1P2IA

Structural consequences of accommodation of four non-cognate amino-acid residues in the s1 pocket of bovine trypsin and chymotrypsin
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Trypsinogen, cationic
publication title Structural consequences of accommodation of four non-cognate amino acid residues in the S1 pocket of bovine trypsin and chymotrypsin.
pubmed doi rcsb
source organism Bos taurus
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1p2iA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1p2iA02
4D8NA 1C5TA 1GI0A 2P16A 2WYGA 3ZVFA 1BIOA 4IS5A 1EPTB 1MKWK 3STIA 1PPHE 1DXWA 1O2JA 3E8LA 3V12A 1Z6JH 2Q6FA 3GY5A 3B9FH 1ETRH 1EQ9A 1F0TA 2GD4B 4GSOA 4YZUA 1O2XA 1E34B 2VB0A 5EW1H 1L1NA 2QYIA 1W0YH 5LH8A 4CBOA 3MH7A 1AUTC 5AFZH 3P92A 4HGCA 1A7SA 3OY6U 2R0KA 3ZZ6A 4UONA 1O3JA 1WCZA 1SGNE 2V0BA 2BX3A 3MU1A 1N6XA 4TWYA 5GCHF 1L4ZA 3FAOA 4YT6H 1GBLA 3P6ZB 1HUTH 4HI3A 4U30A 3GOVB 3ZV8A 3NXPA 2AIPA 2VIQA 1ELCA 1YC0A 1GGDB 3QX5H 3AAVA 2P59A 1V2TT 1CO7E 3FZDA 1CBWB 2Y7XA 3TK9A 3E3TA 3SNCA 3GDSA 1P0SH 3QK1A 2FPZA 2VWNA 3TH2H 3SHAH 4MNYA 1CSOE 3ZYEA 2BOKA 3A80A 1EZSC 1UK3A 3FP7E 2F9OA 2SGPE 2Z6BD 2D1JA 1NRNH 3NUMA 3D62A 1GI2A 1C5RA 3MFJA 2GDDA 2BLWA 1UTQA 2BTCE 3F6UH 1MKWH 1NS3A 1SHHB 2H9HA 3A7YA 1ZHMA 2TBSA 4BXSA 3ITIA 4O03A 1EAWA 1SQAA 2FLRH 2F9PA 1ARBA 1DT2A 1TONA 1TWXB 2J92A 3RMNH 2YNAA 1UVPA 1Z6EA 2A4RA 1C2KA 4UFGH 1N8OB 3UOPA 3DD2H 3UNRA 1IQMA 3PWCA 1HAIH 1O2SA 1ZHRA 1DPOA 2VIPA 1NRRH 1LPKB 1LKBA 1IOEA 1HFDA 4IN2A 2V3HH 1HBTH 1DY8A 3MH6A 3KQBA 1AI8H 3UIRA 3AASA 1V2UT 2P8OB 2WV4A 1Y3UA 1GVZA 1KXFA 3PTBA 4AOQA 2C93B 1AD8H 1C5WB 2ZPSA 4ABGA 4ZXXH 1XUFA 1TNJA 3SO3A 4YTAA 1QURH 1C5UA 5H4IB 2G5VA 1WV7H 1YLCA 1BZXE 3CP7A 1AE5A 1C2HA 3LJJA 3R3GB 2PV9B 2BY6X 3LGTA 2TGPZ 4B2CA 2F83A 3VEQB 1QIXB 2G8TA 1SGTA 2ZU4A 2SGEE 1KXBA 1YPMH 2W3KA 3EAJA 3TLOA 1CA0B 3MO9A 4CRGA 3GY8A 4BAMB 3M36A 2B8OH 3K65B 1TRYA 1VCQA 4CBNA 1QCPA 4UDWH 4TPYA 2J94A 1K28D 1O5EH 2BD8A 3F68H 1UTMA 2QXIA 1BCUH 3A86A 4AYYB 2VWLA 4NFFA 4ISLA 1OKXA 2G52A 5C67A 1OWHA 1PPZA 1P06A 1AKSA 2FTLE 4JYVH 3GCNA 3ELAH 1A0JA 2HNTC 3U8RH 3GCOA 1L1JA 1UVUH 1ETTH 2K1QA 1T8LA 3QN7A 1O2VA 2UUKB 1THRH 1V2RT 5GCHG 5DP5A 1SQTA 2R0LA 4LZ4B 1HPGA 3MNXA 1C5OH 2VGCB 3U8TH 4GVUA 2EI8A 3PV4A 1H8IH 2OTVA 3OYPA 1GDNA 1A3BH 1C2DA 1FY4A 1GBMA 3ZZ8A 4B1TA 4D7FA 2ZHDA 2ULLA 4ZHAA 5T6DA 4BAQB 3SJIA 1HLTH 1FIWA 2H6MA 2ZU2A 5CHAC 2ZTZA 4X1PU 1O39A 1VJAU 3E16B 3URCA 3DT0H 1AE8H 1PQ7A 1W2KH 2VVVA 1GI3A 2TGTA 3ATMA 1FLEE 3K2UA 1O2YA 1XKBC 1NY22 2QY0B 2ANYA 2Z3EA 1MZAA 1QRXA 3BTEE 1C2FA 3SJ8A 3SNEA 4ZHMU 4Y0ZE 1NT1A 2BHGA 5A8ZA 1UVTH 1ZPBA 5L30H 3JZ1B 4BTTB 2WPIS 3BIVH 4NGAH 4OGXA 4MPUA 3PYHA 3UTUH 4UD9H 2JETB 1O37A 2W3IA 5ESTE 1PPCE 2A4QA 2OQUA 1KXCA 4FU9A 4ISNA 1TE0A 2F91A 4E06H 1NFUA 1UCYK 3FVFB 5E0GA 1EP5A 2ODPA 1NROH 1ESAA 1TNIA 5LPEA 1SQOA 1ELEE 2ANWA 2FI5E 5GIBA 2FDAA 1TB6H 4YESB 1NZQH 1EAUA 3FZZA 3ATLA 4ESTE 2NU0E 2R3YA 4R0IA 2P95A 3TK5A 1QBVH 2BXUH 2FLBH 1QBNA 2VIWA 5JB8S 2VINA 4MPWA 1SFQB 1C1RA 1V2JT 1EB1H 1NESE 4B75A 4ABEA 8LPRA 1KTTB 2HWLB 1HJAC 1TGSZ 1ZYOA 4F49A 3RMMH 2SGFE 2SGQE 2BZAA 1S0QA 5E2OA 2IJOB 4MPVA 3V3MA 2ZU5A 3P8OA 2FM2A 2WUBA 1UHBA 5FPTA 1K22H 1Z8GA 1D9IA 2M5TA 3K6ZA 3P95A 3LT3A 1OWIA 2WPKS 5AHGH 1D3TB 5C1YA 4I8GA 1YLDA 2ESTE 1A4WH 3E0PB 3QGNB 1V2ST 3OX7U 3DUXH 2AYWA 4LOYH 4DG4A 1W11U 2A5AA 1SPJA 3TIUA 1OPHB 1FXYA 1UTJA 1C1TA 5LGOA 4KELA 4AGKA 5IDKA 3BN9A 4X1SU 4YOGA 1C1VH 1X7AC 3MHWU 1SL3A 4K8BA 3ZZCA 1SGEE 2C8ZB 4AB9A 1FY5A 1ESBA 3BTQE 2BDCA 2NU1E 4WVPE 4B73A 3RU4T 1V2QT 1ABJH 1HAYB 2V3OH 1OS8A 3BG4B 1TX6A 3M5NA 4FUDA 1BT7A 3ODDA 2GKVE 3H5CB 3PM3A 3OTJE 1YP9A 2ZDKA 3TGIE 1GBDA 3Q76A 4O97A 2F9NA 4IC5A 1P02A 3V7TA 2PSYA 1YCPH 4THNH 3SU6A 2GMTB 1SLUB 5JBCS 4IMZA 3P8GA 4AX9H 4X1NU 1FZZA 3SU3A 1VGCC 2B9LA 3RU4D 1QGFA 1MTNB 3LOXA 1TPOA 2R2WU 1Y3XA 2BY9X 4Y79A 4BTUB 5C2ZA 4K1TA 4Y7AA 2OUAA 3UFAA 4BNRA 3HATH 5FX5A 3RXLA 2OC0A 4JK5A 4ZKOU 1P10A 3WY8A 1LQEA 2AGIX 1O35A 1VITH 1P09A 3P17H 1NRPH 2ODQA 2G4UA 1L0ZA 3BTFE 1L4DA 2Y6TA 1D6WA 3O8CA 1BA8B 3C27B 1BJVA 1F2SE 2ZGXH 3RUOA 2GCTC 1WUNH 1HV7A 4ZH8A 1ZMLA 1RIWB 4ZKRU 1LTOA 2PHBA 3PTNA 1EZXC 4AFZA 5F6MA 3BEUA 1C1MA 3CS0A 1K1OA 2A0QB 4K5ZA 1QQ4A 4X6MA 3VFEA 4CR9A 1KXDA 1P12E 4FVBA 3KN2A 5JBTA 3RMOH 1F5LA 1F0UA 1A0HB 1GBEA 1C1SA 3PLKA 1C4Y2 1P9SA 4DURA 1SGQE 2O8LA 1O3FA 3A83A 3V0XA 1P04A 1ABIH 1MQ5A 1GJAB 1C1QA 1WU1A 5BRRE 2BLOA 2UWPA 1Q31A 1A61H 5HM9A 1GBJA 2VIDA 2Z9JA 1DOJA 1O5BB 1Y5BT 3N7OA 2XC5A 1GHBF 3QO6A 3TJOA 3CS7A 1QTFA 1TMBH 4GHQA 1NFWA 1OWDA 3LH1A 1G3BA 2AERH 2BX4A 1WAYB 2WPMS 1S5SA 4X6NA 4KKDA 1HGTH 3LGVA 1P8VC 2ZFFH 3SI4H 4B76A 1K1LA 3ZZ4A 1EPTC 3U69H 4DY7B 1ZMNA 2CHAB 1VCWA 2FS9A 1GBKA 4JK6A 2ZO3H 1OWKA 3RXEA 4CH2B 2ASUB 4AG2A 4X1QU 5DG6A 1KLJH 2STAE 2BDHA 4I8JA 1V2PT 2VVCA 2XWAA 3M5LA 3B8JA 3K6YA 3MWIU 1SFIA 1C5NH 2H1UA 2Z9IA 5GJ4B 4ABFA 1KY9A 1GCTC 1RS0A 4UE7H 3HKJB 2DUCA 4M7GA 3PB1E 3BSQA 4FUFA 1NFYA 2ZECA 1IHTH 1DICA 3SV6A 5F8XA 1GGDC 1XM1A 1NN6A 4NIXA 4NWLA 1T8OA 1WSSH 1RXPA 2PKSB 3SQEE 1CBWC 1ELVA 3UWJH 3ZV9A 4CHAB 3E0NB 3SNDA 2ZG0H 3ZZDA 2FI3E 4Q7YA 4I31A 4O3UA 1UHBB 4TY7A 2VNTA 1O3NA 4FUIA 5FPYA 1LQDB 3QWCH 4WWYA 4X8SH 1AVGH 2UWOA 1JIMA 2NU4E 2A2QH 3RXCA 1B5GH 1KYNA 1NU9A 5JBBS 4D9RA 1WQVH 4Q7XA 3MNBA 3PMBB 1OWEA 3T62A 1V2MT 3BTDE 4ABIA 1LKAA 3SW2B 2UUFB 3I77A 4FUCA 1YPKH 2FOAA 4J2YB 2PGQB 1FAXA 4O9VA 1ZPCA 1C4U2 5AFYH 1O33A 3A89A 4ZKSU 2ZDLA 1O32A 4Y0YE 3JZ2B 1QA7A 4AZ2B 2RDLA 2ALVA 4X6PA 1MCVA 2C3SA 2ZDMA 1LVYA 3PROA 3Q00A 2GGVB 1ZRKA 1QB9A 4DIHH 2H5CA 4WY3A 6CHAB 1ID5H 1WQSA 1AHTH 1A46H 4RSPA 2A31A 3EYDA 2WUCA 4GLYA 1B0FA 2P8OC 1QJ6B 3TH4H 1S6FA 5FCKA 1BTZA 3AW1A 1EZQA 2ZFTA 4HZHA 3T25A 1MH0A 4A5TS 1ZOMA 3MI4A 1IQJA 1NO9H 5C3NA 4AGJA 2BY7X 1XVOA 4ZMAH 5EQSA 5L2ZH 3MOCA 1MMJN 3T27A 1EOJA 3AAUA 1CA0C 1LHGH 1VJ9U 1MKXK 3TJUA 4CRCA 1TGCA 3BTHE 9LPRA 5FXLA 3K9XB 1GHBG 1ORFA 2Y5HA 5GPIB 3UOUA 4NIWA 3RXKA 5F8TA 2ZHWH 4JCNA 1DSUA 2ZQ2A 3A85A 1SLXB 3RLWH 4TWWA 2AGGX 1NM6A 1HB0B 2BQ6B 1AGJA 4D76A 4YT7H 7GCHF 3UQVA 1A2CH 2BY8X 1O3PB 2FOBA 3A84A 1V3XA 1P2KA 1B7XB 5ETXA 2O8UA 1DSTA 1EAIA 4K3JA 1LCYA 4WH6A 1GBFA 4NA7A 1INCA 2CV3A 2QAAA 1AFEH 1P2JA 1KSNA 4MDSA 1QNJA 1ELBA 3SI3H 4INKA 2Q6GA 1DDJA 3TNTA 1G36A 1O34A 4BAKB 3B23B 5EG4A 1CHOF 3SQHE 2OC7A 4KTUA 1BMMH 4NSVA 1TYNA 3FP6E 1FAKH 4IN1A 3RXHA 4JMYA 2A5IA 1XX9A 1SOTA 4NZQA 1KXAA 5IYTA 2OXSA 3EGKH 1P3CA 1AWFH 2EI7A 2BLVA 3ESTA 4YOJA 4NG9H 5LPRA 1AO5A 1ZR0A 4NIVA 4A1XA 1AVWA 1ZZZA 2R9PA 2O8MA 1OYTH 5EQRA 1TRMA 1PPBH 1ZSLA 3IWMA 2GV6A 1SVPA 1J17T 1ACBE 2NU2E 4K1SA 3NPSA 3SOSA 2QF0A 3PO1B 1LVOA 2PLXA 2RCEA 1HDTH 2J9NA 2GZ7A 4I8LA 2VIOA 3TJVA 2Y80A 3MU0A 2QXJA 1MD8A 3RMLH 1SOZA 2ZI2H 1NU7B 2GCHF 4DVAU 2A7JA 5A0CA 1ELFA 4A92A 4B2BA 5K7RA 3KIDU 3GCHB 1HRTH 2TIOA 1FPHH 3GY2A 2Y7ZA 4WJG2 2AMPA 2JETC 4NFEA 1O3IA 1GBIA 5JB9S 1XUJA 2OBQA 1C5VA 3NK8A 1E36B 3TJNA 1XUHA 3ATWA 4Y76A 4I8KA 1VITF 1BQYA 2Y81A 1D3PB 4X0WU 1JMOH 2PSXA 4DJZB 2BD4A 1D3DB 1J14A 2QIQA 4ISIH 2HRVA 1D4PB 1GG6B 1O2TA 2FOFA 1GHYH 1P05A 2ZCLP 3KCGH 3VPKA 1O5DH 1GI8B 1P2OA 1NPMA 1Z8IB 4XBBA 5EPNA 5F03A 3RXFA 4BOHA 1MU6B 4K69A 1Y3YA 1H9HE 3F9FA 2C4FH 2SNVA 4FUEA 4MNXA 1LHDH 2A5KA 1EJNA 3TGKE 1BRUP 1IHSH 1O2HA 1TMUH 4UFFH 3KQCA 1PPFE 3SU0A 2BD9A 1YF4A 1MBQA 1GCDA 3SJOA 4XFQA 1TNKA 2GTBA 4BAOB 1QJ1B 1AMHA 1C2LA 4RKJB 2KAIA 2SNWA 2AEIH 3UR9A 2ZCHP 3A7TA 4MNWA 2EEKA 1TPPA 2OD3B 2TGAA 2D8WA 4H42U 3VXEH 1O5GH 4IGDA 1VZQH 1GL0E 4K8YA 3MNSA 4AFUA 1LHEH 1TBQH 7GCHG 1AVXA 3NCLA 4WMFA 3T5FH 2W5EA 1KTSB 3U1JB 1S0RA 2FOGA 3A87A 1AU8A 4JZ1A 3MO6A 4ZXYH 3SJKA 3QLPH 1TABE 2BDGA 5EXMA 1O2UA 2G5NA 1HAZB 2W7UA 3GCTF 4NIYA 1CHGA 3TITA 3LJOA 3SBKA 4XDEA 1O3CA 1RJXB 1QL9A 4Y8ZA 3M7QA 2BM2A 2VIVA 2Z7FE 1FPCH 4AFSA 3P8NA 2A4GA 1O2NA 1TBRH 1BTYA 3AVZA 3BG4C 4YO9A 3NWUA 1W10U 4AFQA 1CHOG 4YM9A 4ABBA 1KDQA 1U6QA 1KLTA 2ZCKP 1BBRK 1P3EA 2WV5A 1MAYA 5DP8A 1RTLA 4FUHA 3KHVA 1O2MA 2J38A 1ZHPA 1P2NA 4Y7BA 4NA8A 3BTGE 1E35B 5TCCA 4H6SB 8ESTE 1W7GH 1LVMA 2GMTC 3VB6A 1J15A 4FXGH 2CF9H 3TH3H 3SGQE 1MTNC 1W0ZU 1AB9B 1O2WA 1QQUA 2QV1A 1T8NA 2C8YB 4BANB 1V2OT 4GAWA 5C5OA 2PTCE 1QFKH 1C9PA 1K2I1 4WXIA 2QXGA 4D7GA 3U8OH 5I46H 1C2MA 2ZDNA 2A32A 1CU1A 1LHCH 1HAXB 1Y5AT 1PPGE 1UK2A 1CE5A 1O2KA 1TGTA 1QA0A 1S83A 3SV2H 1BBRE 3A7WA 3ENSB 2HLCA 1EOLA 1FY3A 4OS7A 3ZVAA 1GJBB 1EAXA 3VB5A 3ZZ7A 2GCHG 4XBDA 3T29A 8KME2 3BTTE 1NRSH 1GBAA 1BTXA 2NU3E 1RIWC 2CF8H 2BDAA 1O2OA 1BMLA 1BTUA 1P03A 2ZA5A 2ZIQH 3I29A 4ABAA 3GY3A 2BQWB 3VGCB 1TOMH 3SNAA 1UCYH 5BPEA 1B0EA 5FPSA 1VITG 2HOBA 3RM0H 1HIAA 3E90B 1XKAC 2ZHEH 3D65E 4U32A 4Z0KA 2RA3A 3GDVA 1OYQA 2F9VA 4WH8A 4IW4E 1BOQA 2OCVB 4AORA 1GJ8B 1BRBE 2H2ZA 2ANMH 2SGDE 3I78A 3RXVA 1O2RA 2AGEX 3BEIB 1T7CA 3UUZA 2ZGHA 4TYDA 3A8AA 5AVDA 3HKIB 3S9AA 2ODYB 1DUEA 5AF9H 3D23A 2ZFQH 1EASA 5HGGA 1PJPA 3D49H 2GX4A 3OU0A 4YLQH 5EW2H 4AG1A 2AIQA 1SGPE 3PLBA 1G2LA 2BVXH 1NTPA 4O3TA 4MNVA 1IQHA 2A2XH 2OBOA 2ZWLH 1SLWB 1TNLA 4GCHF 1UVSH 2UWLA 1SR5C 1F5RA 1GHVH 2P3TB 2G00A 3STJA 1ANDA 2FYRA 4FUGA 3RXQA 2HALA 1AUJA 3U98H 4BAHB 2DE9A 2UUYA 3KGPA 4X2YA 3TPIZ 1O3MA 2FWWA 2XNIA 1O3OA 3F9EA 3MTYA 1BMNH 1RD3B 1FN8A 3HGPA 2FOCA 2TGDA 1GJ9B 1V2VT 5HYOA 3GCTG 1BUIA 2P93A 4HTCH 2JH6D 2Z3DA 3U9AH 2JKHA 4YOIA 2EA3A 4B74A 2FX6A 1AIXH 3TK6A 1SB1H 2THFB 3RC5A 2AMDA 5ESBA 4JYTA 1GI4A 2J2UA 3S7HB 5L2YH 3KF2A 2OP9A 1IAUA 1Z1JA 3RLYH 1TA6A 2B7DH 1D6RA 1MAXA 5DPAA 4VGCB 1W12U 1UTNA 2JH0D 2P3FH 3UY9A 2FIRH 4ISHH 1S82A 1WOFA 4NA9H 5GXPA 8GCHF 1C5PA 1JBUH 3DFLA 1FIZA 1PQAA 2H9EH 1UVOA 1CGJE 2GP9B 3E1XB 3M35A 1DFPA 4Y6DA 1E38B 5TJXA 2Z9KA 2PKSC 3H7OA 1TOCB 2XBXA 2VVUA 3T26A 1O3AA 1P2QA 1XXFA 1SC8U 4CHAC 2FTMA 3EA7A 2KAIB 3ZVCA 5GWZA 1MZDA 2QXHA 1MTUA 2CN0H 1TQ0B 2ZGJA 5EPYA 1QR3E 1K21H 2ZFRH 3RU4E 2PUXB 3SV9A 1TQ7B 3KL6A 3RC4A 2ZQ1A 3KQDA 2XBYA 4E7NA 1NC6A 1RTFB 2FEQH 1OX1A 1Y8TA 3CENA 1E37B 1S6HA 3A8CA 2PTNA 1PFXC 5L6NH 1FQ3A 2ZNKH 3SNBA 2O8TA 2EC9H 2RG3A 2HNTF 4XSKU 3ZVBA 3MH5A 1J16A 1ELTA 1GJ7B 1VGCB 3LONA 1W14U 1XUKA 7ESTE 1GHAF 5HMAA 4ASHA 2D26C 3OSYA 5FBEA 3U1IB 5EQQA 1P9UA 1O2QA 5E2PA 1SGCA 1O30A 1KDQB 6CHAC 1CT2E 3RDZA 5CMXH 2F9BH 1O3HA 1FN6A 2FOMB 1FV9A 2BOHB 1ZJDA 1Q2WA 3M7TA 4Y8YA 5DP9A 3HPTB 2XW9A 2ZF0H 5J4SA 2BXTH 1DWEH 3TNSA 1P57B 2IPHA 1C5QA 1K1JA 1ETSH 1VCPA 1Y3WA 4J1YA 1ZRBA 3TU7H 4CRDA 4JZIA 1UMAH 3RXMA 4KTCA 2J95A 5B6OA 3T2NA 3LGWA 4HFPB 1ZPZA 1MUEB 2CJIA 4XBCA 3SV8A 2XCNA 4CR5A 3S9BA 1SBWA 1O2ZA 3HK3B 5EXNA 2FZZA 1AFQB 3SU2A 1TALA 2ZKSA 4GCHG 1V6DA 2AS9A 1P11E 2Z9LA 1IQKA 5DKMA 1KLIH 3M5OA 3PWBA 1AZ8A 4ZKNU 3M3VA 5DP7A 1UK4A 1GI9B 3RXAA 1MTVA 2SFAA 1JXPA 4MQAA 3A7XA 1Z1IA 2YOLA 1K1NA 2C90B 1TLDA 1L2EA 4ZHLU 1THSH 3EDXB 3PMJA 4LK4A 2BMGB 3EQ0H 3PLPA 1C2JA 1A0LA 4H4FA 4CRBA 2BLQA 2LNCA 4OS4A 1HIAB 1H4WA 1A3EH 3RXBA 1FNIA 1EJAA 1GHXH 1DY9A 1N8OC 2D2DA 3SZNA 4AYVB 1XUGA 2BB4A 1O2LA 1OP0A 5G4BA 3VB7A 1F92A 2F9UA 1GJ5H 1G3EA 1OP2A 1TFXA 2Q1JA 1GHWH 1MQ6A 2V35A 1ELDE 8GCHG 3L33A 4ZUHA 3LGIA 1VR1H 2FS8A 2XYAA 2BVRH 2BVSH 2BD3A 1BJUA 1HNEE 1Z8RA 2AH4X 1GL1A 4K60A 2NWNA 1JRSA 2VJ1A 1UTKA 5DP3A 3M3SA 5A8YA 1O38A 1TX7A 4MTBA 1N6YA 3ZVGA 1HCGA 2IOTA 1ZMJA 1JOUB 2QN5T 2BDIA 2Y82A 3PO1C 1HAGE 4OGYA 1XXDA 4FVDA 2G81E 1GCTB 1YKTA 2W26A 2F3CE 2GZ8A 5DGJA 3IITA 1H9LB 2ZP0H 1EKBB 4MG3A 4U01A 3VXFH 1W7XH 2P94A 2ZHFH 1GMHF 4FUJA 3EA9A 3L6PA 4X8VH 1WYKA 1UTPA 4JZEH 1BITA 4AB8A 1SGDE 6LPRA 3GCHC 2HVXA 1GHAG 2QCYA 3LGUA 2ZZUH 2IN2A 3NKKA 1G32B 1Y59T 2QA9E 3MU5A 4WMEA 3SV7A 2Z3CA 1DXPA 1BDAA 1G30B 1K1MA 1FMGA 2H5DA 1BRCE 3W95A 1ZJKA 6GCHF 3LKWA 4NWKA 1FY8E 3P70B 1O3LA 1GG6C 1DS2E 3SU1A 2FOHA 2FYQA 4I32A 1ANCA 1S85A 2VGCC 1J8AA 3RXRA 1W13U 2FX4A 1EX3A 1BMAA 2HNTE 1PYTC 2FP7B 1H8DH 3GY6A 2PW8H 2ILNA 1EATA 5E0JA 3URDA 3A8DA 3SUGA 4LZ1H 3ATIA 3LC5A 1MKXH 1O5CB 1BTHH 1O2IA 1EB2A 3MNCA 4IBLH 3L3TA 4X1RU 1A5HA 2C8XB 3KQEA 1C2EA 1BTPA 5EU8A 2RA0A 2WINI 4WMDA 4D9QA 1AN1E 1O3KA 5E0HA 4K1EA 1T4UH 4XE4A 1W8BH 1HYLA 1QL7A 1S81A 5CE1A 5GDSH 1ANBA 1C5YB 3C1KA 9ESTA 4FUBA 4U2WA 1QBOA 1Z71A 4CRFA 5FBIA 3SU5A 3LIWA 5JPMH 2XC4A 3AW0A 1C1WH 2YNBA 1C1UH 2O9QA 1GMCF 3QUMP 2PKAA 3QZRA 1TNHA 1OXGA 1TBZH 1TAWA 3OY5U 1T8MA 1UJ1A 2QF3A 3RXGA 2OINA 4GHTA 2BD7A 3QDZB 5C1UA 1GJDB 1O36A 3RP2A 3F9HA 3ZVDA 4MLFB 3BG8A 1DITH 3TGJE 2CGAA 4Y11E 1F0RA 1YPHE 3SGAE 1BHXF 1EJMA 5TCAA 4X6OA 3HGNA 1ZGIA 1UTLM 3NZIA 2FO9A 4X2VA 3O8BA 2Q6DA 3RC6A 1HXFH 3MU8A 3G01A 4SGAE 3ODFA 2ZDAH 2A4OA 2FESH 1K1PA 5A0BA 3ZZ3A 1V2WT 1O2GH 3IG6B 1OSSA 4Q80A 7KMEH 1AB9C 1A5IA 2ZPRA 3MU4A 2LPRA 1YGCH 2A1DB 3A88A 1MTWA 3MO3A 1OP8A 3RM2H 4Q7ZA 1CVWH 1GBHA 1C5MD 4K2YA 5EXLA 2C8WB 1H1BA 4FU7A 1P01A 1O0DH 1YBWA 5K0HA 5T3HA 5ABWA 1K9OE 1ZGVA 2EI6A 2OQ5A 2H9TH 4INLA 3FP8E 4DT7B 1LPZB 4H6TA 3F1SB 2Y5FA 1SMFE 1DWCH 2V6NA 1QHRB 3BV9B 4GPGA 1GMHG 1O2PA 4I8HA 1HAVA 3BIUH 3P8FA 4BTIB 4NSYA 2PGBB 1SGIB 1QRZA 2BD5A 4QT8C 2WYJA 5DP6A 3BTWE 3BEFB 5SGAE 1F7ZA 1WBGB 3SU4A 1SGFA 2OLGA 4Y71A 1LPGB 2FXRA 4OS6A 5F8ZA 1YCPM 3VGCC 3EA8A 2A7CA 1E0FD 4ISOA 1SGFG 4B71A 4RKOB 1YPGH 1FUJA 6GCHG 1DE7H 1ELGA 4F4OC 1JWTA 3GYMA 4IC6A 3GICB 4B2AA 5HXFA 1PQ5A 1ESTA 2GV7A 2AMQA 5T6GA 1LO6A 1C5LH 3S0NA 4PROA 3GDUA 1TNGA 1BB0B 1RRKA 1V2LT 2BQ7B 3E6PH 1OOKB 1YPHC 2ANKH 3BTKE 2R2MB 3QTOH 3UREA 5I25A 2PUQH 3ZYDA 1A5GH 1GJ4H 4OS5A 4TY6A 4A1TA 1LVBA 2CXVA 4KP0A 3GISB 4YLUA 2JH5D 1GVLA 2O8WA 4MPXA 1HJ8A 3LPRA 1DVAH 3SUFA 1GDUA 4X2XA 4WXVA 1H9IE 1MBMA 2VWOA 1WTGH 4DCDA 1PPEE 3FFGA 4A6LA 1BTWA 4DOQA 3UQOA 4UFDH 3VB3A 1DANH 3A81A 4JYUH 5JYIA 3S7KB 7LPRA 3BTME 1GWAA 2XC0A 1TMTH 4INHA 2CMYA 3O8RA 4JZDH 1AQ7A 1HAOH 1IQLA 2ZU3A 1YCPK 1ZTKA 1AY6H 1C1NA 2ZGBH 2PFEA 1GMCG 3S69A 2B5TB 3QZQA 3Q3KA 1ZSJA 1GJ6A 4Q2KA 1C1PA 1C2GA 3LH3A 2ALPA 5CHAB 4X8TH 1UCYE 1GBCA 3RXUA 3UNSA 5DK1A 1GJCB 1SG8B 2A45B 5FHTA 2ZTYA 3RXOA 1GPZA 1RGQA 3RXTA 1GHZA 4NZLA 1TGNA 3A82A 4VGCC 1BBRH 1GI7B 2ZEBA 3E91A 3Q3XA 1ZLRA 2HPQH 4CREA 3GYLB 5DJ7A 2ZC9H 2STBE 3SGBE 2WPJS 3M3TA 1RTKA 2XCFA 5PTPA 4A7IB 1TIOA 2ZTXA 1CGIE 4GUXA 1OWJA 2VH0A 3LDXH 4R8TB 1O3BA 4DIIH 1MD7A 3R0FA 1YPEH 1EP6A 1IQGA 1EPTA 3EE0B 2GDEH 1C5XB 1CQQA 2ZHQH 2DE8A 1C5ZB 1GVKB 3ZZ9A 1C4V2 1F5KU 6ESTA 5LPFA 1D3QB 1DLEA 3W94A 3RXDA 4UEHH 1ZSKA 3SHCH 3UNQA 1FONA 2BYAX 3MMGA 4KGAA 1XMNB 1MU8B 1XUIA 2ZFSA 2XBVA 1IQEA 2TPIZ 2G4TA 3H7TA 5HM2A 3SN8A 4Z6AH 4RN6A 2PKAB 3SJ9A 1TPSA 1NRQH 2CHAC 1HJAB 1SI5H 1QB6A 2I6QA 1QL8A 2HGTH 3RXSA 1GI6A 2J34A 1J9CH 4FU8A 2J4IA 3VB4A 2ZFPH 5FCRA 1YYY1 1S84A 2GVFA 1PQ8A 1TGBA 3F9GA 3RXIA 1C9TA 1DX5M 2FMJA 5EODA 5DP4A 5EGMA 2BDYA 3DA9B 4NCYA 1GMDF 4E05H 1IQIA 3TVJB 3Q3YA 3M37A 2UUJB 1BRAA 1G9IE 1AKSB 4XOJA 1QJ7B 3LU9B 4IMQA 1YPLH 1TA2A 4LXBH 2XXLA 4JZFH 1LDTT 1N1LA 2PR3A 2G55A 1EUFA 4UFEH 4CRAA 5JBAS 5EOKA 2VH6A 2HPPH 1O5FH 4ZAEA 1FY1A 3ATKA 1AFQC 3LC3A 4SGBE 2FOEA 2GZ9A 1P2IA 1Y5UT 3M7UA 3ZZBA 3SUDA 3S9CA 2VU8E 5FAHA 1HXEH 3MH4A 1EZUC 3M5MA 4BXWA 1AWHB 1DM4B 1HAVB 1O5AB 2WPHS 4KTSA 4ABDA 1ANEA 2R3UA 2Z94A 2ZU1A 5DO4H 1MTSA 1CGHA 1SHYA 1IQFA 1Z7KA 2ZGCA 1QRWA 1RFNA 1DWBH 2ZPQA 4OS1A 1EXFA 2TRMA 5C20A 3DFJA 1G37A 1V2KT 1GBTA 1ZTJA 4MVNA 2I6SA 3A7VA 1O3GA 1GDQA 1O31A 2P3UB 5C1XA 2BY5X 1T4VH 4ABHA 1CT0E 4X2WA 2AFQB 1XVMA 1UO6A 4Y8XA 2SGAA 5E8EH 3GY4A 1F0SA 1K1IA 3PMHB 1TPAE 3Q77A 3QTVH 1QY6A 1CA8B 2OC8A 3PMAB 1JRTA 3FANA 1YPJH 4X8UH 4WF8A 1CT4E 1SLVB 3QGJA 2ZDVH 1FI8A 1IQNA 1Q3XA 1GI5A 1TX8A 1M9UA 1HAPH 1DLKB 1SGYE 3M61U 2GT7A 3GY7A 3UPEA 3UWIA 1MCTA 2FI4E 2XTTB 2GCTB 4I33A 3ZZ5A 3A8BA 1KIGH 1O3DA 3UR6A 4AN7A 3ZZAA 1FDPA 4OS2A 4DGJA 1C5SA 4DW2U 1G3CA 5JDUB 1PYTD 3O8DA 5A0AE 2OC1A 4TPIZ 1O3EA 1C1OA 4E7RG 2Y5GA 4ABJA 1YM0A 3A7ZA 2GT8A 1ARCA 1Z8JB 2BD2A 1FJSA 2XWBI 1ZTLA 3DHKH 1V2NT 1KXEA 1HAHH 2A7HA 1WTHD 3V13A 1GBBA 4CH8B 2XRCA 5C5NA 1G2MA 2QGRA 2PWXA 1LHFH 1T31A 1L1GA 1T32A 2FODA 3HK6B 1NFXA 3LGYA 1DUAA 1G3DA 1W3CA 2XBWA 1DWDH 3T28A 3BF6H 1QB1A 1BHXB 1A1RA 1HJ9A 2BZ6H 2WPLS 4ZROA 3RXJA 4Y10E 5T6FA 1SSXA 1THPB 5A2MH 2G51A 3KNXA 1P2MA 3SUEA 3SORA 1JIRA 5J4QA 2BDBA 5A09A 2QC2A 1LMWB 3MYWA 1UTOA 2VWMA 5FX6A 2W7SA 1C2IA 4A1VA 1AZZA 5A8XA 1ELAA 1TRNA 1GMDG 1Y3VA 3ZVEA 2Z9GA 3RXPA 4I7YH 1SGRE 3KEEA 1GI1A 2B0FA
chains in the Genus database with same CATH superfamily
4D8NA 1C5TA 1GI0A 2P16A 2WYGA 1YLNA 3ZVFA 1BIOA 4IS5A 1EPTB 1MKWK 3STIA 1PPHE 1DXWA 1O2JA 3E8LA 3V12A 1Z6JH 2HVYB 2Q6FA 3GY5A 3B9FH 1ETRH 1EQ9A 1F0TA 2GD4B 4GSOA 4YZUA 1O2XA 1E34B 2VB0A 5EW1H 1L1NA 2QYIA 1W0YH 5LH8A 4CBOA 3MH7A 1AUTC 5AFZH 3P92A 4HGCA 1A7SA 3OY6U 2R0KA 3ZZ6A 4UONA 1O3JA 5T1VA 1WCZA 1SGNE 2V0BA 2BX3A 3MU1A 1N6XA 4TWYA 5GCHF 1L4ZA 3FAOA 4YT6H 1GBLA 5CDFE 3P6ZB 4B6EA 1HUTH 4HI3A 5EIYA 4U30A 3GOVB 3ZV8A 3NXPA 2AIPA 2VIQA 1ELCA 1YC0A 2J97A 1GGDB 3QX5H 3AAVA 2P59A 5DSFA 1V2TT 1CO7E 3FZDA 1CBWB 2Y7XA 3TK9A 3E3TA 3SNCA 3GDSA 1P0SH 3QK1A 2FPZA 2VWNA 3TH2H 3SHAH 4MNYA 1CSOE 3ZYEA 2BOKA 3A80A 1EZSC 1UK3A 3FP7E 2F9OA 2SGPE 2Z6BD 2D1JA 1NRNH 3NUMA 3D62A 1GI2A 1C5RA 3MFJA 2GDDA 2BLWA 1UTQA 2BTCE 3F6UH 2KFWA 1MKWH 1NS3A 1SHHB 2H9HA 3A7YA 1ZHMA 2TBSA 4BXSA 3ITIA 4O03A 1EAWA 1SQAA 2FLRH 2F9PA 4RT1A 3FOAA 1ARBA 1DT2A 1TONA 5EJLA 1TWXB 2J92A 3RMNH 2YNAA 1H8HD 1UVPA 1Z6EA 2A4RA 1OHHD 1C2KA 4UFGH 1N8OB 3UOPA 3DD2H 3UNRA 1IQMA 3PWCA 1HAIH 1O2SA 1ZHRA 1DPOA 2VIPA 1NRRH 1LPKB 1LKBA 1IOEA 1HFDA 4IN2A 2V3HH 1HBTH 1DY8A 3MH6A 3KQBA 1AI8H 3UIRA 3AASA 1V2UT 2P8OB 2WV4A 1Y3UA 1GVZA 1KXFA 3PTBA 4AOQA 2C93B 1AD8H 1C5WB 2ZPSA 4ABGA 4ZXXH 1XUFA 1TNJA 3SO3A 4YTAA 1QURH 1C5UA 5H4IB 2G5VA 1WV7H 1YLCA 1BZXE 3CP7A 1AE5A 1C2HA 3LJJA 3R3GB 2PV9B 2BY6X 3LGTA 2TGPZ 4B2CA 2F83A 3VEQB 1QIXB 2G8TA 1SGTA 2ZU4A 2SGEE 1KXBA 1YPMH 2W3KA 3EAJA 3TLOA 1CA0B 2YMSB 3MO9A 4CRGA 3GY8A 4BAMB 3M36A 2B8OH 3K65B 1TRYA 1VCQA 4CBNA 1QCPA 4UDWH 4TPYA 2J94A 1K28D 1O5EH 2BD8A 3F68H 1UTMA 2QXIA 1BCUH 3A86A 4AYYB 1E79D 2VWLA 4NFFA 4ISLA 1OKXA 2G52A 5HIZA 5C67A 1OWHA 1PPZA 1P06A 1AKSA 2FTLE 4JYVH 3GCNA 3ELAH 1A0JA 2HNTC 3U8RH 3GCOA 1L1JA 1UVUH 1ETTH 2K1QA 4FETA 1T8LA 3QN7A 1O2VA 2UUKB 1THRH 1V2RT 5GCHG 5DP5A 1SQTA 2R0LA 4LZ4B 1HPGA 2GJGA 3MNXA 1C5OH 2VGCB 3U8TH 4GVUA 2EI8A 3PV4A 2K0QA 1H8IH 2OTVA 3OYPA 1GDNA 5KEDA 1A3BH 1C2DA 1FY4A 1GBMA 3ZZ8A 4B1TA 4D7FA 2ZHDA 2ULLA 4ZHAA 5T6DA 4BAQB 3SJIA 1HLTH 1FIWA 2H6MA 3N99A 2ZU2A 5CHAC 2ZTZA 4X1PU 2CK3D 1O39A 1VJAU 3E16B 3URCA 3DT0H 1AE8H 1PQ7A 1W2KH 2VVVA 1GI3A 2TGTA 3ATMA 1FLEE 3K2UA 1O2YA 1XKBC 1NY22 2QY0B 2ANYA 2Z3EA 1MZAA 1QRXA 2J98A 3BTEE 3PV5A 1C2FA 3SJ8A 3SNEA 4ZHMU 4Y0ZE 1NT1A 2BHGA 5A8ZA 1UVTH 1ZPBA 5L30H 3JZ1B 4BTTB 2WPIS 3BIVH 2PP6A 4NGAH 4OGXA 4MPUA 3PYHA 3UTUH 4UD9H 2JETB 1O37A 2W3IA 5ESTE 1PPCE 2A4QA 2OQUA 1KXCA 4FU9A 1MABB 4ISNA 1TE0A 2F91A 4E06H 1NFUA 1UCYK 3FVFB 5E0GA 1EP5A 2ODPA 1NROH 1ESAA 1TNIA 5LPEA 1SQOA 1ELEE 2ANWA 2FI5E 5GIBA 3F2GA 2FDAA 1TB6H 4YESB 1NZQH 1EAUA 3FZZA 1KMHB 3ATLA 4ESTE 2NU0E 2R3YA 4R0IA 2P95A 3TK5A 1QBVH 2BXUH 2FLBH 1QBNA 2VIWA 5JB8S 2VINA 4MPWA 1SFQB 1C1RA 1V2JT 1EB1H 1NESE 4B75A 4ABEA 8LPRA 1KTTB 2HWLB 3N7EA 1HJAC 1TGSZ 1ZYOA 4F49A 3RMMH 2SGFE 2SGQE 2BZAA 1S0QA 5E2OA 2IJOB 4MPVA 3V3MA 5EJ1A 2ZU5A 3P8OA 2FM2A 2WUBA 1UHBA 5FPTA 1K22H 1Z8GA 1D9IA 4P00A 2M5TA 3K6ZA 3P95A 3LT3A 4I86A 1OWIA 2WPKS 5AHGH 1D3TB 5C1YA 4I8GA 1YLDA 2ESTE 4YXWD 1A4WH 3E0PB 1YWUA 3QGNB 1V2ST 3OX7U 3DUXH 2AYWA 4LOYH 4DG4A 1W11U 2A5AA 1SPJA 3TIUA 1OPHB 1FXYA 1UTJA 1C1TA 5LGOA 1QZ8A 4KELA 4DT4A 4AGKA 5IDKA 3BN9A 4X1SU 4YOGA 1C1VH 1X7AC 3MHWU 1SL3A 4K8BA 3ZZCA 1SGEE 2C8ZB 4AB9A 1FY5A 1ESBA 3BTQE 4ACBA 2BDCA 2NU1E 4WVPE 4B73A 3RU4T 1V2QT 1ABJH 1HAYB 1EFRD 2V3OH 1OS8A 3BG4B 1TX6A 3M5NA 4FUDA 1BT7A 3ODDA 2GKVE 3H5CB 3PM3A 3OTJE 1YP9A 2ZDKA 3TGIE 1GBDA 3Q76A 4O97A 2F9NA 4IC5A 1P02A 2WV9A 3V7TA 2PSYA 1YCPH 5C17A 4THNH 3SU6A 2GMTB 1SLUB 5JBCS 4IMZA 3P8GA 4AX9H 4X1NU 1FZZA 3SU3A 1VGCC 2B9LA 3RU4D 1QGFA 1MTNB 3LOXA 1TPOA 2R2WU 1Y3XA 2BY9X 3PV2A 4Y79A 4BTUB 5C2ZA 4K1TA 4Y7AA 2OUAA 3UFAA 4BNRA 3HATH 5FX5A 3RXLA 2OC0A 4JK5A 4ZKOU 3F0PA 1K0HA 1P10A 3WY8A 1LQEA 2AGIX 1O35A 1VITH 1P09A 3P17H 1NRPH 2ODQA 2G4UA 1L0ZA 3BTFE 3DSOA 1L4DA 2Y6TA 1D6WA 3O8CA 1BA8B 3C27B 1BJVA 1F2SE 2ZGXH 3RUOA 2GCTC 1WUNH 1HV7A 4ZH8A 1ZMLA 1RIWB 4ZKRU 1LTOA 2PHBA 3PTNA 1EZXC 4AFZA 5F6MA 3BEUA 1C1MA 3CS0A 1K1OA 2A0QB 4K5ZA 1QQ4A 4X6MA 3VFEA 4CR9A 1KXDA 2KX4A 1P12E 2QF5A 4FVBA 3KN2A 5JBTA 3RMOH 1F5LA 1F0UA 1A0HB 1GBEA 1C1SA 3PLKA 1C4Y2 1P9SA 1VKYA 4DURA 1SGQE 3FN8A 2O8LA 1O3FA 3A83A 3V0XA 1P04A 1ABIH 5EJZA 1MQ5A 1GJAB 1C1QA 1WU1A 5BRRE 2BLOA 2UWPA 1Q31A 1A61H 5HM9A 1GBJA 2VIDA 2Z9JA 1DOJA 1O5BB 1Y5BT 3N7OA 2XC5A 1GHBF 3QO6A 3TJOA 3CS7A 1QTFA 4TSFD 1TMBH 4GHQA 1NFWA 1OWDA 3LH1A 1G3BA 2AERH 2BX4A 1WAYB 2WPMS 1S5SA 4X6NA 4KKDA 1HGTH 1NBMD 1P8VC 3LGVA 2ZFFH 3SI4H 4B76A 5C94A 1K1LA 3ZZ4A 1EPTC 3U69H 4DY7B 1ZMNA 2CHAB 1VCWA 2FS9A 4RT0A 1GBKA 4JK6A 2ZO3H 1OWKA 4AC9A 3RXEA 3GS9A 4CH2B 2ASUB 4AG2A 4X1QU 5DG6A 1KLJH 2STAE 2BDHA 4I8JA 1V2PT 2VVCA 3F2HA 2XWAA 3KYFA 3M5LA 3B8JA 3K6YA 3MWIU 4ASUD 1SFIA 1C5NH 2H1UA 2Z9IA 5GJ4B 4ABFA 1KY9A 1GCTC 1RS0A 2L6OA 4UE7H 3HKJB 2DUCA 4M7GA 3PB1E 3BSQA 4FUFA 1NFYA 2ZECA 1IHTH 1DICA 3SV6A 5F8XA 1GGDC 1XM1A 1NN6A 4NIXA 4NWLA 1T8OA 1WSSH 1RXPA 2PKSB 3SQEE 1CBWC 2OK5A 1ELVA 3UWJH 3ZV9A 1E1QD 4CHAB 3E0NB 3SNDA 2ZG0H 3ZZDA 2FI3E 4Q7YA 4I31A 4O3UA 1UHBB 4TY7A 2VNTA 1O3NA 4FUIA 5FPYA 3MQKC 1LQDB 3QWCH 3DSGA 3F2FA 4WWYA 4X8SH 1AVGH 2UWOA 2KCPA 1JIMA 2NU4E 2A2QH 3RXCA 1B5GH 1KYNA 1NU9A 5JBBS 4D9RA 1WQVH 4Q7XA 3MNBA 3PMBB 1OWEA 3T62A 4B6FA 1V2MT 3BTDE 4ABIA 1LKAA 3SW2B 2UUFB 3I77A 4FUCA 1YPKH 2FOAA 4J2YB 2PGQB 1FAXA 4O9VA 1ZPCA 1C4U2 5AFYH 1O33A 3A89A 4ZKSU 2ZDLA 1O32A 4Y0YE 3JZ2B 1QA7A 4AZ2B 2RDLA 2ALVA 4X6PA 1MCVA 2C3SA 2ZDMA 1LVYA 3PROA 3Q00A 2GGVB 1ZRKA 1QB9A 4DIHH 2H5CA 4WY3A 6CHAB 1ID5H 1WQSA 1AHTH 1A46H 4RSPA 2A31A 3UB0A 3EYDA 2WUCA 4GLYA 1B0FA 2P8OC 1QJ6B 3TH4H 1S6FA 5FCKA 1BTZA 3AW1A 1EZQA 2ZFTA 4HZHA 3T25A 1MH0A 4A5TS 1ZOMA 3MI4A 1IQJA 1NO9H 5C3NA 4AGJA 2BY7X 1XVOA 4ZMAH 5EQSA 5L2ZH 3MOCA 1MMJN 3T27A 1EOJA 3AAUA 1CA0C 1LHGH 1VJ9U 1MKXK 3TJUA 2YMSC 4CRCA 1TGCA 3BTHE 9LPRA 5FXLA 3K9XB 1GHBG 4Z1MD 1ORFA 2Y5HA 5GPIB 3UOUA 4NIWA 4ZCNA 3RXKA 5F8TA 2ZHWH 4JCNA 1DSUA 2ZQ2A 3A85A 1SLXB 3RLWH 4TWWA 2AGGX 2EY4C 1NM6A 1HB0B 2BQ6B 1AGJA 4D76A 4YT7H 7GCHF 3UQVA 1A2CH 2BY8X 1O3PB 2FOBA 3OFND 3A84A 3PRDA 1V3XA 1P2KA 1B7XB 5ETXA 3KYGA 2K8IA 2O8UA 1DSTA 1EAIA 4K3JA 1LCYA 4WH6A 1GBFA 4NA7A 1INCA 2CV3A 2QAAA 1AFEH 1P2JA 1KSNA 4MDSA 1QNJA 1ELBA 3SI3H 4INKA 3ZIAD 2Q6GA 1DDJA 3TNTA 1G36A 1O34A 4BAKB 3B23B 5EG4A 1CHOF 3SQHE 2OC7A 4KTUA 1BMMH 4NSVA 1TYNA 3FP6E 1FAKH 4IN1A 3RXHA 1WXRA 4JMYA 2A5IA 1XX9A 1SOTA 5HKKD 4NZQA 1KXAA 2HLDD 5IYTA 2OXSA 3EGKH 1P3CA 1AWFH 2EI7A 2BLVA 3ESTA 4YOJA 4NG9H 5LPRA 2WSSD 1AO5A 1ZR0A 4NIVA 4A1XA 1AVWA 1ZZZA 2R9PA 2O8MA 1OYTH 5EQRA 1TRMA 1PPBH 3SZEA 1ZSLA 3IWMA 2GV6A 1SVPA 1J17T 1ACBE 2NU2E 4K1SA 3NPSA 3SOSA 1H8ED 2QF0A 1LVOA 3PO1B 2PLXA 2RCEA 2QE7D 1HDTH 2J9NA 2GZ7A 4I8LA 2VIOA 3TJVA 2Y80A 3MU0A 3DSPA 2QXJA 1MD8A 3RMLH 1SOZA 2ZI2H 1NU7B 2GCHF 4DVAU 2A7JA 3WWBA 5A0CA 1ELFA 4A92A 4B2BA 5K7RA 3KIDU 3GCHB 2J5UA 1HRTH 2TIOA 1FPHH 3GY2A 2Y7ZA 4WJG2 2AMPA 2JETC 4XRNA 4NFEA 1O3IA 1GBIA 5JB9S 1XUJA 1C5VA 2OBQA 3NK8A 1E36B 3TJNA 1XUHA 3ATWA 4Y76A 4I8KA 1VITF 1BQYA 2Y81A 1D3PB 4X0WU 1JMOH 2PSXA 4DJZB 2BD4A 1D3DB 1J14A 2QIQA 4ISIH 2HRVA 5HIYA 1D4PB 1GG6B 1O2TA 2FOFA 1GHYH 1P05A 2ZCLP 2QF4A 3KCGH 3FKSD 3VPKA 1O5DH 1GI8B 1P2OA 1NPMA 4OM9A 1Z8IB 4XBBA 5EPNA 5F03A 3RXFA 4BOHA 1MU6B 4K69A 4F55A 1Y3YA 1H9HE 3F9FA 2C4FH 2SNVA 4FUEA 4MNXA 1LHDH 2A5KA 1EJNA 3TGKE 1BRUP 1IHSH 1O2HA 1TMUH 4UFFH 3KQCA 1PPFE 3SU0A 2BD9A 1YF4A 1MBQA 1GCDA 3SJOA 4XFQA 1TNKA 2GTBA 4BAOB 1QJ1B 1AMHA 1C2LA 4RKJB 2KAIA 2SNWA 2AEIH 3UR9A 2ZCHP 3A7TA 4MNWA 2EEKA 1TPPA 2OD3B 2TGAA 2D8WA 4H42U 3VXEH 1O5GH 4IGDA 1VZQH 1GL0E 4K8YA 3MNSA 4AFUA 1LHEH 1TBQH 7GCHG 1AVXA 3NCLA 4WMFA 3T5FH 2W5EA 1KTSB 3U1JB 1S0RA 2FOGA 3A87A 1AU8A 4JZ1A 3MO6A 4ZXYH 3SJKA 3QLPH 1TABE 2BDGA 5EXMA 5KGOA 1O2UA 2G5NA 1HAZB 2W7UA 3GCTF 4NIYA 1CHGA 3TITA 2W6ID 3LJOA 3SBKA 4XDEA 1O3CA 1RJXB 1QL9A 4Y8ZA 2KR7A 3M7QA 2BM2A 2VIVA 2Z7FE 1FPCH 4AFSA 3P8NA 2A4GA 1O2NA 1TBRH 1BTYA 3AVZA 3BG4C 4YO9A 3NWUA 1W10U 4AFQA 1CHOG 4YM9A 4ABBA 1KDQA 1U6QA 1KLTA 2ZCKP 1BBRK 1P3EA 1S6LA 2WV5A 1MAYA 5DP8A 1RTLA 2JJ1D 4FUHA 3KHVA 1O2MA 2J38A 1ZHPA 1P2NA 4Y7BA 4NA8A 3BTGE 1E35B 5TCCA 4H6SB 8ESTE 1W7GH 1LVMA 2GMTC 3VB6A 1J15A 4FXGH 2CF9H 3TH3H 3SGQE 1MTNC 1W0ZU 1AB9B 1O2WA 1QQUA 2QV1A 1T8NA 2C8YB 4BANB 1V2OT 4GAWA 5C5OA 2KZ4A 5DN6D 2PTCE 1QFKH 1C9PA 1K2I1 4WXIA 2QXGA 4D7GA 3U8OH 5I46H 1C2MA 2ZDNA 2A32A 1CU1A 1LHCH 1HAXB 1Y5AT 1PPGE 1UK2A 1CE5A 1O2KA 1TGTA 1QA0A 1S83A 3SV2H 1BBRE 3A7WA 3ENSB 2HLCA 1EOLA 1FY3A 4OS7A 3ZVAA 1GJBB 1EAXA 3VB5A 3ZZ7A 2GCHG 4XBDA 3T29A 4F48B 8KME2 3BTTE 1NRSH 1GBAA 1BTXA 2NU3E 1RIWC 2CF8H 2BDAA 1O2OA 1BMLA 1BTUA 1P03A 2ZA5A 2ZIQH 3I29A 4ABAA 3GY3A 2BQWB 3VGCB 1TOMH 3SNAA 1UCYH 5BPEA 2RFKC 1B0EA 5FPSA 1VITG 2HOBA 3RM0H 1HIAA 3E90B 1XKAC 2ZHEH 3D65E 4U32A 4Z0KA 2RA3A 3GDVA 1OYQA 2F9VA 4WH8A 4IW4E 3OAAD 1BOQA 2OCVB 4ACAA 4AORA 1GJ8B 1BRBE 2H2ZA 2ANMH 2SGDE 3I78A 3RXVA 1O2RA 2AGEX 3BEIB 1T7CA 3UUZA 2ZGHA 4TYDA 3A8AA 5AVDA 3HKIB 3S9AA 2ODYB 1DUEA 5AF9H 3D23A 2ZFQH 1EASA 5HGGA 1PJPA 3D49H 2GX4A 3OU0A 4YLQH 5KECA 5EW2H 4AG1A 3F3BA 2AIQA 1SGPE 3PLBA 1G2LA 2BVXH 3W1EA 1NTPA 4O3TA 4MNVA 1IQHA 2A2XH 2OBOA 2ZWLH 1SLWB 1TNLA 4GCHF 1UVSH 2UWLA 1SR5C 1F5RA 1GHVH 2P3TB 2G00A 3STJA 1ANDA 2FYRA 4FUGA 3RXQA 2HALA 1AUJA 3U98H 4BAHB 3OTPA 2DE9A 2UUYA 3KGPA 4X2YA 3TPIZ 1O3MA 2FWWA 2XNIA 1O3OA 3F9EA 3MTYA 1BMNH 1RD3B 3AK5A 1FN8A 3HGPA 2FOCA 2TGDA 1GJ9B 1V2VT 5HYOA 3GCTG 1BUIA 2P93A 1FX0B 4HTCH 2JH6D 2Z3DA 3U9AH 2JKHA 4YOIA 2EA3A 4B74A 2FX6A 1UW7A 1AIXH 3TK6A 1SB1H 2THFB 3RC5A 2AMDA 2V7QD 5ESBA 4JYTA 1GI4A 2J2UA 3S7HB 5L2YH 3KF2A 2OP9A 1IAUA 1Z1JA 3RLYH 1TA6A 2B7DH 1D6RA 1MAXA 5DPAA 4VGCB 1W12U 1UTNA 2JH0D 2P3FH 3UY9A 2FIRH 4ISHH 1S82A 1WOFA 4NA9H 5GXPA 8GCHF 1C5PA 1JBUH 3DFLA 1FIZA 1PQAA 2H9EH 1SQRA 1UVOA 3SYJA 1CGJE 2GP9B 3E1XB 3M35A 1DFPA 4Y6DA 1E38B 5TJXA 2Z9KA 2PKSC 3H7OA 1TOCB 2XBXA 2VVUA 3T26A 1O3AA 1P2QA 1XXFA 1SC8U 5GNDA 4CHAC 2FTMA 3EA7A 2KAIB 3ZVCA 5GWZA 1MZDA 2QXHA 1MTUA 2CN0H 1TQ0B 2ZGJA 5EPYA 1COWD 1QR3E 1K21H 2ZFRH 3RU4E 3NRLA 3VG8A 2PUXB 3SV9A 1TQ7B 3KL6A 3RC4A 2ZQ1A 3F0OA 3KQDA 2XBYA 4E7NA 1NC6A 1RTFB 2FEQH 1OX1A 1Y8TA 3CENA 1E37B 1S6HA 3A8CA 2PTNA 1PFXC 5L6NH 1FQ3A 2ZNKH 3SNBA 2O8TA 2EC9H 2RG3A 2HNTF 4XSKU 3ZVBA 3MH5A 1J16A 1ELTA 1GJ7B 1VGCB 3LONA 1W14U 1XUKA 7ESTE 1GHAF 5HMAA 2JIZD 4ASHA 2D26C 3OSYA 5FBEA 3U1IB 5EQQA 1P9UA 1O2QA 5E2PA 1SGCA 1O30A 1KDQB 6CHAC 1CT2E 3RDZA 5CMXH 2F9BH 1O3HA 1FN6A 3UAIC 2FOMB 1FV9A 2BOHB 2LP6A 1ZJDA 1Q2WA 3M7TA 4Y8YA 1BMFD 5DP9A 3HPTB 2XW9A 3PRBA 2ZF0H 1YY3A 5J4SA 5CHBA 2BXTH 1DWEH 3TNSA 1P57B 2IPHA 1C5QA 1K1JA 1ETSH 1VCPA 1Y3WA 4J1YA 4Q4LA 1ZRBA 3TU7H 4CRDA 4JZIA 1UMAH 3RXMA 4KTCA 2J95A 5B6OA 1W0KD 3T2NA 2XOKD 3LGWA 4HFPB 3CNRA 1ZPZA 1MUEB 4XD7D 2CJIA 4XBCA 3SV8A 2XCNA 4CR5A 2W6JD 3S9BA 1SBWA 1O2ZA 3HK3B 1W0JD 5EXNA 2FZZA 2EQNA 1AFQB 3SU2A 1TALA 2KCOA 2ZKSA 4GCHG 4M9FA 1V6DA 2AS9A 1P11E 2Z9LA 1IQKA 5DKMA 1KLIH 3M5OA 3PWBA 2AHME 2WZQA 1AZ8A 4ZKNU 3M3VA 5DP7A 1UK4A 1GI9B 3RXAA 1MTVA 2SFAA 1JXPA 4MQAA 2F4LA 3WW7A 3A7XA 1Z1IA 2YOLA 1K1NA 2C90B 1TLDA 1NBME 2KCAA 1L2EA 4ZHLU 1THSH 3EDXB 3PMJA 4LK4A 2BMGB 3EQ0H 3PLPA 1C2JA 1A0LA 4H4FA 4CRBA 2BLQA 2LNCA 4OS4A 1HIAB 1H4WA 1A3EH 3RXBA 1FNIA 1EJAA 1GHXH 1DY9A 1N8OC 2D2DA 3SZNA 4AYVB 1XUGA 2BB4A 1O2LA 2F43B 1OP0A 5G4BA 3VB7A 1F92A 2F9UA 1GJ5H 1G3EA 1OP2A 1TFXA 2Q1JA 1GHWH 1MQ6A 2V35A 1ELDE 8GCHG 3L33A 4ZUHA 3WWFA 3LGIA 1VR1H 2FS8A 2XYAA 2BVRH 2BVSH 2BD3A 1BJUA 1HNEE 1Z8RA 2AH4X 1GL1A 4K60A 2NWNA 1JRSA 2VJ1A 1UTKA 5DP3A 3M3SA 5A8YA 1O38A 1TX7A 4MTBA 1N6YA 3ZVGA 1HCGA 2IOTA 1ZMJA 2JDID 3FO8D 1JOUB 2QN5T 2BDIA 2Y82A 3PO1C 1HAGE 4OGYA 1XXDA 4FVDA 2G81E 1GCTB 1YKTA 2W26A 2F3CE 2GZ8A 5DGJA 3IITA 3OEED 1H9LB 2ZP0H 1EKBB 4MG3A 3OEHD 1E1RD 4U01A 3VXFH 1W7XH 2P94A 2ZHFH 1GMHF 4FUJA 3EA9A 3L6PA 4X8VH 1WYKA 1UTPA 4JZEH 1BITA 2KCYA 4AB8A 1SGDE 6LPRA 3GCHC 2HVXA 1GHAG 2QCYA 3LGUA 2ZZUH 2IN2A 3NKKA 1G32B 4HG6A 1Y59T 2QA9E 3MU5A 4WMEA 3SV7A 2Z3CA 1DXPA 1BDAA 1G30B 1K1MA 1FMGA 2H5DA 1BRCE 3W95A 1ZJKA 6GCHF 3LKWA 4NWKA 1FY8E 3P70B 1O3LA 5IK2D 1GG6C 1DS2E 3SU1A 2FOHA 2FYQA 4I32A 1ANCA 1S85A 2VGCC 1J8AA 3RXRA 1W13U 2FX4A 1EX3A 1BMAA 2HNTE 1PYTC 2FP7B 1H8DH 3GY6A 2PW8H 2ILNA 1EATA 5E0JA 5C0TA 3URDA 3A8DA 3SUGA 4LZ1H 3ATIA 3LC5A 1MKXH 1O5CB 1BTHH 1O2IA 1EB2A 3MNCA 4IBLH 3L3TA 4X1RU 1A5HA 2KM0A 2C8XB 3KQEA 1C2EA 1BTPA 5EU8A 2RA0A 2WINI 4WMDA 4D9QA 1AN1E 1O3KA 1WDIA 4K1EA 1T4UH 5E0HA 4XE4A 1W8BH 1HYLA 1QL7A 1S81A 5CE1A 5GDSH 1ANBA 1C5YB 5B6LA 3C1KA 9ESTA 4FUBA 4U2WA 1QBOA 1Z71A 4CRFA 5FBIA 3SU5A 2L74A 3LIWA 5JPMH 2XC4A 3AW0A 1C1WH 2YNBA 1C1UH 2WHXA 2O9QA 1GMCF 3QUMP 2PKAA 3QZRA 1TNHA 1OXGA 1TBZH 1TAWA 3OY5U 1T8MA 1UJ1A 2QF3A 3RXGA 2OINA 4GHTA 2BD7A 3QDZB 5C1UA 1GJDB 3U28C 1O36A 3RP2A 3F9HA 3ZVDA 4MLFB 3BG8A 1DITH 3TGJE 2CGAA 4Y11E 1F0RA 1YPHE 3SGAE 1BHXF 1EJMA 5TCAA 4X6OA 3HGNA 1ZGIA 1UTLM 3NZIA 2FO9A 4X2VA 3O8BA 2Q6DA 3RC6A 1HXFH 3MU8A 3G01A 4SGAE 3ODFA 2ZDAH 2A4OA 2FESH 1K1PA 5A0BA 3ZZ3A 1V2WT 1O2GH 3IG6B 1OSSA 4Q80A 7KMEH 1AB9C 1A5IA 2ZPRA 3MU4A 2LPRA 1YGCH 2A1DB 3A88A 1MTWA 3MO3A 1OP8A 3RM2H 4Q7ZA 1CVWH 4P02A 1GBHA 5C0UA 1C5MD 4K2YA 5EXLA 2C8WB 1H1BA 4FU7A 1P01A 1O0DH 1YBWA 5K0HA 5T3HA 5ABWA 1K9OE 1ZGVA 2EI6A 2OQ5A 2H9TH 4INLA 3FP8E 2IPQX 4DT7B 1LPZB 4H6TA 3F1SB 2Y5FA 1SMFE 1DWCH 2V6NA 1QHRB 3BV9B 4GPGA 1GMHG 1O2PA 4I8HA 1HAVA 3BIUH 3P8FA 4BTIB 4NSYA 2PGBB 1SGIB 1QRZA 2BD5A 4QT8C 2WYJA 5DP6A 3BTWE 3BEFB 5SGAE 1F7ZA 1WBGB 3SU4A 1SGFA 2OLGA 4Y71A 1LPGB 2FXRA 4OS6A 5F8ZA 1YCPM 3VGCC 3EA8A 2A7CA 1E0FD 4ISOA 1SGFG 4B71A 4RKOB 1YPGH 1FUJA 6GCHG 1DE7H 1ELGA 4F4OC 1JWTA 3GYMA 4IC6A 3GICB 4B2AA 5HXFA 1PQ5A 1ESTA 2GV7A 2AMQA 5T6GA 1LO6A 5FL7D 1C5LH 3S0NA 4PROA 3GDUA 1TNGA 1BB0B 1RRKA 1V2LT 2BQ7B 3E6PH 1OOKB 1YPHC 2ANKH 3BTKE 2R2MB 3QTOH 3UREA 5I25A 2PUQH 3ZYDA 1A5GH 1GJ4H 4OS5A 4TY6A 4A1TA 1LVBA 2CXVA 4KP0A 3GISB 4YLUA 2JH5D 1GVLA 3EE7A 2O8WA 4MPXA 2WPDD 1HJ8A 3LPRA 1DVAH 3SUFA 1GDUA 4X2XA 4WXVA 1H9IE 1MBMA 2VWOA 1WTGH 4DCDA 1PPEE 3FFGA 4A6LA 1BTWA 4DOQA 3UQOA 4UFDH 3VB3A 1DANH 3A81A 4JYUH 5JYIA 3S7KB 7LPRA 3BTME 1GWAA 2XC0A 1TMTH 4INHA 2CMYA 3O8RA 4JZDH 1AQ7A 3OE7D 1HAOH 1IQLA 2ZU3A 1YCPK 1ZTKA 1AY6H 1C1NA 2ZGBH 2PFEA 1GMCG 3S69A 2B5TB 3QZQA 3Q3KA 1ZSJA 1GJ6A 4Q2KA 1C1PA 1C2GA 3LH3A 2ALPA 5CHAB 2XNDD 1UCYE 1GBCA 4X8TH 3RXUA 3UNSA 5DK1A 1GJCB 1SG8B 2A45B 5FHTA 2ZTYA 3RXOA 1GPZA 1RGQA 3KQ5A 3RXTA 1GHZA 4NZLA 1TGNA 3A82A 4VGCC 1BBRH 1GI7B 2ZEBA 3E91A 3Q3XA 1ZLRA 2HPQH 4CREA 4FOUC 3GYLB 5DJ7A 2ZC9H 2STBE 2JJ2D 2WPJS 3M3TA 3SGBE 1RTKA 2XCFA 5PTPA 4A7IB 1TIOA 2ZTXA 1CGIE 4GUXA 1OWJA 2VH0A 3LDXH 4R8TB 1O3BA 4DIIH 1MD7A 3R0FA 1YPEH 1EP6A 1IQGA 1EPTA 3EE0B 2GDEH 1C5XB 1CQQA 2ZHQH 2DE8A 2IJD1 1C5ZB 1GVKB 3ZZ9A 1C4V2 1F5KU 6ESTA 5LPFA 1D3QB 1DLEA 3W94A 3RXDA 4UEHH 1ZSKA 3SHCH 2VBCA 3UNQA 1FONA 2BYAX 3MMGA 4KGAA 1XMNB 1MU8B 1XUIA 5F53A 2ZFSA 2XBVA 1IQEA 2TPIZ 2G4TA 3H7TA 2RDEA 5HM2A 3SN8A 1SKYE 4Z6AH 4RN6A 2PKAB 3SJ9A 1TPSA 1NRQH 2CHAC 1HJAB 1SI5H 1QB6A 2I6QA 1QL8A 2HGTH 3RXSA 1GI6A 2J34A 1J9CH 4FU8A 2J4IA 3VB4A 2ZFPH 5FCRA 1YYY1 1S84A 2GVFA 1PQ8A 1TGBA 3F9GA 3RXIA 1C9TA 1DX5M 2FMJA 5EODA 4TT3D 5DP4A 5EGMA 2BDYA 3DA9B 4NCYA 1GMDF 4E05H 1IQIA 3TVJB 3Q3YA 3M37A 2UUJB 1BRAA 1G9IE 1AKSB 4XOJA 1QJ7B 3LU9B 4IMQA 1YPLH 1TA2A 2V3MA 4LXBH 2XXLA 4JZFH 1LDTT 1N1LA 2PR3A 3DCLA 2G55A 1EUFA 4UFEH 4CRAA 5JBAS 5EOKA 2VH6A 2HPPH 1O5FH 4ZAEA 1FY1A 3ATKA 1AFQC 3LC3A 4SGBE 2FOEA 2GZ9A 1P2IA 1Y5UT 3M7UA 3ZZBA 3SUDA 3S9CA 2VU8E 5FAHA 1HXEH 3MH4A 1EZUC 3M5MA 4BXWA 1AWHB 1DM4B 1HAVB 1O5AB 2WPHS 4KTSA 4ABDA 1ANEA 2R3UA 2Z94A 2ZU1A 5DO4H 1MTSA 1CGHA 1SHYA 1IQFA 1Z7KA 2ZGCA 1QRWA 1RFNA 1DWBH 2ZPQA 4OS1A 2YMSD 1EXFA 2TRMA 5C20A 3DFJA 1G37A 1V2KT 1GBTA 1ZTJA 4MVNA 2I6SA 3A7VA 1O3GA 1GDQA 1O31A 2P3UB 5C1XA 2BY5X 1T4VH 4ABHA 1CT0E 4X2WA 2AFQB 1XVMA 1UO6A 2J98B 4Y8XA 2SGAA 5E8EH 3GY4A 1F0SA 1K1IA 3PMHB 1TPAE 3Q77A 3QTVH 1QY6A 1CA8B 2OC8A 3PMAB 4RI0A 1JRTA 3FANA 1YPJH 4X8UH 4WF8A 1CT4E 1SLVB 2M2AA 3QGJA 2ZDVH 1FI8A 1IQNA 1Q3XA 1GI5A 1TX8A 1M9UA 1HAPH 1DLKB 1SGYE 3M61U 2LELA 2GT7A 3GY7A 3UPEA 3UWIA 1MCTA 2FI4E 2XTTB 2GCTB 4I33A 3ZZ5A 3H09A 3A8BA 1KIGH 1O3DA 3UR6A 4AN7A 3ZZAA 1FDPA 4OS2A 4DGJA 1C5SA 4DW2U 1G3CA 5JDUB 1PYTD 3O8DA 5A0AE 2OC1A 4TPIZ 1O3EA 1C1OA 4E7RG 2Y5GA 4ABJA 1YM0A 3A7ZA 2GT8A 1ARCA 1Z8JB 2BD2A 1FJSA 2XWBI 1ZTLA 3DHKH 1V2NT 1KXEA 1HAHH 2A7HA 1WTHD 3V13A 1GBBA 4CH8B 2XRCA 5C5NA 1G2MA 2QGRA 2PWXA 1LHFH 1T31A 1L1GA 1T32A 2FODA 3HK6B 1NFXA 3LGYA 1DUAA 1G3DA 1W3CA 2XBWA 1DWDH 3N7DA 3T28A 3BF6H 1QB1A 1BHXB 1A1RA 1HJ9A 2BZ6H 2WPLS 4ZROA 3RXJA 4Y10E 5T6FA 1SSXA 1THPB 5A2MH 2G51A 3KNXA 1P2MA 3SUEA 3SORA 1JIRA 5J4QA 2BDBA 5A09A 2QC2A 1LMWB 3MYWA 1UTOA 2VWMA 5FX6A 2W7SA 1C2IA 4A1VA 1AZZA 5A8XA 1ELAA 4Q63A 1TRNA 1GMDG 1Y3VA 3ZVEA 2Z9GA 3RXPA 4I7YH 1SGRE 3KEEA 1GI1A 2B0FA
chains in the Genus database with same CATH topology
4D8NA 1C5TA 1GI0A 2P16A 2WYGA 3ZVFA 1BIOA 4IS5A 1EPTB 1MKWK 3STIA 1PPHE 1DXWA 1O2JA 3E8LA 3V12A 1Z6JH 2Q6FA 3GY5A 3B9FH 1ETRH 1EQ9A 1F0TA 2GD4B 4GSOA 4YZUA 1O2XA 1E34B 2VB0A 5EW1H 1L1NA 2QYIA 1W0YH 5LH8A 4CBOA 3MH7A 1AUTC 5AFZH 3P92A 4HGCA 1A7SA 3OY6U 2R0KA 3ZZ6A 4UONA 1O3JA 1WCZA 1SGNE 2V0BA 2BX3A 3MU1A 1N6XA 4TWYA 5GCHF 1L4ZA 3FAOA 4YT6H 1GBLA 3P6ZB 1HUTH 4HI3A 4U30A 3GOVB 3ZV8A 3NXPA 2AIPA 2VIQA 1ELCA 1YC0A 1GGDB 3QX5H 3AAVA 2P59A 1V2TT 1CO7E 3FZDA 1CBWB 2Y7XA 3TK9A 3E3TA 3SNCA 3GDSA 1P0SH 3QK1A 2FPZA 2VWNA 3TH2H 3SHAH 4MNYA 1CSOE 3ZYEA 2BOKA 3A80A 1EZSC 1UK3A 3FP7E 2F9OA 2SGPE 2Z6BD 2D1JA 1NRNH 3NUMA 3D62A 1GI2A 1C5RA 3MFJA 2GDDA 2BLWA 1UTQA 2BTCE 3F6UH 1MKWH 1NS3A 1SHHB 2H9HA 3A7YA 1ZHMA 2TBSA 4BXSA 3ITIA 4O03A 1EAWA 1SQAA 2FLRH 2F9PA 1ARBA 1DT2A 1TONA 1TWXB 2J92A 3RMNH 2YNAA 1UVPA 1Z6EA 2A4RA 1C2KA 4UFGH 1N8OB 3UOPA 3DD2H 3UNRA 1IQMA 3PWCA 1HAIH 1O2SA 1ZHRA 1DPOA 2VIPA 1NRRH 1LPKB 1LKBA 1IOEA 1HFDA 4IN2A 2V3HH 1HBTH 1DY8A 3MH6A 3KQBA 1AI8H 3UIRA 3AASA 1V2UT 2P8OB 2WV4A 1Y3UA 1GVZA 1KXFA 3PTBA 4AOQA 2C93B 1AD8H 1C5WB 2ZPSA 4ABGA 4ZXXH 1XUFA 1TNJA 3SO3A 4YTAA 1QURH 1C5UA 5H4IB 2G5VA 1WV7H 1YLCA 1BZXE 3CP7A 1AE5A 1C2HA 3LJJA 3R3GB 2PV9B 2BY6X 3LGTA 2TGPZ 4B2CA 2F83A 3VEQB 1QIXB 2G8TA 1SGTA 2ZU4A 2SGEE 1KXBA 1YPMH 2W3KA 3EAJA 3TLOA 1CA0B 3MO9A 4CRGA 3GY8A 4BAMB 3M36A 2B8OH 3K65B 1TRYA 1VCQA 4CBNA 1QCPA 4UDWH 4TPYA 2J94A 1K28D 1O5EH 2BD8A 3F68H 1UTMA 2QXIA 1BCUH 3A86A 4AYYB 2VWLA 4NFFA 4ISLA 1OKXA 2G52A 5C67A 1OWHA 1PPZA 1P06A 1AKSA 2FTLE 4JYVH 3GCNA 3ELAH 1A0JA 2HNTC 3U8RH 3GCOA 1L1JA 1UVUH 1ETTH 2K1QA 1T8LA 3QN7A 1O2VA 2UUKB 1THRH 1V2RT 5GCHG 5DP5A 1SQTA 2R0LA 4LZ4B 1HPGA 3MNXA 1C5OH 2VGCB 3U8TH 4GVUA 2EI8A 3PV4A 1H8IH 2OTVA 3OYPA 1GDNA 1A3BH 1C2DA 1FY4A 1GBMA 3ZZ8A 4B1TA 4D7FA 2ZHDA 2ULLA 4ZHAA 5T6DA 4BAQB 3SJIA 1HLTH 1FIWA 2H6MA 2ZU2A 5CHAC 2ZTZA 4X1PU 1O39A 1VJAU 3E16B 3URCA 3DT0H 1AE8H 1PQ7A 1W2KH 2VVVA 1GI3A 2TGTA 3ATMA 1FLEE 3K2UA 1O2YA 1XKBC 1NY22 2QY0B 2ANYA 2Z3EA 1MZAA 1QRXA 3BTEE 1C2FA 3SJ8A 3SNEA 4ZHMU 4Y0ZE 1NT1A 2BHGA 5A8ZA 1UVTH 1ZPBA 5L30H 3JZ1B 4BTTB 2WPIS 3BIVH 4NGAH 4OGXA 4MPUA 3PYHA 3UTUH 4UD9H 2JETB 1O37A 2W3IA 5ESTE 1PPCE 2A4QA 2OQUA 1KXCA 4FU9A 4ISNA 1TE0A 2F91A 4E06H 1NFUA 1UCYK 3FVFB 5E0GA 1EP5A 2ODPA 1NROH 1ESAA 1TNIA 5LPEA 1SQOA 1ELEE 2ANWA 2FI5E 5GIBA 2FDAA 1TB6H 4YESB 1NZQH 1EAUA 3FZZA 3ATLA 4ESTE 2NU0E 2R3YA 4R0IA 2P95A 3TK5A 1QBVH 2BXUH 2FLBH 1QBNA 2VIWA 5JB8S 2VINA 4MPWA 1SFQB 1C1RA 1V2JT 1EB1H 1NESE 4B75A 4ABEA 8LPRA 1KTTB 2HWLB 1HJAC 1TGSZ 1ZYOA 4F49A 3RMMH 2SGFE 2SGQE 2BZAA 1S0QA 5E2OA 2IJOB 4MPVA 3V3MA 2ZU5A 3P8OA 2FM2A 2WUBA 1UHBA 5FPTA 1K22H 1Z8GA 1D9IA 2M5TA 3K6ZA 3P95A 3LT3A 1OWIA 2WPKS 5AHGH 1D3TB 5C1YA 4I8GA 1YLDA 2ESTE 1A4WH 3E0PB 3QGNB 1V2ST 3OX7U 3DUXH 2AYWA 4LOYH 4DG4A 1W11U 2A5AA 1SPJA 3TIUA 1OPHB 1FXYA 1UTJA 1C1TA 5LGOA 4KELA 4AGKA 5IDKA 3BN9A 4X1SU 4YOGA 1C1VH 1X7AC 3MHWU 1SL3A 4K8BA 3ZZCA 1SGEE 2C8ZB 4AB9A 1FY5A 1ESBA 3BTQE 2BDCA 2NU1E 4WVPE 4B73A 3RU4T 1V2QT 1ABJH 1HAYB 2V3OH 1OS8A 3BG4B 1TX6A 3M5NA 4FUDA 1BT7A 3ODDA 2GKVE 3H5CB 3PM3A 3OTJE 1YP9A 2ZDKA 3TGIE 1GBDA 3Q76A 4O97A 2F9NA 4IC5A 1P02A 3V7TA 2PSYA 1YCPH 4THNH 3SU6A 2GMTB 1SLUB 5JBCS 4IMZA 3P8GA 4AX9H 4X1NU 1FZZA 3SU3A 1VGCC 2B9LA 3RU4D 1QGFA 1MTNB 3LOXA 1TPOA 2R2WU 1Y3XA 2BY9X 4Y79A 4BTUB 5C2ZA 4K1TA 4Y7AA 2OUAA 3UFAA 4BNRA 3HATH 5FX5A 3RXLA 2OC0A 4JK5A 4ZKOU 1P10A 3WY8A 1LQEA 2AGIX 1O35A 1VITH 1P09A 3P17H 1NRPH 2ODQA 2G4UA 1L0ZA 3BTFE 1L4DA 2Y6TA 1D6WA 3O8CA 1BA8B 3C27B 1BJVA 1F2SE 2ZGXH 3RUOA 2GCTC 1WUNH 1HV7A 4ZH8A 1ZMLA 1RIWB 4ZKRU 1LTOA 2PHBA 3PTNA 1EZXC 4AFZA 5F6MA 3BEUA 1C1MA 3CS0A 1K1OA 2A0QB 4K5ZA 1QQ4A 4X6MA 3VFEA 4CR9A 1KXDA 1P12E 4FVBA 3KN2A 5JBTA 3RMOH 1F5LA 1F0UA 1A0HB 1GBEA 1C1SA 3PLKA 1C4Y2 1P9SA 4DURA 1SGQE 2O8LA 1O3FA 3A83A 3V0XA 1P04A 1ABIH 1MQ5A 1GJAB 1C1QA 1WU1A 5BRRE 2BLOA 2UWPA 1Q31A 1A61H 5HM9A 1GBJA 2VIDA 2Z9JA 1DOJA 1O5BB 1Y5BT 3N7OA 2XC5A 1GHBF 3QO6A 3TJOA 3CS7A 1QTFA 1TMBH 4GHQA 1NFWA 1OWDA 3LH1A 1G3BA 2AERH 2BX4A 1WAYB 2WPMS 1S5SA 4X6NA 4KKDA 1HGTH 3LGVA 1P8VC 2ZFFH 3SI4H 4B76A 1K1LA 3ZZ4A 1EPTC 3U69H 4DY7B 1ZMNA 2CHAB 1VCWA 2FS9A 1GBKA 4JK6A 2ZO3H 1OWKA 3RXEA 4CH2B 2ASUB 4AG2A 4X1QU 5DG6A 1KLJH 2STAE 2BDHA 4I8JA 1V2PT 2VVCA 2XWAA 3M5LA 3B8JA 3K6YA 3MWIU 1SFIA 1C5NH 2H1UA 2Z9IA 5GJ4B 4ABFA 1KY9A 1GCTC 1RS0A 4UE7H 3HKJB 2DUCA 4M7GA 3PB1E 3BSQA 4FUFA 1NFYA 2ZECA 1IHTH 1DICA 3SV6A 5F8XA 1GGDC 1XM1A 1NN6A 4NIXA 4NWLA 1T8OA 1WSSH 1RXPA 2PKSB 3SQEE 1CBWC 1ELVA 3UWJH 3ZV9A 4CHAB 3E0NB 3SNDA 2ZG0H 3ZZDA 2FI3E 4Q7YA 4I31A 4O3UA 1UHBB 4TY7A 2VNTA 1O3NA 4FUIA 5FPYA 1LQDB 3QWCH 4WWYA 4X8SH 1AVGH 2UWOA 1JIMA 2NU4E 2A2QH 3RXCA 1B5GH 1KYNA 1NU9A 5JBBS 4D9RA 1WQVH 4Q7XA 3MNBA 3PMBB 1OWEA 3T62A 1V2MT 3BTDE 4ABIA 1LKAA 3SW2B 2UUFB 3I77A 4FUCA 1YPKH 2FOAA 4J2YB 2PGQB 1FAXA 4O9VA 1ZPCA 1C4U2 5AFYH 1O33A 3A89A 4ZKSU 2ZDLA 1O32A 4Y0YE 3JZ2B 1QA7A 4AZ2B 2RDLA 2ALVA 4X6PA 1MCVA 2C3SA 2ZDMA 1LVYA 3PROA 3Q00A 2GGVB 1ZRKA 1QB9A 4DIHH 2H5CA 4WY3A 6CHAB 1ID5H 1WQSA 1AHTH 1A46H 4RSPA 2A31A 3EYDA 2WUCA 4GLYA 1B0FA 2P8OC 1QJ6B 3TH4H 1S6FA 5FCKA 1BTZA 3AW1A 1EZQA 2ZFTA 4HZHA 3T25A 1MH0A 4A5TS 1ZOMA 3MI4A 1IQJA 1NO9H 5C3NA 4AGJA 2BY7X 1XVOA 4ZMAH 5EQSA 5L2ZH 3MOCA 1MMJN 3T27A 1EOJA 3AAUA 1CA0C 1LHGH 1VJ9U 1MKXK 3TJUA 4CRCA 1TGCA 3BTHE 9LPRA 5FXLA 3K9XB 1GHBG 1ORFA 2Y5HA 5GPIB 3UOUA 4NIWA 3RXKA 5F8TA 2ZHWH 4JCNA 1DSUA 2ZQ2A 3A85A 1SLXB 3RLWH 4TWWA 2AGGX 1NM6A 1HB0B 2BQ6B 1AGJA 4D76A 4YT7H 7GCHF 3UQVA 1A2CH 2BY8X 1O3PB 2FOBA 3A84A 1V3XA 1P2KA 1B7XB 5ETXA 2O8UA 1DSTA 1EAIA 4K3JA 1LCYA 4WH6A 1GBFA 4NA7A 1INCA 2CV3A 2QAAA 1AFEH 1P2JA 1KSNA 4MDSA 1QNJA 1ELBA 3SI3H 4INKA 2Q6GA 1DDJA 3TNTA 1G36A 1O34A 4BAKB 3B23B 5EG4A 1CHOF 3SQHE 2OC7A 4KTUA 1BMMH 4NSVA 1TYNA 3FP6E 1FAKH 4IN1A 3RXHA 4JMYA 2A5IA 1XX9A 1SOTA 4NZQA 1KXAA 5IYTA 2OXSA 3EGKH 1P3CA 1AWFH 2EI7A 2BLVA 3ESTA 4YOJA 4NG9H 5LPRA 1AO5A 1ZR0A 4NIVA 4A1XA 1AVWA 1ZZZA 2R9PA 2O8MA 1OYTH 5EQRA 1TRMA 1PPBH 1ZSLA 3IWMA 2GV6A 1SVPA 1J17T 1ACBE 2NU2E 4K1SA 3NPSA 3SOSA 2QF0A 3PO1B 1LVOA 2PLXA 2RCEA 1HDTH 2J9NA 2GZ7A 4I8LA 2VIOA 3TJVA 2Y80A 3MU0A 2QXJA 1MD8A 3RMLH 1SOZA 2ZI2H 1NU7B 2GCHF 4DVAU 2A7JA 5A0CA 1ELFA 4A92A 4B2BA 5K7RA 3KIDU 3GCHB 1HRTH 2TIOA 1FPHH 3GY2A 2Y7ZA 4WJG2 2AMPA 2JETC 4NFEA 1O3IA 1GBIA 5JB9S 1XUJA 2OBQA 1C5VA 3NK8A 1E36B 3TJNA 1XUHA 3ATWA 4Y76A 4I8KA 1VITF 1BQYA 2Y81A 1D3PB 4X0WU 1JMOH 2PSXA 4DJZB 2BD4A 1D3DB 1J14A 2QIQA 4ISIH 2HRVA 1D4PB 1GG6B 1O2TA 2FOFA 1GHYH 1P05A 2ZCLP 3KCGH 3VPKA 1O5DH 1GI8B 1P2OA 1NPMA 1Z8IB 4XBBA 5EPNA 5F03A 3RXFA 4BOHA 1MU6B 4K69A 1Y3YA 1H9HE 3F9FA 2C4FH 2SNVA 4FUEA 4MNXA 1LHDH 2A5KA 1EJNA 3TGKE 1BRUP 1IHSH 1O2HA 1TMUH 4UFFH 3KQCA 1PPFE 3SU0A 2BD9A 1YF4A 1MBQA 1GCDA 3SJOA 4XFQA 1TNKA 2GTBA 4BAOB 1QJ1B 1AMHA 1C2LA 4RKJB 2KAIA 2SNWA 2AEIH 3UR9A 2ZCHP 3A7TA 4MNWA 2EEKA 1TPPA 2OD3B 2TGAA 2D8WA 4H42U 3VXEH 1O5GH 4IGDA 1VZQH 1GL0E 4K8YA 3MNSA 4AFUA 1LHEH 1TBQH 7GCHG 1AVXA 3NCLA 4WMFA 3T5FH 2W5EA 1KTSB 3U1JB 1S0RA 2FOGA 3A87A 1AU8A 4JZ1A 3MO6A 4ZXYH 3SJKA 3QLPH 1TABE 2BDGA 5EXMA 1O2UA 2G5NA 1HAZB 2W7UA 3GCTF 4NIYA 1CHGA 3TITA 3LJOA 3SBKA 4XDEA 1O3CA 1RJXB 1QL9A 4Y8ZA 3M7QA 2BM2A 2VIVA 2Z7FE 1FPCH 4AFSA 3P8NA 2A4GA 1O2NA 1TBRH 1BTYA 3AVZA 3BG4C 4YO9A 3NWUA 1W10U 4AFQA 1CHOG 4YM9A 4ABBA 1KDQA 1U6QA 1KLTA 2ZCKP 1BBRK 1P3EA 2WV5A 1MAYA 5DP8A 1RTLA 4FUHA 3KHVA 1O2MA 2J38A 1ZHPA 1P2NA 4Y7BA 4NA8A 3BTGE 1E35B 5TCCA 4H6SB 8ESTE 1W7GH 1LVMA 2GMTC 3VB6A 1J15A 4FXGH 2CF9H 3TH3H 3SGQE 1MTNC 1W0ZU 1AB9B 1O2WA 1QQUA 2QV1A 1T8NA 2C8YB 4BANB 1V2OT 4GAWA 5C5OA 2PTCE 1QFKH 1C9PA 1K2I1 4WXIA 2QXGA 4D7GA 3U8OH 5I46H 1C2MA 2ZDNA 2A32A 1CU1A 1LHCH 1HAXB 1Y5AT 1PPGE 1UK2A 1CE5A 1O2KA 1TGTA 1QA0A 1S83A 3SV2H 1BBRE 3A7WA 3ENSB 2HLCA 1EOLA 1FY3A 4OS7A 3ZVAA 1GJBB 1EAXA 3VB5A 3ZZ7A 2GCHG 4XBDA 3T29A 8KME2 3BTTE 1NRSH 1GBAA 1BTXA 2NU3E 1RIWC 2CF8H 2BDAA 1O2OA 1BMLA 1BTUA 1P03A 2ZA5A 2ZIQH 3I29A