1P2IA

Structural consequences of accommodation of four non-cognate amino-acid residues in the s1 pocket of bovine trypsin and chymotrypsin
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsinogen, cationic
publication title Structural consequences of accommodation of four non-cognate amino acid residues in the S1 pocket of bovine trypsin and chymotrypsin.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1p2iA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1p2iA02
1CHOF 2XTTB 1G30B 1NN6A 1VGCB 2CV3A 1A0LA 2VWMA 4ZH8A 6GCHG 2Z9KA 1DUEA 4MLFB 1QB6A 1AWFH 1CE5A 2NU3E 2A4OA 1F5LA 1QJ6B 1ZSJA 1BTXA 2VVCA 4AZ2B 2H2ZA 3ZZ6A 7KMEH 4B1TA 1C5VA 1EAIA 2TPIZ 5GIBA 3GYMA 5GJ4B 1DS2E 1T7CA 4H4FA 2Z3EA 1EX3A 1WBGB 4JZFH 3O8BA 4GVUA 3RUOA 1OP8A 4ZAEA 1C2FA 3M3VA 1C2JA 1DWBH 3ZZDA 1GI7B 5EXMA 1TIOA 1DE7H 1BRAA 1OWKA 3M3SA 1UCYH 4K69A 4DIHH 1VJAU 4YOGA 1K2I1 2QXJA 1O2RA 2RCEA 1SPJA 4QT8C 1PQ8A 1P02A 2B8OH 1TGSZ 5FXLA 2BDCA 2J92A 1TABE 1S85A 1OP2A 2Z9GA 4Y71A 1XVMA 2ZHQH 3ZZ7A 3VXEH 1TPSA 2FOGA 2W5EA 1LPKB 2AMPA 5HXFA 3LGIA 2GX4A 1N8OB 2K1QA 3RMLH 4NG9H 1S83A 3OTJE 4DGJA 3BG4C 3QK1A 4O9VA 1RIWB 1W7XH 1MAXA 5JYIA 1C5TA 1O2SA 2BDHA 1BA8B 4X2XA 1W2KH 3GY8A 1CT0E 1T8LA 3OY5U 5A8XA 2AFQB 1CSOE 1NU9A 1Q3XA 1SGFA 1GI1A 4BTUB 1P2JA 2QF0A 1SGYE 4TPYA 3RP2A 3QTOH 1TQ0B 3TNTA 1P9SA 4YLQH 5JBTA 4VGCC 1AZ8A 2IJOB 3GY5A 4Y7AA 2TGDA 5C1UA 2BM2A 1FY8E 1ETSH 3QN7A 4YOIA 1G3CA 3RXEA 1UTQA 3NPSA 1HAYB 1SGTA 5G4BA 3ZZ9A 5A09A 2QCYA 2BLQA 3STIA 3K2UA 3SV8A 4X1RU 4ZHMU 2VIQA 4UONA 2FO9A 1WQSA 3EQ0H 2ZC9H 3LPRA 4SGBE 2QYIA 2I6QA 4CR9A 1RTFB 1BMNH 2ILNA 1GJ4H 2ZDNA 4BTTB 1VCQA 2P59A 1LTOA 2P8OC 4BAHB 4CRFA 2YOLA 2G52A 1AKSB 1ESAA 1EXFA 4GSOA 5DK1A 1C1VH 2BLVA 3FFGA 4GPGA 5AFYH 1ZPCA 2BD2A 1QY6A 2B9LA 1LHDH 1O3EA 2EEKA 2Q6DA 3EYDA 2AGEX 2RG3A 1SGNE 4Y7BA 1SQOA 2B7DH 2PHBA 3NUMA 3TJOA 1QA7A 1SMFE 3RMMH 1QNJA 4KTUA 4XOJA 1QRWA 1WYKA 1ZLRA 2GGVB 3GCHC 4KTCA 1N1LA 3RU4E 3M35A 3PO1C 1L0ZA 1H4WA 1JOUB 1NRQH 1KLIH 4B76A 2A45B 1A0JA 4Y8YA 3GCTF 1ID5H 3LIWA 5EW1H 5EQQA 3U8TH 4GUXA 5DP3A 1KXCA 4ZROA 2ZU1A 5EXNA 1O30A 1BTZA 4I33A 4BXSA 1P2OA 3AAVA 1YGCH 4ISLA 4HZHA 2Y7XA 1TMBH 3UREA 1C5ZB 4I8GA 1GJ6A 4LZ1H 1UCYK 2ZHFH 1JMOH 1LPGB 4ISHH 1QB1A 1JIRA 2A5KA 2W7SA 1Z8IB 1C4U2 1QRXA 3PLBA 1S6HA 1TX7A 3F6UH 1CBWC 1O2QA 1UTMA 4X6NA 1VGCC 1KTTB 4ZXXH 3UFAA 1O3PB 3RLWH 3RXBA 2ZDVH 1YPHC 1C1NA 5AHGH 1KLTA 1OYQA 2BQ6B 4U01A 4NSVA 1AFQC 1GHVH 3LU9B 2XC4A 3PM3A 3A84A 5HGGA 1OP0A 2QV1A 1FAKH 2R0KA 2ZG0H 1QURH 4IBLH 3M37A 3SJIA 1ZZZA 1V2ST 3PWCA 4X8TH 1TNIA 3VGCB 5EPNA 1K28D 2GZ8A 4LZ4B 4K5ZA 1VCWA 2P94A 1SGDE 7GCHF 2R3YA 2HPPH 4AX9H 2GDEH 5GXPA 1ELAA 2BZAA 1FMGA 4DT7B 3ZV9A 2HRVA 3EGKH 1GI9B 1O5AB 4TYDA 3TGIE 1HFDA 3SZNA 3MH4A 5BRRE 1O2UA 1O2PA 1MZAA 1QBVH 5E2PA 1P2IA 1GJAB 2F3CE 1BIOA 2LPRA 4XDEA 1YM0A 1UVUH 2SGFE 4FUHA 1GHAF 1VCPA 3OX7U 1PPEE 4YLUA 2CJIA 5EXLA 4BAQB 1JRSA 2BYAX 2ZDMA 1FZZA 3VB3A 4CRAA 3BN9A 1GI2A 4NSYA 2FS9A 4I8JA 2XBYA 4O3TA 1OOKB 3M61U 1O3CA 1O3KA 1YKTA 1P3CA 4X1SU 1IQEA 1N8OC 2WPMS 3RXKA 1C5QA 2OC0A 4JZIA 1NFUA 2A31A 1D6WA 1C1RA 2FX4A 3M7QA 2A32A 1UTNA 2J95A 1SL3A 1UCYE 3GYLB 2G81E 1AWHB 2FOMB 3QGJA 4YM9A 4ZHAA 3SU4A 1O2OA 1B7XB 2WYGA 1P06A 1UK3A 4NIYA 2QXGA 4A5TS 1ELBA 3D65E 2QGRA 1Y3UA 3ITIA 1LHCH 2BX3A 4X0WU 3ZYDA 1ZGIA 3K65B 2ZDLA 1CGHA 1QQUA 1EJMA 4MQAA 4X8SH 4BANB 1FJSA 1J16A 3TH2H 3UTUH 3MO3A 4CREA 1O2HA 1NFXA 2CF9H 5BPEA 1XM1A 5C5OA 8ESTE 2GCHF 2GP9B 3U9AH 4K1EA 4UE7H 3SOSA 5CHAC 1F5KU 1KSNA 1V2JT 1O2JA 3MWIU 1DDJA 1BJVA 4BAMB 1CO7E 1LVYA 1DOJA 1QJ1B 5B6OA 1ZMLA 1NC6A 5EGMA 1GHZA 2PR3A 2IPHA 1LHEH 1YPMH 3PMJA 1F0RA 1BBRH 3KN2A 1IHSH 1UTPA 2ALVA 1TBQH 1NZQH 4A6LA 1O2WA 4AFZA 3GOVB 4H42U 1GMCG 1GGDB 1K1JA 2H5DA 2ZGHA 3HKJB 1T4UH 3PMBB 6ESTA 4A92A 3SQEE 1O2LA 4IW4E 2XXLA 1FN6A 1H8IH 4Q80A 1ZR0A 4FUDA 3T25A 2P3UB 1GHXH 1Z6EA 2D8WA 1SR5C 3W95A 2G55A 5DP4A 3VB7A 1B5GH 1QGFA 3N7OA 4NZLA 1GBHA 4RSPA 3AASA 4CBOA 1ZTLA 3KIDU 4AYVB 5L6NH 4AN7A 2VJ1A 1V2NT 2GZ9A 1C1QA 3LGUA 4INKA 2ANKH 1QA0A 3RXOA 4ABEA 1MAYA 3CENA 2A2XH 3TH3H 1P05A 3PV4A 1V2RT 1AD8H 2OC7A 1LQEA 1PFXC 2XRCA 2BVSH 3GDSA 2J94A 2QC2A 1KLJH 3TNSA 1HAIH 1BJUA 3SQHE 5A8YA 1ZJKA 3S9AA 5L2YH 1FONA 1DM4B 1AU8A 5TCCA 2BD8A 4LK4A 3K9XB 2V35A 1A3BH 3RU4T 1NFYA 1BRCE 1CQQA 2ZFFH 2VGCB 2BY9X 4D9QA 1K1OA 1QIXB 1VZQH 4THNH 1HAOH 3E90B 1G3BA 1O2XA 3BIVH 2FX6A 1TPPA 4YO9A 2HOBA 5L30H 4UD9H 1TPOA 1TB6H 1YC0A 2AMQA 4JK5A 1L1JA 2ZU3A 5LGOA 1LKBA 3SU5A 1XVOA 1MH0A 2WV4A 1SQAA 1E38B 2BTCE 4MTBA 3ATIA 4XSKU 3B8JA 4A1VA 3O8DA 2CN0H 2GT8A 1TOCB 4K3JA 2FI5E 1SGCA 4B73A 1SHYA 3BTQE 5GDSH 3R3GB 1PPHE 1FUJA 5K0HA 3UR6A 2ZFTA 2HGTH 3H7OA 2WINI 1KIGH 1TNKA 3EDXB 3PLPA 4KELA 5ESBA 1MQ6A 1BBRK 2XBXA 1KYNA 1WV7H 2STAE 2VNTA 1IQNA 4INHA 3TITA 3ZZBA 2BOKA 4E7RG 2O8LA 3NKKA 2Z6BD 1O2TA 4IN1A 1ZHPA 3SN8A 1ESBA 1P10A 1SSXA 5EQRA 3RXSA 1GI6A 1M9UA 1T8OA 1GJ9B 4WWYA 1F0SA 1KXAA 5A0AE 5J4QA 1ZPZA 2ANYA 1FV9A 4CH2B 2FLRH 3L33A 1P12E 2F91A 4MNWA 2ZCLP 2SGQE 4D7FA 2XWAA 3UR9A 4I8HA 3UWJH 5E2OA 4IGDA 2AMDA 2EI8A 2NU4E 5F8ZA 3L6PA 2FOHA 1GBDA 4K2YA 1DPOA 2O8TA 2HLCA 3PTBA 4X2YA 1EKBB 3M5NA 1EASA 1IQHA 1GBTA 1YCPM 3ODFA 1OS8A 2P8OB 2XCFA 1Q2WA 3NZIA 3UOUA 1ETRH 4WMDA 3RXLA 4FUIA 1JRTA 3ENSB 4ASHA 1W7GH 5PTPA 1Y59T 3MMGA 6LPRA 1GBMA 1DY9A 2AIPA 3QZRA 4WMEA 1SC8U 1YPEH 1GGDC 1EQ9A 2ZQ1A 1GDNA 5DP5A 1SFQB 1RJXB 1A3EH 5C3NA 5T6FA 2CF8H 3KQBA 1ANBA 1GMHG 2ZECA 3M5MA 1Z8RA 3LC3A 5IDKA 5C67A 3MH7A 2BDBA 3PO1B 4YZUA 2ZDKA 3P8OA 1EB2A 5FX5A 4I7YH 2AYWA 5FCKA 1VITH 4H6SB 1DWCH 1O3DA 1W8BH 1O3AA 2A7JA 3ZZ3A 2ZQ2A 1D3PB 1AUTC 3ATMA 3T27A 1ELDE 1YCPK 1F5RA 1LHGH 1ABJH 2VIOA 4U30A 4YOJA 2GT7A 1Y3YA 4MNVA 2PFEA 4J2YB 5FHTA 4UEHH 1YYY1 3ATKA 1BBRE 3V13A 2BY6X 2IOTA 1C5OH 2R2MB 1GHBG 2FMJA 1A1RA 2ZU5A 1TLDA 4FUJA 4NWLA 2DUCA 1EPTA 2O8MA 3BTEE 1GG6C 4MG3A 2M5TA 1EZSC 3DFLA 1C4Y2 3SJOA 4X6MA 3MH5A 4R8TB 3MU5A 1O35A 1A2CH 1FN8A 2OUAA 3RXTA 4X1QU 4ABGA 1C5LH 3A8DA 4BTIB 1L2EA 4O03A 1B0EA 3STJA 3TJVA 3RXFA 1BTPA 3BTME 1AFQB 1V2MT 2R3UA 4OS5A 3LH1A 3SV2H 1HIAA 1AUJA 1GI3A 1ZYOA 4Q7XA 1TOMH 1ZMNA 1EZUC 8KME2 1KXEA 1O3JA 1YLDA 2FOBA 4FUFA 4GCHG 2DE8A 3I78A 2R0LA 2B5TB 2PTCE 2VGCC 3GY3A 1PPBH 4MVNA 1BTWA 1H9LB 3NCLA 4AOQA 2ZIQH 1MZDA 1BHXF 3SUFA 2W7UA 4ESTE 1NO9H 2F9UA 3UY9A 2EC9H 2XNIA 1W12U 2THFB 4OS6A 1ZMJA 4JZ1A 3BTDE 1GBJA 5F03A 4FUCA 4HTCH 1P2MA 3RC5A 1NT1A 1X7AC 2ZEBA 3A7VA 2VINA 1G36A 1QHRB 1O3LA 3HPTB 3F1SB 1RD3B 4ABDA 3A85A 2ZNKH 2ZHEH 5FBEA 4I31A 2A4GA 3HGPA 2AEIH 2G5NA 2LNCA 3MHWU 1D3TB 2WPLS 2QAAA 1GMDG 2PLXA 4UFGH 4O97A 4ABHA 2WPKS 3Q3KA 4MDSA 1C5NH 5DO4H 3ESTA 2BB4A 3T62A 3SGBE 1FIWA 3E1XB 1UK4A 1E35B 3BIUH 3P6ZB 1NPMA 3TIUA 2FOCA 4ZHLU 3LJOA 5F6MA 1A5IA 1O2NA 2Z7FE 1PPCE 4ZKSU 2OXSA 1O3GA 4FXGH 3T26A 1KTSB 3P95A 2JETB 1YPLH 2ZGXH 1NRPH 2BD9A 2ANMH 8GCHG 2JH6D 1QCPA 2OD3B 5JBAS 1PQ5A 1RXPA 2NU2E 3RC4A 4FVBA 4RKJB 1UTLM 5CHAB 1SGEE 1QTFA 3ODDA 1MTNC 5E0HA 1ARCA 4IS5A 3V3MA 5ABWA 4X2WA 3RXDA 2FOAA 9LPRA 2ZFPH 3SNCA 4FUEA 1ZRKA 2XYAA 1GHWH 1IOEA 1C2LA 2BD4A 3ZYEA 2BXTH 1YPGH 1AB9C 3HGNA 3C1KA 3RXPA 4MNYA 1LMWB 4FUGA 4SGAE 3RM2H 2GV6A 2GDDA 3URDA 1DICA 1BHXB 4FVDA 4YT7H 2PKAA 1S84A 3MO9A 4AG1A 1VJ9U 5DG6A 3DFJA 3U8RH 3FP8E 3ZZCA 1O2YA 4IMZA 2F9NA 1O2IA 2ZI2H 4ABJA 1LVMA 4IC5A 4A1TA 1FPCH 1QJ7B 1MUEB 3DUXH 1ZTKA 1TGTA 3A86A 1P3EA 3PROA 1SLVB 1TRNA 2QXHA 1WUNH 2ZKSA 3LGYA 1PYTD 1N6XA 4XBBA 1O2KA 5GCHF 4INLA 3ZVCA 1FLEE 2PW8H 1HXEH 5DKMA 3BG8A 1C2IA 1C1MA 2OC1A 3GDVA 1MTSA 2TIOA 4NA9H 2Y7ZA 2H1UA 2HPQH 2D1JA 1MTWA 4ISNA 1DX5M 4O3UA 3M5OA 1G9IE 4HFPB 1EOLA 4NIXA 3A82A 4AG2A 1TBZH 4ZKRU 1GJ5H 8LPRA 4K1SA 4ISOA 3BEUA 1OWEA 3ZZ8A 2ASUB 1HRTH 1AN1E 4TY7A 1C2GA 2V0BA 1RS0A 3HATH 4CHAB 2C8YB 1Y5BT 1S82A 1JBUH 2I6SA 2KAIA 2ULLA 1VITF 1MD8A 3IG6B 2KAIB 2C8WB 4GLYA 5FPTA 3F9HA 3MNBA 1C5MD 1TRYA 4X6PA 2BMGB 3NK8A 3VFEA 4CRCA 3NWUA 3G01A 1OWHA 4E05H 1IQGA 2R9PA 1U6QA 3S7KB 4MPWA 2PKSB 1PPFE 1BDAA 3MU8A 4FUBA 5JDUB 1ANCA 5C2ZA 1PPGE 1NRNH 2TGAA 2G4UA 1UTJA 3RXAA 2FOEA 3MU0A 3RM0H 1ELTA 2VIVA 5TCAA 3TVJB 1YBWA 1QBOA 2ZGBH 1TRMA 4ZXYH 1ELGA 1EP6A 1TNJA 2C93B 1C5PA 3ATWA 3UQVA 3GCTG 1O31A 1C1WH 1D4PB 1ZGVA 1P2NA 3MFJA 2FPZA 3F9EA 3RXIA 3SI4H 1RTKA 1TALA 2WPJS 3RXVA 3P8GA 3RXUA 2OQUA 2ZWLH 1SGIB 4RN6A 4AB8A 1WQVH 3SU3A 2P93A 4PROA 1HJ9A 2ALPA 3TK6A 2PGBB 2ZHDA 3SHCH 2JETC 1UTKA 1BQYA 1S0QA 2FTLE 2O9QA 1BMLA 1TX6A 1UJ1A 3TGJE 1C1UH 1QL9A 2GTBA 3NXPA 2Y5HA 1GJ7B 3Q76A 2WUCA 3A7TA 3URCA 1CA0B 3ZVFA 1LKAA 1XXDA 1HDTH 4B71A 2V3HH 3KF2A 2VVVA 2NU0E 3EA8A 1RRKA 5EU8A 2ZPSA 3Q3YA 4WJG2 1E0FD 2DE9A 2AIQA 3A80A 5I46H 1PQAA 1P09A 1BMAA 4NFEA 3L3TA 7GCHG 2F83A 3E16B 1IAUA 2UWLA 1HLTH 1O33A 4JYTA 5FX6A 2ZPRA 5IYTA 1LVBA 4F49A 2ZO3H 1TAWA 5F8TA 4Y8ZA 4AYYB 1OXGA 2PTNA 1UVOA 4CH8B 2UWOA 2OBQA 2H5CA 1DFPA 1O2ZA 1JWTA 1AO5A 1MKXH 1P2KA 3SGQE 4ABAA 1GI0A 3A81A 5EODA 3SO3A 3RXGA 5I25A 1DSTA 2FXRA 1P0SH 2AGIX 1GBIA 2J9NA 1HGTH 1L4ZA 1DSUA 1V3XA 4Z0KA 5LPRA 3SW2B 1SBWA 1NROH 1AIXH 3E91A 1A5GH 1P2QA 2ZCHP 4WMFA 1LO6A 3A8BA 2AGGX 1K22H 1W10U 4X8UH 1O39A 1THSH 3SU0A 1DITH 4MPXA 1DY8A 3OYPA 1Y5UT 3SBKA 2V6NA 4R0IA 4DW2U 4XFQA 2VWNA 1HJAB 1EAUA 4K8YA 3T28A 3RC6A 2BQWB 3AVZA 1GG6B 4ABBA 2BLOA 2HNTE 1XUHA 3LGTA 1V2PT 4MPVA 3UIRA 1HCGA 1V2UT 3MYWA 1GVLA 2G51A 1ANEA 2BY7X 3K6ZA 2ZTYA 1HNEE 1SGQE 5EW2H 1O5FH 3SU2A 5AFZH 2CMYA 1S81A 2GCHG 4Y0YE 5AVDA 1YPJH 1OWDA 3CS0A 1W3CA 4CHAC 3TGKE 3M3TA 2EI7A 2HNTF 2ODYB 1WSSH 4KKDA 1C2KA 1E34B 4AB9A 2FOFA 2BDGA 1O36A 3OU0A 3TPIZ 1TE0A 2F9VA 1J15A 3BTHE 1Y3VA 2PSXA 1O38A 1T32A 2JH5D 1GDQA 1HPGA 1SGPE 5A0CA 4X6OA 2PKSC 3LONA 4Q2KA 1C2MA 1DWDH 3BTWE 1GBEA 1IQMA 1EAWA 4NZQA 1BITA 2Q6GA 1DXWA 2WV5A 2A7HA 4Q7ZA 2C8ZB 5C1XA 2XWBI 3V7TA 1F2SE 4U2WA 4Y10E 3LT3A 4YT6H 2BDYA 1LPZB 1OYTH 5E0JA 3MNSA 1GI8B 3RXMA 4AFQA 1P01A 2XCNA 4K8BA 1CHGA 3MNCA 2Z9JA 1Y3WA 2H9HA 1GBCA 1QBNA 3ZVBA 1C9PA 1EJNA 3RXQA 1EZXC 1XKBC 1EUFA 3DT0H 2GCTB 1SOZA 3AW1A 2PUXB 3IWMA 2OLGA 1O3HA 3ELAH 6CHAB 1ELCA 1MKXK 2XC5A 1ANDA 9ESTA 1C1TA 1C9TA 3JZ2B 1TMTH 2WYJA 3SJ9A 3Q3XA 2P95A 2Y82A 1O0DH 3E0PB 1OSSA 2P3TB 2FWWA 4I32A 1ACBE 1L1NA 3RXCA 1CA0C 1ZOMA 1C4V2 1UMAH 1AE8H 2TRMA 1L4DA 3VB4A 1NFWA 1A4WH 2A2QH 4JK6A 4X8VH 1OPHB 1OWIA 1W0YH 6GCHF 5K7RA 4E7NA 1MTNB 1A5HA 3ATLA 4Z6AH 1HUTH 3ZZAA 1HAGE 1GCDA 2OTVA 2ZGJA 2PUQH 1GL0E 4LOYH 4Y0ZE 4A1XA 1XUJA 1SHHB 1SG8B 1E37B 1A7SA 3E6PH 5FAHA 2FYQA 3A8CA 1KDQA 1AGJA 1KXBA 1RFNA 1JXPA 1O34A 4DVAU 1SOTA 1AB9B 2CXVA 2UUKB 2ZCKP 3QLPH 3BTGE 1LDTT 3UNRA 2VWOA 1HB0B 1EZQA 2IN2A 3KHVA 1C2HA 2FTMA 1S5SA 2WUBA 2ZFRH 2QN5T 4CRGA 4J1YA 3SNDA 4JYVH 3GDUA 4K1TA 4TWYA 1GPZA 2SGEE 2A0QB 1EP5A 5A2MH 3FP6E 2BVRH 1QFKH 4XE4A 5LPEA 3ZVEA 1NESE 3W94A 3QTVH 1ELFA 4BAOB 5A0BA 3SGAE 1K21H 2ODQA 1C5SA 3GY7A 3SU1A 4KTSA 3BEFB 1XX9A 5DP6A 4WF8A 1WAYB 2O8WA 4X2VA 4HI3A 1FY1A 4JYUH 1HJAC 5EPYA 1H1BA 1TPAE 1GMDF 1FIZA 4NA7A 5ESTE 4YTAA 3TJNA 5EQSA 1SQTA 1XUIA 1EPTB 2Y6TA 2ZFQH 5DP8A 1UK2A 2BVXH 2VVUA 2GZ7A 1H8DH 3BTKE 3MO6A 1ZHRA 1O2VA 3UWIA 5TJXA 1QB9A 2ZFSA 4I8LA 5L2ZH 3DD2H 3UPEA 1GJBB 4X1PU 3A88A 3BV9B 3LDXH 2W26A 2FP7B 1HIAB 2A5IA 5EOKA 2AH4X 1V2LT 3UUZA 3FVFB 3RLYH 2JH0D 2G00A 1OX1A 1FY3A 5FPYA 4OS7A 1MTVA 4BAKB 8GCHF 1GBFA 1GVKB 3BTTE 2OBOA 5E8EH 1FY5A 3QWCH 1C5YB 5AF9H 4X1NU 5HMAA 4BOHA 2C8XB 3MNXA 3LC5A 2ESTE 1BRBE 2HALA 4NWKA 3R0FA 2QF3A 3SORA 2W3KA 3OY6U 2XC0A 2GD4B 1T8MA 4M7GA 1OWJA 3ZZ4A 2YNAA 2JKHA 4IN2A 1W0ZU 3A8AA 5DGJA 3SV6A 3M36A 4D8NA 5LH8A 1G2MA 3SV7A 2H6MA 1GBAA 2J34A 1ELVA 5CMXH 5A8ZA 4IC6A 4CBNA 1A46H 1JIMA 3Q77A 1HAXB 1TONA 2SFAA 1K1LA 3QO6A 1SGFG 1GI5A 1B0FA 3SJKA 2GCTC 1C5RA 1AZZA 1TBRH 2VH0A 4FU8A 1F0TA 3KQDA 1MTUA 1P11E 6CHAC 1TNHA 3BEIB 1V2TT 2XBWA 3SHAH 1Z1JA 2BD3A 4AFUA 1CGIE 1IHTH 2PV9B 5C20A 1MBMA 3PMHB 4D9RA 1BTYA 1G32B 2D26C 4UFFH 1O3IA 1CHOG 3QGNB 1C1OA 2H9EH 1BTUA 3LGWA 1DLKB 2FESH 2VIDA 4CR5A 4Y11E 2UWPA 1MCVA 2BY8X 3OSYA 3A83A 3UOPA 1GHYH 1CU1A 3A7ZA 5GWZA 4Q7YA 2BDIA 2SGPE 1G3DA 2ZU2A 1KXDA 2YNBA 2G8TA 3HK3B 3RMOH 2OINA 3U1IB 3EA7A 3KNXA 2BLWA 1ZHMA 1IQKA 1GVZA 3P8FA 1WTGH 3GY2A 4AFSA 1K1NA 1O3MA 3UNQA 3UQOA 5T3HA 1AFEH 1O37A 2XBVA 4AORA 2HNTC 3B9FH 1Z8GA 1V6DA 2D2DA 1ARBA 3RXHA 3CP7A 3LKWA 1AKSA 1FQ3A 1FI8A 5CE1A 1V2KT 1QL7A 2PKAB 2OC8A 2ZU4A 1XUKA 1DWEH 2Y81A 5FPSA 1Z8JB 3BF6H 1F7ZA 1Q31A 4DURA 3E0NB 3KQCA 1CVWH 1E36B 3S9BA 3KCGH 3RU4D 1NRRH 1EATA 1RGQA 2F9BH 5EG4A 1RTLA 1H9HE 2OQ5A 4B2CA 1CT4E 2EA3A 4ZKOU 2A1DB 2V3OH 1D9IA 3AW0A 2ZA5A 3S9CA 4ABFA 1DANH 4UDWH 5JB9S 1WTHD 1J17T 1EPTC 1HJ8A 1MKWH 2ZHWH 5E0GA 1YPKH 1N6YA 2AS9A 2J2UA 4XBDA 1C5XB 3BTFE 4WH6A 1TQ7B 1LCYA 2ZTXA 3P8NA 1D6RA 3QZQA 5T6GA 1P9UA 4A7IB 1IQFA 3D62A 1O5CB 3C27B 4MNXA 1HAHH 3F68H 1KXFA 4WXVA 1THRH 1IQLA 2BD7A 1Y3XA 1PPZA 2VB0A 1C1PA 1SLWB 1ZRBA 4AGJA 1P04A 4OS1A 1GJDB 3F9GA 1TA2A 1L1GA 1HAPH 1INCA 3SU6A 2STBE 4DIIH 1D3QB 3T29A 1TWXB 4GHQA 2GKVE 3MI4A 1NM6A 2CHAB 1DUAA 4FU9A 7ESTE 3FAOA 1AY6H 4MPUA 3M5LA 4NA8A 1IQIA 1T8NA 2BXUH 1G37A 3ZV8A 2J38A 3O8CA 3A7YA 1YP9A 1TNLA 5J4SA 2HWLB 1GJCB 3SUDA 5JPMH 2VIWA 3H7TA 1OKXA 3ZZ5A 4B74A 2FI3E 2GMTB 1NTPA 1GMCF 3SNBA 4IMQA 3S7HB 2FZZA 5GPIB 4OS4A 1D3DB 4H6TA 1UTOA 3P92A 1O32A 1MBQA 1P8VC 1TGCA 4F4OC 2BD5A 1MQ5A 3QDZB 5DPAA 2ZGCA 4OS2A 3I29A 1GWAA 2PSYA 2BOHB 3M7TA 4NGAH 1K1PA 4E06H 3GISB 1BMMH 3MOCA 5GCHG 5DP9A 2ZDAH 3MU1A 2ZTZA 1T31A 1F0UA 4ZMAH 2R2WU 5LPFA 2EI6A 1T4VH 1QQ4A 1RIWC 1ETTH 4Y76A 3F9FA 5JB8S 4TY6A 1Y8TA 2GVFA 1K1IA 3HK6B 1TNGA 1P57B 1ZTJA 1V2WT 1GBLA 4JZEH 1BCUH 2SNVA 1O5BB 1UVPA 1HAVA 1S6FA 1J14A 1BTHH 2A4QA 2BHGA 1HAVB 1DT2A 2RA3A 2SGAA 1FNIA 4KGAA 5FBIA 1O5DH 1PJPA 1YLCA 4NFFA 4DJZB 1XKAC 3PTNA 5C5NA 1UO6A 3P17H 1MKWK 1NS3A 1HBTH 2Z9LA 3D49H 4Y6DA 1VITG 1VR1H 4RKOB 4KP0A 4WY3A 3V0XA 2QY0B 1C2DA 3A7WA 3FP7E 4ZKNU 2ODPA 3VB5A 1O2MA 2BX4A 1V2QT 3GICB 1WOFA 2A5AA 4D76A 5FCRA 1A0HB 5T6DA 2J4IA 1GHAG 1MCTA 3DHKH 1C5WB 5DP7A 3TK5A 4ABIA 2TBSA 4GHTA 3MTYA 4TWWA 1NU7B 2BDAA 4UFDH 1BZXE 2ANWA 1K1MA 2OP9A 3TU7H 4DCDA 2ZZUH 3EA9A 4JCNA 1WCZA 1W11U 1NRSH 1CGJE 2FYRA 1GBBA 3S69A 4YESB 2WPHS 1LQDB 2FS8A 2PGQB 5DJ7A 1LVOA 3EE0B 2G4TA 2VU8E 3DA9B 4U32A 2Z94A 4WXIA 1TMUH 2VWLA 2FDAA 1PQ7A 2NU1E 1AMHA 2ZPQA 1SB1H 4B2AA 1EAXA 1C2EA 4B2BA 1IQJA 3JZ1B 4ISIH 3QX5H 3PYHA 2GV7A 1GCTB 1QL8A 1MU6B 2Q6FA 3O8RA 4NIVA 1BT7A 2RA0A 2VIPA 3PMAB 3RXJA 1O3OA 2F9PA 3U69H 3GY6A 1ZSKA 1AHTH 1DXPA 2RDLA 1SGRE 3T5FH 3ZVAA 3QUMP 1HXFH 1XUFA 4JMYA 2A4RA 3A7XA 1O3NA 3VPKA 3RDZA 2C90B 4WH8A 1A61H 1ELEE 1TGNA 3TLOA 1AVWA 1K9OE 3GCOA 1J9CH 4Y79A 3IITA 3H5CB 2Z3CA 3VEQB 1Z7KA 1QRZA 1Z6JH 2QXIA 2CHAC 3KGPA 1FDPA 1AQ7A 2Q1JA 3VGCC 2QIQA 2G5VA 3U98H 5HM2A 1UVTH 2UUFB 3ZVDA 4XBCA 1AVGH 1ZPBA 4D7GA 1QR3E 1ESTA 1HYLA 4BNRA 3SV9A 1XMNB 5HM9A 5F8XA 4I8KA 1XXFA 3P70B 4K60A 1ZSLA 3FZDA 1EJAA 1C1SA 2UUJB 3S0NA 1O3FA 1YCPH 1EB1H 1HAZB 1Y5AT 3WY8A 3E3TA 1KY9A 2P3FH 1LHFH 1SLUB 2GMTC 1ORFA 1HV7A 2AERH 2FI4E 4Y8XA 3SI3H 3KQEA 1UVSH 2O8UA 4HGCA 2FIRH 3A87A 2H9TH 3T2NA 1GMHF 2XW9A 2W3IA 3B23B 5C1YA 4B75A 2Z3DA 1CA8B 1W13U 4UFEH 3LJJA 1YPHE 3GCNA 3FZZA 3K6YA 1O2GH 3SUEA 4DY7B 1DLEA 1Z71A 1FAXA 2Y5FA 3PB1E 2VH6A 1BRUP 1FXYA 5JBCS 3RXRA 3U8OH 4FU7A 2WPIS 1TX8A 1AVXA 3BG4B 2Y5GA 3BSQA 1GHBF 1GBKA 2ZF0H 2FM2A 1V2OT 2SGDE 1SVPA 1W14U 1MD7A 2TGPZ 3LGVA 2PWXA 3KEEA 3SNEA 4WVPE 5SGAE 2NWNA 2ZP0H 1GI4A 1SLXB 1O3BA 3KL6A 1S0RA 2C3SA 7LPRA 4VGCB 2C4FH 3TK9A 1AE5A 1P03A 3RMNH 1UHBA 2A7CA 1PYTC 2BZ6H 2FODA 4BXWA 1CT2E 1FPHH 2F9OA 1UHBB 3PLKA 2FLBH 4NCYA 2BY5X 1GJ8B 4GCHF 1TYNA 1KDQB 5HYOA 1SI5H 4GAWA 1AI8H 1O5EH 3V12A 3LOXA 4DG4A 1BOQA 4DOQA 1FY4A 1TGBA 2Y80A 2P16A 3TJUA 4LXBH 5JBBS 1O5GH 3GY4A 1EOJA 1SFIA 1Z1IA 3SJ8A 1THPB 1C5UA 3LH3A 1TA6A 1BB0B 3MU4A 3U1JB 2QA9E 1H9IE 3M7UA 3AAUA 4CRBA 3FANA 3EAJA 2FEQH 3TH4H 1G2LA 3D23A 4NIWA 2CGAA 1MU8B 2TGTA 1MMJN 1WU1A 2OCVB 1GDUA 3GCHB 3CS7A 2HVXA 2SNWA 4CRDA 1XUGA 3Q00A 1GCTC 3HKIB 3I77A 3MH6A 2B0FA 5ETXA 2UUYA 3ZVGA 4OGYA 1DVAH 3SNAA 4AGKA 3E8LA 1F92A 4JZDH 4TPIZ 4ZUHA 2BQ7B 3UNSA 3PWBA 5H4IB 1J8AA 1ZJDA 3SUGA 3VXFH 1G3EA 1ABIH 1TFXA 1YF4A 3A89A 4OGXA 2Z9IA 1NY22 1BUIA 1GL1A 1V2VT 3VB6A 1CBWB
chains in the Genus database with same CATH superfamily
1CHOF 2XTTB 1G30B 1NN6A 1VGCB 3F2HA 2CV3A 1A0LA 3OEHD 2VWMA 2JIZD 4ZH8A 6GCHG 2Z9KA 1DUEA 4MLFB 1QB6A 1AWFH 1CE5A 2NU3E 2LELA 2A4OA 1F5LA 1QJ6B 1ZSJA 1BTXA 2VVCA 4AZ2B 2H2ZA 3ZZ6A 7KMEH 4B1TA 1C5VA 1EAIA 2TPIZ 2WHXA 5GIBA 3GYMA 5GJ4B 1DS2E 1T7CA 4H4FA 2Z3EA 1EX3A 1WBGB 4JZFH 3O8BA 1E1RD 4GVUA 3RUOA 1OP8A 4ZAEA 1C2FA 3M3VA 1C2JA 1DWBH 3ZZDA 1GI7B 5EXMA 1TIOA 1DE7H 1BRAA 1OWKA 3M3SA 1UCYH 4K69A 4DIHH 2XOKD 1VJAU 4YOGA 1K2I1 2QXJA 1O2RA 2RCEA 1SPJA 4QT8C 1PQ8A 1P02A 2B8OH 3KQ5A 1TGSZ 5FXLA 2BDCA 2J92A 4Z1MD 1TABE 1S85A 1OP2A 3FO8D 2Z9GA 4Y71A 1XVMA 2ZHQH 3ZZ7A 3VXEH 1TPSA 2FOGA 2W5EA 1LPKB 2AMPA 5HXFA 3LGIA 2GX4A 1N8OB 2K1QA 3RMLH 4NG9H 1S83A 3OTJE 4DGJA 3BG4C 3QK1A 4O9VA 1RIWB 1W7XH 1MAXA 5JYIA 1C5TA 1O2SA 4FOUC 2BDHA 3ZIAD 1BA8B 4X2XA 1W2KH 3GY8A 1CT0E 1T8LA 3OY5U 5A8XA 2AFQB 1CSOE 1NU9A 3SYJA 1Q3XA 1SGFA 1GI1A 4BTUB 1P2JA 2QF0A 1SGYE 4TPYA 3RP2A 3QTOH 1TQ0B 3TNTA 1P9SA 4YLQH 5JBTA 4VGCC 1AZ8A 2IJOB 3GY5A 4Y7AA 2TGDA 5C1UA 2BM2A 1FY8E 1ETSH 3GS9A 3QN7A 4YOIA 1G3CA 3RXEA 1UTQA 3NPSA 1HAYB 1SGTA 5G4BA 3ZZ9A 5A09A 2QCYA 2BLQA 3STIA 3K2UA 3SV8A 4X1RU 4ZHMU 2VIQA 4UONA 2FO9A 1WQSA 3EQ0H 2ZC9H 3LPRA 4SGBE 2QYIA 2I6QA 3KYGA 4CR9A 3F2GA 4B6FA 1RTFB 1BMNH 2KFWA 2ILNA 1GJ4H 2ZDNA 4BTTB 1VCQA 2P59A 1LTOA 2OK5A 2P8OC 4BAHB 4CRFA 2YOLA 2G52A 1NBMD 1AKSB 1ESAA 1EXFA 4GSOA 5DK1A 1C1VH 2BLVA 3FFGA 4GPGA 5AFYH 1ZPCA 2BD2A 1QY6A 2B9LA 1LHDH 1O3EA 2EEKA 2K0QA 2Q6DA 2IJD1 3EYDA 2AGEX 2RG3A 1SGNE 4Y7BA 1SQOA 2B7DH 2PHBA 3NUMA 3TJOA 1QA7A 1SMFE 3RMMH 1QNJA 4KTUA 4XOJA 1QRWA 1WYKA 1ZLRA 2GGVB 3GCHC 4KTCA 1N1LA 3RU4E 3M35A 3PO1C 1L0ZA 1H4WA 1JOUB 1NRQH 1KLIH 4B76A 2A45B 1A0JA 4Y8YA 3GCTF 1ID5H 3LIWA 5EW1H 5EQQA 3U8TH 4GUXA 5DP3A 1KXCA 4ZROA 2ZU1A 5EXNA 1O30A 1BTZA 4I33A 4BXSA 1P2OA 3AAVA 2QE7D 1YGCH 4ISLA 4HZHA 2Y7XA 1TMBH 3UREA 1C5ZB 3OTPA 4I8GA 1GJ6A 4LZ1H 1UCYK 2ZHFH 1JMOH 1LPGB 4ISHH 1QB1A 1JIRA 2A5KA 2W7SA 1Z8IB 1C4U2 1QRXA 3PLBA 1S6HA 2IPQX 1TX7A 3F6UH 1CBWC 1O2QA 1UTMA 4X6NA 1VGCC 1KTTB 4ZXXH 4XD7D 3UFAA 1O3PB 3RLWH 3RXBA 2ZDVH 1YPHC 1C1NA 5AHGH 1KLTA 1OYQA 2BQ6B 2KCYA 4U01A 4NSVA 1AFQC 1GHVH 3LU9B 2XC4A 3PM3A 3A84A 5HGGA 1OP0A 2QV1A 1FAKH 2R0KA 2ZG0H 1QURH 4IBLH 3M37A 5GNDA 3SJIA 1ZZZA 5EJZA 1V2ST 3PWCA 4X8TH 1TNIA 3VGCB 5EPNA 1K28D 2GZ8A 4LZ4B 4K5ZA 1VCWA 2P94A 1SGDE 7GCHF 2R3YA 2HPPH 4AX9H 2GDEH 5GXPA 1ELAA 2BZAA 1FMGA 4DT7B 3ZV9A 2HRVA 3EGKH 1GI9B 1O5AB 4TYDA 3TGIE 1HFDA 3SZNA 3MH4A 5BRRE 1O2UA 1O2PA 1MZAA 1QBVH 5E2PA 1P2IA 1GJAB 2F3CE 1BIOA 2LPRA 4XDEA 1YM0A 1UVUH 2SGFE 4FUHA 1GHAF 1VCPA 3OX7U 1PPEE 4YLUA 2CJIA 5EXLA 4BAQB 1JRSA 2BYAX 2CK3D 2ZDMA 1FZZA 3VB3A 4CRAA 3BN9A 1GI2A 4NSYA 2FS9A 4I8JA 2XBYA 4O3TA 1OOKB 3M61U 1O3CA 1O3KA 1YKTA 3AK5A 1P3CA 4X1SU 5C0TA 1IQEA 1N8OC 2WPMS 3RXKA 1C5QA 2OC0A 4JZIA 1NFUA 2A31A 1D6WA 1C1RA 2FX4A 3M7QA 2A32A 1UTNA 2J95A 1SL3A 1UCYE 3GYLB 2G81E 1AWHB 2FOMB 3QGJA 4YM9A 4ZHAA 3SU4A 1O2OA 1B7XB 2WYGA 1P06A 1UK3A 4NIYA 2QXGA 4A5TS 1ELBA 3D65E 2QGRA 1Y3UA 3ITIA 1LHCH 5KECA 2BX3A 4X0WU 3ZYDA 1ZGIA 3K65B 2ZDLA 1CGHA 1QQUA 1EJMA 4MQAA 4X8SH 1SKYE 4BANB 1FJSA 1J16A 3TH2H 3UTUH 3MO3A 4CREA 1O2HA 1NFXA 2CF9H 5BPEA 1XM1A 5C5OA 8ESTE 2GCHF 2GP9B 3U9AH 4K1EA 4UE7H 3SOSA 5CHAC 1F5KU 1KSNA 1V2JT 3F3BA 1O2JA 3MWIU 1DDJA 1BJVA 4BAMB 4B6EA 1CO7E 1LVYA 1DOJA 1QJ1B 5B6OA 1ZMLA 1NC6A 5EGMA 1GHZA 2PR3A 2IPHA 1LHEH 1YPMH 3PMJA 1F0RA 1BBRH 3KN2A 2V3MA 1IHSH 1UTPA 2ALVA 1TBQH 1NZQH 4A6LA 1O2WA 3N7DA 3GOVB 4AFZA 5DSFA 4H42U 1GMCG 1GGDB 1K1JA 2H5DA 2ZGHA 3HKJB 1T4UH 3PMBB 6ESTA 2KM0A 4A92A 3SQEE 1O2LA 4IW4E 2XXLA 1FN6A 2KZ4A 1H8IH 4Q80A 1ZR0A 4FUDA 3T25A 3CNRA 3UAIC 2P3UB 1GHXH 1Z6EA 2D8WA 1SR5C 3W95A 2G55A 5KEDA 5DP4A 3VB7A 1B5GH 1QGFA 3N7OA 4NZLA 1GBHA 4RSPA 3AASA 4CBOA 1ZTLA 3KIDU 4AYVB 5L6NH 4AN7A 2VJ1A 1V2NT 1KMHB 2GZ9A 1C1QA 3LGUA 4INKA 2ANKH 1QA0A 3RXOA 4ABEA 1MAYA 3CENA 2A2XH 3TH3H 1P05A 3PV4A 1V2RT 1AD8H 2OC7A 1LQEA 1PFXC 2XRCA 2BVSH 3GDSA 2J94A 2QC2A 1KLJH 3TNSA 1HAIH 1BJUA 3SQHE 5A8YA 1ZJKA 3S9AA 5L2YH 1FONA 1DM4B 1AU8A 5TCCA 2BD8A 4LK4A 3K9XB 2V35A 3UB0A 1A3BH 4RI0A 3RU4T 1NFYA 2YMSD 1BRCE 1CQQA 2ZFFH 2VGCB 4HG6A 2BY9X 4D9QA 1K1OA 1QIXB 1VZQH 4THNH 1HAOH 3E90B 1G3BA 1O2XA 3BIVH 2FX6A 1TPPA 4YO9A 2HOBA 5L30H 4UD9H 1TPOA 1TB6H 1YC0A 2AMQA 3OEED 4JK5A 1L1JA 2ZU3A 5LGOA 1LKBA 3SU5A 1XVOA 1MH0A 2WV4A 1SQAA 1E38B 4ZCNA 2BTCE 3N99A 4MTBA 3ATIA 4XSKU 3B8JA 4A1VA 3O8DA 2CN0H 2GT8A 1TOCB 4K3JA 4FETA 2FI5E 1SGCA 4B73A 1SHYA 3BTQE 5GDSH 3R3GB 1PPHE 1FUJA 5K0HA 3UR6A 2ZFTA 2HGTH 3H7OA 2WINI 1KIGH 1TNKA 3EDXB 3PLPA 4KELA 5ESBA 1MQ6A 1BBRK 2XBXA 1KYNA 1WV7H 2STAE 2VNTA 1IQNA 4INHA 3TITA 3ZZBA 2BOKA 4E7RG 2O8LA 3NKKA 2Z6BD 2VBCA 4TT3D 1O2TA 4IN1A 1ZHPA 3SN8A 1ESBA 1P10A 1SSXA 5EQRA 3RXSA 1GI6A 1M9UA 1T8OA 1GJ9B 4WWYA 1F0SA 1KXAA 5A0AE 5J4QA 1ZPZA 2ANYA 1FV9A 4CH2B 2FLRH 3L33A 5CDFE 1P12E 2F91A 4MNWA 2ZCLP 2SGQE 4D7FA 2XWAA 3UR9A 4I8HA 3UWJH 5E2OA 4IGDA 2AMDA 2EI8A 2NU4E 5F8ZA 3L6PA 2FOHA 1GBDA 4K2YA 2L74A 4ACAA 1DPOA 2O8TA 2HLCA 3PTBA 4X2YA 1EKBB 5HIYA 3M5NA 1EASA 1IQHA 1GBTA 1YCPM 3ODFA 1OS8A 2P8OB 2XCFA 1Q2WA 3NZIA 3UOUA 1ETRH 4WMDA 3RXLA 4FUIA 4YXWD 1JRTA 3ENSB 4ASHA 1W7GH 5PTPA 1Y59T 3MMGA 6LPRA 1GBMA 1DY9A 2AIPA 3QZRA 4WMEA 1SC8U 1YPEH 1GGDC 1EQ9A 2ZQ1A 1GDNA 3WWFA 5DP5A 1SFQB 1RJXB 1A3EH 5C3NA 5T6FA 2CF8H 3KQBA 5C0UA 1ANBA 1GMHG 2ZECA 3M5MA 1Z8RA 3LC3A 5IDKA 5C67A 3MH7A 2BDBA 3PO1B 4YZUA 2ZDKA 3P8OA 1EB2A 5FX5A 4I7YH 2AYWA 5FCKA 1VITH 4H6SB 1DWCH 1O3DA 1W8BH 1O3AA 2A7JA 3ZZ3A 2ZQ2A 1D3PB 1AUTC 3ATMA 3T27A 1ELDE 1YCPK 3U28C 1F5RA 1LHGH 1ABJH 2VIOA 4U30A 4YOJA 2GT7A 1Y3YA 4MNVA 2PFEA 4J2YB 5FHTA 4UEHH 1YYY1 3ATKA 1BBRE 3V13A 5DN6D 2BY6X 2IOTA 1C5OH 2R2MB 1GHBG 2FMJA 1A1RA 2ZU5A 1TLDA 4FUJA 4NWLA 2DUCA 3FOAA 1EPTA 2O8MA 3BTEE 1GG6C 4MG3A 2M5TA 1EZSC 3DFLA 1C4Y2 3SJOA 4X6MA 3MH5A 4R8TB 3MU5A 1O35A 1A2CH 1FN8A 2OUAA 3RXTA 4X1QU 4ABGA 1C5LH 3A8DA 4BTIB 1L2EA 2PP6A 4O03A 1B0EA 3STJA 3TJVA 3RXFA 1BTPA 3BTME 1AFQB 1V2MT 2R3UA 4OS5A 3LH1A 3SV2H 1HIAA 1AUJA 1GI3A 1ZYOA 4Q7XA 1TOMH 1ZMNA 1EZUC 8KME2 1KXEA 1O3JA 1YLDA 2FOBA 4FUFA 4GCHG 2DE8A 3I78A 2R0LA 2B5TB 2PTCE 2VGCC 3GY3A 1PPBH 4MVNA 1BTWA 1H9LB 3NCLA 4AOQA 2ZIQH 1MZDA 1BHXF 3SUFA 2W7UA 4ESTE 1NO9H 2F9UA 3UY9A 2EC9H 2XNIA 1W12U 2THFB 4OS6A 1ZMJA 4JZ1A 3BTDE 1GBJA 5F03A 4FUCA 4HTCH 1P2MA 3RC5A 1NT1A 1X7AC 2ZEBA 3A7VA 2VINA 1G36A 1QHRB 1O3LA 3HPTB 3F1SB 1RD3B 4F55A 4ABDA 2GJGA 3A85A 2ZNKH 2ZHEH 5FBEA 4I31A 2A4GA 3HGPA 3DCLA 2AEIH 2G5NA 2LNCA 3MHWU 1D3TB 2WPLS 2QAAA 1GMDG 2PLXA 4UFGH 4O97A 4Q63A 4ABHA 2WPKS 3Q3KA 4MDSA 1C5NH 5DO4H 3ESTA 2BB4A 3T62A 3SGBE 1FIWA 3E1XB 1UK4A 1E35B 3BIUH 3P6ZB 1NPMA 3TIUA 2FOCA 4ZHLU 3LJOA 5F6MA 1A5IA 1O2NA 2Z7FE 1PPCE 1W0KD 4ZKSU 2OXSA 1O3GA 4FXGH 3T26A 1KTSB 3P95A 2JETB 1YPLH 1QZ8A 2ZGXH 5KGOA 1NRPH 2BD9A 2ANMH 8GCHG 2JH6D 1QCPA 2OD3B 5JBAS 1PQ5A 1RXPA 2NU2E 3RC4A 4FVBA 5C17A 4RKJB 1UTLM 5CHAB 1SGEE 1QTFA 3ODDA 1MTNC 5E0HA 1ARCA 4IS5A 3V3MA 5ABWA 4X2WA 3RXDA 2FOAA 9LPRA 2ZFPH 3SNCA 1NBME 4FUEA 1ZRKA 2XYAA 1GHWH 1IOEA 1C2LA 2BD4A 3ZYEA 2BXTH 1YPGH 1AB9C 3HGNA 3C1KA 3RXPA 4MNYA 1LMWB 4FUGA 4SGAE 3RM2H 2GV6A 2GDDA 4RT0A 3URDA 1DICA 1BHXB 4FVDA 4YT7H 2PKAA 1S84A 3MO9A 4AG1A 1VJ9U 3OAAD 3DFJA 5DG6A 3U8RH 1UW7A 3FP8E 3ZZCA 1O2YA 4IMZA 2F9NA 1O2IA 2ZI2H 4ABJA 1LVMA 4IC5A 4A1TA 1FPCH 1QJ7B 1MUEB 3DSGA 3DUXH 1ZTKA 1TGTA 3A86A 1P3EA 3PROA 1SLVB 1TRNA 2QXHA 1WUNH 2ZKSA 3LGYA 3N7EA 1PYTD 1N6XA 4XBBA 1O2KA 5GCHF 4INLA 3ZVCA 1FLEE 3VG8A 2PW8H 1HXEH 5DKMA 2JJ2D 3BG8A 1C2IA 1C1MA 2OC1A 3GDVA 1MTSA 2KX4A 4XRNA 2TIOA 4NA9H 2Y7ZA 2H1UA 2HPQH 2D1JA 1MTWA 2KCAA 4ISNA 1DX5M 4O3UA 3M5OA 1G9IE 4HFPB 1EOLA 4NIXA 3A82A 4AG2A 1TBZH 4ZKRU 1GJ5H 8LPRA 4K1SA 4ISOA 3BEUA 1OWEA 3ZZ8A 2ASUB 1HRTH 1AN1E 4TY7A 1C2GA 2V0BA 1RS0A 3HATH 3W1EA 4CHAB 2C8YB 1Y5BT 1S82A 1JBUH 2I6SA 2KAIA 2ULLA 1VITF 1MD8A 3IG6B 2KAIB 4F48B 2C8WB 4GLYA 5FPTA 3F9HA 3MNBA 1C5MD 1TRYA 4X6PA 2BMGB 3NK8A 3VFEA 4CRCA 3NWUA 3G01A 5HIZA 1OWHA 4E05H 1IQGA 2R9PA 1U6QA 3S7KB 4MPWA 2PKSB 1PPFE 1BDAA 3MU8A 4FUBA 5JDUB 1ANCA 5C2ZA 1PPGE 1NRNH 2TGAA 2G4UA 1UTJA 3RXAA 2FOEA 3MU0A 4M9FA 3RM0H 1ELTA 2VIVA 5TCAA 3TVJB 1YBWA 1QBOA 2ZGBH 1TRMA 4ZXYH 1ELGA 1EP6A 1TNJA 2C93B 1C5PA 3ATWA 3UQVA 3GCTG 1O31A 1C1WH 1D4PB 1ZGVA 1P2NA 3MFJA 2FPZA 3F9EA 3RXIA 3SI4H 1RTKA 1TALA 2WPJS 3RXVA 3P8GA 3RXUA 2OQUA 2AHME 2ZWLH 1SGIB 4RN6A 4AB8A 1WQVH 3SU3A 2P93A 4PROA 1HJ9A 3OFND 2ALPA 3TK6A 2PGBB 2ZHDA 3PRDA 3SHCH 2JETC 4P00A 1UTKA 1BQYA 1S0QA 2FTLE 2O9QA 1BMLA 1TX6A 2WPDD 1UJ1A 3TGJE 1C1UH 1QL9A 2GTBA 3NXPA 2Y5HA 5EJLA 1GJ7B 3Q76A 2WUCA 3A7TA 3URCA 1CA0B 3ZVFA 1LKAA 1XXDA 1HDTH 4B71A 1MABB 2V3HH 3KF2A 2VVVA 2NU0E 3EA8A 1RRKA 5EU8A 2ZPSA 3H09A 3Q3YA 4WJG2 1E0FD 2DE9A 2AIQA 3A80A 5I46H 1PQAA 1P09A 1BMAA 4NFEA 3L3TA 7GCHG 2F83A 3E16B 1IAUA 2W6JD 2UWLA 1HLTH 1O33A 4JYTA 5FX6A 1K0HA 2ZPRA 5IYTA 1LVBA 4F49A 2ZO3H 3PV2A 1TAWA 5F8TA 4Y8ZA 4AYYB 1EFRD 1OXGA 2F4LA 2PTNA 1UVOA 4CH8B 2UWOA 2OBQA 2H5CA 1DFPA 1O2ZA 1JWTA 1AO5A 1MKXH 1P2KA 3SGQE 4ABAA 1GI0A 1E79D 3A81A 5EODA 3SO3A 3RXGA 3KYFA 5I25A 1DSTA 2FXRA 1P0SH 2AGIX 1GBIA 2J9NA 1HGTH 1L4ZA 1DSUA 1V3XA 4Z0KA 5LPRA 3SW2B 1SBWA 1NROH 1AIXH 3E91A 1A5GH 1P2QA 2ZCHP 4WMFA 1LO6A 3A8BA 2AGGX 1K22H 1W10U 4X8UH 1O39A 1THSH 3SU0A 1DITH 4MPXA 1DY8A 3OYPA 1Y5UT 3SBKA 2V6NA 4R0IA 4DW2U 4XFQA 2VWNA 1HJAB 1EAUA 4K8YA 3T28A 3RC6A 2BQWB 3AVZA 1GG6B 4ABBA 2BLOA 2HNTE 4I86A 1XUHA 1VKYA 1V2PT 3LGTA 4MPVA 1HCGA 3UIRA 1V2UT 3MYWA 1GVLA 2G51A 1ANEA 2BY7X 3K6ZA 2ZTYA 1HNEE 1SGQE 5EW2H 1O5FH 3SU2A 5AFZH 2CMYA 1S81A 2GCHG 4Y0YE 5AVDA 1YPJH 1OWDA 3CS0A 1W3CA 4CHAC 3TGKE 3M3TA 5C94A 2EI7A 2HNTF 2ODYB 1WSSH 4KKDA 1C2KA 1E34B 4AB9A 3EE7A 2FOFA 2BDGA 1O36A 3OU0A 3TPIZ 1TE0A 2F9VA 1J15A 3WW7A 3BTHE 1Y3VA 2PSXA 1O38A 1T32A 2JH5D 2JJ1D 1GDQA 1HPGA 1SGPE 5A0CA 4X6OA 2PKSC 3LONA 4Q2KA 1C2MA 1DWDH 3BTWE 1GBEA 1IQMA 2J5UA 4ASUD 1EAWA 4NZQA 1BITA 2Q6GA 1DXWA 2WV5A 2A7HA 4Q7ZA 2C8ZB 5C1XA 2XWBI 3V7TA 1F2SE 4U2WA 4Y10E 3LT3A 4YT6H 4TSFD 2BDYA 1LPZB 1OYTH 5E0JA 2EQNA 3MNSA 1GI8B 3RXMA 4AFQA 1P01A 2XCNA 4K8BA 1CHGA 3MNCA 2Z9JA 1Y3WA 2H9HA 1GBCA 1QBNA 3ZVBA 1C9PA 1EJNA 3RXQA 1EZXC 1XKBC 1EUFA 3DT0H 2WZQA 2GCTB 1SOZA 2J98A 3AW1A 2PUXB 2J98B 2K8IA 1O3HA 2OLGA 3ELAH 3IWMA 6CHAB 1ELCA 1MKXK 2XC5A 1ANDA 9ESTA 1C1TA 1C9TA 1SQRA 3JZ2B 5IK2D 1TMTH 2WYJA 3SJ9A 3Q3XA 2P95A 2Y82A 1S6LA 1O0DH 3E0PB 1OSSA 2P3TB 2FWWA 4I32A 1ACBE 1L1NA 3RXCA 1CA0C 1ZOMA 4DT4A 1C4V2 1UMAH 1AE8H 2TRMA 1L4DA 3VB4A 1NFWA 1A4WH 2A2QH 4JK6A 4X8VH 1OPHB 1OWIA 1W0YH 6GCHF 5K7RA 4E7NA 1MTNB 1A5HA 3ATLA 4Z6AH 1HUTH 3ZZAA 1HAGE 1GCDA 2OTVA 2ZGJA 2PUQH 1GL0E 4LOYH 4Y0ZE 4A1XA 1XUJA 1SHHB 1H8ED 1SG8B 1E37B 1A7SA 3E6PH 5FAHA 3DSPA 2FYQA 3A8CA 1KDQA 1AGJA 1KXBA 1RFNA 1JXPA 1O34A 4DVAU 1SOTA 1AB9B 2CXVA 2UUKB 2ZCKP 3QLPH 3BTGE 4P02A 4OM9A 1LDTT 4RT1A 3UNRA 2VWOA 1HB0B 1EZQA 2IN2A 3KHVA 1C2HA 2FTMA 1S5SA 2WUBA 2ZFRH 2RDEA 2QN5T 2HLDD 4CRGA 4J1YA 3SNDA 4JYVH 3GDUA 4K1TA 4TWYA 1GPZA 2SGEE 2A0QB 1EP5A 5A2MH 3FP6E 2BVRH 1QFKH 4XE4A 5LPEA 3ZVEA 1NESE 3W94A 3QTVH 1ELFA 1WDIA 4BAOB 5A0BA 3SGAE 1K21H 2ODQA 3NRLA 1C5SA 3GY7A 3SU1A 4KTSA 3BEFB 1XX9A 5DP6A 4WF8A 1WAYB 2O8WA 4X2VA 4HI3A 1FY1A 4JYUH 1HJAC 5EPYA 1H1BA 1TPAE 3PV5A 1GMDF 1FIZA 4NA7A 5ESTE 4YTAA 3TJNA 5EQSA 1SQTA 1XUIA 1EPTB 2Y6TA 2ZFQH 5DP8A 1UK2A 2BVXH 2VVUA 2GZ7A 1H8DH 3BTKE 3MO6A 1ZHRA 1O2VA 3UWIA 5TJXA 1QB9A 2ZFSA 4I8LA 5L2ZH 3DD2H 3UPEA 1GJBB 2W6ID 4X1PU 3A88A 3BV9B 3LDXH 2W26A 2FP7B 1HIAB 2A5IA 5EOKA 2AH4X 1V2LT 3UUZA 3FVFB 3RLYH 2JH0D 2G00A 1OX1A 1FY3A 5FPYA 4OS7A 1MTVA 4BAKB 8GCHF 1GBFA 1GVKB 1YLNA 3BTTE 2OBOA 5E8EH 1FY5A 3QWCH 1C5YB 3OE7D 5AF9H 4X1NU 5HMAA 4BOHA 2C8XB 3MNXA 3LC5A 2ESTE 1BRBE 2HALA 4NWKA 3R0FA 2QF3A 3SORA 2W3KA 3OY6U 2XC0A 2GD4B 1T8MA 2KCPA 1OWJA 4M7GA 3ZZ4A 2YNAA 2JKHA 4IN2A 1W0ZU 3A8AA 5DGJA 3SV6A 3M36A 4D8NA 5LH8A 1G2MA 3SV7A 2H6MA 1GBAA 2J34A 1ELVA 5CMXH 5A8ZA 4IC6A 4CBNA 1A46H 1JIMA 3Q77A 1HAXB 1TONA 2SFAA 1K1LA 3QO6A 1SGFG 1GI5A 1B0FA 3SJKA 2L6OA 5FL7D 2GCTC 1C5RA 1AZZA 1TBRH 2VH0A 4FU8A 1F0TA 3KQDA 1MTUA 1P11E 6CHAC 1TNHA 3BEIB 1V2TT 2XBWA 3SHAH 1Z1JA 2BD3A 4AFUA 1CGIE 1IHTH 2PV9B 5C20A 1MBMA 3PMHB 4D9RA 1BTYA 1G32B 2D26C 4UFFH 1O3IA 1CHOG 3QGNB 1C1OA 2H9EH 1BTUA 3LGWA 1DLKB 2FESH 2VIDA 4CR5A 4Y11E 5HKKD 2UWPA 1MCVA 2BY8X 3OSYA 3A83A 3UOPA 1GHYH 1CU1A 3A7ZA 4AC9A 5GWZA 4Q7YA 2BDIA 2SGPE 1G3DA 2ZU2A 1KXDA 2YNBA 2V7QD 2G8TA 3HK3B 3RMOH 2OINA 3U1IB 3EA7A 3KNXA 2BLWA 1ZHMA 2WSSD 1IQKA 1GVZA 3P8FA 1WTGH 3GY2A 4AFSA 1K1NA 1O3MA 3UNQA 3UQOA 5T3HA 1AFEH 1O37A 3SZEA 2XBVA 4AORA 2HNTC 3B9FH 1Z8GA 1V6DA 2D2DA 2J97A 1ARBA 3RXHA 3CP7A 3LKWA 1AKSA 1FQ3A 1FI8A 2QF5A 1COWD 5CE1A 1V2KT 1QL7A 2OC8A 2PKAB 2ZU4A 3PRBA 3F2FA 1XUKA 1DWEH 2Y81A 5FPSA 2YMSC 1Z8JB 3BF6H 1F7ZA 5CHBA 1Q31A 4DURA 3E0NB 3KQCA 1CVWH 1E36B 3S9BA 3KCGH 3RU4D 1NRRH 1EATA 1RGQA 2F9BH 5EG4A 1RTLA 1H9HE 2HVYB 2OQ5A 1E1QD 4B2CA 1CT4E 2EA3A 4ZKOU 2A1DB 2V3OH 4ACBA 1D9IA 3AW0A 2ZA5A 3S9CA 4ABFA 1DANH 4UDWH 5JB9S 1WTHD 1J17T 1EPTC 1HJ8A 1MKWH 2ZHWH 5E0GA 1YPKH 1N6YA 2AS9A 2J2UA 4XBDA 1C5XB 3BTFE 4WH6A 1TQ7B 1LCYA 2ZTXA 3P8NA 1D6RA 3QZQA 5T6GA 1P9UA 4A7IB 1IQFA 3D62A 1O5CB 3C27B 4MNXA 1HAHH 3F68H 1KXFA 4WXVA 1THRH 1IQLA 2BD7A 1Y3XA 5EJ1A 1PPZA 2VB0A 1C1PA 1SLWB 1ZRBA 4AGJA 1P04A 4OS1A 1GJDB 3F9GA 1TA2A 1L1GA 1HAPH 1INCA 3SU6A 2STBE 4DIIH 1D3QB 5F53A 3T29A 1TWXB 4GHQA 2GKVE 3MI4A 1NM6A 2CHAB 1DUAA 4FU9A 1OHHD 7ESTE 3FAOA 1AY6H 4MPUA 3M5LA 4NA8A 1IQIA 1T8NA 2BXUH 1W0JD 1G37A 3ZV8A 2J38A 3O8CA 3A7YA 1YP9A 1TNLA 5J4SA 2HWLB 1GJCB 3SUDA 5JPMH 2VIWA 3H7TA 1OKXA 3ZZ5A 4B74A 2FI3E 2GMTB 1NTPA 1GMCF 3SNBA 4IMQA 3S7HB 2FZZA 5GPIB 4OS4A 1D3DB 4H6TA 1UTOA 3P92A 1O32A 1MBQA 1P8VC 1TGCA 4F4OC 2BD5A 1MQ5A 3QDZB 5DPAA 2ZGCA 4OS2A 3I29A 1GWAA 2PSYA 5T1VA 2BOHB 3M7TA 4NGAH 1K1PA 4E06H 3GISB 1BMMH 3MOCA 5GCHG 5DP9A 2ZDAH 3MU1A 2ZTZA 1T31A 1F0UA 4ZMAH 2R2WU 5LPFA 2EI6A 1T4VH 1QQ4A 1RIWC 1ETTH 4Y76A 3F9FA 5JB8S 4TY6A 1Y8TA 2GVFA 1K1IA 3HK6B 1TNGA 1P57B 1ZTJA 1V2WT 1GBLA 4JZEH 1BCUH 2SNVA 1O5BB 1UVPA 1HAVA 1S6FA 1J14A 1BTHH 2A4QA 2BHGA 1HAVB 1DT2A 2RA3A 2SGAA 1FNIA 4KGAA 5FBIA 1O5DH 1PJPA 1YLCA 4NFFA 4DJZB 1XKAC 3PTNA 2EY4C 5C5NA 1UO6A 3P17H 1MKWK 1NS3A 1HBTH 2Z9LA 3D49H 4Y6DA 1VITG 1VR1H 4RKOB 4KP0A 4WY3A 3V0XA 2QY0B 1C2DA 3A7WA 3FP7E 4ZKNU 2ODPA 3VB5A 1O2MA 2BX4A 1V2QT 3GICB 1WOFA 2A5AA 4D76A 1WXRA 5FCRA 1A0HB 5T6DA 2J4IA 1GHAG 1MCTA 3DHKH 1C5WB 5DP7A 3TK5A 4ABIA 2TBSA 4GHTA 3MTYA 4TWWA 1NU7B 2BDAA 4UFDH 1BZXE 2ANWA 1K1MA 3FKSD 2OP9A 3TU7H 4DCDA 2ZZUH 3EA9A 4JCNA 1WCZA 1W11U 1NRSH 1CGJE 2FYRA 1GBBA 3S69A 1YWUA 4YESB 2WPHS 1LQDB 3MQKC 2FS8A 2PGQB 5DJ7A 1LVOA 3EE0B 2G4TA 2VU8E 3DA9B 4U32A 2Z94A 4WXIA 1TMUH 2LP6A 2VWLA 2FDAA 1PQ7A 2NU1E 1AMHA 2ZPQA 1SB1H 4B2AA 1EAXA 1C2EA 4B2BA 1IQJA 3JZ1B 3F0PA 4ISIH 3QX5H 3PYHA 5EIYA 2GV7A 1GCTB 1QL8A 1MU6B 2Q6FA 3O8RA 4NIVA 1BT7A 2RA0A 2VIPA 3PMAB 3RXJA 1O3OA 2F9PA 3U69H 3GY6A 1ZSKA 1AHTH 1DXPA 2RDLA 1SGRE 3T5FH 3ZVAA 3QUMP 1HXFH 1XUFA 2F43B 4JMYA 2A4RA 3A7XA 1O3NA 3WWBA 3VPKA 3RDZA 2C90B 4WH8A 1A61H 1ELEE 1YY3A 1TGNA 3TLOA 1AVWA 1K9OE 3GCOA 1J9CH 4Y79A 3IITA 3H5CB 2Z3CA 3VEQB 1Z7KA 1QRZA 1Z6JH 2M2AA 2QXIA 2CHAC 3KGPA 4Q4LA 1FDPA 1AQ7A 1FX0B 2Q1JA 3VGCC 2QIQA 2WV9A 2G5VA 3U98H 5HM2A 1UVTH 2UUFB 3ZVDA 4XBCA 1AVGH 1ZPBA 4D7GA 1QR3E 1ESTA 1HYLA 4BNRA 3SV9A 1XMNB 5HM9A 5F8XA 4I8KA 1XXFA 3P70B 4K60A 1ZSLA 3FZDA 1EJAA 1C1SA 2UUJB 3S0NA 1O3FA 1YCPH 1EB1H 1HAZB 1Y5AT 3WY8A 3E3TA 1KY9A 1LHFH 2GMTC 1SLUB 2P3FH 1ORFA 1HV7A 2AERH 2FI4E 4Y8XA 3SI3H 3KQEA 1UVSH 2O8UA 4HGCA 2FIRH 3A87A 2H9TH 3T2NA 1GMHF 2XW9A 2W3IA 3B23B 5C1YA 4B75A 2Z3DA 1CA8B 1W13U 4UFEH 3LJJA 2KR7A 1YPHE 3GCNA 3FZZA 3K6YA 1O2GH 3SUEA 2JDID 4DY7B 1DLEA 1Z71A 1FAXA 2Y5FA 3PB1E 2VH6A 1BRUP 1FXYA 5JBCS 3RXRA 3U8OH 4FU7A 2WPIS 1TX8A 1AVXA 3BG4B 2Y5GA 3BSQA 1GHBF 1GBKA 1H8HD 2FM2A 2ZF0H 1V2OT 2SGDE 1SVPA 1W14U 1MD7A 2TGPZ 3LGVA 2PWXA 3KEEA 3SNEA 4WVPE 5SGAE 2NWNA 2ZP0H 1GI4A 1SLXB 1O3BA 3FN8A 3KL6A 1S0RA 2C3SA 7LPRA 4VGCB 2C4FH 3TK9A 1AE5A 1P03A 3RMNH 2KCOA 1UHBA 2A7CA 1PYTC 2BZ6H 2FODA 4BXWA 2XNDD 1CT2E 1FPHH 2F9OA 1UHBB 3PLKA 2FLBH 4NCYA 2BY5X 1GJ8B 4GCHF 1TYNA 1KDQB 5HYOA 1SI5H 4GAWA 1AI8H 1O5EH 3V12A 3LOXA 4DG4A 1BOQA 4DOQA 1FY4A 1TGBA 2Y80A 2P16A 3TJUA 4LXBH 5JBBS 1O5GH 3F0OA 3GY4A 1EOJA 1SFIA 1Z1IA 3SJ8A 1THPB 1C5UA 3LH3A 1TA6A 1BB0B 3MU4A 3U1JB 2QA9E 1H9IE 3M7UA 3AAUA 5B6LA 4CRBA 3FANA 2YMSB 3EAJA 2FEQH 3TH4H 1G2LA 3D23A 4NIWA 2CGAA 1MU8B 2TGTA 1MMJN 1WU1A 2OCVB 1GDUA 3GCHB 3CS7A 2HVXA 3DSOA 2SNWA 4CRDA 2RFKC 1XUGA 3Q00A 1GCTC 3HKIB 3I77A 3MH6A 2B0FA 5ETXA 2UUYA 3ZVGA 4OGYA 1DVAH 2QF4A 3SNAA 4AGKA 3E8LA 1F92A 4JZDH 4TPIZ 4ZUHA 2BQ7B 3UNSA 3PWBA 1BMFD 5H4IB 1J8AA 1ZJDA 3SUGA 3VXFH 1G3EA 1ABIH 1TFXA 1YF4A 3A89A 4OGXA 2Z9IA 1NY22 1BUIA 1GL1A 1V2VT 3VB6A 1CBWB
chains in the Genus database with same CATH topology
1CHOF 2XTTB 1G30B 1NN6A 1VGCB 2CV3A 1A0LA 2VWMA 4ZH8A 6GCHG 2Z9KA 1DUEA 4MLFB 1QB6A 1AWFH 1CE5A 2NU3E 2A4OA 1F5LA 1QJ6B 1ZSJA 1BTXA 2VVCA 4AZ2B 2H2ZA 3ZZ6A 7KMEH 4B1TA 1C5VA 1EAIA 2TPIZ 5GIBA 3GYMA 5GJ4B 1DS2E 1T7CA 4H4FA 2Z3EA 1EX3A 1WBGB 4JZFH 3O8BA 4GVUA 3RUOA 1OP8A 4ZAEA 1C2FA 3M3VA 1C2JA 1DWBH 3ZZDA 1GI7B 5EXMA 1TIOA 1DE7H 1BRAA 1OWKA 3M3SA 1UCYH 4K69A 4DIHH 1VJAU 4YOGA 1K2I1 2QXJA 1O2RA 2RCEA 1SPJA 4QT8C 1PQ8A 1P02A 2B8OH 1TGSZ 5FXLA 2BDCA 2J92A 1TABE 1S85A 1OP2A 2Z9GA 4Y71A 1XVMA 2ZHQH 3ZZ7A 3VXEH 1TPSA 2FOGA 2W5EA 1LPKB 2AMPA 5HXFA 3LGIA 2GX4A 1N8OB 2K1QA 3RMLH 4NG9H 1S83A 3OTJE 4DGJA 3BG4C 3QK1A 4O9VA 1RIWB 1W7XH 1MAXA 5JYIA 1C5TA 1O2SA 2BDHA 1BA8B 4X2XA 1W2KH 3GY8A 1CT0E 1T8LA 3OY5U 5A8XA 2AFQB 1CSOE 1NU9A 1Q3XA 1SGFA 1GI1A 4BTUB 1P2JA 2QF0A 1SGYE 4TPYA 3RP2A 3QTOH 1TQ0B 3TNTA 1P9SA 4YLQH 5JBTA 4VGCC 1AZ8A 2IJOB 3GY5A 4Y7AA 2TGDA 5C1UA 2BM2A 1FY8E 1ETSH 3QN7A 4YOIA 1G3CA 3RXEA 1UTQA 3NPSA 1HAYB 1SGTA 5G4BA 3ZZ9A 5A09A 2QCYA 2BLQA 3STIA 3K2UA 3SV8A 4X1RU 4ZHMU 2VIQA 4UONA 2FO9A 1WQSA 3EQ0H 2ZC9H 3LPRA 4SGBE 2QYIA 2I6QA 4CR9A 1RTFB 1BMNH 2ILNA 1GJ4H 2ZDNA 4BTTB 1VCQA 2P59A 1LTOA 2P8OC 4BAHB 4CRFA 2YOLA 2G52A 1AKSB 1ESAA 1EXFA 4GSOA 5DK1A 1C1VH 2BLVA 3FFGA 4GPGA 5AFYH 1ZPCA 2BD2A 1QY6A 2B9LA 1LHDH 1O3EA 2EEKA 2Q6DA 3EYDA 2AGEX 2RG3A 1SGNE 4Y7BA 1SQOA 2B7DH 2PHBA 3NUMA 3TJOA 1QA7A 1SMFE 3RMMH 1QNJA 4KTUA 4XOJA 1QRWA 1WYKA 1ZLRA 2GGVB 3GCHC 4KTCA 1N1LA 3RU4E 3M35A 3PO1C 1L0ZA 1H4WA 1JOUB 1NRQH 1KLIH 4B76A 2A45B 1A0JA 4Y8YA 3GCTF 1ID5H 3LIWA 5EW1H 5EQQA 3U8TH 4GUXA 5DP3A 1KXCA 4ZROA 2ZU1A 5EXNA 1O30A 1BTZA 4I33A 4BXSA 1P2OA 3AAVA 1YGCH 4ISLA 4HZHA 2Y7XA 1TMBH 3UREA 1C5ZB 4I8GA 1GJ6A 4LZ1H 1UCYK 2ZHFH 1JMOH 1LPGB 4ISHH 1QB1A 1JIRA 2A5KA 2W7SA 1Z8IB 1C4U2 1QRXA 3PLBA 1S6HA 1TX7A 3F6UH 1CBWC 1O2QA 1UTMA 4X6NA 1VGCC 1KTTB 4ZXXH 3UFAA 1O3PB 3RLWH 3RXBA 2ZDVH 1YPHC 1C1NA 5AHGH 1KLTA 1OYQA 2BQ6B 4U01A 4NSVA 1AFQC 1GHVH 3LU9B 2XC4A 3PM3A 3A84A 5HGGA 1OP0A 2QV1A 1FAKH 2R0KA 2ZG0H 1QURH 4IBLH 3M37A 3SJIA 1ZZZA 1V2ST 3PWCA 4X8TH 1TNIA 3VGCB 5EPNA 1K28D 2GZ8A 4LZ4B 4K5ZA 1VCWA 2P94A 1SGDE 7GCHF 2R3YA 2HPPH 4AX9H 2GDEH 5GXPA 1ELAA 2BZAA 1FMGA 4DT7B 3ZV9A 2HRVA 3EGKH 1GI9B 1O5AB 4TYDA 3TGIE 1HFDA 3SZNA 3MH4A 5BRRE 1O2UA 1O2PA 1MZAA 1QBVH 5E2PA 1P2IA 1GJAB 2F3CE 1BIOA 2LPRA 4XDEA 1YM0A 1UVUH 2SGFE 4FUHA 1GHAF 1VCPA 3OX7U 1PPEE 4YLUA 2CJIA 5EXLA 4BAQB 1JRSA 2BYAX 2ZDMA 1FZZA 3VB3A 4CRAA 3BN9A 1GI2A 4NSYA 2FS9A 4I8JA 2XBYA 4O3TA 1OOKB 3M61U 1O3CA 1O3KA 1YKTA 1P3CA 4X1SU 1IQEA 1N8OC 2WPMS 3RXKA 1C5QA 2OC0A 4JZIA 1NFUA 2A31A 1D6WA 1C1RA 2FX4A 3M7QA 2A32A 1UTNA 2J95A 1SL3A 1UCYE 3GYLB 2G81E 1AWHB 2FOMB 3QGJA 4YM9A 4ZHAA 3SU4A 1O2OA 1B7XB 2WYGA 1P06A 1UK3A 4NIYA 2QXGA 4A5TS 1ELBA 3D65E 2QGRA 1Y3UA 3ITIA 1LHCH 2BX3A 4X0WU 3ZYDA 1ZGIA 3K65B 2ZDLA 1CGHA 1QQUA 1EJMA 4MQAA 4X8SH 4BANB 1FJSA 1J16A 3TH2H 3UTUH 3MO3A 4CREA 1O2HA 1NFXA 2CF9H 5BPEA 1XM1A 5C5OA 8ESTE 2GCHF 2GP9B 3U9AH 4K1EA 4UE7H 3SOSA 5CHAC 1F5KU 1KSNA 1V2JT 1O2JA 3MWIU 1DDJA 1BJVA 4BAMB 1CO7E 1LVYA 1DOJA 1QJ1B 5B6OA 1ZMLA 1NC6A 5EGMA 1GHZA 2PR3A 2IPHA 1LHEH 1YPMH 3PMJA 1F0RA 1BBRH 3KN2A 1IHSH 1UTPA 2ALVA 1TBQH 1NZQH 4A6LA 1O2WA 4AFZA 3GOVB 4H42U 1GMCG 1GGDB 1K1JA 2H5DA 2ZGHA 3HKJB 1T4UH 3PMBB 6ESTA 4A92A 3SQEE 1O2LA 4IW4E 2XXLA 1FN6A 1H8IH 4Q80A 1ZR0A 4FUDA 3T25A 2P3UB 1GHXH 1Z6EA 2D8WA 1SR5C 3W95A 2G55A 5DP4A 3VB7A 1B5GH 1QGFA 3N7OA 4NZLA 1GBHA 4RSPA 3AASA 4CBOA 1ZTLA 3KIDU 4AYVB 5L6NH 4AN7A 2VJ1A 1V2NT 2GZ9A 1C1QA 3LGUA 4INKA 2ANKH 1QA0A 3RXOA 4ABEA 1MAYA 3CENA 2A2XH 3TH3H 1P05A 3PV4A 1V2RT 1AD8H 2OC7A 1LQEA 1PFXC 2XRCA 2BVSH 3GDSA 2J94A 2QC2A 1KLJH 3TNSA 1HAIH 1BJUA 3SQHE 5A8YA 1ZJKA 3S9AA 5L2YH 1FONA 1DM4B 1AU8A 5TCCA 2BD8A 4LK4A 3K9XB 2V35A 1A3BH 3RU4T 1NFYA 1BRCE 1CQQA 2ZFFH 2VGCB 2BY9X 4D9QA 1K1OA 1QIXB 1VZQH 4THNH 1HAOH 3E90B 1G3BA 1O2XA 3BIVH 2FX6A 1TPPA 4YO9A 2HOBA 5L30H 4UD9H 1TPOA 1TB6H 1YC0A 2AMQA 4JK5A 1L1JA 2ZU3A 5LGOA 1LKBA 3SU5A 1XVOA 1MH0A 2WV4A 1SQAA 1E38B 2BTCE 4MTBA 3ATIA 4XSKU 3B8JA 4A1VA 3O8DA 2CN0H 2GT8A 1TOCB 4K3JA 2FI5E 1SGCA 4B73A 1SHYA 3BTQE 5GDSH 3R3GB 1PPHE 1FUJA 5K0HA 3UR6A 2ZFTA 2HGTH 3H7OA 2WINI 1KIGH 1TNKA 3EDXB 3PLPA 4KELA 5ESBA 1MQ6A 1BBRK 2XBXA 1KYNA 1WV7H 2STAE 2VNTA 1IQNA 4INHA 3TITA 3ZZBA 2BOKA 4E7RG 2O8LA 3NKKA 2Z6BD 1O2TA 4IN1A 1ZHPA 3SN8A 1ESBA 1P10A 1SSXA 5EQRA 3RXSA 1GI6A 1M9UA 1T8OA 1GJ9B 4WWYA 1F0SA 1KXAA 5A0AE 5J4QA 1ZPZA 2ANYA 1FV9A 4CH2B 2FLRH 3L33A 1P12E 2F91A 4MNWA 2ZCLP 2SGQE 4D7FA 2XWAA 3UR9A 4I8HA 3UWJH 5E2OA 4IGDA 2AMDA 2EI8A 2NU4E 5F8ZA 3L6PA 2FOHA 1GBDA 4K2YA 1DPOA 2O8TA 2HLCA 3PTBA 4X2YA 1EKBB 3M5NA 1EASA 1IQHA 1GBTA 1YCPM 3ODFA 1OS8A 2P8OB 2XCFA 1Q2WA 3NZIA 3UOUA 1ETRH 4WMDA 3RXLA 4FUIA 1JRTA 3ENSB 4ASHA 1W7GH 5PTPA 1Y59T 3MMGA 6LPRA 1GBMA 1DY9A 2AIPA 3QZRA 4WMEA 1SC8U 1YPEH 1GGDC 1EQ9A 2ZQ1A 1GDNA 5DP5A 1SFQB 1RJXB 1A3EH 5C3NA 5T6FA 2CF8H 3KQBA 1ANBA 1GMHG 2ZECA 3M5MA 1Z8RA 3LC3A 5IDKA 5C67A 3MH7A 2BDBA 3PO1B 4YZUA 2ZDKA 3P8OA 1EB2A 5FX5A 4I7YH 2AYWA 5FCKA 1VITH 4H6SB 1DWCH 1O3DA 1W8BH 1O3AA 2A7JA 3ZZ3A 2ZQ2A 1D3PB 1AUTC 3ATMA 3T27A 1ELDE 1YCPK 1F5RA 1LHGH 1ABJH 2VIOA 4U30A 4YOJA 2GT7A 1Y3YA 4MNVA 2PFEA 4J2YB 5FHTA 4UEHH 1YYY1 3ATKA 1BBRE 3V13A 2BY6X 2IOTA 1C5OH 2R2MB 1GHBG 2FMJA 1A1RA 2ZU5A 1TLDA 4FUJA 4NWLA 2DUCA 1EPTA 2O8MA 3BTEE 1GG6C 4MG3A 2M5TA 1EZSC 3DFLA 1C4Y2 3SJOA 4X6MA 3MH5A 4R8TB 3MU5A 1O35A 1A2CH 1FN8A 2OUAA 3RXTA 4X1QU 4ABGA 1C5LH 3A8DA 4BTIB 1L2EA 4O03A 1B0EA 3STJA 3TJVA 3RXFA 1BTPA 3BTME 1AFQB 1V2MT 2R3UA 4OS5A 3LH1A 3SV2H 1HIAA 1AUJA 1GI3A 1ZYOA 4Q7XA 1TOMH 1ZMNA 1EZUC 8KME2 1KXEA 1O3JA 1YLDA 2FOBA 4FUFA 4GCHG 2DE8A 3I78A 2R0LA 2B5TB 2PTCE 2VGCC 3GY3A 1PPBH 4MVNA 1BTWA 1H9LB 3NCLA 4AOQA 2ZIQH 1MZDA 1BHXF 3SUFA 2W7UA 4ESTE 1NO9H 2F9UA 3UY9A 2EC9H 2XNIA 1W12U 2THFB 4OS6A 1ZMJA 4JZ1A 3BTDE 1GBJA 5F03A 4FUCA 4HTCH 1P2MA 3RC5A 1NT1A 1X7AC 2ZEBA 3A7VA 2VINA 1G36A 1QHRB 1O3LA 3HPTB 3F1SB 1RD3B 4ABDA 3A85A 2ZNKH 2ZHEH 5FBEA 4I31A 2A4GA 3HGPA 2AEIH 2G5NA 2LNCA 3MHWU 1D3TB 2WPLS 2QAAA 1GMDG 2PLXA 4UFGH 4O97A 4ABHA 2WPKS 3Q3KA 4MDSA 1C5NH 5DO4H 3ESTA 2BB4A 3T62A 3SGBE 1FIWA 3E1XB 1UK4A 1E35B 3BIUH 3P6ZB 1NPMA 3TIUA 2FOCA 4ZHLU 3LJOA 5F6MA 1A5IA 1O2NA 2Z7FE 1PPCE 4ZKSU 2OXSA 1O3GA 4FXGH 3T26A 1KTSB 3P95A 2JETB 1YPLH 2ZGXH 1NRPH 2BD9A 2ANMH 8GCHG 2JH6D 1QCPA 2OD3B 5JBAS 1PQ5A 1RXPA 2NU2E 3RC4A 4FVBA 4RKJB 1UTLM 5CHAB 1SGEE 1QTFA 3ODDA 1MTNC 5E0HA 1ARCA 4IS5A 3V3MA 5ABWA 4X2WA 3RXDA 2FOAA 9LPRA 2ZFPH 3SNCA 4FUEA 1ZRKA 2XYAA 1GHWH 1IOEA 1C2LA 2BD4A 3ZYEA 2BXTH 1YPGH 1AB9C 3HGNA 3C1KA 3RXPA 4MNYA 1LMWB 4FUGA 4SGAE 3RM2H 2GV6A 2GDDA 3URDA 1DICA 1BHXB 4FVDA 4YT7H 2PKAA 1S84A 3MO9A 4AG1A 1VJ9U 5DG6A 3DFJA 3U8RH 3FP8E 3ZZCA 1O2YA 4IMZA 2F9NA 1O2IA 2ZI2H 4ABJA 1LVMA 4IC5A 4A1TA 1FPCH 1QJ7B 1MUEB 3DUXH 1ZTKA 1TGTA 3A86A 1P3EA 3PROA 1SLVB 1TRNA 2QXHA 1WUNH 2ZKSA 3LGYA 1PYTD 1N6XA 4XBBA 1O2KA 5GCHF 4INLA 3ZVCA 1FLEE 2PW8H 1HXEH 5DKMA 3BG8A 1C2IA 1C1MA 2OC1A 3GDVA 1MTSA 2TIOA 4NA9H 2Y7ZA 2H1UA 2HPQH 2D1JA 1MTWA 4ISNA 1DX5M 4O3UA 3M5OA 1G9IE 4HFPB 1EOLA 4NIXA 3A82A 4AG2A 1TBZH 4ZKRU 1GJ5H 8LPRA 4K1SA 4ISOA 3BEUA 1OWEA 3ZZ8A 2ASUB 1HRTH 1AN1E 4TY7A 1C2GA 2V0BA 1RS0A 3HATH 4CHAB 2C8YB 1Y5BT 1S82A 1JBUH 2I6SA 2KAIA 2ULLA 1VITF 1MD8A 3IG6B 2KAIB 2C8WB 4GLYA 5FPTA 3F9HA 3MNBA 1C5MD 1TRYA 4X6PA 2BMGB 3NK8A 3VFEA 4CRCA 3NWUA 3G01A 1OWHA 4E05H 1IQGA 2R9PA 1U6QA 3S7KB 4MPWA 2PKSB 1PPFE 1BDAA 3MU8A 4FUBA 5JDUB 1ANCA 5C2ZA 1PPGE 1NRNH 2TGAA 2G4UA 1UTJA 3RXAA 2FOEA 3MU0A 3RM0H 1ELTA 2VIVA 5TCAA 3TVJB 1YBWA 1QBOA 2ZGBH 1TRMA 4ZXYH 1ELGA 1EP6A 1TNJA 2C93B 1C5PA 3ATWA 3UQVA 3GCTG 1O31A 1C1WH 1D4PB 1ZGVA 1P2NA 3MFJA 2FPZA 3F9EA 3RXIA 3SI4H 1RTKA 1TALA 2WPJS 3RXVA 3P8GA 3RXUA 2OQUA 2ZWLH 1SGIB 4RN6A 4AB8A 1WQVH 3SU3A 2P93A 4PROA 1HJ9A 2ALPA 3TK6A 2PGBB 2ZHDA 3SHCH 2JETC 1UTKA 1BQYA 1S0QA 2FTLE 2O9QA 1BMLA 1TX6A 1UJ1A 3TGJE 1C1UH 1QL9A 2GTBA 3NXPA 2Y5HA 1GJ7B 3Q76A 2WUCA