2ZHDA

Exploring trypsin s3 pocket
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Congeneric but still distinct: how closely related trypsin ligands exhibit different thermodynamic and structural properties
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2008-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zhdA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zhdA02
1J14A 3SQHE 5EQSA 4FVBA 5EGMA 5EW1H 2BB4A 1L1GA 2VWLA 1PPEE 3QO6A 3CS7A 4FUBA 2ZCLP 3E16B 4WY3A 4NZQA 4K2YA 4A7IB 3P8NA 4O97A 2BD3A 3CS0A 3I29A 2C8ZB 2FOFA 1QCPA 3DFLA 1KDQB 3BG4C 1O3FA 4FUJA 5ESTE 3LH3A 3IWMA 2BDGA 2TGPZ 3U8RH 1TE0A 3ZZ4A 4TPYA 4NFFA 5AFYH 5JBBS 1W8BH 3RXDA 2QXJA 1O2VA 1EUFA 2TGDA 2ZGXH 2XWBI 5ETXA 4CRBA 3PO1B 1EP5A 1O2JA 4FU8A 2JKHA 4IGDA 2ZFSA 1GBKA 2TPIZ 4YLUA 4DOQA 1O3MA 3STIA 3W95A 1J15A 2ZPQA 1P3EA 1RJXB 1WYKA 3OX7U 4ZHMU 3ZVCA 4D7GA 5DP9A 1QB9A 1IQJA 1Y3YA 2Z3CA 1E37B 2OC7A 2G8TA 2ZDLA 1Q2WA 1TGCA 2OBQA 1QFKH 2A0QB 3SU3A 4KTCA 1EOLA 2FOHA 1UTMA 1DITH 3SV7A 2WV4A 2WUCA 1SGRE 1QRWA 2I6SA 3LGUA 1KLTA 2GT7A 5L2ZH 4B1TA 4CBOA 4TY6A 5A09A 4BOHA 2BVSH 1GHBF 1DWCH 1QRZA 2FS8A 3H7TA 2GZ8A 4GHQA 1NFXA 2ZFPH 3TGJE 1QB6A 3GCOA 1Q31A 2HWLB 3RMNH 5DP4A 3KCGH 1T4UH 5E0HA 2ZDVH 1T4VH 4IS5A 1YLDA 4ESTE 1DXPA 1C2GA 5IYTA 1RIWC 1QJ6B 2IJOB 2BYAX 1UTQA 1QRXA 2VNTA 1JWTA 1MZDA 5T6FA 4MDSA 4GUXA 4ZHAA 3OTJE 1MZAA 3RLYH 1ZJKA 2G51A 1XX9A 2ANMH 1IQFA 1Z8JB 4VGCB 1EZQA 5EODA 1BMNH 1EJMA 1HGTH 1O0DH 1DVAH 3URCA 1A1RA 5G4BA 4YT6H 3PMBB 1C5UA 1SSXA 3ZZBA 5FCKA 4BTUB 3LGWA 1BTYA 2PHBA 2VH6A 2BQWB 2VU8E 1L2EA 3NCLA 3NK8A 4YO9A 3MMGA 5EW2H 1SQTA 3AAUA 3ENSB 3QGNB 3K65B 2AIPA 3KN2A 4TY7A 1OS8A 1NRSH 1MAXA 4IN2A 1K21H 2F3CE 3RXVA 1NY22 1QJ7B 3AW0A 3GICB 4ABDA 1P12E 1Y5BT 1C5YB 1V2VT 4FUIA 2BDHA 1D9IA 1OYQA 2HNTE 2BXTH 4BXWA 4MNWA 1J17T 4AG2A 1W14U 1A46H 3MYWA 4HGCA 2Q1JA 3VFEA 1BRBE 1WAYB 3DUXH 3MH7A 3EAJA 1QBOA 1Y3WA 2FXRA 2UWOA 1QURH 1PPGE 2ZF0H 2H9TH 2BDIA 4Y0YE 3TH3H 2THFB 1YP9A 1T31A 3SV6A 1XKAC 1TNJA 5T6DA 2SGDE 3SV2H 1Z1IA 3ZVEA 3VGCB 4ABBA 1C5OH 3VB6A 1EKBB 2BOKA 3C27B 3M36A 4RKOB 1O5GH 1T8NA 1V2KT 1LKBA 3BEFB 3RXJA 2QF3A 4DJZB 1P2JA 2OP9A 2CV3A 3MO9A 3LKWA 4YTAA 1AFQC 1ELTA 8KME2 2ZCHP 1C1WH 4WXVA 1SGYE 2WYJA 1P06A 1EB1H 1Y3UA 4ASHA 2ZU1A 5LGOA 1GBAA 5L30H 2GX4A 2A4RA 1DY9A 3A8AA 2Y5FA 1JOUB 3RMOH 4GCHG 1TPAE 2DE9A 1KSNA 1KXCA 2BQ6B 4OS5A 2G00A 4AX9H 1V2OT 5FX5A 2J92A 3C1KA 3BSQA 1QL7A 4IW4E 2D2DA 1HAYB 2STBE 2V35A 1SVPA 1EAIA 1EZXC 2RCEA 3STJA 2ZZUH 4Z6AH 3A7YA 2TGAA 4MNXA 2BD8A 1MTVA 2W7SA 5DO4H 1UCYK 1T32A 7ESTE 1HNEE 2Z9GA 3M3TA 1P01A 5DKMA 1CU1A 5DP5A 1EX3A 4I8LA 2Z9IA 1ZSJA 1L0ZA 1XVMA 2BD4A 4OS1A 2GGVB 5E2PA 2A5KA 3A86A 3GDSA 3UOUA 1C5LH 3A82A 3SUDA 3SHAH 3M5OA 4KTUA 1HAPH 1MTWA 1WQSA 4ISIH 2ZFFH 1V2WT 4Y71A 2OBOA 2SFAA 3SV9A 1Y8TA 2P8OC 1WUNH 2PWXA 3E90B 2P16A 2ZHDA 1IQHA 1UVTH 2C8YB 4NA9H 4Y76A 1GI7B 2OD3B 1V2TT 1SGNE 3SJKA 3A89A 1UCYE 2AMQA 3F68H 3MH5A 1GHAF 1C5PA 1GDUA 1TB6H 1W2KH 1OWEA 2TBSA 3F9FA 4AGJA 4DURA 1CBWB 1GBIA 1SGEE 4ZKSU 2P3TB 1HPGA 1MCTA 1P11E 1AMHA 3FP7E 1AKSA 1W12U 3PYHA 4JYVH 3T2NA 4CREA 1AZ8A 3MH4A 4ABHA 2PR3A 1CO7E 1W0YH 1BTHH 2BX3A 1J8AA 1FIWA 1FONA 1RTKA 3W94A 3SOSA 4NSVA 1TX8A 1C2EA 3RXAA 1OXGA 1KTTB 2D8WA 3TJVA 2AGEX 1IHSH 1CGIE 1D3DB 1F2SE 4GCHF 2WV5A 1IQLA 1NT1A 4I8JA 2BLWA 4NCYA 2BVRH 1FJSA 1QQUA 1O3EA 2R3YA 4CRCA 1N6XA 1TBQH 1CA0B 2P3FH 5FX6A 3VB7A 1BTUA 2UUJB 4MNVA 1BTPA 2ZFTA 1FY8E 4AGKA 1RRKA 3EYDA 1GMHG 1HYLA 3SV8A 3BIUH 2V3HH 3RXQA 1ZRKA 2C93B 4H6SB 3O8DA 3UWJH 3SJ9A 2GTBA 3TH2H 1V3XA 1EZUC 3V0XA 3VB5A 3K6ZA 1K22H 1YPJH 1M9UA 1ZHPA 1AGJA 1O2MA 2ULLA 1H8DH 1SLVB 1FAKH 1MCVA 2ZFQH 1H9HE 2FI3E 1XXDA 4ISHH 3ZZ8A 4FUFA 1BJUA 1GBFA 1HAHH 2FX6A 4X1PU 2VIWA 1DX5M 4IC5A 1PFXC 2LPRA 2Z9KA 5JBTA 3F9GA 4Y8XA 1WOFA 1WTHD 1TMBH 3F6UH 4Y0ZE 1EAXA 3NPSA 4UFDH 1C1OA 5AVDA 1O35A 4ZKOU 2WPLS 2JETC 4X6NA 3P17H 1MTNC 2PKSC 5F8XA 3L6PA 1S83A 1YCPH 1LVBA 1O3JA 5E0GA 3PB1E 1S0RA 5GCHG 4A1VA 1LHGH 2HNTF 1O36A 3MU5A 3UY9A 4LOYH 3MTYA 5JPMH 2R0KA 1BTZA 3E0PB 1ID5H 4CR9A 1FLEE 2D26C 1O3NA 1O3BA 2Y7ZA 2ZPSA 3A8CA 1ANCA 5HYOA 4DW2U 2BX4A 4NIXA 2Q6GA 3LPRA 4Y8YA 1D3PB 1RGQA 3LIWA 1QTFA 2A1DB 3KQEA 2BXUH 2HGTH 3SHCH 1G36A 2P95A 1K1IA 3EA8A 3HATH 1TA6A 2QN5T 4AYYB 1A5GH 1HAVA 4UD9H 3RXRA 1HRTH 3ATMA 4NFEA 1BDAA 1SMFE 1O2NA 1S81A 1H1BA 3ZVAA 4AYVB 4R0IA 1BUIA 2OC8A 1GMHF 1HJ8A 1O3DA 1SGIB 4WWYA 1LDTT 7LPRA 1ELVA 2OC1A 5TCCA 2P3UB 2ALPA 1TGSZ 1PPBH 4UONA 1MQ6A 2C3SA 1GI8B 1S82A 2ZHEH 3B23B 4NIYA 3QZRA 4ISOA 2PV9B 3S7KB 1P02A 2C4FH 2ZHWH 1C2FA 3ZVDA 1K1JA 3SGBE 5I25A 3S69A 2A45B 3UQVA 1AKSB 3P8GA 2O9QA 3BTDE 2PUQH 1GL0E 2J95A 3ODFA 1GCTC 2VIPA 1OYTH 1AB9B 2FLRH 1GG6B 5E2OA 3M7QA 3M35A 4Y10E 6CHAB 5A8YA 4BAMB 3KHVA 1ELEE 3EE0B 3FFGA 4LZ1H 1HCGA 2W7UA 1HV7A 3Q76A 3V13A 9LPRA 1RD3B 1YLCA 2H9EH 2R2MB 1V6DA 3E3TA 1TPOA 3PLBA 2XBXA 3TJOA 1EAWA 1ZGIA 2OINA 2R0LA 3LT3A 5GJ4B 1MUEB 4DY7B 5GCHF 3RXTA 1O5AB 3HKJB 1CA8B 1C2JA 1HAGE 2XNIA 1O5BB 3OU0A 2RA3A 2Z3EA 1XKBC 1GBTA 5EXNA 4BAQB 1THRH 1C1SA 1SB1H 4Q2KA 1CGJE 1MD7A 4B71A 1GJBB 1C2LA 1GGDC 1BHXB 3ZZAA 4Q7XA 3T28A 1W7XH 1S6HA 3SNBA 1TGTA 1N1LA 3ZVBA 1DSUA 2C8XB 1VITG 3KNXA 4TYDA 2Y5HA 5HXFA 4X2YA 3HK6B 2ZDAH 1OWIA 1UVPA 4FXGH 1BBRE 2IOTA 3MU1A 1XUFA 3GCHC 2RG3A 1MU6B 3SJOA 2CMYA 3S9AA 4MQAA 1AE8H 1F5RA 5C67A 4MPWA 2NU3E 5FAHA 5FHTA 1Z6EA 2BD2A 1ABJH 1YM0A 3T5FH 1BMLA 2BY9X 4RSPA 2TGTA 2A31A 4GLYA 3BTME 3E1XB 1ELBA 4B2AA 2AFQB 1MBMA 1EPTB 2IN2A 3A7XA 1BJVA 1VGCB 4HZHA 5FPSA 3E6PH 1EAUA 2WUBA 5C5NA 2QA9E 4JZIA 2FOAA 2I6QA 1G2LA 1V2JT 3SI3H 1FMGA 3SO3A 1ZPCA 2FOEA 1B0EA 1P09A 4YLQH 4X0WU 1GDQA 3RM0H 3PWBA 1DWDH 2UUFB 3FZZA 2PGQB 3FAOA 4E7RG 2VINA 1YF4A 3VEQB 1GBJA 4E7NA 4IN1A 3QWCH 2FX4A 1ZR0A 1VJ9U 3ZVFA 2ZNKH 4ABFA 3ZZ7A 1SC8U 1FPHH 3ATLA 8LPRA 3ZVGA 1P2OA 3R3GB 2EEKA 3SBKA 2BZAA 1O2ZA 4ZXYH 3GY5A 3RXSA 1YPMH 3RXLA 1WBGB 2GCTC 5JDUB 2VVVA 4SGBE 1VITF 1UHBA 1H9IE 3RXFA 1O2OA 3A88A 3V7TA 5C1XA 1EXFA 2PKAA 3U1JB 4GPGA 3LDXH 1V2RT 1ZJDA 1O3OA 3SUGA 1BMMH 5HMAA 1SGQE 1O5DH 4UFFH 1K1PA 2FPZA 1QNJA 5DP6A 2ZA5A 4CR5A 4JK6A 3RLWH 4ZUHA 4DIIH 1A3BH 1AVXA 1HJAB 4R8TB 2XRCA 4WMFA 1UVSH 2TRMA 3S0NA 2FO9A 2VIQA 5F6MA 1QBNA 2Y6TA 2ANYA 1MTUA 1GVZA 3UNRA 1PQAA 3A7VA 1W3CA 1C9PA 2NU0E 3Q00A 2RDLA 4X1SU 2VWMA 1S5SA 5DP7A 1QGFA 2R3UA 4JYTA 1V2ST 2BDCA 2HNTC 4Q80A 4JZEH 4I7YH 4BTTB 2J34A 1VCQA 1MMJN 1MKXK 1UVOA 4KGAA 1LHCH 1B7XB 1Z8RA 1Z1JA 1OSSA 1AI8H 1THSH 1NRRH 1WCZA 1DFPA 1FUJA 1LKAA 2ZKSA 3RXIA 3ZZDA 2XXLA 1GWAA 5A0CA 1N8OB 4K60A 4I31A 3AVZA 1GBBA 3GOVB 2R2WU 5CHAB 4XBCA 4A5TS 4MG3A 4MPXA 3VXFH 5DPAA 1FN8A 2YOLA 1XXFA 1RS0A 4DCDA 2G4TA 5A2MH 1GDNA 1U6QA 3DD2H 1ESBA 3U98H 4I8KA 3BG4B 3R0FA 1L4DA 4XDEA 5GDSH 3PWCA 1LQEA 2J2UA 2F9BH 2A2XH 1YPHE 2ZGCA 2BZ6H 1O38A 1CT2E 1MQ5A 1V2PT 2AEIH 3U9AH 1C5RA 1G9IE 1FNIA 3SNEA 1ZOMA 3S7HB 4A1XA 1A5HA 2H1UA 2ODPA 1DS2E 2JH0D 2ZIQH 1WU1A 4ZH8A 1F0UA 1HIAB 3SQEE 4CRFA 1Q3XA 1B0FA 3ATKA 3KL6A 3M3VA 7KMEH 1Y59T 3SZNA 1J9CH 2GDDA 1C2HA 2VGCC 1O2PA 1TALA 2G81E 1BQYA 4F49A 4NA8A 1QL8A 1GJ7B 2PSXA 3ATWA 3ZZCA 1C1PA 3ESTA 1TQ0B 1XUHA 3TU7H 1P2MA 1F92A 1SGFG 4A6LA 1NTPA 1ZSKA 1MD8A 1ZHRA 4WF8A 1GHAG 3P6ZB 5F03A 1EJNA 2HALA 2JH5D 1ZLRA 5E0JA 5GIBA 2OQ5A 3RMLH 1CBWC 5GXPA 2G4UA 1DT2A 3O8CA 4I8HA 1CE5A 1JBUH 3ZV8A 4O3TA 3A85A 3SNCA 3F9HA 4WJG2 3RC4A 1S85A 1QY6A 1RIWB 3U8OH 2YNBA 4TWYA 3CENA 2WINI 1RXPA 2J4IA 3A7ZA 3B8JA 2FI5E 2GZ7A 5T6GA 4OS2A 3FZDA 1C2IA 4KP0A 3TJNA 1VR1H 3UNQA 4ABIA 1DDJA 1NPMA 1OP2A 3S9BA 4ZHLU 1O2UA 3P95A 3EGKH 2AGIX 1T8OA 4X2VA 1CA0C 1Z71A 1AZZA 1TRNA 1W11U 4RN6A 1UTLM 1FIZA 1UTNA 3BF6H 5L2YH 2BQ7B 1S0QA 1FI8A 1GPZA 4WXIA 4Y7AA 3RXBA 5BRRE 1GBLA 3JZ2B 1TPSA 3N7OA 1O2SA 1IQMA 2EI8A 4CRGA 3PV4A 2VVCA 1GJ8B 1IQIA 1GL1A 1LPGB 3GYLB 4OS4A 1G3BA 3RXGA 3SORA 1AU8A 1SOTA 5A0BA 4NWKA 2SGQE 1PPHE 4K1SA 3M7TA 1TWXB 1DOJA 1T7CA 1YBWA 5EXLA 1P03A 1GHWH 3A8DA 1GMDG 4JK5A 4HI3A 1QA0A 1ESAA 2O8MA 3TGKE 1TOCB 3SU6A 4O3UA 5BPEA 3BTHE 2QXHA 2CHAC 1C5SA 2A32A 1DWEH 2AERH 1SGPE 5H4IB 4NGAH 1KY9A 5GPIB 1YPGH 1JXPA 1PQ5A 1DY8A 3VB3A 4GSOA 1TMTH 4BNRA 1TNGA 2VIDA 5C3NA 1UTPA 1O37A 1F0SA 1CQQA 1TOMH 2GCHG 1ZTKA 3K9XB 1QHRB 2OQUA 1AFQB 1K1MA 2H5CA 1LQDB 1EATA 1AVWA 1TBZH 4ISLA 5FPYA 4MPVA 3KF2A 2XC4A 3DT0H 1P05A 1NFUA 1V2UT 2Z3DA 4GHTA 3NKKA 1F5LA 2Y82A 4NIWA 3TITA 3S9CA 1AUJA 5SGAE 3B9FH 5EG4A 2QY0B 3UWIA 1F0TA 1FY5A 2CF8H 1GCDA 3K2UA 2F9UA 2BY7X 3QUMP 3V3MA 1ELGA 1RTFB 4JZFH 3T62A 1TNIA 2UWPA 4J1YA 1W10U 1AWFH 1GBDA 5CMXH 1EOJA 1DPOA 3KIDU 1AQ7A 2P59A 3MI4A 3QK1A 1FN6A 4UFEH 2EI7A 4CHAC 1P8VC 1T8MA 1TA2A 1ESTA 1C2KA 1GI5A 4WH8A 2B5TB 3ZZ3A 1XUJA 2SNWA 1HAOH 3L3TA 2Z94A 1XUKA 4WMDA 4FUGA 2GMTC 1BTXA 1NC6A 3MFJA 3P70B 1Z6JH 1FAXA 3I77A 3PMJA 4CH8B 1ZZZA 4DG4A 3T25A 3E8LA 4GVUA 3GY8A 1GJ4H 1GMDF 1WTGH 3M5LA 4K69A 2Z7FE 2P8OB 1AUTC 1TNKA 3SW2B 4B75A 4X2XA 1PQ7A 5C20A 2FYQA 3PLKA 1GG6C 1HAXB 1KTSB 3D62A 2QC2A 1TIOA 4RKJB 4X8VH 1HXFH 3RXCA 1V2QT 5EPYA 2WPHS 1O5FH 2FOMB 1WQVH 1C5VA 1TNHA 2Z9LA 1IHTH 1SR5C 3ZV9A 8GCHG 5I46H 3NZIA 4XOJA 2Y5GA 1O2TA 1V2MT 3BV9B 1PPCE 2GCHF 1BITA 3Q77A 4YT7H 1GI9B 3H7OA 2FIRH 4Z0KA 3EA9A 1OKXA 1TPPA 1O34A 3FP8E 2BD9A 3M7UA 2ESTE 3ODDA 2KAIA 1C5ZB 3MO6A 1EZSC 1DUAA 4ABJA 3LONA 2V3OH 2G5NA 2WPKS 4FUEA 3Q3YA 2GKVE 2PW8H 1ANDA 1WSSH 4YOIA 2C8WB 3UQOA 1KXDA 2BDBA 1O39A 1HUTH 1OP0A 1MBQA 4X8TH 2QF0A 3NWUA 3GY6A 1G37A 1P57B 3ATIA 2BLOA 2ALVA 1TRYA 4NA7A 4Y11E 1XUIA 1ORFA 1O33A 4GAWA 3ZYDA 1D3QB 1A0JA 1K28D 3LGTA 1Z7KA 1T8LA 2P94A 4O9VA 2FODA 3KQBA 4K1EA 1A4WH 3BTGE 3KQDA 1UCYH 1GI6A 4AB9A 3UPEA 1BRCE 1GJ9B 1GHZA 1JIRA 2ZU5A 3OY6U 1HB0B 2QIQA 1D3TB 1EPTC 1XUGA 2BMGB 3OY5U 1H9LB 1VGCC 5LH8A 2EC9H 3M61U 5K0HA 1QA7A 2FOBA 4ABAA 3RU4E 4D9RA 1JMOH 1AHTH 2AGGX 4MTBA 2BY6X 4K3JA 2O8LA 1GBCA 3M3SA 1BBRK 1XMNB 3TNTA 3MOCA 1DWBH 1OWJA 1P3CA 1C1TA 1VJAU 1TBRH 2LNCA 2JETB 1MTNB 4X6PA 1SBWA 1Y3VA 5EOKA 1ETRH 5J4SA 2XWAA 3AASA 3H5CB 8GCHF 1O5EH 2OXSA 1HBTH 1ZPBA 4JMYA 3SN8A 3DFJA 1EB2A 5HGGA 1O3KA 1E34B 4FUCA 4XFQA 1SLUB 2Z6BD 2WPJS 1UK3A 1YC0A 1GHVH 4OS6A 1NESE 3U1IB 1OPHB 1ELCA 3RP2A 4DT7B 1K1OA 1G32B 1ACBE 1K9OE 2H6MA 5IDKA 5FCRA 1PYTD 3QN7A 1X7AC 1OX1A 5C5OA 1NRQH 1DICA 3PO1C 4ABEA 1GBEA 2ZGHA 5EQRA 2BD5A 4KELA 1OWKA 1KXBA 2FMJA 2QV1A 1P10A 1LHFH 3ELAH 4ZXXH 2G52A 1S6FA 4OS7A 4ISNA 1UMAH 2QGRA 1LVMA 6LPRA 3VXEH 3QGJA 4Q7ZA 2A4GA 1VCPA 3EA7A 1O3GA 1VITH 1ANEA 4M7GA 1MKWK 3GDVA 3QTOH 1EQ9A 3SU1A 3P8FA 2GV6A 1O2RA 1JRSA 2A7CA 4CRAA 3UR9A 3GCNA 4ZROA 2EA3A 3SNAA 3RMMH 5T3HA 2ASUB 5ABWA 4JYUH 4K5ZA 1GCTB 1NU7B 1BIOA 1ZSLA 3FVFB 1QBVH 2VVUA 1MH0A 2GZ9A 2PFEA 1KXFA 1TAWA 3PM3A 1ARCA 2ODQA 1OP8A 1Y5AT 4O03A 1HAVB 5DJ7A 3RDZA 1O2LA 1GI3A 1C1VH 4A92A 3A8BA 4Q7YA 2A2QH 1UK4A 3LGYA 4ABGA 1NFYA 2IPHA 2AMDA 1FY4A 1TGBA 1E36B 1SPJA 2ZDKA 4AB8A 4D76A 4MNYA 3AAVA 1G2MA 1SGTA 2NU2E 4VGCC 4I33A 1BCUH 3BEIB 4OGYA 3UR6A 2R9PA 2V0BA 3GY4A 1E38B 2VJ1A 4E05H 2ZGJA 1C1QA 1GGDB 3M37A 1JRTA 6GCHG 2PTCE 5C1YA 3ZZ5A 1Z8IB 2ZHQH 2FM2A 5A0AE 2FLBH 1PPZA 3T26A 5A8XA 1PYTC 4AFZA 1ARBA 2TIOA 2XYAA 1YPHC 1HLTH 1LPZB 2VH0A 4SGAE 1THPB 2SGAA 4JZ1A 3GCHB 4U30A 4B74A 4YZUA 2ZC9H 3TH4H 3A83A 1BB0B 1KLJH 1PJPA 4QT8C 5HM9A 1BT7A 2XBWA 1ELFA 1H4WA 1TX6A 1K1NA 4B73A 2AH4X 4Y79A 1G3CA 3L33A 2GDEH 3UUZA 1NS3A 1NROH 5DG6A 3BTFE 3VB4A 4X1NU 2ZO3H 1RTLA 4DVAU 1CT4E 1GJCB 1Z8GA 1KXAA 3OYPA 1C5NH 1WV7H 4YOGA 1D6RA 2B8OH 1C5TA 1C5WB 1TONA 1GI0A 1O2HA 3HK3B 4X1QU 3VGCC 2A4QA 1O30A 1A61H 1L4ZA 1BRUP 1NFWA 5HM2A 1S84A 3HPTB 2A7JA 4AN7A 1P2KA 2ZGBH 3FP6E 3P92A 2HPPH 2XBVA 3GY7A 1C1MA 1LO6A 2CN0H 1J16A 4OGXA 1FQ3A 4AG1A 3M5NA 5J4QA 1C2DA 3TIUA 1YPEH 3A7TA 1O2IA 1AWHB 3GCTG 2BLQA 5FBIA 1IQNA 3QZQA 3SU0A 5EU8A 2WPIS 1BBRH 3BTEE 4X2WA 1SLXB 1B5GH 2ZTZA 1GMCG 3V12A 2GP9B 1PPFE 4IBLH 3ZZ9A 2O8UA 5ESBA 4H6TA 2OCVB 1DSTA 3RUOA 3LC5A 1LVYA 1QB1A 4B2BA 1DANH 1DLKB 6GCHF 1AVGH 4ZAEA 1E35B 2GCTB 2SGPE 4B2CA 1HJ9A 5FBEA 1A7SA 3QX5H 2NU4E 3F1SB 2EI6A 1SL3A 5DP8A 2UWLA 4INHA 1HDTH 1MU8B 1YGCH 3KQCA 1A3EH 1RFNA 3RC6A 3A87A 1SGDE 4E06H 3D49H 1UO6A 5PTPA 2PSYA 2ZU4A 1W13U 2HOBA 2A5IA 1BHXF 1O3CA 4INLA 4UE7H 3DHKH 1BMAA 4WMEA 1XM1A 2A7HA 2ZQ2A 4TWWA 2F9NA 1C4U2 1KYNA 2F91A 4IMQA 1ELDE 5K7RA 1FZZA 2FESH 4AOQA 3BEUA 1CHOG 1IOEA 2ZWLH 1O2WA 1LPKB 1CT0E 1NM6A 1OWDA 2F9PA 1DE7H 4AORA 2P93A 3LJJA 1O2GH 2J38A 1O5CB 3TPIZ 1YKTA 3UFAA 1YCPK 2OC0A 2PGBB 1P0SH 4X6MA 1C4Y2 1MKWH 1ANBA 4D9QA 2ZU2A 4AFSA 1G3DA 5AFZH 1UHBB 5JBAS 5GWZA 1FPCH 2ZQ1A 2PKAB 3RXMA 4JCNA 2K1QA 2J9NA 5F8ZA 3SU2A 1SQAA 3P8OA 2V6NA 1L1JA 5JYIA 3A80A 1P04A 3GCTF 3RXPA 2FWWA 1NZQH 3MNCA 1NN6A 5AF9H 1SI5H 1DLEA 3MWIU 1DUEA 2SGEE 1F0RA 1VZQH 1G3EA 2Q6DA 2QYIA 3URDA 1TYNA 1GJ6A 2SGFE 1NU9A 4KKDA 1GMCF 3BN9A 2Z9JA 2ZG0H 1SG8B 3M5MA 1GI2A 2AS9A 4UEHH 3PTNA 1Y3XA 1TGNA 2VIVA 3PMAB 1PQ8A 3SNDA 5FXLA 1GI1A 3BIVH 4BAOB 1UVUH 3BTTE 7GCHG 1A0LA 1GJ5H 4JZDH 3A84A 3QLPH 4DGJA 3F9EA 3MNSA 2OTVA 1FDPA 3HKIB 2M5TA 3LC3A 1SQOA 1A5IA 4Y6DA 3RXHA 1V2LT 3MNBA 4NG9H 4NWLA 1NO9H 4K8YA 1P2QA 2H9HA 1VCWA 2CF9H 1GVLA 2BHGA 5A8ZA 1IAUA 2ZTYA 1FXYA 3ZZ6A 2ZCKP 4INKA 4B76A 1QIXB 3TK5A 1ETTH 1GBHA 1MAYA 3AW1A 2BD7A 1HAIH 1ZHMA 4WVPE 2D1JA 2OLGA 1O2XA 2VGCB 3BTWE 3T27A 3SGQE 3I78A 4A1TA 4BANB 2DUCA 1CHOF 2CGAA 1C5QA 2XW9A 3IITA 1N6YA 3NUMA 2PLXA 4MVNA 4D7FA 2VIOA 1YPLH 2HVXA 3BG8A 3RU4D 3LGVA 2C90B 1HFDA 4BTIB 3GY3A 3BTQE 1INCA 5F8TA 1W7GH 2F83A 3PMHB 5FPTA 1SHYA 1QL9A 2WYGA 3IG6B 1K2I1 2G5VA 2VWNA 2PTNA 2UUKB 3WY8A 1QR3E 3TNSA 5EXMA 4BXSA 4YOJA 1NRPH 1LCYA 1YCPM 1MKXH 4NSYA 4PROA 2Y81A 4YM9A 3TJUA 1K1LA 4ZKRU 3U69H 3UOPA 1W0ZU 3MHWU 3SU4A 1C1RA 1YYY1 1L1NA 4X1RU 4AZ2B 1F5KU 1TLDA 1O2YA 3EDXB 1YPKH 1TRMA 3QDZB 3Q3XA 2FP7B 3LOXA 4FUHA 1P9SA 1C1UH 1FV9A 1ELAA 4TPIZ 1TNLA 4I8GA 1IQKA 2W3IA 3CP7A 2ZDNA 2W26A 2QXGA 4H4FA 2BTCE 3E0NB 2W5EA 5LPEA 2XCFA 1KLIH 3SJ8A 3SU5A 1BTWA 1TABE 4LK4A 4CRDA 7GCHF 2Y7XA 2FTLE 5EQQA 2FOCA 1O32A 2FI4E 2B7DH 1UTKA 3ZYEA 2RA0A 3K6YA 2F9OA 4XBBA 2FYRA 1BOQA 2BM2A 2ZTXA 2FTMA 4U2WA 1ZGVA 1P2IA 4XBDA 1LTOA 1LHDH 4UDWH 1O31A 3SUFA 4WH6A 1SGCA 4LZ4B 3VPKA 1O3HA 3EQ0H 2BY8X 2BDAA 3E91A 2HPQH 2ZDMA 1BZXE 1E0FD 1A2CH 2J94A 1HAZB 1UK2A 4CH2B 2ZFRH 3UIRA 1AB9C 1CVWH 1UJ1A 3G01A 3NXPA 1AFEH 3GYMA 2ODYB 2GVFA 1O2KA 1SFQB 4MPUA 6CHAC 1O3LA 4X8UH 4ZMAH 3RU4T 5C1UA 1O3IA 2F9VA 5LPRA 1EASA 2ILNA 2CHAB 3Q3KA 3QTVH 1AO5A 2ZECA 3HGPA 4U32A 1AD8H 2NWNA 1OWHA 1C4V2 3UTUH 2A4OA 1KXEA 1CGHA 4AFQA 1EPTA 4J2YB 5L6NH 3O8RA 2O8WA 1O3PB 2AMPA 3LU9B 4HFPB 2XCNA 4IMZA 1FY3A 4BAKB 1MTSA 1GBMA 4Y8ZA 3MU4A 2CXVA 2FEQH 1ZMNA 3HGNA 1SHHB 3PTBA 1ZPZA 5JBCS 4BAHB 4Y7BA 3DA9B 3OSYA 2HRVA 3MU8A 2ZHFH 1TQ7B 1QJ1B 5DP3A 3TVJB 1HXEH 4FU9A 1P2NA 2XC0A 1TX7A 2FZZA 1F7ZA 3MU0A 1AE5A 1KDQA 9ESTA 2H5DA 4ZKNU 2Q6FA 2AIQA 3SJIA 1O2QA 2UUYA 5B6OA 2W3KA 1AN1E 4CHAB 3LH1A 4K1TA 2A5AA 4H42U 5JB9S 3T29A 2JH6D 1OOKB 2BDYA 1LMWB 1DM4B 1ETSH 1ABIH 1C5XB 4HTCH 1CHGA 1BA8B 3SGAE 1GHYH 3ITIA 4CBNA 2GMTB 1G30B 1ZTJA 2WPMS 1NRNH 2QXIA 2B9LA 2DE8A 1LVOA 2BLVA 1SGFA 3D65E 2ZU3A 2PUXB 1SLWB 4NIVA 4X6OA 2Y80A 1QQ4A 8ESTE 4THNH 3RC5A 1ZRBA 1C2MA 2ANKH 3BTKE 3GY2A 2QCYA 2PKSB 1EJAA 2BY5X 2FOGA 1TFXA 3D23A 3UREA 3A81A 2OUAA 4FVDA 1EP6A 2YNAA 1UTJA 2BOHB 3UNSA 5E8EH 5DGJA 3FANA 3PROA 4F4OC 4FU7A 5DK1A 1KIGH 4NZLA 2GT8A 4D8NA 1AY6H 5TCAA 1P9UA 5JB8S 3GDUA 2XTTB 1LHEH 3RXEA 1GJAB 1IQEA 3KGPA 2STAE 3KEEA 4AFUA 1Y5UT 4KTSA 4XE4A 1C9TA 2ZPRA 3JZ1B 1UTOA 2ZEBA 1H8IH 1GJDB 2QAAA 3A7WA 3TGIE 2G55A 2XC5A 1DXWA 2VB0A 2GV7A 1V2NT 4FUDA 1TMUH 3SI4H 2SNVA 3SUEA 3TK6A 2XBYA 1JIMA 1FY1A 1XVOA 2AYWA 1ZMJA 2B0FA 3TK9A 5TJXA 3LJOA 3RM2H 1A0HB 2FDAA 2NU1E 5CE1A 3RXKA 1HJAC 4LXBH 4UFGH 4U01A 5C2ZA 1BRAA 2ZP0H 4MLFB 1C1NA 1C5MD 2ZI2H 1ZMLA 3RXOA 3GISB 5AHGH 3MO3A 2ANWA 3RXUA 3PLPA 1D4PB 1D6WA 1SOZA 4K8BA 4IC6A 3MNXA 2KAIB 1ZTLA 4YESB 2BVXH 3MH6A 5LPFA 3LGIA 5EPNA 4XSKU 1GHXH 3O8BA 1GHBG 4I32A 1IQGA 1HIAA 2VWOA 1CSOE 1GI4A 4X8SH 3TLOA 3U8TH 4DIHH 1GVKB 2CJIA 2HLCA 1O3AA 1N8OC 1SFIA 2GD4B 6ESTA 2O8TA 5CHAC 1ZYOA 1AIXH 2H2ZA 2FS9A
chains in the Genus database with same CATH superfamily
1J14A 3SQHE 5EQSA 4FVBA 5EGMA 5EW1H 2BB4A 1L1GA 2VWLA 1PPEE 3QO6A 3CS7A 4FUBA 2ZCLP 3E16B 4WY3A 4NZQA 4K2YA 4A7IB 3P8NA 4O97A 2BD3A 3CS0A 3I29A 2C8ZB 2FOFA 1QCPA 3DFLA 1KDQB 3BG4C 1O3FA 4FUJA 5ESTE 3LH3A 3IWMA 2QF5A 2BDGA 4XD7D 2TGPZ 3U8RH 1TE0A 3ZZ4A 4TPYA 4NFFA 5AFYH 5JBBS 1W8BH 3RXDA 2QXJA 3FKSD 3F2GA 1O2VA 4F48B 1EUFA 2TGDA 2ZGXH 2XWBI 5ETXA 4CRBA 3PO1B 1EP5A 3DSGA 1O2JA 4FU8A 2JKHA 4IGDA 2ZFSA 2CK3D 1GBKA 2TPIZ 4YLUA 4DOQA 1O3MA 3STIA 3W95A 1J15A 2ZPQA 1P3EA 1RJXB 1WYKA 3OX7U 4ZHMU 3ZVCA 4D7GA 1YLNA 5DP9A 1QB9A 1IQJA 1Y3YA 2Z3CA 1E37B 2OC7A 2PP6A 2G8TA 2ZDLA 4RT1A 1Q2WA 1TGCA 2OBQA 1QFKH 4ACBA 3F2FA 2A0QB 3SU3A 4KTCA 1EOLA 2FOHA 1UTMA 1DITH 3SV7A 2WV4A 2WUCA 1SGRE 1QRWA 2I6SA 3LGUA 1KLTA 2GT7A 5L2ZH 4B1TA 4CBOA 4TY6A 5A09A 4BOHA 2BVSH 1GHBF 1DWCH 1QRZA 2FS8A 3H7TA 5C17A 2GZ8A 4GHQA 1NFXA 2ZFPH 3TGJE 1QB6A 3GCOA 1Q31A 2HWLB 3RMNH 5DP4A 3KCGH 1T4UH 5E0HA 2ZDVH 1T4VH 4IS5A 1YLDA 4ESTE 1DXPA 1WDIA 1C2GA 5IYTA 1RIWC 1QJ6B 2IJOB 2BYAX 1UTQA 1QRXA 2VNTA 1JWTA 1MZDA 5T6FA 4MDSA 4GUXA 4ZHAA 3OTJE 1MZAA 3RLYH 1ZJKA 1FX0B 2G51A 1XX9A 2ANMH 1IQFA 1Z8JB 4VGCB 1EZQA 5EODA 1BMNH 1EJMA 1HGTH 1O0DH 1DVAH 3URCA 3EE7A 1A1RA 5G4BA 4YT6H 3PMBB 1C5UA 1SSXA 5DSFA 3ZZBA 5FCKA 4BTUB 3LGWA 3OFND 1BTYA 2PHBA 2VH6A 2BQWB 2VU8E 1L2EA 3NCLA 3NK8A 4YO9A 3MMGA 5EW2H 1SQTA 3AAUA 3ENSB 3QGNB 3K65B 2AIPA 3KN2A 4TY7A 1OS8A 1NRSH 1MAXA 4IN2A 1K21H 2F3CE 3RXVA 1NY22 1QJ7B 3AW0A 3GICB 4ABDA 1P12E 1Y5BT 1C5YB 1V2VT 4FUIA 2BDHA 1D9IA 1OYQA 2HNTE 2BXTH 4BXWA 4MNWA 1J17T 4AG2A 1W14U 1A46H 3MYWA 4HGCA 2Q1JA 1NBME 3VFEA 1BRBE 1WAYB 3DUXH 3MH7A 4RI0A 3EAJA 5IK2D 1QBOA 1Y3WA 2FXRA 2UWOA 1QURH 1PPGE 2ZF0H 2H9TH 2BDIA 4Y0YE 3TH3H 2THFB 1YP9A 1T31A 3SV6A 1XKAC 1TNJA 2GJGA 5T6DA 2IJD1 2SGDE 3SV2H 1Z1IA 3ZVEA 4P00A 3VGCB 4ABBA 1C5OH 3VB6A 1EKBB 2BOKA 3C27B 3M36A 4RKOB 5FL7D 1O5GH 1T8NA 1V2KT 1LKBA 3BEFB 5KEDA 3RXJA 2QF3A 2V7QD 4DJZB 1P2JA 2OP9A 2CV3A 3MO9A 3LKWA 4YTAA 1AFQC 1ELTA 8KME2 2ZCHP 1C1WH 4WXVA 1SGYE 2WYJA 1P06A 1EB1H 1Y3UA 4ASHA 2ZU1A 5LGOA 1GBAA 5L30H 2GX4A 2A4RA 1DY9A 3A8AA 2WV9A 2Y5FA 1JOUB 3RMOH 4GCHG 1TPAE 2DE9A 1KSNA 1KXCA 2BQ6B 4OS5A 2G00A 4AX9H 1V2OT 5FX5A 2J92A 3C1KA 3BSQA 1QL7A 4IW4E 2D2DA 1HAYB 2STBE 2V35A 1SVPA 1EAIA 1EZXC 2RCEA 3STJA 2ZZUH 4Z6AH 3A7YA 2TGAA 4MNXA 3WW7A 2BD8A 1MTVA 2W7SA 5DO4H 1UCYK 1T32A 7ESTE 1HNEE 2Z9GA 3M3TA 1P01A 5DKMA 1CU1A 5DP5A 1EX3A 4I8LA 2Z9IA 1ZSJA 1L0ZA 1XVMA 2BD4A 4OS1A 2GGVB 5E2PA 2A5KA 3A86A 3GDSA 5EJZA 3UOUA 1C5LH 3A82A 3SUDA 3SHAH 3M5OA 4KTUA 1HAPH 1MTWA 1WQSA 4ISIH 2ZFFH 1V2WT 4Y71A 2OBOA 2SFAA 3SV9A 1Y8TA 2P8OC 1WUNH 2PWXA 3E90B 2P16A 2ZHDA 1IQHA 1UVTH 2C8YB 4NA9H 4Y76A 1GI7B 2OD3B 1V2TT 1SGNE 2WHXA 3SJKA 3A89A 1UCYE 2AMQA 3F68H 1WXRA 3MH5A 1GHAF 1C5PA 1GDUA 1TB6H 1W2KH 1OWEA 2TBSA 3F9FA 4AGJA 4DURA 1CBWB 1GBIA 1SGEE 4ZKSU 2P3TB 1HPGA 1MCTA 1P11E 1AMHA 3FP7E 5HIZA 1AKSA 1W12U 3PYHA 4JYVH 3T2NA 4CREA 1AZ8A 3MH4A 4ABHA 2PR3A 1CO7E 1W0YH 1BTHH 2BX3A 2W6JD 1J8AA 1FIWA 1FONA 1RTKA 3W94A 3SOSA 4NSVA 1TX8A 1C2EA 3RXAA 1OXGA 1KTTB 2D8WA 3TJVA 2AGEX 1IHSH 1CGIE 1D3DB 1F2SE 4GCHF 2WV5A 1IQLA 1NT1A 4I8JA 3H09A 2IPQX 2BLWA 4NCYA 2BVRH 1FJSA 1QQUA 1O3EA 2R3YA 4CRCA 1N6XA 1TBQH 1CA0B 2P3FH 2OK5A 5FX6A 3VB7A 1BTUA 2UUJB 3FOAA 4MNVA 1BTPA 2ZFTA 1FY8E 4AGKA 1RRKA 3EYDA 1GMHG 1HYLA 3SV8A 3BIUH 2V3HH 3RXQA 1ZRKA 2C93B 4H6SB 3O8DA 3UWJH 3SJ9A 2GTBA 2YMSD 3TH2H 1V3XA 1EZUC 3V0XA 3VB5A 3K6ZA 1K22H 1YPJH 1M9UA 1ZHPA 1AGJA 1O2MA 2ULLA 1H8DH 1SLVB 1FAKH 1MCVA 2ZFQH 1H9HE 2FI3E 1XXDA 2K8IA 2KZ4A 4ISHH 3ZZ8A 4FUFA 1BJUA 1GBFA 1HAHH 2FX6A 4HG6A 4X1PU 2VIWA 1DX5M 4IC5A 1PFXC 2LPRA 2Z9KA 5JBTA 3F9GA 4Y8XA 1WOFA 1WTHD 1YY3A 3PRBA 1TMBH 3F6UH 4Y0ZE 1EAXA 3NPSA 4UFDH 1C1OA 5AVDA 1O35A 4ZKOU 2WPLS 2JETC 4X6NA 3P17H 1MTNC 4ZCNA 2PKSC 5F8XA 3L6PA 1S83A 1YCPH 1LVBA 1O3JA 5E0GA 3PB1E 1S0RA 5GCHG 4A1VA 1LHGH 2HNTF 1O36A 3MU5A 3UY9A 4LOYH 3MTYA 5JPMH 2R0KA 1BTZA 3E0PB 1ID5H 4CR9A 1FLEE 2D26C 1O3NA 1O3BA 2Y7ZA 2ZPSA 3A8CA 1ANCA 5HYOA 4DW2U 4I86A 2BX4A 4NIXA 2Q6GA 2WSSD 3LPRA 4Y8YA 1D3PB 1RGQA 3LIWA 1QTFA 2A1DB 3KQEA 2BXUH 2HGTH 3SHCH 1G36A 2P95A 1K1IA 3EA8A 3HATH 1TA6A 2QN5T 4AYYB 1A5GH 1HAVA 3PV5A 4UD9H 3RXRA 1HRTH 3ATMA 4NFEA 1BDAA 4TSFD 1SMFE 1O2NA 1S81A 1H1BA 3ZVAA 4AYVB 4R0IA 1BUIA 2OC8A 1GMHF 1HJ8A 1O3DA 1SGIB 4WWYA 1LDTT 7LPRA 1ELVA 2OC1A 5TCCA 2P3UB 2ALPA 1TGSZ 2QE7D 1PPBH 3NRLA 4UONA 1MQ6A 2C3SA 1GI8B 1S82A 2ZHEH 3B23B 4NIYA 3QZRA 4ISOA 2PV9B 2YMSC 3S7KB 1P02A 2C4FH 2ZHWH 1C2FA 3ZVDA 1K1JA 3SGBE 5I25A 3S69A 2A45B 3UQVA 1AKSB 3P8GA 2O9QA 3BTDE 2PUQH 1GL0E 2J95A 3ODFA 1GCTC 2VIPA 1OYTH 1AB9B 2FLRH 5F53A 1GG6B 5E2OA 3VG8A 3M7QA 3M35A 4Y10E 6CHAB 5A8YA 4BAMB 3KHVA 1ELEE 3EE0B 3FFGA 2W6ID 4LZ1H 3W1EA 1HCGA 2W7UA 1HV7A 3Q76A 3V13A 9LPRA 1RD3B 1YLCA 2H9EH 2R2MB 1V6DA 3E3TA 1TPOA 3PLBA 2XBXA 3TJOA 1EAWA 1ZGIA 2OINA 2R0LA 3LT3A 5GJ4B 1MUEB 4DY7B 5GCHF 3RXTA 1O5AB 3HKJB 1CA8B 1C2JA 1HAGE 2XNIA 1O5BB 3OU0A 2RA3A 2Z3EA 1XKBC 1GBTA 5EXNA 4BAQB 1THRH 1C1SA 1SB1H 4Q2KA 1CGJE 5EIYA 1MD7A 4B71A 1GJBB 1C2LA 5KGOA 1GGDC 2JJ1D 1BHXB 3ZZAA 4Q7XA 3T28A 1W7XH 1S6HA 3SNBA 1TGTA 1N1LA 3ZVBA 1DSUA 2C8XB 1VITG 3KNXA 4TYDA 2Y5HA 5HXFA 4X2YA 3U28C 3HK6B 2ZDAH 1OWIA 1UVPA 4FXGH 1BBRE 2IOTA 3PRDA 3OAAD 3MU1A 1XUFA 3GCHC 2RG3A 1MU6B 3SJOA 2CMYA 3S9AA 4MQAA 1AE8H 1F5RA 5C67A 4MPWA 2NU3E 5FAHA 5FHTA 4YXWD 1Z6EA 3DSPA 2BD2A 1ABJH 1YM0A 3T5FH 1BMLA 2BY9X 4RSPA 2TGTA 2A31A 4GLYA 3BTME 3E1XB 1ELBA 4B2AA 2AFQB 1MBMA 2J98A 1EPTB 2IN2A 3A7XA 1BJVA 1VGCB 1H8HD 4HZHA 5FPSA 3E6PH 1EAUA 2WUBA 5C5NA 2QA9E 4JZIA 2FOAA 2I6QA 1G2LA 1V2JT 3SI3H 1FMGA 3SO3A 1ZPCA 2FOEA 1B0EA 1P09A 4YLQH 4Q4LA 4X0WU 1GDQA 3RM0H 3PWBA 5C94A 1DWDH 2UUFB 3FZZA 1E79D 2PGQB 2J97A 3FAOA 4E7RG 2VINA 1YF4A 3VEQB 1GBJA 4E7NA 4IN1A 3QWCH 5C0UA 2FX4A 1ZR0A 2KFWA 1VJ9U 3ZVFA 2ZNKH 4ABFA 3ZZ7A 1SC8U 1FPHH 3ATLA 8LPRA 3ZVGA 1P2OA 3R3GB 2EEKA 3SBKA 2BZAA 1O2ZA 4ZXYH 3GY5A 3RXSA 1YPMH 3RXLA 1WBGB 2GCTC 5JDUB 2VVVA 4SGBE 1VITF 1UHBA 4XRNA 1H9IE 3RXFA 1O2OA 3A88A 3V7TA 5C1XA 1EXFA 2PKAA 3U1JB 4GPGA 3LDXH 1V2RT 1ZJDA 1O3OA 3SUGA 1BMMH 5HMAA 1SGQE 1O5DH 4UFFH 1K1PA 2FPZA 1QNJA 5DP6A 5EJ1A 2ZA5A 4CR5A 4JK6A 3RLWH 4ZUHA 4DIIH 1A3BH 1AVXA 1HJAB 2QF4A 4R8TB 2XRCA 4WMFA 4Q63A 1UVSH 2TRMA 3S0NA 2FO9A 2VIQA 5F6MA 1QBNA 2Y6TA 2ANYA 1E1RD 1MTUA 1GVZA 3UNRA 1PQAA 3A7VA 1W3CA 1C9PA 3OE7D 2NU0E 3Q00A 2RDLA 4X1SU 2VWMA 1S5SA 5DP7A 1QGFA 2R3UA 4JYTA 1V2ST 2BDCA 2HNTC 4Q80A 4JZEH 4I7YH 4BTTB 2J34A 1VCQA 1MMJN 1MKXK 2L74A 1UVOA 4KGAA 1LHCH 1B7XB 1Z8RA 1Z1JA 1OSSA 1AI8H 1THSH 1NRRH 1WCZA 1DFPA 1FUJA 1LKAA 2ZKSA 3RXIA 3ZZDA 2XXLA 1GWAA 5A0CA 1N8OB 4K60A 4I31A 3AVZA 1GBBA 3GOVB 2R2WU 3UB0A 5CHAB 4XBCA 4A5TS 4MG3A 4MPXA 3VXFH 5DPAA 1FN8A 2YOLA 1XXFA 1RS0A 4DCDA 2G4TA 5A2MH 1GDNA 1U6QA 3DD2H 1ESBA 3U98H 4I8KA 3BG4B 3R0FA 1L4DA 4XDEA 5GDSH 3PWCA 1LQEA 2J2UA 2F9BH 2A2XH 1YPHE 2WPDD 2ZGCA 2BZ6H 1O38A 1CT2E 1MQ5A 1V2PT 2AEIH 3U9AH 1C5RA 2J98B 1G9IE 1FNIA 3SNEA 1ZOMA 3S7HB 2RFKC 4A1XA 1A5HA 2H1UA 2ODPA 1DS2E 2JH0D 2ZIQH 1WU1A 4ZH8A 1F0UA 1HIAB 3SQEE 4CRFA 1Q3XA 1B0FA 3ATKA 3KL6A 3M3VA 7KMEH 1Y59T 3SZNA 1J9CH 2GDDA 1C2HA 2VGCC 1O2PA 1TALA 2G81E 1BQYA 4M9FA 4TT3D 4F49A 4NA8A 1QL8A 1GJ7B 2PSXA 3ATWA 3ZZCA 1C1PA 3ESTA 1TQ0B 1XUHA 3TU7H 1P2MA 5C0TA 5CHBA 1F92A 1SGFG 4A6LA 1NTPA 1ZSKA 1MD8A 1ZHRA 4WF8A 3OTPA 1GHAG 3P6ZB 5F03A 1EJNA 2LELA 2HALA 2JH5D 1ZLRA 5E0JA 5GIBA 2OQ5A 3RMLH 1CBWC 5GXPA 2G4UA 1DT2A 3O8CA 4I8HA 1CE5A 1JBUH 3ZV8A 4O3TA 3A85A 3SNCA 3F9HA 4WJG2 3RC4A 1S85A 1QY6A 1RIWB 3U8OH 1H8ED 2YNBA 4TWYA 3CENA 2WINI 1RXPA 2J4IA 3A7ZA 3B8JA 5B6LA 2FI5E 2GZ7A 5T6GA 4OS2A 3FZDA 1C2IA 4KP0A 3TJNA 1VR1H 3UNQA 4ABIA 1DDJA 1NPMA 1OP2A 3S9BA 4ZHLU 1O2UA 3P95A 3EGKH 2AGIX 1T8OA 4X2VA 1CA0C 1Z71A 1AZZA 1TRNA 1W11U 4RN6A 1UTLM 1FIZA 1UTNA 3BF6H 5L2YH 2BQ7B 1S0QA 2KR7A 1FI8A 1GPZA 4WXIA 4Y7AA 3RXBA 5BRRE 1GBLA 3JZ2B 1TPSA 3N7OA 1O2SA 1IQMA 2EI8A 4CRGA 3PV4A 2VVCA 2VBCA 1GJ8B 1IQIA 1GL1A 1LPGB 3GYLB 4OS4A 1G3BA 3RXGA 3SORA 1AU8A 1SOTA 2KM0A 1MABB 2SGQE 4NWKA 1PPHE 4K1SA 3M7TA 5A0BA 1TWXB 1DOJA 1T7CA 1YBWA 5EXLA 1P03A 1GHWH 3A8DA 1GMDG 4JK5A 4HI3A 1QA0A 1ESAA 2O8MA 3TGKE 3OEHD 1TOCB 3SU6A 4O3UA 5BPEA 3BTHE 2QXHA 2CHAC 1C5SA 2A32A 1DWEH 2AERH 1SGPE 5H4IB 4NGAH 3KYGA 1KY9A 5GPIB 1YPGH 1JXPA 1PQ5A 1DY8A 3VB3A 4GSOA 1TMTH 4BNRA 1TNGA 2VIDA 5C3NA 1UTPA 1O37A 1F0SA 1CQQA 1TOMH 2GCHG 1ZTKA 3K9XB 1QHRB 2OQUA 1AFQB 1K1MA 2H5CA 1LQDB 1EATA 1AVWA 1TBZH 4ISLA 5FPYA 4MPVA 3KF2A 2XC4A 3DT0H 1P05A 1NFUA 1V2UT 2Z3DA 4GHTA 3NKKA 1F5LA 2Y82A 4NIWA 3TITA 3S9CA 1AUJA 5SGAE 1SKYE 3KQ5A 3B9FH 5EG4A 2QY0B 3UWIA 1F0TA 1FY5A 2CF8H 1GCDA 3K2UA 2F9UA 2BY7X 3QUMP 3V3MA 1ELGA 5HKKD 4ASUD 1RTFB 4JZFH 3T62A 1TNIA 2UWPA 4J1YA 1W10U 1AWFH 3CNRA 1GBDA 5CMXH 1EOJA 1DPOA 3KIDU 1AQ7A 2P59A 3MI4A 3N99A 1QZ8A 3QK1A 1FN6A 4UFEH 2EI7A 4CHAC 1P8VC 1T8MA 1TA2A 2KCAA 1ESTA 1C2KA 1GI5A 4WH8A 2B5TB 3ZZ3A 2HVYB 1XUJA 2SNWA 1HAOH 3L3TA 2Z94A 1XUKA 4WMDA 4FUGA 2GMTC 1BTXA 1NC6A 3MFJA 3P70B 1Z6JH 1FAXA 3I77A 3PMJA 4CH8B 1ZZZA 4DG4A 3T25A 3E8LA 4GVUA 3GY8A 4B6FA 1GJ4H 1GMDF 1WTGH 3M5LA 4K69A 2Z7FE 2P8OB 1AUTC 1TNKA 3SW2B 4B75A 4X2XA 1PQ7A 5C20A 2FYQA 3PLKA 1GG6C 1HAXB 1KTSB 3D62A 2QC2A 5KECA 2J5UA 1TIOA 4RKJB 4X8VH 1HXFH 3RXCA 1V2QT 5EPYA 2WPHS 1O5FH 2FOMB 1WQVH 1C5VA 1TNHA 2Z9LA 1IHTH 1SR5C 3ZV9A 8GCHG 5I46H 3NZIA 1E1QD 4XOJA 2Y5GA 2JIZD 1O2TA 1V2MT 3BV9B 1PPCE 2GCHF 1BITA 3Q77A 4YT7H 1GI9B 3H7OA 2FIRH 4Z0KA 3EA9A 2WZQA 1OKXA 3ZIAD 1TPPA 1O34A 3FP8E 1BMFD 2BD9A 3M7UA 2ESTE 3ODDA 2KAIA 1C5ZB 3MO6A 1EZSC 1DUAA 4ABJA 3LONA 2V3OH 2G5NA 2WPKS 4FUEA 3Q3YA 2GKVE 2PW8H 1ANDA 1WSSH 3F2HA 4YOIA 2C8WB 3UQOA 1KXDA 2BDBA 1O39A 1HUTH 1OP0A 1MBQA 2KCOA 4X8TH 2QF0A 3NWUA 3GY6A 1G37A 1P57B 3ATIA 2BLOA 2ALVA 1TRYA 4NA7A 4Y11E 1XUIA 1ORFA 1O33A 4GAWA 3ZYDA 1D3QB 1A0JA 1K28D 3LGTA 1Z7KA 1T8LA 2P94A 4O9VA 2FODA 3KQBA 4K1EA 1A4WH 3BTGE 3KQDA 1UCYH 1GI6A 4AB9A 3AK5A 3UPEA 1BRCE 1GJ9B 1GHZA 1JIRA 2ZU5A 3OY6U 1HB0B 5GNDA 2QIQA 1D3TB 2F43B 1EPTC 1XUGA 2BMGB 3OY5U 1H9LB 1VGCC 5LH8A 2EC9H 3M61U 5K0HA 1QA7A 2FOBA 4ABAA 3RU4E 4D9RA 1JMOH 1AHTH 2AGGX 4MTBA 2BY6X 4K3JA 2O8LA 1GBCA 3M3SA 1BBRK 1XMNB 3TNTA 3MOCA 1DWBH 1OWJA 1P3CA 1C1TA 1VJAU 1TBRH 4F55A 2LNCA 2JETB 1MTNB 4X6PA 1SBWA 1Y3VA 5EOKA 1ETRH 5J4SA 2XWAA 3AASA 3H5CB 8GCHF 1O5EH 2OXSA 1HBTH 1ZPBA 4JMYA 3SN8A 3DFJA 1EB2A 5HGGA 1O3KA 1E34B 4FUCA 4XFQA 1SLUB 2Z6BD 2WPJS 1UK3A 1YC0A 2EY4C 1GHVH 4OS6A 1NESE 3U1IB 1OPHB 1ELCA 3RP2A 4DT7B 1K1OA 1G32B 1ACBE 1K9OE 2H6MA 2KCPA 5IDKA 2JDID 3F3BA 5FCRA 1PYTD 3QN7A 1X7AC 2KX4A 1OX1A 5C5OA 1NRQH 1DICA 3PO1C 4ABEA 1GBEA 2ZGHA 5EQRA 2BD5A 4KELA 1OWKA 1KXBA 2FMJA 2QV1A 1P10A 1LHFH 3ELAH 4OM9A 4ZXXH 2G52A 1S6FA 4OS7A 4ISNA 1UMAH 2QGRA 1LVMA 6LPRA 1YWUA 3VXEH 3QGJA 4Q7ZA 2A4GA 1VCPA 3EA7A 1O3GA 1NBMD 1VITH 1ANEA 4M7GA 1MKWK 3GDVA 2YMSB 3QTOH 1EQ9A 3OEED 3P8FA 3SU1A 2GV6A 1O2RA 1JRSA 2A7CA 4CRAA 3UR9A 3GCNA 4ZROA 2M2AA 4RT0A 2EA3A 3SNAA 3RMMH 5T3HA 2ASUB 5ABWA 4JYUH 4K5ZA 1GCTB 1NU7B 1BIOA 1ZSLA 3FVFB 4B6EA 1QBVH 2VVUA 1MH0A 2GZ9A 2PFEA 1KXFA 1TAWA 3PM3A 1ARCA 2ODQA 1OP8A 1Y5AT 4O03A 1HAVB 5DJ7A 3RDZA 1O2LA 1GI3A 1C1VH 4A92A 3A8BA 1W0KD 4Q7YA 2A2QH 1UK4A 3LGYA 4ABGA 1NFYA 2IPHA 2AMDA 1FY4A 1TGBA 1E36B 1SPJA 2ZDKA 4AB8A 4D76A 4MNYA 3AAVA 1G2MA 1SGTA 2NU2E 4VGCC 4I33A 1BCUH 3BEIB 4OGYA 3UR6A 2R9PA 2V0BA 3GY4A 1E38B 2VJ1A 4E05H 2ZGJA 1C1QA 1GGDB 3M37A 1JRTA 6GCHG 2PTCE 5C1YA 3ZZ5A 1Z8IB 4FOUC 2ZHQH 2FM2A 5A0AE 2FLBH 1PPZA 3T26A 5A8XA 1PYTC 4AFZA 1ARBA 2TIOA 2XYAA 1YPHC 1HLTH 1LPZB 2VH0A 4SGAE 1THPB 2SGAA 2L6OA 3GCHB 4JZ1A 4U30A 3WWBA 4B74A 4YZUA 2ZC9H 1KMHB 3TH4H 3A83A 1BB0B 1KLJH 1PJPA 4QT8C 5HM9A 1BT7A 2XBWA 1ELFA 1H4WA 1TX6A 1K1NA 4B73A 2AH4X 4Y79A 1G3CA 1OHHD 3L33A 2GDEH 3UUZA 1NS3A 1NROH 5DG6A 3BTFE 3VB4A 4X1NU 3MQKC 1VKYA 2ZO3H 1RTLA 4DVAU 1CT4E 3PV2A 1GJCB 1Z8GA 1KXAA 3OYPA 1C5NH 1WV7H 4YOGA 1D6RA 2B8OH 1C5TA 1C5WB 1TONA 1GI0A 1O2HA 3HK3B 4X1QU 3VGCC 2A4QA 1O30A 1A61H 1L4ZA 1BRUP 1NFWA 5HM2A 1S84A 3HPTB 2A7JA 4AN7A 1P2KA 2ZGBH 3FP6E 3P92A 2HPPH 2XBVA 3FN8A 3GY7A 1C1MA 1LO6A 2CN0H 1J16A 4OGXA 1FQ3A 4AG1A 3M5NA 5J4QA 1C2DA 3TIUA 1YPEH 3A7TA 1O2IA 1AWHB 3GCTG 2BLQA 5FBIA 3KYFA 1IQNA 3QZQA 3SU0A 5EU8A 2WPIS 1BBRH 3BTEE 3N7EA 4X2WA 1SLXB 1B5GH 2ZTZA 1GMCG 1K0HA 3V12A 2GP9B 1PPFE 4IBLH 3ZZ9A 2O8UA 5ESBA 4H6TA 2OCVB 1DSTA 3RUOA 3LC5A 1LVYA 1QB1A 4B2BA 1DANH 1DLKB 6GCHF 1AVGH 4ZAEA 1E35B 2GCTB 2SGPE 4B2CA 1HJ9A 5FBEA 1A7SA 3QX5H 2NU4E 3F1SB 2EI6A 1SL3A 5DP8A 2UWLA 4INHA 1HDTH 1MU8B 2RDEA 1YGCH 3KQCA 1A3EH 1RFNA 3RC6A 3A87A 1SGDE 4E06H 3D49H 1UO6A 5PTPA 1EFRD 2PSYA 2ZU4A 1W13U 2HOBA 2A5IA 1BHXF 1O3CA 4INLA 4UE7H 3DHKH 1BMAA 4WMEA 1XM1A 2A7HA 2ZQ2A 4TWWA 2F9NA 1C4U2 1KYNA 2F91A 4IMQA 1ELDE 5K7RA 1FZZA 2FESH 4AOQA 3FO8D 3BEUA 1CHOG 1IOEA 2ZWLH 1O2WA 1LPKB 1CT0E 1NM6A 1OWDA 2F9PA 1DE7H 4AORA 2P93A 3LJJA 1O2GH 2J38A 5T1VA 1O5CB 3TPIZ 1YKTA 3UFAA 1YCPK 2OC0A 2PGBB 1P0SH 4X6MA 1C4Y2 1MKWH 1ANBA 4D9QA 2ZU2A 4AFSA 1G3DA 5AFZH 1UHBB 5JBAS 5GWZA 1FPCH 2ZQ1A 2PKAB 3RXMA 4JCNA 2K1QA 2J9NA 5F8ZA 3SU2A 1S6LA 1SQAA 3P8OA 2V6NA 1L1JA 5JYIA 3A80A 1P04A 3GCTF 3RXPA 2FWWA 3SYJA 1NZQH 3MNCA 1NN6A 5AF9H 1SI5H 1DLEA 3MWIU 1DUEA 2SGEE 1F0RA 1VZQH 1G3EA 2Q6DA 2QYIA 3URDA 1TYNA 1GJ6A 2SGFE 1NU9A 4KKDA 2AHME 1GMCF 3BN9A 2Z9JA 2ZG0H 1SG8B 3M5MA 1GI2A 2AS9A 4UEHH 3PTNA 1Y3XA 1TGNA 2VIVA 3PMAB 1PQ8A 3SNDA 5FXLA 1GI1A 3BIVH 4BAOB 1UVUH 3BTTE 7GCHG 1A0LA 1GJ5H 4JZDH 3A84A 3QLPH 4DGJA 3F9EA 2F4LA 3MNSA 2OTVA 1FDPA 3HKIB 2M5TA 3LC3A 1SQOA 1A5IA 4Y6DA 3RXHA 1V2LT 3MNBA 4NG9H 4NWLA 1NO9H 2V3MA 4K8YA 1P2QA 2H9HA 1VCWA 2CF9H 1GVLA 2BHGA 4ACAA 5A8ZA 1IAUA 2HLDD 2ZTYA 1FXYA 3ZZ6A 2ZCKP 4INKA 4B76A 4Z1MD 1QIXB 3TK5A 1ETTH 1GBHA 1MAYA 3AW1A 2BD7A 2LP6A 4P02A 1HAIH 1ZHMA 4WVPE 2D1JA 2OLGA 1O2XA 2VGCB 3BTWE 3T27A 3SGQE 3I78A 4A1TA 4BANB 2DUCA 1CHOF 2CGAA 1C5QA 2XW9A 3IITA 1N6YA 3NUMA 2PLXA 4MVNA 4D7FA 2VIOA 1YPLH 2HVXA 3BG8A 3RU4D 3LGVA 2C90B 1HFDA 4BTIB 3GY3A 3BTQE 1INCA 3F0PA 5F8TA 1W7GH 2F83A 3PMHB 5FPTA 1SHYA 1QL9A 2WYGA 3IG6B 1K2I1 2G5VA 2VWNA 2PTNA 2UUKB 3WY8A 1QR3E 3TNSA 5EXMA 4BXSA 4YOJA 1NRPH 1LCYA 1YCPM 1MKXH 4NSYA 4PROA 2Y81A 4YM9A 3TJUA 1K1LA 4ZKRU 3U69H 3UOPA 1W0ZU 3MHWU 5CDFE 3SU4A 1C1RA 1YYY1 1L1NA 4X1RU 4AZ2B 1F5KU 1TLDA 1O2YA 3EDXB 1YPKH 1TRMA 3QDZB 3Q3XA 2FP7B 3LOXA 4FUHA 1P9SA 1C1UH 1FV9A 1ELAA 4TPIZ 1TNLA 4I8GA 1IQKA 2W3IA 3CP7A 2ZDNA 2W26A 2QXGA 4H4FA 2BTCE 3E0NB 2W5EA 5LPEA 2XCFA 1KLIH 3SJ8A 2EQNA 3SU5A 1BTWA 1TABE 4LK4A 4CRDA 7GCHF 2Y7XA 2FTLE 5EQQA 2FOCA 1O32A 2FI4E 2B7DH 1UTKA 3ZYEA 2RA0A 3K6YA 2F9OA 4XBBA 2FYRA 1BOQA 2BM2A 2ZTXA 2FTMA 4U2WA 1UW7A 1ZGVA 1P2IA 4XBDA 1LTOA 1LHDH 4UDWH 1O31A 3SUFA 4WH6A 1SGCA 4LZ4B 3VPKA 1O3HA 3EQ0H 3WWFA 2BY8X 2BDAA 3E91A 2HPQH 2ZDMA 2JJ2D 1BZXE 3F0OA 1E0FD 1A2CH 2J94A 1HAZB 1UK2A 4CH2B 1SQRA 3DCLA 1W0JD 2ZFRH 3UIRA 1AB9C 1CVWH 1UJ1A 3G01A 3NXPA 1AFEH 3GYMA 2ODYB 2GVFA 1O2KA 3GS9A 1SFQB 4MPUA 6CHAC 1O3LA 4X8UH 4ZMAH 3RU4T 5C1UA 1O3IA 2F9VA 5LPRA 1EASA 2ILNA 2CHAB 3Q3KA 3QTVH 1AO5A 2ZECA 3HGPA 4U32A 1AD8H 2NWNA 1OWHA 1C4V2 3UTUH 2A4OA 1KXEA 1CGHA 4AFQA 1EPTA 4J2YB 5L6NH 3O8RA 2O8WA 1O3PB 2AMPA 3LU9B 4HFPB 2XCNA 4IMZA 1FY3A 4BAKB 1MTSA 1GBMA 4Y8ZA 3MU4A 2CXVA 2FEQH 1ZMNA 3HGNA 1SHHB 2XOKD 3PTBA 1ZPZA 5JBCS 4BAHB 4Y7BA 2XNDD 3DA9B 3OSYA 2HRVA 3MU8A 2ZHFH 1TQ7B 1QJ1B 5DP3A 3TVJB 1HXEH 4FU9A 1P2NA 2XC0A 1TX7A 2FZZA 1F7ZA 3MU0A 1AE5A 1KDQA 9ESTA 2KCYA 2H5DA 4ZKNU 1COWD 2Q6FA 2AIQA 3SJIA 1O2QA 2UUYA 5B6OA 2W3KA 1AN1E 4CHAB 3LH1A 4K1TA 2A5AA 4H42U 5JB9S 3T29A 4DT4A 2JH6D 1OOKB 2BDYA 1LMWB 1DM4B 1ETSH 1ABIH 1C5XB 4HTCH 1CHGA 1BA8B 3SGAE 1GHYH 3ITIA 4CBNA 2GMTB 1G30B 1ZTJA 2WPMS 1NRNH 2QXIA 2B9LA 2DE8A 1LVOA 2BLVA 1SGFA 3D65E 2ZU3A 2PUXB 1SLWB 4NIVA 4X6OA 2Y80A 1QQ4A 8ESTE 4THNH 3RC5A 1ZRBA 1C2MA 2ANKH 4FETA 3BTKE 3GY2A 2QCYA 2PKSB 1EJAA 2BY5X 2FOGA 1TFXA 3D23A 3UREA 3A81A 2OUAA 4FVDA 1EP6A 2YNAA 1UTJA 2BOHB 3UNSA 5E8EH 5DGJA 3FANA 3PROA 4F4OC 4FU7A 5DK1A 1KIGH 4NZLA 2GT8A 4D8NA 3N7DA 1AY6H 5TCAA 1P9UA 5JB8S 3GDUA 2XTTB 1LHEH 3RXEA 1GJAB 1IQEA 3KGPA 2STAE 3KEEA 4AFUA 1Y5UT 4KTSA 4XE4A 1C9TA 2ZPRA 3JZ1B 1UTOA 2ZEBA 1H8IH 1GJDB 2QAAA 3A7WA 3TGIE 2G55A 2XC5A 1DXWA 2VB0A 2GV7A 1V2NT 4FUDA 1TMUH 3SI4H 2SNVA 3SUEA 3TK6A 5DN6D 2XBYA 1JIMA 1FY1A 1XVOA 2AYWA 1ZMJA 2B0FA 3TK9A 5TJXA 3LJOA 3RM2H 1A0HB 2FDAA 2NU1E 5CE1A 3RXKA 1HJAC 4LXBH 4UFGH 4U01A 5C2ZA 1BRAA 2ZP0H 4MLFB 1C1NA 1C5MD 2ZI2H 2K0QA 1ZMLA 3RXOA 3UAIC 4AC9A 3DSOA 3SZEA 3GISB 5AHGH 3MO3A 2ANWA 3RXUA 3PLPA 1D4PB 1D6WA 1SOZA 4K8BA 4IC6A 3MNXA 2KAIB 1ZTLA 4YESB 2BVXH 3MH6A 5LPFA 3LGIA 5EPNA 4XSKU 1GHXH 3O8BA 1GHBG 5HIYA 4I32A 1IQGA 1HIAA 2VWOA 1CSOE 1GI4A 4X8SH 3TLOA 3U8TH 4DIHH 1GVKB 2CJIA 2HLCA 1O3AA 1N8OC 1SFIA 2GD4B 5EJLA 6ESTA 2O8TA 5CHAC 1ZYOA 1AIXH 2H2ZA 2FS9A
chains in the Genus database with same CATH topology
1J14A 3SQHE 5EQSA 4FVBA 5EGMA 5EW1H 2BB4A 1L1GA 2VWLA 1PPEE 3QO6A 3CS7A 4FUBA 2ZCLP 3E16B 4WY3A 4NZQA 4K2YA 4A7IB 3P8NA 4O97A 2BD3A 3CS0A 3I29A 2C8ZB 2FOFA 1QCPA 3DFLA 1KDQB 3BG4C 1O3FA 4FUJA 5ESTE 3LH3A 3IWMA 2BDGA 2TGPZ 3U8RH 1TE0A 3ZZ4A 4TPYA 4NFFA 5AFYH 5JBBS 1W8BH 3RXDA 2QXJA 1O2VA 1EUFA 2TGDA 2ZGXH 2XWBI 5ETXA 4CRBA 3PO1B 1EP5A 1O2JA 4FU8A 2JKHA 4IGDA 2ZFSA 1GBKA 2TPIZ 4YLUA 4DOQA 1O3MA 3STIA 3W95A 1J15A 2ZPQA 1P3EA 1RJXB 1WYKA 3OX7U 4ZHMU 3ZVCA 4D7GA 5DP9A 1QB9A 1IQJA 1Y3YA 2Z3CA 1E37B 2OC7A 2G8TA 2ZDLA 1Q2WA 1TGCA 2OBQA 1QFKH 2A0QB 3SU3A 4KTCA 1EOLA 2FOHA 1UTMA 1DITH 3SV7A 2WV4A 2WUCA 1SGRE 1QRWA 2I6SA 3LGUA 1KLTA 2GT7A 5L2ZH 4B1TA 4CBOA 4TY6A 5A09A 4BOHA 2BVSH 1GHBF 1DWCH 1QRZA 2FS8A 3H7TA 2GZ8A 4GHQA 1NFXA 2ZFPH 3TGJE 1QB6A 3GCOA 1Q31A 2HWLB 3RMNH 5DP4A 3KCGH 1T4UH 5E0HA 2ZDVH 1T4VH 4IS5A 1YLDA 4ESTE 1DXPA 1C2GA 5IYTA 1RIWC 1QJ6B 2IJOB 2BYAX 1UTQA 1QRXA 2VNTA 1JWTA 1MZDA 5T6FA 4MDSA 4GUXA 4ZHAA 3OTJE 1MZAA 3RLYH 1ZJKA 2G51A 1XX9A 2ANMH 1IQFA 1Z8JB 4VGCB 1EZQA 5EODA 1BMNH 1EJMA 1HGTH 1O0DH 1DVAH 3URCA 1A1RA 5G4BA 4YT6H 3PMBB 1C5UA 1SSXA 3ZZBA 5FCKA 4BTUB 3LGWA 1BTYA 2PHBA 2VH6A 2BQWB 2VU8E 1L2EA 3NCLA 3NK8A 4YO9A 3MMGA 5EW2H 1SQTA 3AAUA 3ENSB 3QGNB 3K65B 2AIPA 3KN2A 4TY7A 1OS8A 1NRSH 1MAXA 4IN2A 1K21H 2F3CE 3RXVA 1NY22 1QJ7B 3AW0A 3GICB 4ABDA 1P12E 1Y5BT 1C5YB 1V2VT 4FUIA 2BDHA 1D9IA 1OYQA 2HNTE 2BXTH 4BXWA 4MNWA 1J17T 4AG2A 1W14U 1A46H 3MYWA 4HGCA 2Q1JA 3VFEA 1BRBE 1WAYB 3DUXH 3MH7A 3EAJA 1QBOA 1Y3WA 2FXRA 2UWOA 1QURH 1PPGE 2ZF0H 2H9TH 2BDIA 4Y0YE 3TH3H 2THFB 1YP9A 1T31A 3SV6A 1XKAC 1TNJA 5T6DA 2SGDE 3SV2H 1Z1IA 3ZVEA 3VGCB 4ABBA 1C5OH 3VB6A 1EKBB 2BOKA 3C27B 3M36A 4RKOB 1O5GH 1T8NA 1V2KT 1LKBA 3BEFB 3RXJA 2QF3A 4DJZB 1P2JA 2OP9A 2CV3A 3MO9A 3LKWA 4YTAA 1AFQC 1ELTA 8KME2 2ZCHP 1C1WH 4WXVA 1SGYE 2WYJA 1P06A 1EB1H 1Y3UA 4ASHA 2ZU1A 5LGOA 1GBAA 5L30H 2GX4A 2A4RA 1DY9A 3A8AA 2Y5FA 1JOUB 3RMOH 4GCHG 1TPAE 2DE9A 1KSNA 1KXCA 2BQ6B 4OS5A 2G00A 4AX9H 1V2OT 5FX5A 2J92A 3C1KA 3BSQA 1QL7A 4IW4E 2D2DA 1HAYB 2STBE 2V35A 1SVPA 1EAIA 1EZXC 2RCEA 3STJA 2ZZUH 4Z6AH 3A7YA 2TGAA 4MNXA 2BD8A 1MTVA 2W7SA 5DO4H 1UCYK 1T32A 7ESTE 1HNEE 2Z9GA 3M3TA 1P01A 5DKMA 1CU1A 5DP5A 1EX3A 4I8LA 2Z9IA 1ZSJA 1L0ZA 1XVMA 2BD4A 4OS1A 2GGVB 5E2PA 2A5KA 3A86A 3GDSA 3UOUA 1C5LH 3A82A 3SUDA 3SHAH 3M5OA 4KTUA 1HAPH 1MTWA 1WQSA 4ISIH 2ZFFH 1V2WT 4Y71A 2OBOA 2SFAA 3SV9A 1Y8TA 2P8OC 1WUNH 2PWXA 3E90B 2P16A 2ZHDA 1IQHA 1UVTH 2C8YB 4NA9H 4Y76A 1GI7B 2OD3B 1V2TT 1SGNE 3SJKA 3A89A 1UCYE 2AMQA 3F68H 3MH5A 1GHAF 1C5PA 1GDUA 1TB6H 1W2KH 1OWEA 2TBSA 3F9FA 4AGJA 4DURA 1CBWB 1GBIA 1SGEE 4ZKSU 2P3TB 1HPGA 1MCTA 1P11E 1AMHA 3FP7E 1AKSA 1W12U 3PYHA 4JYVH 3T2NA 4CREA 1AZ8A 3MH4A 4ABHA 2PR3A 1CO7E 1W0YH 1BTHH 2BX3A 1J8AA 1FIWA 1FONA 1RTKA 3W94A 3SOSA 4NSVA 1TX8A 1C2EA 3RXAA 1OXGA 1KTTB 2D8WA 3TJVA 2AGEX 1IHSH 1CGIE 1D3DB 1F2SE 4GCHF 2WV5A 1IQLA 1NT1A 4I8JA 2BLWA 4NCYA 2BVRH 1FJSA 1QQUA 1O3EA 2R3YA 4CRCA 1N6XA 1TBQH 1CA0B 2P3FH 5FX6A 3VB7A 1BTUA 2UUJB 4MNVA 1BTPA 2ZFTA 1FY8E 4AGKA 1RRKA 3EYDA 1GMHG 1HYLA 3SV8A 3BIUH 2V3HH 3RXQA 1ZRKA 2C93B 4H6SB 3O8DA 3UWJH 3SJ9A 2GTBA 3TH2H 1V3XA 1EZUC 3V0XA 3VB5A 3K6ZA 1K22H 1YPJH 1M9UA 1ZHPA 1AGJA 1O2MA 2ULLA 1H8DH 1SLVB 1FAKH 1MCVA 2ZFQH 1H9HE 2FI3E 1XXDA 4ISHH 3ZZ8A 4FUFA 1BJUA 1GBFA 1HAHH 2FX6A 4X1PU 2VIWA 1DX5M 4IC5A 1PFXC 2LPRA 2Z9KA 5JBTA 3F9GA 4Y8XA 1WOFA 1WTHD 1TMBH 3F6UH 4Y0ZE 1EAXA 3NPSA 4UFDH 1C1OA 5AVDA 1O35A 4ZKOU 2WPLS 2JETC 4X6NA 3P17H 1MTNC 2PKSC 5F8XA 3L6PA 1S83A 1YCPH 1LVBA 1O3JA 5E0GA 3PB1E 1S0RA 5GCHG 4A1VA 1LHGH 2HNTF 1O36A 3MU5A 3UY9A 4LOYH 3MTYA 5JPMH 2R0KA 1BTZA 3E0PB 1ID5H 4CR9A 1FLEE 2D26C 1O3NA 1O3BA 2Y7ZA 2ZPSA 3A8CA 1ANCA 5HYOA 4DW2U 2BX4A 4NIXA 2Q6GA 3LPRA 4Y8YA 1D3PB 1RGQA 3LIWA 1QTFA 2A1DB 3KQEA 2BXUH 2HGTH 3SHCH 1G36A 2P95A 1K1IA 3EA8A 3HATH 1TA6A 2QN5T 4AYYB 1A5GH 1HAVA 4UD9H 3RXRA 1HRTH 3ATMA 4NFEA 1BDAA 1SMFE 1O2NA 1S81A 1H1BA 3ZVAA 4AYVB 4R0IA 1BUIA 2OC8A 1GMHF 1HJ8A 1O3DA 1SGIB 4WWYA 1LDTT 7LPRA 1ELVA 2OC1A 5TCCA 2P3UB 2ALPA 1TGSZ 1PPBH 4UONA 1MQ6A 2C3SA 1GI8B 1S82A 2ZHEH 3B23B 4NIYA 3QZRA 4ISOA 2PV9B 3S7KB 1P02A 2C4FH 2ZHWH 1C2FA 3ZVDA 1K1JA 3SGBE 5I25A 3S69A 2A45B 3UQVA 1AKSB 3P8GA 2O9QA 3BTDE 2PUQH 1GL0E 2J95A 3ODFA 1GCTC 2VIPA 1OYTH 1AB9B 2FLRH 1GG6B 5E2OA 3M7QA 3M35A 4Y10E 6CHAB 5A8YA 4BAMB 3KHVA 1ELEE 3EE0B 3FFGA 4LZ1H 1HCGA 2W7UA 1HV7A 3Q76A 3V13A 9LPRA 1RD3B 1YLCA 2H9EH 2R2MB 1V6DA 3E3TA 1TPOA 3PLBA 2XBXA 3TJOA 1EAWA 1ZGIA 2OINA 2R0LA 3LT3A 5GJ4B 1MUEB 4DY7B 5GCHF 3RXTA 1O5AB 3HKJB 1CA8B 1C2JA 1HAGE 2XNIA 1O5BB 3OU0A 2RA3A 2Z3EA 1XKBC 1GBTA 5EXNA 4BAQB 1THRH 1C1SA 1SB1H 4Q2KA 1CGJE 1MD7A 4B71A 1GJBB 1C2LA 1GGDC 1BHXB 3ZZAA 4Q7XA 3T28A 1W7XH 1S6HA 3SNBA 1TGTA 1N1LA 3ZVBA 1DSUA 2C8XB 1VITG 3KNXA 4TYDA 2Y5HA 5HXFA 4X2YA 3HK6B 2ZDAH 1OWIA 1UVPA 4FXGH 1BBRE 2IOTA 3MU1A 1XUFA 3GCHC 2RG3A 1MU6B 3SJOA 2CMYA 3S9AA 4MQAA 1AE8H 1F5RA 5C67A 4MPWA 2NU3E 5FAHA 5FHTA 1Z6EA 2BD2A 1ABJH 1YM0A 3T5FH 1BMLA 2BY9X 4RSPA 2TGTA 2A31A 4GLYA 3BTME 3E1XB 1ELBA 4B2AA 2AFQB 1MBMA 1EPTB 2IN2A 3A7XA 1BJVA 1VGCB 4HZHA 5FPSA 3E6PH 1EAUA 2WUBA 5C5NA 2QA9E 4JZIA 2FOAA 2I6QA 1G2LA 1V2JT 3SI3H 1FMGA 3SO3A 1ZPCA 2FOEA 1B0EA 1P09A 4YLQH 4X0WU 1GDQA 3RM0H 3PWBA 1DWDH 2UUFB 3FZZA 2PGQB 3FAOA 4E7RG 2VINA 1YF4A 3VEQB 1GBJA 4E7NA 4IN1A 3QWCH 2FX4A 1ZR0A 1VJ9U 3ZVFA 2ZNKH 4ABFA 3ZZ7A 1SC8U 1FPHH 3ATLA 8LPRA 3ZVGA 1P2OA 3R3GB 2EEKA 3SBKA 2BZAA 1O2ZA 4ZXYH 3GY5A 3RXSA 1YPMH 3RXLA 1WBGB 2GCTC 5JDUB 2VVVA 4SGBE 1VITF 1UHBA 1H9IE 3RXFA 1O2OA 3A88A 3V7TA 5C1XA 1EXFA 2PKAA 3U1JB 4GPGA 3LDXH 1V2RT 1ZJDA 1O3OA 3SUGA 1BMMH 5HMAA 1SGQE 1O5DH 4UFFH 1K1PA 2FPZA 1QNJA 5DP6A 2ZA5A 4CR5A 4JK6A 3RLWH 4ZUHA 4DIIH 1A3BH 1AVXA 1HJAB 4R8TB 2XRCA 4WMFA 1UVSH 2TRMA 3S0NA 2FO9A 2VIQA 5F6MA 1QBNA 2Y6TA 2ANYA 1MTUA 1GVZA 3UNRA 1PQAA 3A7VA 1W3CA 1C9PA 2NU0E 3Q00A 2RDLA 4X1SU 2VWMA 1S5SA 5DP7A 1QGFA 2R3UA 4JYTA 1V2ST 2BDCA 2HNTC 4Q80A 4JZEH 4I7YH 4BTTB 2J34A 1VCQA 1MMJN 1MKXK 1UVOA 4KGAA 1LHCH 1B7XB 1Z8RA 1Z1JA 1OSSA 1AI8H 1THSH 1NRRH 1WCZA 1DFPA 1FUJA 1LKAA 2ZKSA 3RXIA 3ZZDA 2XXLA 1GWAA 5A0CA 1N8OB 4K60A 4I31A 3AVZA 1GBBA 3GOVB 2R2WU 5CHAB 4XBCA 4A5TS 4MG3A 4MPXA 3VXFH 5DPAA 1FN8A 2YOLA 1XXFA 1RS0A 4DCDA 2G4TA 5A2MH 1GDNA 1U6QA 3DD2H 1ESBA 3U98H 4I8KA 3BG4B 3R0FA 1L4DA 4XDEA 5GDSH 3PWCA 1LQEA 2J2UA 2F9BH 2A2XH 1YPHE 2ZGCA 2BZ6H 1O38A 1CT2E 1MQ5A 1V2PT 2AEIH 3U9AH 1C5RA 1G9IE 1FNIA 3SNEA 1ZOMA 3S7HB 4A1XA 1A5HA 2H1UA 2ODPA 1DS2E 2JH0D 2ZIQH 1WU1A 4ZH8A 1F0UA 1HIAB 3SQEE 4CRFA 1Q3XA 1B0FA 3ATKA 3KL6A 3M3VA 7KMEH 1Y59T 3SZNA 1J9CH 2GDDA 1C2HA 2VGCC 1O2PA 1TALA 2G81E 1BQYA 4F49A 4NA8A 1QL8A 1GJ7B 2PSXA 3ATWA 3ZZCA 1C1PA 3ESTA 1TQ0B 1XUHA 3TU7H 1P2MA 1F92A 1SGFG 4A6LA 1NTPA 1ZSKA 1MD8A 1ZHRA 4WF8A 1GHAG 3P6ZB 5F03A 1EJNA 2HALA 2JH5D 1ZLRA 5E0JA 5GIBA 2OQ5A 3RMLH 1CBWC 5GXPA 2G4UA 1DT2A 3O8CA 4I8HA 1CE5A 1JBUH 3ZV8A 4O3TA 3A85A 3SNCA 3F9HA 4WJG2 3RC4A 1S85A 1QY6A 1RIWB 3U8OH 2YNBA 4TWYA 3CENA 2WINI 1RXPA 2J4IA 3A7ZA 3B8JA 2FI5E 2GZ7A 5T6GA 4OS2A 3FZDA 1C2IA 4KP0A 3TJNA 1VR1H 3UNQA 4ABIA 1DDJA 1NPMA 1OP2A 3S9BA 4ZHLU 1O2UA 3P95A 3EGKH 2AGIX 1T8OA 4X2VA 1CA0C 1Z71A 1AZZA 1TRNA 1W11U 4RN6A 1UTLM 1FIZA 1UTNA 3BF6H 5L2YH 2BQ7B 1S0QA 1FI8A 1GPZA 4WXIA 4Y7AA 3RXBA 5BRRE 1GBLA 3JZ2B 1TPSA 3N7OA 1O2SA 1IQMA 2EI8A 4CRGA 3PV4A 2VVCA 1GJ8B 1IQIA 1GL1A 1LPGB 3GYLB 4OS4A 1G3BA 3RXGA 3SORA 1AU8A 1SOTA 5A0BA 4NWKA 2SGQE 1PPHE 4K1SA 3M7TA 1TWXB 1DOJA 1T7CA 1YBWA 5EXLA 1P03A 1GHWH 3A8DA 1GMDG 4JK5A 4HI3A 1QA0A 1ESAA 2O8MA 3TGKE 1TOCB 3SU6A 4O3UA 5BPEA 3BTHE 2QXHA 2CHAC 1C5SA 2A32A 1DWEH 2AERH 1SGPE 5H4IB 4NGAH 1KY9A 5GPIB 1YPGH 1JXPA 1PQ5A 1DY8A 3VB3A 4GSOA 1TMTH 4BNRA 1TNGA 2VIDA 5C3NA 1UTPA 1O37A 1F0SA 1CQQA 1TOMH 2GCHG 1ZTKA 3K9XB 1QHRB 2OQUA 1AFQB 1K1MA 2H5CA 1LQDB 1EATA 1AVWA 1TBZH 4ISLA 5FPYA 4MPVA 3KF2A 2XC4A 3DT0H 1P05A 1NFUA 1V2UT 2Z3DA 4GHTA 3NKKA 1F5LA 2Y82A 4NIWA 3TITA 3S9CA 1AUJA 5SGAE 3B9FH 5EG4A 2QY0B 3UWIA 1F0TA