1O39A

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o39A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o39A02
4HI3A 3T2NA 2OTVA 2FI3E 1VJAU 1K28D 5CHAB 4J2YB 1Q31A 2PKSC 1AZ8A 1JRTA 3BF6H 2ZPRA 6ESTA 1ANCA 1QA0A 2TGDA 4Q7ZA 4I33A 8GCHG 1JIRA 1AHTH 1ETRH 1IOEA 1NRQH 3ODDA 4INLA 3UNSA 4B71A 4FUFA 1MCTA 4K69A 3E16B 2ZZUH 1FNIA 1MD8A 1BZXE 3L6PA 4AYYB 1ZRBA 2TPIZ 1UHBA 2SNVA 2EC9H 3GISB 2PW8H 2A45B 5C2ZA 1T8MA 3PLPA 3AW1A 2ANKH 3P92A 3B9FH 1W3CA 4O3UA 4DURA 3KQDA 3QN7A 1O2PA 2AGGX 4JMYA 3NWUA 2A7HA 2ULLA 1TYNA 3RXEA 3Q3XA 1AMHA 2Z7FE 2BDIA 5DK1A 2XC0A 4WH6A 2FOBA 3PWBA 3RXUA 1LQEA 1QJ7B 1QJ6B 4CRBA 4BOHA 1LPGB 2BDBA 2QXIA 2B9LA 3UQVA 1GJ7B 1SI5H 3TH4H 2ZPSA 3U69H 4OS5A 1SGFG 1GJ5H 1HAOH 4RKOB 2SFAA 2GMTB 1ABIH 3UREA 1CE5A 4ASHA 3ATWA 1WBGB 2Y5HA 2WPMS 3O8CA 1J15A 3SJKA 1S0RA 1YLDA 5L2ZH 1GJBB 3LKWA 1V2KT 2GCHF 3BTHE 4NIYA 1O3MA 2FI4E 4F4OC 1HJ8A 2A5IA 2F9VA 1K9OE 5FPTA 2OQUA 4MNXA 1TOCB 2Z9JA 3A7WA 2P95A 1DPOA 2Y5GA 1RGQA 4VGCC 1HDTH 1S85A 2CHAC 3RXAA 3TJNA 1WCZA 3KQEA 1GHBG 3Q00A 1ZGIA 4AGKA 1UTKA 3BIUH 2PHBA 1ZMLA 1P09A 1RS0A 1G3BA 1O3GA 1W0YH 2O8MA 2F9PA 3D23A 3ZVFA 2H9EH 1O3AA 2P8OB 1GBKA 1HAVB 1C5OH 2BY6X 1E0FD 3RXLA 2TGPZ 3EE0B 1Y3WA 2GCHG 1FDPA 4E7RG 4MTBA 3TITA 2PKAA 2D8WA 3KF2A 1RTLA 5DP8A 1GMHF 1A3EH 4R8TB 4YO9A 5GXPA 4ABIA 2WPLS 3GCHC 1GVLA 5ABWA 5C1UA 2ZG0H 1BJUA 4LK4A 2G5NA 4KTSA 3GDVA 4Y71A 3A82A 1TNJA 2BX3A 1GGDB 2VIDA 1OP2A 1ANBA 2C90B 1OS8A 2G51A 2EI8A 1WTHD 6LPRA 1EZXC 4O97A 4ZUHA 5TCCA 2ZGBH 1EPTB 3KIDU 1HXFH 5DKMA 4MG3A 1ETTH 1P2KA 1DWCH 1C5TA 2ZGXH 1MTNC 4WY3A 2ANWA 2BD8A 4X6PA 1Y3XA 4I8HA 3ZVDA 5F8ZA 2ZDNA 2ZFRH 1HJAC 1BHXB 1CA0C 1O2WA 4AYVB 1C4V2 4A5TS 3DFJA 3PWCA 1YPJH 1NESE 4BANB 1GI3A 3RC6A 3SHCH 3F9GA 4BNRA 3EAJA 2FEQH 4CRCA 3LT3A 2IOTA 3BV9B 3P6ZB 1DSUA 3TJVA 1OP8A 1KDQA 3PTNA 3TK9A 4RN6A 4DGJA 1NPMA 2A0QB 1O3EA 3RMOH 3T29A 3WY8A 1F0UA 5I25A 3GY6A 1EKBB 1V2UT 4AX9H 3TVJB 4D7GA 1TNLA 5EW2H 1N6YA 1E38B 5IYTA 5DP6A 3BEFB 4A1VA 3S7HB 2Z3CA 3S9BA 5C1YA 3S0NA 2AS9A 2JKHA 2HPQH 2G55A 3V12A 1ETSH 4AFZA 1C5WB 1EASA 4Q80A 1HFDA 1W8BH 3TH3H 1P57B 3UY9A 5PTPA 2UUYA 4INKA 2XWBI 1IQHA 3MO3A 2XWAA 4PROA 1C2EA 2DE9A 4FU9A 4JZEH 3MNSA 1F7ZA 2VWOA 1O2XA 1EJMA 1NFYA 2FOAA 6CHAC 1PQAA 3VGCC 4Y8ZA 5EQRA 1G32B 5GDSH 2FS9A 5HM9A 1O2QA 2BLWA 4YLUA 1TGSZ 1O0DH 3SV6A 1O3HA 2F3CE 3T27A 1E36B 1K1LA 1S82A 2VIWA 1FJSA 1DLEA 1O2LA 3FP7E 1JWTA 5DP5A 2GX4A 1THPB 2PFEA 4TYDA 4B1TA 1OYTH 1GBHA 1UVSH 1RTFB 1A4WH 1PPHE 2JETB 2C8XB 3M5OA 3A87A 2V3HH 2ZFFH 1QL7A 1KXEA 2VINA 4K1EA 4YZUA 1NM6A 2ZGJA 1DM4B 3SNAA 1TX7A 2AEIH 1IQGA 4YT6H 1DITH 1L0ZA 1RIWC 2NU1E 4HGCA 3QTVH 2F9BH 2JH6D 1LDTT 4IW4E 2STAE 1Y59T 2YNAA 2FDAA 1BRCE 4ABHA 3ZYDA 1ZHMA 3E0PB 1GMCF 4D76A 4LZ4B 3R0FA 3RXBA 4YOGA 1AO5A 1EAXA 2ZDMA 7GCHG 3D62A 1PYTD 1BQYA 2OXSA 1ELTA 2ZFSA 3PV4A 3SORA 1NFUA 4X1SU 3BEIB 4FUIA 1V2OT 3EDXB 2AGEX 2IJOB 4BXWA 2XBVA 3VXEH 2FOEA 4NSVA 2A7JA 3S9AA 4Q2KA 3PMHB 1C9TA 1GHWH 5FBIA 4D8NA 1ABJH 1GJ4H 1FI8A 1TNKA 3MYWA 2XXLA 1J17T 1XUJA 4X8UH 3SUEA 1WU1A 3ZZ8A 4CBOA 1QCPA 2A7CA 1VZQH 1BBRH 1BIOA 1DUEA 2A2QH 4MPXA 3T25A 3SQEE 1GHAF 2W5EA 4BXSA 1XUFA 3KEEA 4AG2A 2EI6A 3T26A 1CGJE 2B7DH 5J4QA 1O2NA 4FUGA 1T7CA 2R2MB 1SQOA 3SW2B 2VGCB 1C5QA 5G4BA 4GAWA 3U8RH 2GT8A 3K9XB 1SGIB 2GZ8A 1G30B 2QYIA 1H9LB 1SGCA 1P3EA 1W13U 2WUBA 4I8GA 2J34A 1TPOA 3QGJA 3GYLB 3M3SA 1PQ7A 5GJ4B 1O5FH 1TB6H 2QC2A 1HUTH 1QBVH 1GDUA 1GBLA 3DA9B 4ISLA 4JYUH 1V6DA 3VB7A 2SGDE 1P12E 3FVFB 4JZ1A 1AKSB 3MNBA 4AB8A 1KLIH 3PMBB 2ZI2H 3TU7H 3SV7A 1CGHA 3ATKA 1GHAG 3HK3B 2C8YB 1LHGH 1V2RT 5GIBA 1ESBA 1CBWC 2CJIA 2QN5T 3DD2H 3F1SB 5JDUB 1O3BA 3HATH 1DY9A 3IWMA 2ZHDA 1C1QA 3M36A 1GPZA 3CS7A 1A0HB 5A09A 1P02A 1W11U 1BMMH 3ATIA 2BDCA 1EXFA 1O33A 1S6HA 3SNBA 1J8AA 1XM1A 1LHEH 1OWJA 1VCPA 5JBTA 1GBTA 2O9QA 2VNTA 1MUEB 1K21H 4LXBH 2ZU1A 1JBUH 2F83A 3GDSA 3PM3A 1ZLRA 3NZIA 4BTTB 5CHAC 2ZDKA 5GCHF 1LTOA 2FX4A 2QIQA 3O8RA 1A2CH 2ZHWH 3OU0A 1MKXK 2VWLA 1MTVA 4CBNA 3HK6B 2GV7A 3PO1B 2G00A 2WPKS 3LJJA 4TPIZ 1XX9A 2BLQA 3A7VA 1BTPA 3KQBA 1WOFA 1O2VA 4FVDA 1SGEE 4JZIA 1TGTA 3EGKH 1W10U 4UD9H 1B0FA 4MLFB 1UTOA 4X2VA 3LGIA 4I31A 5A0BA 4X2WA 1BDAA 4X6OA 1FPCH 1GL0E 5C3NA 1RTKA 1BRBE 5HGGA 1F0RA 3UR9A 4NZLA 1NZQH 1EUFA 1O5BB 5IDKA 7ESTE 5DP7A 3RDZA 1TALA 2A5AA 1E37B 3RMLH 1V2JT 5AFYH 4XFQA 3ZZDA 2WPIS 3RM0H 2JH5D 1INCA 3GY4A 1D3TB 1PYTC 4X8TH 1P10A 1C2KA 8ESTE 1VGCC 2GMTC 3MNCA 2FTLE 2ZCKP 2D26C 3FFGA 1N6XA 2BD5A 1J16A 3RU4D 5DP3A 1TGCA 2GTBA 3MNXA 1O31A 1GVKB 1W7GH 5SGAE 1HV7A 1C2FA 1LQDB 1O30A 1W7XH 1UK2A 3SOSA 1YYY1 4WMDA 2FPZA 1XUKA 2FYQA 1C1NA 2QCYA 1AN1E 1P2IA 3GDUA 1NRRH 1VITF 2BD7A 2HWLB 3BG8A 1RJXB 1UK4A 3QDZB 3UTUH 5EGMA 3A80A 2VVUA 2AGIX 1NY22 3SNDA 2Z6BD 4FUHA 1O35A 3U1IB 5A8ZA 1QQUA 2ILNA 3GY8A 2O8UA 1QB1A 2BVXH 2VVCA 1YBWA 3KGPA 1ZPBA 1GJAB 3VEQB 1MZAA 2Y82A 2GVFA 1GHYH 4XBCA 2O8WA 1H9HE 4ISIH 3BTQE 2ZTXA 4KELA 1AIXH 4DT7B 2P8OC 1O2UA 1MAXA 1TX8A 4UDWH 2YNBA 1OWDA 1CT0E 3RM2H 1H1BA 3VB5A 1O39A 1LPKB 3LH1A 1CT4E 4M7GA 3RXQA 5K7RA 1O5EH 2BQ7B 2GGVB 3U8TH 1BB0B 1EZSC 2Z9KA 4GSOA 1GHZA 1O2RA 4MNVA 2ZHFH 2PR3A 2A4RA 1XMNB 3MFJA 5K0HA 3MHWU 4NZQA 2BLVA 4IMZA 3RU4T 3TJOA 3Q76A 1GGDC 3RXOA 1C2GA 4A7IB 2XW9A 1G9IE 3ZV8A 1N8OC 1BBRK 3SJ8A 5FHTA 1SB1H 5E0HA 4YOIA 3RMMH 1EPTC 5T6DA 1TQ7B 2Z9GA 1FIZA 1IHTH 2ODPA 3SU3A 1NN6A 2Z9IA 3T62A 4FVBA 3FAOA 1TBRH 1CGIE 1YLCA 2H6MA 1WV7H 1KXBA 3O8BA 3SUFA 2BB4A 2Z3DA 1Y3VA 1BRUP 3OTJE 1PPZA 1HIAA 3UOUA 3MTYA 1KTTB 1YPKH 3E8LA 1DY8A 3HGPA 4X2XA 3MMGA 2Y7XA 1AKSA 4OS6A 5ESTE 2SGQE 3LPRA 4X1PU 1YCPM 3BSQA 1DOJA 1SHHB 1HPGA 3RXGA 2FP7B 4E05H 1V2LT 2ZFQH 1L4ZA 2ASUB 2ZGHA 1S83A 4NFFA 4D7FA 1O2ZA 1F2SE 1IAUA 4DIHH 4CH2B 2PUXB 2ZQ2A 1K2I1 2LNCA 2FOHA 4GPGA 1HJ9A 1NU9A 3ZZ3A 3RXSA 3LGWA 5EODA 1GBCA 2P3UB 1V2TT 4BAKB 5TCAA 1ZGVA 3F9HA 2STBE 1GHBF 1XVOA 1S6FA 3SGAE 1SQTA 1MTUA 2B8OH 3QTOH 3P8GA 2OCVB 1UTMA 1C1SA 3AAVA 2XC4A 1GI2A 4ZH8A 1O5DH 1YGCH 1SPJA 5ETXA 1SLWB 4FUDA 3SHAH 1ELEE 2OC1A 1NRPH 2A4GA 1BTHH 1KXFA 1FAKH 1EOLA 2CXVA 2GP9B 2JETC 4IN1A 3RXDA 1G3EA 2GCTC 3MO6A 4WMEA 1PPBH 3B23B 4IGDA 1AGJA 1WQVH 1T8LA 3PLBA 1FAXA 2KAIB 1SGQE 2K1QA 1OP0A 1TFXA 2VIPA 3SNCA 5HXFA 2V0BA 2ZHQH 3CENA 1XUHA 1GBBA 2VWNA 1ZHRA 2BYAX 1EAIA 1SGRE 4CREA 1XKAC 3EA9A 2UUJB 1J14A 2SGPE 1DXWA 5T6FA 5EPNA 1LMWB 2F9UA 4MNWA 1TWXB 4LOYH 2OUAA 2BXTH 1YCPH 4TY6A 5HYOA 4BTUB 1GI0A 3M61U 1QBOA 3RP2A 3LH3A 2UWLA 1SG8B 1C1TA 1RXPA 1C1MA 4CRDA 2HNTE 3K6YA 4FU7A 4KTCA 2F91A 1ZPCA 2C8ZB 1MZDA 2XNIA 1GVZA 3T28A 1MKWK 3SU5A 2Z94A 1S5SA 4HFPB 3K65B 3C27B 3HPTB 1YPLH 3AW0A 3TH2H 1C1RA 5C5NA 1RRKA 1LKAA 1O5CB 2FM2A 2BOKA 2Z9LA 5EXNA 1NC6A 3QWCH 2ZDVH 1GI8B 2VGCC 5AVDA 1TGBA 3MH5A 4ESTE 4ABDA 1GCDA 1O5AB 5LPRA 1CU1A 3L3TA 3QZRA 1AB9B 4YLQH 2H9HA 3P17H 5JBAS 3A8AA 3SGBE 2D1JA 2WUCA 5CE1A 1SL3A 4Y11E 1GJ6A 1OOKB 4I8LA 3RXFA 1UCYH 2A32A 1ZMNA 1FY3A 1A0LA 1AD8H 3VPKA 3ZZ4A 2ANMH 2P3TB 2AERH 2XC5A 2XBYA 4ISOA 2VVVA 3KL6A 1TPSA 1TNHA 3UFAA 2UWOA 3F9EA 1HAYB 3KHVA 4Z6AH 1DANH 3FZDA 1OWIA 2Y5FA 4OGXA 3SBKA 2G8TA 2WV4A 4ABFA 5I46H 3RXHA 1FQ3A 1F0TA 4YESB 1SGNE 2P3FH 5B6OA 1ZTJA 5HM2A 2ZP0H 4ABBA 4AFSA 2TGAA 4NA9H 2SGAA 4X8VH 5L2YH 4ZHLU 4GLYA 2GKVE 1Q3XA 2BD9A 1P06A 1D9IA 1P2NA 1CHGA 1BTUA 2Y7ZA 4CRFA 5EU8A 2ZTZA 2R0KA 2TGTA 5C5OA 1G2LA 2VJ1A 2VIVA 1B5GH 1GBDA 4KP0A 5DPAA 1GWAA 4K1SA 3VFEA 1LVBA 2ZF0H 2EA3A 3LGTA 1O2HA 1TONA 1A7SA 1P9UA 4Y0ZE 5F03A 1TGNA 7GCHF 1HCGA 3M7TA 1OPHB 3MH7A 3PO1C 3TK5A 3A83A 1NFXA 3RMNH 2PGBB 1GJ9B 1ZOMA 1DWEH 1FV9A 1LKBA 1PPFE 2ZU2A 4X1NU 3M3VA 3LDXH 1Z8GA 2O8TA 2WV5A 1P2QA 2FTMA 5C1XA 1F5LA 1A5IA 1Z8RA 4RSPA 3VXFH 1ZYOA 4WF8A 1GL1A 1Z71A 5JYIA 3QGNB 2C93B 4CRGA 1J9CH 3NUMA 2BQWB 5A0CA 2XYAA 1PJPA 3LGUA 4X8SH 4XE4A 3OSYA 4ZKRU 3ZVBA 1EOJA 2HVXA 1JRSA 3TJUA 3BTEE 1P0SH 1QJ1B 2HNTC 1C2HA 1IQMA 1W14U 1K1MA 1V2NT 4NWLA 3RLYH 2QY0B 2G81E 5BRRE 3UWIA 4E7NA 1SC8U 3RXKA 1UVOA 2B0FA 1K1IA 2QA9E 3TNSA 1DS2E 1MMJN 2PTCE 1O3FA 1G3DA 3QX5H 2NU0E 1O2OA 1LVYA 4UONA 3IITA 3BEUA 1SGTA 3SNEA 4B75A 3LGYA 3QLPH 3ZYEA 1CHOF 1GBIA 3BIVH 4DVAU 1NU7B 2P59A 3RXTA 3PMJA 3ZZ6A 1HXEH 2BX4A 2I6QA 3S69A 2Q6DA 1NROH 1KLJH 3SV8A 1OYQA 3S9CA 1E35B 2FYRA 1FPHH 2HOBA 1EQ9A 1EJAA 1GI4A 1KLTA 1TA2A 3T5FH 5DP9A 1EAUA 2EI7A 2QXHA 1QQ4A 2HGTH 1LHDH 2KAIA 1HAVA 1QL8A 4Y6DA 1BCUH 1D6RA 2CV3A 1UJ1A 4D9RA 2AFQB 5HMAA 3UPEA 1GBMA 1MBMA 1DDJA 4YOJA 2OBOA 1JOUB 3M37A 4BAQB 1Y5AT 1O3OA 1T31A 5H4IB 1CA0B 1CHOG 2BM2A 2Z3EA 1GG6C 1O2GH 4Q7XA 2A31A 4AOQA 5FX6A 5CMXH 1A1RA 1KSNA 4DJZB 1YCPK 3A81A 4ZXXH 1SVPA 1TPPA 2G52A 3E3TA 2OD3B 4MVNA 4TY7A 3KQCA 4AFUA 3M3TA 3ZVCA 1AWFH 3D65E 1SSXA 1GBAA 2A4OA 1KYNA 4CH8B 1FY1A 1LHFH 2FI5E 4YTAA 1FY5A 1P01A 4GHTA 4TPYA 2XRCA 1LVOA 3P8NA 3SI3H 1QNJA 1EPTA 1G2MA 3STJA 2A1DB 1A5HA 3GY7A 1OWHA 2G4TA 4Y10E 4R0IA 1NO9H 3JZ1B 4GCHF 2AMPA 1BMNH 1CSOE 1K1PA 1D6WA 1H4WA 3UNRA 1W12U 2BHGA 4FUCA 4WVPE 3A84A 3H7TA 1VR1H 3GICB 2W3KA 3O8DA 2PSYA 1SLUB 3SGQE 2OBQA 2FO9A 5DJ7A 4DW2U 1F5RA 4UFEH 1IQIA 5DG6A 1SGDE 1EX3A 1K1OA 1UCYK 3BTDE 1Z1IA 1SBWA 1ZSJA 1FY4A 1MQ6A 2HALA 3ENSB 3BG4B 2BTCE 2CF9H 2RA3A 2ZA5A 2FOMB 4ZROA 6CHAB 4IN2A 2J4IA 1KTSB 1L4DA 1Y3UA 3R3GB 5F8XA 1LHCH 3BTTE 4WXIA 4CR5A 5F8TA 4YT7H 2ODQA 1FY8E 2ZDAH 4MPVA 1YP9A 4WJG2 3PTBA 5EXMA 5T3HA 1XXFA 4GCHG 4IC6A 4ZMAH 1BTXA 2ZU5A 1O2SA 4NCYA 3VB4A 1GI7B 2VIQA 1NRNH 5GPIB 1BTZA 4AFQA 3W94A 5EXLA 2R3YA 4AORA 3M7QA 1CT2E 2I6SA 4A1TA 1DWBH 1UO6A 4INHA 2P93A 3MOCA 1Z8IB 2ESTE 3U1JB 5FCKA 3GCTF 1MTWA 2GV6A 1A3BH 2AIPA 2BDYA 3GCNA 2J2UA 1AZZA 1BTYA 3A7XA 3E90B 1HAHH 3GOVB 3V0XA 4B73A 4CHAB 2THFB 1TBQH 2BDGA 1Z7KA 1YPGH 1BA8B 1CA8B 2WINI 3OX7U 2J9NA 3V7TA 3A8CA 5JBCS 1T4VH 1TE0A 2ZTYA 2R2WU 4Z0KA 2V3OH 1DSTA 1DXPA 4IC5A 1AFEH 4ZKNU 3FP8E 1TNGA 1K1NA 3E6PH 3STIA 1ELGA 2PKAB 1C1OA 1Y5BT 3A8DA 1P2OA 1L1NA 3RU4E 3A8BA 1C9PA 4JK6A 1EZQA 3GCTG 1QB6A 3TPIZ 1C5VA 2QF0A 1BOQA 1TMTH 2BXUH 1PPGE 3PB1E 2H2ZA 7LPRA 2BDHA 4OS1A 2PUQH 2NU2E 1C5MD 4RKJB 1IQNA 1XVMA 4UFDH 3H7OA 1MBQA 1AFQB 2FOCA 3SN8A 2UWPA 4JCNA 4ZKOU 2XCNA 3RLWH 1TA6A 1ZTLA 3SV9A 2ZHEH 3A89A 1UTQA 1QURH 2ZCHP 3EQ0H 3M35A 3SJ9A 1Q2WA 3ZZ7A 3URCA 1ZR0A 3RC5A 3JZ2B 4TWWA 4IBLH 2QF3A 3B8JA 1AI8H 1GHXH 1K1JA 4Y76A 1OWKA 5EOKA 4MQAA 3Q3YA 3BTGE 3V13A 3ZZ9A 3MO9A 1DFPA 1U6QA 4CR9A 3AAUA 1AY6H 2AMDA 1AQ7A 4ABAA 3A88A 2GDDA 1FN8A 1YPHE 5LH8A 3A7YA 1D3QB 1GDNA 1YM0A 8LPRA 1DUAA 1CBWB 4OGYA 4NSYA 4GVUA 1TAWA 1CO7E 1H8IH 3VB3A 1GCTB 1QTFA 1YPEH 2UUFB 3DFLA 1ID5H 3QK1A 1DLKB 1PPEE 1QA7A 2WPJS 3A7TA 3Q3KA 4H6SB 4H6TA 1FN6A 1GJDB 1TBZH 1O3DA 1XXDA 2BVSH 3RXCA 1C2LA 3P8OA 2G5VA 4Y8YA 1P3CA 2TIOA 1O5GH 2ZIQH 2NU4E 1UVPA 4XSKU 1T4UH 1G37A 1GMDG 1AVWA 2VH6A 4WMFA 1DWDH 1HAIH 1JXPA 1LO6A 5JB9S 3ZZBA 4SGBE 1QRWA 4NA7A 4OS2A 1BT7A 1O2YA 1V2PT 2CGAA 2XCFA 3LC5A 3N7OA 1V2QT 2FLBH 1C5NH 3GY5A 1HAZB 1GBFA 4NIVA 2D2DA 1SOTA 3TGJE 1C2DA 4WXVA 3ATLA 2NU3E 1C5LH 4X1QU 4XOJA 3ATMA 3HKJB 1VCWA 1TNIA 2FXRA 1Z8JB 2FMJA 1Y3YA 1CVWH 2A4QA 2PGQB 1BMLA 3UOPA 1Y8TA 4I8JA 2R0LA 3PYHA 2BY7X 1ZHPA 1D3DB 1F0SA 1O38A 2H5DA 1P04A 1PQ8A 3S7KB 3ELAH 4MPUA 1UMAH 4WWYA 3SUGA 1QIXB 3OYPA 1LVMA 2VU8E 1SLXB 1P11E 2ZQ1A 3E91A 3M5LA 5AHGH 1VGCB 2VH0A 1NT1A 9ESTA 2WYGA 1F92A 4NFEA 1O32A 4ZAEA 1IQEA 3F68H 4FXGH 5AF9H 1G3CA 1ANEA 1P2JA 1H8DH 2H5CA 3BN9A 1BHXF 2AIQA 3TK6A 3M7UA 1EP5A 3OY5U 3LC3A 1QB9A 1N1LA 1D3PB 2R3UA 5C67A 4ZKSU 3ZVAA 4MDSA 3NK8A 1KIGH 2Y6TA 4Y8XA 3GY3A 3RXRA 3SJIA 4B76A 1EATA 3RXPA 2VIOA 3F6UH 1ELFA 3I78A 4Y79A 5EQSA 1EP6A 1AE5A 1DVAH 5J4SA 2RDLA 3K2UA 5E2OA 3SUDA 2SGEE 2ZU4A 1A5GH 2XTTB 1C2IA 1TIOA 1YPHC 1ELBA 1XUGA 1SGYE 2M5TA 2W7UA 5EG4A 3L33A 1EB1H 5BPEA 3ZVGA 2QGRA 2BY9X 2F9OA 2GZ7A 3KCGH 9LPRA 1TLDA 1C4U2 2GT7A 1GBJA 1BBRE 3LGVA 2VB0A 1GDQA 2QV1A 4X6MA 1SMFE 5E2PA 1MH0A 1AWHB 2C3SA 3TGKE 1FZZA 1TPAE 4D9QA 2R9PA 3BTWE 2HPPH 3RXVA 1MTSA 2FOGA 2CMYA 3GCOA 1P8VC 4B74A 1P05A 2J38A 2BD2A 4K8BA 2WYJA 1SLVB 5JBBS 1ZTKA 1O3CA 3SU4A 3TGIE 2Q6GA 4AN7A 2OC7A 4K5ZA 2HRVA 1O3KA 1F5KU 1BUIA 1N8OB 2FODA 5JB8S 4HZHA 2A2XH 1XKBC 4HTCH 3SU0A 2V35A 4O03A 3UR6A 3ZZCA 1KXCA 2ALVA 4ISNA 1NRSH 2W26A 1A0JA 5A0AE 1A61H 2BY5X 5FCRA 2ZEBA 3CP7A 4DOQA 4BAHB 2B5TB 2PV9B 1PPCE 1GMHG 1MU8B 1ARCA 1NTPA 1ORFA 2PKSB 2ZPQA 3A85A 5FPYA 3K6ZA 1MKXH 1YC0A 1Z1JA 3SO3A 3DUXH 2VWMA 3MH4A 3QO6A 3LU9B 4JYVH 2BZ6H 3EYDA 2P94A 1S81A 3M5NA 3NPSA 1C1UH 2H9TH 3HKIB 1H9IE 1EJNA 4UE7H 2RCEA 2ZU3A 1GJ8B 4FU8A 1UVUH 1G36A 3RXIA 4DIIH 2AH4X 3ESTA 1AUTC 3GYMA 3SU6A 2QXJA 3F9FA 3H5CB 2ODYB 4K2YA 1FXYA 1HYLA 3UWJH 2QAAA 5FX5A 5ESBA 1YPMH 2BQ6B 3ZZ5A 1TRMA 4U01A 2A5KA 4GHQA 2FESH 5EPYA 5A8YA 2NWNA 5A8XA 2DUCA 1ELCA 1FUJA 1O2IA 4OS7A 3SQHE 3ZZAA 2IPHA 1V2VT 3E0NB 2DE8A 5T6GA 3BG4C 3MU8A 1HAXB 1QRZA 1MD7A 1C5YB 1C1PA 1JIMA 2TBSA 2ZC9H 3GY2A 1QFKH 1B7XB 2J95A 1UK3A 1IHSH 1BITA 4O3TA 1SFQB 2FLRH 1UVTH 1ACBE 5EQQA 1JMOH 3FP6E 1IQLA 1C5UA 2BOHB 2CN0H 1LPZB 1L1JA 1ANDA 1QY6A 3I29A 1DICA 4VGCB 1OSSA 3RXJA 1GI1A 1T32A 3SU1A 3MH6A 3PLKA 2CHAB 1THRH 1XUIA 1NFWA 2PSXA 3P70B 1AVXA 2OC8A 2FX6A 2W3IA 5TJXA 2PLXA 4B2BA 2GCTB 1VJ9U 5LPFA 3SU2A 4DY7B 1W0ZU 1W2KH 1MU6B 1PQ5A 4A1XA 2ZWLH 4Y7AA 4NWKA 4CHAC 5GWZA 3G01A 4LZ1H 1L2EA 4OS4A 4ABGA 2OC0A 1KXAA 1ARBA 3EA8A 1HB0B 2ANYA 4FUJA 1ESAA 1SFIA 4U30A 4KTUA 4X2YA 1HLTH 3SZNA 5E0GA 4I32A 1IQJA 1OXGA 3U9AH 4NA8A 3HGNA 4QT8C 1AVGH 1ELAA 2FIRH 4ZXYH 1ELDE 3MI4A 4YM9A 1E34B 1DX5M 2Y80A 3GCHB 3LONA 1C5PA 1OX1A 1QL9A 1O2TA 1FONA 3LJOA 1RD3B 2O8LA 1TX6A 1V2MT 4IMQA 2ZNKH 1IQFA 5DP4A 1O3JA 4Y0YE 3V3MA 3NXPA 5AFZH 4JZFH 1DT2A 1SGFA 3C1KA 2FWWA 1S0QA 4KKDA 3RC4A 1TMBH 1WQSA 4H4FA 1GHVH 1AFQC 4TWYA 1GMCG 1O37A 3A86A 1MTNB 4E06H 3P8FA 3ITIA 4Q7YA 3TNTA 1NS3A 1X7AC 3FANA 3KN2A 1GJCB 1HJAB 1O3NA 1WTGH 2BD4A 3QZQA 2ZDLA 3PMAB 1GI9B 1HAPH 1EAWA 1MAYA 4K1TA 1MCVA 2WPHS 1WYKA 3I77A 1M9UA 3KNXA 1C5XB 3URDA 1O3PB 5E8EH 2OLGA 1Z6EA 2UUKB 1WSSH 2ZO3H 5F6MA 2Q6FA 4AGJA 1HBTH 1HIAB 2GD4B 5DO4H 1V3XA 3NCLA 1SR5C 1C5RA 1V2WT 2HNTF 4I7YH 3RXMA 1OKXA 3LOXA 3SV2H 3IG6B 1UHBB 2BD3A 1FMGA 1Z6JH 1L1GA 5EW1H 2GDEH 4X0WU 4JK5A 4Y7BA 1A46H 2QXGA 5FPSA 1ESTA 1GCTC 1Y5UT 3VB6A 4U32A 2Q1JA 2W7SA 1ZJDA 2AYWA 1TMUH 3ODFA 1P9SA 2PWXA 1YKTA 4O9VA 2P16A 2XBWA 1P2MA 1BTWA 1GI6A 3ZV9A 2GZ9A 1LCYA 4XBDA 4B2CA 1HNEE 2BZAA 1AE8H 3CS0A 4AZ2B 1O3LA 2BLOA 4ISHH 3SJOA 3RUOA 3VGCB 3TIUA 3TLOA 2RG3A 7KMEH 4K8YA 1EZUC 1QGFA 3DT0H 2FZZA 2ZCLP 4NGAH 4XDEA 1ZMJA 1QBNA 1VCQA 1WUNH 1SGPE 1GI5A 1O36A 3MU1A 1DE7H 1IQKA 2BVRH 6GCHF 5FBEA 3BTKE 1ZPZA 1T8OA 4K3JA 1OWEA 4B2AA 1TRNA 1S84A 3P95A 1HGTH 1TABE 4X1RU 4ZHAA 3BTFE 1UTLM 1D4PB 4UFFH 1QRXA 1EB2A 4FUBA 4DCDA 1C2MA 1RIWB 4H42U 2FOFA 3UIRA 1RFNA 5GCHG 3SI4H 3ZVEA 3A7ZA 1AUJA 1VITH 2ZKSA 4AB9A 5L30H 3FZZA 3W95A 1C5SA 1MQ5A 2J94A 2JH0D 2YOLA 1AU8A 1ZRKA 2TRMA 2Y81A 3UNQA 1TOMH 2RA0A 4CRAA 3U8OH 2SNWA 6GCHG 1TRYA 1C5ZB 4UFGH 4ABJA 1BJVA 3AASA 1HRTH 3MU5A 1QHRB 1T8NA 1GBEA 2C8WB 1TQ0B 2ZFPH 1P03A 8KME2 2C4FH 5A2MH 2PTNA 3PROA 2H1UA 2BMGB 3DHKH 1THSH 2ZFTA 3MU0A 2F9NA 1B0EA 4GUXA 1MKWH 1UTJA 4JYTA 1BRAA 4WH8A 2V6NA 1K22H 1O3IA 4A92A 4SGAE 1SQAA 2BY8X 2J92A 1KXDA 2FS8A 4U2WA 4J1YA 2ZECA 2ZGCA 3NKKA 4BAOB 2BDAA 1ELVA 3AVZA 2ALPA 2CF8H 2OP9A 4A6LA 4JZDH 5LPEA 4K60A 3D49H 4NG9H 4I8KA 3M5MA 3Q77A 1ZJKA 5FXLA 5L6NH 4FUEA 1PFXC 2SGFE 1ZSLA 5C20A 1UTNA 5E0JA 3UUZA 4IS5A 4ZHMU 4NIWA 1O2JA 1C1WH 2AMQA 1KDQB 1VITG 4MNYA 4NIXA 2XBXA 1GG6B 1QR3E 1WAYB 1YF4A 2HLCA 1O2KA 1GMDF 3EA7A 3U98H 3UQOA 3LIWA 4BAMB 1C1VH 4KGAA 4X6NA 1ZZZA 5FAHA 2LPRA 1SHYA 3BTME 8GCHF 1CQQA 3MWIU 4F49A 1C2JA 1UTPA 3MU4A 5LGOA 4UEHH 2EEKA 3OY6U 1C4Y2 4DG4A 2OINA 3E1XB 5JPMH 1UCYE 4THNH 4MPWA 5DGJA 1BMAA 1O2MA 1V2ST 1AB9C 1ZSKA 1HAGE 4BTIB 1O34A 3QUMP 1KY9A 4XBBA 4AG1A 1FIWA 2OQ5A 1SOZA 2IN2A 4ABEA 2G4UA 1FLEE
chains in the Genus database with same CATH superfamily
4HI3A 3T2NA 2OTVA 2FI3E 1VJAU 1K28D 5CHAB 4J2YB 1Q31A 2PKSC 1AZ8A 1JRTA 3BF6H 2ZPRA 6ESTA 1ANCA 1QA0A 2TGDA 4Q7ZA 3ZIAD 4I33A 8GCHG 1JIRA 1AHTH 1ETRH 1IOEA 1NRQH 3ODDA 4INLA 3UNSA 4B71A 3MQKC 4FUFA 5EJ1A 1MCTA 4K69A 3E16B 2ZZUH 1FNIA 3F0PA 1MD8A 1BZXE 3L6PA 4AYYB 1ZRBA 2TPIZ 1UHBA 2SNVA 2EC9H 3GISB 2PW8H 2A45B 5C2ZA 1T8MA 3PLPA 3AW1A 2F43B 2ANKH 3P92A 3B9FH 1W3CA 4O3UA 3UB0A 4DURA 3KQDA 3QN7A 1O2PA 2AGGX 4JMYA 3NWUA 2A7HA 2ULLA 1TYNA 4ZCNA 3RXEA 3Q3XA 1AMHA 2Z7FE 2BDIA 5DK1A 2XC0A 4WH6A 2FOBA 3PWBA 3RXUA 1LQEA 1QJ7B 1QJ6B 4CRBA 4BOHA 1LPGB 2BDBA 2QXIA 2B9LA 3UQVA 1GJ7B 1SI5H 3TH4H 2ZPSA 3U69H 4OS5A 1SGFG 1GJ5H 1HAOH 4RKOB 2SFAA 2GMTB 1ABIH 3UREA 1CE5A 4ASHA 3ATWA 1WBGB 2Y5HA 2WPMS 3O8CA 1J15A 3SJKA 1S0RA 1YLDA 5L2ZH 1GJBB 3LKWA 1V2KT 2GCHF 3BTHE 4NIYA 1O3MA 2FI4E 4F4OC 1HJ8A 2A5IA 2F9VA 1K9OE 5FPTA 2OQUA 4MNXA 1TOCB 2Z9JA 3A7WA 2P95A 1DPOA 2Y5GA 1RGQA 4VGCC 1HDTH 1S85A 2CHAC 3RXAA 3TJNA 1WCZA 3KQEA 1GHBG 3Q00A 1ZGIA 4AGKA 1UTKA 3BIUH 2PHBA 1ZMLA 1P09A 1RS0A 1G3BA 1O3GA 1W0YH 2O8MA 2F9PA 4I86A 3D23A 3ZVFA 2H9EH 1O3AA 2P8OB 1GBKA 1HAVB 1C5OH 2BY6X 1E0FD 3RXLA 4F55A 2TGPZ 3EE0B 1Y3WA 2GCHG 1FDPA 1BMFD 2CK3D 4E7RG 4MTBA 3TITA 2PKAA 4RI0A 2D8WA 3KF2A 1RTLA 5DP8A 1GMHF 1A3EH 4R8TB 4YO9A 2HVYB 5GXPA 4ABIA 2WPLS 3GCHC 1GVLA 5ABWA 5C1UA 2ZG0H 1BJUA 4LK4A 2G5NA 4KTSA 3GDVA 4Y71A 3A82A 1TNJA 2BX3A 1GGDB 2VIDA 1OP2A 1ANBA 2C90B 1OS8A 2G51A 2EI8A 1WTHD 6LPRA 1EZXC 4O97A 4ZUHA 5TCCA 2ZGBH 1EPTB 3KIDU 1HXFH 5DKMA 4MG3A 1YY3A 1ETTH 1P2KA 1DWCH 1C5TA 2ZGXH 1MTNC 4WY3A 2ANWA 2BD8A 4X6PA 1Y3XA 4I8HA 3ZVDA 5F8ZA 2ZDNA 2ZFRH 1HJAC 1BHXB 1CA0C 1O2WA 4AYVB 1C4V2 4A5TS 3DFJA 3PWCA 1YPJH 2W6ID 1NESE 4BANB 1GI3A 3RC6A 3SHCH 3F9GA 4BNRA 3EAJA 4B6FA 2FEQH 4CRCA 3LT3A 2IOTA 3BV9B 3P6ZB 1DSUA 3TJVA 1OP8A 1KDQA 3PTNA 3TK9A 3OEHD 4RN6A 4DGJA 1NPMA 2A0QB 1O3EA 3RMOH 3T29A 3WY8A 1F0UA 5I25A 3GY6A 1EKBB 1V2UT 4AX9H 2IJD1 3TVJB 4D7GA 1TNLA 5EW2H 1N6YA 1E38B 5IYTA 5DP6A 3BEFB 4A1VA 3S7HB 2Z3CA 3S9BA 5C1YA 3S0NA 2AS9A 2JKHA 4OM9A 2HPQH 2G55A 3V12A 1ETSH 4AFZA 1C5WB 1EASA 4Q80A 1HFDA 1W8BH 3N7DA 3TH3H 1P57B 3UY9A 5PTPA 2UUYA 4INKA 2XWBI 1IQHA 3MO3A 2XWAA 4PROA 1C2EA 2DE9A 4FU9A 4JZEH 3MNSA 1F7ZA 2VWOA 2KR7A 1O2XA 1K0HA 1EJMA 1NFYA 2FOAA 6CHAC 1PQAA 3VGCC 4Y8ZA 5EQRA 1G32B 5GDSH 2FS9A 5HM9A 1O2QA 2BLWA 4YLUA 1TGSZ 1O0DH 3SV6A 1O3HA 4M9FA 2F3CE 3T27A 1E36B 1K1LA 1S82A 4DT4A 1YLNA 2VIWA 1FJSA 1DLEA 1O2LA 4AC9A 3FP7E 1JWTA 5DP5A 2GX4A 1THPB 2PFEA 4TYDA 4B1TA 1OYTH 1GBHA 1UVSH 1RTFB 1A4WH 1PPHE 2JETB 2C8XB 3M5OA 3A87A 2V3HH 2ZFFH 1QL7A 1KXEA 2VINA 4K1EA 4YZUA 1NM6A 2ZGJA 1DM4B 3SNAA 1TX7A 2AEIH 1IQGA 4YT6H 1DITH 1L0ZA 1RIWC 2NU1E 4HGCA 3QTVH 2F9BH 2JH6D 1LDTT 4IW4E 2STAE 1Y59T 2YNAA 2FDAA 1BRCE 4ABHA 3ZYDA 1ZHMA 3E0PB 1GMCF 4D76A 4LZ4B 3R0FA 3RXBA 4YOGA 1AO5A 1EAXA 2ZDMA 7GCHG 3D62A 1PYTD 1BQYA 2OXSA 1ELTA 2ZFSA 3PV4A 3SORA 1NFUA 4X1SU 3BEIB 4FUIA 1V2OT 5CHBA 5FL7D 3EDXB 2AGEX 2IJOB 4BXWA 2XBVA 3VXEH 2FOEA 4NSVA 2A7JA 3S9AA 4Q2KA 3PMHB 1C9TA 1GHWH 5FBIA 4D8NA 1ABJH 1GJ4H 1FI8A 1TNKA 3MYWA 2XXLA 1J17T 1XUJA 4X8UH 3SUEA 1WU1A 3ZZ8A 4CBOA 1QCPA 2A7CA 1VZQH 1BBRH 1BIOA 1DUEA 2A2QH 4MPXA 3T25A 3SQEE 1GHAF 2W5EA 4BXSA 1XUFA 3KEEA 4AG2A 2EI6A 3T26A 1CGJE 2B7DH 1S6LA 5J4QA 1O2NA 2WZQA 4FUGA 1T7CA 2R2MB 1SQOA 3SW2B 2VGCB 1C5QA 5G4BA 4GAWA 3U8RH 2GT8A 3K9XB 1SGIB 5DN6D 2GZ8A 1G30B 2QYIA 1H9LB 1SGCA 1P3EA 1W13U 2WUBA 4I8GA 2J34A 1TPOA 3QGJA 3GYLB 3M3SA 1PQ7A 5GJ4B 1O5FH 1TB6H 2QC2A 1HUTH 1QBVH 1GDUA 1GBLA 3DA9B 4ISLA 4JYUH 1V6DA 3VB7A 2SGDE 1H8HD 1P12E 3FVFB 4JZ1A 1AKSB 2QF5A 3MNBA 4AB8A 1KLIH 3PMBB 2ZI2H 3TU7H 3SV7A 1CGHA 3ATKA 1GHAG 3HK3B 2C8YB 1LHGH 1V2RT 5GIBA 1ESBA 1CBWC 2CJIA 2QN5T 2PP6A 3DD2H 3F1SB 5JDUB 1O3BA 3HATH 1DY9A 3IWMA 3NRLA 2ZHDA 1C1QA 3M36A 1GPZA 3CS7A 1A0HB 5A09A 1P02A 1W11U 1BMMH 3ATIA 2BDCA 1EXFA 1O33A 1S6HA 3SNBA 1J8AA 1XM1A 1LHEH 1OWJA 1VCPA 5JBTA 1GBTA 2O9QA 2VNTA 1MUEB 1K21H 4LXBH 2ZU1A 1JBUH 3DSOA 2F83A 3GDSA 3PM3A 1ZLRA 3NZIA 4BTTB 5CHAC 2ZDKA 5GCHF 1LTOA 2FX4A 2QIQA 3PRBA 3O8RA 1A2CH 2ZHWH 3OU0A 1MKXK 2VWLA 1MTVA 2AHME 4CBNA 3HK6B 3WW7A 2GV7A 2KCYA 2G00A 3PO1B 2WPKS 3LJJA 4TPIZ 1XX9A 2BLQA 3A7VA 1BTPA 3KQBA 1WOFA 1O2VA 4FVDA 1SGEE 4JZIA 1TGTA 3EGKH 1W10U 4UD9H 3AK5A 1B0FA 4MLFB 1UTOA 4X2VA 3LGIA 4I31A 5A0BA 4X2WA 1BDAA 4X6OA 1FPCH 5C0TA 1GL0E 5C3NA 1RTKA 1BRBE 5HGGA 1F0RA 3UR9A 4NZLA 1NZQH 1EUFA 3DCLA 1O5BB 5IDKA 7ESTE 5DP7A 3RDZA 1TALA 2A5AA 3F0OA 1E37B 3RMLH 1V2JT 5AFYH 4XFQA 3ZZDA 4YXWD 2WPIS 3RM0H 2JH5D 1OHHD 1INCA 3GY4A 1D3TB 1PYTC 4X8TH 1P10A 1C2KA 8ESTE 1VGCC 5C94A 2GMTC 3MNCA 2FTLE 2ZCKP 1W0KD 4TT3D 2D26C 2QE7D 3FFGA 1N6XA 2BD5A 1J16A 3RU4D 5DP3A 1TGCA 1KMHB 2GTBA 3MNXA 1O31A 1GVKB 1W7GH 5SGAE 1HV7A 1C2FA 1LQDB 1MABB 1O30A 1UK2A 1W7XH 3SOSA 5KEDA 1YYY1 4WMDA 2FPZA 1XUKA 2FYQA 1C1NA 2QCYA 1AN1E 1P2IA 3GDUA 1NRRH 1VITF 2BD7A 2HWLB 3BG8A 2M2AA 1RJXB 1UK4A 3QDZB 3UTUH 5EGMA 3A80A 2VVUA 1E1RD 2AGIX 1NY22 3SNDA 2Z6BD 4FUHA 1O35A 3U1IB 5A8ZA 1QQUA 3PV2A 2ILNA 3GY8A 2O8UA 1QB1A 2BVXH 2VVCA 1YBWA 3KGPA 1ZPBA 1GJAB 3VEQB 1MZAA 2Y82A 2GVFA 1GHYH 4XBCA 3SZEA 2O8WA 4Q4LA 1H9HE 4ISIH 3BTQE 2ZTXA 4KELA 1AIXH 4DT7B 2P8OC 1O2UA 1MAXA 1TX8A 4UDWH 2YNBA 1OWDA 1CT0E 3RM2H 1H1BA 3VB5A 1O39A 1LPKB 3LH1A 1CT4E 4M7GA 3RXQA 5K7RA 1O5EH 2BQ7B 2GGVB 3U8TH 1BB0B 1EZSC 2Z9KA 4GSOA 1GHZA 1O2RA 4MNVA 2ZHFH 2PR3A 2A4RA 1XMNB 3MFJA 5K0HA 3MHWU 4NZQA 1COWD 2BLVA 4IMZA 3RU4T 3TJOA 3Q76A 1GGDC 3RXOA 2QF4A 1C2GA 4A7IB 2XW9A 1G9IE 3ZV8A 1N8OC 1BBRK 3SJ8A 5FHTA 1SB1H 1NBMD 5E0HA 4YOIA 3RMMH 1EPTC 5T6DA 1TQ7B 2Z9GA 4Q63A 1FIZA 1IHTH 2ODPA 3SU3A 1NN6A 2Z9IA 3T62A 2KFWA 4FVBA 3FAOA 1TBRH 1CGIE 2J98B 1YLCA 2H6MA 1WV7H 1KXBA 3O8BA 3SUFA 2BB4A 2Z3DA 1Y3VA 1BRUP 3OTJE 1PPZA 1HIAA 1YWUA 3MTYA 3UOUA 1KTTB 1YPKH 3E8LA 1DY8A 3HGPA 4X2XA 3MMGA 2Y7XA 1AKSA 4OS6A 3FO8D 5ESTE 5KECA 2SGQE 3LPRA 3FOAA 4X1PU 1YCPM 3BSQA 1DOJA 1SHHB 1HPGA 3RXGA 2FP7B 4E05H 1V2LT 2ZFQH 3GS9A 1L4ZA 2ASUB 2ZGHA 1S83A 4NFFA 4D7FA 1O2ZA 1F2SE 1IAUA 4DIHH 4CH2B 3W1EA 2PUXB 2ZQ2A 2JJ2D 1K2I1 2KCPA 2LNCA 2FOHA 4GPGA 1HJ9A 1NU9A 3ZZ3A 3RXSA 3LGWA 5EODA 1GBCA 2P3UB 1V2TT 4BAKB 5TCAA 1ZGVA 2JJ1D 3F9HA 1E1QD 2STBE 1GHBF 1XVOA 2XOKD 1S6FA 3SGAE 1SQTA 1MTUA 2B8OH 3QTOH 3P8GA 2OCVB 1UTMA 1C1SA 3AAVA 2XC4A 1GI2A 4ZH8A 1O5DH 1YGCH 1SPJA 5ETXA 1SLWB 4FUDA 3SHAH 1ELEE 2OC1A 1NRPH 2A4GA 1BTHH 1KXFA 1FAKH 2L74A 1EOLA 2CXVA 2GP9B 2JETC 4IN1A 3RXDA 1G3EA 2GCTC 3MO6A 4WMEA 1PPBH 3B23B 4IGDA 1AGJA 1WQVH 1T8LA 3PLBA 1FAXA 2KAIB 1SGQE 2K1QA 1OP0A 1TFXA 2VIPA 3SNCA 5HXFA 2V0BA 2ZHQH 3CENA 1XUHA 1GBBA 2VWNA 1ZHRA 2BYAX 1EAIA 1SGRE 4CREA 3PV5A 1XKAC 3EA9A 2UUJB 1J14A 2SGPE 3UAIC 1DXWA 5T6FA 5EPNA 1UW7A 1LMWB 5C0UA 2F9UA 4MNWA 1TWXB 4LOYH 2OUAA 5HIYA 2BXTH 1YCPH 4TY6A 5HYOA 4BTUB 1GI0A 3M61U 1QBOA 3RP2A 4TSFD 3LH3A 2UWLA 1SG8B 1C1TA 1RXPA 1C1MA 4CRDA 5B6LA 2HNTE 3K6YA 4FU7A 4KTCA 2F91A 1ZPCA 2C8ZB 1MZDA 2XNIA 1GVZA 3T28A 1MKWK 3SU5A 2Z94A 1S5SA 4HFPB 3K65B 3C27B 3HPTB 1YPLH 3AW0A 3TH2H 1C1RA 5C5NA 1RRKA 1LKAA 1O5CB 2FM2A 2BOKA 2Z9LA 5EXNA 1NC6A 4ASUD 3QWCH 2ZDVH 1GI8B 2VGCC 5AVDA 1TGBA 3MH5A 4ESTE 4ABDA 1GCDA 2KM0A 1O5AB 5LPRA 1CU1A 3L3TA 3QZRA 1AB9B 4YLQH 3F2GA 2H9HA 3P17H 5JBAS 3A8AA 3SGBE 2D1JA 2WUCA 5CE1A 1SL3A 4Y11E 1GJ6A 1OOKB 4I8LA 3RXFA 1UCYH 2A32A 1ZMNA 1FY3A 1A0LA 1AD8H 3VPKA 3ZZ4A 2ANMH 2P3TB 2AERH 2XC5A 2XBYA 4ISOA 2VVVA 3KL6A 1TPSA 1TNHA 3UFAA 2UWOA 3F9EA 1HAYB 3KHVA 4Z6AH 1DANH 3FZDA 1OWIA 2WHXA 2Y5FA 4OGXA 3SBKA 2G8TA 2WV4A 4ABFA 2RFKC 5I46H 3RXHA 1FQ3A 1F0TA 4YESB 1SGNE 2P3FH 5B6OA 1ZTJA 5HM2A 2ZP0H 4ABBA 4AFSA 2TGAA 4NA9H 2SGAA 4X8VH 5L2YH 4ZHLU 2RDEA 4GLYA 2GKVE 1Q3XA 2BD9A 1P06A 3FN8A 1D9IA 1P2NA 1CHGA 1VKYA 1BTUA 2Y7ZA 4CRFA 5EU8A 2ZTZA 2R0KA 2TGTA 5C5OA 1G2LA 2VJ1A 2VIVA 1B5GH 1GBDA 4KP0A 5DPAA 1GWAA 4K1SA 3VFEA 2W6JD 1LVBA 2ZF0H 2EA3A 3LGTA 1O2HA 1TONA 1A7SA 1P9UA 4Y0ZE 5F03A 1TGNA 7GCHF 1HCGA 3M7TA 1OPHB 3MH7A 3PO1C 3TK5A 3A83A 1NFXA 3RMNH 1GJ9B 1ZOMA 2PGBB 1DWEH 1FV9A 1LKBA 1PPFE 2ZU2A 4X1NU 3M3VA 3LDXH 1Z8GA 2O8TA 2WV5A 1P2QA 2FTMA 5C1XA 1F5LA 2HLDD 1A5IA 1Z8RA 4RSPA 3VXFH 1ZYOA 4WF8A 1GL1A 1Z71A 5JYIA 3QGNB 2C93B 4CRGA 1J9CH 3NUMA 2BQWB 5A0CA 2XYAA 1PJPA 1E79D 3LGUA 4X8SH 4XE4A 3OSYA 4ZKRU 3ZVBA 1EOJA 2HVXA 3FKSD 1JRSA 3TJUA 3BTEE 1P0SH 1QJ1B 2HNTC 1C2HA 1IQMA 1W14U 1K1MA 1V2NT 4NWLA 3RLYH 2QY0B 2G81E 3F3BA 5BRRE 3UWIA 4E7NA 1SC8U 3RXKA 1UVOA 2B0FA 1K1IA 2QA9E 3TNSA 1DS2E 1MMJN 2PTCE 1O3FA 1G3DA 2WPDD 3QX5H 5HIZA 2NU0E 1O2OA 1LVYA 4UONA 3IITA 3BEUA 4F48B 1SGTA 3SNEA 4B75A 1SQRA 3LGYA 3QLPH 3ZYEA 1CHOF 1GBIA 3BIVH 4DVAU 1NU7B 2P59A 3RXTA 3PMJA 3ZZ6A 3KYFA 1HXEH 2BX4A 2I6QA 3S69A 3H09A 2Q6DA 1NROH 1KLJH 3SV8A 1OYQA 3S9CA 1E35B 2FYRA 1FPHH 2HOBA 1EQ9A 1EJAA 1GI4A 1KLTA 1TA2A 3T5FH 5DP9A 1EAUA 2EI7A 2QXHA 1QQ4A 2HGTH 3KYGA 1LHDH 2KAIA 1HAVA 1QL8A 4Y6DA 1BCUH 1D6RA 2CV3A 1UJ1A 4D9RA 2AFQB 5HMAA 3UPEA 1GBMA 1MBMA 1DDJA 4YOJA 2OBOA 1JOUB 3M37A 4BAQB 1Y5AT 1O3OA 1T31A 5H4IB 1CA0B 1CHOG 2BM2A 2Z3EA 1GG6C 1O2GH 4Q7XA 2A31A 4AOQA 5FX6A 5CMXH 1A1RA 1KSNA 4DJZB 1YCPK 3A81A 4ZXXH 1SVPA 1TPPA 2G52A 3E3TA 2OD3B 4MVNA 4TY7A 3KQCA 4AFUA 3M3TA 3ZVCA 1AWFH 3D65E 1SSXA 1GBAA 2A4OA 1KYNA 4CH8B 1FY1A 1LHFH 2FI5E 4YTAA 1FY5A 1P01A 4GHTA 4TPYA 4P00A 2XRCA 1LVOA 3P8NA 3SI3H 1QNJA 1EPTA 2EQNA 1G2MA 3STJA 2A1DB 1A5HA 3GY7A 1OWHA 2G4TA 4Y10E 4R0IA 1NO9H 3JZ1B 4GCHF 2AMPA 1BMNH 1CSOE 1K1PA 1D6WA 1H4WA 3UNRA 1W12U 2BHGA 4FUCA 4WVPE 3A84A 3H7TA 1VR1H 3GICB 2W3KA 3O8DA 2PSYA 1SLUB 3SGQE 2OBQA 2FO9A 5DJ7A 3DSGA 4DW2U 1F5RA 4UFEH 1IQIA 5DG6A 1SGDE 1EX3A 1K1OA 1UCYK 3BTDE 1Z1IA 1SBWA 1ZSJA 1FY4A 1MQ6A 2HALA 3ENSB 3BG4B 2BTCE 2CF9H 2RA3A 2ZA5A 2FOMB 4ZROA 6CHAB 4IN2A 2J4IA 1KTSB 1L4DA 1Y3UA 3R3GB 5F8XA 1LHCH 3BTTE 3EE7A 4WXIA 2WSSD 4CR5A 5F8TA 4YT7H 2ODQA 1FY8E 2ZDAH 4MPVA 1YP9A 4P02A 4WJG2 3PTBA 1W0JD 5EXMA 5T3HA 1XXFA 4GCHG 4IC6A 4ZMAH 1BTXA 2ZU5A 1O2SA 4NCYA 3VB4A 1GI7B 2VIQA 1NRNH 5GPIB 1BTZA 4AFQA 3W94A 5EXLA 2R3YA 4AORA 3DSPA 3M7QA 1CT2E 2I6SA 5IK2D 4A1TA 1DWBH 1UO6A 4INHA 2P93A 3MOCA 1Z8IB 2ESTE 3U1JB 5FCKA 3GCTF 1MTWA 2KZ4A 5EJLA 2GV6A 2WV9A 1A3BH 2AIPA 2BDYA 3GCNA 2J2UA 1AZZA 1BTYA 3A7XA 3E90B 1HAHH 3GOVB 3V0XA 4B73A 4CHAB 2THFB 1TBQH 2BDGA 1Z7KA 1YPGH 1BA8B 1CA8B 2WINI 3OX7U 2J9NA 3V7TA 3A8CA 5JBCS 1T4VH 1TE0A 2ZTYA 3PRDA 2R2WU 4Z0KA 2V3OH 1DSTA 1DXPA 2KCOA 4IC5A 3F2HA 1AFEH 4ZKNU 3FP8E 1TNGA 1K1NA 3E6PH 3STIA 1ELGA 2JIZD 2PKAB 2JDID 1C1OA 1Y5BT 3A8DA 1P2OA 1L1NA 3RU4E 3A8BA 1C9PA 4JK6A 4ACBA 1EZQA 2GJGA 1QB6A 3GCTG 3WWBA 3TPIZ 1C5VA 2QF0A 1BOQA 1TMTH 2BXUH 3OE7D 1PPGE 3PB1E 2H2ZA 7LPRA 2BDHA 4OS1A 4FOUC 2PUQH 2NU2E 1C5MD 4RKJB 1IQNA 1XVMA 3U28C 4UFDH 3H7OA 1MBQA 1AFQB 2FOCA 3SN8A 2UWPA 4JCNA 4ZKOU 2XCNA 3RLWH 1TA6A 1ZTLA 3SV9A 2ZHEH 3A89A 1UTQA 1QURH 2ZCHP 3EQ0H 3M35A 3SJ9A 1Q2WA 3ZZ7A 3URCA 1ZR0A 3RC5A 3JZ2B 4TWWA 4IBLH 2QF3A 3B8JA 1AI8H 1GHXH 1K1JA 4Y76A 1OWKA 5EOKA 4MQAA 3Q3YA 3BTGE 3V13A 3ZZ9A 3MO9A 4FETA 1WXRA 1DFPA 1U6QA 4CR9A 3AAUA 1AY6H 2AMDA 1AQ7A 4ABAA 3A88A 2GDDA 3SYJA 1FN8A 1YPHE 5LH8A 3A7YA 1D3QB 1GDNA 1YM0A 8LPRA 1DUAA 4XD7D 1CBWB 4OGYA 4NSYA 4GVUA 1TAWA 1CO7E 1H8IH 3VB3A 1GCTB 1QTFA 1YPEH 2UUFB 3DFLA 1ID5H 3QK1A 1DLKB 1PPEE 1QA7A 2WPJS 3A7TA 3Q3KA 4H6SB 4H6TA 1NBME 1FN6A 2XNDD 1GJDB 1TBZH 1O3DA 1XXDA 2BVSH 3RXCA 1C2LA 3P8OA 2G5VA 4Y8YA 5F53A 5EJZA 1P3CA 2TIOA 1O5GH 2ZIQH 2NU4E 1UVPA 4XSKU 1T4UH 1G37A 1GMDG 1AVWA 2VH6A 4WMFA 1DWDH 1HAIH 1JXPA 1LO6A 5JB9S 3ZZBA 4SGBE 1QRWA 4NA7A 4OS2A 1BT7A 1O2YA 1V2PT 2CGAA 2XCFA 3LC5A 3N7OA 1V2QT 2FLBH 1C5NH 5KGOA 2J97A 3GY5A 1HAZB 5HKKD 1GBFA 4NIVA 2D2DA 1SOTA 3TGJE 1C2DA 4WXVA 3ATLA 2NU3E 1C5LH 4X1QU 4XOJA 3ATMA 3HKJB 1VCWA 1TNIA 2FXRA 3KQ5A 1Z8JB 2FMJA 1Y3YA 1CVWH 2A4QA 2PGQB 1BMLA 3UOPA 1Y8TA 4I8JA 2R0LA 3PYHA 2BY7X 1ZHPA 1D3DB 1F0SA 1O38A 2H5DA 1P04A 5CDFE 1PQ8A 3S7KB 3ELAH 4MPUA 1UMAH 4WWYA 3SUGA 5DSFA 1QIXB 3OYPA 1LVMA 2VU8E 1SLXB 1P11E 2ZQ1A 3E91A 3M5LA 5AHGH 1VGCB 2VH0A 1NT1A 9ESTA 2WYGA 1F92A 4NFEA 1O32A 4ZAEA 1IQEA 3F68H 2J5UA 4FXGH 5AF9H 1G3CA 1ANEA 1P2JA 1H8DH 2H5CA 3BN9A 1BHXF 2AIQA 5EIYA 3TK6A 3M7UA 1EP5A 3OY5U 3LC3A 1QB9A 1N1LA 1D3PB 2R3UA 5C67A 4ZKSU 3ZVAA 4MDSA 3NK8A 1KIGH 2Y6TA 4Y8XA 3GY3A 3RXRA 3SJIA 4B76A 1EATA 2LELA 3RXPA 2VIOA 3F6UH 3N7EA 1ELFA 3I78A 5GNDA 4Y79A 5EQSA 1EP6A 1AE5A 1DVAH 5J4SA 2RDLA 3K2UA 5E2OA 2YMSB 2SGEE 3SUDA 2ZU4A 1A5GH 2XTTB 2KX4A 1C2IA 1TIOA 1YPHC 1ELBA 1XUGA 1SGYE 2M5TA 2W7UA 5EG4A 3L33A 1EB1H 5BPEA 4ACAA 3ZVGA 2QGRA 2OK5A 2BY9X 2F9OA 4XRNA 2GZ7A 3KCGH 9LPRA 1TLDA 1C4U2 2GT7A 1GBJA 1BBRE 3LGVA 2VB0A 1GDQA 2QV1A 4X6MA 1SMFE 5E2PA 1MH0A 1AWHB 2C3SA 3TGKE 1FZZA 1TPAE 4D9QA 2R9PA 3BTWE 2HPPH 3RXVA 1MTSA 2FOGA 2CMYA 3GCOA 1P8VC 4B74A 1P05A 2J38A 2BD2A 4K8BA 2WYJA 1SLVB 1EFRD 5JBBS 1ZTKA 1O3CA 4HG6A 3SU4A 3TGIE 2Q6GA 4AN7A 2OC7A 4K5ZA 2HRVA 1O3KA 1F5KU 1BUIA 1N8OB 2FODA 5JB8S 4HZHA 2A2XH 1XKBC 4HTCH 3SU0A 2V35A 4O03A 3UR6A 3ZZCA 1KXCA 2ALVA 4ISNA 1NRSH 2W26A 1A0JA 5A0AE 1A61H 2BY5X 5FCRA 2ZEBA 1FX0B 3CP7A 4DOQA 4BAHB 2B5TB 2PV9B 1PPCE 1GMHG 1MU8B 1ARCA 1NTPA 1ORFA 2PKSB 2ZPQA 3A85A 5FPYA 3K6ZA 1MKXH 1YC0A 1Z1JA 3SO3A 3DUXH 2VWMA 2KCAA 3MH4A 3LU9B 3QO6A 4JYVH 2BZ6H 3EYDA 2P94A 1S81A 3M5NA 3NPSA 1C1UH 2H9TH 3HKIB 1H9IE 1EJNA 4UE7H 2RCEA 2ZU3A 1GJ8B 4FU8A 1UVUH 1G36A 3RXIA 4DIIH 2AH4X 3ESTA 1AUTC 3GYMA 3SU6A 2QXJA 3F9FA 3H5CB 2ODYB 4B6EA 4K2YA 4RT0A 1FXYA 1HYLA 3UWJH 2QAAA 5FX5A 5ESBA 1YPMH 2BQ6B 3ZZ5A 1TRMA 2J98A 4U01A 2A5KA 2IPQX 4GHQA 2FESH 5EPYA 5A8YA 2NWNA 5A8XA 2DUCA 1ELCA 1FUJA 1O2IA 4OS7A 3SQHE 3ZZAA 2IPHA 1V2VT 3E0NB 2DE8A 5T6GA 4RT1A 3BG4C 3MU8A 1HAXB 1QRZA 1MD7A 1C5YB 1C1PA 1JIMA 2TBSA 2ZC9H 3GY2A 1QFKH 1B7XB 2V7QD 2J95A 1UK3A 1IHSH 1BITA 4O3TA 1SFQB 2FLRH 1UVTH 1ACBE 5EQQA 1JMOH 3FP6E 1IQLA 1C5UA 2BOHB 2CN0H 1LPZB 2F4LA 1L1JA 1ANDA 1QY6A 3I29A 1DICA 4VGCB 1OSSA 3RXJA 1GI1A 1T32A 3SU1A 3MH6A 3PLKA 2CHAB 1THRH 1XUIA 1NFWA 2PSXA 3P70B 1AVXA 2OC8A 2FX6A 2W3IA 5TJXA 2PLXA 4B2BA 2GCTB 1VJ9U 5LPFA 3SU2A 4DY7B 1W0ZU 1W2KH 1MU6B 1PQ5A 4A1XA 2ZWLH 4Y7AA 4NWKA 4CHAC 5GWZA 3G01A 4LZ1H 1L2EA 4OS4A 4ABGA 2OC0A 1KXAA 1ARBA 3EA8A 1HB0B 2ANYA 4FUJA 1ESAA 1SFIA 4U30A 4KTUA 4X2YA 1HLTH 3SZNA 5E0GA 4I32A 1IQJA 1OXGA 2VBCA 3U9AH 4NA8A 3HGNA 4QT8C 1AVGH 1ELAA 2FIRH 4ZXYH 1ELDE 3MI4A 4YM9A 1E34B 1DX5M 2Y80A 3GCHB 3LONA 1C5PA 1OX1A 1QL9A 3N99A 1O2TA 1FONA 3LJOA 1RD3B 2O8LA 1TX6A 1V2MT 4IMQA 2ZNKH 1IQFA 5DP4A 1O3JA 4Y0YE 3V3MA 3NXPA 5AFZH 4JZFH 1DT2A 1SGFA 3C1KA 2FWWA 1S0QA 4KKDA 3RC4A 1TMBH 1WQSA 4H4FA 1GHVH 1AFQC 4TWYA 1GMCG 1O37A 2YMSD 3A86A 1MTNB 3F2FA 4E06H 3P8FA 3ITIA 4Q7YA 3TNTA 1NS3A 1X7AC 3FANA 3KN2A 1GJCB 1HJAB 1O3NA 1WTGH 2BD4A 3QZQA 2ZDLA 3PMAB 1GI9B 1HAPH 1EAWA 1MAYA 4K1TA 1MCVA 2WPHS 1WYKA 3I77A 1M9UA 3KNXA 4Z1MD 1C5XB 3URDA 1O3PB 5E8EH 2OLGA 1Z6EA 2UUKB 5T1VA 1WSSH 2ZO3H 2V3MA 5F6MA 2K0QA 2Q6FA 4AGJA 1HBTH 1HIAB 2GD4B 5DO4H 1V3XA 3NCLA 1SR5C 1C5RA 1V2WT 2HNTF 2LP6A 4I7YH 3RXMA 1OKXA 3LOXA 3SV2H 3IG6B 1UHBB 2BD3A 1FMGA 1Z6JH 1L1GA 5EW1H 2GDEH 4X0WU 4JK5A 4Y7BA 1A46H 2QXGA 5FPSA 1ESTA 1GCTC 1Y5UT 3VB6A 4U32A 2Q1JA 2W7SA 3CNRA 1ZJDA 2AYWA 1TMUH 3ODFA 1P9SA 2PWXA 1YKTA 4O9VA 2P16A 2XBWA 1P2MA 1BTWA 1GI6A 2EY4C 3ZV9A 2GZ9A 1LCYA 4XBDA 4B2CA 1HNEE 2BZAA 3OEED 1AE8H 3CS0A 4AZ2B 1O3LA 2BLOA 4ISHH 3SJOA 3RUOA 3VGCB 3TIUA 3TLOA 2RG3A 7KMEH 4K8YA 1EZUC 1QGFA 3DT0H 2FZZA 2ZCLP 4NGAH 4XDEA 1ZMJA 1QBNA 3OTPA 1VCQA 1WDIA 1WUNH 1SGPE 1GI5A 1O36A 3MU1A 1DE7H 1IQKA 2BVRH 6GCHF 5FBEA 3BTKE 1ZPZA 1T8OA 3VG8A 4K3JA 1OWEA 4B2AA 1TRNA 1S84A 3P95A 1HGTH 1TABE 1SKYE 4X1RU 4ZHAA 3BTFE 1UTLM 3OAAD 1D4PB 4UFFH 1QRXA 1EB2A 4FUBA 4DCDA 1C2MA 1RIWB 4H42U 2FOFA 3UIRA 1RFNA 5GCHG 3SI4H 3ZVEA 3A7ZA 1AUJA 1VITH 2ZKSA 4AB9A 5L30H 3FZZA 3W95A 1C5SA 1MQ5A 2J94A 2JH0D 2YOLA 1AU8A 1ZRKA 2TRMA 2Y81A 3UNQA 1TOMH 2RA0A 4CRAA 3U8OH 5C17A 2SNWA 6GCHG 1TRYA 1C5ZB 1QZ8A 4UFGH 4ABJA 1BJVA 3AASA 1HRTH 3MU5A 1QHRB 1T8NA 1GBEA 2C8WB 1TQ0B 2ZFPH 1P03A 8KME2 2C4FH 5A2MH 2PTNA 3PROA 2H1UA 2BMGB 3DHKH 1THSH 2L6OA 2ZFTA 3MU0A 2F9NA 1B0EA 4GUXA 1MKWH 1UTJA 4JYTA 1BRAA 4WH8A 2V6NA 1K22H 1O3IA 4A92A 4SGAE 2YMSC 1SQAA 2BY8X 2J92A 1KXDA 2FS8A 4U2WA 4J1YA 2ZECA 2ZGCA 3NKKA 4BAOB 2BDAA 3OFND 1ELVA 3AVZA 2ALPA 2CF8H 2OP9A 4A6LA 4JZDH 5LPEA 4K60A 3D49H 4NG9H 1H8ED 4I8KA 3M5MA 3Q77A 1ZJKA 5FXLA 5L6NH 4FUEA 1PFXC 2SGFE 1ZSLA 5C20A 1UTNA 5E0JA 3UUZA 4IS5A 4ZHMU 4NIWA 1O2JA 1C1WH 2AMQA 1KDQB 3WWFA 2K8IA 1VITG 4MNYA 4NIXA 2XBXA 1GG6B 1QR3E 1WAYB 1YF4A 2HLCA 1O2KA 1GMDF 3EA7A 3U98H 3UQOA 3LIWA 4BAMB 1C1VH 4KGAA 4X6NA 1ZZZA 5FAHA 2LPRA 1SHYA 3BTME 8GCHF 1CQQA 3MWIU 4F49A 1C2JA 1UTPA 3MU4A 5LGOA 4UEHH 2EEKA 3OY6U 1C4Y2 4DG4A 2OINA 3E1XB 5JPMH 1UCYE 4THNH 4MPWA 5DGJA 1BMAA 1O2MA 1V2ST 1AB9C 1ZSKA 1HAGE 4BTIB 1O34A 3QUMP 1KY9A 4XBBA 4AG1A 1FIWA 2OQ5A 1SOZA 2IN2A 4ABEA 2G4UA 1FLEE
chains in the Genus database with same CATH topology
4HI3A 3T2NA 2OTVA 2FI3E 1VJAU 1K28D 5CHAB 4J2YB 1Q31A 2PKSC 1AZ8A 1JRTA 3BF6H 2ZPRA 6ESTA 1ANCA 1QA0A 2TGDA 4Q7ZA 4I33A 8GCHG 1JIRA 1AHTH 1ETRH 1IOEA 1NRQH 3ODDA 4INLA 3UNSA 4B71A 4FUFA 1MCTA 4K69A 3E16B 2ZZUH 1FNIA 1MD8A 1BZXE 3L6PA 4AYYB 1ZRBA 2TPIZ 1UHBA 2SNVA 2EC9H 3GISB 2PW8H 2A45B 5C2ZA 1T8MA 3PLPA 3AW1A 2ANKH 3P92A 3B9FH 1W3CA 4O3UA 4DURA 3KQDA 3QN7A 1O2PA 2AGGX 4JMYA 3NWUA 2A7HA 2ULLA 1TYNA 3RXEA 3Q3XA 1AMHA 2Z7FE 2BDIA 5DK1A 2XC0A 4WH6A 2FOBA 3PWBA 3RXUA 1LQEA 1QJ7B 1QJ6B 4CRBA 4BOHA 1LPGB 2BDBA 2QXIA 2B9LA 3UQVA 1GJ7B 1SI5H 3TH4H 2ZPSA 3U69H 4OS5A 1SGFG 1GJ5H 1HAOH 4RKOB 2SFAA 2GMTB 1ABIH 3UREA 1CE5A 4ASHA 3ATWA 1WBGB 2Y5HA 2WPMS 3O8CA 1J15A 3SJKA 1S0RA 1YLDA 5L2ZH 1GJBB 3LKWA 1V2KT 2GCHF 3BTHE 4NIYA 1O3MA 2FI4E 4F4OC 1HJ8A 2A5IA 2F9VA 1K9OE 5FPTA 2OQUA 4MNXA 1TOCB 2Z9JA 3A7WA 2P95A 1DPOA 2Y5GA 1RGQA 4VGCC 1HDTH 1S85A 2CHAC 3RXAA 3TJNA 1WCZA 3KQEA 1GHBG 3Q00A 1ZGIA 4AGKA 1UTKA 3BIUH 2PHBA 1ZMLA 1P09A 1RS0A 1G3BA 1O3GA 1W0YH 2O8MA 2F9PA 3D23A 3ZVFA 2H9EH 1O3AA 2P8OB 1GBKA 1HAVB 1C5OH 2BY6X 1E0FD 3RXLA 2TGPZ 3EE0B 1Y3WA 2GCHG 1FDPA 4E7RG 4MTBA 3TITA 2PKAA 2D8WA 3KF2A 1RTLA 5DP8A 1GMHF 1A3EH 4R8TB 4YO9A 5GXPA 4ABIA 2WPLS 3GCHC 1GVLA 5ABWA 5C1UA 2ZG0H 1BJUA 4LK4A 2G5NA 4KTSA 3GDVA 4Y71A 3A82A 1TNJA 2BX3A 1GGDB 2VIDA 1OP2A 1ANBA 2C90B 1OS8A 2G51A 2EI8A 1WTHD 6LPRA 1EZXC 4O97A 4ZUHA 5TCCA 2ZGBH 1EPTB 3KIDU 1HXFH 5DKMA 4MG3A 1ETTH 1P2KA 1DWCH 1C5TA 2ZGXH 1MTNC 4WY3A 2ANWA 2BD8A 4X6PA 1Y3XA 4I8HA 3ZVDA 5F8ZA 2ZDNA 2ZFRH 1HJAC 1BHXB 1CA0C 1O2WA 4AYVB 1C4V2 4A5TS 3DFJA 3PWCA 1YPJH 1NESE 4BANB 1GI3A 3RC6A 3SHCH 3F9GA 4BNRA 3EAJA 2FEQH 4CRCA 3LT3A 2IOTA 3BV9B 3P6ZB 1DSUA 3TJVA 1OP8A 1KDQA 3PTNA 3TK9A 4RN6A 4DGJA 1NPMA 2A0QB 1O3EA 3RMOH 3T29A 3WY8A 1F0UA 5I25A 3GY6A 1EKBB 1V2UT 4AX9H 3TVJB 4D7GA 1TNLA 5EW2H 1N6YA 1E38B 5IYTA 5DP6A 3BEFB 4A1VA 3S7HB 2Z3CA 3S9BA 5C1YA 3S0NA 2AS9A 2JKHA 2HPQH 2G55A 3V12A 1ETSH 4AFZA 1C5WB 1EASA 4Q80A 1HFDA 1W8BH 3TH3H 1P57B 3UY9A 5PTPA 2UUYA 4INKA 2XWBI 1IQHA 3MO3A 2XWAA 4PROA 1C2EA 2DE9A 4FU9A 4JZEH 3MNSA 1F7ZA 2VWOA 1O2XA 1EJMA 1NFYA 2FOAA 6CHAC 1PQAA 3VGCC 4Y8ZA 5EQRA 1G32B 5GDSH 2FS9A 5HM9A 1O2QA 2BLWA 4YLUA 1TGSZ 1O0DH 3SV6A 1O3HA 2F3CE 3T27A 1E36B 1K1LA 1S82A 2VIWA 1FJSA 1DLEA 1O2LA 3FP7E 1JWTA 5DP5A 2GX4A 1THPB 2PFEA 4TYDA 4B1TA 1OYTH 1GBHA 1UVSH 1RTFB 1A4WH 1PPHE 2JETB 2C8XB 3M5OA 3A87A 2V3HH 2ZFFH 1QL7A 1KXEA 2VINA 4K1EA 4YZUA 1NM6A 2ZGJA 1DM4B 3SNAA 1TX7A 2AEIH 1IQGA 4YT6H 1DITH 1L0ZA 1RIWC 2NU1E 4HGCA 3QTVH 2F9BH 2JH6D 1LDTT 4IW4E 2STAE 1Y59T 2YNAA 2FDAA 1BRCE 4ABHA 3ZYDA 1ZHMA 3E0PB 1GMCF 4D76A 4LZ4B 3R0FA 3RXBA 4YOGA 1AO5A 1EAXA 2ZDMA 7GCHG 3D62A 1PYTD 1BQYA 2OXSA 1ELTA 2ZFSA 3PV4A 3SORA 1NFUA 4X1SU 3BEIB 4FUIA 1V2OT 3EDXB 2AGEX 2IJOB 4BXWA 2XBVA 3VXEH 2FOEA 4NSVA 2A7JA 3S9AA 4Q2KA 3PMHB 1C9TA 1GHWH 5FBIA 4D8NA 1ABJH 1GJ4H 1FI8A 1TNKA 3MYWA 2XXLA 1J17T 1XUJA 4X8UH 3SUEA 1WU1A 3ZZ8A 4CBOA 1QCPA 2A7CA 1VZQH 1BBRH 1BIOA 1DUEA 2A2QH 4MPXA 3T25A 3SQEE 1GHAF 2W5EA 4BXSA 1XUFA 3KEEA 4AG2A 2EI6A 3T26A 1CGJE 2B7DH 5J4QA 1O2NA 4FUGA 1T7CA 2R2MB 1SQOA 3SW2B 2VGCB 1C5QA 5G4BA 4GAWA 3U8RH 2GT8A 3K9XB 1SGIB 2GZ8A 1G30B 2QYIA 1H9LB 1SGCA 1P3EA 1W13U 2WUBA 4I8GA 2J34A 1TPOA 3QGJA 3GYLB 3M3SA 1PQ7A 5GJ4B 1O5FH 1TB6H 2QC2A 1HUTH 1QBVH 1GDUA 1GBLA 3DA9B 4ISLA 4JYUH 1V6DA 3VB7A 2SGDE 1P12E 3FVFB 4JZ1A 1AKSB 3MNBA 4AB8A 1KLIH 3PMBB 2ZI2H 3TU7H 3SV7A 1CGHA 3ATKA 1GHAG 3HK3B 2C8YB 1LHGH 1V2RT 5GIBA 1ESBA 1CBWC 2CJIA 2QN5T 3DD2H 3F1SB 5JDUB 1O3BA 3HATH 1DY9A 3IWMA 2ZHDA 1C1QA 3M36A 1GPZA 3CS7A 1A0HB 5A09A 1P02A 1W11U 1BMMH 3ATIA 2BDCA 1EXFA 1O33A 1S6HA 3SNBA 1J8AA 1XM1A 1LHEH 1OWJA 1VCPA 5JBTA 1GBTA 2O9QA 2VNTA 1MUEB 1K21H 4LXBH 2ZU1A 1JBUH 2F83A 3GDSA 3PM3A 1ZLRA 3NZIA 4BTTB 5CHAC 2ZDKA 5GCHF 1LTOA 2FX4A 2QIQA 3O8RA 1A2CH 2ZHWH 3OU0A 1MKXK 2VWLA 1MTVA 4CBNA 3HK6B 2GV7A 3PO1B 2G00A 2WPKS 3LJJA 4TPIZ 1XX9A 2BLQA 3A7VA 1BTPA 3KQBA 1WOFA 1O2VA 4FVDA 1SGEE 4JZIA 1TGTA 3EGKH 1W10U 4UD9H 1B0FA 4MLFB 1UTOA 4X2VA 3LGIA 4I31A 5A0BA 4X2WA 1BDAA 4X6OA 1FPCH 1GL0E 5C3NA 1RTKA 1BRBE 5HGGA 1F0RA 3UR9A 4NZLA 1NZQH 1EUFA 1O5BB 5IDKA 7ESTE 5DP7A 3RDZA 1TALA 2A5AA 1E37B 3RMLH 1V2JT 5AFYH 4XFQA 3ZZDA 2WPIS 3RM0H 2JH5D 1INCA 3GY4A 1D3TB 1PYTC 4X8TH 1P10A 1C2KA 8ESTE 1VGCC 2GMTC 3MNCA 2FTLE 2ZCKP 2D26C 3FFGA 1N6XA 2BD5A 1J16A 3RU4D 5DP3A 1TGCA 2GTBA 3MNXA 1O31A 1GVKB 1W7GH 5SGAE 1HV7A 1C2FA 1LQDB 1O30A 1W7XH 1UK2A 3SOSA 1YYY1 4WMDA 2FPZA 1XUKA 2FYQA 1C1NA 2QCYA 1AN1E 1P2IA 3GDUA 1NRRH 1VITF 2BD7A 2HWLB 3BG8A 1RJXB 1UK4A 3QDZB 3UTUH 5EGMA 3A80A 2VVUA 2AGIX 1NY22 3SNDA 2Z6BD 4FUHA 1O35A 3U1IB 5A8ZA 1QQUA 2ILNA 3GY8A 2O8UA 1QB1A 2BVXH 2VVCA 1YBWA 3KGPA 1ZPBA 1GJAB 3VEQB 1MZAA 2Y82A 2GVFA 1GHYH 4XBCA 2O8WA 1H9HE 4ISIH 3BTQE 2ZTXA 4KELA 1AIXH 4DT7B 2P8OC 1O2UA 1MAXA 1TX8A 4UDWH 2YNBA 1OWDA 1CT0E 3RM2H 1H1BA 3VB5A 1O39A 1LPKB 3LH1A 1CT4E 4M7GA 3RXQA 5K7RA 1O5EH 2BQ7B 2GGVB 3U8TH 1BB0B 1EZSC 2Z9KA 4GSOA 1GHZA 1O2RA 4MNVA 2ZHFH 2PR3A 2A4RA 1XMNB 3MFJA 5K0HA 3MHWU 4NZQA 2BLVA 4IMZA 3RU4T 3TJOA 3Q76A 1GGDC 3RXOA 1C2GA 4A7IB 2XW9A 1G9IE 3ZV8A 1N8OC 1BBRK 3SJ8A 5FHTA 1SB1H 5E0HA 4YOIA 3RMMH 1EPTC 5T6DA 1TQ7B 2Z9GA 1FIZA 1IHTH 2ODPA 3SU3A 1NN6A 2Z9IA 3T62A 4FVBA 3FAOA 1TBRH 1CGIE 1YLCA 2H6MA 1WV7H 1KXBA 3O8BA 3SUFA 2BB4A 2Z3DA 1Y3VA 1BRUP 3OTJE 1PPZA 1HIAA 3UOUA 3MTYA 1KTTB 1YPKH 3E8LA 1DY8A 3HGPA 4X2XA 3MMGA 2Y7XA 1AKSA 4OS6A 5ESTE 2SGQE 3LPRA 4X1PU 1YCPM 3BSQA 1DOJA 1SHHB 1HPGA 3RXGA 2FP7B 4E05H 1V2LT 2ZFQH 1L4ZA 2ASUB 2ZGHA 1S83A 4NFFA 4D7FA 1O2ZA 1F2SE 1IAUA 4DIHH 4CH2B 2PUXB 2ZQ2A 1K2I1 2LNCA 2FOHA 4GPGA 1HJ9A 1NU9A 3ZZ3A 3RXSA 3LGWA 5EODA 1GBCA 2P3UB 1V2TT 4BAKB 5TCAA 1ZGVA 3F9HA 2STBE 1GHBF 1XVOA 1S6FA 3SGAE 1SQTA 1MTUA 2B8OH 3QTOH 3P8GA 2OCVB 1UTMA 1C1SA 3AAVA 2XC4A 1GI2A 4ZH8A 1O5DH 1YGCH 1SPJA 5ETXA 1SLWB 4FUDA 3SHAH 1ELEE 2OC1A 1NRPH 2A4GA 1BTHH 1KXFA 1FAKH 1EOLA 2CXVA 2GP9B 2JETC 4IN1A 3RXDA 1G3EA 2GCTC 3MO6A 4WMEA 1PPBH 3B23B 4IGDA 1AGJA 1WQVH 1T8LA 3PLBA 1FAXA 2KAIB 1SGQE 2K1QA 1OP0A 1TFXA 2VIPA 3SNCA 5HXFA 2V0BA 2ZHQH 3CENA 1XUHA 1GBBA 2VWNA 1ZHRA 2BYAX 1EAIA 1SGRE 4CREA 1XKAC 3EA9A 2UUJB 1J14A 2SGPE 1DXWA 5T6FA 5EPNA 1LMWB 2F9UA 4MNWA 1TWXB 4LOYH 2OUAA 2BXTH 1YCPH 4TY6A 5HYOA 4BTUB 1GI0A 3M61U 1QBOA 3RP2A 3LH3A 2UWLA 1SG8B 1C1TA 1RXPA 1C1MA 4CRDA 2HNTE 3K6YA 4FU7A 4KTCA 2F91A 1ZPCA 2C8ZB 1MZDA 2XNIA 1GVZA 3T28A 1MKWK 3SU5A 2Z94A 1S5SA 4HFPB 3K65B 3C27B 3HPTB 1YPLH 3AW0A 3TH2H 1C1RA 5C5NA 1RRKA 1LKAA 1O5CB 2FM2A 2BOKA 2Z9LA 5EXNA 1NC6A 3QWCH 2ZDVH 1GI8B 2VGCC 5AVDA 1TGBA 3MH5A 4ESTE 4ABDA 1GCDA 1O5AB 5LPRA 1CU1A 3L3TA 3QZRA 1AB9B 4YLQH 2H9HA 3P17H 5JBAS 3A8AA 3SGBE 2D1JA 2WUCA 5CE1A 1SL3A 4Y11E 1GJ6A 1OOKB 4I8LA 3RXFA 1UCYH 2A32A 1ZMNA 1FY3A 1A0LA 1AD8H 3VPKA 3ZZ4A 2ANMH 2P3TB 2AERH 2XC5A 2XBYA 4ISOA 2VVVA 3KL6A 1TPSA 1TNHA 3UFAA 2UWOA 3F9EA 1HAYB 3KHVA 4Z6AH 1DANH 3FZDA 1OWIA 2Y5FA 4OGXA 3SBKA 2G8TA 2WV4A 4ABFA 5I46H 3RXHA 1FQ3A 1F0TA 4YESB 1SGNE 2P3FH 5B6OA 1ZTJA 5HM2A 2ZP0H 4ABBA 4AFSA 2TGAA 4NA9H 2SGAA 4X8VH 5L2YH 4ZHLU 4GLYA 2GKVE 1Q3XA 2BD9A 1P06A 1D9IA 1P2NA 1CHGA 1BTUA 2Y7ZA 4CRFA 5EU8A 2ZTZA 2R0KA 2TGTA 5C5OA 1G2LA 2VJ1A 2VIVA 1B5GH 1GBDA 4KP0A 5DPAA 1GWAA 4K1SA 3VFEA 1LVBA 2ZF0H 2EA3A 3LGTA 1O2HA 1TONA 1A7SA 1P9UA 4Y0ZE 5F03A 1TGNA 7GCHF 1HCGA 3M7TA 1OPHB 3MH7A 3PO1C 3TK5A 3A83A 1NFXA 3RMNH 2PGBB 1GJ9B 1ZOMA 1DWEH 1FV9A 1LKBA 1PPFE 2ZU2A 4X1NU 3M3VA 3LDXH 1Z8GA 2O8TA 2WV5A 1P2QA 2FTMA 5C1XA 1F5LA 1A5IA 1Z8RA 4RSPA 3VXFH 1ZYOA 4WF8A 1GL1A 1Z71A 5JYIA 3QGNB 2C93B 4CRGA 1J9CH 3NUMA 2BQWB 5A0CA 2XYAA 1PJPA 3LGUA 4X8SH 4XE4A 3OSYA 4ZKRU 3ZVBA 1EOJA 2HVXA 1JRSA 3TJUA 3BTEE 1P0SH 1QJ1B 2HNTC 1C2HA 1IQMA 1W14U 1K1MA 1V2NT 4NWLA 3RLYH 2QY0B 2G81E 5BRRE 3UWIA 4E7NA 1SC8U 3RXKA 1UVOA 2B0FA 1K1IA 2QA9E 3TNSA 1DS2E 1MMJN 2PTCE 1O3FA 1G3DA 3QX5H 2NU0E 1O2OA 1LVYA 4UONA 3IITA 3BEUA 1SGTA 3SNEA 4B75A 3LGYA 3QLPH 3ZYEA 1CHOF 1GBIA 3BIVH 4DVAU 1NU7B 2P59A 3RXTA 3PMJA 3ZZ6A