ELGA 1NTPA 5E8EH 1A46H 2OC0A 1TPOA 1RXPA 4YOGA 1O3PB 1PQ7A 1SGNE 2QA9E 2QY0B 4DIHH 2VGCC 1PQ8A 2CMYA 4UFDH 1QB1A 3F1SB 1AVGH 3SJKA 2F9BH 1YLDA 4O3UA 3SNEA 3ZZ7A 5HGGA 3FAOA 3PB1E 3SORA 1HAXB 2BDCA 3UFAA 2BOHB 5ESBA 1SGPE 1O3KA 1HJ9A 3V13A 1MTSA 2B9LA 1F2SE 1CT0E 1SGFG 2O8WA 4BXWA 1BTHH 4DY7B 1BMNH 5GXPA 5C67A 4ABBA 1DWCH 1NU7B 1L1GA 1P12E 1RTKA 4ESTE 3AAUA 3VGCB 3S9AA 5L2ZH 1CHOF 4DIIH 1KXDA 1TMUH 5EW2H 3QTVH 1OWIA 1WYKA 3GYMA 3ESTA 4WY3A 3U98H 1DM4B 2H9HA 2BDHA 2A2QH 5EGMA 2GDEH 1TGBA 4GCHG 1DANH 2BXUH 1ABJH 3T62A 2A5KA 3HKIB 1NM6A 4D9QA 3S7HB 1LHCH 5FAHA 4HTCH 1ELDE 2FYRA 1GHAF 1G9IE 3RU4D 1PPGE 4UE7H 5C2ZA 2HOBA 3Q3YA 4IN1A 1YP9A 1UJ1A 1F0TA 2G52A 5HM9A 1GI6A 2GZ9A 2VGCB 3K9XB 4UEHH 1GJ9B 3TK6A 8ESTE 3GY6A 3KEEA 1N8OC 1XXDA 3SV6A 1XKBC 1V2TT 1ZYOA 3UOPA 1T4VH 1JRSA 1V2JT 1SGQE 1U6QA 3NPSA 1NFUA 5SGAE 1DXWA 2FWWA 5F6MA 4GHTA 1AZZA 5E2OA 1BRBE 4FXGH 1AVXA 3ATKA 4YZUA 3HK3B 1EP5A 1P9SA 5DJ7A 2OQUA 1TALA 2GGVB 2SNVA 5LGOA 1D3PB 3PMBB 2A7JA 3Q3XA 1DICA 1O2QA 1VITG 1HAVA 4NIYA 4Y79A 1ESTA 3VB3A 1SLXB 2R3UA 3URCA 1A4WH 3D23A 3A82A 3TNTA 5C3NA 1W12U 2FDAA 2BX4A 2ZFSA 4HFPB 4DCDA 4CH8B 2A31A 1TQ7B 2QF3A 4MDSA 4R8TB 1E38B 1H9LB 1D3QB 3GY3A 3SV7A 3LJOA 1P2IA 1FY4A 4CHAC 1TA6A 1C9PA 3MFJA 2AS9A 5FBEA 1TAWA 2QV1A 1O2ZA 3UTUH 4ZH8A 3QLPH 4DT7B 5HYOA 1IQJA 3E8LA 1DUAA 2VVUA 3QZRA 4ISOA 1CBWB 1ZSJA 2ZU3A 3LGVA 4AZ2B 3GCHB 1IQNA 5PTPA 3ATMA 2ODQA 1CQQA 1O2NA 2H1UA 1A0LA 3HKJB 6GCHG 4B2AA 1GDNA 1XM1A 8GCHG 2F9PA 3L33A 1UVSH 2OP9A 2WUCA 1GI4A 4TWYA 4YLQH 1C2EA 1CVWH 1O3FA 1J16A 3LGIA 1SGFA 1BT7A 2P94A 3IWMA 1OX1A 2VH0A 3M5MA 3E16B 4GPGA 2FM2A 2OQ5A 4A92A 1HLTH 3RXOA 2AMDA 5JBBS 1RTFB 1YPGH 3NZIA 1ANEA 3BN9A 2AFQB 1TRNA 2AYWA 3RXAA 1A5HA 1GMCG 2BTCE 3EDXB 1EAWA 4YO9A 4VGCC 3JZ1B 4CHAB 4AG1A 2SGQE 4XBBA 5LPEA 2FYQA 4O9VA 2ZP0H 2BYAX 1AD8H 1FQ3A 2QCYA 1JIRA 3BIUH 2ODPA 3NKKA 4ISHH 1FMGA 2R2WU 2VIOA 3H7TA 3UR6A 2JH5D 1TPSA 5F8ZA 1C2LA 1AI8H 3ATWA 2OCVB 4NFEA 3GYLB 1QQUA 4MVNA 4Q7XA 4ABFA 1H1BA 2PTCE 2WPIS 1MAXA 2BD2A 1T8NA 1TIOA 3TVJB 2CXVA 1UTPA 1MZAA 2ALPA 2IN2A 1LPKB 1O2WA 1O5DH 2NWNA 4NIXA 2DE9A 4MNYA 2FOHA 3ZVBA 4ZHLU 1YPHE 1GI9B 1O2JA 5TCAA 2Z3CA 4U32A 1AWFH 1C1QA 1O2VA 1KXFA 3RU4E 2XRCA 3SU6A 1DWEH 3M36A 4NG9H 1C1PA 1SFQB 2GZ8A 3CS7A 2ZQ1A 4NZQA 1ELBA 1AUTC 1EZSC 1C1TA 5EODA 2QYIA 5F8TA 5TJXA 4IS5A 1GBTA 2BY6X 1EKBB 4K5ZA 1INCA 4Q7ZA 5A8YA 3U8TH 2HGTH 5LH8A 4B1TA 2CN0H 3ZZ8A 1ELFA 1FJSA 3O8DA 3MNSA 3SUGA 1IAUA 3SJIA 1HCGA 3TU7H 1DY9A 2W5EA 3A7YA 1P10A 1C5RA 3KQBA 4K3JA 1S5SA 1PQAA 3KQDA 1DT2A 1MZDA 2HNTE 1C1VH 3ZVAA 2V3HH 4IC6A 2ALVA 5TCCA 1EAIA 2ZGJA 2AERH 4ABAA 1P3EA 1V2PT 2CHAB 4Q7YA 2ZHEH 1EUFA 4ZHMU 3P70B 4INKA 2ZTZA 5GCHG 1VGCC 3KQEA 2SGEE 3RC6A 2BDYA 1SHYA 2PGBB 5AHGH 1HUTH 1AE8H 1DLKB 4MPWA 5DP7A 3LGTA 3ZZ4A 3RXUA 3A83A 1TMTH 5A09A 2W7UA 5DP9A 1NPMA 3PO1C 3DT0H 3F68H 3UREA 4YM9A 1EZQA 2GMTC 3SO3A 2Y5FA 3P8NA 1OP8A 2ZDMA 1IQMA 3LJJA 1GPZA 1D9IA 1IQIA 1G3EA 3FFGA 2GVFA 1P11E 2WPMS 1F5RA 3DD2H 3C1KA 3LGUA 1C2GA 1KDQB 1L2EA 1QA7A 2BDGA 1SOTA 1L4ZA 1F5KU 1TNGA 2ANYA 3EGKH 1PPEE 1GBEA 1O3OA 2XBXA 3RC5A 2UUJB 3ZVDA 1QJ1B 1QL7A 2FX6A 1ZZZA 1EJMA 2FXRA 4NA8A 1SI5H 1UHBB 1V2VT 1SGDE 2EA3A 2Y81A 4YTAA 4FVDA 1C5VA 2A2XH 2C93B 2STBE 2A0QB 1EP6A 1YCPH 1CO7E 2ZIQH 4O97A 3T2NA 2ULLA 2VWOA 4Q80A 4GAWA 2FP7B 4K8YA 3E91A 1C2MA 1VGCB 1SOZA 1HAVB 4WWYA 1M9UA 1BOQA 1UK3A 5JPMH 1KLJH 1EASA 1QBOA 1VCPA 2GTBA 2VIQA 2YOLA 2RCEA 2JETC 3PLKA 2A45B 4X8UH 1G32B 3U9AH 2J9NA 4TPIZ 2GMTB 2Z9GA 6CHAC 1BA8B 3A7WA 3HGPA 3BTFE 2NU1E 1Z8RA 4I7YH 2G00A 1SC8U 1H8DH 3IG6B 3OSYA 1N6YA 1SMFE 3E90B 4OGYA 3RXEA 4NSVA 2XC4A 3RXCA 4BAMB 2ZU4A 2OC1A 3SU0A 1RIWC 1AFEH 3SHAH 2KAIB 3A88A 5EXLA 4RSPA 3GY7A 3MOCA 2B0FA 1LO6A 4BAHB 3G01A 1FI8A 1SR5C 4NGAH 3NCLA 3S9BA 4I31A 5GIBA 3BTQE 2ZPSA 3GDVA 5IYTA 1KLTA 1QR3E 2Y7XA 3KF2A 1NRRH 1QCPA 1W7XH 3RMNH 5I46H 2I6QA 2PGQB 1ZR0A 2SGDE 4AGKA 1GGDC 1FIZA 2H9EH 2ZFQH 9ESTA 5GPIB 2EI7A 1P02A 5C5OA 1C2DA 1FXYA 2OBQA 3GISB 1C1WH 1HAIH 3SU2A 2QC2A 1UK2A 1GBFA 3RP2A 4FUFA 2THFB 4IMZA
chains in the Genus database with same CATH superfamily
4HGCA 1MMJN 2JETB 2Z6BD 2C3SA 4FUBA 3D62A 3ZZ5A 3H7OA 4BAQB 2OC7A 1IHSH 3URDA 6CHAB 5FPYA 2ZGXH 4AFUA 9LPRA 3AK5A 1K1IA 1P0SH 2VVVA 3M7TA 1O3EA 3UWIA 1QB6A 3UNQA 2ZHQH 1EB2A 2BD4A 4RT0A 1UTQA 5CDFE 1B0EA 1OP0A 2TRMA 1THSH 2AHME 2A5IA 3A8DA 1AU8A 1K1NA 3ODDA 3HK6B 5HIZA 4AFSA 2NU4E 1MAYA 4H42U 2QF5A 1E37B 3CENA 1TNHA 3F9EA 2FOCA 1O2IA 3H5CB 2XBVA 4X6NA 3T25A 3PRDA 2D1JA 1D6RA 1A0JA 1MBMA 4LZ4B 1XUJA 1O2SA 4GLYA 1NRNH 1XUGA 4KTUA 4ACBA 1JOUB 3PM3A 5CMXH 1GGDB 1PPZA 1Z8IB 4CR5A 1BJVA 3BEFB 5IK2D 5IDKA 2FS8A 4FUDA 5JDUB 1WQSA 2ZEBA 8KME2 1EOJA 1IQKA 1SG8B 1GBHA 2M2AA 2J5UA 1QRWA 3KQCA 5DP8A 5L6NH 4WF8A 3HATH 3BF6H 1K1MA 4ABEA 2QXHA 1V2KT 2QXIA 1NU9A 3P8GA 3MNXA 2ZDKA 4X8TH 1C1OA 3A81A 3PMAB 1HNEE 1YPEH 2OTVA 3STIA 5A8XA 2K8IA 1KXAA 4FU8A 1QGFA 4WMFA 3ZZCA 3M37A 2SFAA 2OXSA 1YYY1 1ZMJA 1XUFA 1CA0B 1Z6JH 1BCUH 2R9PA 1OPHB 1TABE 1NS3A 1W11U 4TWWA 1XVOA 4MQAA 4Y7BA 1TX7A 2CV3A 1C5TA 2PHBA 3SU3A 1DE7H 1B7XB 1KLIH 1NRPH 1O3NA 1O30A 2UWPA 1WUNH 1J9CH 2XC5A 4NWKA 3SUEA 4X8SH 1Y3YA 4I8HA 4ACAA 5LPRA 2ZI2H 3BTEE 3DHKH 1JWTA 1UMAH 2Q1JA 2H2ZA 1TPAE 4Y0ZE 1F0RA 1HFDA 4X6MA 2BDAA 1NZQH 2G5NA 2W6JD 1D4PB 4RKOB 5DPAA 1IHTH 4DGJA 2Y82A 2KX4A 1O2GH 1NRSH 1NROH 2VB0A 4FUHA 2XYAA 1CT2E 4A6LA 2ZF0H 4B76A 3RM2H 2P93A 2GD4B 3SBKA 1YBWA 2JJ1D 3FN8A 1O3BA 2W26A 4JZIA 1O2HA 1O3LA 1GBAA 1QA0A 1F5LA 1L0ZA 3K6ZA 3PYHA 4X6PA 1GI3A 3A80A 3SNCA 1C5XB 5AF9H 1KYNA 1SLUB 2G8TA 2VWLA 2ZGHA 4SGBE 2BZ6H 2QF4A 1TQ0B 4IBLH 1QURH 1SKYE 3MU1A 2P8OB 1SQTA 1V2OT 2PTNA 1GI8B 1V2MT 3TJUA 1TGSZ 1NFXA 1A0HB 4WH6A 4B74A 4ABHA 3GCNA 3A86A 3TK5A 1PPCE 1C1RA 5CHAB 2W6ID 4Y10E 1ARCA 1MKXH 3Q3KA 1AUJA 4M9FA 1UK4A 2ZZUH 3NUMA 1T7CA 1V2ST 1VCQA 3EYDA 5EXNA 4LK4A 3AASA 4GCHF 1Y5BT 4FUCA 1AQ7A 1PPBH 5A2MH 3PTNA 3UQVA 4BNRA 1O2UA 5C1XA 3RMOH 3F2GA 4DW2U 5JBCS 1KDQA 1A1RA 1MQ6A 1CBWC 3C27B 3N99A 4Q2KA 3E0PB 1BHXF 3GCHC 4NIVA 1NBME 1S6LA 3OY6U 1K1JA 3PROA 5C17A 1N6XA 3T5FH 1UHBA 2VU8E 1O3DA 1XUKA 3P8OA 1FY3A 1V2QT 4O03A 2GT8A 1BMLA 3GDUA 4R0IA 1O2XA 3DSGA 5BRRE 1TGTA 3LGYA 2C4FH 1XVMA 3RM0H 1E35B 3E0NB 4NIWA 1MTVA 3EA8A 1O36A 5C0UA 1EZUC 3OU0A 3O8CA 3R3GB 4DVAU 3RXVA 5LPFA 1O3AA 3GY8A 1TNLA 4X1SU 1YPMH 3RXRA 1TPPA 1YPJH 1E0FD 1VITF 1ZRKA 2ZFTA 1QFKH 1PPFE 4CREA 3I29A 1FAXA 1FN8A 1GJDB 2JIZD 3NK8A 1ZSLA 1YCPK 1MTWA 1C4V2 4BTIB 2A4OA 1AO5A 3S9CA 3SYJA 1O31A 3UAIC 1O37A 2PFEA 1GHBF 1LVMA 2Q6DA 5ABWA 3LC3A 3VFEA 3RMMH 3RLWH 4JYUH 1TOMH 5EJZA 1K28D 2C8ZB 1KIGH 1ABIH 4Y71A 4E05H 1YLCA 2O8MA 3BEIB 4UDWH 2V3MA 1YPHC 2WPLS 5EPYA 1FIWA 5F03A 4B2BA 2GJGA 2A32A 5C20A 2ZWLH 2KAIA 3BG4C 2HALA 3T29A 1KSNA 1QY6A 5FL7D 2BY8X 2BQWB 1UVOA 3VB7A 2O8UA 2H6MA 1T8LA 2QGRA 4ABGA 1WSSH 6GCHF 2XNIA 2BLVA 3MHWU 2J95A 2Z3DA 4NCYA 8GCHF 1J14A 2FOMB 1ZSKA 2YMSB 4U2WA 3V7TA 3ZZBA 1P2QA 2HWLB 1GJ7B 4FVBA 5KEDA 3BIVH 3L6PA 3TH3H 2OD3B 1MBQA 4CRGA 2I6SA 4K60A 4CRCA 4D8NA 2P3FH 2BMGB 1HAPH 3TITA 2J34A 1QL8A 4AOQA 1ZPCA 1CA8B 3ZZ3A 1ZHPA 2D2DA 3M7QA 4FUEA 2H5CA 1QB9A 2ASUB 2Y7ZA 2FTLE 2ZA5A 4FUGA 3MH7A 2AIPA 1THRH 1P2KA 2IPHA 4OS6A 1GJ8B 3QO6A 1TNIA 1P57B 1GVZA 3Q77A 2BLOA 4AGJA 1FX0B 4DJZB 2VH6A 5E0JA 3TIUA 2C8WB 5EPNA 2BD8A 1HAZB 5C5NA 1OOKB 1T4UH 1TRMA 2G5VA 1EOLA 1GBLA 3U1JB 1AIXH 3ENSB 3TK9A 2JJ2D 1ZGVA 1C2JA 1W0ZU 3MNCA 4MNVA 1O2KA 3SQHE 1PYTC 1TA2A 1WDIA 1O3GA 2Z94A 5K7RA 3NXPA 1TBQH 1HYLA 2B8OH 2Z9LA 5JBAS 3Q00A 1GHYH 3PV4A 1W7GH 2K1QA 3BG4B 1OWHA 2ZHFH 1O38A 1S0RA 3D49H 1E34B 1NY22 4LZ1H 2DUCA 5T1VA 3RXSA 3RLYH 2PSYA 3TJVA 4DURA 1AZ8A 2G4TA 1SL3A 1QL9A 1TYNA 2SGFE 1FONA 4XE4A 3PLBA 4P02A 1O2TA 1Z1IA 1UVPA 4AG2A 1YPLH 1V2LT 1GBIA 1OWKA 2ZCKP 3V12A 3O8BA 2CHAC 1YWUA 2RA0A 1XUHA 3UY9A 2ZDNA 2VIDA 5AFZH 3MU8A 1GCTC 2SNWA 1BDAA 1NFYA 2RFKC 1MKWK 4NSYA 4ZHAA 4XRNA 4AYVB 5L30H 1O3MA 2ZGCA 2Z9IA 5H4IB 4YXWD 1V2RT 1XXFA 3F0OA 3VPKA 5T6DA 1ESBA 2GCTC 1EAUA 2V35A 2ZPQA 1QRZA 1SGEE 4RT1A 5DP6A 2VWMA 4JZ1A 4X1NU 3FZDA 2GV7A 1CGIE 5DO4H 1BMMH 3OEHD 1S0QA 2D26C 1UCYH 2F9NA 3SU4A 1C4Y2 1CHGA 5EG4A 2GP9B 3A7ZA 2XTTB 3QZQA 3ZV9A 6ESTA 2ILNA 4Y8YA 2BY5X 3ZZAA 4IW4E 1SQRA 1LHEH 1DOJA 4Y11E 2NU2E 2HPPH 1X7AC 2TIOA 1AB9B 4FU7A 1IQEA 2FTMA 3P17H 1V3XA 2FOBA 1P05A 2HRVA 3QUMP 1ELEE 1P04A 5C94A 3A7VA 1C9TA 2KZ4A 3OTJE 3SOSA 2ZCHP 2O9QA 3UPEA 4B6EA 1LVBA 4I8KA 1GBDA 2A4QA 1XKAC 1GMHF 1P09A 1BRAA 1ELAA 2QAAA 2ZU1A 2WV5A 4CBNA 2TBSA 1G36A 1DWDH 4ZKRU 3U69H 1GI7B 1F0UA 4INHA 1GCTB 5GCHF 4GVUA 3DFLA 1XMNB 1WBGB 3MH5A 3A87A 3PMJA 3SZEA 2F43B 2J4IA 1SSXA 4P00A 4JK5A 3E3TA 1YCPM 3HPTB 2AIQA 1BTUA 1TE0A 1SVPA 3QTOH 4AB9A 1PQ5A 2C8YB 1RGQA 3M61U 1AN1E 3I77A 3RUOA 2GCTB 4X0WU 1YKTA 1A5GH 2P16A 5EXMA 1C5YB 2FEQH 5A0AE 2G55A 4D76A 4FOUC 3K65B 4A5TS 1TBZH 4IMQA 1G3BA 1O0DH 2BY9X 2ZPRA 5FCRA 3W94A 4UD9H 1B0FA 3VB6A 1OWJA 1C1NA 1GHXH 3LU9B 4K8BA 1EPTB 4Y6DA 1GJ5H 1MKXK 3AW1A 3BTTE 1UVUH 1ZTKA 4BXSA 2VWNA 1T8OA 1TOCB 3SUFA 3WWBA 3A8BA 2XCNA 2ANWA 2F9OA 2ZO3H 3V0XA 1FY1A 1AVWA 4F49A 4TYDA 3RXLA 4ZKOU 1AY6H 4UFEH 1GDQA 3KQ5A 1ANDA 3I78A 3U8OH 1C5QA 2C8XB 4I33A 4E7RG 1C5NH 1O2PA 3SZNA 2XW9A 4CR9A 1GG6C 1ZOMA 1AKSB 3VXEH 2FZZA 3SHCH 1EB1H 1Y5AT 2XWBI 1VJAU 4ASHA 2UWOA 1HAGE 1AMHA 1BMFD 3PWCA 1LVOA 2J38A 2WUBA 1O2MA 1TB6H 3ATIA 4CRAA 3F9FA 3S0NA 2P95A 4BTTB 4KELA 4NWLA 1SQOA 1DFPA 3AVZA 2B7DH 1BTXA 2ZCLP 5AVDA 2VIWA 1BRCE 2ZDLA 5FCKA 1ZGIA 1F92A 1OWDA 1ID5H 2ZDAH 2FLBH 4Z0KA 1L1JA 3F2FA 1O5FH 3S69A 1JRTA 3RU4T 1GJBB 5EU8A 5DP4A 2UUYA 1TWXB 7GCHG 1BITA 4CBOA 5EQQA 3WY8A 5C0TA 4H6SB 1LTOA 4JZFH 1Y3WA 1GHZA 1QJ7B 2ZKSA 3EE0B 1RS0A 2GV6A 3GCTF 3KHVA 4OM9A 4CH2B 3F0PA 2BOKA 3BTWE 1K0HA 1O5CB 2LPRA 3TNSA 2BLQA 1O33A 1THPB 1O2LA 2O8LA 3MU4A 4KTCA 3RC4A 3TPIZ 4AN7A 4CRDA 3A89A 1CU1A 1T32A 1P03A 2R2MB 3SNBA 1ZLRA 1GG6B 1HAOH 3P95A 1Y3UA 3M5LA 3R0FA 1TGCA 2HLCA 2KCAA 4IC5A 4B75A 1P01A 2Z9KA 2TGDA 2FI4E 3SGQE 1EJAA 3ZZ9A 2G4UA 1VKYA 3OAAD 3GDSA 2JDID 1C5LH 1CA0C 5EQSA 3UR9A 4DT4A 2SGAA 1ZHRA 1G2LA 4DG4A 1FNIA 1GHWH 4TPYA 3PV2A 4TT3D 1ELTA 2PUXB 4FETA 4MTBA 4F55A 1ETSH 2FOEA 3QN7A 2ZTYA 4ABIA 2V7QD 3BV9B 2HVYB 1DDJA 4K1TA 4ZAEA 3LH3A 1WQVH 1GMDG 1OXGA 4XSKU 5AFYH 3FANA 3A84A 1GBMA 5FHTA 1UTMA 1MQ5A 2XC0A 3RXPA 3BTKE 2VNTA 3B23B 1ZJDA 3UOUA 5GDSH 1H4WA 1TBRH 1KXCA 1V2WT 5T3HA 1H9HE 4SGAE 2CF9H 1SGRE 2GZ7A 2CGAA 1LHGH 1S85A 4YOJA 3LGWA 4ZKSU 1S6FA 3EAJA 1JBUH 1O3CA 1WOFA 3A7TA 2Y5HA 7LPRA 1G3DA 1UTNA 1WU1A 3SNDA 4JZEH 3SU1A 2VJ1A 1NESE 2QF0A 1SGCA 5GWZA 3TJNA 1O3IA 3FP7E 1SLVB 2JH0D 2ZTXA 2B5TB 2Z3EA 3GOVB 2ZFFH 4DOQA 1ELVA 5HMAA 5FXLA 2A4GA 2P8OC 3RXKA 1VCWA 2A5AA 3FVFB 3FKSD 4ZKNU 4H6TA 1K2I1 4BTUB 5CHAC 3ZYDA 1ETTH 3OTPA 1H8HD 2XOKD 2AMPA 1AFQC 4B2CA 1ZHMA 1TNKA 1V6DA 2OC8A 1LDTT 2RDLA 3FP6E 1OHHD 1VZQH 3LC5A 3K6YA 1UW7A 4MPUA 3DA9B 1VITH 1GI0A 4IN2A 2SGPE 5HIYA 1ZMLA 2QXJA 1S83A 4ZXXH 4AORA 1ANCA 4NA7A 2QXGA 2HVXA 2GCHG 1YM0A 2WINI 5FPTA 1H9IE 1DS2E 2PKAB 3AAVA 1C5PA 4ABJA 1ACBE 1A7SA 1A3EH 2WPDD 3GCOA 2STAE 4YESB 1DSUA 1E36B 3RXMA 5DKMA 2BD3A 3IITA 3OY5U 3L3TA 2ZQ2A 2BQ6B 1UTLM 4JYVH 2BB4A 2ZC9H 2Q6FA 5HKKD 1UCYK 2BY7X 1MU8B 1TLDA 1PFXC 2AGIX 1Y59T 3GICB 1QZ8A 3QWCH 1W10U 1TMBH 5EW1H 2CJIA 1OKXA 2FOAA 3QDZB 3QX5H 3DCLA 3MO6A 4BANB 4D7FA 1LCYA 2BDIA 1HV7A 1EXFA 1GI1A 3GY4A 4ISIH 1WCZA 4Y8ZA 2BD7A 1T8MA 2FLRH 1AGJA 1MCTA 3EA7A 5T6GA 1LQEA 2R0LA 1WAYB 4YLUA 2TGPZ 4XD7D 4HZHA 5HXFA 5A0BA 1AFQB 4GUXA 1CHOG 1XUIA 4ABDA 1C5ZB 2ZFRH 2KM0A 3T26A 2GDDA 1LKAA 4B6FA 1FUJA 2RG3A 3MO9A 1BRUP 5F8XA 4AFQA 1IQFA 1OP2A 5JBTA 5BPEA 3E6PH 4B73A 1GBBA 1A3BH 1DUEA 1Q31A 2QN5T 1UTKA 1W0JD 3SU5A 1ELCA 1BBRH 1EAXA 3SGAE 4MNWA 1GHVH 4E06H 2W7SA 4U01A 1GHAG 3MTYA 3PWBA 3NWUA 1EPTA 4FUIA 3U8RH 1GJ6A 3M3SA 4ZCNA 1QBNA 3MU5A 2PLXA 2BHGA 2F91A 7KMEH 2OUAA 2D8WA 3M3VA 5DP3A 3RXTA 4OS2A 5I25A 2YMSC 2WYJA 3LPRA 3RDZA 3LDXH 5L2YH 1EJNA 1BBRE 2EEKA 1HPGA 1AHTH 1GI5A 1HXEH 4UFFH 1EQ9A 3MH6A 3FP8E 1UTOA 1O3JA 4H4FA 3E1XB 1BQYA 1GI2A 1NC6A 5DP5A 1MUEB 3UWJH 3P8FA 3LONA 1LPGB 1S84A 1P2OA 1AKSA 1IQLA 2YNBA 3M5NA 1MTNC 1MH0A 3TGKE 1HAYB 1G2MA 3RXQA 4O3TA 1NO9H 2FS9A 3F6UH 1RJXB 5EQRA 5FX6A 1QRXA 4XOJA 2P3UB 1GJ4H 4JZDH 2ZHDA 2V6NA 1P2JA 3N7DA 4Q63A 1O39A 1H8IH 4XBCA 1MD7A 1KTSB 2Y80A 2PSXA 2H9TH 2PV9B 4YT6H 1J15A 3TGIE 3O8RA 1GHBG 2BX3A 1WTGH 5DGJA 4KKDA 3EQ0H 3SUDA 1GDUA 3BG8A 1PYTD 4I8JA 2AH4X 4HG6A 1DVAH 2EC9H 3F9HA 3LIWA 3UIRA 1DPOA 4MNXA 2HPQH 1J17T 1C5SA 1YGCH 1W2KH 3RMLH 3VEQB 2BXTH 1SGYE 3ZZ6A 3W95A 1UTJA 2WPHS 3BSQA 2ZGBH 3OEED 4JMYA 1W13U 2W3KA 3ITIA 1ZTJA 5JB8S 2BVSH 1LHFH 2AGGX 2EQNA 3RXGA 4I8LA 1MU6B 1GJAB 3ZVEA 2WHXA 3RXDA 2PW8H 1O2YA 2F9VA 2G81E 1O5EH 4YT7H 5JYIA 1C2KA 2LNCA 1HJAC 3DUXH 1DSTA 4PROA 1N8OB 1W8BH 2HLDD 3RXIA 1F0SA 1BTZA 1T31A 2BD9A 4JCNA 1Y3VA 1MTNB 1KMHB 2WPJS 2FESH 2HNTC 4X1RU 3SN8A 1P2MA 1O5GH 3HGNA 3SJOA 3KN2A 3PTBA 4D9RA 4X8VH 3SJ9A 2JH6D 1XX9A 1TONA 3SV2H 1GMCF 1GBJA 2FPZA 3U28C 5EIYA 4Y7AA 4OS4A 1S6HA 4WH8A 1MCVA 1ZJKA 5A0CA 4CRFA 1SQAA 1DY8A 4J1YA 3WW7A 1AB9C 1P2NA 3SNAA 1YC0A 3BTME 4UONA 1OYQA 1SGIB 1VJ9U 1CE5A 4K1SA 4ASUD 3AW0A 4RKJB 3KGPA 4MPXA 1C5UA 1ORFA 1G37A 1K1LA 1PJPA 1TNJA 1LVYA 2G51A 4XBDA 2IPQX 3FZZA 4WMEA 2Q6GA 3SGBE 4JK6A 3T27A 3KIDU 4OS7A 2WPKS 3WWFA 4OS5A 1S81A 4KTSA 3QK1A 1C4U2 2FOGA 1TX6A 4AX9H 1SBWA 1Y3XA 1HAHH 4BAOB 1ESAA 1V2UT 4K1EA 1HJAB 4ZROA 1C1UH 4THNH 1QNJA 3MNBA 2TPIZ 2R3YA 3MYWA 2UUFB 1BB0B 4KGAA 1DLEA 3A8CA 2FIRH 3N7OA 4X6OA 1O5AB 2A1DB 4ZXYH 4NFFA 4FU9A 2P3TB 1YF4A 1K21H 1FLEE 2J2UA 3DFJA 5EJ1A 1CSOE 1DITH 2PR3A 3MI4A 3LOXA 3KYGA 3MO3A 1PPHE 1C2FA 2OBOA 5F53A 1ZPBA 2ANKH 2XWAA 1UVTH 4Y8XA 3ELAH 1MABB 4GSOA 2FX4A 1O5BB 1HIAB 1E1RD 4X1PU 1IQHA 1HB0B 4YOIA 3ODFA 2DE8A 1VR1H 3BEUA 1CT4E 2PKAA 1EPTC 2Y5GA 3SI3H 2FODA 1SPJA 2GT7A 4VGCB 1UCYE 4TY7A 8LPRA 3T28A 5G4BA 2V3OH 3LKWA 5HM2A 3LT3A 2GKVE 4Z1MD 2UWLA 4J2YB 1DX5M 5FX5A 3U1IB 3W1EA 1P3CA 2TGAA 3ZVCA 2ZG0H 1OYTH 4INLA 5FPSA 2ZHWH 1ETRH 1QJ6B 1K1PA 2BQ7B 1GCDA 2A7CA 5JB9S 3A7XA 1V2NT 4WJG2 1GMHG 1BZXE 1A2CH 3TH4H 3SI4H 1HXFH 2FMJA 3TJOA 3P6ZB 2R0KA 2GX4A 2O8TA 3CP7A 1K9OE 2BVRH 2FI3E 4MG3A 1RRKA 3A8AA 3BTHE 2BLWA 4RN6A 1NRQH 3MWIU 2YNAA 1TX8A 1W3CA 5GJ4B 2FI5E 1C5MD 4AB8A 1HDTH 1D3DB 1EX3A 1JMOH 3SW2B 1BTYA 4JYTA 1GBKA 2F9UA 3A85A 1P8VC 5B6OA 4Y76A 1TRYA 1Z8JB 1YPKH 4Y0YE 1HJ8A 1RTLA 2PKSC 2J92A 4LXBH 2XBWA 2A7HA 4AFZA 3MU0A 4BAKB 2Z7FE 2VVCA 1J8AA 4X2WA 1CGJE 3B9FH 1BTWA 2IOTA 1C1MA 4B71A 1GBCA 2EI6A 3SJ8A 2A4RA 1IOEA 1G3CA 4WXIA 2BZAA 1DXPA 1MD8A 2IJOB 2ANMH 3M35A 3VXFH 1KXEA 1CGHA 4IGDA 4GHQA 1BBRK 1FAKH 3UNRA 4AYYB 2ZECA 4X1QU 5CE1A 4BOHA 5DK1A 4HI3A 2WSSD 4E7NA 1HBTH 4UFGH 1Z6EA 4A1XA 1AWHB 1JXPA 2J98A 3BTDE 1FZZA 1FPHH 1GL1A 1O34A 3RXHA 2KFWA 1W14U 3ATLA 2FOFA 1MTUA 1OS8A 1Q2WA 1KXBA 3V3MA 7ESTE 4I32A 4FUJA 1D6WA 4OGXA 1ZRBA 2HNTF 1SGTA 4U30A 2K0QA 4X2XA 3PO1B 2FO9A 2V0BA 1QTFA 3VB4A 2PKSB 4ISNA 1ARBA 4K69A 3QGNB 1D3TB 3S7KB 4KP0A 3ZV8A 1QIXB 1LPZB 1FDPA 2QIQA 1C1SA 2UUKB 5KECA 2OINA 1G30B 2ZFPH 1BMAA 1Q3XA 7GCHF 5EOKA 2KCPA 2RA3A 2XBYA 5E2PA 3B8JA 3D65E 3KL6A 1B5GH 3RXJA 3TLOA 3LH1A 3UQOA 4TY6A 5ESTE 1BUIA 5C1UA 2ZDVH 2ODYB 1JIMA 4XDEA 1ZMNA 1WXRA 2CF8H 1FY5A 1GJCB 1TFXA 2VIPA 3GCTG 4LOYH 3ZZDA 2BM2A 2PUQH 2AGEX 1EZXC 5ETXA 4A1VA 2LELA 2BDBA 1Z1JA 1GVKB 1GL0E 1QQ4A 4A1TA 1GVLA 2AMQA 4QT8C 2KCYA 3GS9A 3SV9A 2P59A 5C1YA 3ZVFA 2WYGA 1P06A 4ZUHA 1AE5A 3Q76A 1NBMD 2ZU5A 3GY2A 2XXLA 1O2RA 4NZLA 1ZPZA 1BJUA 5FBIA 2EY4C 1BTPA 4WMDA 3TGJE 3DSOA 4WXVA 1LKBA 1YY3A 1NN6A 4K2YA 3SQEE 3ZYEA 2PWXA 3OYPA 1F7ZA 5J4SA 1KY9A 1DWBH 2L6OA 3EA9A 3MMGA 2EI8A 1BIOA 1GMDF 1RFNA 1FN6A 1QBVH 3RXBA 2VINA 1SFIA 4A7IB 1O32A 3ZVGA 1WV7H 1QHRB 3M5OA 2VIVA 2M5TA 1BHXB 3RXFA 1UO6A 4F48B 1Z71A 1Z8GA 1NT1A 4OS1A 1TGNA 4I8GA 4WVPE 2L74A 1RIWB 5A8ZA 4X2VA 1O3HA 1H8ED 1Y5UT 2C90B 1C2IA 4F4OC 3UUZA 5EJLA 1K1OA 1S82A 1HGTH 1N1LA 3UNSA 6LPRA 4MLFB 5E0HA 1FY8E 1MKWH 3OX7U 4Z6AH 5GNDA 2LP6A 3JZ2B 1C5WB 1K22H 2OLGA 4NA9H 3CS0A 5T6FA 2J94A 3K2UA 3KNXA 1LQDB 1SB1H 2AEIH 3BTGE 3STJA 3TH2H 2H5DA 3MH4A 1LHDH 4X2YA 1HRTH 5K0HA 4XFQA 2F4LA 1Z7KA 1Y8TA 2F3CE 4CRBA 1OWEA 1L1NA 1KTTB 3M3TA 5J4QA 1L4DA 1NFWA 3PRBA 3P92A 1GWAA 4ZMAH 2Y6TA 1O35A 1EATA 1C5OH 2TGTA 2F83A 3VGCC 1A5IA 3SV8A 2ZU2A 4M7GA 1IQGA 3QGJA 2NU3E 1ZTLA 2VBCA 5E0GA 5DG6A 1LMWB 1C2HA 3GY5A 3KCGH 2XCFA 3M7UA 1FPCH 1WTHD 1W0YH 1ANBA 1SHHB 2GCHF 1RD3B 2JKHA 2BVXH 1A61H 3PMHB 1HIAA 4D7GA 1FV9A 1OSSA 2Z9JA 3F9GA 1SLWB 2WV4A 2ESTE 4MPVA 4ISLA 1P9UA 3VB5A 2ZNKH 1O2OA 3PLPA 2NU0E 2BD5A 2W3IA 1ELGA 1NTPA 2RDEA 5E8EH 1A46H 2OC0A 1TPOA 1RXPA 2KR7A 4YOGA 1O3PB 1PQ7A 1SGNE 4Q4LA 2QA9E 2QY0B 4DIHH 2VGCC 1PQ8A 2CMYA 4UFDH 1QB1A 3F1SB 2YMSD 1AVGH 3SJKA 2F9BH 1YLDA 4O3UA 3SNEA 3ZZ7A 5HGGA 3FAOA 3PB1E 3SORA 1HAXB 2BDCA 3UFAA 2BOHB 5ESBA 1SGPE 1O3KA 1HJ9A 3V13A 1MTSA 2B9LA 1F2SE 1CT0E 1SGFG 2O8WA 4BXWA 1BTHH 4DY7B 1BMNH 5GXPA 5C67A 4ABBA 1DWCH 1NU7B 1L1GA 1P12E 1RTKA 4ESTE 3AAUA 3VGCB 3S9AA 5L2ZH 1CHOF 4DIIH 1KXDA 1TMUH 5EW2H 3QTVH 1OWIA 2OK5A 1WYKA 3PV5A 3GYMA 3ESTA 4WY3A 3U98H 1DM4B 2H9HA 2BDHA 2A2QH 5EGMA 2GDEH 1TGBA 4GCHG 1DANH 2BXUH 1ABJH 3T62A 2A5KA 3HKIB 1NM6A 4D9QA 3S7HB 1LHCH 5FAHA 4HTCH 1ELDE 2FYRA 1GHAF 1G9IE 3OFND 1PPGE 4UE7H 3RU4D 5C2ZA 2HOBA 3Q3YA 4IN1A 1YP9A 1UJ1A 1F0TA 2G52A 5HM9A 1GI6A 2GZ9A 3KYFA 2VGCB 3K9XB 4UEHH 1GJ9B 3TK6A 8ESTE 3GY6A 3KEEA 1N8OC 1XXDA 3SV6A 1XKBC 1V2TT 1ZYOA 3UOPA 1T4VH 3EE7A 1JRSA 1V2JT 1SGQE 2J98B 1U6QA 3NPSA 2WV9A 1NFUA 5SGAE 1DXWA 2FWWA 5F6MA 4GHTA 1AZZA 5E2OA 1BRBE 4FXGH 1AVXA 3ATKA 4YZUA 3HK3B 1EP5A 1P9SA 5DJ7A 2OQUA 1TALA 2GGVB 2SNVA 5LGOA 1D3PB 3PMBB 2A7JA 3Q3XA 1DICA 1O2QA 1VITG 1HAVA 4NIYA 4Y79A 1ESTA 3VB3A 1SLXB 2R3UA 3URCA 1A4WH 3D23A 3A82A 3TNTA 5C3NA 1W12U 2FDAA 2BX4A 2ZFSA 4HFPB 4DCDA 4CH8B 2A31A 1TQ7B 2QF3A 4MDSA 4R8TB 1E38B 1H9LB 1D3QB 3GY3A 3SV7A 2WZQA 3DSPA 3LJOA 1P2IA 1FY4A 4CHAC 1TA6A 1C9PA 3MFJA 2AS9A 5FBEA 1TAWA 2QV1A 1O2ZA 3UTUH 4ZH8A 3QLPH 4DT7B 5HYOA 1IQJA 3E8LA 1DUAA 2VVUA 3QZRA 4ISOA 3UB0A 1CBWB 1YLNA 1ZSJA 2ZU3A 3LGVA 4AZ2B 3GCHB 1IQNA 5PTPA 3ATMA 2CK3D 2ODQA 5KGOA 1CQQA 1O2NA 2H1UA 1A0LA 3HKJB 6GCHG 5DSFA 4B2AA 1GDNA 1XM1A 8GCHG 2F9PA 3L33A 1UVSH 2OP9A 2WUCA 1GI4A 4TWYA 4YLQH 1C2EA 1CVWH 1O3FA 1J16A 3LGIA 1SGFA 1E79D 1BT7A 2P94A 3IWMA 1OX1A 2QE7D 2VH0A 3M5MA 3E16B 4GPGA 2FM2A 2OQ5A 4A92A 1HLTH 3RXOA 2AMDA 3F3BA 5JBBS 1RTFB 1YPGH 3NZIA 1ANEA 3ZIAD 3BN9A 2AFQB 1TRNA 2AYWA 3RXAA 1A5HA 1GMCG 2BTCE 3EDXB 1EAWA 4YO9A 4TSFD 4VGCC 3JZ1B 4CHAB 4AG1A 2SGQE 4XBBA 5LPEA 1W0KD 2FYQA 4O9VA 2ZP0H 3NRLA 2BYAX 1AD8H 1FQ3A 2QCYA 1JIRA 3BIUH 2ODPA 3NKKA 4ISHH 1FMGA 2R2WU 2VIOA 2PP6A 3H7TA 3UR6A 2JH5D 1TPSA 5F8ZA 1C2LA 1AI8H 3ATWA 1COWD 3OE7D 2OCVB 4NFEA 3GYLB 1QQUA 4MVNA 4Q7XA 4ABFA 1H1BA 2PTCE 2WPIS 1MAXA 2BD2A 2J97A 1T8NA 1TIOA 3TVJB 2CXVA 1UTPA 1MZAA 2ALPA 2IN2A 1LPKB 1O2WA 1O5DH 2NWNA 4NIXA 2DE9A 4MNYA 2FOHA 3ZVBA 4ZHLU 1YPHE 1GI9B 1O2JA 5TCAA 2Z3CA 4U32A 1AWFH 1C1QA 1O2VA 1KXFA 3RU4E 2XRCA 3MQKC 3SU6A 1DWEH 3M36A 4NG9H 1C1PA 1SFQB 2GZ8A 3CS7A 2ZQ1A 4NZQA 1ELBA 1AUTC 1EZSC 1C1TA 5EODA 2QYIA 5F8TA 5TJXA 4I86A 4IS5A 1GBTA 2BY6X 1EKBB 4K5ZA 1INCA 4Q7ZA 3N7EA 5A8YA 3U8TH 2HGTH 5LH8A 4B1TA 2CN0H 3ZZ8A 1ELFA 1FJSA 3O8DA 3MNSA 3SUGA 1IAUA 3SJIA 3H09A 1HCGA 3TU7H 1DY9A 2W5EA 3A7YA 1P10A 1C5RA 3KQBA 4K3JA 1S5SA 1PQAA 3KQDA 1DT2A 1MZDA 2HNTE 1C1VH 3ZVAA 2V3HH 4IC6A 2ALVA 5TCCA 1EAIA 2ZGJA 2AERH 4ABAA 1P3EA 1V2PT 2CHAB 4Q7YA 2ZHEH 1EUFA 4ZHMU 3P70B 4INKA 2ZTZA 5GCHG 1VGCC 3KQEA 2SGEE 3RC6A 2BDYA 4RI0A 1SHYA 2PGBB 5AHGH 1HUTH 3FO8D 1AE8H 1DLKB 4MPWA 5DP7A 1EFRD 3LGTA 3ZZ4A 3RXUA 2XNDD 3A83A 1TMTH 5A09A 2W7UA 3F2HA 5DP9A 1NPMA 3PO1C 3DT0H 3F68H 3UREA 4YM9A 1EZQA 2GMTC 3SO3A 2Y5FA 3P8NA 1OP8A 2ZDMA 1IQMA 3LJJA 1GPZA 1D9IA 1IQIA 1G3EA 3FFGA 2GVFA 1P11E 2WPMS 1F5RA 3DD2H 3C1KA 3LGUA 1C2GA 1KDQB 1L2EA 1QA7A 2BDGA 1SOTA 1L4ZA 1F5KU 1TNGA 2ANYA 3EGKH 1PPEE 1GBEA 1O3OA 2XBXA 3RC5A 2UUJB 3ZVDA 1QJ1B 1QL7A 2FX6A 1ZZZA 1EJMA 2FXRA 4NA8A 1SI5H 1UHBB 1V2VT 1SGDE 2EA3A 2Y81A 4YTAA 4FVDA 1C5VA 5CHBA 2A2XH 2C93B 2STBE 2A0QB 1EP6A 1YCPH 1CO7E 2ZIQH 4O97A 3T2NA 2ULLA 2VWOA 4Q80A 4GAWA 2FP7B 4K8YA 3E91A 1C2MA 1VGCB 1SOZA 1HAVB 4WWYA 1M9UA 1BOQA 1UK3A 1E1QD 5JPMH 1KLJH 1EASA 1QBOA 1VCPA 2GTBA 2VIQA 2YOLA 2RCEA 2JETC 3PLKA 2A45B 4X8UH 3VG8A 1G32B 3U9AH 4AC9A 2J9NA 4TPIZ 3FOAA 2GMTB 2Z9GA 6CHAC 1BA8B 3A7WA 3HGPA 3BTFE 2NU1E 1Z8RA 4I7YH 2G00A 1SC8U 5DN6D 1H8DH 3IG6B 3OSYA 1N6YA 2IJD1 1SMFE 3E90B 4OGYA 3RXEA 4NSVA 2XC4A 3RXCA 4BAMB 2ZU4A 2OC1A 3SU0A 1RIWC 1AFEH 2KCOA 3SHAH 2KAIB 3A88A 5EXLA 4RSPA 3GY7A 3MOCA 3CNRA 2B0FA 1LO6A 4BAHB 3G01A 1FI8A 1SR5C 4NGAH 3NCLA 3S9BA 4I31A 5GIBA 3BTQE 2ZPSA 3GDVA 5IYTA 1KLTA 1QR3E 2Y7XA 3KF2A 1NRRH 1QCPA 1W7XH 3RMNH 5I46H 2I6QA 5B6LA 2PGQB 1ZR0A 2SGDE 4AGKA 1GGDC 1FIZA 2H9EH 2ZFQH 9ESTA 5GPIB 2EI7A 1P02A 5C5OA 1C2DA 1FXYA 2OBQA 3GISB 1C1WH 1HAIH 3SU2A 2QC2A 1UK2A 1GBFA 3RP2A 4FUFA 2THFB 4IMZA
chains in the Genus database with same CATH topology
4HGCA 1MMJN 2JETB 2Z6BD 2C3SA 4FUBA 3D62A 3ZZ5A 3H7OA 4BAQB 2OC7A 1IHSH 3URDA 6CHAB 5FPYA 2ZGXH 4AFUA 9LPRA 1K1IA 1P0SH 2VVVA 3M7TA 1O3EA 3UWIA 1QB6A 3UNQA 2ZHQH 1EB2A 2BD4A 1UTQA 1B0EA 1OP0A 2TRMA 1THSH 2A5IA 3A8DA 1AU8A 1K1NA 3ODDA 3HK6B 4AFSA 2NU4E 1MAYA 4H42U 1E37B 3CENA 1TNHA 3F9EA 2FOCA 1O2IA 3H5CB 2XBVA 4X6NA 3T25A 2D1JA 1D6RA 1A0JA 1MBMA 4LZ4B 1XUJA 1O2SA 4GLYA 1NRNH 1XUGA 4KTUA 5CMXH 1JOUB 3PM3A 1GGDB 1PPZA 1Z8IB 4CR5A 1BJVA 3BEFB 5IDKA 2FS8A 4FUDA 5JDUB 1WQSA 2ZEBA 8KME2 1EOJA 1IQKA 1SG8B 1GBHA 1QRWA 3KQCA 5DP8A 5L6NH 4WF8A 3HATH 3BF6H 1K1MA 4ABEA 2QXHA 1V2KT 2QXIA 1NU9A 3P8GA 3MNXA 2ZDKA 4X8TH 1C1OA 3A81A 3PMAB 1HNEE 1YPEH 2OTVA 3STIA 5A8XA 1KXAA 4FU8A 1QGFA 4WMFA 3ZZCA 3M37A 2SFAA 2OXSA 1YYY1 1ZMJA 1XUFA 1CA0B 1Z6JH 1BCUH 2R9PA 1OPHB 1TABE 1NS3A 1W11U 4TWWA 1XVOA 4MQAA 4Y7BA 1TX7A 2CV3A 1C5TA 2PHBA 3SU3A 1DE7H 1B7XB 1KLIH 1NRPH 1O3NA 1O30A 2UWPA 1WUNH 1J9CH 2XC5A 4NWKA 3SUEA 4X8SH 1Y3YA 4I8HA 5LPRA 2ZI2H 3BTEE 3DHKH 1JWTA 1UMAH 2Q1JA 2H2ZA 1TPAE 4Y0ZE 1F0RA 1HFDA 4X6MA 2BDAA 1NZQH 2G5NA 1D4PB 4RKOB 5DPAA 1IHTH 4DGJA 2Y82A 1O2GH 1NRSH 1NROH 2VB0A 4FUHA 2XYAA 1CT2E 4A6LA 2ZF0H 4B76A 3RM2H 2P93A 2GD4B 3SBKA 1YBWA 1O3BA 2W26A 4JZIA 1O2HA 1O3LA 1GBAA 1QA0A 1F5LA 1L0ZA 3K6ZA 3PYHA 4X6PA 1GI3A 3A80A 3SNCA 1C5XB 5AF9H 1KYNA 1SLUB 2G8TA 2VWLA 2ZGHA 4SGBE 2BZ6H 1TQ0B 4IBLH 1QURH 3MU1A 2P8OB 1SQTA 1V2OT 2PTNA 1GI8B 1V2MT 3TJUA 1TGSZ 1NFXA 1A0HB 4WH6A 4B74A 4ABHA 3GCNA 3A86A 3TK5A 1PPCE 1C1RA 5CHAB 4Y10E 1ARCA 1MKXH 3Q3KA 1AUJA 1UK4A 2ZZUH 3NUMA 1T7CA 1V2ST 1VCQA 3EYDA 5EXNA 4LK4A 3AASA 4GCHF 1Y5BT 4FUCA 1AQ7A 1PPBH 5A2MH 3PTNA 3UQVA 4BNRA 1O2UA 5C1XA 3RMOH 4DW2U 5JBCS 1KDQA 1A1RA 1MQ6A 1CBWC 3C27B 4Q2KA 3E0PB 1BHXF 3GCHC 4NIVA 3OY6U 1K1JA 3PROA 1N6XA 3T5FH 1UHBA 2VU8E 1O3DA 1XUKA 3P8OA 1FY3A 1V2QT 4O03A 2GT8A 1BMLA 3GDUA 4R0IA 1O2XA 5BRRE 1TGTA 3LGYA 2C4FH 1XVMA 3RM0H 1E35B 3E0NB 4NIWA 1MTVA 3EA8A 1O36A 1EZUC 3OU0A 3O8CA 3R3GB 4DVAU 3RXVA 5LPFA 1O3AA 3GY8A 1TNLA 4X1SU 1YPMH 3RXRA 1TPPA 1YPJH 1E0FD 1VITF 1ZRKA 2ZFTA 1QFKH 1PPFE 4CREA 3I29A 1FAXA 1FN8A 1GJDB 3NK8A 1ZSLA 1YCPK 1MTWA 1C4V2 4BTIB 2A4OA 1AO5A 3S9CA 1O31A 1O37A 2PFEA 1GHBF 1LVMA 2Q6DA 5ABWA 3LC3A 3VFEA 3RMMH 3RLWH 4JYUH 1TOMH 1K28D 2C8ZB 1KIGH 1ABIH 4Y71A 4E05H 1YLCA 2O8MA 3BEIB 4UDWH 1YPHC 2WPLS 5EPYA 1FIWA 5F03A 4B2BA 2A32A 5C20A 2ZWLH 2KAIA 3BG4C 2HALA 3T29A 1KSNA 1QY6A 2BY8X 2BQWB 1UVOA 3VB7A 2O8UA 2H6MA 1T8LA 2QGRA 4ABGA 1WSSH 6GCHF 2XNIA 2BLVA 3MHWU 2J95A 2Z3DA 4NCYA 8GCHF 1J14A 2FOMB 1ZSKA 4U2WA 3V7TA 3ZZBA 1P2QA 2HWLB 1GJ7B 4FVBA 3BIVH 3L6PA 3TH3H 2OD3B 1MBQA 4CRGA 2I6SA 4K60A 4CRCA 4D8NA 2P3FH 2BMGB 1HAPH 3TITA 2J34A 1QL8A 4AOQA 1ZPCA 1CA8B 3ZZ3A 1ZHPA 2D2DA 3M7QA 4FUEA 2H5CA 1QB9A 2ASUB 2Y7ZA 2FTLE 2ZA5A 4FUGA 3MH7A 2AIPA 1THRH 1P2KA 2IPHA 4OS6A 1GJ8B 3QO6A 1TNIA 1P57B 1GVZA 3Q77A 2BLOA 4AGJA 4DJZB 2VH6A 5E0JA 3TIUA 2C8WB 5EPNA 2BD8A 1HAZB 5C5NA 1OOKB 1T4UH 1TRMA 2G5VA 1EOLA 1GBLA 3U1JB 1AIXH 3ENSB 3TK9A 1ZGVA 1C2JA 1W0ZU 3MNCA 4MNVA 1O2KA 3SQHE 1PYTC 1TA2A 2Z94A 1O3GA 5K7RA 3NXPA 1TBQH 1HYLA 2B8OH 2Z9LA 5JBAS 3Q00A 1GHYH 3PV4A 1W7GH 2K1QA 3BG4B 1OWHA 2ZHFH 1O38A 1S0RA 3D49H 1E34B 1NY22 4LZ1H 2DUCA 3RXSA 3TJVA 3RLYH 2PSYA 4DURA 1AZ8A 2G4TA 1SL3A 1QL9A 1TYNA 2SGFE 1FONA 4XE4A 3PLBA 1O2TA 1Z1IA 1UVPA 4AG2A 1YPLH 1V2LT 1GBIA 1OWKA 2ZCKP 3V12A 3O8BA 2CHAC 2RA0A 1XUHA 3UY9A 2ZDNA 2VIDA 5AFZH 3MU8A 1GCTC 2SNWA 1BDAA 1NFYA 1MKWK 4NSYA 4ZHAA 4AYVB 5L30H 1O3MA 2ZGCA 2Z9IA 5H4IB 1V2RT 1XXFA 3VPKA 5T6DA 1ESBA 2GCTC 1EAUA 2V35A 2ZPQA 1QRZA 1SGEE 5DP6A 2VWMA 4JZ1A 4X1NU 3FZDA 2GV7A 1CGIE 5DO4H 1BMMH 1S0QA 2D26C 1UCYH 2F9NA 3SU4A 1C4Y2 1CHGA 5EG4A 2GP9B 3A7ZA 2XTTB 3QZQA 3ZV9A 6ESTA 2ILNA 4Y8YA 2BY5X 3ZZAA 4IW4E 1LHEH 1DOJA 4Y11E 2NU2E 2HPPH 1X7AC 2TIOA 1AB9B 4FU7A 1IQEA 2FTMA 3P17H 1V3XA 2FOBA 1P05A 2HRVA 3QUMP 1ELEE 1P04A 3A7VA 1C9TA 3OTJE 3SOSA 2ZCHP 2O9QA 3UPEA 1LVBA 4I8KA 1GBDA 2A4QA 1XKAC 1GMHF 1P09A 1BRAA 1ELAA 2QAAA 2ZU1A 2WV5A 4CBNA 2TBSA 1G36A 1DWDH 4ZKRU 3U69H 1GI7B 1F0UA 4INHA 1GCTB 5GCHF 4GVUA 3DFLA 1XMNB 1WBGB 3MH5A 3A87A 3PMJA 2J4IA 1SSXA 4JK5A 3E3TA 1YCPM 3HPTB 2AIQA 1BTUA 1TE0A 1SVPA 3QTOH 4AB9A 1PQ5A 2C8YB 1RGQA 3M61U 1AN1E 3I77A 3RUOA 2GCTB 4X0WU 1YKTA 1A5GH 2P16A 5EXMA 1C5YB 2FEQH 5A0AE 2G55A 4D76A 3K65B 4A5TS 1TBZH 4IMQA 1G3BA 1O0DH 2BY9X 2ZPRA 5FCRA 3W94A 4UD9H 1B0FA 3VB6A 1OWJA 1C1NA 1GHXH 3LU9B 4K8BA 1EPTB 4Y6DA 1GJ5H 1MKXK 3AW1A 3BTTE 1UVUH 1ZTKA 4BXSA 2VWNA 1T8OA 1TOCB 3SUFA 3A8BA 2XCNA 2ANWA 2F9OA 2ZO3H 3V0XA 1FY1A 1AVWA 4F49A 4TYDA 3RXLA 4ZKOU 1AY6H 4UFEH 1GDQA 1ANDA 3I78A 3U8OH 1C5QA 2C8XB 4I33A 4E7RG 1C5NH 1O2PA 3SZNA 2XW9A 4CR9A 1GG6C 1ZOMA 1AKSB 3VXEH 2FZZA 3SHCH 1EB1H 1Y5AT 2XWBI 1VJAU 4ASHA 2UWOA 1HAGE 1AMHA 3PWCA 1LVOA 2J38A 2WUBA 1O2MA 1TB6H 3ATIA 4CRAA 3F9FA 3S0NA 2P95A 4BTTB 4KELA 4NWLA 1SQOA 1DFPA 3AVZA 2B7DH 1BTXA 2ZCLP 5AVDA 2VIWA 1BRCE 2ZDLA 5FCKA 1ZGIA 1F92A 1OWDA 1ID5H 2ZDAH 2FLBH 4Z0KA 1L1JA 1O5FH 3S69A 1JRTA 3RU4T 1GJBB 5EU8A 5DP4A 2UUYA 1TWXB 7GCHG 1BITA 4CBOA 5EQQA 3WY8A 4H6SB 1LTOA 4JZFH 1Y3WA 1GHZA 1QJ7B 2ZKSA 3EE0B 1RS0A 2GV6A 3GCTF 3KHVA 4CH2B 2BOKA 3BTWE 1O5CB 2LPRA 3TNSA 2BLQA 1O33A 1THPB 1O2LA 2O8LA 3MU4A 4KTCA 3RC4A 3TPIZ 4AN7A 4CRDA 3A89A 1CU1A 1T32A 1P03A 2R2MB 3SNBA 1ZLRA 1GG6B 1HAOH 3P95A 1Y3UA 3M5LA 3R0FA 1TGCA 2HLCA 4B75A 4IC5A 1P01A 2Z9KA 2TGDA 2FI4E 3SGQE 1EJAA 3ZZ9A 2G4UA 3GDSA 1C5LH 1CA0C 5EQSA 3UR9A 2SGAA 1ZHRA 1G2LA 4DG4A 1FNIA 1GHWH 4TPYA 1ELTA 2PUXB 4MTBA 1ETSH 2FOEA 3QN7A 2ZTYA 4ABIA 3BV9B 1DDJA 4K1TA 4ZAEA 3LH3A 1WQVH 1GMDG 1OXGA 4XSKU 5AFYH 3FANA 3A84A 1GBMA 5FHTA 1UTMA 1MQ5A 2XC0A 3RXPA 3BTKE 2VNTA 3B23B 1ZJDA 3UOUA 5GDSH 1H4WA 1TBRH 1KXCA 1V2WT 5T3HA 1H9HE 4SGAE 2CF9H 1SGRE 2GZ7A 2CGAA 1LHGH 1S85A 4YOJA 3LGWA 4ZKSU 1S6FA 3EAJA 1JBUH 1O3CA 1WOFA 3A7TA 2Y5HA 7LPRA 1G3DA 1UTNA 1WU1A 3SNDA 4JZEH 3SU1A 2VJ1A 1NESE 2QF0A 1SGCA 5GWZA 3TJNA 1O3IA 3FP7E 1SLVB 2JH0D 2ZTXA 2B5TB 2Z3EA 3GOVB 2ZFFH 4DOQA 1ELVA 5HMAA 5FXLA 2A4GA 2P8OC 3RXKA 1VCWA 2A5AA 3FVFB 4ZKNU 4BTUB 4H6TA 1K2I1 5CHAC 3ZYDA 1ETTH 2AMPA 1AFQC 4B2CA 1ZHMA 1TNKA 1V6DA 2OC8A 1LDTT 2RDLA 3FP6E 1VZQH 3LC5A 3K6YA 4MPUA 3DA9B 1VITH 1GI0A 4IN2A 2SGPE 4AORA 1ZMLA 2QXJA 1S83A 4ZXXH 1ANCA 4NA7A 2QXGA 2HVXA 2GCHG 1YM0A 2WINI 5FPTA 1H9IE 1DS2E 2PKAB 3AAVA 1C5PA 4ABJA 1ACBE 1A7SA 1A3EH 3GCOA 2STAE 4YESB 1DSUA 1E36B 3RXMA 5DKMA 2BD3A 3IITA 3OY5U 3L3TA 2ZQ2A 2BQ6B 1UTLM 4JYVH 2BB4A 2ZC9H 2Q6FA 1UCYK 2BY7X 1MU8B 1TLDA 1PFXC 2AGIX 1Y59T 3GICB 3QWCH 1W10U 1TMBH 5EW1H 2CJIA 1OKXA 2FOAA 3QDZB 3QX5H 3MO6A 4BANB 4D7FA 1LCYA 2BDIA 1HV7A 1EXFA 1GI1A 3GY4A 4ISIH 1WCZA 4Y8ZA 2BD7A 1T8MA 2FLRH 1AGJA 1MCTA 3EA7A 5T6GA 1LQEA 2R0LA 1WAYB 4YLUA 2TGPZ 4HZHA 5HXFA 5A0BA 1AFQB 4GUXA 1CHOG 1XUIA 4ABDA 1C5ZB 2ZFRH 3T26A 2GDDA 1LKAA 1FUJA 2RG3A 3MO9A 1BRUP 5F8XA 4AFQA 1IQFA 1OP2A 5JBTA 5BPEA 3E6PH 4B73A 1GBBA 1A3BH 1DUEA 1Q31A 2QN5T 1UTKA 3SU5A 1ELCA 1BBRH 1EAXA 3SGAE 4MNWA 1GHVH 4E06H 2W7SA 4U01A 1GHAG 3MTYA 3PWBA 3NWUA 1EPTA 4FUIA 3U8RH 1GJ6A 3M3SA 1QBNA 3MU5A 2PLXA 2BHGA 2F91A 7KMEH 2OUAA 2D8WA 3M3VA 5DP3A 3RXTA 4OS2A 5I25A 2WYJA 3LPRA 3RDZA 3LDXH 5L2YH 1EJNA 1BBRE 2EEKA 1HPGA 1AHTH 1GI5A 1HXEH 4UFFH 1EQ9A 3MH6A 3FP8E 1UTOA 1O3JA 4H4FA 3E1XB 1BQYA 1GI2A 1NC6A 5DP5A 1MUEB 3UWJH 3P8FA 3LONA 1LPGB 1S84A 1P2OA 1AKSA 1IQLA 2YNBA 3M5NA 1MTNC 1MH0A 3TGKE 1HAYB 1G2MA 3RXQA 4O3TA 1NO9H 2FS9A 3F6UH 1RJXB 5EQRA 5FX6A 1QRXA 4XOJA 2P3UB 1GJ4H 4JZDH 2ZHDA 2V6NA 1P2JA 1O39A 1H8IH 4XBCA 1MD7A 1KTSB 2Y80A 2PSXA 2H9TH 2PV9B 4YT6H 1J15A 3TGIE 3O8RA 1GHBG 2BX3A 1WTGH 5DGJA 4KKDA 3EQ0H 3SUDA 1GDUA 3BG8A 1PYTD 4I8JA 2AH4X 1DVAH 2EC9H 3F9HA 3LIWA 3UIRA 1DPOA 4MNXA 2HPQH 1J17T 1C5SA 1YGCH 1W2KH 3RMLH 3VEQB 2BXTH 1SGYE 3ZZ6A 3W95A 1UTJA 2WPHS 3BSQA 2ZGBH 4JMYA 1W13U 2W3KA 3ITIA 1ZTJA 5JB8S 2BVSH 1LHFH 2AGGX 3RXGA 4I8LA 1MU6B 1GJAB 3ZVEA 3RXDA 2PW8H 1O2YA 2F9VA 2G81E 1O5EH 4YT7H 5JYIA 1C2KA 2LNCA 1HJAC 3DUXH 1DSTA 4PROA 1N8OB 1W8BH 3RXIA