2ZHDA

Exploring trypsin s3 pocket
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
publication title Congeneric but still distinct: how closely related trypsin ligands exhibit different thermodynamic and structural properties
pubmed doi rcsb
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2008-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zhdA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zhdA02
2R2MB 1A3EH 1AB9B 1LHCH 2AFQB 1BT7A 3BIVH 2ESTE 3TGJE 1NU7B 3RXCA 5HGGA 4Y7BA 1W13U 1TNHA 4YTAA 3CS7A 2BXTH 2W7UA 3TJNA 4ABBA 1HAVB 4ZMAH 2AEIH 1DSUA 3UREA 3NPSA 1O2UA 3LDXH 2D2DA 1AKSB 1RTFB 4XE4A 1SGFG 1Z8JB 3MWIU 1FJSA 2TIOA 1NFYA 1P9SA 4J2YB 1Z1IA 2CN0H 1IQEA 4TWWA 1KSNA 2STBE 2VWOA 3BEUA 4FUFA 4K8YA 1F5LA 3D65E 3GISB 3K9XB 1MQ6A 7GCHF 1O3HA 1QGFA 2G4UA 2VIDA 1FPCH 3MOCA 1C1OA 4YLUA 3LPRA 1SBWA 5JBTA 4FU8A 1PPZA 1LVBA 3BEIB 3D49H 2AMDA 3S9AA 4AFQA 1PQAA 3BTHE 1ZSJA 1O2HA 3KQCA 2GZ8A 3PMJA 4UFGH 5TCAA 1K2I1 1C5LH 4FUCA 3GCOA 1LPKB 1FAXA 4DURA 1MKXK 5C5NA 2GVFA 3KCGH 1A5GH 4YM9A 2FXRA 1GJBB 1IAUA 4XBDA 3BG4B 1HUTH 4YZUA 2BVXH 1TNJA 2WYGA 1LQDB 1DFPA 1SVPA 3KL6A 4FUHA 1O2GH 8GCHF 1UMAH 3LT3A 3QO6A 1HV7A 1QURH 2CXVA 4UFEH 5FBIA 5GPIB 1ID5H 1SOZA 3P8GA 2Y82A 2AMQA 2JKHA 2QC2A 4X6NA 1K1IA 2ZP0H 5FX6A 1GBBA 2VVCA 2Z3CA 2R0KA 3OX7U 1HGTH 1TOMH 4TY6A 1KXCA 4DCDA 3RXJA 5ETXA 4ABIA 1TABE 1DWDH 2FWWA 1DE7H 2YNAA 3F6UH 4X1QU 4VGCB 1GBKA 3DA9B 5I46H 3ODFA 1GJ4H 1P02A 1UK3A 2XXLA 2RA0A 4B73A 1UTLM 4B2AA 1F2SE 1SFIA 4IW4E 1S0RA 1H8IH 1K1NA 3STIA 3HK3B 2CHAC 5E0JA 2M5TA 1MAYA 2WPJS 1GVLA 1SFQB 1P2KA 4K1EA 3PYHA 1GMHG 1GHAF 2ALPA 2HNTF 1DANH 1GDQA 2P93A 3RXRA 1ZHMA 3SJOA 2ZDLA 3LH1A 1Z1JA 4E06H 2P3FH 4CBOA 1W14U 6CHAC 3DUXH 1F0UA 1K9OE 1O2NA 1BIOA 1GHYH 3MYWA 2SFAA 2SGEE 1VJ9U 3MH7A 5DO4H 1TBQH 3QTOH 3LJOA 3URCA 3E3TA 1O30A 4JZ1A 4K8BA 1NRSH 4INHA 2HRVA 3SNEA 4K69A 2ANMH 1OSSA 1QA0A 4X6OA 2F9UA 1A61H 1GBIA 2FYRA 4X2VA 3P70B 2G8TA 1C5YB 1MKWH 1TFXA 2PUXB 2ZU5A 4FUDA 2BLOA 1CT4E 2PKSB 4OS6A 4X1RU 1HAYB 1S5SA 3M36A 4NIVA 1BZXE 1CA0B 1BBRK 5GIBA 2NU2E 1GVZA 5E2OA 2WV4A 4I7YH 1YPHC 3F9GA 3MH6A 2G55A 1ZSLA 5HXFA 4MNYA 1NTPA 3OU0A 1OXGA 1FUJA 5AF9H 4PROA 3VB4A 1K1PA 1MMJN 1ZPCA 1K22H 4I8LA 3NZIA 1SQAA 3FAOA 4ZROA 1T32A 4GCHG 1P10A 1ZMLA 3DHKH 1NZQH 2DUCA 3I29A 1K1OA 1P9UA 2XW9A 1NROH 2BQ7B 3VGCB 1XM1A 1AGJA 1WBGB 1EAUA 3UOPA 1HFDA 2C8XB 3SHCH 1P2MA 5DK1A 2HGTH 1OKXA 2Y5GA 1GMCF 1O5DH 2BZ6H 4BAOB 2B5TB 4TWYA 1QNJA 2QF3A 2XWBI 5FX5A 2Y80A 1AVWA 4MNVA 4ABDA 3SQHE 2GDEH 1C5PA 1SOTA 1JIMA 1AZ8A 1Q31A 3V3MA 1GPZA 3FZDA 1XMNB 1Y3VA 2BD4A 2D8WA 2I6SA 3A7TA 1GBFA 1O2SA 1ESBA 3LGVA 4CHAB 3VB6A 2W3IA 4ZXYH 1GHBG 2BD3A 2P3UB 4Y8XA 1GCTB 3ZZ6A 4IMZA 4Y8YA 3GY8A 2A45B 1C2GA 1HAIH 3LGUA 2FODA 4WMEA 1GI5A 4MVNA 1WQSA 1L1JA 3SJIA 3UIRA 1BHXB 3KNXA 1W7GH 4YT7H 3SQEE 5FCRA 2G00A 5IDKA 1TIOA 1WCZA 2ZTXA 2C8YB 2FS9A 3UNSA 1VCWA 6GCHF 1CO7E 4Y10E 1T8LA 4TPIZ 1EB2A 1DY8A 4H42U 4UFDH 1XVMA 3V7TA 1O3KA 4I8HA 1JOUB 5JYIA 1S84A 2A7CA 2FX4A 1SMFE 5I25A 3S0NA 3OTJE 2VWMA 1EX3A 3TK9A 2PGQB 2ZFTA 4Y79A 2G52A 3NK8A 1SGEE 1C1UH 2ZDNA 3F9FA 1HAGE 4YT6H 1FN6A 1OWDA 2BX3A 1O5EH 4LK4A 2ZCLP 1Z8IB 1NT1A 3NCLA 4INKA 1QHRB 1TNIA 1FIZA 1G2LA 4NWLA 2RA3A 1GGDC 1WU1A 1TPSA 6LPRA 1C1NA 2NU1E 4OGXA 2XC4A 3NXPA 3VXEH 3HATH 3C27B 1C1VH 1BQYA 2ZHWH 1GI1A 3A7VA 1DUAA 4ISNA 3RM2H 3TPIZ 1UVUH 1ZPBA 2FOGA 1SGQE 1MAXA 4JZIA 2C93B 2PHBA 1C9PA 1D3DB 1ZMNA 4AFSA 1CQQA 1G9IE 1K1MA 1GI9B 1S0QA 1KXEA 1HIAB 3RXGA 3SNCA 3SU1A 1D3TB 1ARBA 2P59A 2F83A 3DT0H 4B2BA 3MNXA 1V2JT 3RC6A 1P8VC 1UVSH 5SGAE 1LHGH 1XXDA 1S82A 2VIWA 4XOJA 1YCPH 1YLDA 2ILNA 4KP0A 1LMWB 3SV9A 1YLCA 3F9HA 1Y5BT 1PYTD 9LPRA 3Q00A 1Y3UA 3U1IB 1CT2E 2BDHA 5ABWA 3QGJA 1QBVH 4Q7XA 2ALVA 2FOEA 4LXBH 1BA8B 1BMAA 1HAHH 1F7ZA 1ELAA 4MTBA 1HAPH 1TMUH 3A80A 1BJVA 3M37A 2XBYA 3SUFA 1VCPA 2ZEBA 2ZCKP 1GL0E 1O38A 5CHAC 2J2UA 3EDXB 3U8TH 1SB1H 2GCTB 3QLPH 1EKBB 2QY0B 1HJAB 4DIIH 1CGJE 2PW8H 2WPKS 3TU7H 1GVKB 1XXFA 1C5WB 2WINI 1YGCH 2ZU2A 1D3QB 4QT8C 5ESTE 1PQ5A 5GCHG 1IHTH 2BZAA 2B9LA 3GICB 1CHGA 1P09A 1E35B 2ZGXH 2OTVA 1IQLA 2OQUA 3PTBA 4BXSA 1GHXH 1D6RA 4U30A 3SU3A 4BTTB 1O37A 2R3UA 2BDIA 1C5NH 2AGIX 1Y8TA 2F9NA 2VGCC 2FI3E 2BLWA 2P16A 5HM2A 1BHXF 2XWAA 1Y59T 3RXAA 1Z71A 3TJUA 1Z7KA 4BOHA 1EB1H 2VIPA 3PROA 4MNWA 2CF9H 1C4V2 3NWUA 2Y81A 3EE0B 1EXFA 1J8AA 1WTGH 2ZGJA 3BTFE 3LC5A 3VB3A 1GI0A 1UTKA 8KME2 1EOJA 3A86A 1J14A 1C4U2 1QBNA 2JETC 1P03A 1LVOA 3GYLB 4U2WA 4NZQA 2A2XH 1OP8A 4OS7A 3KGPA 2F9BH 2V3OH 1TX6A 1AUTC 5TJXA 3BF6H 4O3UA 4NSVA 1CT0E 1THSH 3SOSA 2Y7XA 4IBLH 5E2PA 2ZC9H 5DP9A 4CH8B 1AE5A 1DX5M 3H7OA 2SGPE 4R0IA 1O5GH 4ZKRU 1OYQA 3DFJA 2D26C 1WTHD 4WH8A 5JBAS 3HPTB 2R2WU 3NKKA 1WYKA 1DPOA 1VR1H 4A1TA 4CRAA 1TALA 2ZFQH 1ELBA 1JMOH 2ZU4A 2AGGX 4O97A 1P2IA 2VVVA 3ZVGA 1NFUA 3RXQA 3BG8A 3O8BA 4Z6AH 3NUMA 3MO3A 1P2QA 2H1UA 1V2ST 1A0HB 4YOIA 1G3BA 2ZKSA 2A4RA 1O5AB 1HB0B 3E91A 4SGAE 3ZZ4A 3RMMH 5FHTA 4ASHA 4FVBA 3SZNA 2ZTZA 3A84A 1TAWA 4Y11E 3W95A 2ZHFH 2ZCHP 2Q6DA 3A8DA 3MHWU 4X2XA 3BTME 1TE0A 1O35A 4INLA 3U69H 1C5QA 1QB6A 2C3SA 3HKIB 2ZFRH 3HKJB 2G5VA 1BMLA 2LPRA 1ESTA 1O3JA 1V2UT 4NSYA 4H6TA 1NESE 4UE7H 3P92A 4DT7B 1GBLA 2A7JA 3VB7A 1O2YA 2CJIA 1EPTC 2Q6FA 2FM2A 3LOXA 1A0JA 1HAVA 2FP7B 3A7YA 2ZHQH 4THNH 1EUFA 1YP9A 2FOFA 3TK6A 4A1VA 1D6WA 1V2OT 1U6QA 2ZDAH 3E6PH 1A46H 2FX6A 1TRNA 1N6YA 1GJAB 1TQ0B 3SUGA 4OS5A 5DP5A 3A89A 5A8ZA 1O3LA 5A0AE 4LOYH 1HJ8A 4JMYA 4BAHB 2P95A 4BAMB 1C5SA 5A2MH 2Z7FE 1YPMH 1OWKA 5GXPA 5LPEA 5C1UA 3MU5A 4KTCA 1TMBH 4I33A 3FFGA 2VWLA 1N8OC 3G01A 1ELCA 3M5NA 4WJG2 3PWBA 2FDAA 1SC8U 3IITA 2OLGA 1UTPA 4AYVB 1JBUH 2RCEA 1P3EA 1KXDA 1INCA 4WMDA 1H1BA 2B7DH 1LHFH 3FP7E 3OY5U 2QIQA 1AUJA 1ELTA 5PTPA 3SU4A 2HNTC 1AHTH 2NU4E 1LPZB 4JK5A 4UDWH 2TPIZ 1BCUH 2J34A 3UNRA 1BB0B 4Y0YE 3WY8A 2GGVB 3VXFH 2TGTA 4NIWA 2NU3E 1V2WT 1CSOE 1EASA 1C5ZB 2VVUA 4H6SB 1DM4B 5C5OA 1SLXB 2VINA 2J94A 2FLBH 1SLVB 3AASA 1VITH 1O2ZA 3MH4A 7GCHG 1P2NA 3UFAA 3GYMA 3ZYDA 1QCPA 3P17H 3GY6A 2FESH 3OY6U 2ZGCA 4IS5A 1BRBE 2PFEA 3MTYA 1OOKB 4WH6A 4UONA 1EQ9A 5DJ7A 1SGDE 2QN5T 3LKWA 1OYTH 1IQFA 2BOHB 1XX9A 2A5AA 3UPEA 2CGAA 1NRQH 3V12A 1HCGA 2ZDVH 3GDVA 1CVWH 4X6PA 1NN6A 2VH6A 1BDAA 3C1KA 2BHGA 1IQNA 3KIDU 3RXTA 8GCHG 4BTUB 4YOJA 1ZTLA 2J4IA 1Z8GA 2J38A 1O34A 3B9FH 1XKBC 1GMDF 6CHAB 4BXWA 1C5MD 1TMTH 4CH2B 1RTLA 3QUMP 4AOQA 5K0HA 1TOCB 3ZV9A 1QB9A 3LGWA 3SNBA 2QXGA 3BTTE 1OWIA 3UR6A 3U9AH 1WSSH 1ACBE 3MH5A 1V2KT 3M3SA 4CBNA 1C1MA 1ETRH 1G37A 5L2YH 3BTGE 3UR9A 2UUFB 4MPXA 2PSXA 1V6DA 2FOBA 3BG4C 1NM6A 1P0SH 2HNTE 3STJA 4ZH8A 5F8ZA 1NRNH 2QXIA 2EA3A 1GCDA 1X7AC 1XUHA 5FPSA 4DG4A 3E16B 1PPFE 4NGAH 1GG6C 1GI2A 2Z6BD 1UK2A 4WY3A 3M3VA 2O8TA 3P8FA 1G3DA 2V6NA 1XUGA 3KN2A 2VU8E 4BAKB 1AMHA 1WOFA 2WPHS 2B0FA 5C3NA 1GHAG 2XBXA 3GY7A 1GJDB 1A5IA 1LO6A 1P57B 3LC3A 2HLCA 3O8CA 2LNCA 4FU9A 2Y6TA 3LIWA 3UQOA 1NU9A 2GCHF 5F8TA 5C20A 1WQVH 4TPYA 2IN2A 4GHQA 4ZAEA 3SI4H 4CRBA 2ZHDA 1Z8RA 2Z9LA 1Y5UT 2TRMA 4M7GA 3SUEA 4AORA 1W7XH 3MNSA 4B76A 4ZHLU 1BRUP 1O32A 4UD9H 2BLQA 1O33A 2XC0A 1W0YH 4X1PU 5GDSH 2CMYA 1PPBH 3SJ8A 3F1SB 1H9IE 3V13A 2XCFA 1YPEH 4NA8A 3GY2A 4AFZA 1AY6H 5EXMA 5C1YA 1Z6JH 3RU4D 2JH0D 1C2LA 4SGBE 2F9PA 2ZECA 3UQVA 3SW2B 4GAWA 4H4FA 2A7HA 2AH4X 3P6ZB 1LDTT 1GDUA 1EOLA 1DVAH 2FI4E 2JH5D 4B74A 2F9OA 3A82A 2ODPA 3PO1C 2BDGA 2VIVA 2VIQA 3B8JA 4F49A 4CRCA 1QRZA 2UWLA 4J1YA 4RKOB 3RXKA 1QL8A 5DPAA 1SHHB 3RU4E 2WPIS 4A7IB 2Q1JA 2XRCA 4FUEA 1BBRE 1FZZA 2ZPRA 1MTNC 1B5GH 3T26A 1GBHA 2UUKB 2G4TA 1G3CA 1SQOA 1LHEH 4GLYA 4X2WA 1KLJH 1SGTA 1TA6A 3FP8E 2QXJA 2EI8A 1RS0A 4E7RG 1H9HE 3KEEA 1MBMA 5EQQA 1HNEE 3PLKA 1FY1A 1P05A 2K1QA 1GMCG 2PKSC 5BPEA 1W11U 5FXLA 4I32A 5J4QA 5L6NH 3TLOA 5EW1H 1IQMA 3F9EA 1CBWB 5DP6A 1NFWA 1QIXB 2CF8H 1J16A 1J17T 3EA8A 2W26A 2ZFSA 5DGJA 1UCYH 3SNAA 5DP8A 1T8OA 1VITF 2ZGBH 3QK1A 4NG9H 2D1JA 1ZGVA 1L1GA 1J9CH 1V2LT 4IN1A 2GX4A 1FI8A 3VGCC 1ABIH 1NFXA 4NA7A 1BMNH 1CHOF 1BRAA 1ZOMA 3AAVA 4DW2U 1YPKH 1PYTC 3ATLA 3BTWE 1HIAA 1MQ5A 1PPGE 2J95A 4ABJA 3M35A 2QF0A 6GCHG 3MU4A 1FY3A 1MCVA 1MZAA 3F68H 1ESAA 1O2OA 1ZLRA 3PTNA 1DITH 1FIWA 5A0BA 1OX1A 1BTWA 1GDNA 1S83A 3SJKA 2UWOA 9ESTA 3SV6A 3E1XB 3SU5A 4CHAC 3QWCH 2WPMS 4JZFH 1UVTH 3M5OA 2ZDMA 1IOEA 1GCTC 2HALA 2VNTA 4OS4A 3T29A 2FOCA 2DE9A 3SU6A 3IWMA 2WV5A 2Y5HA 3A7WA 5T3HA 5FCKA 1AIXH 2R9PA 1GL1A 2EC9H 2B8OH 1MKWK 1V2NT 2O8LA 2Q6GA 1C5UA 3A7XA 1VZQH 4X1SU 2ZO3H 1V2PT 1NC6A 2BY5X 3B23B 1GBAA 1IQJA 2AERH 1T8NA 3N7OA 3SU2A 2OP9A 3RC5A 4D7GA 4I8KA 1DICA 3BTDE 4F4OC 1P3CA 3RM0H 1C2HA 1DLEA 1PPEE 1O2LA 1TPPA 1PPCE 4AGJA 1AFQC 1ZTJA 5T6DA 1QFKH 2OC0A 5AFZH 3A7ZA 4X1NU 1FNIA 2FOMB 1EZSC 3HGNA 1TPOA 4DVAU 3FANA 1WUNH 3P8OA 1PJPA 4ZKNU 3RXVA 3M5LA 1MTUA 1RJXB 4BNRA 4I8GA 5FAHA 2XYAA 2J92A 4NA9H 1LVMA 4IN2A 1K21H 5GWZA 1FY4A 1QL9A 4MPUA 2OC8A 3FP6E 1GHZA 1AD8H 1OWHA 1SSXA 2OUAA 2UUJB 2VGCB 3QX5H 4NIYA 4D76A 2FOHA 2C4FH 1BITA 1UTJA 3U98H 1XUJA 2IPHA 1O2WA 1YKTA 1JIRA 2BD9A 1ANDA 1TONA 3EAJA 1AI8H 1SGFA 3EQ0H 2H6MA 5HMAA 3M7UA 1W12U 3MU1A 1NPMA 2DE8A 4JCNA 1ARCA 1FXYA 3TK5A 1DY9A 3BTKE 5L30H 1HJ9A 5LGOA 1C2KA 4ZKOU 1AN1E 3GCNA 1VGCC 1PPHE 2AIPA 4XSKU 4E7NA 1N6XA 4HGCA 2SNVA 4Y0ZE 1EAXA 1QBOA 1IQIA 2FOAA 3K6YA 5AVDA 3AW0A 1BTUA 3GCHB 1CU1A 2UWPA 3M7TA 2GD4B 4ABGA 2ZFPH 2NU0E 3R3GB 1AVGH 2ZQ2A 1V2TT 1W10U 2PGBB 4ZHAA 2Z9GA 2BD8A 3MU8A 1C5OH 4CRGA 1HJAC 2Z9JA 2BX4A 5E0HA 3HGPA 4U01A 5TCCA 1O3BA 2O8UA 5FPYA 1ELVA 1BRCE 3BTEE 1TX8A 4DIHH 3QN7A 1TBZH 1EPTA 2J9NA 4K60A 1A2CH 4AX9H 1ZJKA 4OS2A 1TRMA 4TYDA 1A1RA 3A83A 2QGRA 2FO9A 1LHDH 3O8RA 1GJCB 4KTUA 2BD2A 3VPKA 3ZZ8A 3SU0A 2TGPZ 2HWLB 1MTWA 1O31A 4CREA 3LGIA 1MKXH 1HAXB 4A6LA 1V2MT 2GT8A 1SLWB 1BTXA 1KXBA 5A0CA 2BYAX 6ESTA 1HXFH 3ATMA 3OYPA 1BTHH 3MNBA 5JPMH 1O3DA 3RXHA 3T25A 3MMGA 1RD3B 1ZJDA 1EPTB 1KIGH 1AE8H 1VCQA 2A4GA 5DG6A 3RXDA 4AFUA 1S85A 2GT7A 1TYNA 1LTOA 3VB5A 1KY9A 5LH8A 2TGAA 4B1TA 2P3TB 1C5TA 1YCPK 7ESTE 2ULLA 5T6GA 1BJUA 1DDJA 1C5VA 1QR3E 3I77A 1W8BH 1O3MA 2GMTC 2Z9KA 3FVFB 4NFFA 5JBBS 1O3FA 1T31A 3TH2H 3ZVCA 3PWCA 2F91A 1EJAA 2ZU3A 1TGCA 1ANEA 3TVJB 2ZNKH 4FUJA 3ATKA 1O2KA 4D8NA 2Y7ZA 5F8XA 2XTTB 1CGIE 1RIWC 1UVOA 3A81A 4D9RA 1ELGA 1H8DH 3TIUA 4WXVA 3BIUH 2OD3B 1C1WH 1F5RA 2BQWB 1FONA 1Y3WA 1TWXB 1T4VH 3GCTF 1N8OB 1ETSH 1DWEH 3SV2H 4D9QA 1TNLA 2ODYB 1C1RA 5G4BA 1DT2A 3GDSA 2A31A 3OSYA 4WWYA 2WYJA 1MCTA 1EJNA 1MU8B 5E8EH 4DGJA 1FAKH 1EATA 1GI4A 3RXOA 1SL3A 3Q3YA 2Z3DA 4RSPA 4ZHMU 5EPNA 4IC6A 1A5HA 2BB4A 5DP3A 4YOGA 1FLEE 1YPLH 2YOLA 1WAYB 3EYDA 4GSOA 4Y7AA 1ABJH 1AWHB 4FUBA 1ZHPA 3PMHB 5H4IB 2AIQA 3LU9B 1GJ8B 1ELDE 1TNKA 2GKVE 4X0WU 3EA7A 3SUDA 1GBCA 4AN7A 2ZPSA 3KF2A 2F3CE 4O9VA 4ISIH 1ZGIA 2XBVA 2ZZUH 1TRYA 4DY7B 1YC0A 3RXMA 1O3EA 3RXEA 1S6FA 3UTUH 1BTZA 4AB9A 5L2ZH 1MD7A 1C2FA 1QTFA 2AMPA 1LVYA 1RFNA 1EZUC 2EEKA 1RGQA 1AFEH 2QCYA 3SO3A 1PFXC 1TBRH 2SGDE 4CRFA 3S7HB 1GBDA 1V2VT 2BY7X 3BN9A 3JZ2B 3ZVFA 1O2JA 1BTYA 1BBRH 2XC5A 2A5KA 2IOTA 2HPQH 3QZQA 4HI3A 3RXUA 1VJAU 3L3TA 3U8OH 2ODQA 2GZ7A 1C1SA 2P8OC 3LONA 4Y6DA 3RXBA 1E34B 2WUBA 3QGNB 4MDSA 1DLKB 1ZPZA 4B2CA 2C8ZB 1C5RA 1KYNA 3KQDA 3UUZA 2WUCA 1EJMA 2A2QH 4D7FA 1NY22 2C90B 1MBQA 2V0BA 3H7TA 3HK6B 2IJOB 4XDEA 4NIXA 1FV9A 1MD8A 2SGFE 3DFLA 1AB9C 1G3EA 1QJ7B 4IMQA 2QA9E 4O03A 1HLTH 3ATIA 1C1QA 3RLWH 1TGNA 2ZU1A 4A5TS 3SI3H 1AZZA 2YNBA 4YO9A 1Z6EA 1IQGA 3PV4A 4MPWA 2F9VA 2FS8A 4Q80A 2CHAB 1MTSA 1O3NA 1TGTA 1L0ZA 3K6ZA 2ZTYA 4U32A 3SORA 4Z0KA 4GUXA 1KDQA 3MNCA 3KQEA 2FPZA 4XFQA 1YM0A 2ANWA 1B0FA 3SNDA 1GG6B 4KTSA 5GJ4B 1O2RA 1W0ZU 1KXFA 1TQ7B 1NRRH 1UHBA 1OP0A 3RXPA 2HOBA 3S69A 1GI6A 3PMAB 3P95A 2EI7A 1O3AA 1ZMJA 4MLFB 4AG2A 8ESTE 3GOVB 3ZV8A 4R8TB 3URDA 5IYTA 1TX7A 3VEQB 1NO9H 4O3TA 5A09A 1ETTH 1GMDG 2Z94A 1W3CA 3L6PA 1K28D 1ZHRA 1C9TA 3RXSA 1C4Y2 1DSTA 4E05H 1SHYA 2BDYA 2GP9B 1O3GA 1ZTKA 5HYOA 3E0PB 2RDLA 1KDQB 1V2RT 4RN6A 3ZVAA 1J15A 1GMHF 2BXUH 2BY9X 1C1TA 1UHBB 4K5ZA 1SGCA 3AW1A 3ZVBA 1CGHA 5C67A 3T62A 1XKAC 3JZ1B 4ZKSU 3T2NA 4AB8A 2ZPQA 3PLPA 3QZRA 4MNXA 1Y3XA 3RDZA 1TNGA 4ABHA 1K1JA 1T8MA 2OC1A 1MTVA 4ISHH 2OCVB 4IC5A 4X6MA 2PR3A 2PSYA 1DOJA 3M5MA 1Q3XA 3A85A 2PLXA 3PO1B 3RLYH 1S6HA 4VGCC 5F6MA 1ZRBA 3O8DA 2ZA5A 1OS8A 2GV7A 3BSQA 4GHTA 3D23A 3UWIA 2GCHG 2XBWA 4YESB 3SV8A 3TGIE 2PV9B 3KQBA 1YCPM 2H9TH 2SNWA 5AHGH 1MTNB 2VH0A 1P01A 1E0FD 1P06A 3RXIA 3ZVEA 1L4ZA 3ZZ3A 1AVXA 2TGDA 3SBKA 2G51A 3LJJA 1A0LA 1BMMH 2ZGHA 1EAIA 5LPFA 1OWJA 3M7QA 3SV7A 3RXFA 1AQ7A 1TGSZ 2BD5A 2VJ1A 3IG6B 5F03A 2PTNA 1FN8A 1EP5A 2ZWLH 1QJ1B 1E37B 1GJ9B 4JZDH 3SGBE 1AU8A 4JYUH 4GCHF 4NZLA 3SN8A 2CV3A 5EGMA 1KLTA 2TBSA 2ZQ1A 3TH4H 1GBMA 5LPRA 2HVXA 3ENSB 4BTIB 1AO5A 4OS1A 3W94A 1GBTA 1CA8B 2QV1A 1RXPA 2BTCE 1P11E 3Q77A 1Y3YA 4NWKA 1ANBA 5K7RA 3ESTA 1F92A 1O0DH 1XUFA 2VWNA 3MFJA 5DKMA 3ZYEA 2GZ9A 1SGNE 2JH6D 3LGYA 4A1XA 2VB0A 2QAAA 4CRDA 4KGAA 3RU4T 1GI3A 3A8AA 1HDTH 1TPAE 2HPPH 4X8VH 3D62A 4Q2KA 3BEFB 5EPYA 4DOQA 2ANYA 3PM3A 4AG1A 3CS0A 2O8MA 3E0NB 4WXIA 1ZZZA 4JZEH 1O5FH 1CA0C 4Y76A 2FI5E 1YF4A 3TH3H 5A8XA 5BRRE 2GTBA 2NWNA 1QB1A 1IHSH 1GHBF 2GDDA 3RC4A 1SGIB 2FMJA 5EODA 1LKAA 7LPRA 2XNIA 1GWAA 1DUEA 4FU7A 1A3BH 1DXWA 1O2QA 4XBCA 1JRSA 1GGDB 1FY5A 2KAIA 1ELEE 1XVOA 3U1JB 1YYY1 1UK4A 3RXLA 3UWJH 1ZYOA 1QJ6B 1UTMA 3E8LA 1Y5AT 2FLRH 1UTQA 1SPJA 2A4OA 2ZHEH 4MPVA 2RG3A 3BTQE 3A87A 1HYLA 3A8BA 2AS9A 1O39A 3RP2A 1VITG 5FPTA 1L4DA 1PQ8A 1SQTA 3S9BA 1H9LB 5T6FA 2OXSA 3SJ9A 3R0FA 3ZZ9A 2A1DB 3TJOA 5E0GA 4KELA 1L1NA 3U8RH 1TB6H 3PLBA 1SGPE 1F0RA 2H5DA 1CHOG 3SHAH 4ABEA 4RKJB 1IQHA 7KMEH 1QRXA 3TNTA 1S81A 3LH3A 1LQEA 1D9IA 2Z3EA 4Q7ZA 4WVPE 1TA2A 1A7SA 1YPHE 4CR9A 2KAIB 4B75A 1DS2E 1O3OA 2FEQH 1D3PB 1CBWC 4UFFH 3GY4A 4ZUHA 1GHWH 1H4WA 1ZSKA 1D4PB 1JWTA 1P2JA 1BTPA 1GBJA 3S7KB 3I78A 3RMNH 1YPJH 1AFQB 2XCNA 1V2QT 1THPB 3LGTA 1NS3A 5C1XA 5JBCS 3GY3A 1FMGA 3UY9A 1O5BB 2ZDKA 1O3IA 2ZIQH 5JB9S 1P04A 3ZZ7A 5CHAB 3E90B 2FTMA 1G30B 3V0XA 1HRTH 1MZDA 1O2XA 4K3JA 1BOQA 1DWBH 1B0EA 1C2DA 2BDAA 3TNSA 1W2KH 4I8JA 2BY6X 4Y8ZA 1SG8B 3EA9A 1A4WH 2H9HA 5AFYH 1E38B 1G2MA 3ODDA 4NFEA 1GHVH 2FIRH 1BUIA 1FY8E 5C2ZA 1RRKA 3MU0A 4FUIA 2O9QA 1QQUA 3T28A 3S9CA 1LKBA 3Q76A 5ESBA 4KKDA 2BMGB 5J4SA 4A92A 1EZXC 4JYTA 2SGQE 4X2YA 1C2MA 3PB1E 1N1LA 1PQ7A 5EQSA 2VIOA 1VGCB 2PTCE 3AVZA 1HAZB 4HFPB 4AZ2B 1KTSB 4GVUA 2ZG0H 1QQ4A 4ZXXH 2BM2A 4HZHA 3TITA 4X8TH 4MQAA 4Q7YA 2ANKH 3CP7A 3DD2H 2A0QB 3ITIA 1G32B 4YLQH 5JDUB 1DWCH 1FPHH 2BD7A 4K1TA 4FUGA 5GCHF 1XUKA 3Q3XA 3RUOA 4WF8A 4Y71A 3GDUA 3ZZCA 1C2IA 2WPLS 3UOUA 1EAWA 1P2OA 1SR5C 2ASUB 5EXLA 4DJZB 1GI8B 1ELFA 2THFB 2JETB 4XBBA 5DP4A 1XUIA 5HM9A 1O2PA 4OGYA 2ZFFH 1UJ1A 3AAUA 1IQKA 1P12E 1O3CA 1JXPA 1AWFH 1JRTA 1MH0A 1UCYK 4GPGA 3RMOH 1O5CB 1O3PB 3L33A 2BLVA 3UNQA 2UUYA 2BDBA 1ZR0A 1GJ5H 1O2VA 2AYWA 1C1PA 1QRWA 2C8WB 2W7SA 3A8CA 2GCTC 1KLIH 5DP7A 4ABAA 3GY5A 1OWEA 1UO6A 2A32A 4CR5A 1QL7A 2H5CA 2O8WA 2BOKA 2PUQH 2BVSH 2STAE 1F5KU 1YBWA 4MG3A 5EW2H 4B71A 2Y5FA 1UCYE 3MO9A 3RMLH 2GV6A 4ABFA 1V3XA 3VFEA 1GJ6A 4I31A 2ZF0H 4TY7A 2I6QA 5EU8A 2OBOA 4JYVH 2A4QA 4LZ1H 1ORFA 2FYQA 1M9UA 1T4UH 2W3KA 1UTOA 1FQ3A 2GMTB 3PMBB 1SLUB 4AGKA 8LPRA 1Q2WA 3ZZBA 1C2JA 2QXHA 5EOKA 3SGAE 1UVPA 1G36A 3GCHC 5B6OA 1C5XB 1HPGA 1RIWB 5EG4A 1WV7H 4X8UH 1F0TA 3KHVA 2R3YA 1O2MA 2A5IA 2FTLE 1THRH 5EQRA 1TGBA 3SGQE 4UEHH 1MU6B 4K1SA 1T7CA 3K2UA 2OBQA 3MO6A 2FZZA 2G81E 2V3HH 4X8SH 1SI5H 1HXEH 3FZZA 2P94A 3QTVH 1SGRE 1QA7A 1E36B 2G5NA 2SGAA 5FBEA 4JK6A 3H5CB 2OC7A 2R0LA 5A8YA 2OQ5A 1SGYE 1ZRKA 3ZVDA 1O2IA 1GJ7B 1O36A 1MUEB 1KTTB 1F0SA 1LPGB 3MI4A 3T5FH 2Z9IA 4BANB 4ISOA 4AYYB 4BAQB 1GI7B 4ISLA 2BDCA 2PKAA 4NCYA 3TGKE 1QY6A 3A88A 4FVDA 2V35A 2BY8X 3TJVA 5EXNA 4K2YA 5CMXH 5JB8S 1CE5A 1O2TA 3T27A 1K1LA 3Q3KA 4IGDA 4HTCH 2H9EH 2PWXA 1TLDA 1NRPH 1YPGH 5CE1A 1RTKA 1DXPA 1L2EA 3GCTG 1FDPA 3ZZ5A 1KXAA 2ZI2H 2W5EA 3P8NA 4FXGH 4LZ4B 3ZZDA 3CENA 2EI6A 1C2EA 4ESTE 2H2ZA 3BV9B 1UTNA 3QDZB 1AKSA 2QYIA 4WMFA 3EGKH 3ATWA 2P8OB 2PKAB 2AGEX 1HAOH 1OPHB 3ELAH 3M61U 3M3TA 1GBEA 2OINA 1EZQA 2BQ6B 2BVRH 3ZZAA 1HBTH 1B7XB 1ANCA 1LCYA 1EP6A 3K65B 1OP2A
chains in the Genus database with same CATH superfamily
2R2MB 1A3EH 1AB9B 1LHCH 2AFQB 1BT7A 3BIVH 2ESTE 1YY3A 3TGJE 1NU7B 3RXCA 5HGGA 4Y7BA 1W13U 1TNHA 4YTAA 3F0PA 3CS7A 2BXTH 2W7UA 3TJNA 5C0TA 4ABBA 1HAVB 2YMSB 4ZMAH 2AEIH 1DSUA 2WHXA 3UREA 3NPSA 1O2UA 3LDXH 2D2DA 1AKSB 1RTFB 4XE4A 1SGFG 1Z8JB 3MWIU 4HG6A 1FJSA 2TIOA 1NFYA 1P9SA 4J2YB 1Z1IA 2CN0H 1IQEA 4TWWA 1KSNA 2STBE 2VWOA 3BEUA 4FUFA 4K8YA 1F5LA 3D65E 3GISB 3K9XB 1MQ6A 7GCHF 1O3HA 2RDEA 1QGFA 2G4UA 2VIDA 1FPCH 1BMFD 1C1OA 3MOCA 4YLUA 3LPRA 1SBWA 5JBTA 4FU8A 1PPZA 1LVBA 3BEIB 3D49H 2AMDA 3S9AA 4AFQA 1PQAA 3BTHE 1ZSJA 1O2HA 3KQCA 2GZ8A 3PMJA 4UFGH 5TCAA 1K2I1 1C5LH 4FUCA 2IJD1 3GCOA 1LPKB 1FAXA 4DURA 1MKXK 5C5NA 2GVFA 3KCGH 1A5GH 4YM9A 2FXRA 3OEHD 1GJBB 1IAUA 4XBDA 3BG4B 1HUTH 5CDFE 4YZUA 2BVXH 1TNJA 2WYGA 1LQDB 1DFPA 1SVPA 3KL6A 4FUHA 1O2GH 8GCHF 1UMAH 3LT3A 3QO6A 1HV7A 1QURH 2CXVA 4UFEH 5FBIA 5GPIB 1ID5H 1SOZA 3P8GA 2Y82A 2AMQA 2JKHA 2QC2A 4X6NA 1K1IA 2ZP0H 3SYJA 5FX6A 1GBBA 2VVCA 2Z3CA 2R0KA 3OX7U 1HGTH 2KZ4A 1TOMH 4TY6A 1KXCA 4DCDA 3RXJA 5ETXA 4ABIA 1TABE 1DWDH 3AK5A 2FWWA 1DE7H 2YNAA 3F6UH 4X1QU 4VGCB 1GBKA 3DA9B 5I46H 3ODFA 1GJ4H 1P02A 1UK3A 2XXLA 2RA0A 4B73A 1UTLM 4B2AA 1F2SE 1SFIA 4IW4E 1S0RA 1H8IH 1K1NA 3STIA 3HK3B 2CHAC 5E0JA 2M5TA 1MAYA 2WPJS 1GVLA 1SFQB 1P2KA 4K1EA 4ACAA 3PYHA 1GMHG 1GHAF 2ALPA 2HNTF 1DANH 1GDQA 2P93A 3RXRA 1ZHMA 3SJOA 2ZDLA 3LH1A 1Z1JA 4E06H 2P3FH 4CBOA 1W14U 6CHAC 3DUXH 1F0UA 1K9OE 1O2NA 1BIOA 4Z1MD 1GHYH 3MYWA 2SFAA 2SGEE 1VJ9U 3MH7A 5DO4H 1TBQH 3QTOH 3LJOA 3URCA 3E3TA 1O30A 4JZ1A 5KGOA 4K8BA 1NRSH 4INHA 2HRVA 3SNEA 4K69A 2ANMH 1OSSA 1QA0A 4X6OA 2F9UA 1A61H 1GBIA 2FYRA 4X2VA 3P70B 2G8TA 1C5YB 1MKWH 1TFXA 2PUXB 2ZU5A 4FUDA 2BLOA 1CT4E 2PKSB 4OS6A 4X1RU 1HAYB 1S5SA 3M36A 4NIVA 1BZXE 1CA0B 1BBRK 5GIBA 2NU2E 1GVZA 5E2OA 2WV4A 4I7YH 1YPHC 2JIZD 3F9GA 3MH6A 2G55A 2QF4A 1ZSLA 5HXFA 4MNYA 1NTPA 3OU0A 1OXGA 1FUJA 5AF9H 4PROA 3VB4A 1K1PA 1MMJN 1ZPCA 1K22H 4I8LA 3NZIA 1SQAA 3FAOA 4ZROA 1T32A 4GCHG 1P10A 1ZMLA 3DHKH 3F2FA 1NZQH 2DUCA 3I29A 1K1OA 1P9UA 2W6JD 2XW9A 1NROH 2BQ7B 3VGCB 1XM1A 1AGJA 1WBGB 1EAUA 2OK5A 5HIZA 3UOPA 1HFDA 2C8XB 3SHCH 1P2MA 5DK1A 2HGTH 1OKXA 2Y5GA 1GMCF 1O5DH 2BZ6H 4BAOB 2B5TB 4TWYA 1QNJA 2QF3A 2XWBI 5FX5A 2Y80A 1AVWA 4MNVA 4ABDA 3SQHE 2GDEH 1C5PA 1SOTA 1JIMA 4FOUC 1AZ8A 1Q31A 3V3MA 1GPZA 3FZDA 1XMNB 1Y3VA 2BD4A 2D8WA 2I6SA 3A7TA 1GBFA 1O2SA 1ESBA 3UAIC 3LGVA 4CHAB 3VB6A 2W3IA 4ZXYH 1GHBG 2BD3A 2P3UB 4Y8XA 5EIYA 1GCTB 3ZZ6A 4IMZA 4Y8YA 3GY8A 2A45B 1C2GA 1HAIH 3LGUA 2FODA 2JJ1D 4WMEA 1GI5A 4MVNA 1WQSA 1L1JA 3SJIA 3UIRA 1BHXB 3KNXA 1W7GH 4YT7H 3SQEE 5FCRA 2G00A 5IDKA 1TIOA 1WCZA 2ZTXA 2C8YB 2FS9A 3UNSA 1VCWA 6GCHF 1CO7E 4Y10E 1T8LA 4TPIZ 1EB2A 1DY8A 4H42U 4UFDH 1XVMA 3V7TA 1O3KA 4I8HA 1JOUB 5JYIA 1S84A 2A7CA 2FX4A 1SMFE 5I25A 3S0NA 3OTJE 2VWMA 1EX3A 3TK9A 2PGQB 2ZFTA 4Y79A 2G52A 3NK8A 1SGEE 1C1UH 2ZDNA 3F9FA 1HAGE 4I86A 4YT6H 1FN6A 1OWDA 2BX3A 1O5EH 4LK4A 2ZCLP 1Z8IB 1NT1A 3NCLA 4INKA 1QHRB 1TNIA 1FIZA 1G2LA 4NWLA 2RA3A 1GGDC 1WU1A 1TPSA 6LPRA 1C1NA 2NU1E 4OGXA 2EY4C 2XC4A 3NXPA 3VXEH 3HATH 3C27B 1C1VH 1BQYA 2ZHWH 1GI1A 3A7VA 1DUAA 4ISNA 3RM2H 3TPIZ 1UVUH 1ZPBA 2FOGA 1SGQE 1MAXA 4JZIA 2C93B 2PHBA 1C9PA 1D3DB 1ZMNA 4AFSA 1CQQA 1G9IE 1K1MA 1GI9B 1S0QA 2KCYA 1KXEA 1HIAB 3RXGA 3SNCA 3SU1A 1D3TB 1ARBA 2P59A 3OEED 2F83A 3DT0H 4B2BA 3MNXA 1V2JT 3RC6A 1P8VC 1UVSH 5SGAE 1LHGH 1XXDA 1S82A 2VIWA 4XOJA 1YCPH 1YLDA 2ILNA 4KP0A 1LMWB 3SV9A 1YLCA 3F9HA 1Y5BT 1PYTD 9LPRA 3Q00A 1Y3UA 3U1IB 1CT2E 2BDHA 5ABWA 3QGJA 1QBVH 4Q7XA 2ALVA 2FOEA 4LXBH 1BA8B 1BMAA 1HAHH 1F7ZA 1ELAA 4MTBA 1HAPH 1TMUH 3A80A 1BJVA 3M37A 2XBYA 3SUFA 1VCPA 2ZEBA 2ZCKP 1GL0E 1O38A 5CHAC 2J2UA 2IPQX 3EDXB 3KYGA 5C94A 3U8TH 1SB1H 2GCTB 3QLPH 1FX0B 1EKBB 2LELA 2QY0B 1HJAB 4DIIH 1CGJE 2PW8H 2WPKS 3TU7H 1GVKB 1XXFA 1C5WB 2WINI 1YGCH 2ZU2A 1D3QB 4QT8C 5ESTE 1PQ5A 5GCHG 3FO8D 1IHTH 4DT4A 2BZAA 2B9LA 3GICB 1CHGA 1P09A 5B6LA 1E35B 2ZGXH 2OTVA 1IQLA 2OQUA 3PTBA 4BXSA 1GHXH 1D6RA 4U30A 3SU3A 3F3BA 4BTTB 1O37A 2R3UA 2BDIA 1C5NH 2AGIX 1Y8TA 2F9NA 2VGCC 2FI3E 2BLWA 2P16A 5HM2A 1BHXF 2XWAA 1Y59T 3RXAA 1Z71A 3TJUA 1Z7KA 4F55A 4BOHA 1EB1H 2VIPA 3PROA 4MNWA 2CF9H 1C4V2 3NWUA 2Y81A 3EE0B 1EXFA 1J8AA 1WTGH 2ZGJA 3BTFE 3LC5A 3VB3A 1GI0A 1UTKA 8KME2 1EOJA 3A86A 1J14A 1C4U2 1QBNA 2JETC 1P03A 1LVOA 4F48B 3GYLB 4U2WA 4NZQA 2A2XH 1OP8A 4OS7A 3KGPA 2F9BH 2V3OH 1TX6A 1AUTC 5TJXA 3BF6H 4O3UA 4NSVA 1CT0E 1THSH 3SOSA 2Y7XA 4IBLH 5E2PA 2ZC9H 1E1QD 5DP9A 4CH8B 1AE5A 1DX5M 3H7OA 2SGPE 4R0IA 1O5GH 4TSFD 1S6LA 4ZKRU 1OYQA 3DFJA 2D26C 1WTHD 4WH8A 5JBAS 3HPTB 2WZQA 2R2WU 3NKKA 1WYKA 2V3MA 1DPOA 1VR1H 4A1TA 4CRAA 1TALA 2ZFQH 1ELBA 1JMOH 2ZU4A 2AGGX 4O97A 1P2IA 1W0KD 2VVVA 3ZVGA 1NFUA 3RXQA 3BG8A 3O8BA 4Z6AH 3NUMA 3MO3A 1P2QA 2KR7A 2H1UA 1V2ST 1A0HB 4YOIA 1G3BA 2HVYB 2ZKSA 2A4RA 1O5AB 1HB0B 3E91A 4SGAE 3ZZ4A 3RMMH 5FHTA 4ASHA 1K0HA 5GNDA 4FVBA 3SZNA 2ZTZA 3A84A 1TAWA 4Y11E 3W95A 2ZHFH 2ZCHP 2Q6DA 3A8DA 3MHWU 4X2XA 3BTME 1TE0A 1O35A 4INLA 3U69H 1C5QA 1QB6A 2C3SA 3HKIB 2ZFRH 3HKJB 2G5VA 1BMLA 2LPRA 1ESTA 1O3JA 1V2UT 4NSYA 4H6TA 1NESE 4UE7H 3P92A 4DT7B 1GBLA 2A7JA 3VB7A 1O2YA 2CJIA 3WW7A 1EPTC 2Q6FA 2FM2A 3LOXA 1A0JA 1HAVA 2FP7B 3A7YA 2ZHQH 4THNH 1EUFA 1YP9A 2FOFA 3TK6A 4A1VA 1D6WA 1V2OT 4Q4LA 1U6QA 2ZDAH 3E6PH 1A46H 2FX6A 1TRNA 1N6YA 1GJAB 1TQ0B 3SUGA 4OS5A 5DP5A 3A89A 5A8ZA 1O3LA 5A0AE 4LOYH 1HJ8A 4JMYA 4BAHB 2P95A 4BAMB 1C5SA 5A2MH 2Z7FE 1YPMH 1OWKA 5GXPA 5LPEA 5C1UA 3MU5A 4KTCA 2XOKD 1TMBH 4I33A 3FFGA 2VWLA 1N8OC 3G01A 1ELCA 3M5NA 4WJG2 3PWBA 2FDAA 1SC8U 3IITA 2OLGA 1UTPA 4AYVB 1JBUH 2RCEA 1P3EA 1KXDA 1INCA 4WMDA 1H1BA 2B7DH 3MQKC 1LHFH 3FP7E 3OY5U 2QIQA 1AUJA 1ELTA 5PTPA 3SU4A 2HNTC 1AHTH 2NU4E 1LPZB 4JK5A 4UDWH 2TPIZ 1BCUH 2J34A 3UNRA 1BB0B 4Y0YE 3WY8A 2GGVB 3VXFH 2TGTA 4NIWA 2NU3E 1V2WT 1CSOE 1EASA 1C5ZB 2VVUA 4H6SB 1DM4B 5C5OA 1SLXB 2VINA 3OAAD 2J94A 2FLBH 1SLVB 5DN6D 3AASA 1VITH 1O2ZA 3MH4A 7GCHG 1P2NA 3UFAA 3GYMA 3ZYDA 1QCPA 3P17H 3GY6A 2FESH 3OY6U 2ZGCA 4IS5A 1BRBE 2PFEA 3MTYA 1OOKB 1VKYA 4WH6A 4UONA 1EQ9A 5DJ7A 1SGDE 2QN5T 3LKWA 1OYTH 1IQFA 2BOHB 1XX9A 2A5AA 3UPEA 2CGAA 3PRDA 1NRQH 3V12A 1HCGA 2ZDVH 3GDVA 1CVWH 4X6PA 1NN6A 2VH6A 1BDAA 3C1KA 2BHGA 1IQNA 2WV9A 3KIDU 4TT3D 3RXTA 1NBMD 8GCHG 4BTUB 4YOJA 2VBCA 4ZCNA 1ZTLA 2J4IA 1Z8GA 2J38A 1O34A 3B9FH 1XKBC 1GMDF 3N7DA 6CHAB 4BXWA 1C5MD 1TMTH 4CH2B 1RTLA 3QUMP 5HKKD 4AOQA 3FN8A 1TOCB 3ZV9A 5K0HA 1QB9A 3LGWA 3SNBA 2QXGA 3BTTE 1OWIA 3UR6A 5FL7D 3U9AH 1WSSH 1ACBE 1NBME 3MH5A 1V2KT 3M3SA 4CBNA 1C1MA 1ETRH 1G37A 5L2YH 3BTGE 3UR9A 2UUFB 4MPXA 2PSXA 1V6DA 2FOBA 3BG4C 2GJGA 1NM6A 1P0SH 2HNTE 3STJA 4ZH8A 5F8ZA 1NRNH 2QXIA 2EA3A 1GCDA 1X7AC 1XUHA 5FPSA 4DG4A 3E16B 1PPFE 4NGAH 1GG6C 1GI2A 2Z6BD 1UK2A 4WY3A 3M3VA 2O8TA 3P8FA 1G3DA 4FETA 2V6NA 1XUGA 3KN2A 2VU8E 4BAKB 1AMHA 1WOFA 2WPHS 2YMSD 2B0FA 5C3NA 1GHAG 2XBXA 3GY7A 1GJDB 1A5IA 1LO6A 1P57B 3LC3A 2HLCA 3O8CA 2LNCA 4FU9A 2Y6TA 3LIWA 3UQOA 1NU9A 2GCHF 5F8TA 2RFKC 5C20A 1WQVH 4TPYA 2IN2A 4GHQA 4ZAEA 3SI4H 4CRBA 2ZHDA 1Z8RA 2Z9LA 1Y5UT 2TRMA 3KYFA 4M7GA 3SUEA 4AORA 1W7XH 3MNSA 4B76A 4ZHLU 1BRUP 1O32A 3NRLA 3N7EA 4UD9H 2BLQA 1O33A 2XC0A 1W0YH 4X1PU 5GDSH 2CMYA 1PPBH 3SJ8A 3F1SB 1H9IE 3V13A 2XCFA 1YPEH 4NA8A 3GY2A 3U28C 1AY6H 3UB0A 4AFZA 5EXMA 5C1YA 1Z6JH 3RU4D 2JH0D 1C2LA 4SGBE 2F9PA 2ZECA 3UQVA 3SW2B 3DSPA 4GAWA 4H4FA 2A7HA 2AH4X 3P6ZB 1LDTT 1GDUA 1EOLA 1DVAH 2FI4E 2JH5D 4B74A 2F9OA 3A82A 2ODPA 3PO1C 2BDGA 2VIVA 2VIQA 3B8JA 4F49A 4CRCA 1QRZA 2UWLA 4J1YA 4RKOB 3RXKA 1QL8A 5DPAA 1SHHB 3RU4E 2WPIS 4A7IB 2Q1JA 2XRCA 4FUEA 5HIYA 1BBRE 1FZZA 2ZPRA 1MTNC 1B5GH 3T26A 1GBHA 2UUKB 1KMHB 2G4TA 1G3CA 1SQOA 2J97A 1LHEH 4GLYA 4X2WA 1KLJH 1SGTA 1TA6A 3FP8E 2QXJA 2EI8A 1RS0A 4E7RG 1H9HE 3KEEA 1MBMA 5EQQA 1HNEE 3PLKA 1FY1A 1P05A 2K1QA 1GMCG 2PKSC 5BPEA 1W11U 5FXLA 4I32A 5J4QA 5L6NH 3TLOA 5EW1H 1IQMA 3F9EA 1CBWB 5DP6A 1NFWA 2J5UA 1QIXB 2CF8H 1J16A 1J17T 3EA8A 2W26A 2ZFSA 5DGJA 1UCYH 3SNAA 5DP8A 1T8OA 1VITF 2ZGBH 3QK1A 4NG9H 2D1JA 1ZGVA 1L1GA 1J9CH 1V2LT 4IN1A 2GX4A 1FI8A 3VGCC 1ABIH 1NFXA 4NA7A 2K8IA 1BMNH 1CHOF 1BRAA 1ZOMA 3AAVA 4DW2U 1YPKH 1PYTC 3ATLA 3BTWE 1HIAA 1MQ5A 1PPGE 2J95A 4ABJA 5KECA 3M35A 2QF0A 6GCHG 3MU4A 1FY3A 1MCVA 1MZAA 3F68H 1ESAA 1O2OA 1ZLRA 3PRBA 3PTNA 1DITH 1FIWA 5A0BA 1OX1A 1BTWA 1GDNA 1S83A 3SJKA 2UWOA 9ESTA 3SV6A 3E1XB 3SU5A 4CHAC 3QWCH 2WPMS 4JZFH 1UVTH 3M5OA 2ZDMA 1IOEA 1GCTC 2HALA 2L6OA 2VNTA 4OS4A 3T29A 2FOCA 2DE9A 3SU6A 3IWMA 2WV5A 2Y5HA 3A7WA 5T3HA 5FCKA 1AIXH 2L74A 2R9PA 1GL1A 4OM9A 2EC9H 2B8OH 1MKWK 1V2NT 2O8LA 2Q6GA 1C5UA 3A7XA 1VZQH 4X1SU 2ZO3H 1V2PT 1NC6A 2BY5X 3B23B 1GBAA 1IQJA 2AERH 1T8NA 3N7OA 3SU2A 2OP9A 3RC5A 4D7GA 4I8KA 1DICA 3BTDE 4F4OC 1P3CA 3RM0H 1C2HA 1DLEA 1PPEE 1O2LA 1TPPA 5DSFA 1PPCE 4AGJA 1AFQC 1ZTJA 5T6DA 1QFKH 2OC0A 5AFZH 3A7ZA 4X1NU 1FNIA 2FOMB 1EZSC 3HGNA 1TPOA 4DVAU 3FANA 4XRNA 1WUNH 3P8OA 1PJPA 4ZKNU 3RXVA 3WWBA 3M5LA 1MTUA 1RJXB 4BNRA 4I8GA 5FAHA 2XYAA 2J92A 4NA9H 3OE7D 1LVMA 4IN2A 1K21H 5GWZA 1FY4A 1QL9A 4MPUA 3DCLA 2OC8A 3FP6E 1GHZA 1AD8H 1OWHA 1SSXA 2OUAA 2UUJB 2VGCB 3QX5H 4NIYA 4D76A 2FOHA 2C4FH 1BITA 1UTJA 3U98H 1XUJA 2IPHA 1O2WA 1YKTA 1JIRA 2BD9A 1ANDA 5EJLA 1TONA 3EAJA 1AI8H 1SGFA 3EQ0H 2H6MA 3N99A 3M7UA 1W12U 3MU1A 5HMAA 1NPMA 2DE8A 4JCNA 1ARCA 1FXYA 3TK5A 2F4LA 1DY9A 3BTKE 5L30H 4Q63A 1HJ9A 2LP6A 5LGOA 1C2KA 4ZKOU 1AN1E 3GCNA 1VGCC 1PPHE 2AIPA 4XSKU 4E7NA 1N6XA 4HGCA 1EFRD 2SNVA 4Y0ZE 1EAXA 1QBOA 1IQIA 2FOAA 3K6YA 5AVDA 3AW0A 1BTUA 3GCHB 1CU1A 2UWPA 3M7TA 2GD4B 4ABGA 2ZFPH 2NU0E 3R3GB 1AVGH 2ZQ2A 5C17A 1V2TT 1W10U 2PGBB 2QE7D 4ZHAA 2Z9GA 2BD8A 3MU8A 1C5OH 4CRGA 4YXWD 1HJAC 2Z9JA 2BX4A 2KCPA 5E0HA 3EE7A 3HGPA 4U01A 5TCCA 1O3BA 4RI0A 2O8UA 5FPYA 3SZEA 1ELVA 1BRCE 3BTEE 3OFND 1TX8A 4DIHH 3QN7A 1TBZH 1EPTA 2J9NA 4K60A 1A2CH 4AX9H 1ZJKA 4OS2A 1TRMA 4TYDA 1A1RA 3A83A 2QGRA 2FO9A 1LHDH 3O8RA 1GJCB 4KTUA 2BD2A 3VPKA 3ZZ8A 3SU0A 2TGPZ 2HWLB 1MTWA 1O31A 4CREA 3LGIA 1MKXH 1HAXB 2M2AA 4A6LA 1V2MT 2GT8A 1SLWB 1BTXA 1KXBA 5A0CA 2BYAX 6ESTA 1HXFH 3ATMA 3OYPA 1BTHH 3MNBA 5JPMH 1O3DA 3RXHA 3T25A 3MMGA 1RD3B 1ZJDA 1EPTB 1KIGH 1AE8H 1VCQA 2A4GA 5DG6A 3RXDA 1H8ED 4AFUA 1S85A 2GT7A 1TYNA 1LTOA 3VB5A 1KY9A 5LH8A 2TGAA 1H8HD 4B1TA 2P3TB 1C5TA 1YCPK 7ESTE 2ULLA 5T6GA 1BJUA 1DDJA 1C5VA 1QR3E 3I77A 1W8BH 1O3MA 2GMTC 2Z9KA 3FVFB 4NFFA 5JBBS 1O3FA 1T31A 3TH2H 3ZVCA 3PWCA 2F91A 1EJAA 2ZU3A 1TGCA 1ANEA 3TVJB 2ZNKH 4FUJA 3ATKA 1O2KA 4D8NA 2Y7ZA 5F8XA 2XTTB 1CGIE 1RIWC 1UVOA 3A81A 4D9RA 1ELGA 1H8DH 3TIUA 4WXVA 3BIUH 2OD3B 1C1WH 1F5RA 2BQWB 1FONA 1Y3WA 1TWXB 1T4VH 2WPDD 1N8OB 3GCTF 1ETSH 1DWEH 3SV2H 4D9QA 3PV5A 1TNLA 2ODYB 2F43B 1C1RA 5G4BA 1DT2A 3GDSA 2A31A 3OSYA 4WWYA 2WYJA 1MCTA 1EJNA 1MU8B 5E8EH 4DGJA 1FAKH 1EATA 1GI4A 3RXOA 1SL3A 3Q3YA 1OHHD 2Z3DA 4RSPA 4ZHMU 5EPNA 4IC6A 1A5HA 2BB4A 1UW7A 5DP3A 4YOGA 1FLEE 1YPLH 2YOLA 1WAYB 3EYDA 4GSOA 4Y7AA 1ABJH 1AWHB 4FUBA 1ZHPA 3PMHB 5H4IB 2AIQA 3LU9B 1GJ8B 1ELDE 5EJZA 1TNKA 2GKVE 4X0WU 3PV2A 3EA7A 3SUDA 1GBCA 4AN7A 2ZPSA 3KF2A 2F3CE 4O9VA 4ISIH 1ZGIA 2XBVA 2ZZUH 1TRYA 7KMEH 4DY7B 2KCOA 1YC0A 3RXMA 1O3EA 3RXEA 1S6FA 3UTUH 1BTZA 4AB9A 5L2ZH 1MD7A 1C2FA 1QTFA 2AMPA 1LVYA 1RFNA 1E1RD 2KFWA 1EZUC 2EEKA 1RGQA 1AFEH 2QCYA 3SO3A 1PFXC 1TBRH 2SGDE 2K0QA 4CRFA 3S7HB 1GBDA 1V2VT 2BY7X 3BN9A 3DSOA 3JZ2B 4M9FA 1O2JA 3ZVFA 1BTYA 1YWUA 1BBRH 2XC5A 2A5KA 2IOTA 2HPQH 3QZQA 4HI3A 3RXUA 1VJAU 3L3TA 3U8OH 2EQNA 2ODQA 2GZ7A 1C1SA 2P8OC 3LONA 4Y6DA 3RXBA 1E34B 2WUBA 3QGNB 4MDSA 1DLKB 1ZPZA 4B2CA 2C8ZB 1C5RA 1KYNA 3KQDA 3UUZA 2WUCA 1EJMA 2A2QH 4D7FA 1NY22 2C90B 1MBQA 2V0BA 3H7TA 3HK6B 2IJOB 4XDEA 4NIXA 1FV9A 1MD8A 2SGFE 3DFLA 1AB9C 1G3EA 1QJ7B 4IMQA 2QA9E 1W0JD 4O03A 3VG8A 1HLTH 3ATIA 1C1QA 3RLWH 1TGNA 2ZU1A 4A5TS 3SI3H 1AZZA 2YNBA 4YO9A 1Z6EA 2YMSC 1IQGA 3PV4A 4MPWA 2F9VA 2FS8A 4Q80A 2CHAB 5KEDA 1MTSA 1O3NA 1TGTA 1L0ZA 3K6ZA 2ZTYA 4U32A 3SORA 4Z0KA 4GUXA 1KDQA 3MNCA 3KQEA 2FPZA 4XFQA 1YM0A 2ANWA 1B0FA 3SNDA 1GG6B 4KTSA 1MABB 5GJ4B 1O2RA 1W0ZU 1KXFA 1TQ7B 1NRRH 1UHBA 1OP0A 3RXPA 2HOBA 3S69A 1GI6A 3PMAB 3P95A 2EI7A 1O3AA 1ZMJA 4MLFB 4AG2A 8ESTE 3GOVB 3ZV8A 4R8TB 3URDA 5IYTA 1TX7A 3VEQB 1NO9H 4O3TA 5A09A 1ETTH 1GMDG 2Z94A 1W3CA 3L6PA 1K28D 1ZHRA 1C9TA 3RXSA 1C4Y2 1DSTA 4E05H 1SHYA 2BDYA 2GP9B 1QZ8A 1O3GA 1ZTKA 5HYOA 3E0PB 2RDLA 1KDQB 1V2RT 4RN6A 3ZVAA 1J15A 1GMHF 2BXUH 2BY9X 1C1TA 1UHBB 4K5ZA 1SGCA 3AW1A 3ZVBA 1CGHA 5C67A 3T62A 1XKAC 3JZ1B 4ZKSU 3T2NA 4AB8A 2ZPQA 3PLPA 3QZRA 4MNXA 1Y3XA 3RDZA 1TNGA 4ABHA 1K1JA 1T8MA 2OC1A 1MTVA 4ISHH 2OCVB 4IC5A 1COWD 2WSSD 2PR3A 4X6MA 2PSYA 1DOJA 2XNDD 3M5MA 1Q3XA 3A85A 2PLXA 3F2HA 3PO1B 3RLYH 1S6HA 4VGCC 5F6MA 1ZRBA 3O8DA 2ZA5A 1OS8A 2GV7A 3BSQA 4GHTA 3D23A 3UWIA 2GCHG 2XBWA 4YESB 3SV8A 3TGIE 2PV9B 3KQBA 1YCPM 2H9TH 2SNWA 5AHGH 5EJ1A 1MTNB 2VH0A 1P01A 1E0FD 1P06A 3RXIA 3ZVEA 1L4ZA 3ZZ3A 1AVXA 2TGDA 3SBKA 2G51A 3LJJA 1A0LA 1BMMH 2ZGHA 1EAIA 5LPFA 1OWJA 3M7QA 3SV7A 2QF5A 3RXFA 1AQ7A 1TGSZ 2BD5A 2VJ1A 3IG6B 5F03A 2CK3D 2PTNA 1FN8A 1EP5A 2ZWLH 1QJ1B 1E37B 1GJ9B 4JZDH 3SGBE 1AU8A 4JYUH 5C0UA 3OTPA 4GCHF 4NZLA 3SN8A 2CV3A 5EGMA 1KLTA 2TBSA 2ZQ1A 3TH4H 1GBMA 5LPRA 2HVXA 3ENSB 4BTIB 1AO5A 4OS1A 3W94A 1GBTA 1CA8B 2QV1A 1RXPA 2BTCE 1P11E 3Q77A 1Y3YA 4NWKA 1ANBA 5K7RA 3ESTA 1F92A 1O0DH 1XUFA 2VWNA 3MFJA 5DKMA 3ZYEA 2GZ9A 1SGNE 2JH6D 3LGYA 4A1XA 3KQ5A 2VB0A 2QAAA 4CRDA 4KGAA 3RU4T 1GI3A 3A8AA 1HDTH 1TPAE 2HPPH 4X8VH 3D62A 4Q2KA 3BEFB 5EPYA 4DOQA 1WXRA 2ANYA 3PM3A 4AG1A 3CS0A 2O8MA 3E0NB 4WXIA 1ZZZA 4JZEH 1O5FH 1CA0C 4Y76A 2FI5E 1YF4A 4P00A 3TH3H 5A8XA 5BRRE 2GTBA 2NWNA 1QB1A 1IHSH 1GHBF 2GDDA 3RC4A 1SGIB 2FMJA 5EODA 1LKAA 7LPRA 2XNIA 1GWAA 1DUEA 4FU7A 1A3BH 1DXWA 1O2QA 1E79D 4XBCA 1JRSA 1GGDB 1FY5A 2KAIA 1ELEE 1XVOA 3U1JB 1YYY1 1UK4A 3RXLA 3UWJH 1ZYOA 1QJ6B 1UTMA 3E8LA 1Y5AT 2FLRH 1UTQA 1SPJA 2A4OA 2ZHEH 4MPVA 2RG3A 3BTQE 4B6EA 3A87A 1HYLA 3A8BA 2AS9A 1O39A 3RP2A 1VITG 5FPTA 1L4DA 1PQ8A 1SQTA 3ZIAD 3S9BA 2JDID 1H9LB 5T6FA 2OXSA 3SJ9A 3R0FA 3ZZ9A 2A1DB 3TJOA 5E0GA 4KELA 1L1NA 3U8RH 1TB6H 3PLBA 1SGPE 1F0RA 2H5DA 1CHOG 3SHAH 4ABEA 2AHME 4RKJB 1IQHA 2JJ2D 1QRXA 3TNTA 1S81A 3LH3A 1LQEA 1D9IA 2Z3EA 3CNRA 4Q7ZA 4WVPE 1TA2A 1A7SA 1YPHE 4CR9A 2KAIB 4B75A 1DS2E 3FKSD 1O3OA 2KX4A 2FEQH 1D3PB 1CBWC 4UFFH 3GY4A 4ZUHA 1GHWH 1H4WA 4P02A 1ZSKA 1D4PB 1JWTA 1P2JA 1BTPA 1GBJA 4ASUD 3S7KB 3I78A 3RMNH 1WDIA 1YPJH 1AFQB 2XCNA 1V2QT 1THPB 3LGTA 1NS3A 5C1XA 5JBCS 3GY3A 1FMGA 3UY9A 1O5BB 2ZDKA 1O3IA 2ZIQH 5JB9S 1P04A 3ZZ7A 5CHAB 3E90B 2FTMA 1G30B 3V0XA 1HRTH 1MZDA 1O2XA 4K3JA 1BOQA 1DWBH 1B0EA 1C2DA 2BDAA 3TNSA 1W2KH 4I8JA 2BY6X 4Y8ZA 1SG8B 3EA9A 1A4WH 2H9HA 5AFYH 1E38B 1G2MA 3ODDA 4NFEA 1GHVH 2FIRH 1BUIA 1FY8E 5C2ZA 1RRKA 3MU0A 4FUIA 2O9QA 1QQUA 3T28A 3S9CA 1LKBA 3Q76A 5ESBA 4KKDA 2BMGB 5J4SA 4A92A 1EZXC 4JYTA 2SGQE 4X2YA 1C2MA 3PB1E 1N1LA 1PQ7A 5EQSA 2VIOA 1VGCB 2PTCE 3AVZA 1HAZB 4HFPB 4AZ2B 1KTSB 4GVUA 2ZG0H 1QQ4A 4ZXXH 2BM2A 4HZHA 3TITA 4X8TH 4MQAA 4Q7YA 2ANKH 3CP7A 3DD2H 2A0QB 3ITIA 1G32B 4YLQH 5JDUB 1DWCH 2V7QD 1FPHH 3WWFA 2BD7A 4K1TA 4FUGA 5GCHF 1XUKA 3Q3XA 3RUOA 4WF8A 4Y71A 3GDUA 3ZZCA 1C2IA 2WPLS 3UOUA 1EAWA 1P2OA 1SR5C 2ASUB 5EXLA 4DJZB 1GI8B 1ELFA 2THFB 2JETB 4XBBA 4AC9A 5DP4A 1XUIA 5HM9A 5T1VA 1O2PA 2W6ID 4OGYA 2ZFFH 1UJ1A 3AAUA 1IQKA 1P12E 3H09A 4RT0A 1O3CA 3GS9A 1JXPA 1AWFH 1JRTA 1MH0A 1UCYK 4GPGA 3RMOH 1O5CB 1O3PB 3L33A 2BLVA 3UNQA 1YLNA 2UUYA 2BDBA 1ZR0A 1GJ5H 1O2VA 2AYWA 1C1PA 1QRWA 2C8WB 2W7SA 2KCAA 3A8CA 2GCTC 1KLIH 5DP7A 4ABAA 3GY5A 1OWEA 1UO6A 2A32A 4CR5A 1QL7A 1SQRA 2H5CA 2O8WA 2BOKA 2PUQH 2BVSH 2STAE 1F5KU 3F2GA 1YBWA 4MG3A 2HLDD 5EW2H 5F53A 4B71A 2Y5FA 1UCYE 3MO9A 3RMLH 2GV6A 4ABFA 1V3XA 3VFEA 5IK2D 1GJ6A 4I31A 3F0OA 2ZF0H 4TY7A 2I6QA 5EU8A 2OBOA 4JYVH 2A4QA 4LZ1H 1ORFA 2FYQA 1M9UA 1T4UH 2W3KA 1UTOA 1FQ3A 2GMTB 3PMBB 1SLUB 4AGKA 8LPRA 5CHBA 1Q2WA 3ZZBA 1C2JA 2QXHA 5EOKA 4ACBA 3SGAE 1UVPA 1G36A 3GCHC 5B6OA 1C5XB 1HPGA 1RIWB 5EG4A 1WV7H 4X8UH 1F0TA 2PP6A 2R3YA 1O2MA 2A5IA 3KHVA 2FTLE 1THRH 5EQRA 1TGBA 3SGQE 4RT1A 1MU6B 4UEHH 4K1SA 1T7CA 3K2UA 2OBQA 3MO6A 2FZZA 2G81E 2V3HH 4X8SH 1SI5H 1HXEH 3FZZA 3W1EA 2P94A 1SKYE 3QTVH 1SGRE 1QA7A 1E36B 2G5NA 2SGAA 5FBEA 4JK6A 3H5CB 2OC7A 2R0LA 5A8YA 2OQ5A 1SGYE 1ZRKA 3ZVDA 1O2IA 1GJ7B 1O36A 1MUEB 1KTTB 3DSGA 1F0SA 1LPGB 3MI4A 3T5FH 2Z9IA 4BANB 4ISOA 4AYYB 4BAQB 1GI7B 4ISLA 2BDCA 2PKAA 4NCYA 3TGKE 1QY6A 3A88A 4FVDA 2V35A 2BY8X 3TJVA 5EXNA 4K2YA 5CMXH 2J98A 1CE5A 3FOAA 1O2TA 5JB8S 3T27A 1K1LA 3Q3KA 4IGDA 4HTCH 2H9EH 2PWXA 1TLDA 1NRPH 1YPGH 5CE1A 1RTKA 1DXPA 1L2EA 4XD7D 3GCTG 1FDPA 3ZZ5A 2KM0A 1KXAA 2ZI2H 2W5EA 3P8NA 4FXGH 4LZ4B 3ZZDA 3CENA 2EI6A 1C2EA 4ESTE 2H2ZA 3BV9B 1UTNA 3QDZB 1AKSA 2QYIA 4WMFA 3EGKH 3ATWA 2P8OB 2PKAB 2AGEX 4B6FA 1HAOH 1OPHB 3ELAH 3M61U 3M3TA 1GBEA 2OINA 1EZQA 2BQ6B 2BVRH 3ZZAA 1HBTH 2J98B 1B7XB 1ANCA 1LCYA 1EP6A 3K65B 1OP2A
chains in the Genus database with same CATH topology
2R2MB 1A3EH 1AB9B 1LHCH 2AFQB 1BT7A 3BIVH 2ESTE 3TGJE 1NU7B 3RXCA 5HGGA 4Y7BA 1W13U 1TNHA 4YTAA 3CS7A 2BXTH 2W7UA 3TJNA 4ABBA 1HAVB 4ZMAH 2AEIH 1DSUA 3UREA 3NPSA 1O2UA 3LDXH 2D2DA 1AKSB 1RTFB 4XE4A 1SGFG 1Z8JB 3MWIU 1FJSA 2TIOA 1NFYA 1P9SA 4J2YB 1Z1IA 2CN0H 1IQEA 4TWWA 1KSNA 2STBE 2VWOA 3BEUA 4FUFA 4K8YA 1F5LA 3D65E 3GISB 3K9XB 1MQ6A 7GCHF 1O3HA 1QGFA 2G4UA 2VIDA 1FPCH 3MOCA 1C1OA 4YLUA 3LPRA 1SBWA 5JBTA 4FU8A 1PPZA 1LVBA 3BEIB 3D49H 2AMDA 3S9AA 4AFQA 1PQAA 3BTHE 1ZSJA 1O2HA 3KQCA 2GZ8A 3PMJA 4UFGH 5TCAA 1K2I1 1C5LH 4FUCA 3GCOA 1LPKB 1FAXA 4DURA 1MKXK 5C5NA 2GVFA 3KCGH 1A5GH 4YM9A 2FXRA 1GJBB 1IAUA 4XBDA 3BG4B 1HUTH 4YZUA 2BVXH 1TNJA 2WYGA 1LQDB 1DFPA 1SVPA 3KL6A 4FUHA 1O2GH 8GCHF 1UMAH 3LT3A 3QO6A 1HV7A 1QURH 2CXVA 4UFEH 5FBIA 5GPIB 1ID5H 1SOZA 3P8GA 2Y82A 2AMQA 2JKHA 2QC2A 4X6NA 1K1IA 2ZP0H 5FX6A 1GBBA 2VVCA 2Z3CA 2R0KA 3OX7U 1HGTH 1TOMH 4TY6A 1KXCA 4DCDA 3RXJA 5ETXA 4ABIA 1TABE 1DWDH 2FWWA 1DE7H 2YNAA 3F6UH 4X1QU 4VGCB 1GBKA 3DA9B 5I46H 3ODFA 1GJ4H 1P02A 1UK3A 2XXLA 2RA0A 4B73A 1UTLM 4B2AA 1F2SE 1SFIA 4IW4E 1S0RA 1H8IH 1K1NA 3STIA 3HK3B 2CHAC 5E0JA 2M5TA 1MAYA 2WPJS 1GVLA 1SFQB 1P2KA 4K1EA 3PYHA 1GMHG 1GHAF 2ALPA 2HNTF 1DANH 1GDQA 2P93A 3RXRA 1ZHMA 3SJOA 2ZDLA 3LH1A 1Z1JA 4E06H 2P3FH 4CBOA 1W14U 6CHAC 3DUXH 1F0UA 1K9OE 1O2NA 1BIOA 1GHYH 3MYWA 2SFAA 2SGEE 1VJ9U 3MH7A 5DO4H 1TBQH 3QTOH 3LJOA 3URCA 3E3TA 1O30A 4JZ1A 4K8BA 1NRSH 4INHA 2HRVA 3SNEA 4K69A 2ANMH 1OSSA 1QA0A 4X6OA 2F9UA 1A61H 1GBIA 2FYRA 4X2VA 3P70B 2G8TA 1C5YB 1MKWH 1TFXA 2PUXB 2ZU5A 4FUDA 2BLOA 1CT4E 2PKSB 4OS6A 4X1RU 1HAYB 1S5SA 3M36A 4NIVA 1BZXE 1CA0B 1BBRK 5GIBA 2NU2E 1GVZA 5E2OA 2WV4A 4I7YH 1YPHC 3F9GA 3MH6A 2G55A 1ZSLA 5HXFA 4MNYA 1NTPA 3OU0A 1OXGA 1FUJA 5AF9H 4PROA 3VB4A 1K1PA 1MMJN 1ZPCA 1K22H 4I8LA 3NZIA 1SQAA 3FAOA 4ZROA 1T32A 4GCHG 1P10A 1ZMLA 3DHKH 1NZQH 2DUCA 3I29A 1K1OA 1P9UA 2XW9A 1NROH 2BQ7B 3VGCB 1XM1A 1AGJA 1WBGB 1EAUA 3UOPA 1HFDA 2C8XB 3SHCH 1P2MA 5DK1A 2HGTH 1OKXA 2Y5GA 1GMCF 1O5DH 2BZ6H 4BAOB 2B5TB 4TWYA 1QNJA 2QF3A 2XWBI 5FX5A 2Y80A 1AVWA 4MNVA 4ABDA 3SQHE 2GDEH 1C5PA 1SOTA 1JIMA 1AZ8A 1Q31A 3V3MA 1GPZA 3FZDA 1XMNB 1Y3VA 2BD4A 2D8WA 2I6SA 3A7TA 1GBFA 1O2SA 1ESBA 3LGVA 4CHAB 3VB6A 2W3IA 4ZXYH 1GHBG 2BD3A 2P3UB 4Y8XA 1GCTB 3ZZ6A 4IMZA 4Y8YA 3GY8A 2A45B 1C2GA 1HAIH 3LGUA 2FODA 4WMEA 1GI5A 4MVNA 1WQSA 1L1JA 3SJIA 3UIRA 1BHXB 3KNXA 1W7GH 4YT7H 3SQEE 5FCRA 2G00A 5IDKA 1TIOA 1WCZA 2ZTXA 2C8YB 2FS9A 3UNSA 1VCWA 6GCHF 1CO7E 4Y10E 1T8LA 4TPIZ 1EB2A 1DY8A 4H42U 4UFDH 1XVMA 3V7TA 1O3KA 4I8HA 1JOUB 5JYIA 1S84A 2A7CA 2FX4A 1SMFE 5I25A 3S0NA 3OTJE 2VWMA 1EX3A 3TK9A 2PGQB 2ZFTA 4Y79A 2G52A 3NK8A 1SGEE 1C1UH 2ZDNA 3F9FA 1HAGE 4YT6H 1FN6A 1OWDA 2BX3A 1O5EH 4LK4A 2ZCLP 1Z8IB 1NT1A 3NCLA 4INKA 1QHRB 1TNIA 1FIZA 1G2LA 4NWLA 2RA3A 1GGDC 1WU1A 1TPSA 6LPRA 1C1NA 2NU1E 4OGXA 2XC4A 3NXPA 3VXEH 3HATH 3C27B 1C1VH 1BQYA 2ZHWH 1GI1A 3A7VA 1DUAA 4ISNA 3RM2H 3TPIZ 1UVUH 1ZPBA 2FOGA 1SGQE 1MAXA 4JZIA 2C93B 2PHBA 1C9PA 1D3DB 1ZMNA 4AFSA 1CQQA 1G9IE 1K1MA 1GI9B 1S0QA 1KXEA 1HIAB 3RXGA 3SNCA 3SU1A 1D3TB 1ARBA 2P59A 2F83A 3DT0H 4B2BA 3MNXA 1V2JT 3RC6A 1P8VC 1UVSH 5SGAE 1LHGH 1XXDA 1S82A 2VIWA 4XOJA 1YCPH 1YLDA 2ILNA 4KP0A 1LMWB 3SV9A 1YLCA 3F9HA 1Y5BT 1PYTD 9LPRA 3Q00A 1Y3UA 3U1IB 1CT2E 2BDHA 5ABWA 3QGJA 1QBVH 4Q7XA 2ALVA 2FOEA 4LXBH 1BA8B 1BMAA 1HAHH 1F7ZA 1ELAA 4MTBA 1HAPH 1TMUH 3A80A 1BJVA 3M37A 2XBYA 3SUFA 1VCPA 2ZEBA 2ZCKP 1GL0E 1O38A 5CHAC 2J2UA 3EDXB 3U8TH 1SB1H 2GCTB 3QLPH 1EKBB 2QY0B 1HJAB 4DIIH 1CGJE 2PW8H 2WPKS 3TU7H 1GVKB 1XXFA 1C5WB 2WINI 1YGCH 2ZU2A 1D3QB 4QT8C 5ESTE 1PQ5A 5GCHG 1IHTH 2BZAA 2B9LA 3GICB 1CHGA 1P09A 1E35B 2ZGXH 2OTVA 1IQLA 2OQUA 3PTBA 4BXSA 1GHXH 1D6RA 4U30A 3SU3A 4BTTB 1O37A 2R3UA 2BDIA 1C5NH 2AGIX 1Y8TA 2F9NA 2VGCC 2FI3E 2BLWA 2P16A 5HM2A 1BHXF 2XWAA 1Y59T 3RXAA 1Z71A 3TJUA 1Z7KA 4BOHA 1EB1H 2VIPA 3PROA 4MNWA 2CF9H 1C4V2 3NWUA 2Y81A 3EE0B 1EXFA 1J8AA 1WTGH 2ZGJA 3BTFE 3LC5A 3VB3A 1GI0A 1UTKA 8KME2 1EOJA 3A86A 1J14A 1C4U2 1QBNA 2JETC 1P03A 1LVOA 3GYLB 4U2WA 4NZQA 2A2XH 1OP8A 4OS7A 3KGPA 2F9BH 2V3OH 1TX6A 1AUTC 5TJXA 3BF6H 4O3UA 4NSVA 1CT0E 1THSH 3SOSA 2Y7XA 4IBLH 5E2PA 2ZC9H 5DP9A 4CH8B 1AE5A 1DX5M 3H7OA 2SGPE 4R0IA 1O5GH 4ZKRU 1OYQA 3DFJA 2D26C 1WTHD 4WH8A 5JBAS 3HPTB 2R2WU 3NKKA 1WYKA 1DPOA 1VR1H 4A1TA 4CRAA 1TALA 2ZFQH 1ELBA 1JMOH 2ZU4A 2AGGX 4O97A 1P2IA 2VVVA 3ZVGA 1NFUA 3RXQA 3BG8A 3O8BA 4Z6AH 3NUMA 3MO3A 1P2QA 2H1UA 1V2ST 1A0HB 4YOIA 1G3BA 2ZKSA 2A4RA 1O5AB 1HB0B 3E91A 4SGAE 3ZZ4A 3RMMH 5FHTA 4ASHA 4FVBA 3SZNA 2ZTZA 3A84A 1TAWA 4Y11E 3W95A 2ZHFH 2ZCHP 2Q6DA 3A8DA 3MHWU 4X2XA 3BTME 1TE0A 1O35A 4INLA 3U69H 1C5QA 1QB6A 2C3SA 3HKIB 2ZFRH 3HKJB 2G5VA 1BMLA 2LPRA 1ESTA 1O3JA 1V2UT 4NSYA 4H6TA 1NESE 4UE7H 3P92A 4DT7B 1GBLA 2A7JA 3VB7A 1O2YA 2CJIA 1EPTC 2Q6FA 2FM2A 3LOXA 1A0JA 1HAVA 2FP7B 3A7YA 2ZHQH 4THNH 1EUFA 1YP9A 2FOFA 3TK6A 4A1VA 1D6WA 1V2OT 1U6QA 2ZDAH 3E6PH 1A46H 2FX6A 1TRNA 1N6YA 1GJAB 1TQ0B 3SUGA 4OS5A 5DP5A 3A89A 5A8ZA 1O3LA 5A0AE 4LOYH 1HJ8A 4JMYA 4BAHB 2P95A 4BAMB 1C5SA 5A2MH 2Z7FE 1YPMH 1OWKA 5GXPA 5LPEA 5C1UA 3MU5A 4KTCA 1TMBH 4I33A 3FFGA 2VWLA 1N8OC 3G01A 1ELCA 3M5NA 4WJG2 3PWBA 2FDAA 1SC8U 3IITA 2OLGA 1UTPA 4AYVB 1JBUH 2RCEA 1P3EA 1KXDA 1INCA 4WMDA 1H1BA 2B7DH 1LHFH 3FP7E 3OY5U 2QIQA 1AUJA 1ELTA 5PTPA 3SU4A 2HNTC 1AHTH 2NU4E 1LPZB 4JK5A 4UDWH 2TPIZ 1BCUH 2J34A 3UNRA 1BB0B 4Y0YE 3WY8A 2GGVB 3VXFH 2TGTA 4NIWA 2NU3E 1V2WT 1CSOE 1EASA 1C5ZB 2VVUA 4H6SB 1DM4B 5C5OA 1SLXB 2VINA 2J94A 2FLBH 1SLVB 3AASA 1VITH 1O2ZA 3MH4A 7GCHG 1P2NA 3UFAA 3GYMA 3ZYDA 1QCPA 3P17H 3GY6A 2FESH 3OY6U 2ZGCA 4IS5A 1BRBE 2PFEA 3MTYA 1OOKB 4WH6A 4UONA 1EQ9A 5DJ7A 1SGDE 2QN5T 3LKWA 1OYTH 1IQFA 2BOHB 1XX9A 2A5AA 3UPEA 2CGAA 1NRQH 3V12A 1HCGA 2ZDVH 3GDVA 1CVWH 4X6PA 1NN6A 2VH6A 1BDAA 3C1KA 2BHGA 1IQNA 3KIDU 3RXTA 8GCHG 4BTUB 4YOJA 1ZTLA 2J4IA 1Z8GA 2J38A 1O34A 3B9FH 1XKBC 1GMDF 6CHAB 4BXWA 1C5MD 1TMTH 4CH2B 1RTLA 3QUMP 4AOQA 5K0HA 1TOCB 3ZV9A 1QB9A 3LGWA 3SNBA 2QXGA 3BTTE 1OWIA 3UR6A 3U9AH 1WSSH 1ACBE 3MH5A 1V2KT 3M3SA 4CBNA 1C1MA 1ETRH 1G37A 5L2YH 3BTGE 3UR9A 2UUFB 4MPXA 2PSXA 1V6DA 2FOBA 3BG4C 1NM6A 1P0SH 2HNTE 3STJA 4ZH8A 5F8ZA 1NRNH 2QXIA 2EA3A 1GCDA 1X7AC 1XUHA 5FPSA 4DG4A 3E16B 1PPFE 4NGAH 1GG6C 1GI2A 2Z6BD 1UK2A 4WY3A 3M3VA 2O8TA 3P8FA 1G3DA 2V6NA 1XUGA 3KN2A 2VU8E 4BAKB 1AMHA 1WOFA 2WPHS 2B0FA 5C3NA 1GHAG 2XBXA 3GY7A 1GJDB 1A5IA 1LO6A 1P57B 3LC3A 2HLCA 3O8CA 2LNCA 4FU9A 2Y6TA 3LIWA 3UQOA 1NU9A 2GCHF 5F8TA 5C20A 1WQVH 4TPYA 2IN2A 4GHQA 4ZAEA 3SI4H 4CRBA 2ZHDA 1Z8RA 2Z9LA 1Y5UT 2TRMA 4M7GA 3SUEA 4AORA 1W7XH 3MNSA 4B76A 4ZHLU 1BRUP 1O32A 4UD9H 2BLQA 1O33A 2XC0A 1W0YH 4X1PU 5GDSH 2CMYA 1PPBH 3SJ8A 3F1SB 1H9IE 3V13A 2XCFA 1YPEH 4NA8A 3GY2A 4AFZA 1AY6H 5EXMA 5C1YA 1Z6JH 3RU4D 2JH0D 1C2LA 4SGBE 2F9PA 2ZECA 3UQVA 3SW2B 4GAWA 4H4FA 2A7HA 2AH4X 3P6ZB 1LDTT 1GDUA 1EOLA 1DVAH 2FI4E 2JH5D 4B74A 2F9OA 3A82A 2ODPA 3PO1C 2BDGA 2VIVA 2VIQA 3B8JA 4F49A 4CRCA 1QRZA 2UWLA 4J1YA 4RKOB 3RXKA 1QL8A 5DPAA 1SHHB 3RU4E 2WPIS 4A7IB 2Q1JA 2XRCA 4FUEA 1BBRE 1FZZA 2ZPRA 1MTNC 1B5GH 3T26A 1GBHA 2UUKB 2G4TA 1G3CA 1SQOA 1LHEH 4GLYA 4X2WA 1KLJH 1SGTA 1TA6A 3FP8E 2QXJA 2EI8A 1RS0A 4E7RG 1H9HE 3KEEA 1MBMA 5EQQA 1HNEE 3PLKA 1FY1A 1P05A 2K1QA 1GMCG 2PKSC 5BPEA 1W11U 5FXLA 4I32A 5J4QA 5L6NH 3TLOA 5EW1H 1IQMA 3F9EA 1CBWB 5DP6A 1NFWA 1QIXB 2CF8H 1J16A 1J17T 3EA8A 2W26A 2ZFSA 5DGJA 1UCYH 3SNAA 5DP8A 1T8OA 1VITF 2ZGBH 3QK1A 4NG9H 2D1JA 1ZGVA 1L1GA 1J9CH 1V2LT 4IN1A 2GX4A 1FI8A 3VGCC 1ABIH 1NFXA 4NA7A 1BMNH 1CHOF 1BRAA 1ZOMA 3AAVA 4DW2U 1YPKH 1PYTC 3ATLA 3BTWE 1HIAA 1MQ5A 1PPGE 2J95A 4ABJA 3M35A 2QF0A 6GCHG 3MU4A 1FY3A 1MCVA 1MZAA 3F68H 1ESAA 1O2OA 1ZLRA 3PTNA 1DITH 1FIWA 5A0BA 1OX1A 1BTWA 1GDNA 1S83A 3SJKA 2UWOA 9ESTA 3SV6A 3E1XB 3SU5A 4CHAC 3QWCH 2WPMS 4JZFH 1UVTH 3M5OA 2ZDMA 1IOEA 1GCTC 2HALA 2VNTA 4OS4A 3T29A 2FOCA 2DE9A 3SU6A 3IWMA 2WV5A 2Y5HA 3A7WA 5T3HA 5FCKA 1AIXH 2R9PA 1GL1A 2EC9H 2B8OH 1MKWK 1V2NT 2O8LA 2Q6GA 1C5UA 3A7XA 1VZQH 4X1SU