2ZHDA

Exploring trypsin s3 pocket
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Congeneric but still distinct: how closely related trypsin ligands exhibit different thermodynamic and structural properties
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2008-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zhdA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zhdA02
1ZJDA 5AFZH 1HAXB 5C1XA 4I8HA 3ZZAA 1QFKH 3KEEA 2G81E 2ZP0H 3M35A 1MBQA 1ZRKA 2IOTA 5DK1A 1AB9B 3VXEH 3GY2A 1WCZA 1HAIH 3K65B 4BXWA 1AVGH 1TNLA 4B2CA 1HAYB 4E06H 1M9UA 1BIOA 1G3CA 4X2YA 2P3UB 5AFYH 3BEFB 3R0FA 3MMGA 4KELA 2ZHFH 1GDQA 1T8LA 4Q7YA 4KKDA 1V2TT 1WV7H 2ZHEH 2F83A 1F92A 1SVPA 1BTZA 1XUJA 1SGEE 2VB0A 4RKJB 4FUBA 2WINI 3S9CA 1C2FA 1JXPA 3RXHA 1YCPK 1HIAB 1SLUB 2GTBA 1W12U 1UVOA 5CHAB 2O8TA 5E0JA 1BZXE 1OWIA 2R0KA 4IGDA 2YOLA 1V2NT 4FU9A 1AQ7A 1RXPA 1Z7KA 1S85A 2WPIS 2Z9LA 1AVXA 1LVYA 1ZTKA 2F3CE 1GI2A 2BHGA 3VPKA 1TNHA 1FLEE 3EDXB 4AGJA 1IQEA 1HJAB 1P2NA 2OLGA 1LHCH 2SFAA 2RA3A 1T32A 1C5WB 2PGQB 1O3FA 3BTKE 1W0ZU 2GT7A 1MTNB 1ZLRA 1SGQE 2ZU3A 2OC7A 3E0PB 4GCHF 3MH5A 2UWOA 2PLXA 2ZDKA 2BX4A 1VJ9U 3A7YA 3EA9A 1GBHA 3HGNA 4Y6DA 1O3BA 4J1YA 1CA0C 2XBXA 3DT0H 2XBYA 5A2MH 4XOJA 2D8WA 2XYAA 2ODYB 2BMGB 3W95A 4K8YA 1GI1A 4XDEA 5AHGH 3OX7U 2VJ1A 1C2IA 1FY8E 5ABWA 1GCTC 4X1PU 1A46H 1J14A 1C2LA 2IJOB 5C20A 3Q3YA 2QAAA 1ZTLA 1O34A 1VCWA 1HJ8A 2XNIA 1PQ5A 1ZMLA 2O8MA 3HK3B 2WPMS 4B1TA 5FCKA 4IMQA 2QCYA 3RC4A 1GHZA 1O31A 1P03A 2FLRH 4NIWA 2C8ZB 1HAVA 1YPHC 2OC0A 3TITA 2EA3A 4H6SB 2QY0B 4Y8XA 1DSTA 1TMTH 1FNIA 1ELCA 4ZHMU 3TGJE 1CA8B 3PO1C 3VGCB 1EAUA 2GZ7A 1P10A 3P8GA 2EC9H 5EU8A 1O32A 1G9IE 2A7CA 1QRXA 4ISHH 4X6PA 2BD8A 5E2OA 1S6FA 4MNXA 3SGAE 1UTJA 1V2PT 1BHXF 1UO6A 4KP0A 3S9BA 3LH1A 3SJOA 3S69A 3GY5A 1FY1A 1BRUP 1EKBB 1FUJA 4AG1A 1Z8GA 1UCYK 4KTCA 4AB9A 2XBVA 3UQVA 1J8AA 1ORFA 3N7OA 1NRSH 1VITF 3PROA 1NTPA 1O37A 4IW4E 2OCVB 1O3AA 2FOGA 2G5VA 5A0BA 2YNAA 1AHTH 3MU8A 1AFQB 2P93A 5A8ZA 3T26A 4JZEH 1S83A 3A81A 4TWYA 2JH5D 2ZA5A 3FAOA 1HJAC 4UONA 2TRMA 4CRBA 3UNSA 3EA7A 1C1RA 3SI4H 2D1JA 4J2YB 3ODDA 2C4FH 3A86A 1P2QA 4AOQA 3PO1B 1EAXA 2UWLA 5EOKA 2AERH 2Y81A 4KGAA 1MKWK 1TWXB 6CHAC 1TE0A 1RFNA 2STBE 2C90B 2FOCA 2BXUH 1PPHE 1WSSH 4INHA 1Z1JA 1SG8B 2ZDAH 1XUHA 2I6SA 3ATLA 1FI8A 2WV4A 1NROH 1T8OA 2PTNA 2PUQH 5JBAS 1AY6H 1CT0E 4BANB 1ARCA 4AG2A 1A5IA 1WTGH 1EP5A 2M5TA 2W3KA 2A5IA 2STAE 1NY22 1PPFE 2QA9E 1IHSH 2ANMH 5B6OA 1ZYOA 2BDGA 3SUEA 2ZGCA 3LDXH 1SGNE 1OSSA 4HTCH 3QDZB 2TGAA 2FI5E 1L4ZA 2PKAA 4BAMB 3MFJA 5F03A 1BBRH 2OQ5A 2ZGXH 2Z94A 3T25A 1CA0B 1S5SA 3PTNA 1L0ZA 1ZOMA 3STIA 5DP7A 5FX6A 1O2QA 1KYNA 1TMUH 1O36A 1XVMA 2QF3A 3GY3A 1JWTA 1BRBE 1O3JA 1K21H 1IQFA 1H4WA 1NU9A 4F4OC 1D4PB 5BPEA 4X0WU 3UPEA 4XSKU 2BX3A 3RMOH 4CBNA 1V2MT 4ABBA 4UFGH 2ZHWH 3BIVH 4Y11E 1Z1IA 2OQUA 1GBKA 3CENA 5BRRE 1H1BA 4E05H 4DG4A 1DWEH 4BOHA 1D3TB 2BLOA 3SNDA 2AH4X 1PQAA 3QGNB 2TIOA 1CQQA 1GGDB 3A7XA 4ZHLU 3SZNA 1RTLA 4XFQA 2ZFFH 2QC2A 3BTME 1A7SA 2UUFB 1O2TA 1QGFA 5EPYA 1SB1H 4JZFH 1HAHH 2ZU1A 1QQ4A 1EPTB 2WPKS 4U2WA 4JMYA 1OXGA 1KLTA 1TGSZ 2R2MB 1UTKA 4GLYA 3SU4A 2ZGJA 4R0IA 1TBRH 1HAOH 3BEUA 3LT3A 3ZYDA 2Q6DA 5F8TA 2WPLS 3RXGA 4TPIZ 2ZWLH 1C1QA 3ZZ4A 3K6YA 1XMNB 2BDHA 1C5UA 2J92A 2OBOA 2ZEBA 4ISIH 1TX7A 1FN6A 3UOPA 2BDYA 1O2UA 2BZ6H 5LH8A 2J95A 3P8OA 5FHTA 1IQLA 1W3CA 3UNQA 3RU4E 4K1SA 1MMJN 1BB0B 4Y71A 2FMJA 1MBMA 2ALVA 2BLQA 1A5GH 3PMJA 1CBWB 1O2XA 4OGYA 1TNKA 2ZPQA 1VITG 1SPJA 5PTPA 3MO6A 4Y10E 3RLWH 4CRFA 3PTBA 5DP9A 2UWPA 3GISB 5EQQA 5EXNA 2RG3A 4CHAB 2W26A 2FXRA 2H9EH 1DY8A 1MQ6A 1QL7A 3ATMA 3RC6A 1G32B 2XC0A 2QXHA 2Z7FE 1GBFA 3T27A 1GJ8B 3RXMA 1AE8H 1XUKA 1OWJA 2PWXA 2GCHG 3F9FA 3SORA 1ZJKA 1HV7A 3QLPH 2PHBA 3TVJB 2R9PA 4GHQA 1O2YA 2A4OA 3A7TA 2NWNA 2R3YA 1DWCH 5EXLA 2Y6TA 1Y5BT 1PPEE 3PLBA 1YLCA 2ALPA 1BTPA 1GBAA 2B7DH 4UFFH 1ZZZA 1QA7A 3NXPA 3RXOA 3F68H 1LKAA 2VWLA 1Z8JB 4JK6A 1V3XA 1VZQH 4Z6AH 1KLJH 2GP9B 3SJIA 2GDEH 2ZFTA 1GHAG 4OS7A 4O97A 4RN6A 2BLWA 2Y82A 1IQGA 1C5ZB 1O3MA 1TIOA 4H6TA 3Q77A 2BY7X 5K0HA 1A1RA 3LGUA 3ZZCA 2LNCA 3AASA 2W7SA 1JIMA 2CGAA 1AKSA 1C5RA 3M7UA 3M5OA 1XUFA 1DUEA 3MTYA 2A5KA 3P8NA 5J4QA 3SNCA 1EJNA 1S84A 4MLFB 5FBEA 1C1SA 1ZR0A 4FUGA 1DITH 1P2KA 3QWCH 2H2ZA 2ZKSA 2PTCE 4Z0KA 3T2NA 4D9QA 2CF9H 1S82A 3QGJA 4I31A 1K1LA 5C67A 2HGTH 2A32A 2ZHQH 4DIHH 1FAXA 2BY6X 2IN2A 3V3MA 3FZDA 3KF2A 4IBLH 2Z3DA 3UY9A 1VGCB 1C5XB 2VH6A 3V7TA 1ZHPA 4X6MA 4CBOA 3LGIA 1MZAA 1O0DH 4WVPE 2O8WA 3Q76A 1X7AC 2ZNKH 1AB9C 1UTMA 3A87A 1LMWB 3KQDA 1ANBA 4GUXA 2FOEA 5L2ZH 1Z8IB 4ZUHA 2SGPE 2SNVA 2WUCA 2V35A 2FOAA 1UTPA 1ZHMA 1RJXB 4X1SU 1P06A 1GI9B 1LHFH 1GBTA 1P12E 3BN9A 3RXPA 3A8BA 4LK4A 1AVWA 1F5RA 2QXIA 4K69A 4NCYA 3SU0A 1WU1A 1CT4E 1VCPA 2J4IA 3SV6A 1QQUA 1T31A 1SR5C 1LO6A 3BSQA 3UIRA 4CREA 3FVFB 1HCGA 1GMHF 2P3FH 1AWFH 1GI5A 3LH3A 1YPJH 5EXMA 3FP6E 2VIVA 3SGQE 2ZDVH 1P04A 3GDUA 2TPIZ 1TFXA 5DP3A 1LQDB 4YLUA 5FX5A 1BTUA 1OX1A 4UFDH 1LVOA 1V2VT 2FO9A 2V0BA 1F2SE 3PM3A 2FOFA 2GZ9A 2HALA 4UEHH 4BTUB 1AU8A 1HJ9A 4FUHA 4Q7XA 4YT6H 1YPEH 1YP9A 4NG9H 1EUFA 2NU3E 4FUFA 1P2MA 4A1VA 1AD8H 1WQVH 1MD7A 4RKOB 3GCOA 3OY6U 2OTVA 3BTEE 3FP7E 1O2LA 3E0NB 2ZIQH 4WY3A 3MH7A 1GI6A 2LPRA 3SJKA 4WJG2 1E35B 4NZQA 5DKMA 3DFLA 1GBEA 1GBIA 1IQHA 2G52A 5FAHA 2VGCB 3O8BA 3URDA 1BHXB 7ESTE 4ABIA 3VXFH 3ZZ9A 3O8DA 2ULLA 1OOKB 1XXFA 1FAKH 4YO9A 2NU1E 5C5OA 1FMGA 3A82A 3TLOA 3U9AH 1GBDA 1L4DA 4SGBE 1K1NA 1NM6A 3RM0H 1GCTB 1GJ7B 1EOJA 3SHAH 2GKVE 3TGKE 1HLTH 2BYAX 1GJCB 3CS0A 3VB7A 1FY3A 3MO3A 4BXSA 1T4UH 5JYIA 4U32A 3M7QA 1EAWA 2WV5A 4AN7A 5GWZA 2ODQA 1F7ZA 5T6GA 1K28D 1NFYA 1YCPM 4Q80A 3ENSB 3LC3A 1B0FA 2Z9JA 1UVUH 2A31A 3RMMH 3STJA 3G01A 1LDTT 1QBNA 5JB9S 1DE7H 1XM1A 5T6FA 4JK5A 3GCNA 1EASA 3A7ZA 1SBWA 1RIWC 3RXQA 2EI8A 2Z9KA 3RXLA 2FDAA 3ZVFA 4ABGA 1D3PB 1SGFA 1G3EA 2CHAB 5GCHG 4AORA 2ZFSA 1C4V2 3OY5U 1ESAA 3SNBA 3QN7A 2AIQA 1DS2E 1CVWH 3T28A 1TB6H 1TX6A 3S7KB 6ESTA 1D3QB 4ZHAA 5EPNA 3K6ZA 1UTLM 3AVZA 2C3SA 1MAXA 4FUEA 2G55A 2G51A 5E0HA 2VIWA 1GI8B 2P16A 1C2EA 4H42U 4I7YH 1F0RA 1SL3A 1G3DA 4YM9A 2Z9IA 4TPYA 3BG4C 3V13A 4YTAA 3VEQB 2WYJA 4WMDA 1EP6A 2FYRA 1UHBB 3F1SB 1ZPBA 1FPHH 3PWCA 1GBLA 3EAJA 5JPMH 3MWIU 7GCHF 1K1IA 2ZFRH 4K60A 2GD4B 1YF4A 1RS0A 4TYDA 3OSYA 1O39A 1C5OH 3RDZA 2K1QA 5L2YH 1O2VA 1P01A 1BMNH 3SBKA 4D7FA 2GT8A 1C1MA 2QXGA 1EOLA 3ZZDA 1UCYH 2BY5X 2XW9A 1C5TA 3UR6A 2GX4A 4A92A 4INLA 1ZSLA 1SQTA 4IN1A 1QBVH 3U69H 1MKXH 4OS5A 3MH6A 1WQSA 1NPMA 1K2I1 5C1YA 1C1WH 1MCVA 1TA2A 4D8NA 1P57B 4HFPB 3BIUH 2DE8A 2FTLE 1O3NA 2XC5A 5FPSA 1CHOF 2HPPH 3Q3KA 4TY6A 4RSPA 4AFZA 1P05A 4XBBA 3LGTA 1KXEA 1EJAA 4JCNA 1SGRE 3M5MA 4YOJA 1N6XA 2VVCA 1K1PA 3RXUA 1P11E 1C1UH 2ZFPH 2F9NA 2EI6A 1KXAA 2F9VA 5E2PA 2QGRA 1SLXB 2Q1JA 5DP4A 1NZQH 4K1TA 1GL0E 3GOVB 3KQEA 1TBZH 1HDTH 3AAUA 3RXIA 2A4RA 5K7RA 1ESBA 1H9HE 5DG6A 1C1PA 5EG4A 2VU8E 2ANKH 4MVNA 1TOCB 1O3KA 2ZECA 7GCHG 2ZDMA 1C9PA 1TAWA 3F6UH 3SV8A 1DDJA 1BBRK 1AWHB 1W14U 3SV2H 4DJZB 2FIRH 3U1JB 5DP8A 1BCUH 1K1OA 2A5AA 4FUCA 1KTTB 1GJAB 2BQ6B 4Q7ZA 1A4WH 1O3HA 2WPHS 2V6NA 2H9HA 3RXVA 1GJBB 1YC0A 2ZCLP 1NRRH 3AW1A 3B9FH 3BG4B 1W7XH 2ZTZA 3ZZ6A 4SGAE 1Y59T 1HUTH 3ODFA 5H4IB 4D9RA 1BA8B 5G4BA 4B2BA 2FPZA 2ODPA 3KQBA 4Y76A 3B8JA 4LZ1H 4DCDA 2ZTYA 1G36A 1YCPH 1QJ6B 4YLQH 1HB0B 4JZDH 3V0XA 1G30B 1GVZA 2OC1A 4A1XA 3M3VA 3F9EA 1NT1A 1GJ5H 4MQAA 2Y7XA 4A1TA 2RCEA 1OKXA 1Y3VA 1QRWA 4TY7A 2XBWA 4NSVA 1J15A 4JYUH 1O2OA 2ZO3H 1HAPH 1P3EA 3MU5A 1Z6JH 2FLBH 1LPKB 4UFEH 1KXDA 4X2XA 1ELBA 4Q2KA 2TGDA 3MO9A 3BF6H 3URCA 3IITA 1YLDA 3BG8A 4BAHB 5FXLA 1FY5A 3EGKH 4MPUA 1ZHRA 5A8XA 2VINA 1KSNA 3SQEE 3I77A 3U8RH 1TGBA 2FZZA 3QTOH 2DE9A 3BTWE 1YPHE 1QA0A 1JIRA 2PR3A 1Y3UA 1MH0A 2AS9A 3PYHA 1CSOE 5CMXH 4FUIA 4DURA 2JKHA 4NWKA 6LPRA 2F9UA 1LVMA 1P9UA 1W11U 4ZH8A 1C2JA 1O3EA 1OP0A 5F8XA 4ZKNU 3VFEA 1YM0A 5HM9A 2SGFE 4CRAA 1C1NA 1WAYB 1BTHH 1W0YH 1SQOA 2QF0A 1JOUB 1PYTC 2R3UA 2ZZUH 1L2EA 1O2NA 1NFXA 1A3BH 5A0AE 3BV9B 1O2PA 4X2VA 1CGIE 4FU7A 4M7GA 4A5TS 2ASUB 1O5EH 2J9NA 1GDNA 2FOHA 3P70B 1TGTA 3RXSA 1PJPA 3M61U 1BDAA 3KN2A 1ANDA 4YT7H 1XUIA 1KDQB 2ZTXA 3UTUH 1SFIA 3TK6A 3Q3XA 2OD3B 4D7GA 1D9IA 2BQWB 4OGXA 5EQSA 3UFAA 1TQ0B 1HRTH 3P6ZB 2AMQA 2ZF0H 3U8OH 3PMBB 2FX4A 3E3TA 1AE5A 2ILNA 3BTFE 2G8TA 2WPJS 3U8TH 1GG6B 4A7IB 2Y5FA 3QK1A 4GVUA 1GHAF 1GGDC 1XKBC 3RP2A 3ESTA 2BTCE 5FCRA 1TLDA 3RLYH 1W13U 5J4SA 1BTWA 3HK6B 4YZUA 4ZXYH 3SJ9A 1C5YB 3W94A 1LQEA 1PPGE 1ZPCA 1PFXC 7LPRA 3AAVA 3SGBE 1ZRBA 1O2ZA 1GI7B 2BQ7B 4TWWA 1GJ9B 1UHBA 4WF8A 2A1DB 3T5FH 2A7HA 2UUJB 4MPXA 3DFJA 1E36B 2VVVA 2CHAC 1GI4A 1WYKA 1TPPA 4DOQA 5A09A 1FN8A 1EJMA 1MCTA 1TONA 1RIWB 2TBSA 1A0JA 2BY9X 9ESTA 4HZHA 1C5LH 4AFQA 1BRCE 2ZDNA 1C5QA 1TNJA 1TNIA 3ZZ8A 1GHVH 4B74A 3TJOA 1P9SA 1SLWB 3RXFA 3A8DA 1DFPA 1TGNA 2BD4A 3GCHC 5GDSH 1DWBH 4I8LA 2CN0H 2QV1A 5L30H 3PWBA 1UTNA 4CRGA 1HNEE 1C4U2 3RM2H 4O9VA 3EE0B 5GJ4B 1MZDA 1O3CA 3DUXH 4O3UA 1W2KH 3GY7A 1WUNH 3KNXA 1V2ST 2CF8H 3SHCH 1DT2A 1L1GA 2SNWA 4ISOA 2Y5GA 4MTBA 1H8IH 1KXCA 1CE5A 1TOMH 1F0TA 1ZGVA 2J2UA 1CT2E 1NRPH 1V2OT 2A2QH 1DLKB 1GHBG 3GCTG 1MTWA 1P2OA 2SGQE 4B2AA 2WUBA 2H6MA 4BNRA 2BVSH 4ABEA 1VJAU 2P8OB 1KIGH 3KHVA 3H7TA 1D3DB 3ATIA 1DSUA 2BOHB 2VWMA 2UUYA 1EPTA 1C2GA 1NS3A 2C93B 6CHAB 5JDUB 1SHHB 3UR9A 2PKSC 3SO3A 3RXCA 1FXYA 1ELVA 3FFGA 4JZIA 2B0FA 1QIXB 4ISLA 1PQ7A 2XCFA 2ANWA 2ZQ2A 4JYTA 1OWKA 3RXEA 5A0CA 3ZV8A 4CR5A 4QT8C 1O2IA 1SGDE 1PPCE 5AVDA 5LGOA 1P2JA 1O3IA 2BY8X 3D65E 1WTHD 4E7RG 3MHWU 4I32A 3DA9B 4DGJA 5C5NA 2FI3E 1K1MA 1QY6A 3SNEA 6GCHG 1EPTC 3VB4A 4CRDA 1V2QT 4KTSA 3SI3H 3H5CB 1GMHG 1MTVA 1QL9A 4Y8ZA 2FP7B 1SGTA 2ZFQH 2ESTE 3PLPA 3U98H 2B9LA 1GMDF 1DANH 1WOFA 1ZSKA 3NKKA 1AMHA 1SGFG 5HGGA 1JMOH 3ZVGA 1TRMA 4ZKSU 3D23A 3A7WA 3FP8E 3RXRA 2HVXA 3JZ2B 1GJ4H 4CRCA 3E90B 4MDSA 2A4QA 2Z3EA 1LHGH 4FVBA 8LPRA 1P0SH 1TABE 1SHYA 2FYQA 1O5DH 4CH2B 2G4TA 3GICB 1JRTA 3TNTA 4NZLA 4WH8A 2XCNA 2RDLA 3ZVCA 2G4UA 1SQAA 1GJDB 3A80A 1YPKH 4PROA 4NFFA 4X8VH 1TRNA 2QIQA 2ZI2H 1TRYA 1DICA 2R2WU 3QUMP 4NA8A 3GDVA 2BZAA 1XVOA 1V2KT 2ZU2A 1XX9A 5GPIB 2GCTC 2AYWA 5DPAA 2QXJA 3LOXA 3ZVDA 4MNYA 1NESE 1C5PA 2AMDA 2Y5HA 2YNBA 4ZAEA 3LPRA 1ELDE 3RXTA 3MU4A 1O30A 2SGEE 1RRKA 1H9IE 1BMLA 1EZXC 1GWAA 3KCGH 1TALA 1IOEA 2Y7ZA 3LIWA 1TPAE 5E8EH 2FOBA 1SC8U 4OS1A 1LHDH 3ZVBA 1BUIA 3BTDE 3F9GA 1FJSA 1VGCC 8ESTE 1HPGA 2HNTE 3R3GB 4YESB 1MU6B 4UD9H 2BDBA 4I8JA 1V2WT 3D49H 4BTIB 1LPZB 1SGIB 1O5CB 3UWJH 3SUDA 1F0SA 1DLEA 3LGWA 4DIIH 4AGKA 1A0LA 1E37B 1MKWH 1SLVB 3RU4T 3GYLB 2NU2E 3EA8A 3WY8A 2HOBA 2FS8A 1ZSJA 1EZSC 1Y8TA 3TGIE 1MTSA 2KAIA 3I78A 2V3OH 2VIOA 1XXDA 3M3SA 1GCDA 2F91A 1HYLA 2ZC9H 2FX6A 1MTNC 8GCHF 3LJJA 2Q6FA 2FWWA 4CH8B 1K22H 4D76A 3BTGE 1MD8A 1RTFB 3FANA 1NRQH 5HMAA 5DP5A 1EB1H 1RTKA 4NA7A 3RXJA 1Q2WA 1QB6A 1GHXH 1F0UA 4KTUA 1BT7A 2VH0A 4LXBH 4A6LA 5LPRA 3MOCA 1ARBA 4ZXXH 1O5BB 3HKIB 3SUFA 3SV7A 5GCHF 2CJIA 3QZRA 2WYGA 1Z71A 2ZPRA 1C1VH 3ZZ7A 5LPFA 1ESTA 2CXVA 1SOTA 1DX5M 1ELAA 3RUOA 3ZV9A 3T62A 3A8AA 1L1NA 3A83A 3GYMA 2P95A 3VB3A 1Y5AT 1N8OB 4WMFA 4X1QU 1CU1A 2F9OA 2JETC 1GJ6A 2O9QA 2XRCA 3NCLA 4IC6A 1CHGA 3DD2H 1FIWA 1TBQH 1FONA 2HNTF 2ZCHP 2XTTB 5C3NA 2C8WB 1C2HA 3F9HA 4HGCA 3U1IB 4Y0YE 5F8ZA 1KY9A 1MKXK 1J17T 3UWIA 2GV6A 1O5FH 1E38B 4ESTE 2W7UA 3HATH 1V2UT 4X8TH 2C8XB 4VGCC 1NO9H 4YOIA 4YOGA 1ELTA 4HI3A 4AFSA 3S7HB 1OP2A 3LKWA 1THSH 4LOYH 3MH4A 1EXFA 2BLVA 2BOKA 9LPRA 2A7JA 3OTJE 1P8VC 3L6PA 4O03A 2FTMA 3I29A 3RMLH 1TX8A 3NK8A 3SN8A 1TPOA 1B5GH 2W3IA 1HAVB 3IWMA 1THRH 1B7XB 2NU4E 4AYVB 5FBIA 1EB2A 1J16A 2TGTA 4E7NA 1INCA 2BD2A 1D6WA 1QJ7B 1O2KA 1FZZA 1QL8A 3NWUA 3L3TA 1HBTH 1QR3E 3TU7H 5IDKA 4BTTB 1BBRE 2W5EA 3B23B 3K9XB 1UMAH 1TA6A 2GVFA 4B73A 1AFQC 3MU1A 1K1JA 1GMDG 3NZIA 7KMEH 5F6MA 1DVAH 3CP7A 3MI4A 2Z6BD 2GZ8A 4XBCA 1IQJA 2H1UA 1O2HA 2JETB 5L6NH 3M37A 1YBWA 4U30A 2EEKA 5IYTA 2OP9A 1C2MA 1KLIH 1N1LA 2OC8A 3GCHB 1C2DA 4FUJA 5EODA 3RXDA 1AUJA 1ZMJA 4BAOB 1DOJA 3OYPA 1BJVA 1RD3B 3KIDU 4X1NU 2O8UA 3LU9B 5TCCA 1LKBA 4ZROA 3TH4H 1IHTH 2VIDA 4Y8YA 2GMTB 1GI0A 1AI8H 1UVSH 2AGIX 3RXAA 4F49A 3GY6A 4FVDA 2FOMB 4WXVA 3HKJB 1S81A 1SI5H 1AKSB 3ZZBA 1C2KA 2SGDE 5HXFA 3GDSA 1GMCG 2PKAB 3QZQA 3PMAB 1ELGA 4NSYA 5DO4H 5LPEA 4WWYA 3M3TA 1BTYA 1SMFE 2ZU5A 1OP8A 1AGJA 4ABAA 4B71A 2RA0A 2A0QB 1A5HA 4ZKOU 3QO6A 1CHOG 2P8OC 3JZ1B 1Y3WA 3HGPA 4X6OA 3TJUA 2FM2A 1H9LB 1ABJH 1EQ9A 1KXBA 1O3LA 2DUCA 1MUEB 4WMEA 3O8RA 3ZVAA 4X2WA 2P94A 3MU0A 1ZTJA 1UVPA 2BDAA 2AEIH 1K9OE 1QJ1B 3KQCA 3P95A 2J94A 3SOSA 3CS7A 1SGYE 4LZ4B 1E0FD 1GVKB 1V6DA 4X8UH 5C2ZA 2GGVB 2GCTB 3A8CA 3TH2H 4B75A 2PV9B 3RMNH 1ACBE 1W7GH 3SUGA 2F9BH 3RU4D 4AB8A 4XBDA 5JBBS 1MU8B 1FPCH 1OYTH 1AFEH 2PSXA 1C5VA 2G5NA 1OPHB 3UQOA 4ABDA 1P09A 1OWEA 1YGCH 1C1TA 1GI3A 3BEIB 1P2IA 2GMTC 3A84A 5HYOA 1VCQA 5I25A 3PMHB 1QHRB 1JRSA 1KDQA 2ANYA 3A89A 4NIYA 4MNWA 2BD7A 1SOZA 1P02A 2FESH 1BTXA 4K1EA 1PPBH 3TK9A 1GMCF 3AW0A 5T3HA 3PLKA 2XC4A 2JH6D 2J34A 4DVAU 1PYTD 4ZKRU 1FIZA 1U6QA 1EATA 5EW1H 3TH3H 5EW2H 3ELAH 4IS5A 4X6NA 8GCHG 2PSYA 4THNH 1HXEH 3QTVH 3TJVA 2A2XH 4I33A 1KXFA 1V2LT 2D2DA 1YPMH 2ZPSA 1YPLH 1GHYH 1VR1H 3MYWA 1QTFA 2GV7A 3TJNA 1O2SA 5CE1A 1XUGA 4IN2A 1PPZA 1ID5H 4JZ1A 3SQHE 1W8BH 1S0QA 3UUZA 1XKAC 1C9TA 3P8FA 4O3TA 4CHAC 2FI4E 1BOQA 2Y80A 2BM2A 1ELEE 3SW2B 1N6YA 1Y3YA 4OS4A 2OXSA 2HWLB 2BXTH 1HAGE 3VB6A 4Y79A 2Z3CA 1CBWC 3ZZ5A 1OWHA 3E6PH 2BB4A 1WBGB 2THFB 1GL1A 4NIVA 2R0LA 2FODA 1NFUA 1UVTH 1A0HB 3K2UA 2BDCA 1QBOA 3LJOA 2EI7A 2NU0E 3SU5A 2AGEX 1T8MA 1H8DH 4UE7H 3Q00A 2SGAA 1AIXH 1O3GA 1LVBA 2AFQB 3UNRA 1OS8A 3GY4A 4OS6A 3EQ0H 4BAQB 1QB1A 3SNAA 2IPHA 1J9CH 2FEQH 1EX3A 1B0EA 2ZDLA 3BTHE 2BVXH 5ESTE 1O2MA 1O3PB 2QYIA 3RXBA 3E8LA 1C5NH 4U01A 3PB1E 4GPGA 3SU2A 1TNGA 1E34B 1O38A 2O8LA 1AO5A 2VWNA 1EZUC 1P3CA 3ATWA 2AIPA 3T29A 1O35A 3S9AA 1FY4A 4DY7B 1FV9A 2PW8H 1EZQA 1TMBH 2BD3A 3EYDA 1DUAA 3L33A 4NWLA 1DPOA 1G37A 8KME2 2HRVA 5C1UA 4MPVA 1OYQA 2G00A 1ANEA 4K5ZA 3IG6B 3BTTE 1HIAA 2PGBB 1O33A 1C5MD 3PV4A 2PKSB 1O5AB 2PUXB 1BRAA 5TJXA 1ELFA 1O5GH 4K8BA 4AX9H 1LHEH 1GBJA 2P3TB 2UUKB 2P59A 1F5LA 3V12A 1QCPA 3VB5A 3C1KA 1NU7B 1GBMA 1NN6A 4AYYB 3KGPA 1LCYA 1MTUA 1V2RT 1HXFH 1MAYA 1GVLA 1BQYA 4ABJA 5T6DA 2FS9A 1UK3A 4DT7B 2HPQH 4NGAH 4DW2U 2GDDA 4AFUA 1NC6A 1UK4A 2VNTA 1GHWH 3GY8A 1SGCA 3E16B 1AZZA 3MNSA 1AUTC 1DWDH 1CO7E 1CGJE 4K2YA 1G3BA 2OUAA 1KTSB 2AMPA 4UDWH 4GCHG 2V3HH 1IQMA 1Z6EA 1IAUA 1HAZB 1VITH 1LPGB 1C1OA 4GHTA 4OS2A 3SJ8A 2I6QA 1QRZA 1T8NA 1C5SA 2BD5A 2CV3A 2VWOA 2D26C 1TGCA 2ZU4A 1DY9A 5JB8S 2XXLA 4NIXA 3LONA 2BD9A 2VVUA 5FPTA 3NPSA 1A61H 3E1XB 3ITIA 1UTQA 3M36A 1A3EH 1ETRH 5DGJA 2HNTC 3A88A 3M5NA 3UREA 4K3JA 1L1JA 2BDIA 2B8OH 4WH6A 3MNCA 1GPZA 4GAWA 3H7OA 3E91A 3TNSA 1O3OA 1IQIA 2B5TB 4ASHA 3ZZ3A 5SGAE 3NUMA 5GIBA 4ABHA 1G2LA 1Z8RA 1GG6C 4FXGH 1ANCA 1MQ5A 1JBUH 4WXIA 2AGGX 2KAIB 1QNJA 3SV9A 5EGMA 4I8KA 1LTOA 1O2JA 1TYNA 5HM2A 5TCAA 3LGVA 1BJUA 2H9TH 3SU3A 3A7VA 4MG3A 4XE4A 1GBBA 2VIQA 2VIPA 1UJ1A 3D62A 3FZZA 3P92A 5I46H 4ZMAH 3QX5H 3S0NA 1G2MA 4BAKB 1GBCA 3OU0A 4R8TB 5FPYA 2ZCKP 3ZYEA 1GDUA 5ESBA 3VGCC 1AZ8A 1IQNA 1ETSH 1T7CA 1O3DA 2ZHDA 1HFDA 1FDPA 2CMYA 2QN5T 4Y0ZE 1SSXA 2PFEA 1GHBF 1TQ7B 1HGTH 1S0RA 1T4VH 1ZMNA 3O8CA 2ZGBH 3C27B 4GSOA 3SU6A 4ABFA 2BVRH 1D6RA 3HPTB 5AF9H 5E0GA 1O2RA 1YYY1 1DXPA 4IC5A 1FQ3A 4VGCB 2XWBI 4X8SH 1YKTA 2H5CA 3BTQE 1Q3XA 1V2JT 5A8YA 1NFWA 1AN1E 1TPSA 2JH0D 1SFQB 1ZGIA 5DP6A 4CR9A 2A45B 1BITA 3ATKA 5GXPA 1UCYE 2XWAA 2TGPZ 3M5LA 4X1RU 3SU1A 1YPGH 1O2GH 2GCHF 3LC5A 1DXWA 4ISNA 1A2CH 4Y7AA 1RGQA 4NA9H 3GCTF 5ETXA 4B76A 4I8GA 2ZQ1A 5EQRA 2Z9GA 1N8OC 3ZVEA 1Q31A 4MPWA 5JBCS 1UK2A 3RC5A 4IMZA 2C8YB 4FU8A 4INKA 2Q6GA 3P17H 1ETTH 4NFEA 3DHKH 3TK5A 5JBTA 1ZPZA 1F5KU 2F9PA 1IQKA 1QURH 4MNVA 5DJ7A 2HLCA 3MNXA 2ZG0H 1BMMH 1S6HA 2OBQA 4JYVH 1PQ8A 3RXKA 1OWDA 1BMAA 2A4GA 2H5DA 1CGHA 4H4FA 1O2WA 3M7TA 1DM4B 2J38A 2OINA 2ZGHA 3A85A 1C4Y2 1NRNH 6GCHF 3KL6A 4Y7BA 1QB9A 1ABIH 2VGCC 3LGYA 4AZ2B 3TPIZ 1Y3XA 5CHAC 1EAIA 1THPB 4FUDA 1W10U 1Y5UT 3TIUA 3UOUA 3MNBA 1UTOA 1SGPE
chains in the Genus database with same CATH superfamily
1ZJDA 5AFZH 1HAXB 5C1XA 4I8HA 3ZZAA 1QFKH 3KEEA 2G81E 2ZP0H 3M35A 1MBQA 1ZRKA 2IOTA 5DK1A 1AB9B 3VXEH 4RI0A 3GY2A 1WCZA 1HAIH 3K65B 4BXWA 1AVGH 1TNLA 4B2CA 1HAYB 4E06H 1M9UA 1BIOA 1G3CA 2YMSB 4X2YA 2P3UB 5AFYH 3BEFB 3R0FA 3MMGA 4KELA 2ZHFH 1GDQA 1T8LA 4Q7YA 4KKDA 1V2TT 1WV7H 2ZHEH 2F83A 1F92A 1SVPA 3CNRA 1BTZA 1XUJA 1SGEE 2VB0A 4RKJB 4FUBA 2WINI 3S9CA 1C2FA 1JXPA 3RXHA 1YCPK 1HIAB 1SLUB 2GTBA 1W12U 1UVOA 5CHAB 2O8TA 5E0JA 1BZXE 1OWIA 2R0KA 2HLDD 4IGDA 2YOLA 1V2NT 4FU9A 3VG8A 1AQ7A 1RXPA 1Z7KA 1S85A 2WPIS 2Z9LA 1AVXA 1LVYA 1ZTKA 2F3CE 1GI2A 2BHGA 3VPKA 1TNHA 1FLEE 3EDXB 4AGJA 1IQEA 1HJAB 1P2NA 2OLGA 1LHCH 2SFAA 2RA3A 1T32A 1C5WB 2PGQB 1O3FA 3BTKE 1W0ZU 2GT7A 1MTNB 1ZLRA 1SGQE 2ZU3A 2OC7A 3E0PB 4GCHF 3MH5A 2UWOA 2PLXA 2ZDKA 2BX4A 1VJ9U 3A7YA 3EA9A 1GBHA 3HGNA 4Y6DA 4XD7D 1O3BA 4J1YA 2WSSD 1CA0C 4F48B 2XBXA 3DT0H 2XBYA 5A2MH 4XOJA 2D8WA 2XYAA 2ODYB 2BMGB 3W95A 4K8YA 1GI1A 4XDEA 5AHGH 3OX7U 2VJ1A 1C2IA 1FY8E 5ABWA 1E79D 1GCTC 1H8HD 4X1PU 1A46H 1J14A 1C2LA 2IJOB 5C20A 3Q3YA 2QAAA 1ZTLA 1O34A 1VCWA 1HJ8A 4M9FA 2XNIA 1PQ5A 1ZMLA 4F55A 1COWD 2O8MA 3HK3B 2WPMS 4B1TA 5FCKA 4IMQA 2QCYA 3RC4A 1GHZA 1O31A 1P03A 2FLRH 4NIWA 2C8ZB 1HAVA 1YPHC 2OC0A 3TITA 2EA3A 4H6SB 1SQRA 2QY0B 4Y8XA 1DSTA 1TMTH 1FNIA 1ELCA 4ZHMU 3TGJE 1CA8B 3PO1C 2KR7A 3VGCB 1EAUA 2GZ7A 1P10A 3P8GA 2EC9H 5EU8A 5B6LA 1O32A 1G9IE 2A7CA 1QRXA 4ISHH 4X6PA 2BD8A 5E2OA 1S6FA 4MNXA 3SGAE 1UTJA 1V2PT 1BHXF 1UO6A 4KP0A 3S9BA 3LH1A 3SJOA 3S69A 3GY5A 1FY1A 1BRUP 1EKBB 1FUJA 3DSPA 4AG1A 1Z8GA 1UCYK 4KTCA 4AB9A 2XBVA 3UQVA 1J8AA 1ORFA 3N7OA 5HKKD 1NRSH 4DT4A 1VITF 3PROA 1NTPA 1O37A 4IW4E 2OCVB 1O3AA 2FOGA 2G5VA 5A0BA 2YNAA 1AHTH 3MU8A 1AFQB 2P93A 5A8ZA 3T26A 4JZEH 2JDID 1S83A 3A81A 4TWYA 2JH5D 2ZA5A 3FAOA 1HJAC 4UONA 2TRMA 4CRBA 3UNSA 3EA7A 1C1RA 3SI4H 2D1JA 4J2YB 3ODDA 2C4FH 3A86A 1P2QA 4AOQA 3PO1B 1EAXA 2UWLA 5EOKA 2AERH 2Y81A 4KGAA 1MKWK 1TWXB 6CHAC 1TE0A 1RFNA 2STBE 2C90B 2FOCA 2BXUH 1PPHE 1WSSH 4INHA 1Z1JA 1SG8B 2ZDAH 1XUHA 2I6SA 3ATLA 1FI8A 1NROH 2PUQH 1T8OA 2PTNA 2WV4A 5JBAS 1AY6H 1CT0E 4BANB 1ARCA 4AG2A 1A5IA 1WTGH 1EP5A 2M5TA 3OAAD 3PRDA 2W3KA 2A5IA 2STAE 1NY22 1PPFE 2QA9E 1IHSH 2ANMH 5B6OA 1ZYOA 2BDGA 3SUEA 2YMSD 2ZGCA 3LDXH 1SGNE 1OSSA 4HTCH 3QDZB 2TGAA 2FI5E 1L4ZA 2PKAA 4BAMB 3MFJA 5F03A 1BBRH 2OQ5A 2ZGXH 2Z94A 3T25A 1CA0B 1S5SA 3PTNA 1L0ZA 1ZOMA 3STIA 5DP7A 4Q4LA 3FN8A 5FX6A 1O2QA 1KYNA 1TMUH 1O36A 1XVMA 2QF3A 3EE7A 3GY3A 1JWTA 1BRBE 1O3JA 1K21H 1IQFA 1H4WA 1NU9A 4F4OC 1D4PB 5BPEA 1MABB 4X0WU 3UPEA 4XSKU 2BX3A 3RMOH 4CBNA 1V2MT 1W0JD 4ABBA 4UFGH 2ZHWH 3BIVH 4Y11E 1Z1IA 2OQUA 1GBKA 3CENA 5BRRE 1H1BA 4E05H 4DG4A 1DWEH 4BOHA 1D3TB 2BLOA 3SNDA 2AH4X 1PQAA 3QGNB 2TIOA 1CQQA 1GGDB 3A7XA 4ZHLU 3SZNA 1RTLA 4XFQA 2ZFFH 2QC2A 3BTME 1A7SA 2UUFB 1O2TA 1QGFA 5EPYA 1SB1H 4JZFH 1HAHH 2ZU1A 1QQ4A 1EPTB 3WW7A 2WPKS 4U2WA 4JMYA 1OXGA 1KLTA 1TGSZ 2R2MB 1UTKA 4GLYA 3SU4A 2ZGJA 4R0IA 1TBRH 4YXWD 1HAOH 3BEUA 3LT3A 3ZYDA 2Q6DA 5F8TA 2WPLS 3RXGA 1KMHB 4TPIZ 2ZWLH 1C1QA 3ZZ4A 3K6YA 1XMNB 2BDHA 1C5UA 2J92A 2OBOA 2ZEBA 4ISIH 1TX7A 1FN6A 2F4LA 3UOPA 2BDYA 1O2UA 2BZ6H 4FETA 5LH8A 2J95A 3P8OA 5FHTA 1IQLA 1W3CA 3UNQA 3RU4E 4K1SA 1MMJN 1BB0B 1WDIA 4Y71A 2FMJA 1MBMA 2ALVA 2BLQA 3F0PA 1A5GH 3PMJA 1CBWB 1O2XA 4OGYA 1TNKA 2ZPQA 1VITG 1SPJA 5PTPA 5C0UA 3MO6A 4Y10E 3RLWH 4CRFA 3PTBA 5DP9A 2UWPA 3GISB 5EQQA 5EXNA 2RG3A 4CHAB 2W26A 2FXRA 2H9EH 1DY8A 1MQ6A 1NBME 1QL7A 3ATMA 3RC6A 1G32B 2XC0A 2QXHA 2Z7FE 1GBFA 3T27A 5KGOA 1GJ8B 3RXMA 1AE8H 1XUKA 1OWJA 2PWXA 2GCHG 4TSFD 3F9FA 3SORA 1ZJKA 1HV7A 3QLPH 2PHBA 2QE7D 3TVJB 2R9PA 4GHQA 1O2YA 2A4OA 3A7TA 2NWNA 4OM9A 2R3YA 5HIYA 1DWCH 5EXLA 2Y6TA 1Y5BT 1PPEE 3PLBA 1YLCA 2ALPA 3WWFA 1BTPA 1GBAA 2B7DH 4UFFH 1ZZZA 1QA7A 3N99A 3NXPA 3RXOA 3PV2A 3F68H 1LKAA 2VWLA 1Z8JB 4JK6A 1V3XA 1VZQH 4Z6AH 1KLJH 2GP9B 3SJIA 2GDEH 2ZFTA 1GHAG 4OS7A 4O97A 4RN6A 2BLWA 2Y82A 3OEED 1IQGA 1C5ZB 1O3MA 1TIOA 4H6TA 3Q77A 2BY7X 5K0HA 1A1RA 3LGUA 3ZZCA 2LNCA 3AASA 2W7SA 1JIMA 2CGAA 1AKSA 1C5RA 3M7UA 3M5OA 1XUFA 1DUEA 3MTYA 2A5KA 3P8NA 5J4QA 3SNCA 1EJNA 1S84A 4MLFB 5FBEA 1C1SA 1ZR0A 4FUGA 4Z1MD 1DITH 1P2KA 3QWCH 2H2ZA 2ZKSA 2PTCE 4Z0KA 3T2NA 4D9QA 2CF9H 1S82A 3QGJA 4I31A 1K1LA 5C67A 2HGTH 2A32A 2ZHQH 4DIHH 1FAXA 2BY6X 2IN2A 3V3MA 3FZDA 3KF2A 4IBLH 2Z3DA 3UY9A 1VGCB 1C5XB 2VH6A 3V7TA 1ZHPA 4X6MA 4CBOA 3LGIA 3F0OA 1MZAA 1O0DH 4WVPE 2O8WA 3Q76A 1X7AC 2ZNKH 1AB9C 1UTMA 3A87A 1LMWB 3KQDA 1ANBA 4GUXA 5GNDA 2FOEA 5L2ZH 1Z8IB 4ZUHA 2SGPE 2SNVA 2WUCA 2V35A 2FOAA 1UTPA 1ZHMA 1RJXB 4X1SU 1P06A 2F43B 1GI9B 1LHFH 1GBTA 1P12E 3BN9A 3RXPA 3A8BA 4LK4A 1AVWA 1F5RA 2L6OA 2QXIA 4K69A 4NCYA 3SU0A 1WU1A 1CT4E 1VCPA 2J4IA 3SV6A 5KECA 1QQUA 1T31A 5EJZA 1SR5C 1LO6A 3BSQA 3UIRA 4CREA 4XRNA 3FVFB 1HCGA 1GMHF 2P3FH 1AWFH 1GI5A 3LH3A 1YPJH 5EXMA 3FP6E 2VIVA 3SGQE 2ZDVH 1P04A 3GDUA 2TPIZ 1TFXA 3DSOA 2WHXA 5DP3A 1LQDB 4YLUA 5FX5A 1BTUA 1OX1A 3DSGA 4UFDH 1LVOA 1V2VT 2FO9A 2V0BA 3GS9A 1F2SE 3PM3A 2FOFA 2GZ9A 2HALA 4UEHH 4BTUB 1AU8A 1HJ9A 4FUHA 4Q7XA 4YT6H 5EJLA 1YPEH 1YP9A 4NG9H 1EUFA 2NU3E 4FUFA 1P2MA 4A1VA 1AD8H 1WQVH 1MD7A 4RKOB 3GCOA 2VBCA 3OY6U 2OTVA 3BTEE 3FP7E 1O2LA 3E0NB 5EJ1A 2ZIQH 4WY3A 3MH7A 1GI6A 2LPRA 3SJKA 4WJG2 1E35B 4NZQA 5DKMA 3DFLA 1GBEA 5IK2D 1GBIA 1IQHA 2G52A 5FAHA 2VGCB 3O8BA 3URDA 1BHXB 7ESTE 4ABIA 3VXFH 3ZZ9A 3O8DA 2ULLA 1OOKB 2KCYA 1XXFA 1FAKH 4YO9A 2NU1E 5C5OA 4ACBA 1FMGA 3A82A 3TLOA 3U9AH 1GBDA 1L4DA 4SGBE 1K1NA 1NM6A 3RM0H 1GCTB 1GJ7B 1EOJA 4FOUC 3SHAH 2GKVE 3TGKE 1HLTH 2BYAX 1GJCB 3CS0A 3VB7A 1FY3A 3MO3A 4BXSA 1T4UH 5JYIA 4U32A 3M7QA 1EAWA 2WV5A 4AN7A 5GWZA 2ODQA 1F7ZA 5T6GA 1K28D 1NFYA 1YCPM 4Q80A 3ENSB 3LC3A 1B0FA 2Z9JA 1UVUH 2A31A 3RMMH 3STJA 3G01A 1LDTT 1QBNA 5JB9S 3FO8D 1DE7H 1XM1A 5T6FA 4JK5A 3GCNA 1EASA 3A7ZA 1SBWA 1RIWC 3RXQA 3ZIAD 2EI8A 2Z9KA 3RXLA 2FDAA 3ZVFA 2V3MA 4ABGA 1D3PB 1SGFA 1G3EA 2CHAB 5GCHG 4AORA 2ZFSA 1C4V2 3OY5U 1ESAA 3SNBA 3QN7A 2AIQA 1DS2E 1CVWH 3T28A 1TB6H 1TX6A 3S7KB 6ESTA 1D3QB 4ZHAA 5EPNA 3K6ZA 1UTLM 3AVZA 2C3SA 1MAXA 4FUEA 2G55A 2G51A 5E0HA 1SKYE 2VIWA 1GI8B 2P16A 1C2EA 4H42U 4I7YH 1F0RA 1SL3A 1G3DA 4YM9A 2Z9IA 4TPYA 3BG4C 3V13A 4YTAA 3VEQB 2WYJA 2LP6A 4WMDA 1EP6A 2FYRA 1UHBB 3F1SB 1ZPBA 1FPHH 3PWCA 1GBLA 3EAJA 5JPMH 3MWIU 7GCHF 1K1IA 2ZFRH 4K60A 2GD4B 4P00A 1YF4A 1RS0A 4TYDA 3OSYA 1O39A 1C5OH 3RDZA 2K1QA 5L2YH 1O2VA 1P01A 1BMNH 2KFWA 3SBKA 4D7FA 2GT8A 1C1MA 2QXGA 1EOLA 3ZZDA 1UCYH 2BY5X 2XW9A 1C5TA 3UR6A 2GX4A 4A92A 4INLA 1ZSLA 1SQTA 4IN1A 1QBVH 3U69H 1MKXH 4OS5A 3AK5A 3MH6A 1WQSA 1NPMA 1K2I1 5C1YA 1K0HA 1C1WH 1MCVA 1TA2A 4D8NA 1P57B 4HFPB 3BIUH 2DE8A 2FTLE 1O3NA 2XC5A 5FPSA 1CHOF 2HPPH 3Q3KA 4TY6A 4RSPA 4AFZA 1P05A 4XBBA 3LGTA 1KXEA 1EJAA 4JCNA 1SGRE 3M5MA 4YOJA 1N6XA 2VVCA 3KYFA 1K1PA 3N7DA 3RXUA 1P11E 1C1UH 2ZFPH 2F9NA 2EI6A 1KXAA 2F9VA 5E2PA 4B6FA 2QGRA 1SLXB 2Q1JA 5DP4A 1NZQH 4K1TA 1GL0E 3GOVB 3KQEA 1TBZH 1HDTH 3AAUA 3RXIA 2A4RA 5K7RA 1ESBA 1H9HE 5DG6A 1C1PA 5EG4A 2VU8E 2ANKH 4MVNA 1TOCB 1O3KA 2ZECA 7GCHG 2ZDMA 1C9PA 1TAWA 3F6UH 3SV8A 1DDJA 1BBRK 1AWHB 1W14U 3SV2H 4DJZB 2FIRH 3U1JB 5DP8A 1BCUH 1K1OA 2A5AA 4FUCA 1KTTB 1GJAB 2BQ6B 4Q7ZA 1A4WH 1O3HA 2WPHS 2V6NA 2H9HA 3RXVA 1GJBB 1YC0A 2ZCLP 1NRRH 3AW1A 3B9FH 2L74A 1W7XH 3BG4B 2ZTZA 3ZZ6A 5F53A 4SGAE 1Y59T 1HUTH 3ODFA 5H4IB 4D9RA 1BA8B 5G4BA 4B2BA 2FPZA 2ODPA 3KQBA 4Y76A 3B8JA 4LZ1H 4DCDA 2ZTYA 1G36A 1YCPH 1QJ6B 4YLQH 1HB0B 4JZDH 3V0XA 1G30B 1GVZA 2OC1A 4A1XA 3PRBA 3M3VA 3F3BA 3F9EA 1NT1A 1GJ5H 4MQAA 2Y7XA 4A1TA 2RCEA 1OKXA 1Y3VA 1QRWA 4TY7A 2GJGA 2XBWA 1J15A 4NSVA 4JYUH 1O2OA 2ZO3H 1HAPH 1P3EA 3MU5A 1Z6JH 2FLBH 1LPKB 4UFEH 1KXDA 4X2XA 1ELBA 4Q2KA 2TGDA 3MO9A 3BF6H 3URCA 3IITA 4AC9A 1YLDA 3BG8A 4BAHB 5FXLA 1FY5A 3EGKH 4MPUA 1ZHRA 5A8XA 2VINA 1KSNA 3SQEE 3I77A 3U8RH 1TGBA 2FZZA 3QTOH 2DE9A 3BTWE 1YPHE 1QA0A 1JIRA 4ZCNA 2PR3A 1Y3UA 1MH0A 2AS9A 3PYHA 1CSOE 5CMXH 4FUIA 3MQKC 4DURA 2JKHA 4NWKA 6LPRA 2F9UA 1LVMA 1P9UA 1W11U 4ZH8A 1C2JA 1O3EA 1OP0A 5F8XA 4HG6A 4ZKNU 3VFEA 1YM0A 5HM9A 2SGFE 4CRAA 1C1NA 1WAYB 1BTHH 1W0YH 1SQOA 2QF0A 1JOUB 1PYTC 2R3UA 2ZZUH 1L2EA 1O2NA 1NFXA 1A3BH 5A0AE 3BV9B 1O2PA 4X2VA 1CGIE 4FU7A 4M7GA 4A5TS 4Q63A 2ASUB 1O5EH 2J9NA 1GDNA 2FOHA 3P70B 1TGTA 2EQNA 3RXSA 1PJPA 3M61U 2YMSC 1BDAA 3KN2A 1ANDA 4YT7H 1XUIA 1KDQB 2ZTXA 3UTUH 1SFIA 3TK6A 3Q3XA 2OD3B 5DSFA 4D7GA 1D9IA 2BQWB 4OGXA 5EQSA 3UFAA 1TQ0B 1HRTH 3P6ZB 2AMQA 2ZF0H 3U8OH 3PMBB 2FX4A 3E3TA 1AE5A 2ILNA 3BTFE 2G8TA 2WPJS 3U8TH 1GG6B 4A7IB 2Y5FA 3QK1A 4GVUA 1GHAF 1GGDC 1XKBC 3RP2A 3ESTA 2BTCE 5FCRA 1TLDA 3RLYH 1W13U 5J4SA 1BTWA 3HK6B 4YZUA 4ZXYH 3SJ9A 1C5YB 3W94A 1LQEA 1YLNA 1PPGE 1ZPCA 1PFXC 7LPRA 3AAVA 3SGBE 1ZRBA 1O2ZA 1GI7B 2BQ7B 4TWWA 1GJ9B 1UHBA 4WF8A 2A1DB 3T5FH 2A7HA 2UUJB 4MPXA 3DFJA 1E36B 2VVVA 1QZ8A 2CHAC 1GI4A 1WYKA 1TPPA 4DOQA 5A09A 1FN8A 1EJMA 1MCTA 1TONA 1RIWB 2TBSA 1A0JA 2BY9X 9ESTA 4HZHA 1C5LH 4AFQA 1BRCE 2ZDNA 1C5QA 1TNJA 1TNIA 3ZZ8A 1GHVH 4B74A 3TJOA 1P9SA 1SLWB 3RXFA 3A8DA 1DFPA 2HVYB 1TGNA 2V7QD 2BD4A 3GCHC 5GDSH 1DWBH 4I8LA 2CN0H 2QV1A 5L30H 3PWBA 1UTNA 4CRGA 1HNEE 2KM0A 1C4U2 3RM2H 4O9VA 3EE0B 5GJ4B 1MZDA 1O3CA 3DUXH 4O3UA 1H8ED 1W2KH 2KCAA 3GY7A 1WUNH 3KNXA 1V2ST 2CF8H 3SHCH 1DT2A 1L1GA 2SNWA 4ISOA 2Y5GA 4MTBA 1H8IH 1KXCA 1CE5A 1TOMH 1F0TA 1ZGVA 2J2UA 1CT2E 1NRPH 1V2OT 3OE7D 2A2QH 3DCLA 1DLKB 1GHBG 3GCTG 1MTWA 1P2OA 2SGQE 4B2AA 2WUBA 2H6MA 4BNRA 2BVSH 4ABEA 1VJAU 2P8OB 1KIGH 3KHVA 3H7TA 2W6ID 1D3DB 3F2FA 3ATIA 1DSUA 2BOHB 2JJ2D 2VWMA 2UUYA 1EPTA 1C2GA 1NS3A 2C93B 6CHAB 5JDUB 1SHHB 5CHBA 3UR9A 5HIZA 2PKSC 3SO3A 3RXCA 1FXYA 1ELVA 3FFGA 4JZIA 2B0FA 1QIXB 4ISLA 1PQ7A 2XCFA 2ANWA 2ZQ2A 4JYTA 1OWKA 3RXEA 5A0CA 3ZV8A 4CR5A 4QT8C 1O2IA 1SGDE 1PPCE 5AVDA 5LGOA 1P2JA 1O3IA 2BY8X 3D65E 1WTHD 4E7RG 3MHWU 4I32A 3DA9B 4DGJA 5C5NA 2FI3E 1K1MA 1QY6A 3SNEA 6GCHG 1EPTC 3VB4A 4CRDA 1V2QT 4KTSA 3SI3H 3H5CB 1GMHG 1MTVA 1QL9A 4Y8ZA 2FP7B 3WWBA 1SGTA 2ZFQH 2ESTE 3PLPA 3U98H 2B9LA 1GMDF 1DANH 1WOFA 1ZSKA 3NKKA 1AMHA 1SGFG 5HGGA 1JMOH 3ZVGA 1TRMA 4ZKSU 3D23A 3A7WA 3FP8E 3RXRA 2HVXA 3JZ2B 1GJ4H 4CRCA 3E90B 4MDSA 2A4QA 2Z3EA 1LHGH 4FVBA 8LPRA 1P0SH 1TABE 1SHYA 2FYQA 1O5DH 4CH2B 2G4TA 3GICB 1JRTA 3UAIC 3TNTA 2JIZD 4NZLA 4WH8A 2XCNA 2RDLA 3ZVCA 2G4UA 1SQAA 1GJDB 3A80A 1YPKH 3UB0A 4PROA 4NFFA 4X8VH 1TRNA 2QIQA 2ZI2H 1TRYA 1DICA 2R2WU 3QUMP 4NA8A 3GDVA 2BZAA 1XVOA 1V2KT 2ZU2A 1XX9A 5GPIB 2GCTC 2AYWA 5DPAA 2QXJA 3LOXA 3ZVDA 4MNYA 1NESE 1C5PA 2AMDA 2Y5HA 2YNBA 4ZAEA 3LPRA 1ELDE 3RXTA 3MU4A 1O30A 2SGEE 1RRKA 3KQ5A 1YY3A 1H9IE 1BMLA 1EZXC 1GWAA 1UW7A 3KCGH 1TALA 1IOEA 2Y7ZA 3LIWA 1TPAE 5E8EH 2FOBA 1SC8U 4OS1A 1LHDH 3ZVBA 1BUIA 3BTDE 3F9GA 1FJSA 1VGCC 8ESTE 1HPGA 2HNTE 3R3GB 4YESB 1MU6B 4UD9H 2BDBA 4I8JA 1V2WT 3D49H 4BTIB 1LPZB 1SGIB 1O5CB 3UWJH 3SUDA 1F0SA 1DLEA 5CDFE 3LGWA 4DIIH 4AGKA 3FOAA 1A0LA 1E37B 1MKWH 1SLVB 3RU4T 3GYLB 2NU2E 3EA8A 3WY8A 2HOBA 2FS8A 1ZSJA 1EZSC 1Y8TA 3TGIE 1MTSA 2KAIA 3I78A 2V3OH 2VIOA 1XXDA 3M3SA 1GCDA 2F91A 1HYLA 2ZC9H 2FX6A 1MTNC 8GCHF 3NRLA 3LJJA 2Q6FA 2FWWA 4CH8B 1K22H 4D76A 4RT0A 3BTGE 1MD8A 1RTFB 3FANA 1NRQH 5HMAA 5DP5A 1EB1H 1RTKA 4NA7A 3RXJA 1Q2WA 1QB6A 1GHXH 1F0UA 4KTUA 1BT7A 2VH0A 4LXBH 4A6LA 5LPRA 3MOCA 3W1EA 1ARBA 2KX4A 4ZXXH 5C17A 1O5BB 3HKIB 3SUFA 3SV7A 5GCHF 2CJIA 3QZRA 2WYGA 1Z71A 2ZPRA 1C1VH 3ZZ7A 5LPFA 1ESTA 2CXVA 1SOTA 1DX5M 1ELAA 3RUOA 3ZV9A 3T62A 3A8AA 1L1NA 3A83A 3GYMA 2P95A 3VB3A 1Y5AT 1N8OB 4WMFA 4I86A 4X1QU 1CU1A 2F9OA 2JETC 1GJ6A 2O9QA 2XRCA 3NCLA 4IC6A 1CHGA 3DD2H 1FIWA 1TBQH 1FONA 2HNTF 2ZCHP 2XTTB 2XNDD 5C3NA 5EIYA 2C8WB 1C2HA 3F9HA 3PV5A 4HGCA 3U1IB 2IJD1 4Y0YE 3KYGA 5F8ZA 1KY9A 1MKXK 1J17T 3UWIA 2GV6A 1O5FH 1E38B 4ESTE 2W7UA 3HATH 1V2UT 4X8TH 2C8XB 4VGCC 1NO9H 4YOIA 4YOGA 1ELTA 4HI3A 4AFSA 3S7HB 1OP2A 3LKWA 1THSH 4LOYH 3MH4A 1EXFA 2BLVA 2BOKA 9LPRA 2A7JA 3OTJE 1P8VC 3L6PA 4O03A 2FTMA 3I29A 3RMLH 1TX8A 3NK8A 3SN8A 1TPOA 1B5GH 2W3IA 1HAVB 3IWMA 1THRH 1B7XB 2NU4E 5DN6D 4AYVB 5FBIA 1EB2A 1J16A 2TGTA 4E7NA 1INCA 2BD2A 1D6WA 1QJ7B 1O2KA 1FZZA 1QL8A 3NWUA 3L3TA 1HBTH 1QR3E 3TU7H 5IDKA 4BTTB 1BBRE 2W5EA 3B23B 3K9XB 1UMAH 1TA6A 2GVFA 4B73A 1AFQC 3MU1A 1K1JA 1GMDG 3NZIA 7KMEH 5F6MA 1DVAH 3CP7A 3MI4A 1BMFD 2Z6BD 2GZ8A 4XBCA 1IQJA 2H1UA 1O2HA 2JETB 5L6NH 3M37A 1YBWA 4U30A 2EEKA 5IYTA 2OP9A 1C2MA 1KLIH 1N1LA 2OC8A 3GCHB 1C2DA 4FUJA 5EODA 3RXDA 1AUJA 1ZMJA 4BAOB 1DOJA 3OYPA 1BJVA 1RD3B 3U28C 3KIDU 4X1NU 2O8UA 1YWUA 3LU9B 5TCCA 2W6JD 1LKBA 4ZROA 3TH4H 2KCOA 2K0QA 1IHTH 2VIDA 4Y8YA 2GMTB 1GI0A 1AI8H 2XOKD 1UVSH 2AGIX 3RXAA 4F49A 3GY6A 4FVDA 2EY4C 4P02A 2FOMB 4WXVA 3HKJB 1S81A 1SI5H 1AKSB 3ZZBA 1C2KA 2SGDE 5HXFA 1NBMD 3GDSA 1GMCG 2PKAB 3QZQA 3PMAB 1ELGA 4NSYA 5DO4H 5LPEA 4WWYA 3M3TA 1BTYA 1SMFE 2ZU5A 1OP8A 1AGJA 4ABAA 4B71A 2RA0A 2A0QB 1A5HA 4ZKOU 3QO6A 1CHOG 2P8OC 3JZ1B 1Y3WA 3HGPA 4X6OA 3TJUA 2FM2A 1H9LB 1ABJH 1EQ9A 1KXBA 1O3LA 2KZ4A 2DUCA 1MUEB 1OHHD 4WMEA 3O8RA 3ZVAA 4X2WA 2P94A 3MU0A 3OTPA 1ZTJA 1UVPA 5T1VA 2BDAA 2WZQA 2AEIH 1K9OE 1QJ1B 3KQCA 3P95A 2J94A 3SOSA 3CS7A 2OK5A 1SGYE 4LZ4B 1E0FD 1GVKB 1V6DA 4X8UH 5C2ZA 2GGVB 2GCTB 3A8CA 3TH2H 4B75A 2PV9B 3RMNH 1ACBE 1W7GH 3SUGA 2F9BH 3RU4D 4AB8A 4XBDA 5JBBS 1MU8B 1FPCH 1OYTH 1AFEH 2PSXA 1C5VA 2G5NA 1OPHB 3UQOA 4ABDA 1P09A 1WXRA 1OWEA 1YGCH 1C1TA 1GI3A 3BEIB 1P2IA 2GMTC 3A84A 5HYOA 1VCQA 5I25A 3PMHB 1QHRB 1JRSA 1KDQA 2ANYA 3A89A 4NIYA 4MNWA 2BD7A 1SOZA 1P02A 2FESH 1BTXA 4K1EA 1PPBH 3TK9A 1GMCF 3AW0A 5T3HA 3PLKA 2XC4A 2JH6D 4B6EA 2J34A 4DVAU 1PYTD 4ZKRU 1FIZA 1U6QA 1EATA 5EW1H 5FL7D 3TH3H 5EW2H 3ELAH 4IS5A 4X6NA 8GCHG 2PSYA 4THNH 1HXEH 3QTVH 3TJVA 2A2XH 4I33A 1KXFA 1V2LT 2D2DA 1YPMH 2ZPSA 1YPLH 1GHYH 1VR1H 3MYWA 1QTFA 2GV7A 3TJNA 3N7EA 1O2SA 5CE1A 1XUGA 4IN2A 1PPZA 1ID5H 4JZ1A 3SQHE 1W8BH 1S0QA 3UUZA 1VKYA 1XKAC 1C9TA 3P8FA 4O3TA 4ASUD 4CHAC 2FI4E 1BOQA 2Y80A 2BM2A 1ELEE 3SW2B 1N6YA 1Y3YA 4OS4A 2OXSA 2HWLB 2BXTH 1HAGE 3VB6A 4Y79A 2Z3CA 1CBWC 3ZZ5A 1OWHA 2PP6A 3E6PH 2BB4A 1E1RD 1WBGB 2THFB 1GL1A 4NIVA 2R0LA 2FODA 1NFUA 1UVTH 1A0HB 3K2UA 2BDCA 1QBOA 3LJOA 2EI7A 2LELA 2NU0E 3SU5A 5C0TA 2AGEX 1T8MA 1H8DH 4UE7H 3Q00A 2K8IA 2SGAA 1AIXH 3OFND 1O3GA 1LVBA 2AFQB 3UNRA 1OS8A 3GY4A 4OS6A 3EQ0H 4BAQB 1QB1A 3SNAA 2WPDD 2IPHA 1J9CH 2FEQH 1EX3A 1B0EA 2ZDLA 3BTHE 2BVXH 5ESTE 1O2MA 1O3PB 2QYIA 3RXBA 3E8LA 1C5NH 4U01A 3PB1E 4GPGA 3SU2A 1TNGA 1E34B 1O38A 2O8LA 1AO5A 2VWNA 1EZUC 1P3CA 3ATWA 2AIPA 4TT3D 3T29A 1O35A 3S9AA 1FY4A 4DY7B 1FV9A 2PW8H 1EZQA 1TMBH 2BD3A 3EYDA 1DUAA 1E1QD 3L33A 4NWLA 1DPOA 1G37A 8KME2 2HRVA 5C1UA 4MPVA 1OYQA 2G00A 1ANEA 4K5ZA 3IG6B 3OEHD 3BTTE 1HIAA 2PGBB 1O33A 1C5MD 3PV4A 2PKSB 1O5AB 2PUXB 1BRAA 5TJXA 1S6LA 1ELFA 1O5GH 4K8BA 4AX9H 1LHEH 2AHME 1GBJA 2P3TB 2UUKB 2P59A 1F5LA 3V12A 1QCPA 3VB5A 3C1KA 1NU7B 1GBMA 1NN6A 4AYYB 3KGPA 1LCYA 1MTUA 1V2RT 1HXFH 1MAYA 1GVLA 1BQYA 4ABJA 5T6DA 2FS9A 1UK3A 2IPQX 4DT7B 2HPQH 4NGAH 4DW2U 2GDDA 4AFUA 2M2AA 1NC6A 1UK4A 2VNTA 1GHWH 3GY8A 1SGCA 3E16B 1AZZA 2CK3D 3MNSA 1AUTC 1DWDH 1CO7E 1CGJE 4K2YA 1G3BA 2OUAA 1KTSB 2AMPA 4UDWH 4GCHG 2V3HH 2WV9A 3SZEA 1IQMA 1Z6EA 1IAUA 1HAZB 1VITH 1LPGB 1C1OA 4GHTA 4OS2A 3SJ8A 2I6QA 1QRZA 1T8NA 1C5SA 2BD5A 2CV3A 2JJ1D 2VWOA 3SYJA 2D26C 1TGCA 2ZU4A 1DY9A 5JB8S 1FX0B 2XXLA 4NIXA 3LONA 2BD9A 2VVUA 5FPTA 3NPSA 1A61H 3E1XB 3ITIA 1UTQA 3M36A 1A3EH 1ETRH 5DGJA 2HNTC 3A88A 3M5NA 3UREA 4K3JA 1L1JA 2BDIA 2B8OH 4WH6A 3MNCA 1GPZA 2RFKC 4GAWA 3H7OA 3E91A 3TNSA 1O3OA 1IQIA 2B5TB 4ASHA 3ZZ3A 5SGAE 3NUMA 5GIBA 4ABHA 1G2LA 2J98A 1Z8RA 1GG6C 3H09A 4FXGH 1ANCA 1MQ5A 1JBUH 4WXIA 2AGGX 2KAIB 3F2HA 1QNJA 3SV9A 5EGMA 4I8KA 1LTOA 1O2JA 1TYNA 5HM2A 5TCAA 3LGVA 1W0KD 1BJUA 2H9TH 3SU3A 3A7VA 4MG3A 4XE4A 1GBBA 2VIQA 4RT1A 2VIPA 1UJ1A 2J5UA 3D62A 3FZZA 2RDEA 3P92A 5I46H 4ZMAH 3QX5H 3S0NA 1G2MA 4BAKB 1GBCA 3OU0A 4R8TB 5FPYA 2ZCKP 3ZYEA 1GDUA 5ESBA 3VGCC 1AZ8A 1IQNA 1ETSH 1T7CA 1O3DA 2ZHDA 1HFDA 1FDPA 2CMYA 2QN5T 4Y0ZE 1SSXA 2PFEA 1GHBF 1TQ7B 1HGTH 1S0RA 1T4VH 1ZMNA 3O8CA 2ZGBH 3C27B 4GSOA 3SU6A 4ABFA 2BVRH 1D6RA 3HPTB 5AF9H 5E0GA 1O2RA 1YYY1 1DXPA 5KEDA 4IC5A 1FQ3A 4VGCB 2XWBI 4X8SH 1YKTA 2H5CA 3BTQE 1Q3XA 3FKSD 1V2JT 1EFRD 5A8YA 1NFWA 1AN1E 1TPSA 2JH0D 1SFQB 1ZGIA 5DP6A 4CR9A 2A45B 1BITA 3ATKA 5GXPA 1UCYE 2XWAA 2TGPZ 2QF5A 3M5LA 4X1RU 3SU1A 1YPGH 1O2GH 2GCHF 3LC5A 1DXWA 4ISNA 1A2CH 4Y7AA 1RGQA 4NA9H 3GCTF 5ETXA 4B76A 4I8GA 2ZQ1A 3F2GA 5EQRA 2Z9GA 1N8OC 3ZVEA 1Q31A 4MPWA 5JBCS 1UK2A 3RC5A 4IMZA 2C8YB 4FU8A 2QF4A 4INKA 3P17H 2Q6GA 1ETTH 4NFEA 3DHKH 3TK5A 5JBTA 1ZPZA 1F5KU 2F9PA 1IQKA 2J97A 1QURH 2KCPA 4MNVA 5DJ7A 2HLCA 3MNXA 2ZG0H 1BMMH 1S6HA 2OBQA 4JYVH 1PQ8A 3RXKA 1OWDA 1BMAA 2A4GA 2H5DA 1CGHA 4H4FA 1O2WA 5C94A 3M7TA 1DM4B 2J98B 2J38A 2OINA 2ZGHA 3A85A 1C4Y2 1NRNH 6GCHF 3KL6A 4Y7BA 1QB9A 1ABIH 2VGCC 3LGYA 4ACAA 4AZ2B 3TPIZ 1Y3XA 5CHAC 1EAIA 1THPB 4FUDA 1W10U 1Y5UT 3TIUA 3UOUA 3MNBA 1UTOA 1SGPE
chains in the Genus database with same CATH topology
1ZJDA 5AFZH 1HAXB 5C1XA 4I8HA 3ZZAA 1QFKH 3KEEA 2G81E 2ZP0H 3M35A 1MBQA 1ZRKA 2IOTA 5DK1A 1AB9B 3VXEH 3GY2A 1WCZA 1HAIH 3K65B 4BXWA 1AVGH 1TNLA 4B2CA 1HAYB 4E06H 1M9UA 1BIOA 1G3CA 4X2YA 2P3UB 5AFYH 3BEFB 3R0FA 3MMGA 4KELA 2ZHFH 1GDQA 1T8LA 4Q7YA 4KKDA 1V2TT 1WV7H 2ZHEH 2F83A 1F92A 1SVPA 1BTZA 1XUJA 1SGEE 2VB0A 4RKJB 4FUBA 2WINI 3S9CA 1C2FA 1JXPA 3RXHA 1YCPK 1HIAB 1SLUB 2GTBA 1W12U 1UVOA 5CHAB 2O8TA 5E0JA 1BZXE 1OWIA 2R0KA 4IGDA 2YOLA 1V2NT 4FU9A 1AQ7A 1RXPA 1Z7KA 1S85A 2WPIS 2Z9LA 1AVXA 1LVYA 1ZTKA 2F3CE 1GI2A 2BHGA 3VPKA 1TNHA 1FLEE 3EDXB 4AGJA 1IQEA 1HJAB 1P2NA 2OLGA 1LHCH 2SFAA 2RA3A 1T32A 1C5WB 2PGQB 1O3FA 3BTKE 1W0ZU 2GT7A 1MTNB 1ZLRA 1SGQE 2ZU3A 2OC7A 3E0PB 4GCHF 3MH5A 2UWOA 2PLXA 2ZDKA 2BX4A 1VJ9U 3A7YA 3EA9A 1GBHA 3HGNA 4Y6DA 1O3BA 4J1YA 1CA0C 2XBXA 3DT0H 2XBYA 5A2MH 4XOJA 2D8WA 2XYAA 2ODYB 2BMGB 3W95A 4K8YA 1GI1A 4XDEA 5AHGH 3OX7U 2VJ1A 1C2IA 1FY8E 5ABWA 1GCTC 4X1PU 1A46H 1J14A 1C2LA 2IJOB 5C20A 3Q3YA 2QAAA 1ZTLA 1O34A 1VCWA 1HJ8A 2XNIA 1PQ5A 1ZMLA 2O8MA 3HK3B 2WPMS 4B1TA 5FCKA 4IMQA 2QCYA 3RC4A 1GHZA 1O31A 1P03A 2FLRH 4NIWA 2C8ZB 1HAVA 1YPHC 2OC0A 3TITA 2EA3A 4H6SB 2QY0B 4Y8XA 1DSTA 1TMTH 1FNIA 1ELCA 4ZHMU 3TGJE 1CA8B 3PO1C 3VGCB 1EAUA 2GZ7A 1P10A 3P8GA 2EC9H 5EU8A 1O32A 1G9IE 2A7CA 1QRXA 4ISHH 4X6PA 2BD8A 5E2OA 1S6FA 4MNXA 3SGAE 1UTJA 1V2PT 1BHXF 1UO6A 4KP0A 3S9BA 3LH1A 3SJOA 3S69A 3GY5A 1FY1A 1BRUP 1EKBB 1FUJA 4AG1A 1Z8GA 1UCYK 4KTCA 4AB9A 2XBVA 3UQVA 1J8AA 1ORFA 3N7OA 1NRSH 1VITF 3PROA 1NTPA 1O37A 4IW4E 2OCVB 1O3AA 2FOGA 2G5VA 5A0BA 2YNAA 1AHTH 3MU8A 1AFQB 2P93A 5A8ZA 3T26A 4JZEH 1S83A 3A81A 4TWYA 2JH5D 2ZA5A 3FAOA 1HJAC 4UONA 2TRMA 4CRBA 3UNSA 3EA7A 1C1RA 3SI4H 2D1JA 4J2YB 3ODDA 2C4FH 3A86A 1P2QA 4AOQA 3PO1B 1EAXA 2UWLA 5EOKA 2AERH 2Y81A 4KGAA 1MKWK 1TWXB 6CHAC 1TE0A 1RFNA 2STBE 2C90B 2FOCA 2BXUH 1PPHE 1WSSH 4INHA 1Z1JA 1SG8B 2ZDAH 1XUHA 2I6SA 3ATLA 1FI8A 2WV4A 1NROH 1T8OA 2PTNA 2PUQH 5JBAS 1AY6H 1CT0E 4BANB 1ARCA 4AG2A 1A5IA 1WTGH 1EP5A 2M5TA 2W3KA 2A5IA 2STAE 1NY22 1PPFE 2QA9E 1IHSH 2ANMH 5B6OA 1ZYOA 2BDGA 3SUEA 2ZGCA 3LDXH 1SGNE 1OSSA 4HTCH 3QDZB 2TGAA 2FI5E 1L4ZA 2PKAA 4BAMB 3MFJA 5F03A 1BBRH 2OQ5A 2ZGXH 2Z94A 3T25A 1CA0B 1S5SA 3PTNA 1L0ZA 1ZOMA 3STIA 5DP7A 5FX6A 1O2QA 1KYNA 1TMUH 1O36A 1XVMA 2QF3A 3GY3A 1JWTA 1BRBE 1O3JA 1K21H 1IQFA 1H4WA 1NU9A 4F4OC 1D4PB 5BPEA 4X0WU 3UPEA 4XSKU 2BX3A 3RMOH 4CBNA 1V2MT 4ABBA 4UFGH 2ZHWH 3BIVH 4Y11E 1Z1IA 2OQUA 1GBKA 3CENA 5BRRE 1H1BA 4E05H 4DG4A 1DWEH 4BOHA 1D3TB 2BLOA 3SNDA 2AH4X 1PQAA 3QGNB 2TIOA 1CQQA 1GGDB 3A7XA 4ZHLU 3SZNA 1RTLA 4XFQA 2ZFFH 2QC2A 3BTME 1A7SA 2UUFB 1O2TA 1QGFA 5EPYA 1SB1H 4JZFH 1HAHH 2ZU1A 1QQ4A 1EPTB 2WPKS 4U2WA 4JMYA 1OXGA 1KLTA 1TGSZ 2R2MB 1UTKA 4GLYA 3SU4A 2ZGJA 4R0IA 1TBRH 1HAOH 3BEUA 3LT3A 3ZYDA 2Q6DA 5F8TA 2WPLS 3RXGA 4TPIZ 2ZWLH 1C1QA 3ZZ4A 3K6YA 1XMNB 2BDHA 1C5UA 2J92A 2OBOA 2ZEBA 4ISIH 1TX7A 1FN6A 3UOPA 2BDYA 1O2UA 2BZ6H 5LH8A 2J95A 3P8OA 5FHTA 1IQLA 1W3CA 3UNQA 3RU4E 4K1SA 1MMJN 1BB0B 4Y71A 2FMJA 1MBMA 2ALVA 2BLQA 1A5GH 3PMJA 1CBWB 1O2XA 4OGYA 1TNKA 2ZPQA 1VITG 1SPJA 5PTPA 3MO6A 4Y10E 3RLWH 4CRFA 3PTBA 5DP9A 2UWPA 3GISB 5EQQA 5EXNA 2RG3A 4CHAB 2W26A 2FXRA 2H9EH 1DY8A 1MQ6A 1QL7A 3ATMA 3RC6A 1G32B 2XC0A 2QXHA 2Z7FE 1GBFA 3T27A 1GJ8B 3RXMA 1AE8H 1XUKA 1OWJA 2PWXA 2GCHG 3F9FA 3SORA 1ZJKA 1HV7A 3QLPH 2PHBA 3TVJB 2R9PA 4GHQA 1O2YA 2A4OA 3A7TA 2NWNA 2R3YA 1DWCH 5EXLA 2Y6TA 1Y5BT 1PPEE 3PLBA 1YLCA 2ALPA 1BTPA 1GBAA 2B7DH 4UFFH 1ZZZA 1QA7A 3NXPA 3RXOA 3F68H 1LKAA 2VWLA 1Z8JB 4JK6A 1V3XA 1VZQH 4Z6AH 1KLJH 2GP9B 3SJIA 2GDEH 2ZFTA 1GHAG 4OS7A 4O97A 4RN6A 2BLWA 2Y82A 1IQGA 1C5ZB 1O3MA 1TIOA 4H6TA 3Q77A 2BY7X 5K0HA 1A1RA 3LGUA 3ZZCA 2LNCA 3AASA 2W7SA 1JIMA 2CGAA 1AKSA 1C5RA 3M7UA 3M5OA 1XUFA 1DUEA 3MTYA 2A5KA 3P8NA 5J4QA 3SNCA 1EJNA 1S84A 4MLFB 5FBEA 1C1SA 1ZR0A 4FUGA 1DITH 1P2KA 3QWCH 2H2ZA 2ZKSA 2PTCE 4Z0KA 3T2NA 4D9QA 2CF9H 1S82A 3QGJA 4I31A 1K1LA 5C67A 2HGTH 2A32A 2ZHQH 4DIHH 1FAXA 2BY6X 2IN2A 3V3MA 3FZDA 3KF2A 4IBLH 2Z3DA 3UY9A 1VGCB 1C5XB 2VH6A 3V7TA 1ZHPA 4X6MA 4CBOA 3LGIA 1MZAA 1O0DH 4WVPE 2O8WA 3Q76A 1X7AC 2ZNKH 1AB9C 1UTMA 3A87A 1LMWB 3KQDA 1ANBA 4GUXA 2FOEA 5L2ZH 1Z8IB 4ZUHA 2SGPE 2SNVA 2WUCA 2V35A 2FOAA 1UTPA 1ZHMA 1RJXB 4X1SU 1P06A 1GI9B 1LHFH 1GBTA 1P12E 3BN9A 3RXPA 3A8BA 4LK4A 1AVWA 1F5RA 2QXIA 4K69A 4NCYA 3SU0A 1WU1A 1CT4E 1VCPA 2J4IA 3SV6A 1QQUA 1T31A 1SR5C 1LO6A 3BSQA 3UIRA 4CREA 3FVFB 1HCGA 1GMHF 2P3FH 1AWFH 1GI5A 3LH3A 1YPJH 5EXMA 3FP6E 2VIVA 3SGQE 2ZDVH 1P04A 3GDUA 2TPIZ 1TFXA 5DP3A 1LQDB 4YLUA 5FX5A 1BTUA 1OX1A 4UFDH 1LVOA 1V2VT 2FO9A 2V0BA 1F2SE 3PM3A 2FOFA 2GZ9A 2HALA 4UEHH 4BTUB 1AU8A 1HJ9A 4FUHA 4Q7XA 4YT6H 1YPEH 1YP9A 4NG9H 1EUFA 2NU3E 4FUFA 1P2MA 4A1VA 1AD8H 1WQVH 1MD7A 4RKOB 3GCOA 3OY6U 2OTVA 3BTEE 3FP7E 1O2LA 3E0NB 2ZIQH 4WY3A 3MH7A 1GI6A 2LPRA 3SJKA 4WJG2 1E35B 4NZQA 5DKMA 3DFLA 1GBEA 1GBIA 1IQHA 2G52A 5FAHA 2VGCB 3O8BA 3URDA 1BHXB 7ESTE 4ABIA 3VXFH 3ZZ9A 3O8DA 2ULLA 1OOKB 1XXFA 1FAKH 4YO9A 2NU1E 5C5OA 1FMGA 3A82A 3TLOA 3U9AH 1GBDA 1L4DA 4SGBE 1K1NA 1NM6A 3RM0H 1GCTB 1GJ7B 1EOJA 3SHAH 2GKVE 3TGKE 1HLTH 2BYAX 1GJCB 3CS0A 3VB7A 1FY3A 3MO3A 4BXSA 1T4UH 5JYIA 4U32A 3M7QA 1EAWA 2WV5A 4AN7A 5GWZA 2ODQA 1F7ZA 5T6GA 1K28D 1NFYA 1YCPM 4Q80A 3ENSB 3LC3A 1B0FA 2Z9JA 1UVUH 2A31A 3RMMH 3STJA 3G01A 1LDTT 1QBNA 5JB9S 1DE7H 1XM1A 5T6FA 4JK5A 3GCNA 1EASA 3A7ZA 1SBWA 1RIWC 3RXQA 2EI8A 2Z9KA 3RXLA 2FDAA 3ZVFA 4ABGA 1D3PB 1SGFA 1G3EA 2CHAB 5GCHG 4AORA 2ZFSA 1C4V2 3OY5U 1ESAA 3SNBA 3QN7A 2AIQA 1DS2E 1CVWH 3T28A 1TB6H 1TX6A 3S7KB 6ESTA 1D3QB 4ZHAA 5EPNA 3K6ZA 1UTLM 3AVZA 2C3SA 1MAXA 4FUEA 2G55A 2G51A 5E0HA 2VIWA 1GI8B 2P16A 1C2EA 4H42U 4I7YH 1F0RA 1SL3A 1G3DA 4YM9A 2Z9IA 4TPYA 3BG4C 3V13A 4YTAA 3VEQB 2WYJA 4WMDA 1EP6A 2FYRA 1UHBB 3F1SB 1ZPBA 1FPHH 3PWCA 1GBLA 3EAJA 5JPMH 3MWIU 7GCHF 1K1IA 2ZFRH 4K60A 2GD4B 1YF4A 1RS0A 4TYDA 3OSYA 1O39A 1C5OH 3RDZA 2K1QA 5L2YH 1O2VA 1P01A 1BMNH 3SBKA 4D7FA 2GT8A 1C1MA 2QXGA 1EOLA 3ZZDA 1UCYH 2BY5X 2XW9A 1C5TA 3UR6A 2GX4A 4A92A 4INLA 1ZSLA 1SQTA 4IN1A 1QBVH 3U69H 1MKXH 4OS5A 3MH6A 1WQSA 1NPMA 1K2I1 5C1YA 1C1WH 1MCVA 1TA2A 4D8NA 1P57B 4HFPB 3BIUH 2DE8A 2FTLE 1O3NA 2XC5A 5FPSA 1CHOF 2HPPH 3Q3KA 4TY6A 4RSPA 4AFZA 1P05A 4XBBA 3LGTA 1KXEA 1EJAA 4JCNA 1SGRE 3M5MA 4YOJA 1N6XA 2VVCA 1K1PA 3RXUA 1P11E 1C1UH 2ZFPH 2F9NA 2EI6A 1KXAA 2F9VA 5E2PA 2QGRA 1SLXB 2Q1JA 5DP4A 1NZQH 4K1TA 1GL0E 3GOVB 3KQEA 1TBZH 1HDTH 3AAUA 3RXIA 2A4RA 5K7RA 1ESBA 1H9HE 5DG6A 1C1PA 5EG4A 2VU8E 2ANKH 4MVNA 1TOCB 1O3KA 2ZECA 7GCHG 2ZDMA 1C9PA 1TAWA 3F6UH 3SV8A 1DDJA 1BBRK 1AWHB 1W14U 3SV2H 4DJZB 2FIRH 3U1JB 5DP8A 1BCUH 1K1OA 2A5AA 4FUCA 1KTTB 1GJAB 2BQ6B 4Q7ZA 1A4WH 1O3HA 2WPHS 2V6NA 2H9HA 3RXVA 1GJBB 1YC0A 2ZCLP 1NRRH 3AW1A 3B9FH 3BG4B 1W7XH 2ZTZA 3ZZ6A 4SGAE 1Y59T 1HUTH 3ODFA 5H4IB 4D9RA 1BA8B 5G4BA 4B2BA 2FPZA 2ODPA 3KQBA 4Y76A 3B8JA 4LZ1H 4DCDA 2ZTYA 1G36A 1YCPH 1QJ6B 4YLQH 1HB0B 4JZDH 3V0XA 1G30B 1GVZA 2OC1A 4A1XA 3M3VA 3F9EA 1NT1A 1GJ5H 4MQAA 2Y7XA 4A1TA 2RCEA 1OKXA 1Y3VA 1QRWA 4TY7A 2XBWA 4NSVA 1J15A 4JYUH 1O2OA 2ZO3H 1HAPH 1P3EA 3MU5A 1Z6JH 2FLBH 1LPKB 4UFEH 1KXDA 4X2XA 1ELBA 4Q2KA 2TGDA 3MO9A 3BF6H 3URCA 3IITA 1YLDA 3BG8A 4BAHB 5FXLA 1FY5A 3EGKH 4MPUA 1ZHRA 5A8XA 2VINA 1KSNA 3SQEE 3I77A 3U8RH 1TGBA 2FZZA 3QTOH 2DE9A 3BTWE 1YPHE 1QA0A 1JIRA 2PR3A 1Y3UA 1MH0A 2AS9A 3PYHA 1CSOE 5CMXH 4FUIA 4DURA 2JKHA 4NWKA 6LPRA 2F9UA 1LVMA 1P9UA 1W11U 4ZH8A 1C2JA 1O3EA 1OP0A 5F8XA 4ZKNU 3VFEA 1YM0A 5HM9A 2SGFE 4CRAA 1C1NA 1WAYB 1BTHH 1W0YH 1SQOA 2QF0A 1JOUB 1PYTC 2R3UA 2ZZUH 1L2EA 1O2NA 1NFXA 1A3BH 5A0AE 3BV9B 1O2PA 4X2VA 1CGIE 4FU7A 4M7GA 4A5TS 2ASUB 1O5EH 2J9NA 1GDNA 2FOHA 3P70B 1TGTA 3RXSA 1PJPA 3M61U 1BDAA 3KN2A 1ANDA 4YT7H 1XUIA 1KDQB 2ZTXA 3UTUH 1SFIA 3TK6A 3Q3XA 2OD3B 4D7GA 1D9IA 2BQWB 4OGXA 5EQSA 3UFAA 1TQ0B 1HRTH 3P6ZB 2AMQA 2ZF0H 3U8OH 3PMBB 2FX4A 3E3TA 1AE5A 2ILNA 3BTFE 2G8TA 2WPJS 3U8TH 1GG6B 4A7IB 2Y5FA 3QK1A 4GVUA 1GHAF 1GGDC 1XKBC 3RP2A 3ESTA 2BTCE 5FCRA 1TLDA 3RLYH 1W13U 5J4SA 1BTWA