3ATLA

Crystal structure of trypsin complexed with benzamidine
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
publication title In-crystal affinity ranking of fragment hit compounds reveals a relationship with their inhibitory activities
doi rcsb
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3atlA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3atlA02
1O5CB 4MNVA 2PSYA 1DXPA 1LQEA 1O36A 2GGVB 3KQDA 1DVAH 3QZQA 1DWEH 1SQOA 3ATWA 1SGFG 3AW0A 4I33A 1D6RA 1PQ5A 4WXIA 2F9UA 2A32A 2ZC9H 1P2OA 1GMCF 1KXEA 1QB1A 5DP6A 1GI6A 3ATLA 3A86A 1MCTA 1NFYA 3EDXB 2A5AA 3SV6A 2ZTZA 4KTUA 1NFXA 2JETB 4HGCA 1AWFH 5EGMA 2PHBA 1F0UA 1ELCA 3RP2A 1O3AA 3D62A 5JBTA 3MI4A 2Y82A 1GI2A 4K3JA 6GCHF 1AVGH 1JMOH 1O2GH 4XBBA 2G52A 5F03A 1TA6A 4D9QA 1Q2WA 3SV9A 1WTHD 2G51A 4UD9H 5C67A 3SOSA 4AX9H 3RXSA 2ODPA 1GJ7B 2C8XB 1MBMA 3P95A 4D7FA 2G5NA 1ARCA 1EASA 1AD8H 2RA3A 1TIOA 2F91A 1RTFB 6LPRA 2RG3A 1TNHA 3N7OA 1ARBA 3F9HA 4X6PA 2TRMA 3QTOH 2H1UA 4H42U 1CHOF 2CJIA 8LPRA 7ESTE 4YLQH 2ZFRH 2IN2A 1P2KA 4CRDA 1RTKA 1XXDA 5JDUB 2BZ6H 4SGBE 3QK1A 4BAMB 3UTUH 4GHQA 2A4OA 1GDUA 3KEEA 1Q3XA 3TK6A 1V2VT 3T29A 1LHFH 4D8NA 2EI8A 3LGYA 1WTGH 3ZZ4A 4TWYA 1TPAE 1GVKB 4FUBA 2R9PA 3MNBA 3LPRA 1CBWC 4BXWA 2PKAA 3U8RH 1YBWA 4H6SB 1UTPA 1BTYA 2FP7B 1P12E 2QAAA 3ZZBA 2TBSA 1EAUA 5E0GA 4E06H 1Y3YA 2QN5T 3HKJB 1NT1A 3U8TH 1Z6EA 1YPMH 8KME2 3TJVA 1GGDC 3U98H 3SGQE 5I25A 1DLEA 2XW9A 1S5SA 2GMTB 1BRAA 1PPBH 2P93A 3BF6H 3FZZA 1O5FH 1C5LH 1E37B 4KKDA 2FMJA 1ELBA 1MTNB 5E2OA 4X8VH 1EPTC 3LKWA 1O3MA 4WVPE 1GJ9B 3LONA 2BDAA 3GY3A 2HLCA 3A81A 4VGCC 3W95A 1SFQB 1ZOMA 3UPEA 1M9UA 2JH6D 3KQEA 3MWIU 1ORFA 4OS1A 1SGNE 2HALA 3LU9B 2NWNA 4FUFA 1OWHA 3TLOA 1SLUB 2G00A 3FFGA 3CS7A 3GYLB 1GMCG 2NU0E 2QXGA 1Z8RA 1C1VH 5F6MA 2HVXA 1NFUA 1C5TA 2BDYA 2F9OA 4UFDH 4Z6AH 1YKTA 3SQEE 4ZKOU 1VITF 4RSPA 2Z6BD 1OYQA 2BQWB 1BJVA 2UWLA 1PFXC 3Q77A 3JZ2B 3RU4D 3SJOA 3UREA 1C2GA 4ISLA 3Q3YA 1A4WH 3OTJE 3UOUA 2BY5X 1BTZA 2BXUH 1O3NA 1FLEE 1W12U 1FPCH 1Q31A 3RMMH 3UR6A 1C5WB 4O9VA 3VFEA 1YPLH 2F9BH 4FUHA 1GJBB 1L2EA 3STIA 3PLPA 3TITA 2HNTC 4BOHA 1J17T 3QLPH 4FUEA 1ABIH 3M5LA 1QA7A 1GJ4H 1FNIA 2HGTH 4BTUB 2D26C 1YLDA 3NZIA 1QBVH 2FTMA 2P3TB 1UTLM 1UJ1A 1RXPA 4YTAA 3E6PH 4ABGA 3RXKA 1O2JA 1SGFA 4XBDA 5C5OA 5AHGH 4WWYA 5ABWA 2ZDMA 1WBGB 2ZHQH 2UWOA 2WPIS 3KQBA 1SLXB 4MNYA 1HJAB 4JYVH 1GHXH 2XBVA 1V2NT 5T3HA 1TGCA 1DWDH 1W11U 5JBCS 1OXGA 3A87A 1AKSA 2W7SA 1F92A 2F9VA 2H2ZA 4LXBH 2OQ5A 1SR5C 1G3CA 3RXQA 5K7RA 4Q7YA 1FY4A 3LOXA 2P8OC 1SFIA 2VWNA 3MMGA 2UUKB 5IDKA 1CA0B 3M35A 3T27A 1QB9A 5FCKA 1W13U 1DWBH 3Q3KA 4GVUA 4AFSA 3TH4H 1O5EH 3SNBA 1QHRB 2B7DH 1QURH 2Z3DA 1K1OA 5HYOA 1AZZA 1KXBA 1BITA 3RUOA 2O8LA 3PWBA 3GY8A 3ZZDA 3SHCH 4I31A 1D3DB 4A1TA 1AVXA 3L33A 4UFFH 4KTSA 1AE5A 4O03A 5L30H 2VIVA 4TY6A 4YZUA 2FLRH 1GBMA 3TGJE 3PWCA 2GV7A 4B75A 1SGPE 1VJAU 3GYMA 4NFFA 1QQ4A 1O2HA 2WUCA 1NRPH 5FPYA 3RXJA 4ZKRU 3BTTE 1FDPA 3F1SB 2BD9A 3SNDA 4X1QU 2GV6A 1Z8GA 2OD3B 4LOYH 4Y7AA 1F5LA 4B2AA 1SGQE 2ZCHP 5JBBS 1QBNA 3B23B 2ZU2A 3UFAA 1GI1A 1G3DA 2O8MA 3TJUA 1J8AA 3RXFA 1DXWA 5GWZA 3T62A 4A6LA 5G4BA 3U1IB 2C93B 5CMXH 1VITG 1P9UA 3MH4A 1OWDA 1IQEA 4CR9A 1EAIA 2TPIZ 2KAIB 3S0NA 5FBIA 2AFQB 1WUNH 2ODQA 2Q1JA 4E7NA 1QRZA 3OY5U 5E0JA 1IQJA 2W3KA 1CT4E 2B9LA 3ZV8A 2ANKH 2FOEA 4A92A 2GCTC 1OS8A 3Q3XA 3QGNB 2O8WA 1UK3A 3ATMA 3RXVA 3V12A 2OC1A 2FYRA 1UK2A 2VIWA 2HPPH 1TQ0B 5EG4A 1NESE 2A1DB 5DP4A 1O2QA 1OWIA 2AGGX 2GD4B 4MVNA 2F9PA 3E8LA 1SLWB 5GCHF 1TA2A 3SUGA 2FX6A 5T6GA 3W94A 2BY9X 1FJSA 1NRRH 3BIUH 1DLKB 1P0SH 4Y7BA 2XNIA 3GDUA 3HGNA 4GCHG 3ITIA 2SGPE 1SQAA 2QXIA 4Y6DA 1AI8H 1P02A 3A7VA 1KLIH 1SGYE 4ASHA 5E8EH 3U1JB 1EXFA 5C3NA 1YPJH 4K5ZA 1O33A 1ETRH 1C1TA 1D4PB 3MU8A 2ALVA 1C2EA 2PR3A 1DFPA 2I6SA 1C4Y2 2FOHA 5DKMA 1GGDB 1ANEA 1VCWA 1U6QA 1FY1A 1GMHF 4SGAE 1AWHB 1UK4A 1A3BH 2FZZA 1C5OH 3IG6B 2GZ8A 1BBRH 2ZTXA 1O5BB 1MU6B 1AY6H 1NRNH 1BDAA 3SI3H 5GXPA 1TPPA 5B6OA 1YCPH 1B0EA 1F2SE 1G30B 2AIQA 2Y7XA 5E2PA 4OS6A 4VGCB 3ZVDA 5FHTA 1IQFA 1A3EH 4Q80A 2V0BA 2F9NA 4BAOB 1HV7A 1UHBA 1C2MA 2A4GA 2W5EA 2XC5A 1DS2E 1EAWA 1MTVA 1PPHE 1VR1H 3ZVCA 1HAPH 4B2BA 7GCHG 1J9CH 1EP6A 3BTFE 3FP6E 2ZFPH 1JWTA 2FI5E 1KDQA 3BN9A 1EATA 3O8BA 4ISNA 1KSNA 3TJNA 3ZVFA 3SNCA 4LZ4B 1BTWA 1Y5AT 1HAVB 1JRSA 2WUBA 2PSXA 1BA8B 1BRCE 3GCHC 4ZHMU 4AOQA 1LDTT 3LDXH 3S9AA 3RLYH 4PROA 5EOKA 2CGAA 4R0IA 4U32A 1PQ8A 4RKJB 1T8OA 2Z9GA 1C2IA 4JYTA 2FI4E 2BD4A 3RXDA 3P6ZB 1VGCC 2ZNKH 4BAQB 1NM6A 1YGCH 4ABJA 1J16A 2C90B 2XYAA 1GHAF 1ANCA 3E91A 1C1UH 3M37A 1AFEH 1GVZA 3LGWA 3SUDA 5F8TA 1XXFA 2QA9E 1O2XA 1MKWH 3PV4A 1C1RA 1DE7H 5GCHG 4BTIB 4AFUA 1C5SA 1LVBA 5LPRA 2VIQA 1P09A 3K9XB 1GBIA 4D7GA 5AF9H 7KMEH 1O39A 1C5XB 2BD7A 1TONA 2BDHA 4Y8ZA 3GCTF 1LHEH 4BTTB 2BXTH 3TU7H 5A09A 1ELDE 1H9LB 5DP7A 1GHWH 1MTWA 4Q2KA 1O3EA 1OWKA 2FLBH 2BOKA 2FI3E 2TGPZ 3RXCA 1TFXA 3LT3A 2VINA 2ZGHA 3EYDA 4NWKA 5F8XA 3UWJH 1PQAA 4DOQA 2SNVA 1KTSB 2QC2A 2UUFB 4ABEA 4NZLA 1THRH 4JZ1A 4HTCH 1UVTH 2G81E 1BTUA 1QFKH 1QQUA 1O3GA 1GMHG 2BLOA 1BMLA 3ZZCA 1C9PA 1H8DH 4YOGA 2TGAA 1K2I1 2ANMH 1F5RA 2FWWA 5CHAC 1ELEE 4ZKNU 2Y80A 5F8ZA 3ZVGA 2CV3A 3SV7A 1G2MA 3RXMA 5FPSA 3ENSB 2ZFQH 1CA8B 3HGPA 3CENA 1LO6A 4LK4A 1TBRH 1C5VA 1T8LA 1IHTH 1LPGB 3NKKA 1DUAA 1G3BA 1GI3A 1A0HB 3MH5A 4ABDA 1FQ3A 1P11E 1G36A 4X8UH 1KDQB 3SNAA 4CBNA 3PLBA 3PMJA 3A7ZA 4X6MA 1WCZA 1IQIA 3VB5A 4JK6A 4X2XA 2BLVA 3SN8A 3V13A 2ZI2H 3SU6A 1CE5A 6CHAB 3LGVA 2J4IA 1TX6A 1UTKA 3EA7A 1BHXB 5ESTE 1W7XH 3BG4C 1C2DA 1HAYB 1XKBC 2Y81A 5FX6A 5FX5A 4CRFA 5DP8A 3UNSA 2BVSH 4FVDA 5C1YA 2FX4A 1MKXH 3EE0B 2VGCB 4K60A 2JKHA 1CQQA 1L1GA 5TCCA 1MMJN 2QIQA 3RXEA 3EA9A 1O3LA 3PTBA 3U8OH 2PWXA 3QZRA 1MZDA 2Z7FE 2QV1A 2OTVA 1NZQH 1O2KA 2FXRA 4DCDA 3PO1B 1V3XA 1W2KH 4X1SU 2VWLA 5HMAA 1FN6A 5LH8A 1GHAG 5EW2H 1DM4B 1HAGE 5L2ZH 1A61H 1TE0A 1NS3A 1ELVA 2BD2A 1BCUH 2W26A 1GBJA 1TMUH 5FCRA 1ZHRA 1TGTA 1O3CA 3SJ8A 2ZDLA 2XBXA 1GHYH 3L6PA 4WF8A 3DUXH 4DG4A 1QIXB 3F9EA 1BUIA 3A8BA 3PB1E 1ID5H 3QO6A 1YC0A 5K0HA 2C4FH 1OP8A 4B1TA 3FAOA 3U69H 1GMDG 4JYUH 3GCTG 1YPEH 3D23A 2AGIX 2FO9A 1SL3A 4INHA 1L1NA 2ZPRA 2BLWA 1OYTH 5A0AE 1ZZZA 1IAUA 1W0YH 4E7RG 3KN2A 1E38B 2ZHWH 4HFPB 2W3IA 3JZ1B 1RGQA 1TB6H 4DJZB 3MU0A 3LH3A 3VXEH 1HGTH 4YT7H 3RMNH 3A83A 1HPGA 2H5DA 3FVFB 1CVWH 2ZZUH 3LJJA 2ZQ1A 1C4U2 2ZDAH 2ZKSA 3A7TA 1SG8B 4K8BA 8GCHF 4X1NU 5BRRE 3TK9A 3M7UA 2FEQH 1O2YA 5JPMH 5EODA 3BTDE 2WV4A 1AFQC 1HDTH 3VGCB 5CE1A 1SMFE 2Z9KA 1LVYA 1SQTA 2EA3A 3SNEA 9LPRA 2BY6X 4ZHLU 1K28D 3A7WA 1LVOA 4O97A 2TGDA 3ZZ8A 4XDEA 1O3HA 1H9IE 1YPHC 3PM3A 2C3SA 1OOKB 2ZFTA 1NU7B 1EOLA 1TMTH 1EKBB 3V7TA 2OBOA 2I6QA 1BHXF 2YNAA 1HFDA 1N1LA 1V2PT 2B0FA 1VJ9U 4AGKA 3DFLA 4GPGA 3GCHB 4BXSA 1OX1A 2H5CA 4NIYA 3QWCH 2ZU4A 1TMBH 3GOVB 3NUMA 3ZVBA 4B71A 4WH6A 1GBDA 1ELAA 1O2LA 3AW1A 5JBAS 1HLTH 3QTVH 4GLYA 2ZFFH 3BTQE 2YOLA 1Y59T 1HB0B 3R0FA 2FPZA 2GVFA 1T32A 4K1EA 2SGQE 2NU3E 3RXOA 1SBWA 1JXPA 4MPVA 1UMAH 1AQ7A 3F68H 1A1RA 1TGNA 1HBTH 2STBE 3HK6B 1LHCH 2ODYB 2BQ6B 2JH0D 1MTSA 1PPFE 2R0KA 2C8YB 1EX3A 1SB1H 3AAVA 3PLKA 3S9BA 1BQYA 3M5OA 3ZZAA 1ESTA 5DK1A 1VITH 1V2LT 1O2IA 4ZMAH 4X0WU 4UONA 1PPEE 2Z9IA 2ANYA 2ANWA 3ODFA 2XC0A 1O0DH 2OUAA 5EQSA 1ZHPA 3RDZA 6GCHG 2FODA 3IWMA 1KXAA 2M5TA 1Z71A 1S83A 1KIGH 1W0ZU 3KGPA 3CP7A 2PV9B 2XCNA 1AZ8A 2GP9B 1THSH 3EQ0H 1ZGVA 1X7AC 1N6XA 3TPIZ 1YF4A 3D65E 3SV8A 2WPMS 3K2UA 1Z6JH 1CSOE 4U01A 3QDZB 1BT7A 5FPTA 4F49A 4IBLH 3KNXA 4NIXA 2A31A 2D2DA 3LGTA 3MU5A 4NSVA 4FXGH 1TWXB 1HJ9A 3BTKE 1G37A 1DX5M 1CHOG 2A5IA 1JIMA 5CHAB 1LKBA 3RXTA 3S7KB 4XFQA 1ZPBA 4U30A 3UY9A 4NCYA 4DGJA 4AFQA 2ZDKA 2WPJS 3F9GA 2BDIA 1GBCA 2UUYA 8GCHG 3DFJA 1MCVA 1O3JA 3I29A 2PKAB 2BX4A 4FU8A 1FI8A 1IQHA 3GICB 4GSOA 4A1XA 1O3BA 2VVUA 1BMNH 1MD8A 1E34B 4I8KA 1GWAA 4OS4A 1WQSA 1XUJA 5I46H 1BTHH 1W14U 4ZROA 5A0BA 1V2OT 4TPIZ 1FZZA 2BM2A 1BB0B 2J38A 1AUTC 3STJA 2XC4A 1HXEH 1C5RA 4KGAA 3BTHE 1OP2A 1V2WT 1XVOA 2GTBA 3P92A 1C2KA 1RJXB 1KXFA 1O2PA 1Y3WA 1QJ6B 2A7JA 2ALPA 1C2HA 1IQMA 2G55A 3NWUA 4OGYA 2QF3A 1CU1A 1K1IA 2H9HA 1FMGA 2OC0A 5EPYA 4B73A 1AO5A 1EPTA 3MYWA 1K22H 4MPXA 3P8OA 5C1XA 1EJMA 3SUEA 1PPGE 2H9EH 3BEFB 5EQQA 1SLVB 1F0RA 1GHBF 1Z8IB 1DUEA 1EZUC 1C1MA 1FAXA 3URDA 1EUFA 3TH2H 4ZXXH 1YM0A 4HZHA 1P2MA 3H5CB 2UWPA 3S69A 2NU1E 1J15A 5J4QA 2R2MB 1CGIE 1FN8A 1SGRE 2EEKA 4AYVB 1UTNA 1TBZH 2Z9LA 1C5PA 5JB9S 4NG9H 5C2ZA 1E35B 1LPKB 2GCHF 1KY9A 1HXFH 1LQDB 1QL7A 3M5MA 5DGJA 3LIWA 2VH6A 2PTCE 3MO9A 2HNTE 3SORA 1ABJH 1GL1A 2A7CA 1O3FA 3PMHB 2OCVB 4ZXYH 1EZSC 3FP8E 4CRGA 4FU9A 5TCAA 2WPKS 3D49H 1T4VH 4FUJA 3UUZA 1O3DA 2VJ1A 4WMFA 4YOJA 5LPFA 3A8CA 1C4V2 1WYKA 1FXYA 1SHHB 2QCYA 1P10A 1QBOA 2TIOA 3KQCA 1QTFA 2SGEE 3LGIA 1FONA 4XSKU 1XUIA 3RMOH 1YCPM 4ISHH 4IW4E 4THNH 3RXAA 3E16B 3GY4A 1AFQB 1B7XB 1W3CA 2WV5A 1ELFA 1GJDB 1S84A 2WYGA 5A8YA 1AKSB 1BTXA 1TNIA 1GDNA 4IGDA 3E3TA 4IMQA 1PPZA 4CREA 2EI6A 1UCYH 1CBWB 1ZPCA 3L3TA 4MNXA 1K1MA 2JETC 2VU8E 4O3TA 1MUEB 2ZA5A 1KYNA 1D3TB 1ZSLA 4CRAA 1F0SA 3RMLH 1N8OC 2BB4A 2G8TA 1NY22 1JRTA 2BD3A 3NCLA 1ZJDA 2W7UA 5LPEA 2VIOA 3NPSA 2VVCA 5IYTA 1EJNA 1NC6A 1PYTD 3SGBE 2WYJA 2SGAA 3P8NA 1TLDA 2QGRA 2AH4X 1O2OA 4B74A 4FUCA 3M3VA 1GBBA 2STAE 3QGJA 3E0NB 1K1JA 1ZYOA 3A84A 2R3YA 1EPTB 1TQ7B 3M3TA 1ZGIA 1GDQA 4D9RA 1NN6A 3RC6A 2DE8A 5HM9A 4AB8A 2GZ9A 4ZUHA 1FAKH 4UEHH 1KXDA 1EP5A 2F83A 3MFJA 1QNJA 1JBUH 1P06A 2A45B 1TPSA 2NU2E 1IHSH 3VXFH 1SGCA 5EXMA 2BY7X 1TRYA 2XBYA 4K1TA 2ZHDA 4BANB 1MAXA 3GY6A 4NIVA 3MO6A 2GZ7A 4ISIH 1P03A 1C2FA 5H4IB 5J4SA 2THFB 2ZHEH 1HIAA 3SUFA 4MTBA 1P3EA 5JYIA 1FIZA 4I8HA 2F3CE 1O3OA 4Y76A 1F0TA 3ZV9A 1ESBA 1A5GH 1TOMH 1QL9A 3ATIA 3K6YA 2ILNA 2GT8A 1VZQH 1GBTA 2BMGB 3LH1A 4OS5A 3SHAH 2FOCA 1C5NH 1V2JT 2BVXH 1Y5BT 1XMNB 1QL8A 2CHAC 2GKVE 2XBWA 1HAXB 1XX9A 2HPQH 5EU8A 4DW2U 2Y5HA 4Y0YE 1YPKH 3P8GA 5BPEA 2GMTC 2ZGCA 2ZPQA 2FOBA 1TPOA 1TNKA 3URCA 1LHGH 1G32B 8ESTE 3MHWU 4B2CA 2PUQH 2AYWA 1EQ9A 1AE8H 3BEIB 4GAWA 4XBCA 1D3QB 1S6HA 1MTNC 1XUHA 3GCOA 3QUMP 5AFZH 3V3MA 3ZZ7A 2ESTE 1T4UH 1C1QA 1Y5UT 2RCEA 2P94A 5EXLA 1DANH 4HI3A 1XUFA 3ATKA 1SGTA 5C5NA 3MO3A 1F5KU 4X8SH 3OU0A 1ANBA 4JCNA 9ESTA 3U9AH 4AYYB 4H6TA 2FTLE 3LGUA 2VH0A 2ZP0H 2P8OB 1WSSH 3MNXA 2XXLA 3TIUA 2XCFA 1GG6C 1OWJA 3IITA 4NA7A 2XRCA 3HKIB 3SV2H 4I8JA 1P2NA 1SGIB 1DSTA 1SHYA 3SO3A 3RLWH 1GJ8B 3M61U 2PW8H 2QXHA 2BY8X 1MTUA 2RA0A 1V2TT 3A7XA 4ABIA 3TGKE 1O38A 2ZO3H 3M3SA 4CRBA 4CHAC 2Z3EA 1WQVH 4ZAEA 2B5TB 2OLGA 3F6UH 4JZEH 4LZ1H 1INCA 1AUJA 1SSXA 3OX7U 1LMWB 5SGAE 1SGEE 2NU4E 1TX7A 2BX3A 2OBQA 1UHBB 2Y5GA 1XKAC 5T6FA 2AMDA 1V2KT 2A2XH 2BDBA 3RXHA 1AMHA 4NFEA 2PLXA 1CT0E 1QB6A 2VVVA 1O35A 1LTOA 4X6NA 3MU4A 3C1KA 5ESBA 2WPHS 1EB1H 1V2QT 3A88A 4ABBA 1GJAB 1NRSH 1TALA 1E0FD 4A5TS 1P8VC 4YT6H 2XTTB 3I77A 1FIWA 3EA8A 1ZHMA 1MKWK 1MD7A 4Y11E 2QXJA 2HOBA 2VIDA 4TWWA 3SZNA 1GI7B 3DT0H 4X6OA 3HK3B 1C1OA 1BOQA 2ZDNA 2C8WB 3GCNA 3NXPA 1O3PB 2AGEX 2GCTB 4KTCA 1TNLA 1MU8B 1CA0C 3OYPA 1QCPA 2PTNA 4QT8C 1GHZA 1B5GH 2PKSC 1S0QA 3BSQA 3ODDA 3M5NA 4BAKB 3ESTA 4JZDH 4J2YB 3GY2A 4M7GA 4RKOB 1P9SA 4RN6A 2WINI 5DJ7A 1MAYA 5DG6A 1ZTLA 1V2UT 2Q6GA 3SGAE 5HGGA 1ZTJA 5EPNA 1HUTH 2FDAA 2ZCKP 3A89A 5C1UA 4GHTA 3ZYEA 4D76A 4IC5A 1TRNA 1ETTH 3T25A 1C5MD 1GBHA 2BD5A 4DY7B 1P04A 1BZXE 2P95A 1QJ1B 2V3OH 1LCYA 1GJ6A 2BZAA 1A7SA 2O8UA 2UUJB 3LC3A 4YOIA 1EZXC 1N8OB 4ZKSU 1JOUB 1C1SA 3RU4E 1C1PA 2AERH 1S6FA 3A8DA 2P3FH 4IN2A 1ELGA 4Q7ZA 1GJ5H 1MBQA 1EOJA 2EI7A 1DSUA 1AU8A 1D9IA 1EAXA 1TX8A 2Z94A 3UR9A 2SGFE 1RIWC 2VWOA 1MQ6A 1O31A 4MNWA 1S85A 4WMEA 2IOTA 4AB9A 1O5AB 1ZSJA 4ABAA 3M7QA 1IQLA 3LC5A 1KLTA 1ANDA 2WPLS 5GPIB 1QRXA 4NIWA 2J34A 4UFEH 2ZEBA 3SU1A 3ZZ5A 1ZR0A 2ZU1A 2QY0B 2FOAA 1TRMA 2B8OH 1QGFA 1MKXK 2BLQA 3VPKA 1HAIH 1W10U 3BG8A 2VB0A 5FXLA 2V6NA 2FOGA 5HXFA 1Y3VA 1C9TA 2J95A 5GIBA 1P57B 2AMQA 3EGKH 1HJ8A 3TNTA 2FM2A 4R8TB 3GY7A 1HAHH 1PJPA 2BDGA 1NPMA 4UE7H 4AG2A 3SU3A 3G01A 1BMMH 1WV7H 3FANA 4UDWH 5A8ZA 3Q00A 4NA8A 1C2JA 3RXPA 4IC6A 3P70B 2ZTYA 2BDCA 1UCYE 2G4UA 4AGJA 4NSYA 5AFYH 1C5UA 3SU5A 3GDSA 1ZMLA 1ZPZA 4Z0KA 1G3EA 3UNRA 4TY7A 2OP9A 2A2QH 5L6NH 2BOHB 4FUIA 2SNWA 4X1RU 1UVOA 1VGCB 3T26A 2CHAB 2H9TH 3BIVH 1UVSH 1BRUP 2RDLA 1H8IH 2P3UB 1HCGA 1PYTC 3MOCA 2BD8A 4ABFA 3ZZ3A 1YLCA 1DDJA 5TJXA 4AZ2B 3EAJA 4Y79A 1THPB 1IOEA 1GL0E 1ZMNA 2AIPA 1A5HA 2FIRH 3VB4A 1EB2A 1LHDH 1BBRE 4I32A 1T8MA 2A5KA 4OS7A 5A2MH 1MH0A 4WY3A 4NGAH 1BRBE 4YESB 3VEQB 2O8TA 1L4ZA 3WY8A 4O3UA 3ZVAA 1TAWA 4GUXA 4F4OC 1B0FA 2ZG0H 4CBOA 1HAOH 2ZDVH 3ZZ6A 1C5ZB 1GI9B 3SW2B 1O2SA 1V2RT 1Z7KA 1RFNA 2D1JA 2R0LA 1KLJH 1OKXA 4I7YH 1IQGA 3PROA 3PTNA 1GG6B 1KXCA 1FPHH 1S0RA 4OS2A 3O8RA 1ZMJA 2FESH 3SU0A 1K21H 2Y6TA 3SI4H 7LPRA 4FUGA 1UVUH 4MDSA 3KCGH 4MPWA 1SVPA 5EW1H 1V2MT 3S7HB 1O32A 1YYY1 1ZRBA 2XWBI 2Z3CA 4CHAB 1FY5A 1PPCE 1C1WH 2LPRA 1IQKA 2P16A 1ACBE 2ZECA 3AAUA 1TGBA 4A7IB 2KAIA 2R2WU 1F7ZA 1GJCB 2DUCA 3UNQA 3FZDA 1MZAA 1TABE 2J92A 3V0XA 3NK8A 2ZQ2A 4CR5A 3TGIE 3PYHA 3S9CA 3RM0H 4TYDA 2HWLB 5A0CA 1GVLA 1O2VA 4X2VA 4JMYA 4WJG2 1VCPA 1NO9H 3MTYA 1P2IA 4GCHF 1YPHE 1S81A 1O2TA 3HPTB 1GBKA 3ZZ9A 1DY9A 1P3CA 3C27B 1ZRKA 5GDSH 1L1JA 4Y8YA 3DA9B 1T7CA 1DWCH 2BYAX 4BNRA 1ELTA 4Y8XA 4ISOA 1P2QA 1GBLA 3DHKH 1UVPA 4IMZA 3O8DA 3BG4B 1GCTC 1XM1A 2V35A 1BJUA 5DP9A 4MPUA 3KHVA 3A8AA 3KF2A 4X2WA 2PKSB 6ESTA 4Y0ZE 3T2NA 3K6ZA 1ZTKA 3RXGA 1YP9A 2ZCLP 3VB6A 3GY5A 1L4DA 2G5VA 4OGXA 1EZQA 4E05H 1P2JA 4YLUA 1O30A 1TYNA 3SJIA 5LGOA 4MLFB 1G2LA 3BTEE 3VB7A 1TOCB 1SOZA 2CN0H 5GJ4B 4H4FA 1V2ST 3KL6A 4K8YA 2VIPA 3O8CA 3UOPA 1QA0A 2PGBB 1GBEA 1UTMA 3I78A 2JH5D 2FS9A 2BQ7B 7GCHF 4TPYA 2HRVA 1HNEE 1NROH 2TGTA 3ELAH 1FV9A 1AB9C 2ASUB 3BV9B 4DURA 1H9HE 3FP7E 2ZIQH 1Y3XA 3BTME 1OSSA 4FVBA 4WMDA 2A7HA 2V3HH 3UQVA 1ZLRA 2LNCA 1K1NA 1DICA 2OC7A 3T28A 1C5QA 3RXRA 1XVMA 3K65B 1HYLA 1AHTH 4JZIA 5T6DA 6CHAC 3MNCA 5AVDA 1RIWB 1UO6A 4KP0A 3TJOA 3B9FH 3MU1A 1O2MA 1Z1IA 2G4TA 4ESTE 1HAVA 1K1PA 3RC4A 1ESAA 4WH8A 4AFZA 1GI4A 1QY6A 4DT7B 1P01A 5HM2A 1TNJA 1NRQH 2PUXB 4X2YA 1RD3B 1KTTB 2O9QA 2Z9JA 2VGCC 2VWMA 2ZGXH 3BTGE 1WAYB 4YO9A 4NA9H 2QYIA 1GPZA 1A2CH 2FOFA 4INLA 1OWEA 4X1PU 1C5YB 1C2LA 1E36B 1T31A 1OPHB 1DY8A 1LKAA 2GT7A 4UFGH 3PO1C 1RTLA 3UWIA 2BTCE 5A8XA 1SPJA 4ZHAA 3E90B 3SU2A 1PQ7A 4NWLA 1IQNA 1VCQA 3QX5H 5DP5A 4MQAA 1AN1E 4A1VA 1Z8JB 4K69A 1RS0A 1C1NA 1UTQA 3A7YA 1MQ5A 1XUKA 4IN1A 1K1LA 3GDVA 1YPGH 3E0PB 2SGDE 1A0LA 1CHGA 1DPOA 2CF9H 1ZJKA 1RRKA 1O2ZA 1SOTA 3BTWE 1A5IA 2ZGBH 1EJAA 2Q6DA 3R3GB 2ZU5A 2Y7ZA 4AORA 2QF0A 1T8NA 4X8TH 3M7TA 4JK5A 3RC5A 4KELA 3RXBA 1O5DH 1LPZB 1O2UA 2ULLA 1QJ7B 3TNSA 3H7TA 2A4QA 4AN7A 1FUJA 1GHBG 2A4RA 2OINA 1GCDA 1J14A 4U2WA 4Q7XA 3VGCC 2OQUA 3ZVEA 4BAHB 3H7OA 4B76A 1G9IE 1TNGA 1SC8U 4Y71A 2EC9H 2FYQA 1GI0A 4INKA 3TVJB 1HRTH 2Q6FA 1CO7E 4NZQA 2GCHG 5L2YH 1N6YA 2D8WA 3HATH 1UCYK 1QRWA 3CS0A 3SQHE 3P8FA 3PMBB 3QN7A 1CT2E 5ETXA 3ZYDA 3SBKA 2IPHA 1SI5H 1CGHA 1WOFA 1NU9A 1A46H 2ZF0H 2FS8A 1GI8B 1S82A 1TBQH 2AMPA 3UIRA 4AG1A 3A85A 3UQOA 3OSYA 5FBEA 4JZFH 5EQRA 2PGQB 3RXUA 4K2YA 5FAHA 4CH8B 2P59A 3Q76A 1K9OE 3PMAB 1O2RA 1DOJA 2K1QA 1AVWA 1O37A 2GDDA 4K1SA 1BTPA 2IJOB 4FU7A 2BHGA 1CGJE 1O3IA 2J94A 2VNTA 2XWAA 1H1BA 2YNBA 3LJOA 3RU4T 1BBRK 5DP3A 1Z1JA 2GDEH 2OXSA 2CMYA 1YCPK 1GI5A 3AVZA 2SFAA 2ZHFH 3TH3H 3TK5A 1FY3A 1D3PB 3A82A 4CH2B 2ZU3A 4DIHH 2Y5FA 3MH7A 1Y3UA 2AEIH 1LVMA 1WU1A 1AIXH 1W7GH 1O3KA 1GMDF 3P17H 3OY6U 1DITH 2ZFSA 1GCTB 4I8LA 2A0QB 1FY8E 4IS5A 1GBFA 1AGJA 3KIDU 1UTJA 4Y10E 5E0HA 4CRCA 3M36A 1O2NA 4XE4A 2C8ZB 1SGDE 2OC8A 1BIOA 1ZSKA 2CXVA 4J1YA 5PTPA 4ABHA 1GHVH 1QR3E 5DO4H 2PFEA 1V6DA 2AS9A 4FUDA 3RXIA 1O5GH 1L0ZA 1H4WA 3B8JA 3SU4A 3MH6A 1NFWA 4DVAU 3BEUA 1O34A 3MNSA 3A80A 1XUGA 2CF8H 4ZH8A 5C20A 1HIAB 2GX4A 4XOJA 2H6MA 1UTOA 5DPAA 2ZWLH 3VB3A 4WXVA 2J2UA 1HJAC 4I8GA 1NTPA 3SJ9A 1O2WA 3E1XB 3SJKA 4DIIH 1AB9B 2ZGJA 2ZPSA 4MG3A 2BVRH 1A0JA 3GISB 1ETSH 5JB8S 2HNTF 2R3UA 3T5FH 1GBAA 1Y8TA 4YM9A 3AASA 1BMAA 3DD2H 1TGSZ 1W8BH 3F9FA 1HAZB 5EXNA 1DT2A 3RXLA 1P05A 2J9NA 1D6WA 2DE9A 3RM2H 2FOMB 1OP0A 1JIRA
chains in the Genus database with same CATH superfamily
1O5CB 4MNVA 2PSYA 3FO8D 1DXPA 1LQEA 1O36A 2GGVB 3KQDA 1DVAH 3QZQA 1DWEH 1SQOA 3ATWA 1SGFG 3AW0A 4I33A 1D6RA 1PQ5A 4WXIA 2F9UA 2A32A 2ZC9H 1P2OA 1GMCF 1KXEA 1QB1A 5DP6A 1GI6A 3ATLA 3A86A 1MCTA 1NFYA 3EDXB 2A5AA 3SV6A 2ZTZA 4KTUA 1NFXA 2JETB 4HGCA 1AWFH 5EGMA 2K8IA 2PHBA 1F0UA 1ELCA 3RP2A 1O3AA 3D62A 5JBTA 4B6FA 3MI4A 2Y82A 1GI2A 4K3JA 3F2HA 6GCHF 2JIZD 1AVGH 1JMOH 1O2GH 5F53A 4XBBA 2G52A 5F03A 1TA6A 4D9QA 1Q2WA 3SV9A 1WTHD 2G51A 4UD9H 5C67A 3SOSA 4AX9H 4Q4LA 3RXSA 1E1QD 2ODPA 1GJ7B 2C8XB 1MBMA 3P95A 4D7FA 2G5NA 1ARCA 1EASA 1AD8H 2RA3A 1TIOA 2F91A 1RTFB 6LPRA 2RG3A 1TNHA 3N7OA 1ARBA 3F9HA 4X6PA 2TRMA 3QTOH 3KQ5A 2H1UA 4H42U 1CHOF 2CJIA 8LPRA 7ESTE 4YLQH 2ZFRH 2IN2A 1P2KA 4CRDA 1RTKA 1XXDA 3F0OA 5KECA 5JDUB 2BZ6H 4SGBE 3QK1A 3OE7D 1H8HD 4BAMB 3UTUH 4GHQA 2A4OA 1GDUA 3DSPA 3KEEA 1Q3XA 3TK6A 1V2VT 3T29A 1LHFH 4D8NA 2EI8A 3LGYA 1WTGH 3ZZ4A 4TWYA 1TPAE 1GVKB 4FUBA 2R9PA 3MNBA 3LPRA 1CBWC 4BXWA 2PKAA 3U8RH 1YBWA 4H6SB 1UTPA 1BTYA 2FP7B 1P12E 2QAAA 3ZZBA 2TBSA 1EAUA 5E0GA 4E06H 1Y3YA 2QN5T 3HKJB 1NT1A 3U8TH 1Z6EA 1YPMH 8KME2 3TJVA 1GGDC 3U98H 3SGQE 2CK3D 5I25A 1DLEA 2XW9A 1MABB 1S5SA 2GMTB 1BRAA 1PPBH 2P93A 3BF6H 3FZZA 1O5FH 1C5LH 1E37B 4KKDA 2FMJA 1ELBA 1MTNB 3FN8A 5E2OA 4X8VH 1EPTC 3LKWA 1O3MA 4WVPE 1GJ9B 3LONA 2BDAA 1OHHD 3GY3A 3OTPA 2HLCA 3A81A 4VGCC 3W95A 1SFQB 1ZOMA 3UPEA 1M9UA 2JH6D 3KQEA 3MWIU 1ORFA 4OS1A 1SGNE 2KCOA 2HALA 3LU9B 2NWNA 4FUFA 1OWHA 3TLOA 1SLUB 2G00A 3FFGA 3CS7A 3GYLB 1GMCG 2NU0E 2QXGA 2M2AA 1Z8RA 1C1VH 3KYGA 5F6MA 2HVXA 1NFUA 1C5TA 2BDYA 2F9OA 4UFDH 4Z6AH 1YKTA 3SQEE 4ZKOU 1VITF 4RSPA 2Z6BD 1OYQA 2BQWB 1BJVA 2UWLA 1PFXC 3Q77A 3JZ2B 3RU4D 3SJOA 3UREA 1C2GA 4ISLA 2KR7A 3Q3YA 1A4WH 3OTJE 3UOUA 2BY5X 1BTZA 2BXUH 1O3NA 1FLEE 1W12U 1FPCH 1Q31A 3RMMH 3UR6A 1C5WB 4O9VA 3VFEA 1YPLH 2F9BH 4FUHA 1NBME 1GJBB 1L2EA 3STIA 3PLPA 3TITA 2HNTC 4BOHA 1J17T 3QLPH 4FUEA 1ABIH 3F2GA 3M5LA 1QA7A 1GJ4H 1FNIA 2HGTH 4BTUB 2D26C 1YLDA 2QF5A 3KYFA 3NZIA 1QBVH 2FTMA 2P3TB 1UTLM 1UJ1A 1RXPA 4YTAA 3E6PH 4ABGA 3RXKA 1O2JA 1SGFA 4XBDA 5C5OA 5AHGH 4WWYA 5ABWA 2ZDMA 1WBGB 2ZHQH 2UWOA 2WPIS 3KQBA 1SLXB 4MNYA 1HJAB 4JYVH 1GHXH 2XBVA 1V2NT 5T3HA 1TGCA 1DWDH 1W11U 4AC9A 1OXGA 5JBCS 3A87A 1AKSA 2W7SA 1F92A 2F9VA 2H2ZA 4LXBH 2OQ5A 1SR5C 1G3CA 3OFND 2JJ2D 3RXQA 5K7RA 4Q7YA 1FY4A 3LOXA 2P8OC 1SFIA 2VWNA 3MMGA 2UUKB 5IDKA 5FL7D 1CA0B 3U28C 1WDIA 3M35A 3T27A 1QB9A 5FCKA 1W13U 1DWBH 3Q3KA 4GVUA 4AFSA 3TH4H 1O5EH 3SNBA 1QHRB 2B7DH 1QURH 2Z3DA 1K1OA 5HYOA 1AZZA 1KXBA 1BITA 3RUOA 2O8LA 3PWBA 3GY8A 3ZZDA 3SHCH 4I31A 1D3DB 4A1TA 1AVXA 3L33A 4UFFH 4KTSA 1AE5A 4O03A 5L30H 2VIVA 4TY6A 4YZUA 2FLRH 1GBMA 3TGJE 3PWCA 2GV7A 4B75A 1SGPE 1VJAU 3GYMA 4NFFA 1QQ4A 1O2HA 3N7EA 2WUCA 1NRPH 5FPYA 3RXJA 4ZKRU 3BTTE 1FDPA 3F1SB 2BD9A 3SNDA 3UB0A 4X1QU 2KFWA 2GV6A 1Z8GA 2OD3B 4LOYH 4Y7AA 1F5LA 4B2AA 2YMSC 1SGQE 2ZCHP 5JBBS 1QBNA 3B23B 2ZU2A 3UFAA 1GI1A 1G3DA 2O8MA 3TJUA 1J8AA 3RXFA 1DXWA 2KX4A 5GWZA 3T62A 4A6LA 5G4BA 3U1IB 2C93B 5CMXH 1VITG 1P9UA 3MH4A 1OWDA 1IQEA 4CR9A 1EAIA 2TPIZ 2KAIB 3S0NA 5FBIA 2AFQB 1WUNH 2ODQA 2Q1JA 4E7NA 1QRZA 3OY5U 5E0JA 1IQJA 2W3KA 1CT4E 2B9LA 3ZV8A 2ANKH 2FOEA 4A92A 2GCTC 1OS8A 3Q3XA 3QGNB 2O8WA 1UK3A 3ATMA 3RXVA 3V12A 2OC1A 2FYRA 1UK2A 2VIWA 2HPPH 1TQ0B 5EG4A 1NESE 2A1DB 5DP4A 1O2QA 1OWIA 2AGGX 2GD4B 4MVNA 2F9PA 3E8LA 1SLWB 5GCHF 1TA2A 3SUGA 2FX6A 5T6GA 3W94A 2BY9X 1FJSA 2KCYA 1NRRH 3BIUH 1DLKB 1P0SH 4Y7BA 2XNIA 3GDUA 3HGNA 4GCHG 3ITIA 2SGPE 1SQAA 2QXIA 4Y6DA 1AI8H 1P02A 3A7VA 1KLIH 1SGYE 4ASHA 5E8EH 3U1JB 1EXFA 5C3NA 1YPJH 4K5ZA 1O33A 1ETRH 1C1TA 1D4PB 3MU8A 2ALVA 1C2EA 2PR3A 1DFPA 2I6SA 1C4Y2 2FOHA 5DKMA 1GGDB 2KM0A 1ANEA 1VCWA 1U6QA 1FY1A 1GMHF 4SGAE 1AWHB 5KGOA 1UK4A 1A3BH 2WV9A 2FZZA 1C5OH 3IG6B 2GZ8A 1BBRH 2ZTXA 1O5BB 1MU6B 1AY6H 1NRNH 1BDAA 1EFRD 3SI3H 5GXPA 1TPPA 2KCPA 5B6OA 1YCPH 1B0EA 1F2SE 1G30B 2AIQA 2Y7XA 5E2PA 4OS6A 4VGCB 3ZVDA 5FHTA 1IQFA 4RT1A 1A3EH 4Q80A 2V0BA 2F9NA 4BAOB 1HV7A 1UHBA 1C2MA 2A4GA 2W5EA 2XC5A 1DS2E 1EAWA 1MTVA 1PPHE 5C17A 1VR1H 3ZVCA 1HAPH 4B2BA 7GCHG 1J9CH 1EP6A 3BTFE 3FP6E 2ZFPH 1JWTA 2FI5E 1KDQA 3BN9A 1EATA 3O8BA 4ISNA 1KSNA 3TJNA 3ZVFA 3SNCA 4LZ4B 1BTWA 1Y5AT 1HAVB 3WWFA 1JRSA 2WUBA 2PSXA 1BA8B 1BRCE 3GCHC 4ZHMU 4AOQA 1LDTT 3LDXH 3S9AA 3RLYH 4PROA 5EOKA 2CGAA 4R0IA 4U32A 1PQ8A 4RKJB 1T8OA 2Z9GA 1C2IA 4JYTA 2FI4E 2BD4A 3RXDA 3P6ZB 1VGCC 2ZNKH 4BAQB 1NM6A 1YGCH 4ABJA 1J16A 2C90B 2EQNA 2XYAA 3ZIAD 1GHAF 1ANCA 3E91A 1C1UH 2JDID 3M37A 1AFEH 1GVZA 3LGWA 3SUDA 5F8TA 1XXFA 2QA9E 1O2XA 1QZ8A 1MKWH 3PV4A 1C1RA 2EY4C 1DE7H 5GCHG 4BTIB 4ACAA 4AFUA 1C5SA 1LVBA 5LPRA 2VIQA 1P09A 3K9XB 1GBIA 4D7GA 5AF9H 7KMEH 1O39A 1C5XB 2BD7A 1TONA 2BDHA 4Y8ZA 3GCTF 1LHEH 4BTTB 2BXTH 3TU7H 5A09A 1ELDE 1H9LB 5DP7A 1GHWH 1MTWA 4Q2KA 1O3EA 1OWKA 2FLBH 1E1RD 2K0QA 2BOKA 2FI3E 2TGPZ 3RXCA 1TFXA 3LT3A 2VINA 2ZGHA 3EYDA 4NWKA 5F8XA 3UWJH 1PQAA 4DOQA 2SNVA 1KTSB 2QC2A 2UUFB 2PP6A 4ABEA 4NZLA 4B6EA 1THRH 4JZ1A 4HTCH 1UVTH 2G81E 1BTUA 1QFKH 1QQUA 1O3GA 1GMHG 2BLOA 1BMLA 3ZZCA 1C9PA 1H8DH 4YOGA 2TGAA 1K2I1 2ANMH 1F5RA 2FWWA 3GS9A 5CHAC 1ELEE 2IJD1 2Y80A 5F8ZA 4ZKNU 3ZVGA 2CV3A 3SV7A 1G2MA 3RXMA 5FPSA 3ENSB 2ZFQH 1CA8B 3HGPA 3CENA 1LO6A 4LK4A 1TBRH 1C5VA 1T8LA 1IHTH 1LPGB 3NKKA 1DUAA 1G3BA 1GI3A 1A0HB 3MH5A 4ABDA 5EIYA 1E79D 1FQ3A 1P11E 1G36A 4X8UH 1KDQB 2YMSB 3SNAA 4CBNA 3PLBA 3PMJA 3A7ZA 4X6MA 1WCZA 1IQIA 3VB5A 4JK6A 4X2XA 5DN6D 2BLVA 3SN8A 3V13A 2ZI2H 3SU6A 1CE5A 6CHAB 3LGVA 2J4IA 1TX6A 1UTKA 3EA7A 1BHXB 5ESTE 1W7XH 3BG4C 1C2DA 1HAYB 1XKBC 2Y81A 5FX6A 5FX5A 4CRFA 5DP8A 3UNSA 2BVSH 4FVDA 5C1YA 2FX4A 1MKXH 5EJLA 3EE0B 2VGCB 4K60A 2JKHA 1CQQA 1L1GA 5TCCA 3FKSD 1MMJN 2QIQA 3RXEA 3WWBA 3EA9A 1O3LA 3PTBA 3U8OH 2PWXA 3QZRA 1MZDA 2Z7FE 2QV1A 2OTVA 1NZQH 1O2KA 2FXRA 4DCDA 3PO1B 5C0UA 1V3XA 1W2KH 4X1SU 2VWLA 2WHXA 3SYJA 5HMAA 1FN6A 5LH8A 1GHAG 5EW2H 1DM4B 1HAGE 5L2ZH 1A61H 1TE0A 1NS3A 1ELVA 2BD2A 1BCUH 2W26A 1GBJA 1TMUH 5FCRA 1ZHRA 1TGTA 1O3CA 3SJ8A 2ZDLA 2XBXA 1GHYH 3L6PA 4WF8A 3DUXH 4DG4A 1QIXB 3F9EA 1BUIA 3A8BA 3PB1E 1ID5H 3QO6A 1YC0A 5K0HA 2C4FH 1OP8A 4B1TA 3FAOA 3U69H 1GMDG 4JYUH 3GCTG 1YPEH 3D23A 2AGIX 2FO9A 1SL3A 4INHA 1L1NA 2ZPRA 2BLWA 1OYTH 5A0AE 1ZZZA 1IAUA 1W0YH 4E7RG 3KN2A 1E38B 2ZHWH 4HFPB 2W3IA 3JZ1B 1RGQA 1TB6H 4DJZB 3MU0A 3LH3A 3VXEH 1HGTH 4YT7H 3RMNH 3A83A 1HPGA 2H5DA 3FVFB 2WPDD 1CVWH 2ZZUH 3LJJA 2ZQ1A 1C4U2 2ZDAH 2ZKSA 3A7TA 1SG8B 4K8BA 8GCHF 4X1NU 5BRRE 3TK9A 3M7UA 2FEQH 1O2YA 5JPMH 5EODA 3BTDE 2WV4A 5EJ1A 1AFQC 1HDTH 3VGCB 5CE1A 1SMFE 2Z9KA 1LVYA 1SQTA 2EA3A 3SNEA 9LPRA 2BY6X 4ZHLU 1K28D 3A7WA 1LVOA 4O97A 2TGDA 3ZZ8A 4XDEA 1O3HA 1H9IE 1YPHC 3PM3A 2C3SA 1OOKB 2ZFTA 1NU7B 1EOLA 1TMTH 1EKBB 3V7TA 2OBOA 2I6QA 1BHXF 2YNAA 1HFDA 1N1LA 1V2PT 2B0FA 1VJ9U 4AGKA 3DFLA 4GPGA 3GCHB 4BXSA 1OX1A 2H5CA 4NIYA 3QWCH 2ZU4A 1TMBH 3GOVB 3NUMA 3ZVBA 4B71A 4WH6A 1GBDA 1ELAA 4XD7D 1O2LA 3AW1A 5JBAS 1HLTH 3QTVH 4GLYA 2ZFFH 3BTQE 2YOLA 1Y59T 1HB0B 3R0FA 2FPZA 2GVFA 1T32A 4K1EA 2SGQE 2NU3E 3RXOA 1SBWA 1JXPA 3N99A 4MPVA 1UMAH 1AQ7A 4P02A 3F68H 1A1RA 1TGNA 1HBTH 2STBE 3HK6B 1LHCH 2VBCA 2ODYB 2BQ6B 2JH0D 1MTSA 1PPFE 2R0KA 2C8YB 1EX3A 1SB1H 3AAVA 3PLKA 3S9BA 1BQYA 3M5OA 3ZZAA 1ESTA 5DK1A 1VITH 1V2LT 1O2IA 4ZMAH 4X0WU 4UONA 1PPEE 1YLNA 2Z9IA 2ANYA 2ANWA 3ODFA 2XC0A 1O0DH 2OUAA 5EQSA 1ZHPA 3RDZA 6GCHG 2FODA 3IWMA 1KXAA 2M5TA 1Z71A 1S83A 1KIGH 1W0ZU 3KGPA 3CP7A 2PV9B 2XCNA 2W6JD 1AZ8A 2GP9B 1THSH 3EQ0H 1ZGVA 1X7AC 1N6XA 3TPIZ 1YF4A 3D65E 3SV8A 2WPMS 3OEHD 3K2UA 1Z6JH 1CSOE 3OEED 4U01A 3QDZB 1BT7A 5FPTA 4F49A 4IBLH 3KNXA 4NIXA 3VG8A 2A31A 2D2DA 3LGTA 3MU5A 4NSVA 4FXGH 1TWXB 1HJ9A 3BTKE 1G37A 1DX5M 1CHOG 2A5IA 1JIMA 5CHAB 1LKBA 3RXTA 3S7KB 4XFQA 1ZPBA 4U30A 3UY9A 4NCYA 4DGJA 4AFQA 2ZDKA 2WPJS 3F9GA 2BDIA 1GBCA 2UUYA 8GCHG 3DFJA 1MCVA 4F48B 1O3JA 3I29A 2PKAB 1COWD 2BX4A 5DSFA 3H09A 4FU8A 1FI8A 1IQHA 3GICB 4GSOA 4A1XA 1O3BA 2VVUA 1BMNH 1MD8A 1W0JD 1E34B 4I8KA 1GWAA 4OS4A 4I86A 2RFKC 1WQSA 1XUJA 5I46H 1BTHH 1W14U 4ZROA 5A0BA 1V2OT 2F43B 4TPIZ 1FZZA 2BM2A 1BB0B 2J38A 1AUTC 1VKYA 3STJA 2XC4A 1HXEH 1C5RA 4OM9A 4KGAA 3BTHE 1OP2A 1V2WT 1XVOA 2GTBA 3P92A 1C2KA 1RJXB 1KXFA 1O2PA 1Y3WA 1QJ6B 2A7JA 2ALPA 1C2HA 1IQMA 2G55A 3NWUA 4OGYA 2QF3A 1CU1A 1K1IA 2H9HA 1FMGA 2OC0A 5EPYA 4B73A 1AO5A 1EPTA 3MYWA 1K22H 4MPXA 3P8OA 5C1XA 1EJMA 2J97A 1PPGE 3SUEA 2H9EH 3BEFB 2LP6A 5EQQA 1SLVB 1F0RA 1GHBF 1Z8IB 5GNDA 1DUEA 1EZUC 1C1MA 1FAXA 3URDA 1EUFA 3TH2H 4ZXXH 1YM0A 4HZHA 1P2MA 3H5CB 2UWPA 3S69A 2NU1E 1J15A 5J4QA 4XRNA 2R2MB 1CGIE 5HIYA 1FN8A 1SGRE 2EEKA 4AYVB 1UTNA 1TBZH 2Z9LA 1YWUA 3F0PA 4ZCNA 3OAAD 1C5PA 5JB9S 4NG9H 5C2ZA 1E35B 1LPKB 2GCHF 1KY9A 1HXFH 1LQDB 1QL7A 3PV2A 3M5MA 5DGJA 3LIWA 2VH6A 2PTCE 3MO9A 2HNTE 3SORA 1ABJH 1GL1A 2A7CA 1O3FA 3PMHB 2OCVB 4ZXYH 1EZSC 4M9FA 3FP8E 4CRGA 4FU9A 5TCAA 2WPKS 3D49H 1T4VH 4FUJA 3UUZA 1O3DA 2VJ1A 4WMFA 4YOJA 5LPFA 3W1EA 3A8CA 1C4V2 1WYKA 3N7DA 1FXYA 1SHHB 2QCYA 1P10A 1QBOA 2TIOA 3KQCA 1QTFA 2SGEE 3LGIA 1FONA 4XSKU 1XUIA 3RMOH 1KMHB 1YCPM 4ISHH 5CHBA 4IW4E 2HLDD 4THNH 3RXAA 3E16B 3GY4A 1AFQB 1B7XB 1W3CA 2WV5A 1ELFA 1GJDB 1S84A 2WYGA 5A8YA 1AKSB 1BTXA 1TNIA 1GDNA 4IGDA 3E3TA 4IMQA 1PPZA 4CREA 2EI6A 1UCYH 1CBWB 1ZPCA 3L3TA 4MNXA 1K1MA 2JETC 2VU8E 4O3TA 1MUEB 2ZA5A 1KYNA 1D3TB 1ZSLA 4CRAA 1F0SA 3RMLH 2AHME 1N8OC 4TSFD 2BB4A 2G8TA 1NY22 1JRTA 2BD3A 3NCLA 1ZJDA 2W7UA 5LPEA 2VIOA 3NPSA 2VVCA 5IYTA 1EJNA 1NC6A 3F3BA 1PYTD 3SGBE 5T1VA 2WYJA 2SGAA 3P8NA 1TLDA 2QGRA 2AH4X 1O2OA 4B74A 4FUCA 3M3VA 1GBBA 2STAE 3QGJA 3E0NB 1K1JA 1ZYOA 3A84A 2R3YA 1EPTB 1TQ7B 3M3TA 1ZGIA 1GDQA 4D9RA 1NN6A 3RC6A 2DE8A 5HM9A 4AB8A 2GZ9A 4ZUHA 1FAKH 4UEHH 1KXDA 1EP5A 2F83A 3MFJA 1QNJA 1JBUH 5C0TA 1P06A 2A45B 1TPSA 2OK5A 2NU2E 1IHSH 3VXFH 1SGCA 5EXMA 2BY7X 1TRYA 2XBYA 4K1TA 2ZHDA 4BANB 1MAXA 3GY6A 4NIVA 3MO6A 2LELA 2GZ7A 4ISIH 1P03A 1C2FA 5H4IB 5J4SA 2THFB 2ZHEH 1HIAA 3SUFA 4MTBA 1P3EA 5JYIA 1FIZA 4I8HA 2F3CE 1O3OA 4Y76A 1F0TA 3ZV9A 1ESBA 1A5GH 1TOMH 1QL9A 3ATIA 3K6YA 2ILNA 2GT8A 1VZQH 1GBTA 2BMGB 3LH1A 4OS5A 3SHAH 2FOCA 1C5NH 1V2JT 2BVXH 1Y5BT 1XMNB 1QL8A 2CHAC 2GKVE 2XBWA 1HAXB 1XX9A 2HPQH 5EU8A 4DW2U 2Y5HA 4Y0YE 2KCAA 1YPKH 3PRBA 3P8GA 5BPEA 2GMTC 2ZGCA 2ZPQA 2FOBA 1TPOA 1TNKA 3URCA 1LHGH 1G32B 8ESTE 3MHWU 4B2CA 2PUQH 2AYWA 1EQ9A 1AE8H 3BEIB 4GAWA 4XBCA 1D3QB 1S6HA 1MTNC 1XUHA 3GCOA 3QUMP 5AFZH 3V3MA 3ZZ7A 2ESTE 1T4UH 1C1QA 1Y5UT 4FOUC 2RCEA 2P94A 5EXLA 1DANH 4HI3A 1XUFA 3ATKA 1SGTA 5C5NA 3MO3A 1F5KU 4X8SH 3OU0A 1ANBA 4JCNA 1SQRA 1YY3A 9ESTA 3U9AH 4AYYB 4H6TA 2FTLE 3LGUA 2VH0A 2ZP0H 2P8OB 1WSSH 3MNXA 2XXLA 3TIUA 2XCFA 1GG6C 1OWJA 3IITA 4NA7A 2XRCA 3HKIB 3SV2H 4I8JA 1P2NA 1SGIB 1DSTA 1SHYA 3SO3A 4RT0A 3RLWH 1GJ8B 3M61U 2PW8H 2QXHA 2BY8X 1MTUA 2RA0A 1V2TT 3A7XA 4ABIA 4FETA 4RI0A 1O38A 3TGKE 2ZO3H 3M3SA 4CRBA 4CHAC 2Z3EA 1WQVH 4ZAEA 2B5TB 2OLGA 3F6UH 4JZEH 4LZ1H 1INCA 1AUJA 1SSXA 3OX7U 1LMWB 5SGAE 1SGEE 2NU4E 1TX7A 2BX3A 2OBQA 1UHBB 2Y5GA 1XKAC 5T6FA 2AMDA 1V2KT 2A2XH 2BDBA 3RXHA 1AMHA 4NFEA 2J98A 2PLXA 1CT0E 1QB6A 2VVVA 1O35A 1LTOA 4X6NA 2JJ1D 3C1KA 3MU4A 2WPHS 5ESBA 1EB1H 1V2QT 3A88A 4ABBA 1GJAB 1NRSH 1TALA 5IK2D 1E0FD 4A5TS 1P8VC 4YT6H 2XTTB 3I77A 1FIWA 3EA8A 1ZHMA 1MKWK 1MD7A 4Y11E 2QXJA 2HOBA 2VIDA 4TWWA 3SZNA 1GI7B 3DT0H 4X6OA 3HK3B 1C1OA 1BOQA 2ZDNA 2C8WB 3GCNA 3NXPA 1O3PB 2AGEX 2GCTB 4KTCA 1TNLA 1MU8B 1CA0C 3OYPA 1QCPA 2PTNA 4QT8C 1GHZA 1B5GH 2PKSC 1S0QA 3BSQA 3ODDA 3M5NA 4BAKB 3ESTA 4JZDH 4J2YB 3GY2A 4M7GA 4RKOB 1P9SA 4RN6A 2WINI 1UW7A 5DJ7A 1MAYA 4TT3D 5DG6A 1ZTLA 1V2UT 2Q6GA 3SGAE 5HGGA 1ZTJA 5EPNA 4YXWD 1HUTH 2FDAA 2ZCKP 3A89A 5C1UA 4GHTA 2RDEA 3ZYEA 4D76A 4IC5A 1TRNA 1ETTH 3T25A 1C5MD 1GBHA 2BD5A 4DY7B 1P04A 1BZXE 2P95A 1QJ1B 2V3OH 1LCYA 1GJ6A 2BZAA 1A7SA 2O8UA 2UUJB 3LC3A 2IPQX 4YOIA 1EZXC 3F2FA 1N8OB 4ZKSU 1JOUB 1C1SA 3RU4E 1C1PA 2AERH 3DSGA 1S6FA 3A8DA 2P3FH 4IN2A 1ELGA 4Q7ZA 4DT4A 1GJ5H 1MBQA 1EOJA 2EI7A 1DSUA 1AU8A 1D9IA 1EAXA 1TX8A 2Z94A 3UR9A 2SGFE 1RIWC 2VWOA 1MQ6A 1O31A 4MNWA 1S85A 4HG6A 4WMEA 2IOTA 4AB9A 1O5AB 1ZSJA 4ABAA 3M7QA 1IQLA 3LC5A 1KLTA 1ANDA 2WPLS 5GPIB 1QRXA 2J98B 4NIWA 2J34A 4UFEH 2ZEBA 3SU1A 3ZZ5A 1ZR0A 2ZU1A 2QY0B 2FOAA 1TRMA 2B8OH 1QGFA 5CDFE 1MKXK 2BLQA 3VPKA 1HAIH 1W10U 3BG8A 2VB0A 5FXLA 2V6NA 2FOGA 5HXFA 1Y3VA 2KZ4A 1C9TA 2J95A 5GIBA 1P57B 2AMQA 3EGKH 1HJ8A 3TNTA 2FM2A 4R8TB 3GY7A 1HAHH 1PJPA 3CNRA 2BDGA 1NPMA 4UE7H 4AG2A 3SU3A 3G01A 1BMMH 1WV7H 3FANA 4UDWH 5A8ZA 3MQKC 3Q00A 4NA8A 4Q63A 1C2JA 3RXPA 4IC6A 3P70B 2ZTYA 2BDCA 1UCYE 2G4UA 4AGJA 4NSYA 5AFYH 1C5UA 3SU5A 3GDSA 1ZMLA 1ZPZA 4Z0KA 1G3EA 3UNRA 4TY7A 3NRLA 2OP9A 2A2QH 5L6NH 2BOHB 4FUIA 2SNWA 4X1RU 1UVOA 1VGCB 3T26A 2CHAB 2H9TH 3BIVH 1UVSH 1BRUP 2RDLA 1H8IH 2F4LA 2P3UB 1HCGA 1PYTC 3MOCA 2BD8A 4ABFA 3ZZ3A 1YLCA 1DDJA 5TJXA 4AZ2B 3EAJA 2HVYB 4Y79A 1THPB 1IOEA 1GL0E 1ZMNA 2AIPA 2QE7D 1A5HA 2FIRH 3VB4A 1EB2A 1LHDH 1BBRE 4I32A 1T8MA 2A5KA 4OS7A 5A2MH 2XOKD 1MH0A 4WY3A 4NGAH 1BRBE 4YESB 3VEQB 2O8TA 1L4ZA 3WY8A 4O3UA 3ZVAA 1TAWA 4GUXA 4F4OC 1B0FA 2ZG0H 4CBOA 1HAOH 2ZDVH 3ZZ6A 1C5ZB 1GI9B 3SW2B 1O2SA 1V2RT 1Z7KA 1RFNA 2D1JA 2R0LA 1KLJH 1OKXA 4I7YH 1IQGA 3PROA 3PTNA 1GG6B 1KXCA 1FPHH 1S0RA 4OS2A 3O8RA 1ZMJA 2FESH 3SU0A 1K21H 2Y6TA 3SI4H 7LPRA 4FUGA 1UVUH 4MDSA 3KCGH 4MPWA 1SVPA 5EW1H 1V2MT 3S7HB 1O32A 1YYY1 1ZRBA 2XWBI 2WSSD 2Z3CA 4CHAB 1FY5A 1PPCE 1C1WH 2LPRA 1IQKA 2P16A 1ACBE 2ZECA 3AAUA 1TGBA 4A7IB 2KAIA 2R2WU 1F7ZA 2J5UA 4F55A 1GJCB 2DUCA 3UNQA 3FZDA 1MZAA 1TABE 2J92A 3V0XA 3NK8A 2ZQ2A 4CR5A 3TGIE 3PYHA 3WW7A 3S9CA 3RM0H 4TYDA 2HWLB 5A0CA 1GVLA 1O2VA 4X2VA 4JMYA 4WJG2 1VCPA 1NO9H 3MTYA 1P2IA 4GCHF 1YPHE 1S81A 1O2TA 3HPTB 1GBKA 3ZZ9A 1DY9A 1P3CA 3C27B 1ZRKA 5GDSH 1L1JA 4P00A 4Y8YA 3DA9B 5B6LA 5HKKD 1T7CA 1DWCH 2BYAX 4BNRA 1ELTA 4Y8XA 4ISOA 1P2QA 1GBLA 3DHKH 1UVPA 3UAIC 4IMZA 3O8DA 3BG4B 1GCTC 1XM1A 2V35A 1BJUA 5DP9A 4MPUA 3KHVA 3FOAA 3A8AA 3KF2A 4X2WA 1SKYE 2PKSB 6ESTA 4Y0ZE 3T2NA 3K6ZA 1ZTKA 3RXGA 1YP9A 2ZCLP 3VB6A 3GY5A 2L6OA 1L4DA 2G5VA 4OGXA 1EZQA 4E05H 1P2JA 4YLUA 1O30A 1TYNA 3SJIA 5LGOA 4MLFB 1G2LA 3BTEE 3VB7A 3DSOA 1TOCB 1SOZA 2CN0H 5GJ4B 4H4FA 1V2ST 3KL6A 4K8YA 2VIPA 3O8CA 3UOPA 1QA0A 2PGBB 1GBEA 1UTMA 3I78A 2JH5D 2L74A 2FS9A 2BQ7B 7GCHF 4TPYA 2HRVA 1HNEE 1NROH 2TGTA 3ELAH 1FV9A 1AB9C 2ASUB 3BV9B 4DURA 1H9HE 3FP7E 2ZIQH 1S6LA 1Y3XA 1W0KD 3BTME 1OSSA 4FVBA 4WMDA 1K0HA 3SZEA 2A7HA 2V3HH 3UQVA 3AK5A 1ZLRA 2LNCA 1K1NA 1DICA 5HIZA 2OC7A 1NBMD 3T28A 1C5QA 3RXRA 1XVMA 5C94A 3K65B 1HYLA 1AHTH 4JZIA 5T6DA 6CHAC 3MNCA 5AVDA 1RIWB 1UO6A 4KP0A 3TJOA 3B9FH 3MU1A 5KEDA 1O2MA 1Z1IA 2G4TA 4ESTE 1HAVA 1K1PA 3RC4A 1ESAA 4WH8A 4AFZA 1GI4A 1QY6A 4DT7B 1P01A 5HM2A 1TNJA 1FX0B 1NRQH 2PUXB 4X2YA 1RD3B 1KTTB 2O9QA 2Z9JA 2VGCC 2VWMA 2ZGXH 3BTGE 1WAYB 4YO9A 4NA9H 2QYIA 1GPZA 1A2CH 2FOFA 4INLA 1OWEA 4X1PU 2GJGA 1BMFD 1C5YB 1C2LA 1E36B 1T31A 1OPHB 1DY8A 1LKAA 2GT7A 4UFGH 3PO1C 1RTLA 3UWIA 2BTCE 5A8XA 1SPJA 4ZHAA 3E90B 3SU2A 1PQ7A 4NWLA 1IQNA 1VCQA 3QX5H 5DP5A 4MQAA 1AN1E 4A1VA 1Z8JB 4K69A 1RS0A 2QF4A 1C1NA 1UTQA 3A7YA 1MQ5A 1XUKA 4IN1A 1K1LA 3GDVA 1YPGH 3E0PB 2SGDE 1A0LA 1CHGA 1DPOA 2V7QD 4ACBA 2CF9H 1ZJKA 1RRKA 1O2ZA 1SOTA 3BTWE 1A5IA 2ZGBH 1EJAA 2Q6DA 3R3GB 2ZU5A 2Y7ZA 4AORA 2QF0A 3PV5A 1T8NA 4X8TH 2WZQA 3M7TA 4JK5A 3RC5A 3PRDA 4KELA 3RXBA 1O5DH 1LPZB 1O2UA 2ULLA 1QJ7B 3TNSA 3H7TA 2W6ID 2A4QA 4AN7A 4Z1MD 1FUJA 1GHBG 2A4RA 2OINA 1GCDA 1J14A 4U2WA 4Q7XA 3VGCC 2OQUA 3ZVEA 4BAHB 3H7OA 4B76A 1G9IE 1TNGA 1SC8U 4Y71A 2EC9H 2FYQA 1GI0A 4INKA 3TVJB 1HRTH 2Q6FA 1CO7E 4NZQA 2GCHG 5L2YH 1N6YA 2D8WA 3HATH 1UCYK 1QRWA 3CS0A 3SQHE 3P8FA 3PMBB 3QN7A 1CT2E 5ETXA 3ZYDA 3SBKA 2IPHA 1SI5H 1CGHA 1WOFA 1NU9A 1A46H 2ZF0H 2FS8A 1GI8B 1S82A 1TBQH 2AMPA 3UIRA 4AG1A 3A85A 3UQOA 3OSYA 5FBEA 4JZFH 5EQRA 2PGQB 3RXUA 4K2YA 5FAHA 4CH8B 2P59A 3Q76A 1K9OE 3PMAB 1O2RA 1DOJA 2K1QA 1AVWA 1O37A 2GDDA 4K1SA 1BTPA 2IJOB 4FU7A 2BHGA 4ASUD 1CGJE 1O3IA 2J94A 2VNTA 2XWAA 1H1BA 2YNBA 3LJOA 3RU4T 1BBRK 5DP3A 1Z1JA 2GDEH 2OXSA 2CMYA 1YCPK 1GI5A 3AVZA 2SFAA 2ZHFH 3TH3H 3TK5A 1WXRA 1FY3A 1D3PB 3A82A 4CH2B 2ZU3A 4DIHH 2Y5FA 3MH7A 1Y3UA 2AEIH 1LVMA 3EE7A 1WU1A 1AIXH 1W7GH 1O3KA 1GMDF 3P17H 3OY6U 1DITH 2ZFSA 1GCTB 4I8LA 2V3MA 2A0QB 1FY8E 4IS5A 1GBFA 1AGJA 1H8ED 3KIDU 1UTJA 4Y10E 5E0HA 2XNDD 4CRCA 3M36A 1O2NA 4XE4A 2C8ZB 1SGDE 2OC8A 1BIOA 1ZSKA 2CXVA 4J1YA 5PTPA 4ABHA 3DCLA 1GHVH 1QR3E 5DO4H 1V6DA 2PFEA 2AS9A 4FUDA 3RXIA 1O5GH 1L0ZA 1H4WA 3B8JA 3SU4A 3MH6A 1NFWA 4DVAU 3BEUA 1O34A 3MNSA 3A80A 1XUGA 2CF8H 4ZH8A 5C20A 1HIAB 2GX4A 2YMSD 4XOJA 2H6MA 1UTOA 5DPAA 2ZWLH 3VB3A 4WXVA 2J2UA 1HJAC 4I8GA 1NTPA 3SJ9A 1O2WA 3E1XB 3SJKA 4DIIH 1AB9B 2ZGJA 2ZPSA 4MG3A 2BVRH 1A0JA 3GISB 1ETSH 5JB8S 2HNTF 2R3UA 3T5FH 1GBAA 1Y8TA 4YM9A 3AASA 1BMAA 3DD2H 1TGSZ 1W8BH 3F9FA 1HAZB 5EXNA 1DT2A 3RXLA 1P05A 2J9NA 1D6WA 2DE9A 5EJZA 3RM2H 2FOMB 1OP0A 1JIRA
chains in the Genus database with same CATH topology
1O5CB 4MNVA 2PSYA 1DXPA 1LQEA 1O36A 2GGVB 3KQDA 1DVAH 3QZQA 1DWEH 1SQOA 3ATWA 1SGFG 3AW0A 4I33A 1D6RA 1PQ5A 4WXIA 2F9UA 2A32A 2ZC9H 1P2OA 1GMCF 1KXEA 1QB1A 5DP6A 1GI6A 3ATLA 3A86A 1MCTA 1NFYA 3EDXB 2A5AA 3SV6A 2ZTZA 4KTUA 1NFXA 2JETB 4HGCA 1AWFH 5EGMA 2PHBA 1F0UA 1ELCA 3RP2A 1O3AA 3D62A 5JBTA 3MI4A 2Y82A 1GI2A 4K3JA 6GCHF 1AVGH 1JMOH 1O2GH 4XBBA 2G52A 5F03A 1TA6A 4D9QA 1Q2WA 3SV9A 1WTHD 2G51A 4UD9H 5C67A 3SOSA 4AX9H 3RXSA 2ODPA 1GJ7B 2C8XB 1MBMA 3P95A 4D7FA 2G5NA 1ARCA 1EASA 1AD8H 2RA3A 1TIOA 2F91A 1RTFB 6LPRA 2RG3A 1TNHA 3N7OA 1ARBA 3F9HA 4X6PA 2TRMA 3QTOH 2H1UA 4H42U 1CHOF 2CJIA 8LPRA 7ESTE 4YLQH 2ZFRH 2IN2A 1P2KA 4CRDA 1RTKA 1XXDA 5JDUB 2BZ6H 4SGBE 3QK1A 4BAMB 3UTUH 4GHQA 2A4OA 1GDUA 3KEEA 1Q3XA 3TK6A 1V2VT 3T29A 1LHFH 4D8NA 2EI8A 3LGYA 1WTGH 3ZZ4A 4TWYA 1TPAE 1GVKB 4FUBA 2R9PA 3MNBA 3LPRA 1CBWC 4BXWA 2PKAA 3U8RH 1YBWA 4H6SB 1UTPA 1BTYA 2FP7B 1P12E 2QAAA 3ZZBA 2TBSA 1EAUA 5E0GA 4E06H 1Y3YA 2QN5T 3HKJB 1NT1A 3U8TH 1Z6EA 1YPMH 8KME2 3TJVA 1GGDC 3U98H 3SGQE 5I25A 1DLEA 2XW9A 1S5SA 2GMTB 1BRAA 1PPBH 2P93A 3BF6H 3FZZA 1O5FH 1C5LH 1E37B 4KKDA 2FMJA 1ELBA 1MTNB 5E2OA 4X8VH 1EPTC 3LKWA 1O3MA 4WVPE 1GJ9B 3LONA 2BDAA 3GY3A 2HLCA 3A81A 4VGCC 3W95A 1SFQB 1ZOMA 3UPEA 1M9UA 2JH6D 3KQEA 3MWIU 1ORFA 4OS1A 1SGNE 2HALA 3LU9B 2NWNA 4FUFA 1OWHA 3TLOA 1SLUB 2G00A 3FFGA 3CS7A 3GYLB 1GMCG 2NU0E 2QXGA 1Z8RA 1C1VH 5F6MA 2HVXA 1NFUA 1C5TA 2BDYA 2F9OA 4UFDH 4Z6AH 1YKTA 3SQEE 4ZKOU 1VITF 4RSPA 2Z6BD 1OYQA 2BQWB 1BJVA 2UWLA 1PFXC 3Q77A 3JZ2B 3RU4D 3SJOA 3UREA 1C2GA 4ISLA 3Q3YA 1A4WH 3OTJE 3UOUA 2BY5X 1BTZA 2BXUH 1O3NA 1FLEE 1W12U 1FPCH 1Q31A 3RMMH 3UR6A 1C5WB 4O9VA 3VFEA 1YPLH 2F9BH 4FUHA 1GJBB 1L2EA 3STIA 3PLPA 3TITA 2HNTC 4BOHA 1J17T 3QLPH 4FUEA 1ABIH 3M5LA 1QA7A 1GJ4H 1FNIA 2HGTH 4BTUB 2D26C 1YLDA 3NZIA 1QBVH 2FTMA 2P3TB 1UTLM 1UJ1A 1RXPA 4YTAA 3E6PH 4ABGA 3RXKA 1O2JA 1SGFA 4XBDA 5C5OA 5AHGH 4WWYA 5ABWA 2ZDMA 1WBGB 2ZHQH 2UWOA 2WPIS 3KQBA 1SLXB 4MNYA 1HJAB 4JYVH 1GHXH 2XBVA 1V2NT 5T3HA 1TGCA 1DWDH 1W11U 5JBCS 1OXGA 3A87A 1AKSA 2W7SA 1F92A 2F9VA 2H2ZA 4LXBH 2OQ5A 1SR5C 1G3CA 3RXQA 5K7RA 4Q7YA 1FY4A 3LOXA 2P8OC 1SFIA 2VWNA 3MMGA 2UUKB 5IDKA 1CA0B 3M35A 3T27A 1QB9A 5FCKA 1W13U 1DWBH 3Q3KA 4GVUA 4AFSA 3TH4H 1O5EH 3SNBA 1QHRB 2B7DH 1QURH 2Z3DA 1K1OA 5HYOA 1AZZA 1KXBA 1BITA 3RUOA 2O8LA 3PWBA 3GY8A 3ZZDA 3SHCH 4I31A 1D3DB 4A1TA 1AVXA 3L33A 4UFFH 4KTSA 1AE5A 4O03A 5L30H 2VIVA 4TY6A 4YZUA 2FLRH 1GBMA 3TGJE 3PWCA 2GV7A 4B75A 1SGPE 1VJAU 3GYMA 4NFFA 1QQ4A 1O2HA 2WUCA 1NRPH 5FPYA 3RXJA 4ZKRU 3BTTE 1FDPA 3F1SB 2BD9A 3SNDA 4X1QU 2GV6A 1Z8GA 2OD3B 4LOYH 4Y7AA 1F5LA 4B2AA 1SGQE 2ZCHP 5JBBS 1QBNA 3B23B 2ZU2A 3UFAA 1GI1A 1G3DA 2O8MA 3TJUA 1J8AA 3RXFA 1DXWA 5GWZA 3T62A 4A6LA 5G4BA 3U1IB 2C93B 5CMXH 1VITG 1P9UA 3MH4A 1OWDA 1IQEA 4CR9A 1EAIA 2TPIZ 2KAIB 3S0NA 5FBIA 2AFQB 1WUNH 2ODQA 2Q1JA 4E7NA 1QRZA 3OY5U 5E0JA 1IQJA 2W3KA 1CT4E 2B9LA 3ZV8A 2ANKH 2FOEA 4A92A 2GCTC 1OS8A 3Q3XA 3QGNB 2O8WA 1UK3A 3ATMA 3RXVA 3V12A 2OC1A 2FYRA 1UK2A 2VIWA 2HPPH 1TQ0B 5EG4A 1NESE 2A1DB 5DP4A 1O2QA 1OWIA 2AGGX 2GD4B 4MVNA 2F9PA 3E8LA 1SLWB 5GCHF 1TA2A 3SUGA 2FX6A 5T6GA 3W94A 2BY9X 1FJSA 1NRRH 3BIUH 1DLKB 1P0SH 4Y7BA 2XNIA 3GDUA 3HGNA 4GCHG 3ITIA 2SGPE 1SQAA 2QXIA 4Y6DA 1AI8H 1P02A 3A7VA 1KLIH 1SGYE 4ASHA 5E8EH 3U1JB 1EXFA 5C3NA 1YPJH 4K5ZA 1O33A 1ETRH 1C1TA 1D4PB 3MU8A 2ALVA 1C2EA 2PR3A 1DFPA 2I6SA 1C4Y2 2FOHA 5DKMA 1GGDB 1ANEA 1VCWA 1U6QA 1FY1A 1GMHF 4SGAE 1AWHB 1UK4A 1A3BH 2FZZA 1C5OH 3IG6B 2GZ8A 1BBRH 2ZTXA 1O5BB 1MU6B 1AY6H 1NRNH 1BDAA 3SI3H 5GXPA 1TPPA 5B6OA 1YCPH 1B0EA 1F2SE 1G30B 2AIQA 2Y7XA 5E2PA 4OS6A 4VGCB 3ZVDA 5FHTA 1IQFA 1A3EH 4Q80A 2V0BA 2F9NA 4BAOB 1HV7A 1UHBA 1C2MA 2A4GA 2W5EA 2XC5A 1DS2E 1EAWA 1MTVA 1PPHE 1VR1H 3ZVCA 1HAPH 4B2BA 7GCHG 1J9CH 1EP6A 3BTFE 3FP6E 2ZFPH 1JWTA 2FI5E 1KDQA 3BN9A 1EATA 3O8BA 4ISNA 1KSNA 3TJNA 3ZVFA 3SNCA 4LZ4B 1BTWA 1Y5AT 1HAVB 1JRSA 2WUBA 2PSXA 1BA8B 1BRCE 3GCHC 4ZHMU 4AOQA 1LDTT 3LDXH 3S9AA 3RLYH 4PROA 5EOKA 2CGAA 4R0IA 4U32A 1PQ8A 4RKJB 1T8OA 2Z9GA 1C2IA 4JYTA 2FI4E 2BD4A 3RXDA 3P6ZB 1VGCC 2ZNKH 4BAQB 1NM6A 1YGCH 4ABJA 1J16A 2C90B 2XYAA 1GHAF 1ANCA 3E91A 1C1UH 3M37A 1AFEH 1GVZA 3LGWA 3SUDA 5F8TA 1XXFA 2QA9E 1O2XA 1MKWH 3PV4A 1C1RA 1DE7H 5GCHG 4BTIB 4AFUA 1C5SA 1LVBA 5LPRA 2VIQA 1P09A 3K9XB 1GBIA 4D7GA 5AF9H 7KMEH 1O39A 1C5XB 2BD7A 1TONA 2BDHA 4Y8ZA 3GCTF 1LHEH 4BTTB 2BXTH 3TU7H 5A09A 1ELDE 1H9LB 5DP7A 1GHWH 1MTWA 4Q2KA 1O3EA 1OWKA 2FLBH 2BOKA 2FI3E 2TGPZ 3RXCA 1TFXA 3LT3A 2VINA 2ZGHA 3EYDA 4NWKA 5F8XA 3UWJH 1PQAA 4DOQA 2SNVA 1KTSB 2QC2A 2UUFB 4ABEA 4NZLA 1THRH 4JZ1A 4HTCH 1UVTH 2G81E 1BTUA 1QFKH 1QQUA 1O3GA 1GMHG 2BLOA 1BMLA 3ZZCA 1C9PA 1H8DH 4YOGA 2TGAA 1K2I1 2ANMH 1F5RA 2FWWA 5CHAC 1ELEE 4ZKNU 2Y80A 5F8ZA 3ZVGA 2CV3A 3SV7A 1G2MA 3RXMA 5FPSA 3ENSB 2ZFQH 1CA8B 3HGPA 3CENA 1LO6A 4LK4A 1TBRH 1C5VA 1T8LA 1IHTH 1LPGB 3NKKA 1DUAA 1G3BA 1GI3A 1A0HB 3MH5A 4ABDA 1FQ3A 1P11E 1G36A 4X8UH 1KDQB 3SNAA 4CBNA 3PLBA 3PMJA 3A7ZA 4X6MA 1WCZA 1IQIA 3VB5A 4JK6A 4X2XA 2BLVA 3SN8A 3V13A 2ZI2H 3SU6A 1CE5A 6CHAB 3LGVA 2J4IA 1TX6A 1UTKA 3EA7A 1BHXB 5ESTE 1W7XH 3BG4C 1C2DA 1HAYB 1XKBC 2Y81A 5FX6A 5FX5A 4CRFA 5DP8A 3UNSA 2BVSH 4FVDA 5C1YA 2FX4A 1MKXH 3EE0B 2VGCB 4K60A 2JKHA 1CQQA 1L1GA 5TCCA 1MMJN 2QIQA 3RXEA 3EA9A 1O3LA 3PTBA 3U8OH 2PWXA 3QZRA 1MZDA 2Z7FE 2QV1A 2OTVA 1NZQH 1O2KA 2FXRA 4DCDA 3PO1B 1V3XA 1W2KH 4X1SU 2VWLA 5HMAA 1FN6A 5LH8A 1GHAG 5EW2H 1DM4B 1HAGE 5L2ZH 1A61H 1TE0A 1NS3A 1ELVA 2BD2A 1BCUH 2W26A 1GBJA 1TMUH 5FCRA 1ZHRA 1TGTA 1O3CA 3SJ8A 2ZDLA 2XBXA 1GHYH 3L6PA 4WF8A 3DUXH 4DG4A 1QIXB 3F9EA 1BUIA 3A8BA 3PB1E 1ID5H 3QO6A 1YC0A 5K0HA 2C4FH 1OP8A 4B1TA 3FAOA 3U69H 1GMDG 4JYUH 3GCTG 1YPEH 3D23A 2AGIX 2FO9A 1SL3A 4INHA 1L1NA 2ZPRA 2BLWA 1OYTH 5A0AE 1ZZZA 1IAUA 1W0YH 4E7RG 3KN2A 1E38B 2ZHWH 4HFPB 2W3IA 3JZ1B 1RGQA 1TB6H 4DJZB 3MU0A 3LH3A 3VXEH 1HGTH 4YT7H 3RMNH 3A83A 1HPGA 2H5DA 3FVFB 1CVWH 2ZZUH 3LJJA 2ZQ1A 1C4U2 2ZDAH 2ZKSA 3A7TA 1SG8B 4K8BA 8GCHF 4X1NU 5BRRE 3TK9A 3M7UA 2FEQH 1O2YA 5JPMH 5EODA 3BTDE 2WV4A 1AFQC 1HDTH 3VGCB 5CE1A 1SMFE 2Z9KA 1LVYA 1SQTA 2EA3A 3SNEA 9LPRA 2BY6X 4ZHLU 1K28D 3A7WA 1LVOA 4O97A 2TGDA 3ZZ8A 4XDEA 1O3HA 1H9IE 1YPHC 3PM3A 2C3SA 1OOKB 2ZFTA 1NU7B 1EOLA 1TMTH 1EKBB 3V7TA 2OBOA 2I6QA 1BHXF 2YNAA 1HFDA 1N1LA 1V2PT 2B0FA 1VJ9U 4AGKA 3DFLA 4GPGA 3GCHB 4BXSA 1OX1A 2H5CA 4NIYA 3QWCH 2ZU4A 1TMBH 3GOVB 3NUMA 3ZVBA 4B71A 4WH6A 1GBDA 1ELAA 1O2LA 3AW1A 5JBAS 1HLTH 3QTVH 4GLYA 2ZFFH 3BTQE 2YOLA 1Y59T 1HB0B 3R0FA 2FPZA 2GVFA 1T32A 4K1EA 2SGQE 2NU3E 3RXOA 1SBWA 1JXPA 4MPVA 1UMAH 1AQ7A 3F68H 1A1RA 1TGNA 1HBTH 2STBE 3HK6B 1LHCH 2ODYB 2BQ6B 2JH0D 1MTSA 1PPFE 2R0KA 2C8YB 1EX3A 1SB1H 3AAVA 3PLKA 3S9BA 1BQYA 3M5OA 3ZZAA 1ESTA 5DK1A 1VITH 1V2LT 1O2IA 4ZMAH 4X0WU 4UONA 1PPEE 2Z9IA 2ANYA 2ANWA 3ODFA 2XC0A 1O0DH 2OUAA 5EQSA 1ZHPA 3RDZA 6GCHG 2FODA 3IWMA 1KXAA 2M5TA 1Z71A 1S83A 1KIGH 1W0ZU 3KGPA 3CP7A 2PV9B 2XCNA 1AZ8A 2GP9B 1THSH 3EQ0H 1ZGVA 1X7AC 1N6XA 3TPIZ 1YF4A 3D65E 3SV8A 2WPMS 3K2UA 1Z6JH 1CSOE 4U01A 3QDZB 1BT7A 5FPTA 4F49A 4IBLH 3KNXA 4NIXA 2A31A 2D2DA 3LGTA 3MU5A 4NSVA 4FXGH 1TWXB 1HJ9A 3BTKE 1G37A 1DX5M 1CHOG 2A5IA 1JIMA 5CHAB 1LKBA 3RXTA 3S7KB 4XFQA 1ZPBA 4U30A 3UY9A 4NCYA 4DGJA 4AFQA 2ZDKA 2WPJS 3F9GA 2BDIA 1GBCA 2UUYA 8GCHG 3DFJA 1MCVA 1O3JA 3I29A 2PKAB 2BX4A 4FU8A 1FI8A 1IQHA 3GICB 4GSOA 4A1XA 1O3BA 2VVUA 1BMNH 1MD8A 1E34B 4I8KA 1GWAA 4OS4A 1WQSA 1XUJA 5I46H 1BTHH 1W14U 4ZROA 5A0BA 1V2OT 4TPIZ 1FZZA 2BM2A 1BB0B 2J38A 1AUTC 3STJA 2XC4A 1HXEH 1C5RA 4KGAA 3BTHE 1OP2A 1V2WT 1XVOA 2GTBA 3P92A 1C2KA 1RJXB 1KXFA 1O2PA 1Y3WA 1QJ6B 2A7JA 2ALPA 1C2HA 1IQMA 2G55A 3NWUA 4OGYA 2QF3A 1CU1A 1K1IA 2H9HA 1FMGA 2OC0A 5EPYA 4B73A 1AO5A 1EPTA 3MYWA 1K22H 4MPXA 3P8OA 5C1XA 1EJMA 3SUEA 1PPGE 2H9EH 3BEFB 5EQQA 1SLVB 1F0RA 1GHBF 1Z8IB 1DUEA 1EZUC 1C1MA 1FAXA 3URDA 1EUFA 3TH2H 4ZXXH 1YM0A 4HZHA 1P2MA 3H5CB 2UWPA 3S69A 2NU1E 1J15A 5J4QA 2R2MB 1CGIE 1FN8A 1SGRE 2EEKA 4AYVB 1UTNA 1TBZH 2Z9LA 1C5PA 5JB9S 4NG9H 5C2ZA 1E35B