1O39A

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o39A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o39A02
3HKJB 2VIQA 1P03A 3N7OA 3P17H 2F9NA 2DE8A 1A3BH 1V2KT 1GG6B 3GCOA 2NU1E 3AW0A 3BEUA 3HGNA 2H9HA 5JBCS 1BDAA 5E2PA 3RXEA 1SGPE 1AUTC 1NRPH 5L2YH 1L0ZA 4K2YA 3B8JA 3M61U 3ZVFA 3V13A 2QXHA 2R0LA 1BTWA 1BIOA 1EOLA 1NRNH 1TB6H 1DS2E 1DWDH 3A7VA 3DHKH 4X1QU 1QURH 3M37A 2GGVB 3BSQA 2F83A 3PTNA 2ZG0H 4MQAA 5CHAB 1P9UA 1AZ8A 2FOAA 4DJZB 1C2GA 1GJ4H 1C4U2 4O3TA 1C2HA 3A88A 1FY4A 2AS9A 1O38A 1OWEA 4Q2KA 4IMQA 1UCYK 1P3CA 1EB1H 3PLBA 1CGHA 1TRNA 2A4RA 3UOPA 1S85A 4CHAB 1D6RA 4ZUHA 1L1NA 1IQNA 4ZAEA 4WXVA 1P0SH 2CHAC 1GBFA 1OSSA 1AFQC 1FIWA 4Z0KA 2C4FH 1OX1A 3CP7A 1MCVA 3SGQE 1N6XA 4BAOB 1MZDA 1IQFA 1D3PB 1LQEA 2SGFE 3ZZ6A 4WWYA 2ANWA 4YLUA 2BOKA 2OQUA 1O2PA 1PPCE 4ZROA 1GBIA 3HPTB 4WVPE 3P8OA 3FAOA 1EX3A 2SGEE 1PPBH 1QB9A 5ESTE 1P57B 3KL6A 2BQ6B 3DFJA 2C3SA 4LZ1H 5DPAA 1ELDE 4R0IA 3ZZ4A 2Z3DA 2BVXH 4FUJA 4NA8A 1FXYA 5TJXA 2ZTXA 4DG4A 2ZHEH 3PV4A 1SLVB 3A8AA 1E38B 2BY8X 2GKVE 2TBSA 3LC3A 1ZGIA 1E34B 3T28A 2XC5A 1XKBC 4INHA 1C5VA 2QCYA 3QWCH 5T6GA 2GZ9A 1KXBA 2PUQH 1S82A 1YLCA 1O2MA 1WYKA 1AHTH 1IQMA 1TPPA 2AYWA 4ZXXH 2GCTB 1NM6A 2GVFA 1GDNA 4DVAU 3LKWA 3L33A 2FOEA 2SGAA 2G5NA 1SC8U 3P92A 2VB0A 1PFXC 2ZP0H 2ZU3A 2FOFA 1EJMA 5FXLA 1ZGVA 3TLOA 1H9IE 1TGCA 5K7RA 2PKSB 4B74A 2WYGA 4CBOA 5EPNA 3BEFB 2TPIZ 1EZUC 3SZNA 2HLCA 1DY8A 1QRXA 1V6DA 1DXPA 2PTCE 1C2DA 3AW1A 2FEQH 1UMAH 1GI1A 2XBYA 1W2KH 3TK6A 4CREA 1J15A 2ZKSA 4FUBA 2M5TA 2NU0E 2BTCE 4QT8C 2XWAA 1GMDG 3LIWA 1S84A 3SV7A 4ASHA 5FPTA 1TFXA 2CMYA 2HPQH 1EAXA 2Q6DA 1FN6A 4X2VA 1LHGH 8GCHF 4DOQA 1MBQA 3SU0A 4FUHA 3U9AH 1UK2A 3PMBB 4X6MA 1K1PA 5FPSA 3F9HA 3M3SA 2W7UA 2A4QA 1C5TA 4DY7B 1C2EA 1SGIB 3MO3A 2QC2A 1Y5BT 1C1NA 2ODPA 1GBBA 1UTOA 2ZFTA 4K1EA 1HAIH 3SU1A 1TX7A 1C5ZB 2EI8A 2KAIB 2THFB 1TMBH 1HIAB 3BTWE 1P2KA 1L2EA 1B0EA 1NC6A 4UFGH 4YTAA 1VJAU 4JZEH 2VIOA 3TJUA 1QL9A 1P05A 3P8FA 2BQWB 5CMXH 2BVRH 4ABJA 3ZZBA 3F9FA 3TH3H 4IW4E 3ATWA 4KELA 4D7FA 1QL8A 4X8TH 3BTGE 2PSXA 2BYAX 2VVUA 1C2KA 2Y82A 1YPHE 5C20A 3RC4A 1TGNA 4XFQA 1W8BH 3GY7A 5L30H 1HAZB 4FUCA 3TU7H 4O3UA 2GTBA 3QGNB 3DFLA 3GCHC 1MTUA 1NFWA 1TA2A 1ACBE 4OS7A 3GDUA 1KDQA 3FP6E 1GBMA 1TQ7B 1JOUB 1SFQB 4AGKA 1WBGB 1A46H 1ARBA 3SJOA 4IS5A 2PW8H 1GL1A 1ZRBA 1HAVA 4MNWA 3B23B 3RMOH 1YBWA 1PPHE 1K1NA 4GSOA 1MKWK 3FFGA 1GBEA 1LO6A 1HFDA 1KTSB 2OBOA 1FIZA 1FAXA 1CE5A 3QGJA 3M35A 1GVLA 2A7CA 2TGAA 4A5TS 1S6FA 1ANBA 2DE9A 3MOCA 2O9QA 4ZHAA 1EP6A 2I6QA 1AFEH 2JH6D 1O37A 4JYTA 1SSXA 1HGTH 1O2SA 1FQ3A 3KQBA 1GMCF 1K2I1 3GY6A 4B1TA 3LH3A 3V3MA 4R8TB 3ATKA 1C5YB 1C2LA 2A5AA 4UDWH 3MI4A 3T26A 1E0FD 3TNSA 5C3NA 1O3FA 1YKTA 1BMAA 4LZ4B 2HOBA 1ZPBA 3O8CA 3S69A 2FLRH 2WPLS 2GT7A 3LGIA 2ZECA 5EG4A 2PFEA 4X8UH 1DOJA 4YESB 2Y81A 1AB9B 3MH4A 4X1NU 6ESTA 1SOTA 1YPLH 1ESAA 1PQ7A 3UY9A 1SGQE 2QXGA 1JIMA 1G3EA 1O3OA 1ZR0A 3I77A 4B2CA 5A8ZA 1VCQA 1BTXA 1WUNH 1F0RA 3RXRA 3E91A 1WAYB 5E0JA 1C4Y2 1CU1A 5JBBS 2ZGJA 4Q7XA 3VFEA 1A5HA 2PKAB 3B9FH 1V2MT 2XYAA 3RXKA 3MH7A 3HATH 1Z6EA 3MNBA 3MFJA 4NA9H 1T7CA 1QNJA 3RXFA 2XW9A 3F9GA 2ZU4A 1LPGB 5F03A 2VNTA 1MTWA 3KCGH 3EA9A 1TA6A 1O2YA 2QV1A 3FZZA 3GYLB 1O2VA 1BOQA 3MTYA 3KNXA 4AB9A 2P94A 2ODQA 4X6PA 1DVAH 3MYWA 1BMNH 2OP9A 1N8OC 3R3GB 1FY5A 5E2OA 1L1JA 5C5NA 3SW2B 1BHXB 3RLWH 1DWEH 3MU8A 4NWKA 1H9LB 3U8TH 4JZIA 1ELTA 4O9VA 2A32A 1WU1A 2QIQA 1EXFA 4AYVB 2XC4A 2VVCA 2STBE 1J17T 1S0QA 2Y5HA 3SJ8A 1SGYE 5J4SA 1K28D 1XUIA 1O5GH 4AB8A 1ZJKA 1ZRKA 4IN2A 1GL0E 5GCHF 2J94A 2JKHA 3BTME 2EC9H 1G37A 3LC5A 4MDSA 1V2WT 1TE0A 1G30B 1UO6A 2ZDLA 3A7YA 1A3EH 1RS0A 1IOEA 1T8LA 1YM0A 1GBLA 5EXMA 5FHTA 2IJOB 1LVOA 3MNCA 2ZQ1A 2R3YA 5HYOA 5A0AE 3K9XB 1ZPZA 1EOJA 1QQUA 4JYUH 3OY6U 2ZTYA 2GP9B 3SV6A 2A7HA 4FXGH 2I6SA 2UUKB 4XE4A 3MO6A 3SN8A 1YC0A 3BIUH 1GBDA 2CV3A 1DY9A 4AYYB 3Q3YA 4A6LA 5J4QA 2SGQE 4INKA 1W7GH 3ZVCA 1AE5A 1O0DH 4AFUA 4MTBA 1DLEA 2ZWLH 3NUMA 2QXIA 1ELGA 1TNJA 1SLUB 3SUDA 4DURA 4OS2A 2WPHS 3UR9A 4OS4A 2RA0A 1F2SE 4BAHB 1W12U 4I31A 1JMOH 3BV9B 1SL3A 1RGQA 5FBIA 1K1MA 2PHBA 4ZHLU 1EP5A 1YF4A 4X2XA 4M7GA 4ABFA 3V12A 3BTEE 3SJ9A 3GICB 3SNEA 3SGBE 1TIOA 2ZPRA 3E0PB 1AI8H 1C1UH 1EASA 3BN9A 1XX9A 5C67A 5TCCA 3LGYA 1GI0A 1P2IA 1SGCA 1X7AC 3RXOA 1SMFE 3UFAA 1GMDF 4I7YH 3OU0A 5LGOA 1O2RA 2FPZA 3K6ZA 1O3DA 1O5EH 1P8VC 2G00A 5BPEA 4Y7AA 1ELCA 3CS0A 3FP8E 3SV2H 4BNRA 1DWBH 2LPRA 1H9HE 4NIYA 3O8BA 5FAHA 4ZKNU 3STJA 5ETXA 3IG6B 4XBCA 2QAAA 3RP2A 3TJVA 3UQVA 1QJ7B 1BBRE 1QR3E 4RKJB 1DT2A 1IAUA 5LH8A 1AWHB 1VITG 3SOSA 4AG2A 1ELAA 1LKBA 1MBMA 3BTTE 2SNVA 2CGAA 4MPUA 3SNCA 2FX6A 3MH5A 2BX4A 1P04A 5A8XA 1RD3B 4E06H 2BY6X 1UHBB 1AVWA 1C2IA 1J16A 1G32B 2ZEBA 3A85A 1HB0B 3LGVA 2ZU5A 1JWTA 2AIQA 1C2FA 1YPMH 2B5TB 3HK3B 4TPYA 4FVDA 4BANB 3AAUA 2ZPSA 1SFIA 2JH5D 3IWMA 1Q3XA 4IBLH 3PM3A 2YNBA 1AUJA 1ELVA 2XBWA 3E0NB 1K22H 1Z8IB 2R2WU 4A1VA 2BMGB 1CT2E 2OQ5A 1TQ0B 2H2ZA 4TY6A 1HAPH 4KTSA 1ELFA 2W26A 1F5KU 3VB3A 3UNQA 2UUJB 3SJKA 1P01A 1O39A 1D3QB 1EAIA 1KLJH 1AIXH 2ZTZA 2HNTE 4BXWA 2ANYA 1LVBA 3A80A 3Q3KA 4MLFB 2JETB 2BLVA 1P11E 1SQTA 1OP8A 1C5WB 3KEEA 3U1IB 3RXBA 1LDTT 1JRTA 4TPIZ 5ABWA 1IHSH 1ZMNA 3LGWA 5A0CA 1C5UA 2Z9GA 3TVJB 3ATIA 2ANKH 4ISIH 4SGAE 4MNYA 4UFEH 1HXFH 1T8OA 1AFQB 1KDQB 1Z71A 1QRWA 3PMHB 2ZZUH 4GPGA 1Z8RA 5EXNA 1RFNA 3QX5H 2TRMA 4FVBA 4X8VH 3WY8A 1A0JA 1O2QA 2FZZA 1O2WA 5DP3A 5E0HA 1BJUA 3D65E 4X6NA 3RXCA 3QTVH 5DP6A 1MKXK 3LJOA 1ID5H 1WV7H 3VXEH 1TNLA 2G4UA 1TWXB 1AVXA 1GMHF 1C5PA 1BRAA 4HTCH 2IOTA 3R0FA 1AB9C 5CHAC 2J38A 3ZVEA 2GDEH 1C5MD 3SQHE 1VGCB 3A8DA 2BDAA 3EAJA 3QLPH 1GI5A 2B8OH 4AFSA 4ISHH 2PKAA 2ZCHP 2BLWA 4I8GA 3Q77A 4NZQA 2ZDAH 1SQOA 4X0WU 5E0GA 1ANCA 1YPGH 1SGFG 3RXJA 1E35B 2Y80A 1U6QA 4CHAC 3E8LA 1F0UA 1HCGA 3ATLA 3BF6H 1KXAA 1N8OB 3OX7U 4H4FA 1EAWA 4I8JA 1THPB 1Z7KA 3UQOA 1RXPA 1UTKA 4ZKRU 1SGEE 1FPCH 2P16A 2ZF0H 3M36A 4E7RG 5EQQA 1GMHG 1C5RA 2Y6TA 3A7WA 1ANDA 4IC6A 1LTOA 4K8YA 2UWPA 1KXDA 1GHAG 1Y8TA 1LPKB 1C1TA 1HV7A 1DXWA 4NSYA 1DUAA 5G4BA 4AORA 2XXLA 3LGTA 2LNCA 4YLQH 3C27B 8ESTE 1BA8B 4ABDA 2GCHG 5GJ4B 5F8TA 2J95A 1TGSZ 3RXDA 1O2LA 1YCPH 2W3IA 3UR6A 1LHEH 5T3HA 1KLIH 3PWBA 3F6UH 2GV7A 1QTFA 4UFFH 2C93B 8GCHG 2G55A 2P95A 1EJAA 3RC6A 1W3CA 1MKXH 5JB8S 3T25A 1FNIA 1HIAA 4X8SH 4Q7YA 1ZSJA 1SPJA 1ESBA 5GCHG 5PTPA 1C4V2 2QYIA 1GCTC 2A5IA 1TMTH 1UTPA 4INLA 2BD8A 2PLXA 3MU5A 2OINA 4NZLA 1H1BA 1L4DA 1THRH 4GCHG 1O3MA 3GDSA 1XKAC 3TNTA 4B73A 2V3OH 4ISLA 1BTYA 1AN1E 1FONA 3SHCH 2ZU1A 3W95A 2BD7A 1NTPA 1TPSA 4BOHA 1D4PB 2ESTE 4HZHA 2WPIS 1PYTC 3MMGA 1ETTH 1HDTH 4YT7H 1PQ5A 3KN2A 1WQVH 1A0HB 1W14U 3SJIA 2ZCKP 4Q7ZA 4JZ1A 2ZQ2A 2AFQB 2C8XB 1O3IA 1TRYA 1EAUA 2QN5T 3TK9A 2XTTB 2NU4E 4UONA 1VGCC 1ZTJA 2VU8E 2FOGA 1SQAA 2ZDKA 4YT6H 3RXIA 4IN1A 2QA9E 3A84A 1TPOA 1NZQH 3AASA 1A5IA 1GJ9B 1NFXA 1FJSA 1IQIA 2D26C 2F9UA 3U8RH 3VB7A 2BD2A 2P3FH 1TX8A 4FU8A 2XCNA 2A2QH 2FM2A 4LOYH 4UD9H 1PJPA 1J8AA 2CN0H 4FUGA 3SI4H 2ZDVH 4MVNA 4WMEA 3L6PA 5AF9H 2BM2A 4GHQA 4OS5A 3SV8A 1CA0B 1O30A 3SNDA 1HJ9A 3LGUA 2GZ7A 2PTNA 1CGJE 3LONA 1P12E 1EB2A 1ELBA 3RMNH 4Y7BA 5FBEA 5JBTA 1OKXA 1O2XA 3T2NA 4HI3A 1SVPA 1MH0A 3A87A 1QBOA 4FUIA 4J2YB 5IDKA 2QF3A 1GJ5H 1KTTB 1WQSA 1MU6B 2ZFSA 2VIDA 1HXEH 5AFYH 3TGJE 3NKKA 4CR9A 1C5LH 2BX3A 1K1OA 1LHCH 4NWLA 5JPMH 1G36A 2BDGA 3UNRA 5EQSA 5EGMA 1FZZA 4AFZA 1OOKB 1N1LA 1O2KA 3URCA 1UVTH 3RXTA 1GJCB 1FN8A 1ZMLA 2A31A 1KYNA 3GY8A 5AVDA 3BTQE 1YP9A 1F0SA 1HAOH 4SGBE 5SGAE 1YCPK 1TBRH 2R0KA 1TOMH 1PQ8A 4OS6A 2VWNA 4NGAH 3AVZA 2HVXA 1Y5UT 4I8HA 2PKSC 2P8OC 3M5NA 3QTOH 1W0ZU 3RC5A 1XVOA 5F6MA 1OWIA 4Y76A 1TRMA 3V7TA 4RKOB 1V2JT 3K6YA 1BCUH 1BQYA 1GDUA 2P8OB 1BTHH 4FU7A 3UIRA 2ZPQA 3PYHA 2A4OA 3SUFA 1ABIH 1BRUP 1O3EA 1XMNB 5A0BA 1EZXC 3KGPA 2G5VA 4XBBA 4D9RA 1MU8B 4MPXA 3TH2H 1DITH 1GDQA 1UVSH 5DO4H 1UHBA 1OWJA 2ILNA 2HPPH 3MU0A 2Z7FE 1ARCA 1BB0B 3U8OH 3S7HB 4ABHA 3RXQA 3P6ZB 4NIWA 5JYIA 1AMHA 4JYVH 1AKSB 2PR3A 5I46H 9LPRA 1AU8A 2WUCA 5DGJA 2TGPZ 5A8YA 1V2VT 1OPHB 2V6NA 1BRBE 5DJ7A 2J4IA 3RXPA 1GHVH 5ESBA 1ZHPA 1HAHH 4NFEA 5EPYA 3SV9A 2Z3CA 1YPEH 1FMGA 1F7ZA 1CA8B 1GG6C 1A0LA 4WH8A 1Q31A 2XBVA 1Y3WA 3A82A 4IMZA 2RA3A 4MNVA 1IQKA 2J9NA 1A1RA 3HK6B 2AGEX 2H1UA 2J2UA 1HAGE 1V3XA 4UEHH 4I8LA 1UK3A 1SLWB 4GHTA 1QL7A 4X6OA 3RUOA 5FPYA 2SNWA 5DKMA 1UTQA 3DA9B 1HAVB 1PPZA 1DM4B 2IN2A 2HNTF 2FS8A 4ZKOU 1O35A 1V2UT 2AERH 1MUEB 7GCHG 1W7XH 1NRRH 2ZDNA 2ZNKH 1XUFA 2H6MA 3PB1E 3PO1C 8LPRA 1SGRE 1S0RA 4JZDH 2ZHWH 2FS9A 1PPFE 1IQJA 3LJJA 1GCTB 1TNKA 3ZVDA 2D1JA 1HAXB 1S81A 1QQ4A 1WOFA 3SNBA 3U1JB 1ZYOA 4WY3A 1O3CA 4GLYA 1WTGH 4H6TA 2A1DB 1P2JA 3EDXB 1ZPCA 1XVMA 4FUDA 3U69H 2XWBI 4LK4A 2ZHDA 3SU6A 4ABBA 2Z9KA 1SB1H 1HJAB 3EGKH 1FUJA 1FV9A 1ORFA 1GJDB 3M5OA 5A09A 1GJBB 5GWZA 1W13U 2ZIQH 4U32A 3F68H 4UE7H 1GMCG 3TH4H 3TPIZ 1O3PB 1YYY1 2ZFQH 2K1QA 1EPTB 2EEKA 5C1XA 1RTLA 2WYJA 3MNSA 4JCNA 4K5ZA 1ETRH 1Q2WA 1Y5AT 4Y6DA 2FDAA 2WPJS 5AFZH 4D76A 1P2NA 6GCHG 2WV4A 1P2MA 4IGDA 1VITF 1XUHA 1AQ7A 5T6DA 3FANA 4MG3A 3VPKA 4GVUA 4JK5A 3UWIA 4NSVA 4YOIA 4X1PU 4AZ2B 4A1XA 5HGGA 1O5AB 4HFPB 1GJ6A 2F3CE 2FWWA 1MQ5A 2FMJA 2BXUH 3UWJH 4GUXA 1AO5A 1HJAC 4BXSA 2OC7A 2V3HH 1DANH 3KHVA 1BTZA 1CBWB 1GGDC 2BVSH 2D8WA 1S5SA 2HWLB 4GAWA 4RN6A 7ESTE 2HRVA 2ZA5A 4KTUA 4VGCC 8KME2 6GCHF 1UTMA 2RG3A 3ZV8A 3SHAH 1CA0C 3GCTG 1HAYB 3VGCC 1C1QA 1DSUA 1QCPA 3S9AA 2PV9B 2ZGBH 3D23A 1Z1IA 1T8NA 1Z8JB 2BDHA 2Z9JA 3BTKE 2CF9H 4Y11E 1AY6H 1E37B 2G51A 1V2RT 1TX6A 4OS1A 1A5GH 3ENSB 2ZGXH 4D7GA 3A83A 3SBKA 1O2HA 3ZV9A 1BITA 4MNXA 3O8RA 1GBAA 1BHXF 1VR1H 1HYLA 3SORA 2FLBH 3MU1A 3TJNA 3LU9B 3RMMH 3RXLA 3A8CA 2EA3A 3KF2A 1JBUH 1DUEA 2JH0D 1O2GH 2OC1A 4ESTE 1TLDA 3DD2H 5FX6A 3U98H 4AX9H 1AZZA 4K69A 1C2JA 2CF8H 1MAYA 2G52A 4WF8A 5HXFA 3BTHE 1GBHA 3ZVAA 1T8MA 2A5KA 1NESE 1O2OA 2SGPE 3LH1A 1NPMA 2PWXA 1G3DA 4YZUA 2Z94A 3GYMA 2ZHFH 2W7SA 2OC0A 2P3TB 2Y7ZA 3ZZCA 4D9QA 5FX5A 3AAVA 1DWCH 1GJAB 3LDXH 2XBXA 2AMDA 5EXLA 1GBCA 2BD9A 2VIVA 1SGFA 2HGTH 1HRTH 1BT7A 2OLGA 1S83A 1V2ST 5C1YA 5BRRE 3ZZ3A 1CQQA 1P02A 4TYDA 3UOUA 3EYDA 4CRAA 4DT7B 3SU4A 1D9IA 4MPWA 2VH0A 1TGTA 1F5RA 2BLQA 3UUZA 2ASUB 5C2ZA 3ZZAA 1BUIA 4E7NA 4X1SU 1C9TA 6LPRA 5JB9S 1ZJDA 1EQ9A 3CENA 3TJOA 2GZ8A 3GY5A 2D2DA 3RXHA 2ALVA 4CH8B 3PO1B 3M3VA 3ZZ8A 2OUAA 1O2NA 1C5NH 1ZSKA 1OXGA 1CHOF 3M7TA 1O3JA 3TGIE 4WXIA 3GCHB 3URDA 1O2UA 2FYRA 5LPEA 1FY3A 3LOXA 2FTLE 2ZCLP 4BAKB 1BTPA 2ZC9H 1P10A 4BAMB 5FCKA 1O3HA 1CO7E 3ITIA 1Z6JH 1FDPA 4DIHH 1C5XB 4DCDA 1V2NT 1QIXB 3MU4A 1DFPA 1C1OA 4WJG2 1YPJH 5K0HA 2FOBA 2OC8A 1UCYH 1ZMJA 1QHRB 4ZXYH 5GXPA 3SNAA 3E90B 2WV5A 1O5BB 2F9BH 1BMLA 5C1UA 4IC5A 4ABAA 4TY7A 1LKAA 3E3TA 4ISOA 1UJ1A 4KP0A 5EQRA 1H4WA 1F92A 1EPTA 3E1XB 2C8ZB 1EJNA 2NWNA 1T31A 4FU9A 4ZHMU 1C1WH 4B2BA 1ABJH 3GDVA 4MPVA 3UNSA 2VIPA 3PLPA 4AFQA 5HM2A 1QRZA 1ESTA 2BXTH 6CHAB 2AH4X 2ZFRH 3RDZA 1G3BA 1KLTA 2VWLA 3KQEA 1IQEA 5DP5A 2BY9X 5DG6A 1OP2A 3SGAE 1DPOA 1SOZA 1O5DH 1DSTA 4AG1A 2CJIA 1C1VH 1NU9A 3OSYA 1OS8A 1O5CB 3O8DA 3FVFB 1D3TB 4VGCB 1GCDA 2FOHA 4CBNA 1K1LA 2G81E 1VITH 2NU2E 4U2WA 3H7OA 2BHGA 2BDCA 3NZIA 5FCRA 2V0BA 3TK5A 1SHHB 4X2YA 3QZQA 2H5CA 1P3EA 1SGTA 4Y0ZE 1W11U 4TWWA 3W94A 2FI5E 4NG9H 1PYTD 3C1KA 2BZAA 2HNTC 4RSPA 5EODA 1PPGE 4F4OC 5AHGH 1ZTLA 2F9VA 3A8BA 3EE0B 5B6OA 3Q3XA 2VVVA 1FLEE 3KQCA 4A1TA 3SU2A 2ULLA 3IITA 1TYNA 4NIVA 1NS3A 2ZHQH 3A89A 2R9PA 1EUFA 1QGFA 1YPHC 3RXGA 4JK6A 4D8NA 1N6YA 1T32A 1J14A 2PSYA 4AGJA 2QXJA 1Z1JA 1QA0A 3K65B 4E05H 1G3CA 2Y7XA 1ZSLA 1GI6A 3PMAB 1KXCA 4B76A 1YLDA 3GOVB 3SUEA 1KY9A 1ZZZA 2O8TA 1HJ8A 1C1MA 3ELAH 3FP7E 4XSKU 2A7JA 2B7DH 4B75A 2H9EH 2TIOA 1MTNC 1THSH 5DP9A 4J1YA 2GX4A 1IQHA 1CHGA 2Q6FA 1BBRH 4XDEA 3NWUA 4TWYA 2F9OA 1C5SA 2QF0A 4Y0YE 3BTFE 1YGCH 5EW2H 3BEIB 2NU3E 1Y3UA 4YM9A 1Z8GA 4BAQB 3BG4C 2FX4A 1M9UA 1QY6A 5EOKA 1P2QA 2CHAB 2VJ1A 1QBVH 1K1IA 2YNAA 3L3TA 1SG8B 2GD4B 1Y3VA 1CGIE 3VEQB 1Y59T 1BBRK 2B9LA 3KIDU 4ABIA 1LCYA 1QFKH 3Q76A 1TNGA 4O03A 1LMWB 2Z3EA 3NK8A 2FOMB 1MD8A 3BTDE 4DW2U 1TALA 3BG4B 4UFDH 4KGAA 1G9IE 4Y8XA 2VH6A 3MH6A 3P70B 3OTJE 4K8BA 3ZZ9A 4H42U 2VWMA 1UTNA 2V35A 4BTUB 1GHAF 1SGNE 3RXUA 1B7XB 2ZGCA 3MWIU 5LPFA 4BTTB 7LPRA 4CRDA 3A81A 1PQAA 1MTNB 5DP4A 2EI7A 3SU5A 1F5LA 4A7IB 3ATMA 1TBQH 1V2LT 4U01A 4X2WA 3SQEE 2GCHF 3NCLA 2UUFB 1QB1A 2EI6A 1V2TT 2GT8A 2Q1JA 1GWAA 1GBTA 1XM1A 3NPSA 1T4VH 3GISB 5JBAS 2O8UA 4Y79A 3OYPA 4Y8YA 2Y5FA 3A7TA 1LVMA 2P93A 1XUGA 3H5CB 3S9BA 2AGIX 2BOHB 2GDDA 5I25A 1C9PA 2BLOA 1LPZB 1UVUH 3VGCB 3QDZB 3A86A 2BY5X 2BQ7B 2J92A 2WPKS 5F8ZA 1GJ8B 3OY5U 1FY8E 4NIXA 1SGDE 1FI8A 3T29A 2C8WB 3P8GA 2FIRH 1GVKB 2VGCC 1XXDA 3VB5A 2AEIH 4DGJA 1MAXA 2G4TA 4KKDA 4NA7A 4Y71A 1QB6A 1OYTH 1AGJA 9ESTA 4AN7A 2FOCA 3SUGA 4NFFA 5F8XA 1D6WA 2J34A 4H6SB 1NFYA 2F91A 2CXVA 3M5LA 2BY7X 3RM2H 2VGCB 1O34A 1GHYH 5IYTA 3I78A 4ABEA 3E16B 1V2PT 1MKWH 4AOQA 2GMTB 3A7ZA 3SI3H 3ZZDA 1OYQA 1TABE 1O5FH 5DP8A 1TONA 3E6PH 3ZVBA 4B2AA 4KTCA 1IQGA 2AMPA 3T5FH 4CRFA 1B5GH 1NRSH 5L6NH 3EQ0H 2AIPA 1O33A 2C90B 3M7QA 2IPHA 3UPEA 1J9CH 1SHYA 2PUXB 4CRCA 1CSOE 1MTVA 2OBQA 1RIWC 5CE1A 3TIUA 2WUBA 1JRSA 2TGTA 2UWLA 1O2IA 1G2MA 2YOLA 1VJ9U 3H7TA 4CRGA 3F9EA 2O8LA 4K3JA 4OGYA 1C1SA 1NU7B 2O8MA 1RTKA 2FI3E 1EKBB 1LHDH 1O2JA 2FESH 4WH6A 1DE7H 2Z9IA 1DDJA 3RXAA 3STIA 1P09A 2ALPA 3UREA 1QJ1B 1GHXH 1GBKA 3ZVGA 2ZFFH 1RJXB 2A4GA 1GI8B 1TPAE 5E8EH 4F49A 3ZYEA 1UTJA 4WMFA 1SLXB 4B71A 5DK1A 1AWFH 3Q00A 1K21H 1UVOA 2BDYA 1MQ6A 2OD3B 1RTFB 3SO3A 2FYQA 2BZ6H 3GCNA 4DIIH 1KIGH 3BIVH 3VXFH 3F1SB 2QY0B 5DP7A 1ZLRA 4CH2B 3JZ1B 3GY2A 4ISNA 1H8IH 5HMAA 4YO9A 1C1PA 1JXPA 1WCZA 1AVGH 4A92A 1UK4A 3PWCA 4YOJA 1TNHA 3MNXA 4X1RU 1GVZA 3HKIB 2ZO3H 1IQLA 3T27A 3PTBA 1ETSH 3FZDA 2AGGX 2A0QB 5C5OA 1C5OH 3M5MA 2H5DA 2UUYA 4ZH8A 4Y8ZA 3RMLH 3RLYH 3RXMA 1IHTH 1O31A 1L4ZA 2BD4A 1Y3YA 2P3UB 5GIBA 2FO9A 2FP7B 1O3KA 1GHBG 3MHWU 1GBJA 4PROA 1NO9H 3JZ2B 1KSNA 1HUTH 5LPRA 3S7KB 4HGCA 3K2UA 1LVYA 1NT1A 1TGBA 1S6HA 1CT0E 1P9SA 1W0YH 2XCFA 1PPEE 3VB6A 1P2OA 1D3DB 2RDLA 1YCPM 3RXSA 3GCTF 3KQDA 1NFUA 1O3GA 3ESTA 1P06A 3PMJA 1A7SA 3RXVA 1SBWA 2ZU2A 1TOCB 4O97A 2F9PA 3CS7A 2BB4A 3D49H 1XUKA 1C1RA 2DUCA 3RU4E 1NY22 1O3BA 2GCTC 2WPMS 1GHWH 4K1SA 4FUFA 2ZI2H 1DLKB 3ODFA 1BJVA 3TGKE 2GV6A 2GMTC 2UWOA 1KXFA 1MD7A 1G2LA 1LHFH 1OP0A 1MTSA 2BD5A 1V2OT 1LQDB 1INCA 2AMQA 5TCAA 3RU4T 1BMMH 1FPHH 2VIWA 2XNIA 1T4UH 3TITA 1C5QA 2KAIA 2Y5GA 1OWKA 1GHZA 4JMYA 1GI2A 3GY4A 1TAWA 1BRCE 4WMDA 3MO9A 3LT3A 3QO6A 4Q80A 3QN7A 2FTMA 1NRQH 1O2ZA 5T6FA 1EZSC 4THNH 1O32A 1ZOMA 1KXEA 1QA7A 3VB4A 3LPRA 4XOJA 1A4WH 3DT0H 3HGPA 2VWOA 2STAE 1XUJA 3EA7A 1Y3XA 2G8TA 2OTVA 4ABGA 5GDSH 3I29A 2Z6BD 4Y10E 1DICA 1L1GA 4NCYA 3ODDA 1SR5C 3ZYDA 5GPIB 4FUEA 6CHAC 3RU4D 1WSSH 4YOGA 2XC0A 1A61H 2W3KA 1AKSA 1O2TA 3ZZ7A 3DUXH 1CHOG 1BZXE 2C8YB 2A2XH 1E36B 1O3LA 2PGQB 3A7XA 1F0TA 1FAKH 1HPGA 3QUMP 3M7UA 4LXBH 1OWHA 4BTIB 2HALA 1ANEA 7GCHF 1FY1A 1UVPA 2BDBA 2SFAA 2ODYB 3S9CA 1O3AA 1A2CH 1DX5M 2BD3A 2Z9LA 3P8NA 2OXSA 3ZZ5A 3UTUH 1OWDA 2FODA 1VCPA 2P59A 1GI7B 3V0XA 1HNEE 3D62A 1RRKA 3PROA 1HLTH 1JIRA 4CR5A 5EW1H 1QJ6B 4I32A 3BG8A 4I33A 4CRBA 3QZRA 2RCEA 1CBWC 4ZKSU 1QBNA 3G01A 1TMUH 3QK1A 1K1JA 1XXFA 3M3TA 1GI3A 4I8KA 5L2ZH 4JZFH 3T62A 1CVWH 4XBDA 1MCTA 5H4IB 1GI4A 5HM9A 1V2QT 1O3NA 2R3UA 1YPKH 2ZGHA 2QGRA 1GJ7B 3EA8A 1VCWA 2H9TH 2R2MB 1W10U 1C2MA 1UCYE 4ZMAH 1GHBF 3PLKA 4K1TA 2JETC 1GI9B 5JDUB 1B0FA 1ZHMA 2VINA 5A2MH 1GPZA 1AD8H 1GGDB 1EPTC 1UTLM 3P95A 4Z6AH 1ZHRA 2W5EA 2SGDE 1ZTKA 2A45B 3S0NA 2TGDA 1EZQA 5EU8A 2O8WA 4K60A 1RIWB 1NN6A 1WTHD 1K9OE 1TNIA 1CT4E 2B0FA 2Q6GA 1EATA 1ELEE 1H8DH 2WINI 2ZFPH 3RM0H 1MZAA 1AE8H 7KMEH 2XRCA 1HBTH 4OGXA 1MMJN 3GY3A 2FI4E 1VZQH 2FXRA 2BDIA 1SI5H 2PGBB 4U30A 1O36A 2ZDMA 3SU3A 3NXPA 1NROH 1TBZH 4GCHF 2ANMH 2OCVB 1BTUA
chains in the Genus database with same CATH superfamily
3HKJB 2VIQA 1P03A 3N7OA 3P17H 2F9NA 2DE8A 1A3BH 1V2KT 1GG6B 5DN6D 3GCOA 2NU1E 3AW0A 3BEUA 3HGNA 2H9HA 3N7EA 5JBCS 2QF4A 1BDAA 5E2PA 3RXEA 5EIYA 1SGPE 1AUTC 1NRPH 5L2YH 1L0ZA 4K2YA 3B8JA 3M61U 3ZVFA 3V13A 2QXHA 2R0LA 1BTWA 1BIOA 1EOLA 1NRNH 1TB6H 1DS2E 1DWDH 3A7VA 3DHKH 4X1QU 1QURH 3M37A 2GGVB 3BSQA 2F83A 3PTNA 2ZG0H 4MQAA 5CHAB 1P9UA 1AZ8A 2FOAA 4DJZB 1C2GA 1GJ4H 1C4U2 4O3TA 1C2HA 3A88A 1FY4A 2AS9A 1O38A 1OWEA 4Q2KA 4IMQA 1UCYK 1P3CA 1EB1H 3PLBA 1CGHA 1TRNA 2A4RA 3UOPA 1OHHD 1S85A 1D6RA 4ZUHA 4CHAB 1L1NA 1IQNA 4ZAEA 4WXVA 1P0SH 2CHAC 1GBFA 1OSSA 1AFQC 1FIWA 4Z0KA 2C4FH 4HG6A 1OX1A 3CP7A 1MCVA 3SGQE 1N6XA 2J97A 4BAOB 1MZDA 1IQFA 1D3PB 1LQEA 2SGFE 3ZZ6A 4WWYA 2KCOA 2ANWA 4YLUA 2BOKA 2OQUA 2KCPA 1O2PA 2CK3D 1PPCE 4ZROA 3UAIC 1GBIA 3HPTB 4WVPE 3P8OA 3FAOA 1EX3A 2SGEE 1PPBH 1QB9A 3PV5A 5ESTE 1P57B 3KL6A 2BQ6B 3DFJA 2C3SA 4LZ1H 5DPAA 1ELDE 4R0IA 3ZZ4A 2Z3DA 2BVXH 4FUJA 4NA8A 1FXYA 5TJXA 2ZTXA 4DG4A 2ZHEH 3PV4A 1SLVB 3A8AA 1E38B 1YLNA 2BY8X 2GKVE 2TBSA 3LC3A 1ZGIA 2RDEA 1E34B 3T28A 2XC5A 1XKBC 4INHA 1C5VA 2QCYA 3QWCH 5T6GA 2GZ9A 2KX4A 1KXBA 2PUQH 1S82A 4RT0A 1YLCA 1O2MA 1WYKA 1AHTH 1IQMA 1TPPA 2AYWA 4ZXXH 2GCTB 1NM6A 2GVFA 1GDNA 4DVAU 3LKWA 3L33A 2FOEA 2SGAA 2G5NA 1SC8U 3P92A 2VB0A 1PFXC 2ZP0H 2ZU3A 2FOFA 1EJMA 5FXLA 1ZGVA 3TLOA 1H9IE 1TGCA 1YWUA 2KZ4A 5K7RA 2PKSB 4B74A 2WYGA 4CBOA 5EPNA 3BEFB 2TPIZ 1EZUC 3SZNA 2HLCA 1UW7A 1DY8A 1QRXA 1V6DA 1DXPA 2PTCE 1C2DA 3AW1A 2FEQH 1UMAH 1GI1A 2XBYA 1W2KH 3TK6A 4CREA 1J15A 2ZKSA 4FUBA 2M5TA 2NU0E 2BTCE 4QT8C 2XWAA 1GMDG 3LIWA 1S84A 3SV7A 4ASHA 5FPTA 3F2GA 1TFXA 2CMYA 2HPQH 1EAXA 3PV2A 2Q6DA 1FN6A 4X2VA 1LHGH 8GCHF 4DOQA 1MBQA 3SU0A 4FUHA 1E1QD 3U9AH 1UK2A 3PMBB 4X6MA 1K1PA 5FPSA 3F9HA 3M3SA 2W7UA 2A4QA 1C5TA 4DY7B 1C2EA 1SGIB 3MO3A 2QC2A 1Y5BT 1C1NA 2ODPA 1GBBA 1UTOA 2ZFTA 4K1EA 3SZEA 1HAIH 3OAAD 3SU1A 1TX7A 1C5ZB 2EI8A 2KAIB 2THFB 1TMBH 1HIAB 3BTWE 1P2KA 1L2EA 1B0EA 1NC6A 4UFGH 4YTAA 1VJAU 4JZEH 2VIOA 3TJUA 1QL9A 1P05A 3P8FA 2BQWB 5CMXH 2BVRH 4ABJA 3ZZBA 3F9FA 3TH3H 4IW4E 3ATWA 4KELA 4D7FA 1QL8A 4X8TH 3BTGE 2PSXA 2BYAX 2VVUA 1C2KA 2Y82A 1YPHE 5C20A 3RC4A 1TGNA 4XFQA 1W8BH 3GY7A 5L30H 1HAZB 4FUCA 3TU7H 4O3UA 2GTBA 3QGNB 3DFLA 3GCHC 1MTUA 1NFWA 1TA2A 1ACBE 4OS7A 3GDUA 1KDQA 3FP6E 1GBMA 1TQ7B 1JOUB 1SFQB 4AGKA 1WBGB 5C0TA 1A46H 1ARBA 3SJOA 4IS5A 2PW8H 1GL1A 1ZRBA 1HAVA 4MNWA 3B23B 3RMOH 1YBWA 1PPHE 1K1NA 4GSOA 1MKWK 3FFGA 1GBEA 1LO6A 1HFDA 1KTSB 2OBOA 1FIZA 1FAXA 1CE5A 3QGJA 3M35A 1GVLA 2A7CA 2TGAA 4A5TS 1S6FA 1ANBA 2DE9A 3MOCA 2O9QA 4ZHAA 1EP6A 2I6QA 1AFEH 2JH6D 1O37A 4JYTA 5FL7D 1SSXA 1HGTH 1O2SA 1FQ3A 3KQBA 1GMCF 1K2I1 4I86A 3GY6A 4B1TA 3LH3A 3V3MA 4R8TB 3ATKA 1C5YB 1C2LA 2A5AA 4UDWH 3MI4A 3T26A 1E0FD 3TNSA 5C3NA 1O3FA 1YKTA 1BMAA 4LZ4B 2HOBA 1ZPBA 3O8CA 3S69A 2FLRH 2WPLS 2GT7A 3LGIA 2ZECA 5EG4A 2PFEA 4X8UH 1DOJA 4YESB 2Y81A 1AB9B 3MH4A 4X1NU 6ESTA 1SOTA 1YPLH 1ESAA 1PQ7A 3UY9A 1SGQE 2QXGA 1JIMA 1G3EA 1O3OA 1ZR0A 3I77A 4B2CA 5A8ZA 1VCQA 5EJLA 1BTXA 1WUNH 1F0RA 3RXRA 3E91A 1WAYB 5E0JA 1C4Y2 1CU1A 5JBBS 2ZGJA 3F2FA 4Q7XA 3VFEA 1A5HA 2PKAB 3B9FH 1V2MT 2XYAA 3RXKA 3MH7A 3HATH 1Z6EA 3MNBA 3MFJA 4NA9H 1T7CA 3F0OA 1QNJA 3RXFA 3F3BA 1W0JD 2XW9A 3F9GA 2ZU4A 1LPGB 5F03A 2VNTA 1MTWA 4F55A 4P00A 3KCGH 3EA9A 1TA6A 1O2YA 2QV1A 1NBME 4B6FA 3FZZA 3GYLB 1O2VA 1BOQA 3MTYA 3KNXA 4AB9A 2P94A 2ODQA 4X6PA 1DVAH 3MYWA 1BMNH 2OP9A 3U28C 1N8OC 3R3GB 1FY5A 5E2OA 1L1JA 5C5NA 3SW2B 1BHXB 3RLWH 1DWEH 3MU8A 4NWKA 1H9LB 3U8TH 4JZIA 1ELTA 1K0HA 4Q4LA 4O9VA 2A32A 1WU1A 2QIQA 1EXFA 4AYVB 2XC4A 2VVCA 2STBE 1J17T 1S0QA 3ZIAD 2Y5HA 3SJ8A 1SGYE 5J4SA 1E1RD 1K28D 1XUIA 4ACBA 1O5GH 5KGOA 4AB8A 1ZJKA 1ZRKA 3OTPA 2XNDD 4IN2A 1GL0E 5GCHF 2J94A 2JKHA 3BTME 2EC9H 1G37A 3LC5A 4MDSA 1V2WT 1TE0A 1G30B 4F48B 1UO6A 2ZDLA 3A7YA 1A3EH 1RS0A 1IOEA 1T8LA 1YM0A 1GBLA 5EXMA 5FHTA 2IJOB 1LVOA 3MNCA 2ZQ1A 2R3YA 5HYOA 5A0AE 3K9XB 1ZPZA 1EOJA 1QQUA 5HKKD 4JYUH 3OY6U 2ZTYA 2GP9B 3SV6A 2A7HA 4FXGH 2I6SA 2UUKB 4XE4A 3MO6A 3SN8A 5CHBA 1YC0A 3BIUH 2F43B 1GBDA 2CV3A 1DY9A 4AYYB 3Q3YA 4A6LA 5J4QA 2SGQE 4INKA 1W7GH 3ZVCA 1AE5A 1O0DH 3CNRA 4AFUA 4MTBA 1DLEA 2ZWLH 3NUMA 2QXIA 1ELGA 1TNJA 1SLUB 3SUDA 3SYJA 4DURA 4OS2A 2WPHS 3UR9A 4OS4A 2RA0A 1F2SE 4BAHB 1W12U 4I31A 5F53A 1JMOH 3BV9B 1SL3A 1RGQA 5FBIA 1K1MA 2PHBA 4ZHLU 1EP5A 1YF4A 4X2XA 4M7GA 4ABFA 3V12A 3BTEE 3SJ9A 3GICB 3SNEA 3SGBE 1TIOA 2ZPRA 4Q63A 3E0PB 1AI8H 1C1UH 1EASA 3BN9A 1XX9A 5C67A 5TCCA 3LGYA 1GI0A 1P2IA 1SGCA 1X7AC 3RXOA 1SMFE 3UFAA 1GMDF 4I7YH 3OU0A 5LGOA 1O2RA 2FPZA 3K6ZA 1O3DA 1O5EH 1P8VC 2G00A 5BPEA 4Y7AA 1ELCA 3CS0A 3FP8E 3SV2H 4BNRA 1DWBH 2LPRA 1H9HE 4NIYA 3O8BA 1WDIA 5FAHA 4ZKNU 3STJA 5ETXA 4Z1MD 3IG6B 4XBCA 2QAAA 3RP2A 3TJVA 3UQVA 1QJ7B 1BBRE 1QR3E 4RKJB 1DT2A 1IAUA 5LH8A 1AWHB 1VITG 3SOSA 4AG2A 1ELAA 1SQRA 1LKBA 1MBMA 3BTTE 2SNVA 2CGAA 4MPUA 2WPDD 3SNCA 2FX6A 3MH5A 3WWFA 2BX4A 1P04A 5A8XA 1RD3B 4E06H 2BY6X 1UHBB 1AVWA 1C2IA 1J16A 1G32B 2ZEBA 3A85A 1HB0B 3LGVA 2ZU5A 1JWTA 2AIQA 1C2FA 1YPMH 2B5TB 3HK3B 4TPYA 2EQNA 4FVDA 4BANB 3AAUA 2JJ2D 2J98B 2ZPSA 1SFIA 2JH5D 3IWMA 1Q3XA 4IBLH 3PM3A 2YNBA 1AUJA 1ELVA 2XBWA 3E0NB 1K22H 1Z8IB 2R2WU 4A1VA 2BMGB 1CT2E 2OQ5A 1TQ0B 2H2ZA 4TY6A 1HAPH 4KTSA 1ELFA 2W26A 1F5KU 3VB3A 3UNQA 2UUJB 3SJKA 1NBMD 1P01A 1O39A 1D3QB 1EAIA 2JIZD 1KLJH 1AIXH 2ZTZA 2HNTE 4BXWA 2ANYA 1LVBA 3A80A 3Q3KA 4MLFB 2JETB 2BLVA 1P11E 2K0QA 1SQTA 1OP8A 1C5WB 3KEEA 3U1IB 2W6JD 3RXBA 1LDTT 1JRTA 4TPIZ 5ABWA 1IHSH 1ZMNA 3LGWA 5A0CA 1C5UA 2Z9GA 3TVJB 3ATIA 2ANKH 4ISIH 4SGAE 4MNYA 4UFEH 1HXFH 1T8OA 1AFQB 1KDQB 1Z71A 1QRWA 3PMHB 2ZZUH 4GPGA 1Z8RA 5EXNA 1RFNA 3QX5H 2TRMA 4FVBA 4X8VH 3WY8A 1A0JA 1O2QA 2FZZA 1O2WA 5DP3A 5E0HA 1BJUA 3D65E 4X6NA 3RXCA 3QTVH 5DP6A 1MKXK 3LJOA 1ID5H 5C0UA 1WV7H 3VXEH 1TNLA 2G4UA 1TWXB 1AVXA 1GMHF 3W1EA 1C5PA 1BRAA 4HTCH 2IOTA 3R0FA 1AB9C 5CHAC 2J38A 3ZVEA 2GDEH 1C5MD 3SQHE 1VGCB 3A8DA 2BDAA 3EAJA 3QLPH 1GI5A 2B8OH 4AFSA 4ISHH 4B6EA 2PKAA 2ZCHP 2BLWA 4I8GA 3Q77A 4NZQA 2ZDAH 1SQOA 4X0WU 5E0GA 2KFWA 1ANCA 1YPGH 1SGFG 3RXJA 1E35B 2Y80A 1U6QA 4CHAC 3E8LA 1F0UA 1HCGA 3ATLA 3BF6H 1KXAA 1N8OB 3OX7U 4H4FA 1EAWA 4I8JA 1THPB 1Z7KA 3UQOA 1RXPA 1UTKA 4ZKRU 1SGEE 1FPCH 2P16A 2ZF0H 3M36A 4E7RG 5EQQA 1GMHG 1C5RA 2Y6TA 3A7WA 1ANDA 4IC6A 1LTOA 4K8YA 2UWPA 1KXDA 1GHAG 1Y8TA 1LPKB 1C1TA 1HV7A 1DXWA 4NSYA 1DUAA 5G4BA 4AORA 2XXLA 3LGTA 2LNCA 4YLQH 3C27B 3OEHD 8ESTE 1BA8B 4ABDA 2GCHG 5GJ4B 5F8TA 2J95A 1TGSZ 3RXDA 1O2LA 1YCPH 2W3IA 2J5UA 3UR6A 1LHEH 5T3HA 1KLIH 1QZ8A 2V3MA 3PWBA 2PP6A 3F6UH 2GV7A 1QTFA 4UFFH 2C93B 8GCHG 2G55A 2P95A 1EJAA 3RC6A 5KECA 1W3CA 1MKXH 5JB8S 3T25A 1FNIA 1HIAA 4X8SH 4Q7YA 1ZSJA 1SPJA 1ESBA 5GCHG 5PTPA 1C4V2 2QYIA 1GCTC 2A5IA 4FETA 1TMTH 1UTPA 3FOAA 4INLA 2BD8A 2PLXA 3MU5A 2OINA 4NZLA 1H1BA 1L4DA 1THRH 4GCHG 1O3MA 3GDSA 1XKAC 3TNTA 4B73A 2V3OH 2JJ1D 4ISLA 1BTYA 1AN1E 1FONA 3SHCH 2ZU1A 3W95A 2BD7A 1NTPA 1TPSA 4BOHA 1D4PB 2ESTE 4HZHA 2WPIS 1PYTC 3MMGA 1ETTH 1HDTH 4YT7H 1PQ5A 3KN2A 1WQVH 1A0HB 1W14U 4TT3D 3SJIA 2ZCKP 4Q7ZA 4JZ1A 2ZQ2A 2AFQB 2C8XB 1O3IA 1TRYA 1EAUA 2QN5T 3TK9A 2XTTB 2NU4E 4UONA 1VGCC 1ZTJA 2VU8E 2WSSD 2FOGA 1SQAA 2ZDKA 4YT6H 3RXIA 4IN1A 2QA9E 3A84A 1TPOA 1NZQH 3AASA 1A5IA 1GJ9B 1NFXA 1FJSA 1IQIA 2D26C 2F9UA 3U8RH 3VB7A 2BD2A 2P3FH 1TX8A 4FU8A 2XCNA 2A2QH 2FM2A 4LOYH 4UD9H 1PJPA 1J8AA 2CN0H 4FUGA 3SI4H 2ZDVH 4MVNA 4WMEA 3L6PA 5AF9H 2BM2A 4GHQA 4OS5A 3SV8A 1CA0B 1O30A 3SNDA 1HJ9A 3LGUA 2GZ7A 2PTNA 1CGJE 5EJ1A 3LONA 2QF5A 1P12E 1EB2A 1ELBA 3RMNH 4Y7BA 5FBEA 5JBTA 1OKXA 1O2XA 3T2NA 4HI3A 1SVPA 1MH0A 3A87A 1QBOA 4FUIA 4J2YB 5IDKA 2QF3A 1GJ5H 1KTTB 1WQSA 1MU6B 1W0KD 2ZFSA 2VIDA 1HXEH 5AFYH 3TGJE 3NKKA 4CR9A 1C5LH 2BX3A 5HIZA 1K1OA 1LHCH 4NWLA 5JPMH 1G36A 2BDGA 2M2AA 3UNRA 5KEDA 5EQSA 5EGMA 1FZZA 1KMHB 4AFZA 1OOKB 1N1LA 1O2KA 4XRNA 3URCA 1UVTH 3RXTA 1GJCB 1FN8A 1ZMLA 2A31A 1KYNA 3GY8A 5AVDA 3BTQE 1YP9A 1F0SA 1HAOH 4SGBE 5SGAE 1YCPK 1TBRH 2R0KA 1TOMH 1PQ8A 4OS6A 2VWNA 4NGAH 3AVZA 2HVXA 1Y5UT 4I8HA 2PKSC 2P8OC 3M5NA 3QTOH 1W0ZU 3RC5A 1XVOA 2LP6A 5F6MA 1OWIA 4Y76A 1TRMA 2HVYB 3V7TA 4RKOB 1V2JT 3K6YA 1BCUH 1BQYA 1GDUA 2P8OB 1BTHH 4FU7A 3UIRA 2ZPQA 3PYHA 2A4OA 3SUFA 1ABIH 1BRUP 1O3EA 1XMNB 5A0BA 1EZXC 3KGPA 2G5VA 4XBBA 4D9RA 1MU8B 4MPXA 3TH2H 1DITH 1GDQA 1UVSH 5DO4H 1UHBA 1OWJA 2ILNA 2HPPH 3MU0A 2Z7FE 1ARCA 1BB0B 1H8ED 3U8OH 3S7HB 4ABHA 3RXQA 3P6ZB 4NIWA 5JYIA 1AMHA 4JYVH 1AKSB 2PR3A 5I46H 5HIYA 9LPRA 1AU8A 2WUCA 5DGJA 2TGPZ 1BMFD 5A8YA 1V2VT 1OPHB 2V6NA 1BRBE 5DJ7A 2J4IA 3RXPA 1GHVH 5ESBA 1ZHPA 1HAHH 4NFEA 5EPYA 3SV9A 3PRDA 2Z3CA 1YPEH 1FMGA 1F7ZA 1CA8B 1GG6C 1A0LA 4WH8A 3FO8D 3OE7D 1Q31A 2XBVA 1Y3WA 2AHME 3A82A 4IMZA 2RA3A 4MNVA 1IQKA 2J9NA 1A1RA 3HK6B 2AGEX 2H1UA 2J2UA 1HAGE 1V3XA 2KCYA 4UEHH 4I8LA 1UK3A 1SLWB 4GHTA 1QL7A 4X6OA 3RUOA 5FPYA 2SNWA 5DKMA 1UTQA 3DA9B 1HAVB 1PPZA 1DM4B 2IN2A 2HNTF 2FS8A 4ZKOU 1O35A 2L6OA 1V2UT 2AERH 1MUEB 7GCHG 1W7XH 1NRRH 2ZDNA 2ZNKH 1XUFA 2H6MA 3PB1E 3PO1C 8LPRA 2WV9A 1SGRE 1S0RA 4JZDH 2ZHWH 2FS9A 1PPFE 1IQJA 3LJJA 1GCTB 1TNKA 3ZVDA 2D1JA 1HAXB 1S81A 4XD7D 1QQ4A 1WOFA 3SNBA 3U1JB 1ZYOA 4WY3A 1O3CA 4GLYA 1WTGH 4H6TA 2A1DB 1P2JA 3EDXB 1ZPCA 1XVMA 4FUDA 3U69H 2XWBI 4LK4A 2ZHDA 3SU6A 4ABBA 2LELA 2Z9KA 1SB1H 1HJAB 3EGKH 1FUJA 1FV9A 1ORFA 1GJDB 3M5OA 5A09A 1GJBB 5GWZA 1W13U 2ZIQH 4U32A 3F68H 4UE7H 1GMCG 3TH4H 3TPIZ 1O3PB 1YYY1 2ZFQH 2K1QA 1EPTB 2EEKA 5C1XA 1RTLA 2WYJA 3MNSA 4JCNA 4K5ZA 1ETRH 1Q2WA 1Y5AT 4Y6DA 2FDAA 2WPJS 5AFZH 4D76A 1P2NA 6GCHG 2WV4A 1P2MA 4IGDA 1VITF 1XUHA 1AQ7A 5T6DA 3FANA 4MG3A 3VPKA 4GVUA 4JK5A 3H09A 3UWIA 4NSVA 4YOIA 4X1PU 4AZ2B 4A1XA 5HGGA 1O5AB 4HFPB 1EFRD 1GJ6A 2F3CE 2FWWA 1MQ5A 2FMJA 2BXUH 3UWJH 4GUXA 1AO5A 1HJAC 4BXSA 2OC7A 2V3HH 1DANH 3KHVA 1BTZA 1CBWB 1GGDC 2BVSH 2D8WA 1S5SA 2HWLB 3VG8A 3GS9A 4GAWA 4RN6A 7ESTE 2HRVA 2ZA5A 4KTUA 4VGCC 8KME2 3WWBA 6GCHF 4FOUC 1UTMA 2RG3A 3ZV8A 4ASUD 3SHAH 1CA0C 3GCTG 1HAYB 3VGCC 4AC9A 1C1QA 1DSUA 1QCPA 3S9AA 2PV9B 2ZGBH 3D23A 1Z1IA 1T8NA 1Z8JB 2BDHA 2Z9JA 3BTKE 2CF9H 4Y11E 1AY6H 1E37B 2G51A 1V2RT 1TX6A 4OS1A 5IK2D 1A5GH 3ENSB 2ZGXH 4D7GA 3A83A 3SBKA 1O2HA 3ZV9A 1BITA 4MNXA 3O8RA 1GBAA 1BHXF 1VR1H 1HYLA 3SORA 2FLBH 3MU1A 3TJNA 3LU9B 3RMMH 3RXLA 3A8CA 2EA3A 3KF2A 1JBUH 1DUEA 3OFND 2JH0D 1O2GH 2OC1A 4ESTE 1TLDA 3DD2H 5FX6A 3U98H 4AX9H 1AZZA 2IJD1 4K69A 1C2JA 2CF8H 1MAYA 2G52A 4WF8A 5HXFA 2L74A 3BTHE 1GBHA 3ZVAA 1T8MA 2A5KA 2HLDD 1NESE 1O2OA 2SGPE 3LH1A 5C94A 1NPMA 2PWXA 1G3DA 4YZUA 2Z94A 1YY3A 3GYMA 2ZHFH 2W7SA 2OC0A 2P3TB 2Y7ZA 4YXWD 3ZZCA 4D9QA 5FX5A 3AAVA 1DWCH 3FN8A 4P02A 1GJAB 3LDXH 2XBXA 2AMDA 5EXLA 1GBCA 2BD9A 2VIVA 1SGFA 2HGTH 1HRTH 1BT7A 2OLGA 1S83A 1V2ST 5C1YA 5BRRE 3ZZ3A 2KCAA 1CQQA 1P02A 4TYDA 3UOUA 3EYDA 4CRAA 4DT7B 3SU4A 1D9IA 4MPWA 2VH0A 1TGTA 1F5RA 2BLQA 3UUZA 5CDFE 2ASUB 5C2ZA 3ZZAA 1BUIA 4E7NA 4X1SU 1C9TA 6LPRA 5JB9S 1ZJDA 1EQ9A 3OEED 3CENA 3TJOA 2GZ8A 3GY5A 2D2DA 3RXHA 2W6ID 2ALVA 4CH8B 3PO1B 3M3VA 3ZZ8A 2OUAA 1O2NA 1C5NH 1ZSKA 1OXGA 1CHOF 3M7TA 1O3JA 3TGIE 4WXIA 3GCHB 3URDA 1O2UA 2FYRA 5LPEA 1FY3A 3LOXA 2FTLE 2ZCLP 4BAKB 1BTPA 2ZC9H 1P10A 4BAMB 5FCKA 1O3HA 1CO7E 4M9FA 3ITIA 1Z6JH 1FDPA 4DIHH 1C5XB 4DCDA 1V2NT 1QIXB 3MU4A 1WXRA 1DFPA 1C1OA 4WJG2 2RFKC 1YPJH 5K0HA 2FOBA 2OC8A 1UCYH 1ZMJA 1QHRB 4ZXYH 5GXPA 3SNAA 3E90B 2WV5A 1O5BB 2F9BH 1BMLA 5EJZA 5C1UA 4IC5A 4ABAA 4TY7A 1LKAA 1VKYA 3E3TA 4ISOA 1UJ1A 4KP0A 5EQRA 1H4WA 1F92A 1EPTA 3E1XB 2C8ZB 1EJNA 2NWNA 1T31A 4FU9A 4ZHMU 1C1WH 4B2BA 1ABJH 3GDVA 4MPVA 3UNSA 2VIPA 3PLPA 4AFQA 5HM2A 5DSFA 1QRZA 1ESTA 2BXTH 6CHAB 2AH4X 2ZFRH 3RDZA 1G3BA 1KLTA 2VWLA 3KQEA 1IQEA 5DP5A 2BY9X 5DG6A 1OP2A 3DSPA 3SGAE 1DPOA 1SOZA 1O5DH 1DSTA 4AG1A 2CJIA 1C1VH 1NU9A 3OSYA 1OS8A 1O5CB 2YMSB 3O8DA 3FVFB 2WZQA 1D3TB 4VGCB 1GCDA 2FOHA 4CBNA 1K1LA 2G81E 1VITH 2NU2E 4U2WA 3H7OA 2BHGA 2BDCA 3NZIA 3DSOA 5FCRA 2V0BA 3TK5A 1SHHB 4X2YA 3QZQA 2H5CA 1P3EA 1SGTA 4Y0ZE 1W11U 4TWWA 3W94A 2FI5E 2KM0A 4NG9H 1PYTD 3C1KA 2BZAA 2HNTC 4RSPA 5EODA 1PPGE 4F4OC 5AHGH 1ZTLA 2F9VA 3A8BA 3EE0B 5B6OA 1S6LA 3Q3XA 2VVVA 1FLEE 3KQCA 4A1TA 3SU2A 2ULLA 3WW7A 3IITA 1TYNA 4NIVA 1NS3A 2ZHQH 3A89A 2R9PA 1EUFA 1QGFA 1YPHC 3RXGA 4JK6A 4D8NA 1N6YA 1T32A 1J14A 2PSYA 4AGJA 2QXJA 1Z1JA 1QA0A 3K65B 4E05H 1G3CA 2Y7XA 1ZSLA 1GI6A 3PMAB 1KXCA 4B76A 1YLDA 2V7QD 3GOVB 3SUEA 1E79D 1KY9A 1ZZZA 2O8TA 1HJ8A 1C1MA 3ELAH 3FP7E 4XSKU 2A7JA 2B7DH 4B75A 2H9EH 2TIOA 1MTNC 1THSH 2WHXA 5DP9A 4J1YA 2GX4A 1IQHA 1CHGA 2Q6FA 1BBRH 4XDEA 3NWUA 4TWYA 2F9OA 1C5SA 2QF0A 4Y0YE 3BTFE 2JDID 1YGCH 3BEIB 5EW2H 5C17A 2NU3E 1Y3UA 4YM9A 1Z8GA 4BAQB 3BG4C 2FX4A 1M9UA 1QY6A 5EOKA 1P2QA 2CHAB 2VJ1A 1QBVH 1K1IA 2YNAA 3L3TA 1SG8B 2GD4B 1Y3VA 1CGIE 3VEQB 1Y59T 1BBRK 2B9LA 3KIDU 4ABIA 1LCYA 1QFKH 3Q76A 1TNGA 4O03A 1LMWB 2Z3EA 3NK8A 2FOMB 1MD8A 3BTDE 4DW2U 1TALA 3BG4B 4UFDH 4RI0A 4KGAA 1G9IE 4Y8XA 2VH6A 3MH6A 3P70B 3UB0A 3OTJE 4K8BA 3ZZ9A 4H42U 2VBCA 1COWD 1UTNA 2VWMA 2V35A 4BTUB 1GHAF 1SGNE 3RXUA 1B7XB 2ZGCA 3MWIU 5LPFA 4BTTB 7LPRA 4CRDA 3A81A 1PQAA 1MTNB 5DP4A 3KYGA 2EI7A 3SU5A 1F5LA 4A7IB 3ATMA 1TBQH 1V2LT 4U01A 4X2WA 3SQEE 2GCHF 3NCLA 2UUFB 1QB1A 3PRBA 2EI6A 1V2TT 2GT8A 2Q1JA 1GWAA 2YMSD 1GBTA 1XM1A 3NPSA 1T4VH 3GISB 5JBAS 2O8UA 4Y79A 3OYPA 4Y8YA 2Y5FA 3A7TA 1LVMA 2P93A 1XUGA 3H5CB 3S9BA 2AGIX 2BOHB 2GDDA 5I25A 1C9PA 2BLOA 1LPZB 1UVUH 3VGCB 3QDZB 3A86A 2BY5X 2BQ7B 2J92A 2WPKS 5F8ZA 1GJ8B 3OY5U 1FY8E 4NIXA 1SGDE 1FI8A 3T29A 2C8WB 3P8GA 2FIRH 1GVKB 2VGCC 1XXDA 3VB5A 2AEIH 4DGJA 1MAXA 2G4TA 4KKDA 4NA7A 4Y71A 3F2HA 1QB6A 1OYTH 1AGJA 9ESTA 4AN7A 2FOCA 5T1VA 3AK5A 3SUGA 4NFFA 5F8XA 5B6LA 1D6WA 2EY4C 2J34A 4H6SB 1NFYA 2F91A 2CXVA 3M5LA 2BY7X 3RM2H 2VGCB 1O34A 1GHYH 5IYTA 3I78A 4ABEA 3E16B 1V2PT 1MKWH 4AOQA 2GMTB 3A7ZA 3SI3H 3ZZDA 1OYQA 1TABE 1O5FH 5DP8A 1TONA 3E6PH 3ZVBA 4B2AA 4KTCA 1IQGA 2AMPA 3T5FH 4CRFA 1B5GH 1NRSH 5L6NH 3EQ0H 1MABB 2AIPA 1O33A 2C90B 3M7QA 1H8HD 2IPHA 3UPEA 1J9CH 1SHYA 2PUXB 4CRCA 1CSOE 1MTVA 2OBQA 1RIWC 5CE1A 3TIUA 2WUBA 1JRSA 2TGTA 2UWLA 1O2IA 1G2MA 2YOLA 1VJ9U 3H7TA 4CRGA 3F9EA 2O8LA 4K3JA 4OGYA 1C1SA 1NU7B 2O8MA 1RTKA 2FI3E 1EKBB 1LHDH 1O2JA 2FESH 4WH6A 1DE7H 2Z9IA 1DDJA 3RXAA 3STIA 1P09A 2ALPA 3UREA 1QJ1B 1GHXH 1GBKA 3NRLA 3ZVGA 2ZFFH 1RJXB 2A4GA 1GI8B 1TPAE 5E8EH 4F49A 3ZYEA 1UTJA 4WMFA 1SLXB 4B71A 5DK1A 1AWFH 3Q00A 1K21H 1UVOA 2BDYA 1MQ6A 2OD3B 1RTFB 3SO3A 2FYQA 2BZ6H 3GCNA 4DIIH 1KIGH 3BIVH 3VXFH 3F1SB 2QY0B 5DP7A 1ZLRA 3F0PA 4CH2B 2YMSC 3JZ1B 3GY2A 4ISNA 1H8IH 5HMAA 4YO9A 1C1PA 1JXPA 1WCZA 1AVGH 4A92A 1UK4A 3PWCA 4YOJA 1TNHA 3MNXA 4X1RU 2GJGA 1GVZA 3HKIB 2ZO3H 1IQLA 3FKSD 3T27A 3PTBA 1ETSH 2IPQX 3FZDA 2AGGX 2A0QB 5C5OA 1C5OH 3M5MA 2H5DA 2UUYA 4ZH8A 4Y8ZA 3RMLH 3RLYH 3RXMA 1IHTH 1O31A 1L4ZA 2BD4A 1Y3YA 2P3UB 5GIBA 2FO9A 2FP7B 1O3KA 1GHBG 3MHWU 1GBJA 4PROA 1NO9H 3JZ2B 1KSNA 1HUTH 5LPRA 3S7KB 4HGCA 3K2UA 1LVYA 1NT1A 1TGBA 4DT4A 1S6HA 1CT0E 1P9SA 1W0YH 2XCFA 1PPEE 3VB6A 1P2OA 1D3DB 2RDLA 1YCPM 3RXSA 3GCTF 3KQDA 1NFUA 1O3GA 3ESTA 1P06A 3PMJA 1A7SA 3RXVA 1SBWA 2ZU2A 1TOCB 4O97A 2F9PA 4RT1A 3CS7A 2BB4A 3D49H 1XUKA 1C1RA 2DUCA 3DCLA 3RU4E 1NY22 1O3BA 2GCTC 2WPMS 1GHWH 4K1SA 4FUFA 2ZI2H 1DLKB 3ODFA 1BJVA 3TGKE 2GV6A 2GMTC 2UWOA 1KXFA 1MD7A 1G2LA 1LHFH 1OP0A 1MTSA 2BD5A 1V2OT 1LQDB 1INCA 2AMQA 5TCAA 3RU4T 1BMMH 1FPHH 2VIWA 2XNIA 1T4UH 3TITA 1FX0B 1C5QA 2KAIA 2Y5GA 1OWKA 1GHZA 4JMYA 2OK5A 1GI2A 3GY4A 1TAWA 1BRCE 4WMDA 3MO9A 3LT3A 3QO6A 4Q80A 3QN7A 2FTMA 1NRQH 1O2ZA 5T6FA 1EZSC 4THNH 1O32A 1ZOMA 1KXEA 1QA7A 3VB4A 2XOKD 3KYFA 3LPRA 4XOJA 1A4WH 3DT0H 3HGPA 2VWOA 2STAE 1XUJA 3EA7A 1Y3XA 2G8TA 2OTVA 4ABGA 5GDSH 3I29A 2Z6BD 4Y10E 4ZCNA 1DICA 1L1GA 4NCYA 3ODDA 1SR5C 3ZYDA 5GPIB 4FUEA 6CHAC 3RU4D 1WSSH 4YOGA 3DSGA 2XC0A 1A61H 2W3KA 1AKSA 1O2TA 3ZZ7A 3DUXH 1CHOG 1SKYE 1BZXE 2C8YB 4OM9A 2A2XH 1E36B 2J98A 1O3LA 2PGQB 3A7XA 1F0TA 1FAKH 1HPGA 3QUMP 3M7UA 4LXBH 1OWHA 4BTIB 2HALA 1ANEA 3N99A 2K8IA 7GCHF 1FY1A 1UVPA 2BDBA 2SFAA 2ODYB 3S9CA 1O3AA 1A2CH 1DX5M 2BD3A 2Z9LA 3P8NA 2OXSA 3ZZ5A 3UTUH 1OWDA 2FODA 1VCPA 2P59A 1GI7B 3V0XA 1HNEE 3D62A 1RRKA 3PROA 1HLTH 1JIRA 4CR5A 5EW1H 1QJ6B 4I32A 3BG8A 4I33A 4CRBA 3QZRA 4TSFD 2RCEA 1CBWC 4ZKSU 1QBNA 3G01A 1TMUH 3QK1A 1K1JA 1XXFA 2QE7D 3M3TA 1GI3A 4I8KA 5L2ZH 4JZFH 3T62A 1CVWH 4XBDA 1MCTA 5H4IB 1GI4A 5HM9A 1V2QT 1O3NA 2R3UA 1YPKH 2ZGHA 2QGRA 1GJ7B 3KQ5A 3EA8A 1VCWA 2H9TH 2R2MB 1W10U 1C2MA 1UCYE 4ZMAH 1GHBF 3PLKA 4K1TA 2JETC 1GI9B 5JDUB 1B0FA 1ZHMA 5GNDA 2VINA 5A2MH 1GPZA 4ACAA 1AD8H 1GGDB 1EPTC 1UTLM 3P95A 4Z6AH 1ZHRA 2W5EA 2SGDE 3EE7A 1ZTKA 2A45B 3S0NA 2TGDA 1EZQA 5EU8A 2O8WA 4K60A 1RIWB 1NN6A 1WTHD 1K9OE 1TNIA 2F4LA 1CT4E 2B0FA 2Q6GA 1EATA 1ELEE 1H8DH 2WINI 2ZFPH 3RM0H 1MZAA 1AE8H 7KMEH 3N7DA 2XRCA 1HBTH 2KR7A 4OGXA 1MMJN 3GY3A 2FI4E 1VZQH 2FXRA 3MQKC 2BDIA 1SI5H 2PGBB 4U30A 1O36A 2ZDMA 3SU3A 3NXPA 1NROH 1TBZH 4GCHF 2ANMH 2OCVB 1BTUA
chains in the Genus database with same CATH topology
3HKJB 2VIQA 1P03A 3N7OA 3P17H 2F9NA 2DE8A 1A3BH 1V2KT 1GG6B 3GCOA 2NU1E 3AW0A 3BEUA 3HGNA 2H9HA 5JBCS 1BDAA 5E2PA 3RXEA 1SGPE 1AUTC 1NRPH 5L2YH 1L0ZA 4K2YA 3B8JA 3M61U 3ZVFA 3V13A 2QXHA 2R0LA 1BTWA 1BIOA 1EOLA 1NRNH 1TB6H 1DS2E 1DWDH 3A7VA 3DHKH 4X1QU 1QURH 3M37A 2GGVB 3BSQA 2F83A 3PTNA 2ZG0H 4MQAA 5CHAB 1P9UA 1AZ8A 2FOAA 4DJZB 1C2GA 1GJ4H 1C4U2 4O3TA 1C2HA 3A88A 1FY4A 2AS9A 1O38A 1OWEA 4Q2KA 4IMQA 1UCYK 1P3CA 1EB1H 3PLBA 1CGHA 1TRNA 2A4RA 3UOPA 1S85A 4CHAB 1D6RA 4ZUHA 1L1NA 1IQNA 4ZAEA 4WXVA 1P0SH 2CHAC 1GBFA 1OSSA 1AFQC 1FIWA 4Z0KA 2C4FH 1OX1A 3CP7A 1MCVA 3SGQE 1N6XA 4BAOB 1MZDA 1IQFA 1D3PB 1LQEA 2SGFE 3ZZ6A 4WWYA 2ANWA 4YLUA 2BOKA 2OQUA 1O2PA 1PPCE 4ZROA 1GBIA 3HPTB 4WVPE 3P8OA 3FAOA 1EX3A 2SGEE 1PPBH 1QB9A 5ESTE 1P57B 3KL6A 2BQ6B 3DFJA 2C3SA 4LZ1H 5DPAA 1ELDE 4R0IA 3ZZ4A 2Z3DA 2BVXH 4FUJA 4NA8A 1FXYA 5TJXA 2ZTXA 4DG4A 2ZHEH 3PV4A 1SLVB 3A8AA 1E38B 2BY8X 2GKVE 2TBSA 3LC3A 1ZGIA 1E34B 3T28A 2XC5A 1XKBC 4INHA 1C5VA 2QCYA 3QWCH 5T6GA 2GZ9A 1KXBA 2PUQH 1S82A 1YLCA 1O2MA 1WYKA 1AHTH 1IQMA 1TPPA 2AYWA 4ZXXH 2GCTB 1NM6A 2GVFA 1GDNA 4DVAU 3LKWA 3L33A 2FOEA 2SGAA 2G5NA 1SC8U 3P92A 2VB0A 1PFXC 2ZP0H 2ZU3A 2FOFA 1EJMA 5FXLA 1ZGVA 3TLOA 1H9IE 1TGCA 5K7RA 2PKSB 4B74A 2WYGA 4CBOA 5EPNA 3BEFB 2TPIZ 1EZUC 3SZNA 2HLCA 1DY8A 1QRXA 1V6DA 1DXPA 2PTCE 1C2DA 3AW1A 2FEQH 1UMAH 1GI1A 2XBYA 1W2KH 3TK6A 4CREA 1J15A 2ZKSA 4FUBA 2M5TA 2NU0E 2BTCE 4QT8C 2XWAA 1GMDG 3LIWA 1S84A 3SV7A 4ASHA 5FPTA 1TFXA 2CMYA 2HPQH 1EAXA 2Q6DA 1FN6A 4X2VA 1LHGH 8GCHF 4DOQA 1MBQA 3SU0A 4FUHA 3U9AH 1UK2A 3PMBB 4X6MA 1K1PA 5FPSA 3F9HA 3M3SA 2W7UA 2A4QA 1C5TA 4DY7B 1C2EA 1SGIB 3MO3A 2QC2A 1Y5BT 1C1NA 2ODPA 1GBBA 1UTOA 2ZFTA 4K1EA 1HAIH 3SU1A 1TX7A 1C5ZB 2EI8A 2KAIB 2THFB 1TMBH 1HIAB 3BTWE 1P2KA 1L2EA 1B0EA 1NC6A 4UFGH 4YTAA 1VJAU 4JZEH 2VIOA 3TJUA 1QL9A 1P05A 3P8FA 2BQWB 5CMXH 2BVRH 4ABJA 3ZZBA 3F9FA 3TH3H 4IW4E 3ATWA 4KELA 4D7FA 1QL8A 4X8TH 3BTGE 2PSXA 2BYAX 2VVUA 1C2KA 2Y82A 1YPHE 5C20A 3RC4A 1TGNA 4XFQA 1W8BH 3GY7A 5L30H 1HAZB 4FUCA 3TU7H 4O3UA 2GTBA 3QGNB 3DFLA 3GCHC 1MTUA 1NFWA 1TA2A 1ACBE 4OS7A 3GDUA 1KDQA 3FP6E 1GBMA 1TQ7B 1JOUB 1SFQB 4AGKA 1WBGB 1A46H 1ARBA 3SJOA 4IS5A 2PW8H 1GL1A 1ZRBA 1HAVA 4MNWA 3B23B 3RMOH 1YBWA 1PPHE 1K1NA 4GSOA 1MKWK 3FFGA 1GBEA 1LO6A 1HFDA 1KTSB 2OBOA 1FIZA 1FAXA 1CE5A 3QGJA 3M35A 1GVLA 2A7CA 2TGAA 4A5TS 1S6FA 1ANBA 2DE9A 3MOCA 2O9QA 4ZHAA 1EP6A 2I6QA 1AFEH 2JH6D 1O37A 4JYTA 1SSXA 1HGTH 1O2SA 1FQ3A 3KQBA 1GMCF 1K2I1 3GY6A 4B1TA 3LH3A 3V3MA 4R8TB 3ATKA 1C5YB 1C2LA 2A5AA 4UDWH 3MI4A 3T26A 1E0FD 3TNSA 5C3NA 1O3FA 1YKTA 1BMAA 4LZ4B 2HOBA 1ZPBA 3O8CA 3S69A 2FLRH 2WPLS 2GT7A 3LGIA 2ZECA 5EG4A 2PFEA 4X8UH 1DOJA 4YESB 2Y81A 1AB9B 3MH4A 4X1NU 6ESTA 1SOTA 1YPLH 1ESAA 1PQ7A 3UY9A 1SGQE 2QXGA 1JIMA 1G3EA 1O3OA 1ZR0A 3I77A 4B2CA 5A8ZA 1VCQA 1BTXA 1WUNH 1F0RA 3RXRA 3E91A 1WAYB 5E0JA 1C4Y2 1CU1A 5JBBS 2ZGJA 4Q7XA 3VFEA 1A5HA 2PKAB 3B9FH 1V2MT 2XYAA 3RXKA 3MH7A 3HATH 1Z6EA 3MNBA 3MFJA 4NA9H 1T7CA 1QNJA 3RXFA 2XW9A 3F9GA 2ZU4A 1LPGB 5F03A 2VNTA 1MTWA 3KCGH 3EA9A 1TA6A 1O2YA 2QV1A 3FZZA 3GYLB 1O2VA 1BOQA 3MTYA 3KNXA 4AB9A 2P94A 2ODQA 4X6PA 1DVAH 3MYWA 1BMNH 2OP9A 1N8OC 3R3GB 1FY5A 5E2OA 1L1JA 5C5NA 3SW2B 1BHXB 3RLWH 1DWEH 3MU8A 4NWKA 1H9LB 3U8TH 4JZIA 1ELTA 4O9VA 2A32A 1WU1A 2QIQA 1EXFA 4AYVB 2XC4A 2VVCA 2STBE 1J17T 1S0QA 2Y5HA 3SJ8A 1SGYE 5J4SA 1K28D 1XUIA 1O5GH 4AB8A 1ZJKA 1ZRKA 4IN2A 1GL0E 5GCHF 2J94A 2JKHA 3BTME 2EC9H 1G37A 3LC5A 4MDSA 1V2WT 1TE0A 1G30B 1UO6A 2ZDLA 3A7YA 1A3EH 1RS0A 1IOEA 1T8LA 1YM0A 1GBLA 5EXMA 5FHTA 2IJOB 1LVOA 3MNCA 2ZQ1A 2R3YA 5HYOA 5A0AE 3K9XB 1ZPZA 1EOJA 1QQUA 4JYUH 3OY6U 2ZTYA 2GP9B 3SV6A 2A7HA 4FXGH 2I6SA 2UUKB 4XE4A 3MO6A 3SN8A 1YC0A 3BIUH 1GBDA 2CV3A 1DY9A 4AYYB 3Q3YA 4A6LA 5J4QA 2SGQE 4INKA 1W7GH 3ZVCA 1AE5A 1O0DH 4AFUA 4MTBA 1DLEA 2ZWLH 3NUMA 2QXIA 1ELGA 1TNJA 1SLUB 3SUDA 4DURA 4OS2A 2WPHS 3UR9A 4OS4A 2RA0A 1F2SE 4BAHB 1W12U 4I31A 1JMOH 3BV9B 1SL3A 1RGQA 5FBIA 1K1MA 2PHBA 4ZHLU 1EP5A 1YF4A 4X2XA 4M7GA 4ABFA 3V12A 3BTEE 3SJ9A 3GICB 3SNEA 3SGBE 1TIOA 2ZPRA 3E0PB 1AI8H 1C1UH 1EASA 3BN9A 1XX9A 5C67A 5TCCA 3LGYA 1GI0A 1P2IA 1SGCA 1X7AC 3RXOA 1SMFE 3UFAA 1GMDF 4I7YH 3OU0A 5LGOA 1O2RA 2FPZA 3K6ZA 1O3DA 1O5EH 1P8VC 2G00A 5BPEA 4Y7AA 1ELCA 3CS0A 3FP8E 3SV2H 4BNRA 1DWBH 2LPRA 1H9HE 4NIYA 3O8BA 5FAHA 4ZKNU 3STJA 5ETXA 3IG6B 4XBCA 2QAAA 3RP2A 3TJVA 3UQVA 1QJ7B 1BBRE 1QR3E 4RKJB 1DT2A 1IAUA 5LH8A 1AWHB 1VITG 3SOSA 4AG2A 1ELAA 1LKBA 1MBMA 3BTTE 2SNVA 2CGAA 4MPUA 3SNCA 2FX6A 3MH5A 2BX4A 1P04A 5A8XA 1RD3B 4E06H 2BY6X 1UHBB 1AVWA 1C2IA 1J16A 1G32B 2ZEBA 3A85A 1HB0B 3LGVA 2ZU5A 1JWTA 2AIQA 1C2FA 1YPMH 2B5TB 3HK3B 4TPYA 4FVDA 4BANB 3AAUA 2ZPSA 1SFIA 2JH5D 3IWMA 1Q3XA 4IBLH 3PM3A 2YNBA 1AUJA 1ELVA 2XBWA 3E0NB 1K22H 1Z8IB 2R2WU 4A1VA 2BMGB 1CT2E 2OQ5A 1TQ0B 2H2ZA 4TY6A 1HAPH 4KTSA 1ELFA 2W26A 1F5KU 3VB3A 3UNQA 2UUJB 3SJKA 1P01A 1O39A 1D3QB 1EAIA 1KLJH 1AIXH 2ZTZA 2HNTE 4BXWA 2ANYA 1LVBA 3A80A 3Q3KA 4MLFB 2JETB 2BLVA 1P11E 1SQTA 1OP8A 1C5WB 3KEEA 3U1IB 3RXBA 1LDTT 1JRTA 4TPIZ 5ABWA 1IHSH 1ZMNA 3LGWA 5A0CA 1C5UA 2Z9GA 3TVJB 3ATIA 2ANKH 4ISIH 4SGAE 4MNYA 4UFEH 1HXFH 1T8OA 1AFQB 1KDQB 1Z71A 1QRWA 3PMHB 2ZZUH 4GPGA 1Z8RA 5EXNA 1RFNA 3QX5H 2TRMA 4FVBA 4X8VH 3WY8A 1A0JA 1O2QA 2FZZA 1O2WA 5DP3A 5E0HA 1BJUA 3D65E 4X6NA 3RXCA 3QTVH 5DP6A 1MKXK 3LJOA 1ID5H 1WV7H 3VXEH 1TNLA 2G4UA 1TWXB 1AVXA 1GMHF 1C5PA 1BRAA 4HTCH 2IOTA 3R0FA 1AB9C 5CHAC 2J38A 3ZVEA 2GDEH 1C5MD 3SQHE 1VGCB 3A8DA 2BDAA 3EAJA 3QLPH 1GI5A 2B8OH 4AFSA 4ISHH 2PKAA 2ZCHP 2BLWA 4I8GA 3Q77A 4NZQA 2ZDAH 1SQOA 4X0WU 5E0GA 1ANCA 1YPGH 1SGFG 3RXJA 1E35B 2Y80A 1U6QA 4CHAC 3E8LA 1F0UA 1HCGA 3ATLA 3BF6H 1KXAA 1N8OB 3OX7U 4H4FA 1EAWA 4I8JA 1THPB 1Z7KA 3UQOA 1RXPA 1UTKA 4ZKRU 1SGEE 1FPCH 2P16A 2ZF0H 3M36A 4E7RG 5EQQA 1GMHG 1C5RA 2Y6TA 3A7WA 1ANDA 4IC6A 1LTOA 4K8YA 2UWPA 1KXDA 1GHAG 1Y8TA 1LPKB 1C1TA 1HV7A 1DXWA 4NSYA 1DUAA 5G4BA 4AORA 2XXLA 3LGTA 2LNCA 4YLQH 3C27B 8ESTE 1BA8B 4ABDA 2GCHG 5GJ4B 5F8TA 2J95A 1TGSZ 3RXDA 1O2LA 1YCPH 2W3IA 3UR6A 1LHEH 5T3HA 1KLIH 3PWBA 3F6UH 2GV7A 1QTFA 4UFFH 2C93B 8GCHG 2G55A 2P95A 1EJAA 3RC6A 1W3CA 1MKXH 5JB8S 3T25A 1FNIA 1HIAA 4X8SH 4Q7YA 1ZSJA 1SPJA 1ESBA 5GCHG 5PTPA 1C4V2 2QYIA 1GCTC 2A5IA 1TMTH 1UTPA 4INLA 2BD8A 2PLXA 3MU5A 2OINA 4NZLA 1H1BA 1L4DA 1THRH 4GCHG 1O3MA 3GDSA 1XKAC 3TNTA 4B73A 2V3OH 4ISLA 1BTYA 1AN1E 1FONA 3SHCH 2ZU1A 3W95A 2BD7A 1NTPA 1TPSA 4BOHA 1D4PB 2ESTE 4HZHA 2WPIS 1PYTC 3MMGA 1ETTH 1HDTH 4YT7H 1PQ5A 3KN2A 1WQVH 1A0HB 1W14U 3SJIA 2ZCKP 4Q7ZA 4JZ1A 2ZQ2A 2AFQB 2C8XB 1O3IA 1TRYA 1EAUA 2QN5T 3TK9A 2XTTB 2NU4E 4UONA 1VGCC 1ZTJA 2VU8E 2FOGA 1SQAA 2ZDKA 4YT6H 3RXIA 4IN1A 2QA9E 3A84A 1TPOA 1NZQH 3AASA 1A5IA 1GJ9B 1NFXA 1FJSA 1IQIA 2D26C 2F9UA 3U8RH 3VB7A 2BD2A 2P3FH 1TX8A 4FU8A 2XCNA 2A2QH 2FM2A 4LOYH 4UD9H 1PJPA 1J8AA 2CN0H 4FUGA 3SI4H 2ZDVH 4MVNA 4WMEA 3L6PA 5AF9H 2BM2A 4GHQA 4OS5A 3SV8A 1CA0B 1O30A 3SNDA 1HJ9A 3LGUA 2GZ7A 2PTNA 1CGJE 3LONA 1P12E 1EB2A 1ELBA 3RMNH 4Y7BA 5FBEA 5JBTA 1OKXA 1O2XA 3T2NA 4HI3A 1SVPA 1MH0A 3A87A 1QBOA 4FUIA 4J2YB 5IDKA 2QF3A 1GJ5H 1KTTB 1WQSA 1MU6B 2ZFSA 2VIDA 1HXEH 5AFYH 3TGJE 3NKKA 4CR9A 1C5LH 2BX3A 1K1OA 1LHCH 4NWLA 5JPMH 1G36A 2BDGA 3UNRA 5EQSA 5EGMA 1FZZA 4AFZA 1OOKB 1N1LA 1O2KA 3URCA 1UVTH 3RXTA 1GJCB 1FN8A 1ZMLA 2A31A 1KYNA 3GY8A 5AVDA 3BTQE 1YP9A 1F0SA 1HAOH 4SGBE 5SGAE 1YCPK 1TBRH 2R0KA 1TOMH 1PQ8A 4OS6A 2VWNA 4NGAH 3AVZA 2HVXA 1Y5UT 4I8HA 2PKSC 2P8OC 3M5NA 3QTOH 1W0ZU 3RC5A 1XVOA 5F6MA 1OWIA 4Y76A 1TRMA 3V7TA 4RKOB 1V2JT 3K6YA 1BCUH 1BQYA 1GDUA 2P8OB 1BTHH 4FU7A 3UIRA 2ZPQA 3PYHA 2A4OA 3SUFA 1ABIH 1BRUP 1O3EA 1XMNB 5A0BA 1EZXC 3KGPA 2G5VA 4XBBA 4D9RA 1MU8B 4MPXA 3TH2H 1DITH 1GDQA 1UVSH 5DO4H 1UHBA 1OWJA 2ILNA 2HPPH 3MU0A 2Z7FE 1ARCA 1BB0B 3U8OH 3S7HB 4ABHA 3RXQA 3P6ZB 4NIWA 5JYIA 1AMHA 4JYVH 1AKSB 2PR3A 5I46H 9LPRA 1AU8A 2WUCA 5DGJA 2TGPZ 5A8YA 1V2VT 1OPHB 2V6NA 1BRBE 5DJ7A 2J4IA 3RXPA 1GHVH 5ESBA 1ZHPA 1HAHH 4NFEA 5EPYA 3SV9A 2Z3CA 1YPEH 1FMGA 1F7ZA 1CA8B 1GG6C