1LKAA

Porcine pancreatic elastase/ca-complex
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Elastase 1
publication title Metal binding to porcine pancreatic elastase: calcium or not calcium.
pubmed doi rcsb
molecule tags Hydrolase
total genus 61
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2002-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1lkaA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1lkaA01
3PWBA 1A7SA 2QF0A 1Z8IB 1EXFA 1ARBA 2PSXA 1FY8E 1O5EH 1QBVH 4IGDA 3TH3H 1TA2A 2GCTC 1CSOE 1A5HA 2WPHS 1G30B 3DT0H 1KXAA 1W11U 1T8LA 5EQQA 4CBNA 4HFPB 3GCTF 3EDXB 4XOJA 2HWLB 2FX4A 2ALPA 5EPNA 4ZHLU 1BMMH 1K1JA 4ABHA 1ZMLA 1TRMA 1TPSA 3BEFB 1FY5A 1T7CA 2ZDNA 4ZAEA 1NTPA 3RLYH 2ZGJA 4XBDA 3A7ZA 3LH3A 4FXGH 2BY5X 4ISHH 3UOUA 5A2MH 2VIQA 2C4FH 3I77A 1ARCA 2NU0E 1EZQA 2ZKSA 3Q00A 1EPTA 1SGPE 1NFYA 1PPHE 2ZU4A 1HGTH 1GI7B 3QZRA 4JZ1A 3URDA 2XNIA 2VB0A 2AMQA 1GHVH 1SOTA 5F03A 1IQLA 5TCAA 3GDVA 4DIIH 4YLQH 3LONA 3LOXA 5DKMA 2FTMA 3QO6A 2P8OC 4NIYA 3K2UA 1GHWH 1XVMA 2PGQB 4AFQA 3UFAA 5JB9S 4AFSA 1UCYE 4FUEA 4GPGA 4B2AA 1A5GH 3Q76A 1C2HA 5L2YH 2R0LA 2SNWA 1F0TA 4I8HA 3A85A 2ZEBA 2OBQA 1E37B 1L0ZA 3SV8A 4NGAH 1P9SA 4Y71A 3BTQE 1L1JA 1LHGH 2VVUA 1C5OH 2ZFQH 1O3KA 2BB4A 1GI0A 3UQOA 1GJ8B 2Z94A 1P05A 3RXQA 1O2UA 4ZKSU 4B74A 3TH2H 1C4U2 3RP2A 1B5GH 1IQFA 1GHBG 1DSUA 1EAWA 2A4GA 1C5VA 4X0WU 2IN2A 1S0RA 1GBLA 3GY7A 1VCWA 1AVWA 2CMYA 4FUCA 5T6DA 1ETTH 4NWLA 1GI8B 2BM2A 2BZAA 2JH0D 3TGJE 1DUAA 2XYAA 2V3OH 1ZGIA 2UUKB 1LO6A 1FONA 3MU4A 3TK5A 1E38B 2VGCC 3ZYEA 4ABGA 5I25A 2A4RA 2VINA 1SQTA 2FYQA 3A7TA 3ESTA 1AHTH 2ZU1A 1YPHE 1V2UT 2O8WA 3TGIE 2A2QH 2PUXB 2G55A 2XWAA 3BG4C 2WPIS 4QT8C 1C5LH 1AGJA 4FUFA 1INCA 1H9IE 2H9TH 5JBTA 3PYHA 1O3GA 1PYTC 1TGSZ 1BBRE 3TITA 1TA6A 1AQ7A 1SL3A 1GBAA 3HATH 8GCHF 1EPTC 2IJOB 3A7YA 2FOFA 5GPIB 1UTNA 1LVOA 4X2WA 1EB2A 1O3BA 3Q3KA 1DITH 3SJ9A 1IQNA 1HXFH 3NKKA 2ZU3A 1KXEA 1AVXA 7LPRA 1KTTB 1TMTH 1HAOH 2BD4A 2J94A 3SGBE 1EAXA 1TPPA 3A86A 2H2ZA 4JZFH 2BD2A 2P3TB 4FUBA 1EX3A 3MOCA 2VIVA 4WXVA 4X2VA 5PTPA 1C5SA 3BTEE 4NCYA 1CGIE 3SV2H 1BJUA 1ZTLA 5DP8A 1HAIH 4DY7B 1WQSA 1CA0C 2FOCA 1LMWB 1HJ8A 1YF4A 2PR3A 1KXBA 4IN2A 4Q7ZA 1QL9A 2SNVA 1BTPA 1DWEH 1EASA 1UHBA 3AASA 3SNAA 3TIUA 3RXVA 1O2LA 3A83A 3DD2H 3TLOA 1O38A 3QGJA 1ELFA 1BTHH 3VEQB 4FVDA 2SGFE 1D6RA 3T26A 4Y8ZA 1OWEA 1T4VH 1O2NA 3M5MA 2FTLE 1ZSLA 1WOFA 1EJMA 2ZCLP 5EW2H 4D76A 1OP0A 1JXPA 5JBBS 1TWXB 3HPTB 3RXFA 1CBWC 3LC3A 1K1PA 3SU4A 1P2OA 5F8XA 3K9XB 1DLKB 4DOQA 3CS0A 4IS5A 2OLGA 4F49A 2F83A 4ZKOU 1GMDF 1TQ7B 4THNH 3FANA 3ZZDA 2OUAA 1NFWA 3E8LA 5GWZA 1N1LA 2TIOA 2FYRA 1LHEH 3AAVA 1DOJA 4K8YA 1LHFH 1UO6A 2WPKS 5C3NA 2W3KA 2ZCHP 1TAWA 1TLDA 5J4SA 1RTLA 4H6SB 4VGCB 1O37A 1BTWA 1J14A 1TB6H 3KQCA 1GBBA 1C1SA 4ISNA 3ZZ6A 3OY5U 4MNWA 1DUEA 3E90B 4MQAA 1EZUC 1MKXH 2GCHG 2A7CA 3TJNA 3RM0H 2VH6A 1WCZA 4TPYA 4YTAA 1EOLA 1DS2E 3NZIA 1BTYA 1MCVA 1GL0E 2XCFA 3O8CA 2F9PA 1C5QA 1K22H 2ZU5A 1AFQC 3GY4A 1B0EA 1MKWH 1BMLA 1MBMA 3A8CA 3E91A 4WMEA 5FHTA 3VFEA 5A09A 3M3TA 1LDTT 1XUGA 2V35A 3ZZ7A 1GBTA 1UCYK 3A89A 4AG2A 1SGNE 1QIXB 4ZH8A 3LIWA 3A81A 4B75A 2HLCA 3QLPH 3M35A 1MD8A 4BTUB 2ZDMA 2BD7A 4MNXA 2QY0B 3RMMH 5DPAA 3GCHC 1RRKA 2WINI 4I8JA 2G5VA 4KP0A 4AB8A 1UTOA 1E0FD 5A8YA 1LPZB 3ZZ5A 1OKXA 2ZQ1A 2ZF0H 1J8AA 2FOHA 2VWOA 4XDEA 1GVLA 3JZ2B 3M36A 2CHAC 1QQUA 1DWCH 4YOGA 2R9PA 1SGCA 4WWYA 2B0FA 1TX8A 3KQBA 3LKWA 1JIRA 1HIAA 3SQEE 3BN9A 1P10A 1HRTH 4A92A 7ESTE 8KME2 2HNTF 2UWPA 1QGFA 2A1DB 3B8JA 3SU2A 3V3MA 2BYAX 2ZGXH 2XBVA 1UK2A 1IQMA 2HVXA 2P95A 3OY6U 3VGCC 1Y5UT 1TX7A 1DICA 1RIWC 1DY8A 4IMQA 1THRH 1O5FH 4MPUA 1KXDA 1GI3A 1TBRH 1L4ZA 3MH7A 3LPRA 1BBRK 2ZTYA 3Q3YA 1VJAU 2G4TA 2R0KA 2FPZA 2BD5A 2C8XB 1ZSKA 3NCLA 4SGAE 2P16A 3SO3A 1AWFH 1ZTJA 5C5OA 2CXVA 2J34A 3FZZA 1BTZA 1AMHA 3GDSA 3M7QA 1GGDB 2PSYA 1N8OC 1SGQE 1BMNH 1ELGA 2XBWA 3UOPA 3BTKE 4UDWH 1TALA 1Q3XA 1O35A 1ZOMA 2XC0A 1O3MA 1F5KU 2WYJA 5FCRA 4UE7H 1GG6C 2RG3A 1IQGA 3RC5A 1C4Y2 1MZAA 2ZDVH 3UNQA 4HZHA 3UQVA 1GWAA 1CGJE 2ZGBH 3GCNA 1ABIH 1EZSC 4K1EA 1P3CA 3SV9A 2Y5GA 1L4DA 1S83A 2PTCE 4GAWA 2CJIA 1A3BH 2Q6DA 4AGKA 1J9CH 2BD3A 2BQWB 1PQ8A 3ATIA 1K2I1 2A4OA 1PPBH 3SNBA 5A8ZA 3QN7A 1F5RA 4RSPA 2PV9B 3H7OA 1Q2WA 1O3AA 1EJAA 1XUJA 1Z8RA 2YOLA 1FV9A 3EYDA 1ZGVA 2QIQA 4XFQA 3O8BA 1GBKA 5LPRA 1F0RA 5DO4H 1C2IA 1SI5H 1E34B 3ZVDA 3RXMA 1EAUA 4K69A 1OYTH 1O2PA 3ZZBA 2VNTA 4X1RU 4BNRA 1AKSB 2FEQH 1PQAA 2G52A 4NFEA 1KDQB 1KYNA 2R2MB 4AX9H 5AVDA 1PPZA 1QURH 2UUYA 3ATMA 1RTFB 3S9AA 1C1TA 3PMBB 1OWHA 4WXIA 1V2NT 1CQQA 1ELDE 1ANDA 2BDYA 1QY6A 1G2MA 4B76A 4LZ4B 1A3EH 2PKSC 1C5WB 4ISIH 4A7IB 4WMFA 2FS9A 1P09A 3ZZ3A 1P11E 1Y3VA 1FAKH 2GV6A 1UTLM 1MD7A 4Y79A 2V3HH 5DGJA 1QB1A 3M7UA 2TRMA 3SV6A 1DFPA 1OS8A 1A5IA 3RU4E 1GHYH 1LQEA 2J95A 3A80A 4Q80A 2GMTC 8GCHG 1FPHH 1ANBA 1SGRE 2BDIA 1C2LA 1JWTA 1X7AC 2YNAA 3QUMP 4INHA 5F8TA 1O2OA 1ESTA 1ZPBA 1D3QB 1TIOA 1NFUA 1WTHD 3EA9A 5G4BA 1OP8A 6GCHF 1GCTB 5I46H 1C5MD 4ASHA 1EAIA 5EPYA 5DP6A 2G8TA 4AYYB 1CO7E 2R3UA 4B73A 1HAYB 1CE5A 1VJ9U 2P93A 1UJ1A 4PROA 1BHXF 4ISLA 1FIZA 1GI6A 1XXFA 4MNYA 4DG4A 2QXIA 3EA8A 4LZ1H 2ALVA 2B8OH 4Q7YA 3CS7A 3MU1A 5FXLA 2OTVA 1Y3UA 4CH2B 2GGVB 1THSH 3GYMA 1MBQA 1HV7A 1MTVA 3SNDA 5GDSH 3SU5A 1K1LA 2HPPH 2ANKH 3RXPA 2ZC9H 3D65E 2H9EH 2SFAA 5LPEA 2ZPRA 3TJUA 1TBQH 1G3BA 2GZ7A 3KEEA 1WQVH 3SBKA 4AYVB 1LVMA 4BAQB 1HYLA 2ANYA 1NRQH 1LVYA 5GIBA 4Z6AH 1SGTA 1C1OA 5C1YA 4O3UA 5J4QA 1O3DA 3UNSA 2QXHA 2A2XH 2QCYA 1O3OA 1BRBE 2KAIB 3HGNA 4MPVA 1Z7KA 3ZVBA 2ZFFH 1C9PA 3T62A 1FUJA 2F9BH 3UREA 3MO6A 3SUGA 3RXLA 1CHGA 4A5TS 2OXSA 5F6MA 2C8ZB 1YBWA 4KGAA 4ABDA 3ZVEA 4OS4A 1MU8B 4MNVA 5DK1A 3RLWH 1Z1JA 4Y6DA 3P95A 1ZYOA 3BG8A 2O8TA 1ZPCA 1TNLA 1JBUH 1F5LA 4FUGA 4FU7A 4CH8B 1XM1A 1CT0E 2OP9A 2GDEH 2ZDLA 1XUFA 1ELBA 4JZIA 2YNBA 1DXPA 2LPRA 4XSKU 1C4V2 1GMCG 3LT3A 1HAPH 5IDKA 2XBYA 3GCOA 1NN6A 4UEHH 4ABJA 1W12U 3U1IB 3RXEA 3CP7A 1TONA 3RXKA 3UR6A 1SLUB 3ZV8A 4O9VA 3HKJB 2VVVA 3MO9A 5A0AE 2VIPA 1FXYA 2PTNA 1XVOA 4WVPE 1LKAA 1C5YB 1PPEE 1A4WH 4F4OC 2TGAA 2Y5HA 4CRBA 1AUJA 1Z6EA 1YCPM 3P6ZB 1ETRH 4KTUA 2FESH 4X6OA 4BAHB 1O2XA 3VB3A 3SOSA 2GKVE 1JOUB 1T32A 3A7XA 5TCCA 1S6FA 2Z7FE 4NIVA 3RXBA 5L30H 3M5LA 4IW4E 4J1YA 3U8TH 1B7XB 2BLWA 2BXUH 1W10U 2GCTB 3BTWE 2UWLA 3BTHE 1WV7H 2Y80A 3LGTA 2FDAA 2ODYB 5HXFA 1JRSA 1UTJA 1XKAC 1K28D 3Q3XA 1C2JA 3QZQA 1C5UA 2HNTE 1SGDE 2P3FH 3QGNB 2VJ1A 2G00A 3F9FA 5GCHG 3QTVH 4K60A 3SJIA 5ABWA 2ZHDA 1VR1H 1UVSH 1Y3WA 1FZZA 4GLYA 2B9LA 5EW1H 3UTUH 1HLTH 1QA0A 3KQEA 4O3TA 3OU0A 1W7XH 1SHHB 1H4WA 1ZHPA 3C27B 4YO9A 1G3DA 2GP9B 2BLOA 1O3JA 1HAXB 1AZ8A 1H9HE 4DJZB 4IC6A 3E6PH 1TMUH 1C2FA 4O03A 4TYDA 1O0DH 4ZUHA 1O3LA 4CHAC 2UUFB 2A32A 1Z8JB 3KNXA 2TGDA 1HJAB 4X6MA 2OQ5A 1C1PA 1D4PB 5JDUB 2EI7A 2QA9E 3ZZ9A 1NC6A 3ZVCA 3V12A 2PUQH 2SGPE 2DE8A 1NRRH 4FUDA 5C1UA 3BIVH 2ZFRH 3ZZ8A 2A5AA 1V2OT 4Y76A 3F68H 1VITF 4AFUA 2H6MA 1O39A 2ZDKA 4E05H 2F9UA 4X6NA 1PYTD 1C5ZB 1GJBB 3V13A 3VB6A 4WH8A 2IPHA 2A45B 2ZFPH 4IN1A 1UVTH 4VGCC 2QF3A 5AFZH 1NPMA 1MTWA 3A8DA 3A8BA 3P8FA 1GJAB 5C5NA 1C9TA 2ZHWH 4JMYA 1Q31A 4HGCA 1NESE 1O2SA 2AGGX 3SU6A 1VITH 3SU0A 3BIUH 5CE1A 2VGCB 3M61U 1QRZA 4H42U 1S82A 5T6GA 4GHQA 2PLXA 1WAYB 3F9GA 1GJDB 4K3JA 2JETC 1OWDA 1YPEH 2Z3CA 1O5DH 3NXPA 2ODPA 3BG4B 1FMGA 1C1QA 1TRYA 4FU8A 1VZQH 2XC4A 3V7TA 3UPEA 1P2NA 6LPRA 1K21H 2Q1JA 3P8NA 3UR9A 1XXDA 2QC2A 1ACBE 1D9IA 1SSXA 2Z9IA 3RXHA 1GI2A 3PROA 2AGIX 1GHAG 4Q2KA 2TGPZ 3A7VA 3A88A 2ZI2H 2BDAA 3P92A 3MH4A 1O3PB 3M7TA 2Q6FA 5CHAB 1QRXA 3RMOH 4UFGH 1E35B 1MKWK 4U01A 5BPEA 1NU9A 3S0NA 2HNTC 4Y7AA 1O5BB 4AB9A 3DFJA 2LNCA 4JK6A 3RXJA 2J2UA 4Y0YE 1OWKA 3TVJB 4CRFA 3N7OA 2SGAA 2B7DH 4K1SA 1V2RT 4A1VA 1ZSJA 1V2MT 3EE0B 4JYVH 3P70B 1DY9A 1U6QA 1PPCE 2ZO3H 4NWKA 6GCHG 1GMCF 1CHOG 2CGAA 3L3TA 2AERH 1N6XA 4MVNA 6CHAB 1BRUP 1MU6B 4D8NA 7KMEH 2O8LA 1XKBC 1ELTA 5EQSA 1GBJA 3HKIB 2QAAA 1DLEA 1GI1A 1C2MA 5A0CA 2ZNKH 3PV4A 2NU1E 4AFZA 5DG6A 1GBDA 1AKSA 1GMHF 1P12E 2PFEA 3MO3A 5HMAA 4R0IA 2Z3EA 3VPKA 1KDQA 1LPKB 1S0QA 2I6SA 2GV7A 1W0ZU 4E06H 1PQ5A 3LGYA 4ISOA 1C1UH 3Q77A 1FY1A 3D23A 3W94A 1CT2E 1ZLRA 1O31A 3RXAA 2A4QA 4CRAA 2BQ7B 1WSSH 2BVRH 2ZG0H 5HM9A 3KHVA 3ZVAA 4BXSA 2BVXH 1C1NA 1NU7B 2R3YA 1MMJN 2ZHFH 1TGNA 4OGXA 3PWCA 4O97A 2AIQA 5EODA 4MG3A 1FPCH 3PLKA 3LJJA 2AEIH 1GBIA 1GGDC 1AFEH 1RS0A 2J92A 3MH6A 3ITIA 3PO1B 2G81E 2J38A 3AW1A 1O2HA 3RXIA 1HFDA 4ABFA 3LGWA 5DP4A 1O30A 1QJ1B 3SJ8A 1V2LT 1UVOA 2OC0A 1NFXA 3QTOH 5E8EH 1C5PA 3RUOA 3CENA 2FO9A 2W7SA 4A1XA 5T6FA 1QQ4A 1IQIA 2BZ6H 1F92A 2QXJA 1DANH 5HGGA 2ZTZA 1O2MA 1YPGH 1ANCA 2F9NA 4AN7A 5FCKA 5K0HA 3GYLB 4TPIZ 1EJNA 5GCHF 2V0BA 4E7RG 1AFQB 1G32B 2WPMS 3SJOA 4NSVA 3SZNA 1O2KA 5ETXA 1BJVA 5FX5A 2VVCA 2GT8A 4X8SH 4JK5A 2WPJS 4H4FA 1ZR0A 4ABIA 2STBE 2ULLA 3TNTA 3AW0A 2A7HA 1W13U 4CRGA 1TPAE 1O2QA 1DPOA 3GY8A 1C5RA 3GISB 3U9AH 1HCGA 2BX4A 1ORFA 5T3HA 1UK4A 1YCPK 1GI4A 1CVWH 5E0HA 4ZXXH 4INKA 2AGEX 3SHCH 3ENSB 4OS5A 3A8AA 1A46H 3ATKA 1TMBH 1BUIA 1L1NA 1GI9B 4FU9A 1ETSH 1F0SA 1QA7A 3C1KA 1AY6H 5FPYA 2ZGCA 4ZKNU 1VGCC 2KAIA 1O5AB 4Z0KA 1BCUH 1FNIA 4AGJA 4KKDA 1LVBA 1J17T 1TNHA 1TNJA 1QRWA 4AZ2B 3SUFA 1WTGH 1AN1E 2XW9A 4ZROA 2NU3E 3SU3A 1BOQA 2WUCA 1IQHA 1W8BH 4UONA 3RXUA 4JYUH 4B2CA 1SHYA 4J2YB 5FBEA 1NROH 3KGPA 1DWBH 1MTNB 1NT1A 4AG1A 3SORA 3LJOA 1Y5BT 2UUJB 1UK3A 1VCPA 3KIDU 3SN8A 2O9QA 2BY7X 1P04A 3U1JB 1T4UH 2XTTB 1G37A 1V6DA 2F91A 1BQYA 1GL1A 1BBRH 2PKAB 3DA9B 3SUEA 1RIWB 3MHWU 1V2KT 3M37A 3AAUA 4M7GA 2D8WA 3GY5A 1NRSH 2H1UA 1BTXA 1GDNA 7GCHF 4MTBA 3RXRA 1SLVB 1C1WH 1G9IE 2Z9LA 1O2ZA 2BXTH 1O3CA 4I8LA 2OC7A 3STIA 1W0YH 1XMNB 2W7UA 5GXPA 1QFKH 4GCHF 1UMAH 2HOBA 2OCVB 5H4IB 4ZXYH 1GHAF 2C8WB 1N8OB 1RTKA 2AS9A 2ZHQH 5LH8A 3A84A 1TNGA 4I33A 2CV3A 1BA8B 2ZDAH 5AFYH 4UFDH 5GJ4B 4JYTA 1ELVA 1ESBA 4OS7A 2OD3B 1ZMNA 2FS8A 2AH4X 2FP7B 3S7KB 1VCQA 1GG6B 1GCDA 1P06A 4X1NU 1ID5H 3RXOA 1A0JA 1N6YA 5DP9A 1SQOA 1OOKB 3MU5A 2Z9KA 3FVFB 4LK4A 1SMFE 3SJKA 2PW8H 1SLXB 1ZJDA 1TX6A 3SNCA 1H9LB 1C2DA 1CHOF 3E0PB 4GVUA 1EKBB 1IQKA 1C1VH 1ELEE 2AIPA 4NG9H 1VITG 3ZYDA 1UTKA 3RU4T 4DVAU 3UWIA 4Y10E 5C20A 1C2GA 1IHTH 1O3HA 4IC5A 2FOBA 2P3UB 1ZRKA 1GJ7B 1AB9B 1Y59T 1MQ5A 1S81A 1Z8GA 2A5IA 1YLDA 4OS6A 1K9OE 4I8GA 1HAVB 2FI3E 1O36A 3UIRA 3RMLH 2BDBA 4BXWA 2WV4A 3TJOA 4GSOA 5AHGH 4YESB 1AE5A 1C5NH 1THPB 1RXPA 2VWLA 1L2EA 4YOJA 1MUEB 5TJXA 3KF2A 4FVBA 4I32A 1Y5AT 2J4IA 3E1XB 3K6ZA 1QB6A 4Y8XA 3GDUA 6ESTA 1SC8U 3ODFA 4JZEH 5E0GA 2FOEA 3BEIB 1HXEH 1BDAA 4NIWA 4ABEA 2PKSB 2J9NA 1K1OA 4MPXA 5SGAE 5E0JA 3L33A 3TK9A 1O3FA 2ZTXA 3F1SB 2QGRA 2BD9A 4R8TB 1MTUA 3QX5H 1W7GH 1IAUA 1G3EA 1BITA 3HK6B 2Y81A 1AVGH 1KIGH 2GMTB 1BB0B 2FLBH 2IOTA 1YLCA 4FUIA 4YLUA 4A1TA 2UWOA 3KL6A 3SHAH 1HUTH 1BTUA 1LTOA 5C2ZA 4HI3A 4YZUA 1V2PT 4XBBA 5ESBA 1GJ6A 2PGBB 3SUDA 1AD8H 1RD3B 1PQ7A 1K1MA 4Y0ZE 2AYWA 3ZZCA 2CF9H 1YYY1 5F8ZA 3LGUA 2ZGHA 1FI8A 3I78A 1V2JT 1PPGE 1D3TB 3RXSA 4CR5A 1HJ9A 1S5SA 1F2SE 3TPIZ 1FIWA 2FX6A 1A0HB 4XBCA 1V2TT 1SFQB 2O8MA 3PLBA 4OS2A 3EQ0H 4TY7A 1KXCA 3BTFE 1QBNA 2F3CE 3FP6E 3LH1A 3B23B 3K6YA 2C90B 4OGYA 1O2GH 4Y8YA 4ABBA 1GMHG 5HM2A 3JZ1B 1ABJH 3IWMA 2H9HA 5IYTA 4BAMB 4BTIB 2V6NA 2XWBI 1QR3E 2FI5E 1QL7A 3TGKE 3ELAH 3OX7U 1EB1H 1NS3A 4X1PU 4WH6A 1DX5M 2EA3A 3MNCA 3I29A 3SI4H 1T8OA 2NWNA 2ZQ2A 1LQDB 5JYIA 3E16B 1YC0A 2BMGB 4YM9A 1O2WA 2BDCA 2BOHB 1ZHMA 2ZPQA 5DP7A 2VH0A 3T29A 1OXGA 2ZECA 3T2NA 3S9CA 1H8DH 3RU4D 3MMGA 3RXTA 3T5FH 1DE7H 3MNXA 1WUNH 1P2JA 1HAHH 3S7HB 3RMNH 1YGCH 3FP8E 1NRPH 1FY4A 1P57B 3ZVFA 2RA3A 1IQJA 1Y3XA 3H7TA 5C67A 1O3NA 2ZZUH 1HJAC 3MU8A 4E7NA 3T27A 1O33A 4ZKRU 2HPQH 3HK3B 2ZFSA 1EATA 1MH0A 1GJCB 4H6TA 2W26A 2RA0A 2XCNA 5L6NH 1GDUA 1MQ6A 1FDPA 8ESTE 3AVZA 2A5KA 1FN6A 3O8RA 3DUXH 1O2JA 5EXMA 1SPJA 4AOQA 2RDLA 2FOAA 1ZJKA 2SGDE 1GBHA 1QJ7B 4DW2U 3GY6A 4UFFH 1EP5A 2DE9A 2FOMB 4TWWA 3MNBA 1FJSA 1EQ9A 4FUJA 2P8OB 1HAGE 1TFXA 1YKTA 2BVSH 2FIRH 3BF6H 1MZDA 1HB0B 1SQAA 1OWJA 1TNIA 3P8GA 1GHZA 3RC6A 2NU4E 4X2YA 1G3CA 1GBFA 1QJ6B 3SU1A 1ESAA 1C5TA 2ZU2A 3MH5A 1XUKA 1LCYA 3LU9B 1E36B 1SOZA 4AORA 4SGBE 2GZ9A 4CR9A 1XX9A 2HALA 1KLJH 4I7YH 4Y11E 3RXCA 1OSSA 3BTME 3MTYA 2VU8E 3FZDA 1HAZB 2SGQE 2VIOA 5CHAC 2BDGA 3SV7A 1SVPA 1CA8B 3QK1A 4BTTB 2FZZA 1A1RA 1YP9A 1SLWB 3GOVB 4YT6H 1D3PB 2VWNA 1DM4B 5JBAS 1XUHA 2BD8A 1QL8A 3SW2B 1GVKB 3GY3A 5L2ZH 1CT4E 1DWDH 3RDZA 3A82A 3URCA 3LC5A 3STJA 2ZFTA 1J15A 3B9FH 5DJ7A 7GCHG 3SGAE 6CHAC 4UD9H 2ZHEH 1GI5A 3IG6B 1P03A 3W95A 1C1RA 1BZXE 1TE0A 3SQHE 1LPGB 1MKXK 1SGEE 1FAXA 1AZZA 4GCHG 1G2LA 1C2KA 2WYGA 4CHAB 1TABE 1UVPA 3EA7A 4WJG2 1A0LA 3VB4A 4NA7A 4RN6A 3M5OA 1F0UA 1C1MA 3P17H 1EPTB 1C2EA 2BOKA 2W3IA 1TPOA 3GICB 2A31A 4U32A 2QN5T 4JZDH 3BTDE 1EZXC 3T28A 3M3SA 1KLIH 3MNSA 4CREA 3F9EA 1ZZZA 4NFFA 3RC4A 1GBEA 1ZMJA 3ZZAA 1JIMA 1O5GH 5FAHA 2JH6D 3OYPA 3MFJA 2FXRA 1V3XA 1MAYA 8LPRA 3H5CB 5K7RA 2P94A 1DXWA 2OQUA 5ESTE 2AMDA 1GBCA 2W5EA 4GUXA 3TH4H 1CA0B 2PKAA 3V0XA 3ZV9A 5A8XA 3ZVGA 2ZPSA 1KXFA 1YM0A 3P8OA 3PO1C 3M5NA 2C3SA 2F9OA 1FQ3A 1V2VT 5JB8S 1BT7A 1IQEA 1Y8TA 5BRRE 3BTTE 4NIXA 1OYQA 5EU8A 1TNKA 2OC1A 1UTQA 2H5CA 2CF8H 1MCTA 4INLA 1G36A 1YPHC 3ATWA 3TNSA 1Z6JH 3F9HA 2BTCE 3S9BA 1ZPZA 2Y7XA 4MDSA 1KLTA 3KQDA 4U2WA 5JPMH 3MU0A 2B5TB 2WV5A 1T31A 1S6HA 1GJ4H 1A61H 2Y5FA 2JETB 2Z9JA 1V2QT 5EG4A 1YPLH 2BY8X 3TK6A 2TGTA 1H1BA 1CBWB 2NU2E 1UTPA 4BAOB 3ATLA 1A2CH 1O2YA 2OINA 1HPGA 1MTSA 1OPHB 4JCNA 3LGVA 3UUZA 1S85A 4D7FA 3D62A 2O8UA 4NA9H 2ZP0H 2Z6BD 4Y7BA 3NK8A 2ANWA 1HBTH 1M9UA 2G5NA 4CRCA 2ANMH 2BY6X 2STAE 1TYNA 1EP6A 1QNJA 1NZQH 1SBWA 1BRAA 5JBCS 5FPTA 2GZ8A 2QV1A 3L6PA 2EI6A 2OBOA 3OSYA 3FP7E 1O2IA 1Z1IA 1RGQA 1ELAA 2AFQB 4IBLH 2ZIQH 1GBMA 3KN2A 4FUHA 4HTCH 2BQ6B 2C8YB 2WUBA 1L1GA 4YOIA 1O2VA 2XXLA 1OX1A 2FWWA 1SGYE 2ZCKP 1C5XB 2K1QA 1UCYH 2FODA 3MYWA 2Q6GA 2M5TA 4ZHMU 1WBGB 3VXEH 1MTNC 1HAVA 4ESTE 2VIWA 3TU7H 1IHSH 3M3VA 1AWHB 3O8DA 4I8KA 2BX3A 2TBSA 3SI3H 3E3TA 3VB7A 1LHDH 1ZRBA 1GHBF 1SB1H 3BEUA 1BMAA 5FPSA 2ASUB 1QTFA 2XRCA 5C1XA 3MWIU 4D9RA 2RCEA 4NA8A 2D1JA 4LXBH 3BTGE 1NY22 4RKOB 4DURA 2Y82A 2D26C 1TOCB 1BIOA 4B1TA 1S84A 3GCTG 3U69H 2A7JA 2C93B 5EXNA 3SNEA 3GCHB 4X2XA 9LPRA 1YPMH 1UHBB 2ZA5A 4DIHH 1P0SH 1T8MA 1W3CA 2EI8A 2JKHA 4X1SU 3RXGA 3E0NB 4KTSA 1P01A 1SR5C 4K8BA 1O32A 1RFNA 1SGIB 2CHAB 3U8OH 2FLRH 5LGOA 4RKJB 2JH5D 2Z9GA 1AUTC 3PTNA 1GJ9B 1J16A 1GHXH 1DDJA 2VIDA 2OC8A 1TRNA 2G51A 2G4UA 3FFGA 3OTJE 4YT7H 1AI8H 1YPKH 1TBZH 1AO5A 3PM3A 4XE4A 3VB5A 3BSQA 2BDHA 1O2TA 1W14U 4B2BA 5HYOA 2FMJA 4MPWA 4UFEH 2GT7A 2ZWLH 1AE8H 2SGEE 3BV9B 4X6PA 4WF8A 4DGJA 3WY8A 1TGBA 1DSTA 1V2WT 3U98H 3VGCB 1O5CB 1BRCE 1QCPA 1OP2A 3G01A 3QWCH 2HRVA 2PWXA 1YCPH 1DT2A 3RM2H 1O34A 1RJXB 2FI4E 1P2KA 1TGTA 3KCGH 4K2YA 1GCTC 4BANB 4OS1A 2AMPA 5E2OA 5EQRA 3TJVA 3VXFH 1F7ZA 3PMJA 1WYKA 2XBXA 4ABAA 4D9QA 3UY9A 5A0BA 2Z3DA 1QHRB 5LPFA 2A0QB 1PPFE 1CU1A 1KSNA 3NWUA 2Y7ZA 4DCDA 1P8VC 1O3EA 1O3IA 2EEKA 2WPLS 1CGHA 1AB9C 3T25A 4CRDA 1TGCA 4LOYH 1W2KH 2QYIA 5B6OA 4NZQA 1Y3YA 4NZLA 4X1QU 1SGFG 3A87A 3DHKH 1ANEA 1ELCA 3PMHB 2ODQA 3RXDA 1VGCB 3EAJA 4X8VH 3EGKH 2Y6TA 2QXGA 1ZHRA 1UVUH 3ZZ4A 2R2WU 3R0FA 4X8TH 1KTSB 3LGIA 5EXLA 4DT7B 1O2RA 2GX4A 1P9UA 4U30A 4KTCA 2GVFA 1UTMA 2BHGA 1V2ST 4K5ZA 2BY9X 2CN0H 1BHXB 4IMZA 2BLQA 1LKBA 1NO9H 5CMXH 1NRNH 1SGFA 4D7GA 3D49H 1EOJA 3PB1E 2HGTH 2DUCA 3HGPA 2GDDA 4MLFB 5FX6A 4TWYA 3UNRA 3PLPA 3K65B 1MAXA 4CBOA 2ESTE 1P3EA 4WMDA 4GHTA 1GJ5H 4BOHA 9ESTA 1GVZA 1HIAB 1JMOH 4X8UH 5DP3A 1D6WA 2H5DA 2GCHF 1EUFA 2D2DA 4WY3A 1PJPA 1FLEE 2PHBA 2P59A 2ILNA 3DFLA 1AU8A 3F6UH 2BLVA 4KELA 1T8NA 4I31A 4ZMAH 4B71A 2THFB 3PTBA 1P2QA 2I6QA 3ODDA 1YPJH 1LHCH 1D3DB 2GD4B 2FOGA 1XUIA 1GPZA 1PFXC 1JRTA 3FAOA 3UWJH 3GY2A 1QB9A 2VWMA 1TOMH 1SG8B 1K1NA 4Q7XA 5EOKA 4NSYA 1GDQA 1P2MA 1SFIA 1K1IA 3S69A 1WU1A 1TQ0B 1HDTH 1QBOA 3NUMA 1ZTKA 3QDZB 2FM2A 1IOEA 3LDXH 2XC5A 2GTBA 1NM6A 1P2IA 5EGMA 3SGQE 1OWIA 4A6LA 3U8RH 1KY9A 5E2PA 3NPSA 3R3GB 3A7WA 2TPIZ 3IITA 5DP5A 3MI4A 1P02A 1DVAH 1Z71A 1HNEE 4TY6A 1GMDG 5AF9H 1FN8A 2EC9H 1B0FA 4BAKB 1FY3A 4ZHAA 4K1TA 3PMAB 2F9VA 1H8IH 5FBIA 1AIXH
chains in the Genus database with same CATH superfamily
3PWBA 1A7SA 2QF0A 1Z8IB 1EXFA 4RI0A 1ARBA 2PSXA 1FY8E 1O5EH 1QBVH 4IGDA 3TH3H 1TA2A 2GCTC 1CSOE 1A5HA 2WPHS 1G30B 3DT0H 1KXAA 1W11U 1T8LA 5EQQA 4CBNA 4HFPB 1KMHB 3GCTF 3EDXB 3F2FA 4XOJA 2CK3D 2HWLB 2FX4A 2ALPA 5EPNA 4ZHLU 1BMMH 1K1JA 4ABHA 1ZMLA 1TRMA 4F48B 1TPSA 3BEFB 1FY5A 1T7CA 2ZDNA 4ZAEA 1NTPA 3RLYH 2ZGJA 2WV9A 4XBDA 3A7ZA 3LH3A 4FXGH 1BMFD 2BY5X 4ISHH 3UOUA 5A2MH 2VIQA 2C4FH 3I77A 1ARCA 2NU0E 3VG8A 1EZQA 2ZKSA 3Q00A 1EPTA 1SGPE 1NFYA 1PPHE 2ZU4A 1HGTH 1GI7B 3QZRA 4JZ1A 3URDA 2XNIA 2VB0A 2AMQA 1GHVH 1SOTA 5F03A 1IQLA 5TCAA 3GDVA 4DIIH 4YLQH 3LONA 3LOXA 5DKMA 2FTMA 3QO6A 2P8OC 4NIYA 3K2UA 1GHWH 1XVMA 2PGQB 4AFQA 3UFAA 5JB9S 4AFSA 1UCYE 4FUEA 4GPGA 4B2AA 1A5GH 3Q76A 1C2HA 5L2YH 2R0LA 2SNWA 3WWBA 1F0TA 4I8HA 3A85A 2ZEBA 2OBQA 1E37B 1L0ZA 3SV8A 4NGAH 1P9SA 4Y71A 3BTQE 1L1JA 3OFND 1LHGH 3WW7A 2VVUA 1C5OH 2ZFQH 1O3KA 2BB4A 1GI0A 3UQOA 1GJ8B 2Z94A 1P05A 3RXQA 1O2UA 4ZKSU 4B74A 3TH2H 1C4U2 3RP2A 1B5GH 1IQFA 1GHBG 1DSUA 1EAWA 2A4GA 1C5VA 4X0WU 2IN2A 1S0RA 1GBLA 3GY7A 1VCWA 1AVWA 2CMYA 4FUCA 5T6DA 1ETTH 4NWLA 1GI8B 2BM2A 2BZAA 2JH0D 3TGJE 1DUAA 2XYAA 2QE7D 2V3OH 1ZGIA 2UUKB 1LO6A 1FONA 3MU4A 3TK5A 1E38B 2VGCC 3ZYEA 4ABGA 5I25A 2A4RA 2VINA 1SQTA 5HIYA 2FYQA 3A7TA 2J98A 3ESTA 1AHTH 2ZU1A 1YPHE 1V2UT 2O8WA 3TGIE 2A2QH 2PUXB 3UAIC 4Q63A 2G55A 2XWAA 3BG4C 2WPIS 5EJLA 4QT8C 5EJ1A 1C5LH 1AGJA 4FUFA 1INCA 1H9IE 2H9TH 5JBTA 3PYHA 1O3GA 1PYTC 1TGSZ 1BBRE 3TITA 1TA6A 1AQ7A 1SL3A 1GBAA 3HATH 8GCHF 1EPTC 2IJOB 3A7YA 2FOFA 5GPIB 1UTNA 1LVOA 4X2WA 1EB2A 1O3BA 3Q3KA 1DITH 3SJ9A 1YWUA 1IQNA 1HXFH 3NKKA 3KQ5A 2ZU3A 1KXEA 1AVXA 7LPRA 1KTTB 1TMTH 1HAOH 2BD4A 2J94A 3SGBE 1EAXA 1TPPA 3A86A 2H2ZA 4JZFH 2BD2A 2P3TB 4FUBA 1EX3A 3MOCA 2VIVA 4WXVA 4X2VA 5PTPA 1C5SA 3BTEE 4NCYA 1CGIE 3SV2H 1BJUA 1ZTLA 5DP8A 1HAIH 4DY7B 1WQSA 1CA0C 2FOCA 1LMWB 1HJ8A 1YF4A 2PR3A 1KXBA 4IN2A 4Q7ZA 1QL9A 2SNVA 1BTPA 1DWEH 1EASA 1UHBA 3AASA 3SNAA 3TIUA 3RXVA 1O2LA 3A83A 3DD2H 3TLOA 1O38A 3QGJA 1ELFA 1BTHH 3VEQB 4FVDA 2SGFE 1D6RA 3T26A 4Y8ZA 1OWEA 1T4VH 1O2NA 3M5MA 2FTLE 1ZSLA 1WOFA 1EJMA 2ZCLP 3OE7D 5EW2H 4D76A 1OP0A 1JXPA 5JBBS 1TWXB 3HPTB 3RXFA 1CBWC 3LC3A 1K1PA 3SU4A 1P2OA 3GS9A 3K9XB 5F8XA 1DLKB 4DOQA 3CS0A 4IS5A 2OLGA 4F49A 2F83A 2EQNA 4ZKOU 1GMDF 1TQ7B 4THNH 3FANA 3ZZDA 2OUAA 1NFWA 3E8LA 5GWZA 1N1LA 2TIOA 2FYRA 1LHEH 3AAVA 1DOJA 2IJD1 4K8YA 1LHFH 1UO6A 2WPKS 3N99A 5C3NA 2W3KA 2ZCHP 1TAWA 1TLDA 5J4SA 1RTLA 4H6SB 4VGCB 1SKYE 3FO8D 1O37A 1BTWA 1J14A 1TB6H 3KQCA 1GBBA 1C1SA 4ISNA 3ZZ6A 3OY5U 4MNWA 1DUEA 3E90B 2KCAA 4MQAA 1EZUC 1MKXH 2GCHG 2A7CA 3TJNA 3RM0H 2VH6A 1WCZA 4TPYA 4YTAA 1EOLA 1DS2E 2WZQA 3NZIA 1BTYA 1MCVA 1GL0E 2XCFA 3O8CA 2F9PA 1C5QA 1K22H 2ZU5A 1AFQC 3GY4A 2HVYB 1B0EA 1MKWH 1BMLA 1MBMA 3A8CA 3E91A 4WMEA 5FHTA 3VFEA 5A09A 3M3TA 1LDTT 1XUGA 2V35A 3ZZ7A 1GBTA 1UCYK 3A89A 4AG2A 1SGNE 1QIXB 4ZH8A 3LIWA 3A81A 4B75A 2HLCA 3FKSD 3QLPH 3M35A 1MD8A 4BTUB 2ZDMA 2BD7A 4MNXA 2QY0B 3RMMH 5DPAA 3GCHC 1RRKA 2EY4C 2WINI 4I8JA 2G5VA 4KP0A 4AB8A 1UTOA 3OEHD 1E0FD 5A8YA 1LPZB 3ZZ5A 1OKXA 2ZQ1A 2ZF0H 1J8AA 2FOHA 2VWOA 4XDEA 1GVLA 2XOKD 3JZ2B 3M36A 1NBMD 2CHAC 1QQUA 1DWCH 4YOGA 2R9PA 1SGCA 3F2GA 4WWYA 2B0FA 4ZCNA 1TX8A 3KQBA 3LKWA 1JIRA 1HIAA 3SQEE 3BN9A 1P10A 3DSPA 1HRTH 4A92A 7ESTE 8KME2 2HNTF 2UWPA 1QGFA 2YMSC 2A1DB 3B8JA 3SU2A 3V3MA 2BYAX 2ZGXH 4OM9A 2XBVA 1UK2A 1IQMA 2HVXA 2P95A 3OY6U 3VGCC 1Y5UT 1TX7A 1DICA 1RIWC 1DY8A 4IMQA 3WWFA 1THRH 3NRLA 1O5FH 4MPUA 1KXDA 1GI3A 1TBRH 2OK5A 2V7QD 1L4ZA 3MH7A 2KZ4A 3LPRA 1BBRK 2ZTYA 3Q3YA 1VJAU 2G4TA 2R0KA 2FPZA 2BD5A 2C8XB 1ZSKA 3NCLA 4SGAE 2P16A 3SO3A 1AWFH 1ZTJA 4B6FA 2RFKC 5C5OA 2CXVA 2J34A 3FZZA 1BTZA 1AMHA 3GDSA 3M7QA 1GGDB 2PSYA 5C0UA 1N8OC 1SGQE 1BMNH 1ELGA 2KCPA 2XBWA 3UOPA 4RT1A 3BTKE 4UDWH 1TALA 1Q3XA 1O35A 1ZOMA 2XC0A 1O3MA 1F5KU 2WYJA 5FCRA 4UE7H 1GG6C 2RG3A 1IQGA 3RC5A 1C4Y2 5T1VA 1MZAA 2ZDVH 3UNQA 4HZHA 3UQVA 1GWAA 1CGJE 2ZGBH 3GCNA 1ABIH 1EZSC 4K1EA 5GNDA 1P3CA 3SV9A 2Y5GA 1L4DA 1S83A 2PTCE 4GAWA 2CJIA 1A3BH 2Q6DA 4AGKA 1J9CH 2BD3A 2BQWB 1PQ8A 3ATIA 1K2I1 2A4OA 1PPBH 3SNBA 5A8ZA 3QN7A 1F5RA 4RSPA 2PV9B 3H7OA 1Q2WA 2F4LA 1O3AA 1EJAA 1XUJA 1Z8RA 2YOLA 1FV9A 3EYDA 1ZGVA 2QIQA 4XFQA 3O8BA 1GBKA 5LPRA 1F0RA 5DO4H 1C2IA 1SI5H 1E34B 3ZVDA 3RXMA 1EAUA 4K69A 1OYTH 1O2PA 3ZZBA 2VNTA 4X1RU 4BNRA 1AKSB 2FEQH 1PQAA 2G52A 4NFEA 1KDQB 1KYNA 2R2MB 4AX9H 5AVDA 1PPZA 1QURH 2UUYA 3ATMA 1QZ8A 1RTFB 3S9AA 1C1TA 3PMBB 1OWHA 4WXIA 1V2NT 1CQQA 1ELDE 1ANDA 2BDYA 1QY6A 1G2MA 4B76A 4LZ4B 1A3EH 2PKSC 1C5WB 4ISIH 4A7IB 4WMFA 2FS9A 1P09A 3ZZ3A 1P11E 1Y3VA 1FAKH 2GV6A 1UTLM 1MD7A 4Y79A 2V3HH 5DGJA 1QB1A 4Z1MD 3M7UA 2TRMA 3SV6A 1DFPA 1OS8A 1A5IA 3RU4E 1GHYH 1LQEA 2J95A 3A80A 3F0OA 4Q80A 2GMTC 8GCHG 1FPHH 1ANBA 1SGRE 2BDIA 1C2LA 1JWTA 4DT4A 1X7AC 2YNAA 3QUMP 4INHA 5F8TA 1O2OA 1ESTA 1ZPBA 1D3QB 1TIOA 1NFUA 1WTHD 3EA9A 5G4BA 1UW7A 1OP8A 6GCHF 1GCTB 5I46H 2JJ1D 1C5MD 4ASHA 1EAIA 5EPYA 5DP6A 2G8TA 4AYYB 1CO7E 2R3UA 4B73A 1HAYB 1CE5A 1VJ9U 2P93A 1UJ1A 4PROA 1BHXF 4ISLA 1FIZA 1GI6A 1XXFA 4MNYA 4DG4A 2QXIA 3EA8A 4LZ1H 2L74A 2ALVA 2B8OH 4Q7YA 3CS7A 3MU1A 5FXLA 2OTVA 1Y3UA 4CH2B 2GGVB 1THSH 3GYMA 1MBQA 1HV7A 1MTVA 3SNDA 1H8ED 5GDSH 3SU5A 1K1LA 2HPPH 2ANKH 3RXPA 2ZC9H 3D65E 2H9EH 2SFAA 5LPEA 2ZPRA 5B6LA 3TJUA 1TBQH 1G3BA 2GZ7A 3CNRA 1WQVH 3KEEA 3SBKA 4AYVB 1LVMA 4BAQB 1HYLA 2ANYA 1NRQH 1LVYA 5GIBA 4Z6AH 1SGTA 1C1OA 5C1YA 4O3UA 5J4QA 1O3DA 3UNSA 2QXHA 2A2XH 2QCYA 1O3OA 1BRBE 2KAIB 3HGNA 4MPVA 1Z7KA 3ZVBA 2ZFFH 1C9PA 3T62A 1FUJA 2F9BH 3UREA 3MO6A 3SUGA 3RXLA 1CHGA 4A5TS 2OXSA 5F6MA 2C8ZB 1YBWA 4KGAA 4ABDA 3ZVEA 1WXRA 4OS4A 1MU8B 4MNVA 5DK1A 3RLWH 1Z1JA 4Y6DA 3P95A 1ZYOA 3BG8A 2O8TA 5HIZA 3DCLA 1COWD 1ZPCA 1TNLA 1JBUH 1F5LA 4FUGA 4FU7A 4CH8B 1XM1A 1CT0E 2OP9A 2GDEH 2ZDLA 1XUFA 1ELBA 4JZIA 2YNBA 1DXPA 2LPRA 4XSKU 1C4V2 1GMCG 3LT3A 1HAPH 5IDKA 2XBYA 3GCOA 1NN6A 5C0TA 4UEHH 4ABJA 1W12U 3U1IB 3RXEA 3CP7A 1TONA 3RXKA 4RT0A 3UR6A 1SLUB 3ZV8A 4O9VA 3HKJB 2VVVA 3MO9A 5A0AE 2VIPA 1FXYA 2PTNA 1XVOA 4WVPE 1LKAA 1C5YB 1PPEE 1A4WH 4F4OC 4FETA 1H8HD 2TGAA 2Y5HA 4CRBA 1AUJA 1Z6EA 1YCPM 3P6ZB 1ETRH 4KTUA 2FESH 4X6OA 4BAHB 1O2XA 3VB3A 3SOSA 2GKVE 1JOUB 1T32A 3A7XA 5TCCA 1S6FA 2Z7FE 1K0HA 4NIVA 3RXBA 5L30H 3M5LA 4IW4E 4J1YA 3U8TH 1B7XB 2BLWA 2BXUH 1W10U 2GCTB 3BTWE 3N7DA 2UWLA 3BTHE 1WV7H 2Y80A 3LGTA 2FDAA 2ODYB 5HXFA 1JRSA 1UTJA 1XKAC 1K28D 3Q3XA 1C2JA 3QZQA 1C5UA 2HNTE 1SGDE 2P3FH 3QGNB 2VJ1A 2G00A 3F9FA 5GCHG 3QTVH 4K60A 3SJIA 1EFRD 5ABWA 2ZHDA 1VR1H 1UVSH 1Y3WA 1FZZA 4GLYA 2B9LA 5EW1H 3UTUH 1SQRA 1HLTH 1QA0A 3KQEA 4O3TA 3OU0A 1W7XH 1SHHB 1H4WA 1ZHPA 2QF5A 3C27B 5EJZA 4YO9A 1G3DA 2GP9B 2BLOA 1O3JA 1HAXB 1AZ8A 1H9HE 4DJZB 4IC6A 3E6PH 3KYGA 1TMUH 1C2FA 4O03A 4TYDA 1O0DH 4ZUHA 1O3LA 4CHAC 5HKKD 2UUFB 2A32A 1Z8JB 3KNXA 2TGDA 1HJAB 4X6MA 2OQ5A 1C1PA 1D4PB 5JDUB 2EI7A 2QA9E 3ZZ9A 1NC6A 3ZVCA 3V12A 2PUQH 2SGPE 2DE8A 1NRRH 4FUDA 5C1UA 3BIVH 2ZFRH 3ZZ8A 2A5AA 1V2OT 4Y76A 3F68H 1VITF 4AFUA 2QF4A 2H6MA 1O39A 2ZDKA 4E05H 1YLNA 2F9UA 4X6NA 1PYTD 1C5ZB 1GJBB 3V13A 3VB6A 4WH8A 5CHBA 2W6ID 2IPHA 2A45B 2ZFPH 4IN1A 1UVTH 4VGCC 2JJ2D 2QF3A 5AFZH 1NPMA 1MTWA 3A8DA 3A8BA 3P8FA 1GJAB 5C5NA 1C9TA 2ZHWH 4JMYA 1Q31A 4HGCA 2JIZD 3AK5A 1NESE 1O2SA 2AGGX 3SU6A 1VITH 3SU0A 3BIUH 5CE1A 2VGCB 3M61U 2KFWA 1QRZA 4H42U 1S82A 5T6GA 4GHQA 3PV2A 2PLXA 1WAYB 3F9GA 1GJDB 4K3JA 2JETC 1OWDA 1YPEH 2Z3CA 1O5DH 3NXPA 2ODPA 3BG4B 1FMGA 1C1QA 1TRYA 4FU8A 1VZQH 2XC4A 3V7TA 3PRBA 3UPEA 1P2NA 6LPRA 1K21H 2Q1JA 3P8NA 3UR9A 1XXDA 2QC2A 1ACBE 1D9IA 1SSXA 2Z9IA 3RXHA 1GI2A 3PROA 2AGIX 4P02A 1GHAG 4Q2KA 4ACAA 2TGPZ 3A7VA 3A88A 2ZI2H 2BDAA 3P92A 3MH4A 1O3PB 3M7TA 2Q6FA 5CHAB 1QRXA 3RMOH 4UFGH 4ACBA 1E35B 1MKWK 4U01A 5BPEA 1NU9A 3S0NA 2HNTC 4Y7AA 1O5BB 4AB9A 3DSGA 3DFJA 2LNCA 2M2AA 4JK6A 3RXJA 2J2UA 4Y0YE 1OWKA 3TVJB 4CRFA 3N7OA 2SGAA 2B7DH 4K1SA 1V2RT 4A1VA 1ZSJA 1V2MT 3EE0B 4JYVH 3P70B 1DY9A 1U6QA 1PPCE 2ZO3H 4NWKA 6GCHG 1GMCF 1CHOG 2KX4A 2CGAA 3L3TA 2AERH 1N6XA 4MVNA 6CHAB 1BRUP 1MU6B 4D8NA 7KMEH 2O8LA 4XD7D 1XKBC 1ELTA 4FOUC 5EQSA 1GBJA 3HKIB 2QAAA 1DLEA 1GI1A 1C2MA 5A0CA 2ZNKH 3PV4A 2NU1E 4AFZA 5DG6A 1GBDA 2J97A 1AKSA 1GMHF 1P12E 2PFEA 3MO3A 5HMAA 4R0IA 2Z3EA 3VPKA 1KDQA 1LPKB 2K8IA 1S0QA 2I6SA 3KYFA 2GV7A 1W0ZU 4E06H 1PQ5A 3LGYA 4ISOA 2KCOA 1C1UH 2RDEA 3Q77A 1FY1A 4I86A 3D23A 3W94A 1CT2E 1ZLRA 1O31A 3RXAA 2A4QA 4CRAA 2BQ7B 1WSSH 2BVRH 2ZG0H 5FL7D 4YXWD 5HM9A 3KHVA 3ZVAA 4BXSA 5C17A 2BVXH 1C1NA 1NU7B 2R3YA 1MMJN 2ZHFH 1TGNA 4OGXA 3W1EA 3PWCA 4O97A 2AIQA 5EODA 4MG3A 1FPCH 3PLKA 3LJJA 2AEIH 1GBIA 1GGDC 1AFEH 1RS0A 2J92A 3MH6A 3ITIA 3PO1B 2G81E 2J38A 3AW1A 1O2HA 3RXIA 1HFDA 4ABFA 3LGWA 5DP4A 1O30A 1QJ1B 3SJ8A 1V2LT 1UVOA 2OC0A 1NFXA 3QTOH 5E8EH 1C5PA 3RUOA 3CENA 2FO9A 2W7SA 4A1XA 5T6FA 1QQ4A 1IQIA 2BZ6H 1F92A 2QXJA 1DANH 5HGGA 2ZTZA 1O2MA 1YPGH 1ANCA 2F9NA 4AN7A 5FCKA 5K0HA 3GYLB 4TPIZ 1EJNA 5GCHF 2V0BA 4E7RG 1AFQB 1G32B 2WPMS 3SJOA 4NSVA 3SZNA 1O2KA 5ETXA 1BJVA 5FX5A 2VVCA 2GT8A 4X8SH 4JK5A 2WPJS 4H4FA 1ZR0A 4ABIA 2STBE 2ULLA 3TNTA 3AW0A 2A7HA 1W13U 4CRGA 1TPAE 1O2QA 1DPOA 3GY8A 1C5RA 3GISB 3U9AH 1HCGA 2BX4A 1ORFA 5T3HA 1UK4A 1YCPK 1GI4A 1CVWH 5E0HA 4ZXXH 4INKA 2AGEX 3SHCH 3ENSB 4OS5A 3A8AA 1A46H 3ATKA 2KR7A 1TMBH 1BUIA 1L1NA 1GI9B 4FU9A 1ETSH 1F0SA 1QA7A 3C1KA 1AY6H 5FPYA 2ZGCA 4ZKNU 1VGCC 2KAIA 1O5AB 1W0JD 4Z0KA 1BCUH 1FNIA 4AGJA 4KKDA 1LVBA 1J17T 1TNHA 1TNJA 1QRWA 4AZ2B 3SUFA 1WTGH 1AN1E 2XW9A 4ZROA 2NU3E 3SU3A 1BOQA 2WUCA 1IQHA 1W8BH 4UONA 3RXUA 4JYUH 4B2CA 1SHYA 4J2YB 5FBEA 1NROH 3KGPA 1DWBH 1MTNB 1NT1A 4AG1A 3SORA 3LJOA 1Y5BT 2UUJB 1UK3A 1VCPA 3KIDU 3FN8A 3SN8A 2O9QA 2BY7X 1P04A 3U1JB 1T4UH 2XTTB 1G37A 1V6DA 2F91A 5C94A 1BQYA 1GL1A 1BBRH 2PKAB 2W6JD 3DA9B 3SUEA 1RIWB 3MHWU 1V2KT 3M37A 3AAUA 4M7GA 2D8WA 3GY5A 1NRSH 2H1UA 1BTXA 1GDNA 7GCHF 4MTBA 3RXRA 1SLVB 1C1WH 1G9IE 1WDIA 2Z9LA 1O2ZA 2BXTH 1O3CA 4I8LA 2OC7A 3STIA 1W0YH 1XMNB 2W7UA 5GXPA 1QFKH 4GCHF 1UMAH 2HOBA 2OCVB 2KM0A 5H4IB 4ZXYH 1GHAF 2C8WB 1N8OB 4TSFD 1RTKA 2AS9A 2ZHQH 5LH8A 3A84A 1TNGA 4I33A 2CV3A 1BA8B 2ZDAH 5AFYH 4UFDH 5GJ4B 2WSSD 4JYTA 1ELVA 1ESBA 4OS7A 2OD3B 1ZMNA 2FS8A 5KEDA 2AH4X 2FP7B 3S7KB 4AC9A 1VCQA 1GG6B 1GCDA 1P06A 4X1NU 1ID5H 1MABB 1A0JA 1N6YA 3RXOA 5DP9A 1SQOA 1OOKB 2HLDD 2Z9KA 3FVFB 3MU5A 4LK4A 1SMFE 3SJKA 2PW8H 3UB0A 1SLXB 1ZJDA 4ASUD 1TX6A 3SNCA 1H9LB 3N7EA 1C2DA 1CHOF 3E0PB 4GVUA 1EKBB 2WPDD 1IQKA 1C1VH 1ELEE 2AIPA 4NG9H 1VITG 3ZYDA 1UTKA 3RU4T 4DVAU 3UWIA 4Y10E 5C20A 1C2GA 1IHTH 1O3HA 4IC5A 2FOBA 2P3UB 1ZRKA 1GJ7B 1AB9B 1Y59T 1MQ5A 1S81A 1Z8GA 2A5IA 1YLDA 4OS6A 1K9OE 4I8GA 1HAVB 2FI3E 2LP6A 1O36A 3UIRA 3RMLH 2BDBA 4BXWA 5CDFE 2WV4A 3TJOA 4GSOA 5AHGH 4YESB 1AE5A 1C5NH 1THPB 1RXPA 5DN6D 2VWLA 1L2EA 4YOJA 1MUEB 5TJXA 2J5UA 3KF2A 4FVBA 4I32A 1Y5AT 2J4IA 3E1XB 3K6ZA 1QB6A 4Y8XA 3GDUA 6ESTA 1SC8U 3ODFA 4JZEH 5E0GA 2FOEA 3BEIB 1HXEH 1BDAA 4NIWA 4ABEA 2PKSB 2J9NA 1K1OA 4MPXA 5SGAE 5E0JA 3L33A 3TK9A 1O3FA 2ZTXA 3F1SB 2QGRA 2BD9A 4R8TB 1YY3A 1MTUA 3QX5H 1W7GH 1IAUA 1G3EA 1BITA 3HK6B 2Y81A 1AVGH 1KIGH 2GMTB 1BB0B 2FLBH 2IOTA 1YLCA 4FUIA 4YLUA 4A1TA 2UWOA 3KL6A 3SHAH 1HUTH 1BTUA 1LTOA 5C2ZA 4HI3A 4YZUA 1V2PT 4XBBA 5ESBA 1GJ6A 2PGBB 3SUDA 1AD8H 1RD3B 1PQ7A 1K1MA 4Y0ZE 2AYWA 3ZZCA 2CF9H 1YYY1 5F8ZA 3LGUA 2ZGHA 3DSOA 1FI8A 3I78A 3F3BA 1V2JT 1PPGE 1D3TB 3RXSA 3FOAA 4CR5A 1HJ9A 1S5SA 1F2SE 3MQKC 3TPIZ 1FIWA 2FX6A 1A0HB 4XBCA 1V2TT 1SFQB 2O8MA 3PLBA 4OS2A 3EQ0H 4TY7A 1KXCA 3BTFE 1QBNA 2F3CE 3FP6E 3LH1A 3B23B 3K6YA 2C90B 4OGYA 1O2GH 4Y8YA 4ABBA 1GMHG 5HM2A 3JZ1B 1ABJH 3IWMA 2H9HA 5IYTA 4BAMB 4BTIB 2V6NA 2XWBI 1QR3E 2FI5E 1QL7A 3TGKE 3OEED 3ELAH 3OX7U 1EB1H 1NS3A 4X1PU 4WH6A 1DX5M 2EA3A 3MNCA 3I29A 3SI4H 1T8OA 2NWNA 2ZQ2A 1LQDB 5JYIA 3E16B 1YC0A 2BMGB 4YM9A 1O2WA 2BDCA 2BOHB 1ZHMA 2ZPQA 5IK2D 3F0PA 5DP7A 2VH0A 3T29A 1OXGA 2ZECA 3T2NA 3S9CA 1H8DH 3RU4D 3MMGA 3RXTA 3T5FH 1DE7H 2VBCA 3MNXA 5KGOA 1WUNH 1P2JA 1HAHH 3S7HB 3RMNH 1YGCH 3FP8E 1NRPH 1FY4A 1P57B 3ZVFA 2RA3A 1IQJA 1Y3XA 2AHME 3H7TA 5C67A 1O3NA 2ZZUH 1HJAC 3MU8A 3PV5A 4E7NA 3T27A 1O33A 3OTPA 2HPQH 4ZKRU 3HK3B 2ZFSA 1EATA 1MH0A 1GJCB 1W0KD 4H6TA 4B6EA 2W26A 2KCYA 2RA0A 2XCNA 5L6NH 1GDUA 1MQ6A 1FDPA 8ESTE 2PP6A 3AVZA 2A5KA 1FN6A 3O8RA 3DUXH 1O2JA 5EXMA 1SPJA 2V3MA 4AOQA 2RDLA 2FOAA 1ZJKA 2SGDE 1GBHA 1QJ7B 4DW2U 3GY6A 4UFFH 1EP5A 2DE9A 2FOMB 4TWWA 3MNBA 1FJSA 1EQ9A 4FUJA 2P8OB 1HAGE 1TFXA 1YKTA 2BVSH 2FIRH 3BF6H 1MZDA 1HB0B 1SQAA 1OWJA 1TNIA 3P8GA 1GHZA 3RC6A 2NU4E 4X2YA 1G3CA 1GBFA 1QJ6B 3SU1A 1ESAA 1C5TA 2ZU2A 3MH5A 1XUKA 1LCYA 3LU9B 1E36B 1SOZA 3EE7A 4AORA 4M9FA 4SGBE 2GZ9A 4CR9A 1XX9A 2HALA 1KLJH 4I7YH 4Y11E 3RXCA 1OSSA 4P00A 3BTME 1NBME 3MTYA 2VU8E 3FZDA 1HAZB 2SGQE 2VIOA 5CHAC 2BDGA 3SV7A 1SVPA 1CA8B 3QK1A 4BTTB 2FZZA 1A1RA 1YP9A 1SLWB 3GOVB 4YT6H 1D3PB 2VWNA 1DM4B 5JBAS 1XUHA 2BD8A 1QL8A 3SW2B 1GVKB 3GY3A 5L2ZH 1CT4E 1DWDH 3RDZA 3A82A 3URCA 3LC5A 3STJA 2ZFTA 1J15A 3B9FH 4Q4LA 5DJ7A 7GCHG 3SGAE 6CHAC 4UD9H 2ZHEH 1GI5A 3IG6B 1P03A 3W95A 1C1RA 1BZXE 1TE0A 3SQHE 1LPGB 1MKXK 1SGEE 1FAXA 1AZZA 4GCHG 1G2LA 1C2KA 1OHHD 2WYGA 4CHAB 1TABE 1UVPA 3EA7A 4WJG2 1A0LA 3VB4A 4NA7A 4RN6A 3M5OA 1F0UA 1C1MA 3P17H 1EPTB 1C2EA 2BOKA 2W3IA 1TPOA 3GICB 2A31A 4U32A 5EIYA 2QN5T 4JZDH 3BTDE 1EZXC 3T28A 3M3SA 1KLIH 3MNSA 4CREA 3F9EA 1ZZZA 4NFFA 3RC4A 1GBEA 1ZMJA 3ZZAA 1JIMA 1O5GH 5FAHA 2JH6D 3OYPA 3MFJA 2FXRA 1V3XA 1MAYA 8LPRA 3H5CB 5K7RA 2P94A 1DXWA 2OQUA 5ESTE 2AMDA 1GBCA 2W5EA 4GUXA 3TH4H 1CA0B 2PKAA 3V0XA 3ZV9A 5A8XA 3ZVGA 2ZPSA 1KXFA 1YM0A 3P8OA 3PO1C 3M5NA 5FBIA 2C3SA 2F9OA 1FQ3A 1V2VT 5JB8S 1BT7A 1IQEA 4F55A 1Y8TA 5BRRE 3BTTE 4NIXA 1OYQA 5EU8A 1TNKA 2OC1A 1UTQA 2H5CA 2CF8H 1MCTA 4INLA 1G36A 1YPHC 3ATWA 3TNSA 1Z6JH 3F9HA 2BTCE 3S9BA 1ZPZA 2Y7XA 4MDSA 2L6OA 1KLTA 3KQDA 4U2WA 5JPMH 3MU0A 2B5TB 2WV5A 1T31A 1S6HA 1GJ4H 1A61H 2Y5FA 2JETB 2Z9JA 1V2QT 5EG4A 1YPLH 2BY8X 3TK6A 5KECA 2TGTA 1H1BA 1CBWB 2NU2E 1UTPA 4BAOB 3ATLA 1A2CH 1O2YA 2OINA 1HPGA 1MTSA 1OPHB 4JCNA 3H09A 3LGVA 3UUZA 1S85A 4D7FA 3D62A 2O8UA 4NA9H 2ZP0H 2J98B 2Z6BD 4Y7BA 3NK8A 2ANWA 1HBTH 1M9UA 2G5NA 4CRCA 2ANMH 2BY6X 2STAE 1TYNA 1EP6A 1QNJA 1NZQH 1SBWA 1BRAA 5JBCS 5FPTA 2GZ8A 2QV1A 3L6PA 2EI6A 2IPQX 2OBOA 3OSYA 3FP7E 1O2IA 1Z1IA 1RGQA 1ELAA 2AFQB 4IBLH 2ZIQH 1GBMA 3KN2A 4FUHA 4HTCH 2BQ6B 2C8YB 2WUBA 1L1GA 4YOIA 1O2VA 1S6LA 2XXLA 1OX1A 2FWWA 1SGYE 2ZCKP 1C5XB 2K1QA 1UCYH 2FODA 3MYWA 2Q6GA 2M5TA 4ZHMU 1WBGB 3VXEH 1MTNC 1HAVA 4ESTE 2VIWA 3TU7H 1IHSH 3U28C 3M3VA 1AWHB 3O8DA 4I8KA 2BX3A 2TBSA 3SI3H 3E3TA 3VB7A 3ZIAD 3PRDA 1LHDH 1ZRBA 1GHBF 1SB1H 2F43B 3BEUA 1BMAA 5FPSA 2ASUB 1QTFA 2XRCA 5C1XA 3MWIU 4D9RA 2RCEA 4NA8A 2D1JA 4LXBH 3BTGE 1NY22 4RKOB 4DURA 2Y82A 2D26C 1TOCB 1BIOA 4B1TA 1S84A 3GCTG 3U69H 2A7JA 2YMSD 2C93B 5EXNA 3SNEA 3GCHB 4X2XA 9LPRA 1YPMH 1UHBB 2ZA5A 4DIHH 1P0SH 1T8MA 1W3CA 2EI8A 2JKHA 4X1SU 3RXGA 3E0NB 4KTSA 1P01A 1SR5C 4K8BA 1O32A 1RFNA 1SGIB 2CHAB 3U8OH 3SYJA 5F53A 2FLRH 5LGOA 4RKJB 2JH5D 2Z9GA 1AUTC 3PTNA 1GJ9B 1J16A 1GHXH 1DDJA 4TT3D 2VIDA 2OC8A 1TRNA 2G51A 2G4UA 3FFGA 3OTJE 4YT7H 1AI8H 1YPKH 1TBZH 1AO5A 3PM3A 4XE4A 3VB5A 3BSQA 2BDHA 1O2TA 1W14U 2YMSB 4B2BA 5HYOA 2FMJA 4MPWA 4UFEH 2GT7A 2ZWLH 1AE8H 2SGEE 3BV9B 4X6PA 4WF8A 4DGJA 3WY8A 1TGBA 1DSTA 1V2WT 3U98H 3VGCB 1O5CB 1BRCE 1QCPA 1OP2A 3G01A 3QWCH 2HRVA 2PWXA 1YCPH 1DT2A 3RM2H 1O34A 1FX0B 1RJXB 2FI4E 1P2KA 1TGTA 3KCGH 4K2YA 1GCTC 4BANB 4OS1A 2AMPA 5E2OA 5EQRA 3TJVA 3VXFH 1F7ZA 3PMJA 1WYKA 2XBXA 4ABAA 4D9QA 3UY9A 5A0BA 2Z3DA 1QHRB 5LPFA 2A0QB 1PPFE 1CU1A 1KSNA 3NWUA 2Y7ZA 4DCDA 1P8VC 1O3EA 1O3IA 2EEKA 2GJGA 2WPLS 1CGHA 1AB9C 3T25A 4CRDA 1TGCA 4LOYH 1W2KH 2QYIA 5B6OA 4NZQA 1Y3YA 4NZLA 4X1QU 1SGFG 1E1RD 3A87A 3DHKH 1ANEA 1ELCA 3PMHB 2ODQA 3RXDA 1VGCB 3EAJA 4X8VH 3EGKH 2Y6TA 2QXGA 1ZHRA 1E79D 1UVUH 3ZZ4A 2R2WU 3R0FA 4X8TH 1KTSB 3LGIA 5EXLA 4DT7B 1O2RA 2GX4A 1P9UA 4U30A 4KTCA 2GVFA 1UTMA 2BHGA 1V2ST 4K5ZA 2BY9X 2CN0H 1BHXB 4IMZA 2BLQA 1LKBA 1NO9H 5CMXH 1NRNH 1SGFA 4D7GA 3D49H 1EOJA 3PB1E 2HGTH 2DUCA 3HGPA 2GDDA 4MLFB 5FX6A 4TWYA 3UNRA 3PLPA 3K65B 1MAXA 4XRNA 4CBOA 2ESTE 1P3EA 3OAAD 4WMDA 4GHTA 1GJ5H 4BOHA 9ESTA 1GVZA 1HIAB 1JMOH 4X8UH 5DP3A 1D6WA 2H5DA 2GCHF 1EUFA 2D2DA 4WY3A 1PJPA 3SZEA 1FLEE 2PHBA 2P59A 2ILNA 3DFLA 1AU8A 3F6UH 2BLVA 4KELA 1T8NA 4I31A 4ZMAH 4B71A 2THFB 3PTBA 1P2QA 2I6QA 3ODDA 4HG6A 1YPJH 1LHCH 1D3DB 2GD4B 2FOGA 1XUIA 1GPZA 1PFXC 1JRTA 3FAOA 3UWJH 3GY2A 1QB9A 2VWMA 2LELA 1TOMH 1SG8B 1K1NA 4Q7XA 5EOKA 4NSYA 1GDQA 1P2MA 2WHXA 1SFIA 1K1IA 3F2HA 3S69A 1WU1A 1TQ0B 1HDTH 1QBOA 3NUMA 1ZTKA 3QDZB 2FM2A 1IOEA 3LDXH 2XC5A 2GTBA 2XNDD 1NM6A 1P2IA 2K0QA 5EGMA 3SGQE 1OWIA 4A6LA 3U8RH 1KY9A 5E2PA 3NPSA 3R3GB 3A7WA 2JDID 2TPIZ 3IITA 5DP5A 3MI4A 1P02A 1VKYA 1DVAH 1Z71A 1HNEE 4TY6A 1GMDG 5AF9H 1FN8A 2EC9H 1B0FA 4BAKB 1FY3A 4ZHAA 4K1TA 1E1QD 3PMAB 2F9VA 1H8IH 5DSFA 1AIXH
chains in the Genus database with same CATH topology
3PWBA 1A7SA 2QF0A 1Z8IB 1EXFA 1ARBA 2PSXA 1FY8E 1O5EH 1QBVH 4IGDA 3TH3H 1TA2A 2GCTC 1CSOE 1A5HA 2WPHS 1G30B 3DT0H 1KXAA 1W11U 1T8LA 5EQQA 4CBNA 4HFPB 3GCTF 3EDXB 4XOJA 2HWLB 2FX4A 2ALPA 5EPNA 4ZHLU 1BMMH 1K1JA 4ABHA 1ZMLA 1TRMA 1TPSA 3BEFB 1FY5A 1T7CA 2ZDNA 4ZAEA 1NTPA 3RLYH 2ZGJA 4XBDA 3A7ZA 3LH3A 4FXGH 2BY5X 4ISHH 3UOUA 5A2MH 2VIQA 2C4FH 3I77A 1ARCA 2NU0E 1EZQA 2ZKSA 3Q00A 1EPTA 1SGPE 1NFYA 1PPHE 2ZU4A 1HGTH 1GI7B 3QZRA 4JZ1A 3URDA 2XNIA 2VB0A 2AMQA 1GHVH 1SOTA 5F03A 1IQLA 5TCAA 3GDVA 4DIIH 4YLQH 3LONA 3LOXA 5DKMA 2FTMA 3QO6A 2P8OC 4NIYA 3K2UA 1GHWH 1XVMA 2PGQB 4AFQA 3UFAA 5JB9S 4AFSA 1UCYE 4FUEA 4GPGA 4B2AA 1A5GH 3Q76A 1C2HA 5L2YH 2R0LA 2SNWA 1F0TA 4I8HA 3A85A 2ZEBA 2OBQA 1E37B 1L0ZA 3SV8A 4NGAH 1P9SA 4Y71A 3BTQE 1L1JA 1LHGH 2VVUA 1C5OH 2ZFQH 1O3KA 2BB4A 1GI0A 3UQOA 1GJ8B 2Z94A 1P05A 3RXQA 1O2UA 4ZKSU 4B74A 3TH2H 1C4U2 3RP2A 1B5GH 1IQFA 1GHBG 1DSUA 1EAWA 2A4GA 1C5VA 4X0WU 2IN2A 1S0RA 1GBLA 3GY7A 1VCWA 1AVWA 2CMYA 4FUCA 5T6DA 1ETTH 4NWLA 1GI8B 2BM2A 2BZAA 2JH0D 3TGJE 1DUAA 2XYAA 2V3OH 1ZGIA 2UUKB 1LO6A 1FONA 3MU4A 3TK5A 1E38B 2VGCC 3ZYEA 4ABGA 5I25A 2A4RA 2VINA 1SQTA 2FYQA 3A7TA 3ESTA 1AHTH 2ZU1A 1YPHE 1V2UT 2O8WA 3TGIE 2A2QH 2PUXB 2G55A 2XWAA 3BG4C 2WPIS 4QT8C 1C5LH 1AGJA 4FUFA 1INCA 1H9IE 2H9TH 5JBTA 3PYHA 1O3GA 1PYTC 1TGSZ 1BBRE 3TITA 1TA6A 1AQ7A 1SL3A 1GBAA 3HATH 8GCHF 1EPTC 2IJOB 3A7YA 2FOFA 5GPIB 1UTNA 1LVOA 4X2WA 1EB2A 1O3BA 3Q3KA 1DITH 3SJ9A 1IQNA 1HXFH 3NKKA 2ZU3A 1KXEA 1AVXA 7LPRA 1KTTB 1TMTH 1HAOH 2BD4A 2J94A 3SGBE 1EAXA 1TPPA 3A86A 2H2ZA 4JZFH 2BD2A 2P3TB 4FUBA 1EX3A 3MOCA 2VIVA 4WXVA 4X2VA 5PTPA 1C5SA 3BTEE 4NCYA 1CGIE 3SV2H 1BJUA 1ZTLA 5DP8A 1HAIH 4DY7B 1WQSA 1CA0C 2FOCA 1LMWB 1HJ8A 1YF4A 2PR3A 1KXBA 4IN2A 4Q7ZA 1QL9A 2SNVA 1BTPA 1DWEH 1EASA 1UHBA 3AASA 3SNAA 3TIUA 3RXVA 1O2LA 3A83A 3DD2H 3TLOA 1O38A 3QGJA 1ELFA 1BTHH 3VEQB 4FVDA 2SGFE 1D6RA 3T26A 4Y8ZA 1OWEA 1T4VH 1O2NA 3M5MA 2FTLE 1ZSLA 1WOFA 1EJMA 2ZCLP 5EW2H 4D76A 1OP0A 1JXPA 5JBBS 1TWXB 3HPTB 3RXFA 1CBWC 3LC3A 1K1PA 3SU4A 1P2OA 5F8XA 3K9XB 1DLKB 4DOQA 3CS0A 4IS5A 2OLGA 4F49A 2F83A 4ZKOU 1GMDF 1TQ7B 4THNH 3FANA 3ZZDA 2OUAA 1NFWA 3E8LA 5GWZA 1N1LA 2TIOA 2FYRA 1LHEH 3AAVA 1DOJA 4K8YA 1LHFH 1UO6A 2WPKS 5C3NA 2W3KA 2ZCHP 1TAWA 1TLDA 5J4SA 1RTLA 4H6SB 4VGCB 1O37A 1BTWA 1J14A 1TB6H 3KQCA 1GBBA 1C1SA 4ISNA 3ZZ6A 3OY5U 4MNWA 1DUEA 3E90B 4MQAA 1EZUC 1MKXH 2GCHG 2A7CA 3TJNA 3RM0H 2VH6A 1WCZA 4TPYA 4YTAA 1EOLA 1DS2E 3NZIA 1BTYA 1MCVA 1GL0E 2XCFA 3O8CA 2F9PA 1C5QA 1K22H 2ZU5A 1AFQC 3GY4A 1B0EA 1MKWH 1BMLA 1MBMA 3A8CA 3E91A 4WMEA 5FHTA 3VFEA 5A09A 3M3TA 1LDTT 1XUGA 2V35A 3ZZ7A 1GBTA 1UCYK 3A89A 4AG2A 1SGNE 1QIXB 4ZH8A 3LIWA 3A81A 4B75A 2HLCA 3QLPH 3M35A 1MD8A 4BTUB 2ZDMA 2BD7A 4MNXA 2QY0B 3RMMH 5DPAA 3GCHC 1RRKA 2WINI 4I8JA 2G5VA 4KP0A 4AB8A 1UTOA 1E0FD 5A8YA 1LPZB 3ZZ5A 1OKXA 2ZQ1A 2ZF0H 1J8AA 2FOHA 2VWOA 4XDEA 1GVLA 3JZ2B 3M36A 2CHAC 1QQUA 1DWCH 4YOGA 2R9PA 1SGCA 4WWYA 2B0FA 1TX8A 3KQBA 3LKWA 1JIRA 1HIAA 3SQEE 3BN9A 1P10A 1HRTH 4A92A 7ESTE 8KME2 2HNTF 2UWPA 1QGFA 2A1DB 3B8JA 3SU2A 3V3MA 2BYAX 2ZGXH 2XBVA 1UK2A 1IQMA 2HVXA 2P95A 3OY6U 3VGCC 1Y5UT 1TX7A 1DICA 1RIWC 1DY8A 4IMQA 1THRH 1O5FH 4MPUA 1KXDA 1GI3A 1TBRH 1L4ZA 3MH7A 3LPRA 1BBRK 2ZTYA 3Q3YA 1VJAU 2G4TA 2R0KA 2FPZA 2BD5A 2C8XB 1ZSKA 3NCLA 4SGAE 2P16A 3SO3A 1AWFH 1ZTJA 5C5OA 2CXVA 2J34A 3FZZA 1BTZA 1AMHA 3GDSA 3M7QA 1GGDB 2PSYA 1N8OC 1SGQE 1BMNH 1ELGA 2XBWA 3UOPA 3BTKE 4UDWH 1TALA 1Q3XA 1O35A 1ZOMA 2XC0A 1O3MA 1F5KU 2WYJA 5FCRA 4UE7H 1GG6C 2RG3A 1IQGA 3RC5A 1C4Y2 1MZAA 2ZDVH 3UNQA 4HZHA 3UQVA 1GWAA 1CGJE 2ZGBH 3GCNA 1ABIH 1EZSC 4K1EA 1P3CA 3SV9A 2Y5GA 1L4DA 1S83A 2PTCE 4GAWA 2CJIA 1A3BH 2Q6DA 4AGKA 1J9CH 2BD3A 2BQWB 1PQ8A 3ATIA 1K2I1 2A4OA 1PPBH 3SNBA 5A8ZA 3QN7A 1F5RA 4RSPA 2PV9B 3H7OA 1Q2WA 1O3AA 1EJAA 1XUJA 1Z8RA 2YOLA 1FV9A 3EYDA 1ZGVA 2QIQA 4XFQA 3O8BA 1GBKA 5LPRA 1F0RA 5DO4H 1C2IA 1SI5H 1E34B 3ZVDA 3RXMA 1EAUA 4K69A 1OYTH 1O2PA 3ZZBA 2VNTA 4X1RU 4BNRA 1AKSB 2FEQH 1PQAA 2G52A 4NFEA 1KDQB 1KYNA 2R2MB 4AX9H 5AVDA 1PPZA 1QURH 2UUYA 3ATMA 1RTFB 3S9AA 1C1TA 3PMBB 1OWHA 4WXIA 1V2NT 1CQQA 1ELDE 1ANDA 2BDYA 1QY6A 1G2MA 4B76A 4LZ4B 1A3EH 2PKSC 1C5WB 4ISIH 4A7IB 4WMFA 2FS9A 1P09A 3ZZ3A 1P11E 1Y3VA 1FAKH 2GV6A 1UTLM 1MD7A 4Y79A 2V3HH 5DGJA 1QB1A 3M7UA 2TRMA 3SV6A 1DFPA 1OS8A 1A5IA 3RU4E 1GHYH 1LQEA 2J95A 3A80A 4Q80A 2GMTC 8GCHG 1FPHH 1ANBA 1SGRE 2BDIA 1C2LA 1JWTA 1X7AC 2YNAA 3QUMP 4INHA 5F8TA 1O2OA 1ESTA 1ZPBA 1D3QB 1TIOA 1NFUA 1WTHD 3EA9A 5G4BA 1OP8A 6GCHF 1GCTB 5I46H 1C5MD 4ASHA 1EAIA 5EPYA 5DP6A 2G8TA 4AYYB 1CO7E 2R3UA 4B73A 1HAYB 1CE5A 1VJ9U 2P93A 1UJ1A 4PROA 1BHXF 4ISLA 1FIZA 1GI6A 1XXFA 4MNYA 4DG4A 2QXIA 3EA8A 4LZ1H 2ALVA 2B8OH 4Q7YA 3CS7A 3MU1A 5FXLA 2OTVA 1Y3UA 4CH2B 2GGVB 1THSH 3GYMA 1MBQA 1HV7A 1MTVA 3SNDA 5GDSH 3SU5A 1K1LA 2HPPH 2ANKH 3RXPA 2ZC9H 3D65E 2H9EH 2SFAA 5LPEA 2ZPRA 3TJUA 1TBQH 1G3BA 2GZ7A 3KEEA 1WQVH 3SBKA 4AYVB 1LVMA 4BAQB 1HYLA 2ANYA 1NRQH 1LVYA 5GIBA 4Z6AH 1SGTA 1C1OA 5C1YA 4O3UA 5J4QA 1O3DA 3UNSA 2QXHA 2A2XH 2QCYA 1O3OA 1BRBE 2KAIB 3HGNA 4MPVA 1Z7KA 3ZVBA 2ZFFH 1C9PA 3T62A 1FUJA 2F9BH 3UREA 3MO6A 3SUGA 3RXLA 1CHGA 4A5TS 2OXSA 5F6MA 2C8ZB 1YBWA 4KGAA 4ABDA 3ZVEA 4OS4A 1MU8B 4MNVA 5DK1A 3RLWH 1Z1JA 4Y6DA 3P95A 1ZYOA 3BG8A 2O8TA 1ZPCA 1TNLA 1JBUH 1F5LA 4FUGA 4FU7A 4CH8B 1XM1A 1CT0E 2OP9A 2GDEH 2ZDLA 1XUFA 1ELBA 4JZIA 2YNBA 1DXPA 2LPRA 4XSKU 1C4V2 1GMCG 3LT3A 1HAPH 5IDKA 2XBYA 3GCOA 1NN6A 4UEHH 4ABJA 1W12U 3U1IB 3RXEA 3CP7A 1TONA 3RXKA 3UR6A 1SLUB 3ZV8A 4O9VA 3HKJB 2VVVA 3MO9A 5A0AE 2VIPA 1FXYA 2PTNA 1XVOA 4WVPE 1LKAA 1C5YB 1PPEE 1A4WH 4F4OC 2TGAA 2Y5HA 4CRBA 1AUJA 1Z6EA 1YCPM 3P6ZB 1ETRH 4KTUA 2FESH 4X6OA 4BAHB 1O2XA 3VB3A 3SOSA 2GKVE 1JOUB 1T32A 3A7XA 5TCCA 1S6FA 2Z7FE 4NIVA 3RXBA 5L30H 3M5LA 4IW4E 4J1YA 3U8TH 1B7XB 2BLWA 2BXUH 1W10U 2GCTB 3BTWE 2UWLA 3BTHE 1WV7H 2Y80A 3LGTA 2FDAA 2ODYB 5HXFA 1JRSA 1UTJA 1XKAC 1K28D 3Q3XA 1C2JA 3QZQA 1C5UA 2HNTE 1SGDE 2P3FH 3QGNB 2VJ1A 2G00A 3F9FA 5GCHG 3QTVH 4K60A 3SJIA 5ABWA 2ZHDA 1VR1H 1UVSH 1Y3WA 1FZZA 4GLYA 2B9LA 5EW1H 3UTUH 1HLTH 1QA0A 3KQEA 4O3TA 3OU0A 1W7XH 1SHHB 1H4WA 1ZHPA 3C27B 4YO9A 1G3DA 2GP9B 2BLOA 1O3JA 1HAXB 1AZ8A 1H9HE 4DJZB 4IC6A 3E6PH 1TMUH 1C2FA 4O03A 4TYDA 1O0DH 4ZUHA 1O3LA 4CHAC 2UUFB 2A32A 1Z8JB 3KNXA 2TGDA 1HJAB 4X6MA 2OQ5A 1C1PA 1D4PB 5JDUB 2EI7A 2QA9E 3ZZ9A 1NC6A 3ZVCA 3V12A 2PUQH 2SGPE 2DE8A 1NRRH 4FUDA 5C1UA 3BIVH 2ZFRH 3ZZ8A 2A5AA 1V2OT 4Y76A 3F68H 1VITF 4AFUA 2H6MA 1O39A 2ZDKA 4E05H 2F9UA 4X6NA 1PYTD 1C5ZB 1GJBB 3V13A 3VB6A 4WH8A 2IPHA 2A45B 2ZFPH 4IN1A 1UVTH 4VGCC 2QF3A 5AFZH 1NPMA 1MTWA 3A8DA 3A8BA 3P8FA 1GJAB 5C5NA 1C9TA 2ZHWH 4JMYA 1Q31A 4HGCA 1NESE 1O2SA 2AGGX 3SU6A 1VITH 3SU0A 3BIUH 5CE1A 2VGCB 3M61U 1QRZA 4H42U 1S82A 5T6GA 4GHQA 2PLXA 1WAYB 3F9GA 1GJDB 4K3JA 2JETC 1OWDA 1YPEH 2Z3CA 1O5DH 3NXPA 2ODPA 3BG4B 1FMGA 1C1QA 1TRYA 4FU8A 1VZQH 2XC4A 3V7TA 3UPEA 1P2NA 6LPRA 1K21H 2Q1JA 3P8NA 3UR9A 1XXDA 2QC2A 1ACBE 1D9IA 1SSXA 2Z9IA 3RXHA 1GI2A 3PROA 2AGIX 1GHAG 4Q2KA 2TGPZ 3A7VA 3A88A 2ZI2H 2BDAA 3P92A 3MH4A 1O3PB 3M7TA 2Q6FA 5CHAB 1QRXA 3RMOH 4UFGH 1E35B 1MKWK 4U01A 5BPEA 1NU9A 3S0NA 2HNTC 4Y7AA 1O5BB 4AB9A 3DFJA 2LNCA 4JK6A 3RXJA 2J2UA 4Y0YE 1OWKA 3TVJB 4CRFA 3N7OA 2SGAA 2B7DH 4K1SA 1V2RT 4A1VA 1ZSJA 1V2MT 3EE0B 4JYVH 3P70B 1DY9A 1U6QA 1PPCE 2ZO3H 4NWKA 6GCHG 1GMCF 1CHOG 2CGAA 3L3TA 2AERH 1N6XA 4MVNA 6CHAB 1BRUP 1MU6B 4D8NA 7KMEH 2O8LA 1XKBC 1ELTA 5EQSA 1GBJA 3HKIB 2QAAA 1DLEA 1GI1A 1C2MA 5A0CA 2ZNKH 3PV4A 2NU1E 4AFZA 5DG6A 1GBDA 1AKSA 1GMHF 1P12E 2PFEA 3MO3A 5HMAA 4R0IA 2Z3EA 3VPKA 1KDQA 1LPKB 1S0QA 2I6SA 2GV7A 1W0ZU 4E06H 1PQ5A 3LGYA 4ISOA 1C1UH 3Q77A 1FY1A 3D23A 3W94A 1CT2E 1ZLRA 1O31A 3RXAA 2A4QA 4CRAA 2BQ7B 1WSSH 2BVRH 2ZG0H 5HM9A 3KHVA 3ZVAA 4BXSA 2BVXH 1C1NA 1NU7B 2R3YA 1MMJN 2ZHFH 1TGNA 4OGXA 3PWCA 4O97A 2AIQA 5EODA 4MG3A 1FPCH 3PLKA 3LJJA 2AEIH 1GBIA 1GGDC 1AFEH 1RS0A 2J92A 3MH6A 3ITIA 3PO1B 2G81E 2J38A 3AW1A 1O2HA 3RXIA 1HFDA 4ABFA 3LGWA 5DP4A 1O30A 1QJ1B 3SJ8A