1P2IA

Structural consequences of accommodation of four non-cognate amino-acid residues in the s1 pocket of bovine trypsin and chymotrypsin
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural consequences of accommodation of four non-cognate amino acid residues in the S1 pocket of bovine trypsin and chymotrypsin.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Trypsinogen, cationic
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1p2iA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1p2iA02
1JMOH 1ARBA 1QR3E 4XFQA 1NFYA 1DOJA 3F1SB 1C1PA 1QJ6B 2Z9JA 4UFEH 4BTUB 5EODA 2FYQA 5EQSA 3RXOA 1SFQB 1C4Y2 3PWCA 1TFXA 3M35A 1ZR0A 4GAWA 2VIOA 4CRAA 1V6DA 1NC6A 2OUAA 3P8NA 1SVPA 1NU9A 2WPHS 1G36A 3STJA 2B9LA 1NFWA 4XSKU 1RS0A 1YLCA 2XC4A 1L4DA 1ELAA 1AVWA 1GBMA 2Z9LA 4I7YH 1SGQE 2HOBA 2IOTA 3F68H 3RXGA 3FP7E 1FQ3A 1L1JA 4X1SU 1F5RA 1QHRB 3MH7A 1IHSH 1AZ8A 1NM6A 1Q3XA 1Y3YA 4ISHH 4VGCC 6GCHF 1VCPA 4BAQB 3VGCC 2FM2A 1UO6A 2WINI 3ELAH 3ZZDA 3U8OH 4JZEH 1ELVA 2OTVA 1O2PA 1RIWC 1P04A 1H9IE 3RMMH 1GI5A 1GMDF 1N1LA 4DOQA 4Y7BA 1T8MA 2ZHDA 3E0PB 2PTNA 4FVDA 1O38A 1J15A 1H4WA 2A32A 2P94A 5EG4A 4HZHA 3O8CA 1ZPBA 1HAGE 1W12U 5JBCS 3SUFA 4ZKSU 1NFUA 4IGDA 2ZP0H 3MOCA 1JRSA 2F9NA 1MBMA 4O9VA 5BRRE 1AQ7A 2G52A 1GJ7B 3TH2H 1AB9C 1OP8A 1Y8TA 1DXPA 3NCLA 2BQWB 2NU1E 1NRQH 1QQUA 2ZDLA 3QN7A 1DT2A 1K1NA 1ZZZA 1V2ST 4X1PU 3ODDA 4B1TA 4E7NA 2QC2A 1O3NA 3LT3A 2V6NA 3M3TA 2TIOA 4KTSA 4FU7A 3TU7H 4IC5A 1GHZA 1S84A 1UK4A 3DA9B 1NFXA 1TGSZ 1EAUA 1OX1A 1V2JT 2WPMS 2FWWA 1LVBA 2D1JA 4D76A 1XKBC 1ID5H 3K2UA 3PMHB 4DIHH 1O2LA 1MZAA 2G81E 1MH0A 2ZU2A 3EA7A 5FXLA 3ZVGA 2SGDE 1AUJA 1C9TA 3BTEE 2LPRA 4JCNA 2M5TA 2P3TB 3SV7A 4KTUA 5F8TA 5GDSH 1UMAH 1HB0B 3LGTA 1HXFH 4WWYA 1O34A 1GVLA 1AFEH 2PWXA 2ZFRH 1PPHE 3OSYA 2VIQA 1P05A 4FXGH 3HKIB 1BTWA 1UTMA 1UCYE 4QT8C 1P09A 1WQSA 2G4UA 1GL1A 1BMLA 1W10U 5A09A 5EQRA 3SU1A 2ZHEH 4YM9A 1VGCB 3DFJA 2P3UB 5AF9H 3TJUA 5L30H 5A0CA 1EOLA 1WYKA 3LGWA 1DFPA 1GI8B 3T25A 1TWXB 1O2SA 1J16A 5K0HA 2B7DH 1YPJH 2XBWA 5JYIA 4D7FA 2ANYA 4SGBE 1PQAA 1TPAE 2ZC9H 1QIXB 1CGJE 3KN2A 2GCTB 4Y0ZE 1CVWH 4NG9H 4FUJA 2SGAA 1T4VH 3LGVA 5C1YA 3VXEH 1AI8H 1TOCB 4WXIA 4AOQA 3VB5A 3LJJA 1HGTH 2FODA 1HJ9A 3VGCB 1ZLRA 1ZHMA 4IBLH 1XM1A 4Y8YA 1DWBH 2BXTH 4AFSA 2PW8H 1TPOA 3SUEA 5DK1A 3LGIA 4WMEA 3T26A 3ZZAA 1WTGH 2ZPSA 2ZTYA 1C4V2 5GCHG 2ZPRA 4Y76A 3T2NA 3RM2H 4Q2KA 1KTSB 2HALA 4ABHA 1C5ZB 2GCHG 1BIOA 1GBCA 2XBVA 3G01A 5IDKA 5ESTE 1LPGB 2GV7A 3ZZ9A 3AW1A 2TGTA 1O2KA 2JETC 3BEUA 1BOQA 1SGDE 5FCRA 4WXVA 2BD7A 4GCHG 4YLQH 2Z9IA 3O8RA 2JH0D 2GT7A 4BNRA 4DGJA 2PSYA 1OYTH 4IN2A 3P17H 4DCDA 4NSVA 1BRCE 2VH0A 3GYLB 1MU8B 5T6DA 6GCHG 1VCQA 1IQJA 3RU4E 4ESTE 2BVXH 3BTKE 1TOMH 4MNYA 2A4RA 4B74A 2ZCLP 1A46H 1GHBG 3KCGH 5JBBS 3TGKE 5C5OA 1DICA 3UY9A 3VB4A 1QNJA 4ABEA 1FDPA 3ZZ8A 1GDNA 1P2IA 1GBDA 4CHAB 2C8ZB 4B2CA 1ACBE 3RXKA 1GJCB 5EU8A 2BLWA 1A0HB 3A84A 3BV9B 1IQEA 2GGVB 5FPTA 3TLOA 1ZSLA 2W7UA 3LDXH 1EZSC 4K5ZA 1C1VH 2P93A 4UONA 5J4SA 5PTPA 3GDSA 2AS9A 1Z1JA 1OWIA 4TY7A 1UJ1A 3NPSA 5GJ4B 1IQHA 2PFEA 3TPIZ 1TYNA 4Y10E 3ZVDA 1QA7A 3GCTG 3VEQB 1Z8GA 2EI7A 4NA9H 3ZZBA 5GWZA 1O3AA 2FS9A 1O35A 2VWLA 4CRGA 4X2XA 1O2ZA 1IQLA 2A5AA 1TNHA 1MKXK 1Z8IB 3MYWA 2KAIB 1C5TA 3F9GA 3D65E 1OWHA 3RC4A 1ANCA 3M37A 4WH6A 2FOBA 4MVNA 3MTYA 3V7TA 3P95A 2ZU3A 4TPIZ 1QB6A 2BD2A 4AORA 1O3CA 3VB7A 2G00A 1S0RA 4A6LA 2ZG0H 1VJ9U 3Q3KA 1MTUA 1HAOH 1GI3A 2ODPA 2G51A 1SGNE 1W13U 3DD2H 1MTNC 1UHBA 3BG4B 2H1UA 4NGAH 1LVOA 2XBYA 1MCVA 3VPKA 5DGJA 1RD3B 1W3CA 3F6UH 5CE1A 3ZV9A 2VU8E 3SHAH 3A8AA 1ETTH 3RXDA 1DUEA 1RIWB 1P3CA 2WV5A 4OS6A 2O8UA 3MNSA 1GL0E 1MKWH 2OD3B 1XMNB 2EI8A 3TK5A 1AGJA 2ZHFH 1PPCE 2H9HA 1P2KA 2GZ9A 2F9BH 1RTKA 3HK6B 3E1XB 4ZROA 1AIXH 1EKBB 3RMOH 2SGFE 3PO1C 4B2AA 2ZA5A 4Y11E 1CQQA 1BBRE 3RLYH 2W3KA 1QJ7B 2BZAA 2UUJB 4XDEA 3AAUA 4FU8A 5EW1H 1J17T 2PHBA 2BM2A 2ZCKP 2DUCA 5T3HA 4KTCA 1NRSH 4OS2A 3V3MA 2ESTE 3TGIE 2XWAA 3UIRA 3OY5U 5EOKA 3UR9A 1NROH 1O3HA 2O9QA 1FPHH 4BAOB 1B0FA 3SJ9A 2A7CA 4D9QA 1P10A 4BOHA 2ZPQA 3PV4A 5JBAS 2BD5A 4ISNA 1JIMA 4XOJA 1IHTH 3U69H 1QRZA 1P01A 1NPMA 8GCHF 2FOCA 3UQVA 5I46H 2B5TB 3K9XB 4ABGA 1GI6A 2XCNA 1CT0E 1IQGA 1IQKA 1OWDA 1TNIA 2BDIA 2QXJA 3RP2A 8KME2 1QL9A 6ESTA 2EA3A 1NN6A 2QXIA 1FN6A 2VIPA 3FP8E 1XVMA 5GIBA 1UTLM 3MO3A 1A61H 1GDUA 1YCPH 2WPKS 3QO6A 3O8BA 3A89A 2FI5E 2C4FH 3A7VA 2P8OC 3VXFH 1D3TB 1TMUH 1C5NH 1EOJA 3MH6A 3MU8A 1XUKA 3P8GA 4MQAA 4ZAEA 1O33A 2FOFA 3KEEA 3OY6U 2EI6A 1TRYA 4ZXXH 4WVPE 3HKJB 5DPAA 5EXLA 1B0EA 1QL7A 4AN7A 4K1SA 1K21H 3STIA 2PKAB 3OTJE 1PQ5A 3E91A 2BQ6B 1HAPH 3P6ZB 1KXBA 2Y82A 3A7TA 1Z8JB 3IITA 3SW2B 1P57B 1O5CB 4JYTA 5C5NA 1TGBA 1C5RA 3A80A 1KDQB 2AIQA 2VGCB 1ZPZA 2FOEA 1HLTH 5H4IB 5ESBA 3E6PH 1SLXB 1AE5A 1GHBF 2CMYA 2J9NA 1KDQA 5E0HA 2JH5D 5DP8A 3S0NA 9ESTA 1NTPA 5AHGH 4NIXA 4AZ2B 1E34B 2AYWA 2QCYA 1GCTB 1TBZH 1QTFA 3MNCA 3HK3B 1O39A 3CS0A 1KXCA 3NWUA 1DDJA 5C67A 4A1TA 1C5PA 2B0FA 1BRUP 3I78A 3PROA 4MPWA 2UWLA 4Z6AH 3W95A 2R0LA 1BUIA 5CMXH 1OPHB 2R3YA 2VJ1A 3OYPA 5HM2A 2PUQH 3GOVB 4IMZA 2G4TA 1OWEA 4IC6A 1QJ1B 1LVYA 2RA3A 3RXHA 4ABIA 2BOHB 2TBSA 1G37A 1UTQA 3B9FH 1AVGH 1FMGA 1P03A 2AMQA 1PFXC 1BTXA 3NXPA 3A86A 1QB1A 2PKAA 1ZMJA 1BTZA 1RJXB 3SJ8A 3SUGA 2XC5A 5JPMH 4R0IA 1UVPA 4AGKA 1P06A 4Q7YA 1XXFA 1O31A 1AFQB 2ANWA 1XVOA 3VFEA 6CHAB 3SBKA 2OC0A 1V2QT 4Y8XA 2P95A 1OOKB 1SGCA 3UOPA 6CHAC 1LQEA 3RLWH 1TGCA 2ZU5A 3SU2A 1E35B 1ETSH 2ZDKA 4ISIH 1OP0A 2SNVA 3O8DA 3SI3H 1HAYB 1AO5A 4NA7A 1BCUH 2Y7XA 3PTBA 4U2WA 2FTMA 5HGGA 3A7ZA 2BHGA 1VITF 2FXRA 3GYMA 1A4WH 1Z1IA 1S85A 1ZMLA 5GPIB 4OGXA 6LPRA 3U1JB 1XXDA 2O8WA 2W7SA 4D8NA 2WV4A 4WH8A 4CRBA 4FUHA 1O5FH 3ENSB 4NWKA 1F7ZA 1YCPK 2BD8A 1T32A 1YPKH 3ZYDA 3D62A 1DANH 1EP6A 5K7RA 1C2IA 4FU9A 7GCHG 3C27B 4I8KA 4A7IB 1C5MD 1M9UA 1EB2A 1GBTA 1EASA 3B23B 2WUBA 2GCHF 4GHTA 5BPEA 2AIPA 2BDGA 2AGEX 1CO7E 1V3XA 3GCNA 5EQQA 1Y3VA 4X0WU 4U32A 2FX4A 1ZPCA 3FVFB 1PPGE 1RRKA 3E3TA 3LONA 2FPZA 1MQ6A 1W11U 1PPFE 2FS8A 3VB6A 1O2WA 3A7WA 1FI8A 1HCGA 1F92A 2PV9B 1WBGB 2FX6A 1TLDA 2A5IA 5AFYH 5LH8A 1NY22 2W5EA 1F5KU 3KGPA 1BT7A 2SFAA 4AGJA 2OBOA 4ABFA 1BRBE 1JBUH 1Y3UA 3TITA 4ZKNU 4BANB 2QGRA 2H9EH 2QAAA 3GCTF 4LZ4B 2NU2E 2EC9H 1IQIA 2V35A 4K60A 1XX9A 3LKWA 1YPMH 2D26C 2BQ7B 2ZEBA 4IS5A 2F3CE 1V2PT 3SU6A 2AGIX 1T31A 1EJAA 3QLPH 3E0NB 1PPEE 1ZTLA 4NFFA 5C3NA 4H42U 1MTNB 1LKBA 1GPZA 1P2NA 3CS7A 1CU1A 3SHCH 3RXIA 1EB1H 1GJDB 4AFUA 3BG8A 3QTVH 2G5NA 3P8OA 2VVUA 4LZ1H 4CR5A 4FUCA 1DLKB 3RMNH 1YPHE 1K1JA 5HXFA 2DE8A 1HJAC 4ZH8A 4OGYA 2Y5HA 4I31A 4ZHLU 1TQ0B 3B8JA 1YKTA 5A8YA 3KF2A 1GMCF 5T6GA 2EEKA 3A87A 2XW9A 3A8CA 1P12E 3TNTA 1O2NA 1P2QA 1AWHB 1GHAF 3Q00A 3Q77A 2ZU4A 1QY6A 1FY4A 2R2WU 1TX7A 1VR1H 2Z7FE 4TY6A 1HAHH 1ZTJA 1MAXA 1MQ5A 3P8FA 3MO9A 4JZ1A 4KGAA 1GHXH 1A3BH 4AG1A 1B5GH 1SGYE 1HAXB 5FPYA 3EQ0H 3RXJA 1CE5A 1GI0A 1XUHA 3KHVA 4SGAE 1G30B 2ZNKH 1V2KT 1KY9A 1C5QA 1WCZA 1ESBA 5ETXA 2ZGBH 5TCAA 4I32A 1ZRKA 2J2UA 1SQTA 3MU4A 3MNBA 4JYVH 1VZQH 3BTTE 3PM3A 1WUNH 1HJ8A 3UREA 1QFKH 3RXUA 1GJ5H 3CP7A 5GXPA 1A7SA 1GHWH 2TGAA 2A4QA 2ZQ1A 3MO6A 1AWFH 1OSSA 5G4BA 1MKWK 3PLKA 3LPRA 1ZJKA 2G55A 4HFPB 1SLUB 4UEHH 4I8LA 1DSUA 2ILNA 2F83A 1UVOA 3SV9A 2OINA 3GY4A 4MNWA 4B73A 1CBWC 4A1XA 4CBNA 2QY0B 3BEFB 1SPJA 2JETB 2VWNA 2ZI2H 5DP7A 2VH6A 2ASUB 4FUFA 1KLIH 3DFLA 3ATWA 1BMNH 3SNBA 3SJKA 1WAYB 3LH1A 1GJ8B 3MMGA 1EAIA 3E90B 3RXSA 4INKA 1BRAA 1J8AA 2BY6X 2WYJA 3BTGE 1LPKB 2STAE 1S0QA 1PJPA 2BDBA 2VB0A 2VIWA 3D23A 1GWAA 2XWBI 2F9VA 4HTCH 4UFGH 1FONA 4FUEA 5DP4A 1CGHA 1V2TT 1V2MT 2ZFTA 3SN8A 1AB9B 1UK2A 1F0UA 4IW4E 2A7HA 2J34A 1CSOE 3LC5A 2HRVA 2OQ5A 3RDZA 1OWJA 1GHYH 1ELGA 1PYTC 1GG6B 1MTWA 2QXHA 2BMGB 3S7HB 1UVSH 1OYQA 2O8MA 1OKXA 4GVUA 4GHQA 1AVXA 2J94A 1C1MA 3QDZB 5E0GA 5FX6A 1YPHC 1O2RA 2V0BA 3ATIA 1YM0A 1LO6A 4I33A 3SV8A 2PR3A 1KXAA 2JH6D 1W8BH 5EPYA 4NIYA 3JZ1B 1P9SA 2ZWLH 2F91A 1SGRE 5FBEA 4YOIA 5A8ZA 1THSH 4IN1A 3GY5A 3SNAA 1IAUA 4MDSA 1C2HA 4TPYA 5AVDA 3M3VA 2CJIA 4RKOB 1YYY1 1ZSKA 3RXEA 2ZU1A 2GV6A 1G3EA 4MPXA 1EQ9A 3BTQE 3A8BA 2FDAA 4H4FA 1O30A 2SGQE 1GI1A 3C1KA 1SR5C 3ZYEA 1SC8U 3NK8A 3BTFE 3QZRA 2AEIH 3F9HA 4U01A 2NU3E 1CA0C 4KP0A 4Y0YE 1SFIA 1Y3XA 3PLBA 4Q7ZA 1YLDA 2P59A 2XYAA 1QRXA 4HGCA 1UHBB 1W7XH 1BITA 1Z71A 4JZIA 1AKSB 2GCTC 1MKXH 1TA6A 1SGIB 2GD4B 2XCFA 3SV6A 4YT7H 3HATH 2ZHQH 5A8XA 2C8XB 5F8ZA 1BBRK 2ZFFH 2ULLA 3ZVFA 2BD3A 4NIWA 2XTTB 4MG3A 3T62A 2A45B 3UR6A 4Y71A 1BTPA 2HNTE 1GBAA 4X2YA 2IPHA 1ELTA 4TYDA 1DE7H 4H6TA 2ZDMA 1K28D 1HRTH 4B71A 2FESH 5C2ZA 1GI2A 1BMAA 1EUFA 1C1RA 1V2UT 2Y5GA 1K1MA 4ZKRU 7ESTE 3V13A 2QF3A 1RTLA 1TE0A 2OC8A 1MTVA 4D9RA 1C2GA 1UVTH 3GY2A 3LGUA 1QA0A 3QGNB 2GMTB 1C9PA 1V2VT 1KXEA 3V0XA 1L4ZA 1K1PA 2BX4A 4Q7XA 2BLQA 1KXDA 3U8RH 1CA0B 3A7YA 3ZZ4A 3KIDU 1GMHF 4J2YB 3U98H 4GUXA 1A5HA 3VB3A 3HGNA 2AH4X 3TJNA 1KSNA 3M7UA 3ZVBA 1SG8B 2ZTXA 1GCDA 3LC3A 3SGQE 1IQMA 5C20A 2BLOA 3T27A 3UWIA 2YNBA 1DLEA 3FFGA 4F4OC 1SGTA 5L2YH 1JXPA 4XBDA 2IJOB 3GCHB 2HNTF 1EJMA 2C90B 3MU1A 3KQDA 5EGMA 1C5LH 5E0JA 1ANBA 2R2MB 1GBLA 1HPGA 1ZGIA 2R3UA 2OLGA 2XRCA 3S9BA 2QYIA 3RXCA 2C8YB 1GHAG 4MNXA 1JWTA 1O3JA 2F9PA 2GP9B 1MD8A 2PGQB 2CF8H 1EP5A 2W3IA 4JK5A 4K1EA 2NU0E 4X8VH 2THFB 2H2ZA 4CRCA 1KXFA 3NKKA 4BXWA 1FIZA 1O3MA 3UFAA 2FOMB 1K2I1 3SGAE 1YBWA 1SL3A 1KYNA 3MH4A 1MMJN 3T28A 1C2DA 2QIQA 3R3GB 1DUAA 2D2DA 1O3IA 2TGDA 2BOKA 4Q80A 1CT2E 1GBFA 1O0DH 1D4PB 3ZZ6A 2VVVA 1LMWB 5DO4H 1ELDE 1SQAA 1GI9B 2AMPA 1KIGH 1BTUA 2UUKB 2Z6BD 2P8OB 1NRPH 3DUXH 3GDUA 3K65B 1EXFA 1SHYA 4ISOA 1JOUB 5L6NH 2RCEA 3JZ2B 7LPRA 1Q31A 3BG4C 2PUXB 3FAOA 4X1RU 3M3SA 2Y5FA 1T7CA 2Y6TA 2NU4E 1O36A 1BZXE 1TB6H 1Y5AT 2PKSC 3SUDA 1HAZB 4NZLA 3HPTB 1ANDA 2HNTC 3PMBB 4YT6H 2V3OH 4JYUH 1E37B 3EAJA 2IN2A 3ZVCA 4UE7H 2ZFPH 4AFZA 3EGKH 5FAHA 3LGYA 1C1OA 2A5KA 1FV9A 5A2MH 2H5DA 5L2ZH 4ABJA 3SI4H 2ZECA 4FUBA 3GY3A 3K6ZA 4ABAA 1O3LA 1YPGH 5CHAC 3GICB 3RXFA 1XUGA 4NCYA 1YPEH 1P2OA 1EZQA 1YP9A 2GDDA 4RKJB 3S9CA 3ZZCA 1SGEE 4BXSA 3M5MA 2BVSH 1TGNA 2O8LA 1FY1A 3SQEE 4AYYB 1NT1A 1P02A 1TABE 1O2TA 5DP5A 1AFQC 4ZXYH 4YLUA 1OWKA 2BY7X 4E7RG 4NSYA 3U8TH 1F5LA 1UTNA 1NO9H 1IQNA 2TPIZ 1KTTB 2ALPA 1F0SA 1P3EA 2BD9A 1ORFA 2F9UA 1P2MA 4O97A 1CHOF 3BTME 1AMHA 2FOGA 4FUGA 1O2IA 4ZMAH 3TGJE 4X6MA 3UNRA 3LH3A 4WMFA 1W2KH 2R9PA 2OCVB 1BHXF 4ABBA 3BN9A 1TRMA 2ODYB 3S69A 2V3HH 3DHKH 4GLYA 1O2HA 1N8OB 1MUEB 2Y80A 4K69A 1O2MA 1ZHRA 1HIAA 4OS1A 4IMQA 4ABDA 1DWEH 4U30A 2BY9X 5DKMA 1GG6C 5B6OA 4BAKB 1FY5A 1C1NA 3MNXA 1TPPA 1VITH 3BF6H 5CHAB 4DY7B 1C5VA 1QBNA 1O2YA 2BZ6H 3MU5A 1A5IA 1KLTA 4A92A 1GHVH 3UUZA 1C5XB 4K8BA 3M7QA 5HM9A 1AKSA 4INLA 2BD4A 4K8YA 1CT4E 3H5CB 4X1NU 2H5CA 4VGCB 5LGOA 2ZDAH 1H9HE 3K6YA 1HAVA 3PMAB 1O2XA 4LXBH 3SNDA 4AFQA 4ISLA 1L1NA 1D3DB 1O3EA 1QBOA 4MPVA 3MFJA 1EPTB 3HGPA 3RXTA 3U9AH 1BB0B 1A3EH 1LPZB 2OBQA 2I6QA 1O32A 3GY8A 2ZCHP 2CXVA 1V2NT 1N6XA 4NIVA 2GMTC 1C5WB 4YOGA 4H6SB 1C2MA 1O3FA 2D8WA 1YC0A 2BB4A 3BIUH 4MPUA 2FLRH 1WTHD 1A0LA 1NESE 4Y79A 2PKSB 5TJXA 5SGAE 2Q1JA 2BDHA 4B76A 4LK4A 5JDUB 1IQFA 4YTAA 4CH8B 3D49H 2XNIA 1V2WT 2BXUH 1E36B 2TRMA 4F49A 2CHAC 2BX3A 1G32B 2A31A 1O3KA 2A7JA 1TBQH 1YF4A 3BSQA 4FUIA 2AFQB 2O8TA 3TIUA 1FN8A 2STBE 3WY8A 1D6WA 2PTCE 1ZMNA 1BMMH 1O5DH 1G3DA 1GCTC 3MWIU 4NFEA 3M7TA 4NWLA 1Z8RA 3KQBA 1MCTA 1T8OA 1LVMA 2FOHA 3PTNA 2BLVA 1Z6JH 4XE4A 1EX3A 4K2YA 1QGFA 3ZZ5A 2ZDNA 3UTUH 1HBTH 1WV7H 1DSTA 4PROA 4XBBA 1XUJA 2BY5X 2Y81A 3DT0H 3L6PA 1K1LA 1SMFE 1TONA 1O2VA 1AUTC 1C2KA 4AYVB 1GJBB 1PQ7A 3RU4T 1TAWA 1O3PB 1THRH 3UQOA 5JBTA 1S83A 2FEQH 1AY6H 2JKHA 3QUMP 3UPEA 4DT7B 1OP2A 1EAXA 1TPSA 1D9IA 4X6NA 2FYRA 3GISB 1DWCH 1FUJA 2GZ7A 3A82A 3M36A 5T6FA 1SLWB 2FTLE 2ZFQH 1FNIA 4GSOA 2CHAB 1RGQA 1QQ4A 5EPNA 1O5AB 3SU3A 1P11E 2FZZA 1A0JA 2J95A 3SU4A 1TQ7B 1RXPA 1GJ6A 1VJAU 4WMDA 3URCA 4J1YA 2AGGX 2I6SA 1HDTH 1UTOA 3F9EA 3UWJH 1P0SH 3UNQA 4GCHF 1HFDA 4AG2A 1PPBH 2Z3EA 3SORA 5A0BA 2HLCA 2VINA 1V2RT 1NU7B 2DE9A 1BTYA 4UDWH 3MHWU 1F0RA 2P3FH 1O5GH 3P92A 1FJSA 1SQOA 3GDVA 2ZQ2A 4Y7AA 1LHDH 1WSSH 1UTJA 2UUYA 3ZVEA 1C4U2 4X8SH 2WPIS 1S5SA 4CHAC 3EYDA 1ZJDA 1TALA 4AB8A 4WJG2 2VWMA 1X7AC 1K9OE 2VIVA 3ZVAA 7GCHF 4K3JA 3P70B 3URDA 1V2LT 1DVAH 4JMYA 1L1GA 3M5OA 3ESTA 2A2XH 2LNCA 2HVXA 1S6FA 4INHA 1T4UH 1GVKB 5FCKA 2GKVE 1EAWA 4JK6A 1GGDC 3BTHE 5EXMA 4B2BA 1UVUH 1UTPA 1XUFA 2J4IA 2UWPA 1C5YB 2VWOA 4Z0KA 2Z3DA 3ODFA 3TVJB 4MTBA 1VGCC 1HYLA 3UOUA 3RXPA 1UCYH 5LPRA 2CV3A 1C5UA 4NA8A 2J92A 1K22H 3SU0A 1ARCA 1GJ9B 2RA0A 1SGFA 1GJ4H 2ALVA 1V2OT 3EDXB 2WYGA 1SB1H 2K1QA 3E8LA 3QK1A 4AB9A 3EE0B 1E0FD 1G3CA 3CENA 1NZQH 1SSXA 5AFZH 3QX5H 3A88A 2AERH 2UWOA 1GMCG 5F03A 3FP6E 4MNVA 4Y8ZA 5JB9S 3BEIB 1K1IA 2ZO3H 4B75A 1DY8A 1DXWA 3IWMA 1QB9A 2XBXA 2Q6GA 2ODQA 2TGPZ 1DM4B 1UCYK 1O5EH 1TA2A 3BTDE 3M5NA 3SNCA 1CHGA 3ITIA 2AMDA 1MD7A 1IOEA 2WUCA 2QA9E 5FHTA 2HPPH 5DJ7A 3AVZA 4CRDA 1HUTH 1TIOA 2VIDA 1N8OC 1EZXC 2BDAA 1YCPM 3TJOA 4GPGA 1AD8H 2UUFB 1ETRH 5TCCA 4X6PA 1LDTT 4AX9H 1D3QB 3I29A 1MAYA 3KNXA 1PYTD 1J9CH 1XUIA 5EW2H 5EXNA 1T8NA 1C2JA 1AU8A 3QZQA 3SQHE 1ZGVA 1BJUA 2CN0H 1LHGH 5C1XA 1CBWB 2C3SA 4X6OA 1J14A 1ABIH 1XKAC 5DP3A 2ZFSA 1EPTC 1O3BA 1FXYA 1S6HA 4O3TA 1TNGA 4BTTB 3Q3YA 4ASHA 1H9LB 1GBEA 1RFNA 1ZYOA 3RXMA 2GVFA 1ZTKA 3RC6A 1W0YH 3NZIA 3FANA 3S7KB 3L3TA 1HAVB 1SI5H 3ZZ3A 3RU4D 2NWNA 3RXBA 3TH4H 2QXGA 1MZDA 2QV1A 1ESTA 1YGCH 1H1BA 2ANMH 3MI4A 4K1TA 3SO3A 1O5BB 5DP9A 4DJZB 5JB8S 3S9AA 3L33A 1O2JA 3PWBA 1DX5M 1TNKA 2Z9GA 1L2EA 2ZTZA 4DG4A 2B8OH 5F8XA 3W94A 2SNWA 4LOYH 4E05H 1TMTH 7KMEH 1ZRBA 1O3GA 1O3DA 2FI4E 2FMJA 5FPSA 1BBRH 1ELCA 3M61U 3FZZA 1S82A 1AE8H 1W0ZU 4X2VA 2A1DB 2VNTA 4I8HA 3PLPA 5GCHF 2FP7B 1W14U 2GT8A 1PPZA 4X8UH 3A81A 1TNLA 3GY6A 1DITH 2RDLA 1QL8A 4DURA 1K1OA 1TBRH 4NZQA 1P2JA 3TK9A 3BTWE 3U1IB 1A1RA 3PYHA 1O2GH 4R8TB 3A85A 3RXLA 4UD9H 1SOZA 4YZUA 3BIVH 3KQCA 5F6MA 4DIIH 2OC1A 1WOFA 2OP9A 2Q6DA 3PB1E 4WY3A 2SGPE 5E2OA 4O03A 4KELA 3RXAA 2Z94A 9LPRA 1GBJA 4CREA 3Q3XA 2QN5T 1SBWA 3SV2H 1LHEH 1T8LA 1Y5BT 1EPTA 2H9TH 2Z3CA 1C1UH 1C5SA 1LHCH 3SJOA 1FY3A 2ZHWH 1F2SE 1FY8E 3RM0H 1TGTA 3RXQA 3LIWA 1G3BA 1GMDG 3E16B 1UTKA 3SGBE 1HAIH 1ABJH 3TH3H 2GZ8A 5LPEA 4JZFH 1GMHG 2ZGXH 2GX4A 1ELEE 4ZKOU 3ZZ7A 1C1SA 1CGIE 2G8TA 1LHFH 4UFDH 4UFFH 2WPLS 3ATMA 4BTIB 2R0KA 4YO9A 2C93B 1SGFG 3UNSA 1ZOMA 1NRRH 4DVAU 1FIWA 3Q76A 1SLVB 3SJIA 3OX7U 1Y5UT 2P16A 3OU0A 1SGPE 4YOJA 4HI3A 1ELBA 1A2CH 1TRNA 2H6MA 3I77A 2RG3A 1MTSA 2BVRH 1C2FA 3MH5A 2A0QB 4Y6DA 3PMJA 4OS7A 3ATKA 1LQDB 2Z9KA 3PO1B 3AASA 1BJVA 3A8DA 1GI4A 4TWWA 5FX5A 4CBOA 5C1UA 1BHXB 1TX8A 2ZGHA 4D7GA 1DPOA 1N6YA 1GGDB 1C2LA 1KLJH 1GBBA 1INCA 3T29A 1BQYA 3QTOH 2ANKH 1ANEA 1A5GH 1WQVH 4WF8A 3LJOA 3SZNA 4E06H 3R0FA 2W26A 1PQ8A 1FZZA 4ZHMU 1O37A 1P9UA 5IYTA 1WU1A 2HPQH 3H7OA 4FVBA 2WPJS 1DS2E 1VITG 2A4OA 4A1VA 3EA9A 4FUDA 1YPLH 5HMAA 5E2PA 1QCPA 2HGTH 3ATLA 1QURH 1G2LA 1EJNA 4ZUHA 1BDAA 4A5TS 2SGEE 1W7GH 3MU0A 2YOLA 4BAHB 1QRWA 1BA8B 3GCHC 4X8TH 2VVCA 1E38B 1HJAB 3FZDA 5HYOA 5ABWA 2G5VA 2PGBB 2OC7A 1TMBH 4MLFB 2CF9H 3AW0A 3GCOA 1MBQA 1C1TA 1O2OA 1Z7KA 2J38A 1D3PB 1GBHA 2ZZUH 1FAXA 2F9OA 1SHHB 2BYAX 3IG6B 1HXEH 3GY7A 4XBCA 1QBVH 1C1QA 3QGJA 5DP6A 3TK6A 1UK3A 2QF0A 2ZF0H 1TNJA 8GCHG 3T5FH 1O2QA 1NRNH 2ZIQH 1LKAA 1ELFA 3KL6A 1FPCH 4KKDA 5LPFA 1ZHPA 3SNEA 4X2WA 4TWYA 2BTCE 3ZV8A 1JIRA 1LTOA 5FBIA 1Z6EA 2FIRH 1SOTA 1FLEE 1B7XB 1F0TA 1ZSJA 1L0ZA 2A4GA 1C1WH 3LOXA 4OS5A 2BY8X 2PLXA 4I8GA 1DY9A 1CA8B 3RC5A 1EATA 3RMLH 2OQUA 1HIAB 4O3UA 4THNH 2BDCA 2HWLB 8LPRA 2FLBH 1G2MA 1LCYA 2FO9A 3TNSA 2YNAA 1OXGA 3F9FA 2ZDVH 5DG6A 1O3OA 5J4QA 1HNEE 1AHTH 3A83A 1GI7B 1G9IE 2Y7ZA 4ZHAA 2ZGJA 4YESB 2GTBA 2VGCC 1GDQA 1P8VC 1EZUC 5E8EH 1THPB 1GBKA 1H8IH 4CH2B 4M7GA 8ESTE 1O2UA 1GVZA 1GBIA 1C5OH 3EA8A 1S81A 4CRFA 3SOSA 4BAMB 4CR9A 1TX6A 3N7OA 3TJVA 1H8DH 3RXVA 1HV7A 1JRTA 2C8WB 2CGAA 1C2EA 3QWCH 1BTHH 1Q2WA 1DWDH 2XC0A 3RUOA 2KAIA 1RTFB 3A7XA 1U6QA 2PSXA 1ESAA 2Q6FA 4RSPA 4DW2U 1Y3WA 1D6RA 2ZGCA 3LU9B 2GDEH 5I25A 3M5LA 1FAKH 3RXRA 1Y59T 3V12A 1AZZA 3H7TA 1VCWA 2OXSA 2ZKSA 4OS4A 1CHOG 3AAVA 3SU5A 2BDYA 2A2QH 1MU6B 4RN6A 2FI3E 4I8JA 3NUMA 3KQEA 1NS3A 1GJAB 2FOAA 1OS8A 2XXLA 1AN1E 5A0AE 4JZDH 4X1QU
chains in the Genus database with same CATH superfamily
1JMOH 1ARBA 1QR3E 4XFQA 1NFYA 1DOJA 3F1SB 1C1PA 1QJ6B 2Z9JA 4UFEH 4BTUB 1EFRD 2FYQA 5EODA 5EJ1A 5EQSA 3F3BA 1YWUA 5GNDA 3RXOA 1SFQB 1C4Y2 3PWCA 1TFXA 3M35A 1ZR0A 4GAWA 2VIOA 4CRAA 1V6DA 1NC6A 2OUAA 3P8NA 1SVPA 1NU9A 2WPHS 1G36A 3STJA 2B9LA 1NFWA 4XSKU 1RS0A 1YLCA 2XC4A 1L4DA 1ELAA 1AVWA 1GBMA 2Z9LA 4I7YH 1SGQE 2HOBA 2IOTA 3F68H 3RXGA 3FP7E 1FQ3A 1L1JA 4X1SU 1F5RA 1QHRB 3MH7A 1IHSH 1AZ8A 1NM6A 1Q3XA 1Y3YA 4ISHH 4VGCC 5B6LA 6GCHF 1VCPA 4BAQB 3VGCC 2FM2A 1UO6A 2WINI 3ELAH 3ZZDA 3U8OH 4JZEH 1ELVA 2OTVA 1O2PA 1RIWC 1P04A 1H9IE 3RMMH 1GI5A 1GMDF 1N1LA 4DOQA 5DN6D 4Y7BA 1T8MA 2ZHDA 3E0PB 2PTNA 4FVDA 2WSSD 1O38A 1J15A 1H4WA 2A32A 2P94A 5EG4A 4HZHA 3O8CA 1ZPBA 1HAGE 1W12U 5JBCS 3SUFA 4ZKSU 1NFUA 4IGDA 2ZP0H 3MOCA 1JRSA 2F9NA 1MBMA 4O9VA 5BRRE 2HLDD 1AQ7A 2G52A 1GJ7B 3TH2H 1AB9C 1H8HD 1OP8A 1Y8TA 1DXPA 3NCLA 2BQWB 2NU1E 1NRQH 1QQUA 2ZDLA 3QN7A 1DT2A 1K1NA 1ZZZA 1V2ST 4X1PU 3ODDA 4B1TA 4E7NA 2QC2A 3MQKC 1O3NA 3LT3A 2V6NA 3M3TA 2TIOA 4KTSA 4FU7A 3TU7H 4IC5A 4ASUD 1GHZA 1S84A 1UK4A 3DA9B 1NFXA 1TGSZ 1EAUA 1OX1A 1V2JT 2WPMS 2FWWA 1LVBA 2D1JA 4D76A 1XKBC 1ID5H 3K2UA 3PMHB 4DIHH 1O2LA 1MZAA 2G81E 1MH0A 2ZU2A 3EA7A 5FXLA 3ZVGA 2SGDE 1AUJA 1C9TA 3BTEE 2LPRA 4JCNA 2M5TA 2P3TB 3SV7A 4KTUA 5F8TA 5GDSH 1UMAH 1HB0B 3LGTA 1HXFH 4WWYA 1O34A 1GVLA 1AFEH 2PWXA 2ZFRH 1PPHE 3OSYA 2VIQA 1P05A 2W6ID 4FXGH 3HKIB 1BTWA 1UTMA 1UCYE 4QT8C 1P09A 1WQSA 2G4UA 1GL1A 1BMLA 1W10U 5A09A 5EQRA 3SU1A 2ZHEH 4YM9A 1VGCB 3DFJA 2P3UB 5AF9H 3TJUA 5L30H 5A0CA 1EOLA 1WYKA 3LGWA 1DFPA 1GI8B 3T25A 1TWXB 1O2SA 1J16A 5K0HA 2B7DH 1YPJH 2XBWA 5JYIA 4D7FA 2ANYA 3OTPA 2IJD1 1PQAA 1TPAE 2ZC9H 1QIXB 4SGBE 1CGJE 3KN2A 2GCTB 4Y0ZE 1CVWH 4NG9H 4FUJA 2SGAA 1T4VH 3LGVA 5C1YA 3VXEH 1AI8H 1TOCB 4WXIA 4AOQA 3VB5A 3LJJA 1HGTH 2FODA 1HJ9A 3VGCB 1ZLRA 1ZHMA 4IBLH 1XM1A 4Y8YA 1DWBH 2BXTH 4AFSA 2PW8H 1TPOA 3SUEA 5DK1A 3LGIA 4WMEA 3T26A 4OM9A 3F0PA 3ZZAA 1WTGH 2ZPSA 2ZTYA 1C4V2 5GCHG 2ZPRA 4Y76A 3T2NA 3RM2H 4Q2KA 1KTSB 2HALA 4ABHA 1C5ZB 2GCHG 1BIOA 1GBCA 2XBVA 3G01A 5IDKA 5ESTE 1LPGB 2GV7A 3ZZ9A 3AW1A 2TGTA 1O2KA 2JETC 3BEUA 1BOQA 1SGDE 5FCRA 4WXVA 1UW7A 2BD7A 4GCHG 4YLQH 2Z9IA 3O8RA 5FL7D 2JH0D 2GT7A 4BNRA 4DGJA 2PSYA 1OYTH 4IN2A 3P17H 4DCDA 4NSVA 1BRCE 2VH0A 3DSPA 3GYLB 1MU8B 5T6DA 6GCHG 1VCQA 1IQJA 3RU4E 4ESTE 2BVXH 3BTKE 1TOMH 4MNYA 2A4RA 4B74A 2ZCLP 1A46H 1GHBG 3KCGH 5JBBS 3TGKE 5C5OA 1DICA 3UY9A 3VB4A 1QNJA 4ABEA 1FDPA 4Q4LA 3ZZ8A 1GDNA 1P2IA 1GBDA 4CHAB 2C8ZB 4B2CA 1ACBE 3RXKA 1GJCB 5EU8A 2BLWA 1A0HB 3A84A 3BV9B 1IQEA 2GGVB 5FPTA 3TLOA 1ZSLA 2W7UA 5HIYA 3LDXH 1EZSC 4DT4A 4K5ZA 1C1VH 5HKKD 2P93A 4UONA 5J4SA 5EJLA 5PTPA 3GDSA 2AS9A 1Z1JA 1OWIA 4TY7A 1UJ1A 2XOKD 3NPSA 5GJ4B 2AHME 3FKSD 1IQHA 2PFEA 3TPIZ 1TYNA 4Y10E 3ZVDA 4AC9A 1QA7A 3GCTG 2RFKC 3VEQB 1Z8GA 2EI7A 4NA9H 3ZZBA 5GWZA 1O3AA 2FS9A 1O35A 2VWLA 4CRGA 4X2XA 1O2ZA 4RT0A 1IQLA 2A5AA 1TNHA 4M9FA 1MKXK 1Z8IB 3CNRA 3MYWA 2KAIB 1C5TA 3F9GA 3D65E 1OWHA 3RC4A 1ANCA 3M37A 4WH6A 3PRDA 2FOBA 4MVNA 3MTYA 3V7TA 3P95A 2ZU3A 4TPIZ 2WV9A 1QB6A 2BD2A 4AORA 1O3CA 3VB7A 2G00A 1S0RA 3F2FA 4A6LA 2ZG0H 4XRNA 1VJ9U 3Q3KA 1MTUA 1HAOH 1GI3A 2ODPA 2G51A 5KECA 1SGNE 1W13U 3DD2H 1MTNC 1UHBA 3BG4B 5C17A 2H1UA 4NGAH 1LVOA 2XBYA 1MCVA 3VPKA 5DGJA 1RD3B 1W3CA 3F6UH 5CE1A 3ZV9A 2VU8E 3SHAH 3A8AA 1ETTH 5EIYA 3RXDA 1DUEA 1RIWB 1P3CA 2WV5A 3OE7D 4OS6A 2O8UA 3MNSA 1GL0E 1MKWH 2OD3B 1XMNB 2EI8A 3TK5A 2KCAA 1AGJA 2ZHFH 1PPCE 2H9HA 1P2KA 2GZ9A 2F9BH 1RTKA 3HK6B 3E1XB 4ZROA 1AIXH 1EKBB 3RMOH 2SGFE 3PO1C 4B2AA 2ZA5A 4Y11E 1CQQA 1BBRE 3RLYH 2W3KA 1QJ7B 2BZAA 2UUJB 4XDEA 3AAUA 4FU8A 5EW1H 1J17T 2PHBA 2BM2A 2ZCKP 1VKYA 2DUCA 1S6LA 5T3HA 4KTCA 1NRSH 4OS2A 3V3MA 2ESTE 3TGIE 3WW7A 2XWAA 3UIRA 3OY5U 5EOKA 3UR9A 1NROH 1O3HA 4ZCNA 2O9QA 1FPHH 4BAOB 1B0FA 3SJ9A 2A7CA 2QF4A 1P10A 4D9QA 4BOHA 2ZPQA 3PV4A 2JJ2D 5JBAS 2BD5A 4ISNA 1JIMA 4XOJA 1IHTH 3U69H 4I86A 1QRZA 4RT1A 2KCPA 1P01A 1NPMA 8GCHF 2FOCA 3UQVA 5I46H 2B5TB 2F4LA 3K9XB 4ABGA 1GI6A 2XCNA 1CT0E 1IQGA 1IQKA 1OWDA 1TNIA 2BDIA 2QXJA 3RP2A 8KME2 1QL9A 6ESTA 2EA3A 4TSFD 2KM0A 1NN6A 2QXIA 1H8ED 1FN6A 2VIPA 3FP8E 1XVMA 5GIBA 1UTLM 3MO3A 1A61H 1GDUA 1YCPH 2WPKS 3QO6A 3O8BA 3A89A 2FI5E 2C4FH 2L6OA 3A7VA 2JDID 2P8OC 3VXFH 1D3TB 1TMUH 1C5NH 1EOJA 3MH6A 3MU8A 1XUKA 3P8GA 4MQAA 4ZAEA 1O33A 2JJ1D 2FOFA 3KEEA 3OY6U 2EI6A 1TRYA 4ZXXH 4WVPE 3HKJB 5DPAA 2JIZD 5EXLA 1B0EA 2OK5A 1QL7A 4AN7A 4K1SA 1K21H 3STIA 2PKAB 3OTJE 1PQ5A 3E91A 2BQ6B 1HAPH 3P6ZB 1KXBA 2Y82A 3A7TA 1Z8JB 3IITA 3SW2B 1P57B 1O5CB 4JYTA 5C5NA 1TGBA 1C5RA 3A80A 1KDQB 2AIQA 2VGCB 1ZPZA 2FOEA 1HLTH 5H4IB 5ESBA 3E6PH 1SLXB 1AE5A 1GHBF 2CMYA 2J9NA 1KDQA 5E0HA 2JH5D 5DP8A 3S0NA 9ESTA 1NTPA 5AHGH 4NIXA 4AZ2B 1E34B 2AYWA 2QCYA 1GCTB 1TBZH 1QTFA 3MNCA 3HK3B 1O39A 3CS0A 1KXCA 3NWUA 5KGOA 1DDJA 5C67A 4A1TA 1C5PA 2B0FA 1BRUP 3I78A 3PROA 4MPWA 2UWLA 4Z6AH 3W95A 2R0LA 1BUIA 5CMXH 1OPHB 2R3YA 2VJ1A 3OYPA 5HM2A 2PUQH 3GOVB 4IMZA 2G4TA 1OWEA 4IC6A 1QJ1B 1LVYA 2RA3A 3RXHA 4ABIA 4Z1MD 2BOHB 2TBSA 1G37A 1UTQA 3B9FH 1AVGH 1FMGA 1P03A 2AMQA 1PFXC 1BTXA 3NXPA 3A86A 1QB1A 3H09A 2PKAA 1ZMJA 1BTZA 1RJXB 3SJ8A 3SUGA 2XC5A 5JPMH 4R0IA 1UVPA 4AGKA 1P06A 4Q7YA 1XXFA 1O31A 1AFQB 2ANWA 1XVOA 3VFEA 6CHAB 3SBKA 2OC0A 1V2QT 4Y8XA 2P95A 1OOKB 1SGCA 3UOPA 6CHAC 1LQEA 3RLWH 1TGCA 2ZU5A 3SU2A 1E35B 1ETSH 2ZDKA 4ISIH 1OP0A 2SNVA 3O8DA 3SI3H 1HAYB 1AO5A 4NA7A 1BCUH 2Y7XA 3PTBA 4U2WA 2FTMA 5HGGA 3A7ZA 2BHGA 1VITF 2FXRA 3GYMA 1A4WH 1Z1IA 1S85A 1ZMLA 5GPIB 4OGXA 6LPRA 3U1JB 1XXDA 3FOAA 2O8WA 2W7SA 4D8NA 2WV4A 4WH8A 4CRBA 4FUHA 1O5FH 3ENSB 4NWKA 1F7ZA 1YCPK 2BD8A 1T32A 1YPKH 3EE7A 3ZYDA 3D62A 1DANH 1EP6A 5K7RA 1C2IA 4FU9A 7GCHG 3C27B 4I8KA 4A7IB 1C5MD 1M9UA 1EB2A 1GBTA 1EASA 3B23B 2WUBA 4TT3D 2GCHF 4GHTA 5BPEA 2AIPA 2BDGA 2AGEX 1CO7E 2WPDD 1V3XA 3GCNA 5EQQA 1Y3VA 3DCLA 4X0WU 4U32A 2FX4A 1ZPCA 3FVFB 1PPGE 1RRKA 3E3TA 3LONA 2FPZA 1MQ6A 1W11U 1PPFE 2FS8A 3VB6A 1O2WA 3A7WA 1FI8A 1HCGA 1F92A 2PV9B 1WBGB 2FX6A 1TLDA 2A5IA 5AFYH 5LH8A 1NY22 2W5EA 1F5KU 3KGPA 1BT7A 2SFAA 4AGJA 2OBOA 4ABFA 1BRBE 1JBUH 1Y3UA 3N7DA 3TITA 4ZKNU 4BANB 2QGRA 2H9EH 2QAAA 3GCTF 4LZ4B 2NU2E 2EC9H 1IQIA 2V35A 4K60A 1XX9A 3LKWA 1YPMH 2D26C 2BQ7B 2ZEBA 4IS5A 2F3CE 1V2PT 3SU6A 1NBME 2AGIX 1T31A 1EJAA 3QLPH 3E0NB 2VBCA 1PPEE 1ZTLA 4NFFA 5C3NA 4H42U 1MTNB 1LKBA 1GPZA 1P2NA 3CS7A 1CU1A 3SHCH 3RXIA 1EB1H 1GJDB 4AFUA 3BG8A 3QTVH 2G5NA 3P8OA 2VVUA 4LZ1H 4CR5A 4FUCA 1DLKB 3RMNH 1YPHE 1K1JA 5HXFA 2DE8A 1HJAC 4ZH8A 4OGYA 2Y5HA 4I31A 4ZHLU 1TQ0B 3B8JA 1YKTA 5A8YA 3KF2A 1GMCF 5T6GA 3ZIAD 2EEKA 3A87A 2XW9A 3A8CA 1P12E 3TNTA 1O2NA 1P2QA 1AWHB 1GHAF 3Q00A 3Q77A 2ZU4A 1QY6A 1FY4A 2R2WU 1VR1H 1TX7A 2Z7FE 4TY6A 1HAHH 1ZTJA 1MAXA 1MQ5A 3P8FA 3MO9A 4JZ1A 4KGAA 1GHXH 1A3BH 4AG1A 1B5GH 2KR7A 1SGYE 1HAXB 5FPYA 3EQ0H 3RXJA 4FETA 1CE5A 1GI0A 1XUHA 3KHVA 4SGAE 1G30B 2ZNKH 1V2KT 1KY9A 1C5QA 1WCZA 1ESBA 5ETXA 1K0HA 2ZGBH 5TCAA 4I32A 1ZRKA 2J2UA 1SQTA 3MU4A 3MNBA 4JYVH 1BMFD 1VZQH 3BTTE 3PM3A 1WUNH 1HJ8A 3UREA 1QFKH 3RXUA 1GJ5H 3CP7A 5GXPA 1A7SA 1GHWH 2TGAA 2A4QA 2ZQ1A 3MO6A 1AWFH 1OSSA 5G4BA 1MKWK 3PLKA 3LPRA 1ZJKA 2G55A 4HFPB 1SLUB 2YMSC 3UB0A 4UEHH 4I8LA 1DSUA 2ILNA 2F83A 1UVOA 3SV9A 3KYFA 2OINA 3GY4A 4MNWA 4B73A 2M2AA 1CBWC 4A1XA 4CBNA 2QY0B 3BEFB 1SPJA 2JETB 2VWNA 2ZI2H 5DP7A 2VH6A 2ASUB 4FUFA 1KLIH 3DFLA 3ATWA 1BMNH 3SNBA 3SJKA 1WAYB 3LH1A 1GJ8B 3MMGA 1EAIA 3E90B 3RXSA 4INKA 1BRAA 1J8AA 2BY6X 3N7EA 2WYJA 3BTGE 1LPKB 2STAE 1S0QA 1PJPA 2BDBA 2VB0A 2VIWA 3D23A 1GWAA 2XWBI 2F9VA 5C0TA 4HTCH 4UFGH 1FONA 4FUEA 5DP4A 1CGHA 1V2TT 1V2MT 2ZFTA 3SN8A 1AB9B 1UK2A 1F0UA 4IW4E 2A7HA 2J34A 1CSOE 3LC5A 2HRVA 2OQ5A 3RDZA 1OWJA 1GHYH 1ELGA 1PYTC 1GG6B 1MTWA 2QXHA 2BMGB 3S7HB 1UVSH 3PV5A 1OYQA 2O8MA 1OKXA 4GVUA 4GHQA 1AVXA 2J94A 1C1MA 3QDZB 5E0GA 5FX6A 1YPHC 1O2RA 2V0BA 3ATIA 1YM0A 1LO6A 4I33A 3SV8A 2PR3A 1KXAA 2JH6D 1W8BH 5EPYA 4NIYA 3JZ1B 1P9SA 2ZWLH 2F91A 1SGRE 5FBEA 4YOIA 5A8ZA 1THSH 4IN1A 3GY5A 3SNAA 1IAUA 4MDSA 1C2HA 4TPYA 5AVDA 3M3VA 2CJIA 4RKOB 1YYY1 1ZSKA 3RXEA 2ZU1A 2GV6A 1G3EA 3OEED 4MPXA 1EQ9A 3BTQE 3A8BA 2FDAA 4H4FA 1O30A 2SGQE 1GI1A 3C1KA 1SR5C 1WDIA 3ZYEA 1SC8U 3NK8A 3BTFE 3QZRA 2AEIH 3F9HA 4U01A 2NU3E 1CA0C 4KP0A 4Y0YE 1SFIA 1Y3XA 3PLBA 4Q7ZA 1COWD 1YLDA 2P59A 2XYAA 1QRXA 4HGCA 1UHBB 1W7XH 1BITA 1Z71A 4JZIA 1AKSB 2GCTC 1MKXH 3SYJA 1TA6A 1SGIB 2GD4B 2XCFA 3SV6A 4YT7H 3HATH 2ZHQH 5A8XA 2C8XB 3F0OA 5F8ZA 1BBRK 2ZFFH 2ULLA 3ZVFA 2BD3A 4NIWA 1E79D 2XTTB 4MG3A 3T62A 2A45B 3UR6A 4Y71A 1BTPA 2HNTE 1GBAA 2KCOA 4X2YA 2IPHA 1ELTA 4TYDA 1DE7H 4H6TA 2ZDMA 1K28D 1HRTH 4B71A 2FESH 5C2ZA 2KX4A 1GI2A 1BMAA 1EUFA 1C1RA 1V2UT 2Y5GA 1K1MA 4Q63A 5DSFA 4ZKRU 7ESTE 3V13A 2QF3A 1RTLA 2J97A 1TE0A 2OC8A 1MTVA 4D9RA 1C2GA 1UVTH 3FO8D 3GY2A 1QA0A 3LGUA 2EQNA 3QGNB 2GMTB 1C9PA 1V2VT 1KXEA 3V0XA 1L4ZA 1K1PA 2BX4A 4Q7XA 2BLQA 1KXDA 2KCYA 1CA0B 3A7YA 3U8RH 3KIDU 3ZZ4A 1GMHF 4J2YB 3U98H 4GUXA 1A5HA 3VB3A 3HGNA 3SZEA 2AH4X 3TJNA 1KSNA 3M7UA 3ZVBA 1SG8B 2ZTXA 1GCDA 3KQ5A 3LC3A 1IQMA 3SGQE 5C20A 2BLOA 3KYGA 3T27A 3UWIA 2YNBA 1DLEA 3FFGA 4F4OC 1SGTA 5L2YH 1JXPA 4XBDA 5HIZA 5F53A 1NBMD 2IJOB 3GCHB 2HNTF 5CDFE 1EJMA 2C90B 3MU1A 3KQDA 5EGMA 1C5LH 5E0JA 1ANBA 2R2MB 1GBLA 1HPGA 1ZGIA 2R3UA 2OLGA 2XRCA 3S9BA 2QYIA 3RXCA 2C8YB 1GHAG 4MNXA 1JWTA 1O3JA 2F9PA 2GP9B 1MD8A 2PGQB 2CF8H 1EP5A 2W3IA 4JK5A 4K1EA 2NU0E 4X8VH 2THFB 2H2ZA 4CRCA 1KXFA 3NKKA 4BXWA 1FIZA 1O3MA 3UFAA 2FOMB 1K2I1 3SGAE 1YBWA 1SL3A 1KYNA 1OHHD 3MH4A 4P00A 3OEHD 1MMJN 3T28A 1C2DA 2QIQA 3R3GB 1DUAA 2D2DA 1O3IA 2KFWA 2TGDA 2BOKA 4Q80A 1CT2E 2J98B 1GBFA 2HVYB 1O0DH 1D4PB 3ZZ6A 2VVVA 1LMWB 5DO4H 1ELDE 1SQAA 1GI9B 2AMPA 1KIGH 1BTUA 2UUKB 2Z6BD 2P8OB 1NRPH 3DUXH 3GDUA 3K65B 1EXFA 1SHYA 4ISOA 1JOUB 5L6NH 2RCEA 3JZ2B 7LPRA 1Q31A 3BG4C 2PUXB 3FAOA 4X1RU 3M3SA 2K8IA 1T7CA 2Y5FA 2Y6TA 2NU4E 1O36A 1BZXE 1TB6H 1Y5AT 2PKSC 3SUDA 1HAZB 4NZLA 3HPTB 1ANDA 2HNTC 3PMBB 4YT6H 1E1QD 2V3OH 4JYUH 1E37B 3EAJA 2IN2A 1MABB 3ZVCA 4UE7H 2F43B 2ZFPH 4AFZA 3EGKH 5FAHA 3LGYA 1C1OA 2A5KA 1FV9A 5A2MH 2H5DA 4XD7D 5L2ZH 4ABJA 3SI4H 2ZECA 4FUBA 3GY3A 3K6ZA 4ABAA 1O3LA 1YPGH 5CHAC 3GICB 3RXFA 1XUGA 4NCYA 1YPEH 1P2OA 1EZQA 1YP9A 2GDDA 4RKJB 3S9CA 1YY3A 3ZZCA 1SGEE 4BXSA 3M5MA 2BVSH 1TGNA 2O8LA 1FY1A 3SQEE 4AYYB 1NT1A 1P02A 1TABE 1O2TA 5DP5A 1AFQC 4ZXYH 4YLUA 1OWKA 2BY7X 4E7RG 4NSYA 3U8TH 1F5LA 1UTNA 1NO9H 1IQNA 2TPIZ 1KTTB 2ALPA 1F0SA 1P3EA 2BD9A 1ORFA 2F9UA 1P2MA 4O97A 1CHOF 3BTME 5KEDA 1AMHA 2FOGA 4FUGA 1O2IA 4ZMAH 3TGJE 4X6MA 3UNRA 3LH3A 4WMFA 1W2KH 2R9PA 2OCVB 2QE7D 1BHXF 4ABBA 3BN9A 1TRMA 2ODYB 3S69A 2V3HH 5CHBA 1W0KD 3DHKH 4GLYA 1O2HA 1N8OB 1MUEB 2Y80A 4K69A 1O2MA 1ZHRA 1HIAA 4OS1A 4IMQA 4ABDA 1DWEH 4U30A 2BY9X 3NRLA 1GG6C 5DKMA 4BAKB 5B6OA 1FY5A 1C1NA 3MNXA 1TPPA 1VITH 2IPQX 3BF6H 5CHAB 4DY7B 1C5VA 1QBNA 1O2YA 2BZ6H 3MU5A 1A5IA 1KLTA 4A92A 1GHVH 3UUZA 1C5XB 2GJGA 4K8BA 3M7QA 5HM9A 1AKSA 4INLA 2BD4A 4K8YA 1CT4E 3H5CB 4X1NU 2H5CA 4VGCB 2V7QD 2LP6A 5LGOA 2ZDAH 1H9HE 3K6YA 1HAVA 3PMAB 5C0UA 1O2XA 4LXBH 3SNDA 4AFQA 4ISLA 1L1NA 1D3DB 1O3EA 1QBOA 4MPVA 3MFJA 1EPTB 3HGPA 3RXTA 3U9AH 2QF5A 1BB0B 3U28C 1A3EH 1LPZB 2OBQA 2I6QA 1O32A 3GY8A 2ZCHP 2CXVA 1V2NT 1N6XA 4NIVA 2GMTC 1C5WB 4YOGA 4H6SB 1C2MA 1O3FA 2D8WA 1YC0A 2BB4A 3BIUH 4MPUA 2FLRH 1WTHD 1A0LA 1NESE 4Y79A 2PKSB 5TJXA 5SGAE 2Q1JA 2BDHA 4B76A 4LK4A 5JDUB 1IQFA 4YTAA 4CH8B 3D49H 2XNIA 1V2WT 2BXUH 1E36B 2TRMA 4F49A 2CHAC 3VG8A 2BX3A 1G32B 2A31A 1O3KA 2A7JA 1TBQH 1YF4A 3BSQA 4FUIA 2AFQB 2O8TA 3TIUA 1FN8A 2STBE 3WY8A 1D6WA 2PTCE 1ZMNA 1BMMH 1O5DH 1G3DA 1GCTC 3MWIU 2J98A 4NFEA 3M7TA 4NWLA 1Z8RA 3KQBA 1MCTA 1T8OA 1LVMA 2FOHA 3PTNA 2BLVA 1Z6JH 4XE4A 1EX3A 4K2YA 1QGFA 3ZZ5A 2ZDNA 3UTUH 1HBTH 1WV7H 1DSTA 4PROA 1E1RD 4XBBA 1XUJA 2BY5X 2Y81A 3DSGA 3DT0H 1KMHB 3L6PA 1K1LA 1SMFE 1TONA 1O2VA 1AUTC 1C2KA 4AYVB 1GJBB 1PQ7A 3RU4T 1TAWA 1O3PB 1THRH 3UQOA 5JBTA 1S83A 2FEQH 1AY6H 2JKHA 3QUMP 3UPEA 4DT7B 3OFND 1OP2A 1EAXA 1TPSA 1D9IA 4X6NA 2FYRA 3GISB 1DWCH 1FUJA 2GZ7A 3A82A 3M36A 5T6FA 1SLWB 2FTLE 2ZFQH 1FNIA 4GSOA 2CHAB 1RGQA 1QQ4A 5EPNA 1O5AB 3SU3A 1P11E 2FZZA 1A0JA 2J95A 3SU4A 1TQ7B 1RXPA 1GJ6A 1VJAU 4WMDA 3URCA 4J1YA 2AGGX 2I6SA 1HDTH 1UTOA 3F9EA 3UWJH 1P0SH 3UNQA 4GCHF 1HFDA 4AG2A 1PPBH 2Z3EA 3SORA 5A0BA 2HLCA 2VINA 1V2RT 1NU7B 2DE9A 1BTYA 1W0JD 3MHWU 4UDWH 1F0RA 2P3FH 1O5GH 3P92A 1FJSA 1SQOA 3GDVA 2ZQ2A 4Y7AA 1LHDH 1WSSH 4ACAA 1UTJA 2UUYA 3ZVEA 1C4U2 4X8SH 1S5SA 2WPIS 4CHAC 3EYDA 1ZJDA 3FN8A 1TALA 4AB8A 4WJG2 2VWMA 1X7AC 1K9OE 2VIVA 3ZVAA 7GCHF 4K3JA 3P70B 3URDA 1V2LT 1DVAH 4JMYA 1L1GA 3M5OA 3ESTA 2A2XH 2LNCA 2HVXA 1S6FA 4INHA 1T4UH 1GVKB 5FCKA 2GKVE 1EAWA 4JK6A 1GGDC 3BTHE 5EXMA 4B2BA 1UVUH 1UTPA 1XUFA 2J4IA 2LELA 2UWPA 1C5YB 2VWOA 4Z0KA 2Z3DA 3ODFA 3TVJB 4MTBA 1VGCC 1WXRA 1HYLA 3UOUA 2CK3D 4RI0A 3RXPA 1UCYH 5LPRA 2CV3A 1C5UA 4NA8A 2J92A 1K22H 3SU0A 1ARCA 1GJ9B 2RA0A 1SGFA 1GJ4H 2ALVA 1V2OT 3EDXB 2WYGA 1SB1H 2K1QA 3E8LA 3QK1A 4AB9A 3EE0B 1E0FD 1G3CA 3CENA 1NZQH 1SSXA 5AFZH 3QX5H 3WWBA 3A88A 2AERH 2UWOA 5C94A 2YMSB 4F48B 1GMCG 5F03A 3FP6E 4MNVA 5T1VA 4Y8ZA 5JB9S 3BEIB 1K1IA 2ZO3H 4B75A 1DY8A 1DXWA 3IWMA 1QB9A 2XBXA 2Q6GA 2ODQA 2TGPZ 1DM4B 1UCYK 1O5EH 1TA2A 3BTDE 3M5NA 3SNCA 1CHGA 3ITIA 2AMDA 1MD7A 1IOEA 2WUCA 2QA9E 5FHTA 2HPPH 5DJ7A 3W1EA 3AVZA 4CRDA 1HUTH 1TIOA 2VIDA 1N8OC 1EZXC 2BDAA 4P02A 1YCPM 3TJOA 4GPGA 1AD8H 2UUFB 1ETRH 5TCCA 4X6PA 1LDTT 4AX9H 1D3QB 3I29A 1MAYA 3KNXA 1PYTD 1J9CH 1XUIA 5EW2H 5EXNA 1T8NA 1C2JA 1AU8A 3QZQA 4B6EA 3SQHE 1ZGVA 1BJUA 2CN0H 1LHGH 5C1XA 1CBWB 2C3SA 4X6OA 1J14A 1ABIH 1XKAC 3F2HA 2ZFSA 5DP3A 1EPTC 1O3BA 1FXYA 1S6HA 4O3TA 1TNGA 4BTTB 2V3MA 3Q3YA 4ASHA 1H9LB 1GBEA 1RFNA 1ZYOA 3RXMA 2GVFA 1ZTKA 3RC6A 1W0YH 3NZIA 3FANA 3S7KB 3L3TA 1HAVB 1SI5H 3ZZ3A 3RU4D 2NWNA 3RXBA 3TH4H 2QXGA 1MZDA 2QV1A 1ESTA 1YGCH 3UAIC 1H1BA 2ANMH 3MI4A 4K1TA 2EY4C 1O5BB 3SO3A 5DP9A 4DJZB 5JB8S 3S9AA 3L33A 1O2JA 3PWBA 1DX5M 1TNKA 2Z9GA 1L2EA 2ZTZA 4DG4A 2B8OH 5F8XA 3W94A 2SNWA 4LOYH 4E05H 1TMTH 7KMEH 1ZRBA 1O3GA 1O3DA 2FI4E 2FMJA 2YMSD 5FPSA 1BBRH 1ELCA 4HG6A 4F55A 3M61U 3FZZA 1S82A 1AE8H 1W0ZU 4X2VA 2A1DB 2VNTA 4I8HA 3PLPA 5GCHF 2FP7B 1W14U 2GT8A 1PPZA 4X8UH 3A81A 1TNLA 3GY6A 1DITH 2RDLA 1QL8A 2XNDD 2J5UA 4DURA 1K1OA 1TBRH 4NZQA 1P2JA 3TK9A 3BTWE 3U1IB 1A1RA 3PYHA 1O2GH 4R8TB 3A85A 3RXLA 4UD9H 1SOZA 3DSOA 4ACBA 4YZUA 3BIVH 3KQCA 5F6MA 4DIIH 2OC1A 1WOFA 2OP9A 2Q6DA 3PB1E 4WY3A 2SGPE 5E2OA 4O03A 4KELA 3RXAA 2Z94A 9LPRA 1GBJA 4CREA 3N99A 3Q3XA 2QN5T 1SBWA 3SV2H 1LHEH 1T8LA 1Y5BT 1EPTA 2H9TH 2Z3CA 1C1UH 1C5SA 1LHCH 1SKYE 1FY3A 3SJOA 2ZHWH 1F2SE 1FY8E 3RM0H 1TGTA 3RXQA 3LIWA 1G3BA 1GMDG 3E16B 1UTKA 3SGBE 1HAIH 1ABJH 3TH3H 2GZ8A 5LPEA 4JZFH 1GMHG 2ZGXH 2GX4A 1ELEE 2PP6A 4ZKOU 2WZQA 3ZZ7A 1C1SA 1CGIE 2G8TA 1LHFH 4UFDH 4UFFH 2WPLS 3ATMA 4BTIB 2R0KA 4YO9A 2C93B 1SGFG 3UNSA 1ZOMA 1NRRH 4DVAU 1FIWA 3Q76A 1SLVB 3SJIA 3OX7U 1Y5UT 2P16A 3OU0A 1SGPE 4YOJA 4HI3A 1ELBA 1A2CH 1TRNA 2H6MA 3I77A 2RG3A 1MTSA 2BVRH 1C2FA 3MH5A 5EJZA 2A0QB 2RDEA 4Y6DA 3PMJA 4OS7A 3ATKA 1LQDB 2Z9KA 3PO1B 3PV2A 3AASA 1BJVA 1QZ8A 3A8DA 1GI4A 4TWWA 5FX5A 4CBOA 5C1UA 1BHXB 3GS9A 1TX8A 2ZGHA 4D7GA 1DPOA 1N6YA 1GGDB 1C2LA 1KLJH 1GBBA 1INCA 3T29A 1BQYA 3QTOH 2ANKH 1ANEA 4YXWD 1A5GH 1WQVH 4WF8A 3LJOA 3SZNA 4E06H 3R0FA 2W26A 1PQ8A 1FZZA 4ZHMU 1O37A 3WWFA 1P9UA 5IYTA 1WU1A 2HPQH 3H7OA 3F2GA 4B6FA 4FVBA 2WPJS 1DS2E 1VITG 2A4OA 4A1VA 3EA9A 4FUDA 1YPLH 5HMAA 5E2PA 1QCPA 2HGTH 3ATLA 1QURH 1G2LA 1EJNA 4ZUHA 1BDAA 4FOUC 4A5TS 2SGEE 1W7GH 3MU0A 2YOLA 4BAHB 1QRWA 1BA8B 3GCHC 4X8TH 5IK2D 2KZ4A 1E38B 2VVCA 1HJAB 3FZDA 5HYOA 5ABWA 2W6JD 2G5VA 2PGBB 2OC7A 1TMBH 4MLFB 2CF9H 3AW0A 3GCOA 1MBQA 1C1TA 1O2OA 1FX0B 1Z7KA 2J38A 1D3PB 1GBHA 2ZZUH 1FAXA 2F9OA 1SHHB 2BYAX 3IG6B 1HXEH 3GY7A 4XBCA 1QBVH 1C1QA 3QGJA 5DP6A 3TK6A 1UK3A 2QF0A 2ZF0H 1TNJA 8GCHG 3T5FH 1O2QA 1NRNH 2ZIQH 1LKAA 1ELFA 3KL6A 1FPCH 1SQRA 4KKDA 5LPFA 3PRBA 1ZHPA 3SNEA 4X2WA 4TWYA 2BTCE 3ZV8A 1JIRA 1LTOA 5FBIA 1Z6EA 2FIRH 1SOTA 1FLEE 1B7XB 1F0TA 1ZSJA 1L0ZA 2A4GA 1C1WH 3LOXA 4OS5A 2BY8X 2PLXA 4I8GA 1DY9A 1CA8B 3RC5A 1EATA 3RMLH 2OQUA 1HIAB 4O3UA 4THNH 2BDCA 2L74A 2HWLB 8LPRA 3AK5A 2FLBH 1G2MA 1LCYA 2FO9A 3TNSA 2YNAA 1OXGA 3F9FA 2ZDVH 5DG6A 1O3OA 1YLNA 5J4QA 1HNEE 1AHTH 3A83A 1GI7B 1G9IE 2Y7ZA 4ZHAA 2ZGJA 4YESB 2GTBA 2VGCC 1GDQA 1P8VC 1EZUC 5E8EH 1THPB 1GBKA 1H8IH 4CH2B 4M7GA 2K0QA 8ESTE 1O2UA 1GVZA 1GBIA 1C5OH 3EA8A 1S81A 4CRFA 3SOSA 2WHXA 4BAMB 4CR9A 1TX6A 3N7OA 3TJVA 1H8DH 3RXVA 1HV7A 1JRTA 2C8WB 2CGAA 1C2EA 3QWCH 1BTHH 1Q2WA 1DWDH 2XC0A 3RUOA 2KAIA 1RTFB 3A7XA 1U6QA 2PSXA 1ESAA 2Q6FA 4RSPA 4DW2U 1Y3WA 1D6RA 2ZGCA 3OAAD 3LU9B 2GDEH 5I25A 3M5LA 1FAKH 3RXRA 1Y59T 3V12A 1AZZA 3H7TA 1VCWA 2OXSA 2ZKSA 4OS4A 1CHOG 3AAVA 3SU5A 2BDYA 2A2QH 1MU6B 4RN6A 2FI3E 4I8JA 3NUMA 3KQEA 1NS3A 1GJAB 2FOAA 1OS8A 2XXLA 1AN1E 5A0AE 4JZDH 4X1QU
chains in the Genus database with same CATH topology
1JMOH 1ARBA 1QR3E 4XFQA 1NFYA 1DOJA 3F1SB 1C1PA 1QJ6B 2Z9JA 4UFEH 4BTUB 5EODA 2FYQA 5EQSA 3RXOA 1SFQB 1C4Y2 3PWCA 1TFXA 3M35A 1ZR0A 4GAWA 2VIOA 4CRAA 1V6DA 1NC6A 2OUAA 3P8NA 1SVPA 1NU9A 2WPHS 1G36A 3STJA 2B9LA 1NFWA 4XSKU 1RS0A 1YLCA 2XC4A 1L4DA 1ELAA 1AVWA 1GBMA 2Z9LA 4I7YH 1SGQE 2HOBA 2IOTA 3F68H 3RXGA 3FP7E 1FQ3A 1L1JA 4X1SU 1F5RA 1QHRB 3MH7A 1IHSH 1AZ8A 1NM6A 1Q3XA 1Y3YA 4ISHH 4VGCC 6GCHF 1VCPA 4BAQB 3VGCC 2FM2A 1UO6A 2WINI 3ELAH 3ZZDA 3U8OH 4JZEH 1ELVA 2OTVA 1O2PA 1RIWC 1P04A 1H9IE 3RMMH 1GI5A 1GMDF 1N1LA 4DOQA 4Y7BA 1T8MA 2ZHDA 3E0PB 2PTNA 4FVDA 1O38A 1J15A 1H4WA 2A32A 2P94A 5EG4A 4HZHA 3O8CA 1ZPBA 1HAGE 1W12U 5JBCS 3SUFA 4ZKSU 1NFUA 4IGDA 2ZP0H 3MOCA 1JRSA 2F9NA 1MBMA 4O9VA 5BRRE 1AQ7A 2G52A 1GJ7B 3TH2H 1AB9C 1OP8A 1Y8TA 1DXPA 3NCLA 2BQWB 2NU1E 1NRQH 1QQUA 2ZDLA 3QN7A 1DT2A 1K1NA 1ZZZA 1V2ST 4X1PU 3ODDA 4B1TA 4E7NA 2QC2A 1O3NA 3LT3A 2V6NA 3M3TA 2TIOA 4KTSA 4FU7A 3TU7H 4IC5A 1GHZA 1S84A 1UK4A 3DA9B 1NFXA 1TGSZ 1EAUA 1OX1A 1V2JT 2WPMS 2FWWA 1LVBA 2D1JA 4D76A 1XKBC 1ID5H 3K2UA 3PMHB 4DIHH 1O2LA 1MZAA 2G81E 1MH0A 2ZU2A 3EA7A 5FXLA 3ZVGA 2SGDE 1AUJA 1C9TA 3BTEE 2LPRA 4JCNA 2M5TA 2P3TB 3SV7A 4KTUA 5F8TA 5GDSH 1UMAH 1HB0B 3LGTA 1HXFH 4WWYA 1O34A 1GVLA 1AFEH 2PWXA 2ZFRH 1PPHE 3OSYA 2VIQA 1P05A 4FXGH 3HKIB 1BTWA 1UTMA 1UCYE 4QT8C 1P09A 1WQSA 2G4UA 1GL1A 1BMLA 1W10U 5A09A 5EQRA 3SU1A 2ZHEH 4YM9A 1VGCB 3DFJA 2P3UB 5AF9H 3TJUA 5L30H 5A0CA 1EOLA 1WYKA 3LGWA 1DFPA 1GI8B 3T25A 1TWXB 1O2SA 1J16A 5K0HA 2B7DH 1YPJH 2XBWA 5JYIA 4D7FA 2ANYA 4SGBE 1PQAA 1TPAE 2ZC9H 1QIXB 1CGJE 3KN2A 2GCTB 4Y0ZE 1CVWH 4NG9H 4FUJA 2SGAA 1T4VH 3LGVA 5C1YA 3VXEH 1AI8H 1TOCB 4WXIA 4AOQA 3VB5A 3LJJA 1HGTH 2FODA 1HJ9A 3VGCB 1ZLRA 1ZHMA 4IBLH 1XM1A 4Y8YA 1DWBH 2BXTH 4AFSA 2PW8H 1TPOA 3SUEA 5DK1A 3LGIA 4WMEA 3T26A 3ZZAA 1WTGH 2ZPSA 2ZTYA 1C4V2 5GCHG 2ZPRA 4Y76A 3T2NA 3RM2H 4Q2KA 1KTSB 2HALA 4ABHA 1C5ZB 2GCHG 1BIOA 1GBCA 2XBVA 3G01A 5IDKA 5ESTE 1LPGB 2GV7A 3ZZ9A 3AW1A 2TGTA 1O2KA 2JETC 3BEUA 1BOQA 1SGDE 5FCRA 4WXVA 2BD7A 4GCHG 4YLQH 2Z9IA 3O8RA 2JH0D 2GT7A 4BNRA 4DGJA 2PSYA 1OYTH 4IN2A 3P17H 4DCDA 4NSVA 1BRCE 2VH0A 3GYLB 1MU8B 5T6DA 6GCHG 1VCQA 1IQJA 3RU4E 4ESTE 2BVXH 3BTKE 1TOMH 4MNYA 2A4RA 4B74A 2ZCLP 1A46H 1GHBG 3KCGH 5JBBS 3TGKE 5C5OA 1DICA 3UY9A 3VB4A 1QNJA 4ABEA 1FDPA 3ZZ8A 1GDNA 1P2IA 1GBDA 4CHAB 2C8ZB 4B2CA 1ACBE 3RXKA 1GJCB 5EU8A 2BLWA 1A0HB 3A84A 3BV9B 1IQEA 2GGVB 5FPTA 3TLOA 1ZSLA 2W7UA 3LDXH 1EZSC 4K5ZA 1C1VH 2P93A 4UONA 5J4SA 5PTPA 3GDSA 2AS9A 1Z1JA 1OWIA 4TY7A 1UJ1A 3NPSA 5GJ4B 1IQHA 2PFEA 3TPIZ 1TYNA 4Y10E 3ZVDA 1QA7A 3GCTG 3VEQB 1Z8GA 2EI7A 4NA9H 3ZZBA 5GWZA 1O3AA 2FS9A 1O35A 2VWLA 4CRGA 4X2XA 1O2ZA 1IQLA 2A5AA 1TNHA 1MKXK 1Z8IB 3MYWA 2KAIB 1C5TA 3F9GA 3D65E 1OWHA 3RC4A 1ANCA 3M37A 4WH6A 2FOBA 4MVNA 3MTYA 3V7TA 3P95A 2ZU3A 4TPIZ 1QB6A 2BD2A 4AORA 1O3CA 3VB7A 2G00A 1S0RA 4A6LA 2ZG0H 1VJ9U 3Q3KA 1MTUA 1HAOH 1GI3A 2ODPA 2G51A 1SGNE 1W13U 3DD2H 1MTNC 1UHBA 3BG4B 2H1UA 4NGAH 1LVOA 2XBYA 1MCVA 3VPKA 5DGJA 1RD3B 1W3CA 3F6UH 5CE1A 3ZV9A 2VU8E 3SHAH 3A8AA 1ETTH 3RXDA 1DUEA 1RIWB 1P3CA 2WV5A 4OS6A 2O8UA 3MNSA 1GL0E 1MKWH 2OD3B 1XMNB 2EI8A 3TK5A 1AGJA 2ZHFH 1PPCE 2H9HA 1P2KA 2GZ9A 2F9BH 1RTKA 3HK6B 3E1XB 4ZROA 1AIXH 1EKBB 3RMOH 2SGFE 3PO1C 4B2AA 2ZA5A 4Y11E 1CQQA 1BBRE 3RLYH 2W3KA 1QJ7B 2BZAA 2UUJB 4XDEA 3AAUA 4FU8A 5EW1H 1J17T 2PHBA 2BM2A 2ZCKP 2DUCA 5T3HA 4KTCA 1NRSH 4OS2A 3V3MA 2ESTE 3TGIE 2XWAA 3UIRA 3OY5U 5EOKA 3UR9A 1NROH 1O3HA 2O9QA 1FPHH 4BAOB 1B0FA 3SJ9A 2A7CA 4D9QA 1P10A 4BOHA 2ZPQA 3PV4A 5JBAS 2BD5A 4ISNA 1JIMA 4XOJA 1IHTH 3U69H 1QRZA 1P01A 1NPMA 8GCHF 2FOCA 3UQVA 5I46H 2B5TB 3K9XB 4ABGA 1GI6A 2XCNA 1CT0E 1IQGA 1IQKA 1OWDA 1TNIA 2BDIA 2QXJA 3RP2A 8KME2 1QL9A 6ESTA 2EA3A 1NN6A 2QXIA 1FN6A 2VIPA 3FP8E 1XVMA 5GIBA 1UTLM 3MO3A 1A61H 1GDUA 1YCPH 2WPKS 3QO6A 3O8BA 3A89A 2FI5E 2C4FH 3A7VA 2P8OC 3VXFH 1D3TB 1TMUH 1C5NH 1EOJA 3MH6A 3MU8A 1XUKA 3P8GA 4MQAA 4ZAEA 1O33A 2FOFA 3KEEA 3OY6U 2EI6A 1TRYA 4ZXXH 4WVPE 3HKJB 5DPAA 5EXLA 1B0EA 1QL7A 4AN7A 4K1SA 1K21H 3STIA 2PKAB 3OTJE 1PQ5A 3E91A 2BQ6B 1HAPH 3P6ZB 1KXBA 2Y82A 3A7TA 1Z8JB 3IITA 3SW2B 1P57B 1O5CB 4JYTA 5C5NA 1TGBA 1C5RA 3A80A 1KDQB 2AIQA 2VGCB 1ZPZA 2FOEA 1HLTH 5H4IB 5ESBA 3E6PH 1SLXB 1AE5A 1GHBF 2CMYA 2J9NA 1KDQA 5E0HA 2JH5D 5DP8A 3S0NA 9ESTA 1NTPA 5AHGH 4NIXA 4AZ2B 1E34B 2AYWA 2QCYA 1GCTB 1TBZH 1QTFA 3MNCA 3HK3B 1O39A 3CS0A 1KXCA 3NWUA 1DDJA 5C67A 4A1TA 1C5PA 2B0FA 1BRUP 3I78A 3PROA 4MPWA 2UWLA 4Z6AH 3W95A 2R0LA 1BUIA 5CMXH 1OPHB 2R3YA 2VJ1A 3OYPA 5HM2A 2PUQH 3GOVB 4IMZA 2G4TA 1OWEA 4IC6A 1QJ1B 1LVYA 2RA3A 3RXHA 4ABIA 2BOHB 2TBSA 1G37A 1UTQA 3B9FH 1AVGH 1FMGA 1P03A 2AMQA 1PFXC 1BTXA 3NXPA 3A86A 1QB1A 2PKAA 1ZMJA 1BTZA 1RJXB 3SJ8A 3SUGA 2XC5A 5JPMH 4R0IA 1UVPA 4AGKA 1P06A 4Q7YA 1XXFA 1O31A 1AFQB 2ANWA 1XVOA 3VFEA 6CHAB 3SBKA 2OC0A 1V2QT 4Y8XA 2P95A 1OOKB 1SGCA 3UOPA 6CHAC 1LQEA 3RLWH 1TGCA 2ZU5A 3SU2A 1E35B 1ETSH 2ZDKA 4ISIH 1OP0A 2SNVA 3O8DA 3SI3H 1HAYB 1AO5A 4NA7A 1BCUH 2Y7XA 3PTBA 4U2WA 2FTMA 5HGGA 3A7ZA 2BHGA 1VITF 2FXRA 3GYMA 1A4WH 1Z1IA 1S85A 1ZMLA 5GPIB 4OGXA 6LPRA 3U1JB 1XXDA 2O8WA 2W7SA 4D8NA 2WV4A 4WH8A 4CRBA 4FUHA 1O5FH 3ENSB 4NWKA 1F7ZA 1YCPK 2BD8A 1T32A 1YPKH 3ZYDA 3D62A 1DANH 1EP6A 5K7RA 1C2IA 4FU9A 7GCHG 3C27B 4I8KA 4A7IB 1C5MD 1M9UA 1EB2A 1GBTA 1EASA 3B23B 2WUBA 2GCHF 4GHTA 5BPEA 2AIPA 2BDGA 2AGEX 1CO7E 1V3XA 3GCNA 5EQQA 1Y3VA 4X0WU 4U32A 2FX4A 1ZPCA 3FVFB 1PPGE 1RRKA 3E3TA 3LONA 2FPZA 1MQ6A 1W11U 1PPFE 2FS8A 3VB6A 1O2WA 3A7WA 1FI8A 1HCGA 1F92A 2PV9B 1WBGB 2FX6A 1TLDA 2A5IA 5AFYH 5LH8A 1NY22 2W5EA 1F5KU 3KGPA 1BT7A 2SFAA 4AGJA 2OBOA 4ABFA 1BRBE 1JBUH 1Y3UA 3TITA 4ZKNU 4BANB 2QGRA 2H9EH 2QAAA 3GCTF 4LZ4B 2NU2E 2EC9H 1IQIA 2V35A 4K60A 1XX9A 3LKWA 1YPMH 2D26C 2BQ7B 2ZEBA 4IS5A 2F3CE 1V2PT 3SU6A 2AGIX 1T31A 1EJAA 3QLPH 3E0NB 1PPEE 1ZTLA 4NFFA 5C3NA 4H42U 1MTNB 1LKBA 1GPZA 1P2NA 3CS7A 1CU1A 3SHCH 3RXIA 1EB1H 1GJDB 4AFUA 3BG8A 3QTVH 2G5NA 3P8OA 2VVUA 4LZ1H 4CR5A 4FUCA 1DLKB 3RMNH 1YPHE 1K1JA 5HXFA 2DE8A 1HJAC 4ZH8A 4OGYA 2Y5HA 4I31A 4ZHLU 1TQ0B 3B8JA 1YKTA 5A8YA 3KF2A 1GMCF 5T6GA 2EEKA 3A87A 2XW9A 3A8CA 1P12E 3TNTA 1O2NA 1P2QA 1AWHB 1GHAF 3Q00A 3Q77A 2ZU4A 1QY6A 1FY4A 2R2WU 1TX7A 1VR1H 2Z7FE 4TY6A 1HAHH 1ZTJA 1MAXA 1MQ5A 3P8FA 3MO9A 4JZ1A 4KGAA 1GHXH 1A3BH 4AG1A 1B5GH 1SGYE 1HAXB 5FPYA 3EQ0H 3RXJA 1CE5A 1GI0A 1XUHA 3KHVA 4SGAE 1G30B 2ZNKH 1V2KT 1KY9A 1C5QA 1WCZA 1ESBA 5ETXA 2ZGBH 5TCAA 4I32A 1ZRKA 2J2UA 1SQTA 3MU4A 3MNBA 4JYVH 1VZQH 3BTTE 3PM3A 1WUNH 1HJ8A 3UREA 1QFKH 3RXUA 1GJ5H 3CP7A 5GXPA 1A7SA 1GHWH 2TGAA 2A4QA 2ZQ1A 3MO6A 1AWFH 1OSSA 5G4BA 1MKWK 3PLKA 3LPRA 1ZJKA 2G55A 4HFPB 1SLUB 4UEHH 4I8LA 1DSUA 2ILNA 2F83A 1UVOA 3SV9A 2OINA 3GY4A 4MNWA 4B73A 1CBWC 4A1XA 4CBNA 2QY0B 3BEFB 1SPJA 2JETB 2VWNA 2ZI2H 5DP7A 2VH6A 2ASUB 4FUFA 1KLIH 3DFLA 3ATWA 1BMNH 3SNBA 3SJKA 1WAYB 3LH1A 1GJ8B 3MMGA 1EAIA 3E90B 3RXSA 4INKA 1BRAA 1J8AA 2BY6X 2WYJA 3BTGE 1LPKB 2STAE 1S0QA 1PJPA 2BDBA 2VB0A 2VIWA 3D23A 1GWAA 2XWBI 2F9VA 4HTCH 4UFGH 1FONA 4FUEA 5DP4A 1CGHA 1V2TT 1V2MT 2ZFTA 3SN8A 1AB9B 1UK2A 1F0UA 4IW4E 2A7HA 2J34A 1CSOE 3LC5A 2HRVA 2OQ5A 3RDZA 1OWJA 1GHYH 1ELGA 1PYTC 1GG6B 1MTWA 2QXHA 2BMGB 3S7HB 1UVSH 1OYQA 2O8MA 1OKXA 4GVUA 4GHQA 1AVXA 2J94A 1C1MA 3QDZB 5E0GA 5FX6A 1YPHC 1O2RA 2V0BA 3ATIA 1YM0A 1LO6A 4I33A 3SV8A 2PR3A 1KXAA 2JH6D 1W8BH 5EPYA 4NIYA 3JZ1B 1P9SA 2ZWLH 2F91A 1SGRE 5FBEA 4YOIA 5A8ZA 1THSH 4IN1A 3GY5A 3SNAA 1IAUA 4MDSA 1C2HA 4TPYA 5AVDA 3M3VA 2CJIA 4RKOB 1YYY1 1ZSKA 3RXEA 2ZU1A 2GV6A 1G3EA 4MPXA 1EQ9A 3BTQE 3A8BA 2FDAA 4H4FA 1O30A 2SGQE 1GI1A 3C1KA 1SR5C 3ZYEA 1SC8U 3NK8A 3BTFE 3QZRA 2AEIH 3F9HA 4U01A 2NU3E 1CA0C 4KP0A 4Y0YE 1SFIA 1Y3XA 3PLBA 4Q7ZA 1YLDA 2P59A 2XYAA 1QRXA 4HGCA 1UHBB 1W7XH 1BITA 1Z71A 4JZIA 1AKSB 2GCTC 1MKXH 1TA6A 1SGIB 2GD4B 2XCFA 3SV6A 4YT7H 3HATH 2ZHQH 5A8XA 2C8XB 5F8ZA 1BBRK 2ZFFH 2ULLA 3ZVFA 2BD3A 4NIWA 2XTTB 4MG3A 3T62A 2A45B 3UR6A 4Y71A 1BTPA 2HNTE 1GBAA 4X2YA 2IPHA 1ELTA 4TYDA 1DE7H 4H6TA 2ZDMA