1O3AA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3aA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3aA02
2YNAA 2BY7X 1BRUP 1RTLA 5JBBS 1TRMA 2ZU4A 1BBRE 2XC0A 2PV9B 2CXVA 4Y8ZA 3E0NB 4XDEA 2DE9A 4U01A 1D4PB 3RM0H 2FEQH 2SGDE 1TYNA 3F68H 3HK3B 1HIAB 4Q7ZA 1KLIH 1TB6H 1BUIA 3MI4A 2RA0A 2GT8A 1CA0C 1MCVA 5EQRA 1EPTC 1AVXA 3TPIZ 1UCYE 1LKAA 1P2JA 1O5EH 1THPB 1ZTLA 4NWLA 1GI6A 1GBTA 1TGCA 2GVFA 1MAYA 1P2NA 2F9PA 4UDWH 2W5EA 1AE8H 1DUEA 2H2ZA 2VIQA 1GBCA 4Q80A 1PPFE 1GI5A 4WMFA 5EW1H 3OY5U 3A81A 3GCTG 1F0SA 1XKBC 1SLVB 1ZYOA 2BVSH 2FOGA 2NU4E 2ZECA 4X1SU 4X8VH 5ESBA 2PSYA 1NM6A 3V12A 2FO9A 1H9IE 1TWXB 4JK6A 1IQLA 1OWDA 2FI4E 4DJZB 1IQGA 1C4U2 1OOKB 3SBKA 2BX4A 3M5NA 4B75A 1DM4B 3RUOA 5C1XA 1G3DA 3SUGA 1GMDG 2Z6BD 1CHGA 1C2FA 2ZG0H 3UQOA 2SNVA 1SLWB 4K2YA 3RXHA 4NZLA 2GD4B 1SQAA 4AB8A 1GHZA 3H7OA 1FY1A 4NIYA 3P8FA 4INLA 3OU0A 1NN6A 3A83A 2FOMB 2GT7A 1KIGH 3M5OA 1AUJA 4RSPA 1A2CH 1LCYA 4O9VA 1XX9A 2W26A 4XBBA 1P2OA 1O5BB 2O8LA 3U8RH 1TGBA 3Q76A 1VITF 4KTCA 3Q77A 1FONA 1O3NA 1SQTA 1QGFA 3JZ2B 3R0FA 2ZFSA 1SGEE 2W3IA 5K0HA 3SJ9A 1TX6A 4CRFA 4INKA 1UVTH 3T27A 3MNCA 1SGDE 1W0YH 1HPGA 3F9FA 1INCA 1O3AA 3GDSA 4K8BA 3V0XA 1NFUA 1TONA 1RS0A 2ZDLA 1VGCB 2P59A 1NFWA 1VCQA 2QXHA 2UWOA 1NU9A 1EQ9A 4JZDH 2V0BA 2AH4X 2C90B 1GG6C 4K8YA 3UOPA 3DHKH 5ETXA 4B2CA 5AF9H 5G4BA 1T8NA 1H4WA 2GV7A 4JK5A 1Y3VA 3AAVA 3RXUA 1KSNA 4X6PA 1A0LA 1V2JT 2WYGA 2ZGJA 3SU5A 3HKJB 1MU8B 1Q31A 4FVBA 3U1IB 1LPKB 3D62A 3NWUA 4AOQA 1KYNA 3SV8A 1O3PB 4GPGA 5HM2A 1EJAA 3LOXA 4RKOB 2ZHQH 1MCTA 3QDZB 1ID5H 4UEHH 1V2NT 2R3UA 3MHWU 6CHAB 1SL3A 1GI8B 2ZP0H 1UTJA 1AKSB 1TAWA 1TBZH 5JPMH 2CMYA 1D6WA 2EI6A 1V2ST 2GZ7A 3EE0B 3M5MA 3T5FH 2IOTA 1YYY1 3A7WA 1C1SA 4WJG2 1A46H 5JBCS 4Y0ZE 3BTWE 2A2QH 4RKJB 5F6MA 3S0NA 1EJNA 3KIDU 1ANBA 2VIWA 4Y0YE 1YBWA 3A80A 3BV9B 3LGTA 1BB0B 3KQDA 5PTPA 3SJIA 2LNCA 2WPIS 1UTLM 4D7GA 1FAXA 1FY8E 4IMZA 1O3FA 3B23B 2FDAA 1MTNB 1HYLA 5HGGA 4I31A 4X2YA 2QXJA 3ZZCA 1GBMA 3ZZ5A 4I32A 1RIWC 2QAAA 2A5AA 2OC8A 4TWWA 1WSSH 1XXFA 1N6YA 1Y3WA 2H9TH 2KAIB 2A45B 2Z94A 3W95A 3GCTF 3SJOA 1JRTA 2A0QB 2VIOA 2PTCE 3RMMH 2RCEA 2ZZUH 1D3TB 3ZZ9A 3EGKH 1H1BA 4H6TA 2ZGCA 3FP6E 1SHHB 3T2NA 2GMTC 3MWIU 1OP8A 2I6SA 1QQ4A 4AG1A 2J9NA 1HCGA 1Y5UT 2BYAX 3TJVA 2FLBH 1HXFH 1J17T 5L2ZH 1HJAC 1TOCB 2ZCHP 1BMMH 1G37A 2TRMA 4NGAH 2ZEBA 5T6GA 4RN6A 4DG4A 3GY2A 1BQYA 1ZZZA 4DGJA 2AERH 4BTIB 4F4OC 3VFEA 3I78A 1K28D 2EEKA 1CA0B 3VPKA 1Z7KA 1EPTB 4MNYA 5FBIA 3BTQE 2Z9JA 4MNWA 1P10A 1Z1JA 2GP9B 3ATIA 3A85A 2OBOA 1EX3A 4NA8A 2ZU3A 1NFXA 1EB1H 1ZSLA 2O8UA 3V7TA 4OS6A 2C4FH 5A2MH 5E2PA 1P12E 1C1UH 2BY9X 4SGAE 1O36A 2XRCA 3KN2A 2ALVA 3D23A 1HBTH 1THSH 1O3LA 1PPZA 2J95A 9ESTA 2ZDKA 3H5CB 1TX7A 2FOHA 1C5TA 1O2ZA 1XM1A 4VGCC 4D76A 4X8SH 1GGDC 2O8MA 3SNAA 1TNLA 1SGIB 1W14U 1NY22 8ESTE 2ZNKH 9LPRA 2CHAC 1HJ9A 2UWLA 4K1EA 4K5ZA 3A7XA 1GI9B 1ETRH 3L3TA 2UUYA 3KF2A 1WAYB 1XUJA 2ZHEH 4GSOA 2ODQA 1K21H 1C1MA 5DG6A 1YPMH 1BBRH 4HGCA 4K3JA 2ZQ1A 4JZFH 3RC6A 1K2I1 4LOYH 4NIVA 2G52A 3UPEA 1MBQA 2F9BH 4OS4A 2O9QA 2VWOA 3UR6A 1WUNH 3EA7A 4ESTE 2TGAA 2Q6FA 1QBVH 1OWIA 5A09A 1GVLA 4UE7H 3ZZDA 1C5PA 1ABIH 1EZXC 2Z9KA 3P17H 4A1TA 1JMOH 3WY8A 1DITH 1MAXA 2WPKS 2Y5GA 2Y7XA 1ZJKA 3EDXB 1C5QA 3TK5A 5E0HA 2FXRA 1PPCE 1GBFA 1ZPZA 1F5KU 2ZDMA 3P70B 3TU7H 4THNH 5DP9A 1BTWA 4NIWA 2PFEA 2NU2E 1GG6B 5FXLA 2HVXA 2BOKA 1H9LB 2ZU5A 5JYIA 3SJKA 1Y3YA 1FY5A 1OWEA 5E0GA 1GJCB 1YPHC 2FOBA 1LTOA 1QURH 4XSKU 3A8BA 3GYLB 1KXAA 1BHXB 2CGAA 5FX5A 1WV7H 5LPRA 1P01A 1K9OE 3T62A 1AQ7A 1O2UA 1SLUB 1WU1A 2PGBB 1Z8JB 3LGIA 4ZKOU 1LVBA 1YKTA 2TIOA 3RMOH 1RFNA 1GJ4H 3PWBA 5FHTA 1CGHA 1HXEH 4Y79A 2UWPA 1CT4E 1S6HA 1O2NA 5FPSA 4FUHA 3FP8E 1GDNA 4JZ1A 1DSTA 4MPXA 4NWKA 1HDTH 2ZFRH 1ARCA 1GL1A 3SI4H 2V3OH 4MDSA 1IQIA 1FN6A 1UTOA 2IJOB 2XBXA 1XUHA 3BIVH 4X8UH 1V6DA 5FAHA 2BLVA 2BXTH 1GJ6A 4CH8B 6GCHG 1P2MA 5DKMA 3ZVFA 4ABAA 1C5WB 1C1PA 2H5DA 4JYVH 1V2UT 1O2GH 1O5DH 1GHWH 2AMPA 4I8GA 2HPPH 2ODYB 4AGJA 1GJAB 3MH6A 4ABBA 1B5GH 2BDGA 4YLUA 1C2IA 2OD3B 4NCYA 1PFXC 1QB1A 3BTTE 2NU0E 2FX4A 1RIWB 5JDUB 1J9CH 2VGCC 3NKKA 2FODA 1BRBE 3KGPA 1EP6A 3E16B 1BDAA 1RRKA 3BTGE 3QTVH 2FOCA 1LVMA 4YTAA 1O31A 4NA7A 2FIRH 1C5MD 2G81E 1YLDA 2VWMA 2VNTA 2ZCKP 1QBNA 1QJ7B 1GBEA 1PPGE 2CF8H 1O3EA 4YM9A 1HJAB 2TBSA 4FUCA 4OS2A 3FP7E 3KQEA 1CQQA 1DSUA 2C8WB 3FZDA 1ORFA 1S81A 2BX3A 1C5YB 2PR3A 3SV2H 4BAOB 1RTKA 1O2OA 5LPEA 1SBWA 3L33A 4WMEA 1C1QA 2DUCA 4IS5A 2SGFE 3SU4A 2WUCA 5EPNA 5C2ZA 1FNIA 1S83A 2OC7A 5BPEA 1YPKH 3SW2B 1BJUA 3QZRA 3U9AH 3V13A 3Q00A 1E35B 2PKAA 1QRXA 5LGOA 1LHCH 5L30H 2QYIA 1O2KA 1L0ZA 3LPRA 3A7TA 3T25A 4BAMB 1CA8B 5ABWA 4FVDA 1GI4A 2A7CA 1Z8RA 1G30B 2HALA 1OYTH 7KMEH 3QUMP 1TQ0B 3ZZ6A 3PV4A 3SUDA 3F9HA 4Y11E 3BF6H 4LK4A 1GHXH 1AI8H 4MVNA 4GAWA 3ZYDA 4BTUB 2UUKB 1W3CA 1AD8H 2ZO3H 2B0FA 1ELDE 2HNTE 3E6PH 1C5UA 2OQ5A 2G4UA 2NU3E 3MYWA 2PHBA 1KTSB 4Q2KA 1CT0E 3MH7A 4XOJA 3BTEE 3GY6A 2J92A 4XBDA 2ZPRA 5LPFA 4X1PU 4NFFA 1TABE 4K1TA 1D9IA 2BLOA 3BEUA 2ZTZA 1QR3E 4WMDA 3GCHC 3PO1C 4R0IA 4WVPE 5F8XA 3HPTB 3SV9A 1QFKH 2XYAA 1QB9A 1C5SA 4ISOA 1TLDA 3M5LA 3TGIE 1MMJN 2BY6X 4I8JA 3TH4H 3BTDE 1P03A 1UK2A 2ULLA 1ZJDA 1LO6A 3O8CA 3TH2H 3UUZA 2BY8X 3PTNA 3A88A 5C1YA 3QN7A 1SGQE 4MNVA 2XCNA 4ISNA 1DANH 1QIXB 1V2KT 4BAKB 2ALPA 6GCHF 1XVOA 5FCKA 5K7RA 1FPCH 1ANEA 1L1GA 2GDDA 4GLYA 4ZKNU 4BXSA 1LQEA 4FUDA 5CHAC 1O3OA 3STJA 1C1WH 3M3TA 2NU1E 4ASHA 2SGAA 3P6ZB 3QO6A 1TNHA 4FUEA 2AMDA 3QZQA 2ZTYA 1PPEE 4HTCH 1RJXB 3K2UA 1BA8B 2GKVE 4BOHA 1IQJA 1C4Y2 1WCZA 1E36B 3TNSA 4ZUHA 3HK6B 1FJSA 1TA2A 1LPGB 3MTYA 3O8BA 1T31A 1Y3UA 2AGEX 2OQUA 3FVFB 1HAVA 1E37B 3ZVBA 1CO7E 1ZPBA 2F91A 3MO3A 1OWKA 3A8CA 2OXSA 2A5KA 3SGQE 5C20A 3MU0A 3GY4A 1BTYA 1DDJA 4KTUA 4BTTB 5DP8A 1UVOA 1SFQB 3RP2A 4X6NA 4YZUA 1O3CA 1VCPA 3HGPA 1BBRK 1KLJH 1L4ZA 2XC5A 3TNTA 3V3MA 3DUXH 1EB2A 2PW8H 1YC0A 4MNXA 1FY3A 5DK1A 3K6ZA 2VGCB 4I8HA 1QL7A 1QCPA 3UTUH 1LDTT 2VINA 4Y8YA 2ZKSA 1S82A 1GJ9B 3RXFA 4J1YA 4Q7XA 3SNBA 4UFDH 1P05A 3RXCA 2PKSC 3LH3A 1DS2E 1UCYK 1BMNH 1GL0E 4F49A 3ZVGA 1H9HE 2AMQA 3AVZA 1EAWA 1C5OH 1DFPA 5EXMA 3SHAH 1AN1E 3ZZ8A 3F9GA 5A0AE 3TGJE 3QLPH 2RA3A 1GMHG 2VVVA 1EZUC 2O8TA 4ISLA 2R2MB 1AY6H 1CU1A 1K1OA 1G2MA 1THRH 2XTTB 1Y5AT 3RXLA 1KDQA 2B9LA 1O2VA 4LZ4B 1BMAA 3MH4A 1KXFA 1JXPA 4K69A 2HLCA 2P16A 1P9UA 3CP7A 3ESTA 2ZCLP 2QA9E 5GDSH 3MFJA 1T8OA 1UVSH 1W2KH 1YGCH 1SSXA 2JH5D 3DFJA 3LU9B 3SNDA 4FU9A 7LPRA 4X2XA 2FX6A 4GVUA 3QWCH 4TPYA 3UNSA 2VIDA 4GCHF 1D6RA 3LKWA 1O2JA 1P11E 1BTXA 1C5VA 4UFEH 2ZU1A 2FS8A 1KLTA 2PUXB 2WV5A 1IQHA 2BDBA 2A4RA 1K1LA 4MTBA 2M5TA 3QX5H 4J2YB 2WYJA 1D3QB 1C2GA 3TJNA 3TJUA 2WPLS 5A8YA 1UK4A 2BQ6B 3HGNA 2Q1JA 4R8TB 3KQCA 3GCHB 1FZZA 3CS7A 3PLPA 4FUFA 3SI3H 1N1LA 4D9QA 3B8JA 5EODA 1LVYA 1SGFA 8KME2 3PTBA 1NESE 1P2QA 4D7FA 4ZROA 5DGJA 1O38A 4DVAU 2ZTXA 1TMBH 1HNEE 1PPBH 1S84A 1EUFA 3VXEH 1F5LA 4Y8XA 5DP3A 3PLBA 3GYMA 1NPMA 1Q3XA 1HB0B 4FUJA 1MKWK 1O2PA 1O2QA 3SU1A 1AB9B 4A1VA 2RG3A 1NFYA 1LVOA 5CHAB 4MPVA 1MH0A 3BG8A 1XUFA 2B8OH 1FQ3A 3LGVA 3MH5A 1GI7B 1EAXA 3W94A 4AGKA 4UFGH 2GCTC 3VGCB 1NRQH 4M7GA 1FMGA 1Y5BT 2C3SA 1C5RA 1NZQH 1IQFA 3GDVA 1B0FA 4TY6A 4WH8A 1YCPH 3PLKA 3E3TA 3ELAH 1V2TT 4DIIH 1NTPA 5JBTA 4WXVA 1T7CA 6LPRA 2BD8A 3GY3A 4OGYA 3A7YA 4X2WA 1UTNA 1PYTC 1XUIA 2EI7A 2QF3A 3I77A 2R0LA 1A5IA 2XW9A 4X6MA 2FYRA 1C2EA 1QL9A 1LHDH 2JH0D 3M35A 3ZV9A 2QXGA 1GCTC 4YOGA 1HJ8A 1O2LA 1ESTA 1GHVH 1EXFA 4I8LA 1ZRKA 4DW2U 2QC2A 2Z3CA 3RXOA 1GMHF 2PLXA 4MPWA 1QQUA 3RDZA 1TPSA 1F5RA 2F9OA 5J4QA 1Y8TA 1VJAU 3RXRA 1S5SA 3IG6B 1TIOA 4PROA 3GDUA 1EZQA 1SGYE 2FMJA 2GZ9A 1AVWA 3DFLA 3S9BA 1XMNB 1ZLRA 1VZQH 3BG4C 3SN8A 2Y81A 3G01A 1LQDB 1SGCA 3SORA 2BDIA 3EQ0H 2FZZA 2H6MA 2PKSB 2ZFQH 3LONA 3E8LA 4KP0A 4YO9A 2GV6A 1W7GH 1MUEB 3LDXH 3PM3A 4GUXA 1D3PB 3SO3A 2W3KA 1M9UA 2ZHWH 3SU6A 1EJMA 3ZZAA 3RXKA 4Y76A 1HFDA 5DP4A 3D49H 1ZHRA 1KXEA 1PQ7A 1O32A 1V3XA 1UTMA 2J38A 1BTPA 1VR1H 2VWNA 4YOIA 3Q3KA 3P92A 3VXFH 2UUJB 1O5GH 2ZGXH 2Z9IA 1NRRH 1C1RA 4NSVA 1GI0A 1UCYH 2YOLA 1TMUH 4JYUH 2XBYA 1HGTH 1ZHMA 1A3EH 3LC3A 2ZU2A 1EASA 2BDHA 3M61U 2VJ1A 1L1JA 2GCHG 2G51A 4U30A 1TBRH 2G8TA 4JYTA 3KQBA 1TFXA 1YPLH 1V2LT 1NRSH 5HMAA 4TPIZ 2A32A 2JKHA 1TNIA 4MG3A 3LJOA 2G5NA 3MU1A 2WPHS 3C27B 2CF9H 3RLWH 1S85A 1SOZA 2OINA 3TK9A 1ANDA 1XXDA 4CBOA 3SUEA 2YNBA 4E05H 2TGPZ 2H9HA 2SGQE 3KHVA 4X0WU 1C5LH 3RXBA 1MTWA 1UO6A 1K1IA 2R3YA 1G3BA 1UHBA 2VU8E 3A82A 1TA6A 1U6QA 4NSYA 3RXAA 2XNIA 4CH2B 2PUQH 2SNWA 3K65B 2D2DA 4Z6AH 3S9CA 1C2DA 2R0KA 1LPZB 5E8EH 1WBGB 2A4GA 3S69A 3GY7A 4YT7H 2Y6TA 1GBIA 1WYKA 1P04A 2OLGA 3K6YA 4CRDA 3MMGA 1C2JA 1BIOA 2ZGHA 1XVMA 1QTFA 1T8LA 2FI5E 4ZXYH 4NZQA 4Z0KA 1GBBA 1UK3A 4AYVB 2Z9LA 2HGTH 2STBE 1GBKA 2BVXH 4A5TS 2F9UA 3URCA 2BM2A 1PQ8A 2Z7FE 3HKIB 3IITA 1LHGH 4I7YH 4WXIA 1F0TA 1KTTB 4MPUA 1XUGA 2CV3A 5F03A 3M7UA 1FV9A 1ZRBA 2GCTB 3UWIA 1T8MA 5DP5A 2HRVA 1K1JA 1MQ6A 4H42U 4Y6DA 4CRCA 4ZH8A 1GPZA 1TRYA 4IGDA 1O34A 1H8IH 1HAIH 4JCNA 1O3BA 3ZZ7A 3R3GB 1DX5M 4HZHA 3EYDA 3OSYA 5GWZA 2P95A 4NA9H 2GMTB 4CR9A 1Z6EA 4YESB 3GISB 3U98H 1BTUA 1MKWH 2GX4A 3RXTA 1ZMNA 3VB6A 4JZEH 1VJ9U 3MU8A 1MD8A 1O3MA 3ZVAA 2F83A 1Q2WA 2A5IA 2A7JA 4YOJA 1KXDA 3H7TA 3BTFE 1C9PA 1GCTB 1SR5C 3F9EA 1IHSH 1K1MA 1Y3XA 3RXSA 3SQEE 3A89A 1ZGIA 3EA8A 3UQVA 3UNRA 1A0HB 1K22H 3SU3A 1HRTH 1F7ZA 3RXMA 5EXLA 5DO4H 5TCCA 1EP5A 2ZHDA 2AYWA 1CT2E 1YPGH 5AFZH 1TOMH 5F8ZA 5GJ4B 3SNEA 1EKBB 4CREA 5FX6A 3ZZ4A 1O30A 1V2VT 2BD9A 1AZZA 3F1SB 1MTVA 3BG4B 3FANA 1BITA 1NRNH 1TPOA 5JBAS 1EOJA 1C5ZB 4VGCB 1FDPA 1C2MA 2QF0A 4IBLH 5AFYH 2ZDVH 1GGDB 1XKAC 3NPSA 1AVGH 3P8GA 2A31A 2XWBI 5GXPA 1MZDA 2CHAB 2AGIX 2GCHF 4KELA 2FP7B 4D8NA 3BEFB 5IDKA 1O35A 1YP9A 1C2HA 2ANWA 2VH0A 1PJPA 1P2IA 5GCHF 4NG9H 1O39A 3RC5A 1O2WA 3KNXA 1SQOA 2OCVB 4FU7A 1N8OC 3MU5A 5DPAA 1ZR0A 3UR9A 1X7AC 1DVAH 1QNJA 4Y7BA 5EG4A 4OS7A 1RTFB 1JBUH 1GJ8B 4U32A 4X2VA 2EI8A 2V35A 3VEQB 3A87A 1PYTD 4ABGA 4AX9H 1LHEH 3PB1E 6ESTA 2GZ8A 3IWMA 5JB8S 5J4SA 5DJ7A 2Q6GA 3E0PB 3SGAE 1ZSKA 3OY6U 1OP0A 3BEIB 3CS0A 2BD3A 4TWYA 2H9EH 1VCWA 1MTSA 2A2XH 4KTSA 1ETTH 2ZFFH 8GCHF 1GJ7B 1HAZB 5IYTA 3D65E 4GHQA 4WF8A 4CRAA 5CE1A 1YCPK 1TNKA 2TGDA 2V6NA 3ENSB 3MNBA 2PKAB 3KCGH 2Z3EA 3UREA 1T4VH 2ZI2H 2BHGA 3ZV8A 4GCHG 3PROA 1O37A 3KEEA 2VIPA 4ZHAA 2B7DH 2FOEA 1A1RA 1E34B 1AIXH 1IQKA 2QXIA 1IQEA 1TE0A 4ZKSU 2G4TA 1SGFG 2D26C 1HAYB 3VB5A 1BOQA 3UY9A 1HIAA 1JRSA 3RC4A 1OYQA 3DD2H 4TYDA 2ZC9H 1BTZA 4A6LA 2WUBA 1Z8IB 2BZAA 2HWLB 3Q3YA 5FPYA 4IN1A 1ZOMA 1O3DA 2G00A 1AU8A 1GHYH 1PQAA 1CGJE 1DOJA 2FOAA 1G3EA 4AFZA 2OC0A 5SGAE 2G55A 4O97A 1RD3B 5AVDA 1B7XB 2B5TB 1FLEE 1TPAE 1GCDA 1TQ7B 4SGBE 5FBEA 1Y59T 1GJDB 1C1OA 2ILNA 1CBWC 1QY6A 1HAGE 1ELBA 1WQVH 1ARBA 1IQNA 2Y5HA 2IN2A 1GVZA 1JOUB 1QBOA 3AW0A 1GHBG 1GDQA 1JWTA 1WTGH 3VB3A 2BOHB 1RXPA 4ABJA 1PPHE 4MQAA 2G5VA 3AASA 1V2OT 1A0JA 5C1UA 1YPHE 1O2MA 1V2MT 1J14A 1BZXE 4MLFB 4BXWA 5E2OA 3RU4E 1PQ5A 1G3CA 2BVRH 1ANCA 1ELCA 5E0JA 3STIA 3F6UH 1MD7A 2ZA5A 3T26A 3VB7A 2F3CE 2FI3E 1QA0A 1TMTH 1P06A 1GBAA 3RU4T 1GMCG 2QN5T 1IAUA 1EAIA 4X6OA 3RXIA 2RDLA 4DIHH 1ELAA 1DPOA 2FYQA 3MOCA 1NS3A 2ANYA 3A8AA 3E91A 1YCPM 4DY7B 5DP7A 3TVJB 1AWFH 1C2KA 1F2SE 5A8ZA 3VB4A 3SV6A 1DWCH 1DE7H 3OYPA 4BAHB 2A1DB 3M7QA 1NT1A 2EC9H 1ELEE 5GPIB 2H5CA 3RU4D 4UD9H 1AFEH 1TGNA 2D8WA 3LC5A 1P3EA 1C5NH 2UUFB 2I6QA 5C3NA 1O5CB 1FN8A 4ABIA 1T32A 3Q3XA 1HAPH 1DUAA 1HAVB 2F9VA 4ZKRU 2FS9A 3UNQA 4ABEA 1SFIA 4NIXA 5A0CA 2XBVA 4INHA 4KKDA 4A92A 4YT6H 1O2SA 2Y82A 2C8XB 3ATKA 4I8KA 2BMGB 2GTBA 2ODPA 3PMAB 1ZPCA 1OX1A 3ITIA 2Z3DA 3M36A 4B2AA 1AFQC 4ZMAH 2CN0H 2AGGX 2P3FH 1GWAA 5C67A 1ABJH 1ELGA 2XC4A 2BZ6H 1SI5H 1ZMJA 1YF4A 5GIBA 1GBDA 1EATA 1O5FH 3GY5A 1O2RA 3A7ZA 4ABHA 2VIVA 4WH6A 4BAQB 2JETC 1MBMA 1NO9H 3TITA 1AKSA 4H4FA 1ZTKA 3CENA 4ZXXH 2THFB 2J34A 4I33A 3MO6A 1SGTA 1N8OB 3LT3A 1O2HA 1ESAA 3OX7U 1H8DH 5HYOA 1FPHH 2PTNA 1P9SA 1AUTC 4B74A 2P93A 1G36A 1F0UA 1LMWB 2ZFTA 3UWJH 1W8BH 3B9FH 2FWWA 3QGJA 4ABFA 1AZ8A 1AHTH 2QY0B 1A61H 3I29A 3A7VA 3S7KB 1GI3A 3BTKE 3PO1B 1G32B 1MTUA 1KDQB 1A4WH 2P3TB 5CMXH 2OUAA 1L4DA 1K1PA 3RMLH 1KY9A 1S0RA 3AAUA 2BD7A 2KAIA 4GHTA 5EPYA 3E90B 3SU2A 1OS8A 1HUTH 1V2QT 4O3TA 2BB4A 1GHBF 1V2WT 1L2EA 1ZGVA 3ODDA 5C5NA 3BTHE 1A3BH 1QRWA 2BQWB 1MQ5A 4FUIA 1ETSH 1CHOF 2SFAA 2C93B 1ELFA 1SOTA 3SJ8A 5BRRE 1O33A 1P0SH 3NCLA 5T6FA 2ZIQH 3BIUH 3TK6A 4A7IB 3BSQA 4E7RG 2ASUB 2OP9A 1P09A 3ZVEA 2VB0A 1EPTA 1FIZA 2GDEH 1C4V2 1EAUA 1GMCF 3RXPA 3T29A 1BT7A 4WY3A 2ESTE 2ZGBH 4XE4A 2AFQB 5L2YH 3FFGA 2ZFPH 3TJOA 2TPIZ 1DXPA 3K9XB 2WINI 3ODFA 1CGIE 1HAOH 1CBWB 5T6DA 1B0EA 3SUFA 1QJ6B 4FU8A 4X1RU 5ESTE 2GGVB 4FUGA 3PMJA 1G2LA 7ESTE 1JIRA 1GBHA 1TBQH 4B1TA 3GICB 2A7HA 4AN7A 3UOUA 3RXJA 1KXBA 2Z9GA 4DOQA 3DA9B 1GDUA 4AFUA 2BDAA 4BNRA 1CSOE 1GI2A 2FM2A 2QGRA 1YPEH 1GMDF 4IC6A 3A84A 4HFPB 4HI3A 3HATH 1SG8B 3M3SA 1O3GA 1DWEH 1S0QA 4AFQA 1C1NA 3ZZ3A 1O3IA 5EGMA 1MZAA 1F92A 2HNTC 4Y71A 1A5GH 4QT8C 1GJBB 5A8XA 4BANB 3ZVCA 3S9AA 2FLRH 2OC1A 3OTJE 1BRCE 1GI1A 2ZPQA 2D1JA 2BLQA 1AWHB 1W13U 2P8OC 2XWAA 2C8ZB 1SGPE 4E7NA 4YLQH 3MNSA 4CRBA 2P3UB 1BRAA 4Y10E 1BHXF 1RGQA 5F8TA 1UVUH 1Z71A 3DT0H 4B2BA 2BXUH 2HPQH 3L6PA 1SLXB 1FAKH 1WQSA 5C5OA 3C1KA 1UMAH 1OWJA 1UTKA 3UFAA 1MKXK 1K1NA 4AYYB 1DWBH 2HOBA 1SVPA 1FY4A 3QGNB 1GBLA 3P95A 1P57B 5EOKA 1E0FD 2BTCE 1AFQB 1N6XA 1O2IA 2A4OA 2LPRA 1TGSZ 1BMLA 2J94A 2AEIH 5LH8A 1Z8GA 1W10U 2QIQA 1SMFE 7GCHG 4A1XA 3O8DA 2FTLE 2JETB 2R2WU 4DCDA 3M3VA 5GCHG 4X1QU 4UONA 3LIWA 1ZSJA 1A5HA 1YM0A 3PMHB 3RXEA 3TIUA 3NUMA 1DY8A 1HAHH 1QB6A 2CJIA 2EA3A 1D3DB 3S7HB 4LXBH 1AO5A 3SNCA 5FCRA 1O3JA 5HXFA 3RMNH 3LGWA 1OXGA 5EQSA 3SV7A 2AS9A 2Q6DA 1KXCA 2BDCA 3NXPA 3BTME 4UFFH 4ZHMU 5DP6A 1O2TA 4FUBA 4X8TH 1FXYA 4AB9A 1A7SA 4TY7A 1BCUH 1OPHB 1ESBA 2K1QA 1QRZA 1O0DH 1W11U 1QA7A 8GCHG 4K1SA 1J16A 3QTOH 1O5AB 1IQMA 3MO9A 1GHAG 1WTHD 1ZHPA 3LJJA 2DE8A 5EQQA 3TLOA 1UVPA 1WOFA 1SPJA 4OS1A 2XCFA 2P94A 1V2PT 3A8DA 3ATWA 1E38B 1QHRB 2VVCA 3U1JB 4O3UA 4CHAC 4JZIA 1LHFH 2HNTF 3M7TA 1G9IE 2W7UA 4WWYA 1MU6B 3U8TH 1IHTH 1DLKB 1P3CA 4E06H 2VVUA 1L1NA 2QCYA 3GY8A 2FTMA 2ZDNA 2VH6A 2ZPSA 2ANKH 4AG2A 1GJ5H 4DURA 2J4IA 4O03A 3PYHA 5FPTA 5TCAA 1DXWA 1GVKB 2BQ7B 3SQHE 4IN2A 2QV1A 1ACBE 3EAJA 4LZ1H 3RXVA 5A0BA 3RXDA 2BD4A 2PWXA 3ATLA 2AIPA 3SGBE 3RXQA 3N7OA 1UHBB 4K60A 2J2UA 3U8OH 2WPMS 4AZ2B 1W12U 1HV7A 1QJ1B 2BD5A 5T3HA 1TRNA 1ZTJA 4ZAEA 4B76A 1DT2A 3P8OA 2Y80A 1C9TA 1LKBA 3GCOA 3SHCH 1HLTH 8LPRA 3GCNA 1IOEA 3NZIA 2ZWLH 4IMQA 3PWCA 4AFSA 1NC6A 4XBCA 5EU8A 4XFQA 3LH1A 1ZMLA 2ZQ2A 1YLCA 1F0RA 2OBQA 1CVWH 3ZVDA 4ISIH 1UTQA 1DY9A 1SGNE 2BY5X 1W7XH 1SGRE 1C5XB 1OKXA 1YPJH 3ATMA 4IW4E 1NROH 1TNJA 3A86A 4CBNA 2TGTA 2SGEE 4CRGA 2ZHFH 1FI8A 3LGUA 2BD2A 5L6NH 1S6FA 1AE5A 2H1UA 1NU7B 7GCHF 2JH6D 3EA9A 2P8OB 3RLYH 4B73A 2FESH 3TGKE 1BTHH 5AHGH 2BDYA 1C1TA 3MU4A 2Y7ZA 2F9NA 3QK1A 1O2YA 5JB9S 1EZSC 4ABDA 2A4QA 4NFEA 2STAE 3SU0A 1DLEA 1VGCC 5I25A 1EOLA 1OSSA 1VITH 1OWHA 1TGTA 4X1NU 4Y7AA 3ZYEA 1CE5A 3AW1A 4CR5A 1O3HA 5HM9A 1DWDH 1UJ1A 4B71A 2AIQA 3LGYA 1Z1IA 3P8NA 5H4IB 1OP2A 1FUJA 3ZZBA 4AORA 2Y5FA 3T28A 1TNGA 4JMYA 1DICA 2WV4A 1GHAF 3O8RA 2PSXA 1TPPA 2O8WA 1JIMA 1SC8U 1AGJA 4U2WA 1T4UH 1VITG 4OS5A 1W0ZU 3PMBB 1AMHA 5EW2H 2C8YB 1GBJA 2XXLA 4KGAA 2R9PA 3MNXA 3GOVB 5TJXA 5I46H 1J8AA 3TH3H 4D9RA 4ZHLU 6CHAC 2BLWA 4H6SB 2OTVA 4IC5A 2PGQB 1MKXH 1C1VH 1ELVA 1P8VC 1QL8A 1XUKA 2V3HH 3KL6A 1C2LA 2W7SA 3E1XB 1P02A 2XBWA 4DT7B 3FZZA 1BJVA 3JZ1B 1NRPH 2ZDAH 3URDA 2IPHA 3UIRA 1SHYA 2SGPE 1AB9C 1J15A 4OGXA 3U69H 3FAOA 2VWLA 2WPJS 4Q7YA 1ELTA 1MTNC 3M37A 5EXNA 1HAXB 2FPZA 4FXGH 1V2RT 1SB1H 3RM2H 3SZNA 1TALA 3VGCC 3RXGA 1P2KA 5B6OA 3NK8A 1O3KA 2FOFA 1TX8A 1FIWA 2ANMH 1O2XA 2NWNA 4ISHH 1Z6JH 1UTPA 4CHAB 1CHOG 3BN9A 2ZF0H 3SOSA
chains in the Genus database with same CATH superfamily
2YNAA 2BY7X 1BRUP 1RTLA 5JBBS 1TRMA 5HKKD 2ZU4A 1BBRE 2XC0A 2PV9B 2CXVA 4Y8ZA 3E0NB 4XDEA 2DE9A 4U01A 1D4PB 3F2GA 3RM0H 2FEQH 2SGDE 1TYNA 2AHME 3F68H 3HK3B 1HIAB 2KR7A 4Q7ZA 1KLIH 1TB6H 1BUIA 3MI4A 2RA0A 2GT8A 1CA0C 1MCVA 5EQRA 1EPTC 1AVXA 3TPIZ 1UCYE 1LKAA 1P2JA 1O5EH 1THPB 1ZTLA 4NWLA 1GI6A 1EFRD 1GBTA 1TGCA 2GVFA 1MAYA 1P2NA 2F9PA 4UDWH 2W5EA 1AE8H 1DUEA 2H2ZA 2VIQA 1GBCA 4Q80A 1PPFE 1GI5A 4WMFA 5EW1H 3OY5U 3A81A 3GCTG 1F0SA 1XKBC 1SLVB 1ZYOA 2BVSH 2FOGA 2NU4E 2ZECA 4X1SU 4X8VH 5ESBA 2PSYA 1NM6A 3V12A 2FO9A 1H9IE 1TWXB 4JK6A 4Q4LA 1IQLA 1OWDA 2FI4E 4DJZB 1IQGA 1C4U2 1OOKB 3SBKA 2BX4A 3M5NA 4B75A 1DM4B 3RUOA 5C1XA 1G3DA 3SUGA 1GMDG 2Z6BD 1CHGA 1C2FA 2ZG0H 3UQOA 2SNVA 1SLWB 4K2YA 3RXHA 4NZLA 2GD4B 1SQAA 4AB8A 1GHZA 3H7OA 1FY1A 5C0UA 4NIYA 3P8FA 4RT1A 2KCPA 4INLA 3OU0A 1NN6A 3A83A 2FOMB 2GT7A 1KIGH 3M5OA 1AUJA 4RSPA 1A2CH 1LCYA 4O9VA 1XX9A 2W26A 4XBBA 1P2OA 1O5BB 2O8LA 3U8RH 1TGBA 3Q76A 1VITF 4KTCA 3Q77A 1FONA 1O3NA 1SQTA 1QGFA 3JZ2B 3R0FA 2ZFSA 1SGEE 2W3IA 5K0HA 3SJ9A 1TX6A 4CRFA 4INKA 1UVTH 3T27A 3MNCA 1SGDE 1W0YH 1HPGA 3F9FA 2HLDD 1INCA 1O3AA 3GDSA 4K8BA 3V0XA 1NFUA 1TONA 1RS0A 2ZDLA 1VGCB 2P59A 1NFWA 1VCQA 2QXHA 2UWOA 1NU9A 3PV5A 1EQ9A 4JZDH 2V0BA 2AH4X 2C90B 1GG6C 4K8YA 3UOPA 3DHKH 5ETXA 4B2CA 5AF9H 5G4BA 1T8NA 1H4WA 3KYGA 2GV7A 4JK5A 1Y3VA 3AAVA 3RXUA 1KSNA 4X6PA 1A0LA 1V2JT 2WYGA 2ZGJA 3SU5A 5CDFE 3HKJB 1MU8B 1Q31A 4FVBA 3U1IB 1LPKB 3D62A 3NWUA 4AOQA 1KYNA 3SV8A 1O3PB 4GPGA 5HM2A 1EJAA 3LOXA 4RKOB 2ZHQH 1MCTA 3QDZB 1ID5H 4UEHH 1V2NT 2R3UA 3MHWU 6CHAB 1SL3A 1WDIA 1GI8B 2ZP0H 1UTJA 1AKSB 1TAWA 1TBZH 5JPMH 2CMYA 1D6WA 2EI6A 1V2ST 2GZ7A 3EE0B 3M5MA 3T5FH 2IOTA 1YYY1 3A7WA 1C1SA 4WJG2 4FOUC 2QE7D 1A46H 5JBCS 4Y0ZE 3BTWE 2A2QH 4RKJB 5F6MA 3S0NA 1EJNA 3KIDU 1ANBA 2KM0A 2VIWA 3UB0A 4Y0YE 1YBWA 3A80A 3BV9B 3LGTA 1BB0B 3KQDA 5PTPA 3SJIA 2LNCA 2GJGA 1UTLM 2WPIS 4D7GA 1FAXA 1FY8E 4IMZA 1O3FA 3B23B 2FDAA 1MTNB 1HYLA 3F0OA 5HGGA 4I31A 4X2YA 2QXJA 3ZZCA 1GBMA 3ZZ5A 4I32A 1RIWC 2QAAA 2A5AA 2OC8A 4TWWA 2L6OA 1WSSH 1XXFA 1N6YA 1Y3WA 2H9TH 2KAIB 2A45B 2Z94A 3W95A 3GCTF 3SJOA 1JRTA 2A0QB 2VIOA 2PTCE 3RMMH 2RCEA 2ZZUH 1D3TB 2KZ4A 3ZZ9A 3EGKH 1H1BA 4H6TA 2ZGCA 3FP6E 1SHHB 3T2NA 2GMTC 3MWIU 1OP8A 2I6SA 1QQ4A 4AG1A 2J9NA 1HCGA 1Y5UT 2BYAX 3TJVA 2FLBH 2CK3D 1HXFH 1J17T 5L2ZH 1HJAC 1TOCB 2ZCHP 1BMMH 1G37A 2TRMA 4NGAH 2ZEBA 5T6GA 4RN6A 4DG4A 3GY2A 1BQYA 1ZZZA 5KGOA 4DGJA 2AERH 4BTIB 4F4OC 3VFEA 3I78A 1K28D 3OE7D 2EEKA 1CA0B 3VPKA 1Z7KA 1EPTB 4MNYA 5FBIA 3BTQE 2Z9JA 4MNWA 1P10A 1Z1JA 2GP9B 3ATIA 3A85A 2OBOA 1EX3A 4NA8A 2ZU3A 1NFXA 1EB1H 1ZSLA 2O8UA 3V7TA 4OS6A 2C4FH 5A2MH 5E2PA 1P12E 1C1UH 2BY9X 4SGAE 1O36A 2XRCA 3KN2A 2ALVA 3D23A 1HBTH 1THSH 1O3LA 1PPZA 2J95A 9ESTA 2ZDKA 3H5CB 1TX7A 2FOHA 1C5TA 1O2ZA 1XM1A 4VGCC 4D76A 4X8SH 1GGDC 2O8MA 3SNAA 1TNLA 1SGIB 1W14U 1NY22 8ESTE 2ZNKH 9LPRA 2CHAC 1HJ9A 2UWLA 4K1EA 4K5ZA 3A7XA 1GI9B 1ETRH 3L3TA 2UUYA 1H8ED 3KF2A 1WAYB 1XUJA 2ZHEH 4GSOA 1W0KD 2ODQA 3WW7A 4ACAA 1K21H 1C1MA 5DG6A 2J98B 1YPMH 1BBRH 4HGCA 4K3JA 2ZQ1A 4JZFH 3RC6A 1K2I1 4LOYH 4NIVA 2G52A 2V7QD 3UPEA 2QF5A 2WV9A 2W6ID 1MBQA 2F9BH 4OS4A 2O9QA 2VWOA 3UR6A 1WUNH 3EA7A 4ESTE 2TGAA 2Q6FA 2LELA 1QBVH 2EQNA 4ACBA 1OWIA 5A09A 1GVLA 4UE7H 3ZZDA 1C5PA 1ABIH 1EZXC 2Z9KA 3P17H 4A1TA 1JMOH 3WY8A 1DITH 1MAXA 2WPKS 2Y5GA 2Y7XA 1ZJKA 3EDXB 1C5QA 1UW7A 3TK5A 5E0HA 2FXRA 1PPCE 1GBFA 1ZPZA 1F5KU 2ZDMA 3P70B 3TU7H 4THNH 5DP9A 1BTWA 4NIWA 2PFEA 2NU2E 1GG6B 5FXLA 2HVXA 2BOKA 1H9LB 2ZU5A 5JYIA 3SJKA 1Y3YA 1FY5A 1OWEA 5E0GA 2XNDD 1GJCB 1YPHC 2FOBA 1LTOA 1QURH 4XSKU 3A8BA 3GYLB 1KXAA 1BHXB 2CGAA 5FX5A 1WV7H 5LPRA 1P01A 1K9OE 3T62A 1AQ7A 1O2UA 1SLUB 1WU1A 2PGBB 1Z8JB 3LGIA 3EE7A 4ZKOU 1LVBA 1YKTA 2TIOA 3RMOH 1RFNA 1GJ4H 3PWBA 5FHTA 1CGHA 1HXEH 4Y79A 1E1RD 2UWPA 1CT4E 1S6HA 1O2NA 5FPSA 4FUHA 3FP8E 1GDNA 4JZ1A 1DSTA 4MPXA 4NWKA 1HDTH 2ZFRH 1ARCA 1GL1A 3SI4H 2V3OH 4MDSA 1IQIA 1FN6A 1UTOA 2IJOB 2XBXA 3UAIC 1XUHA 3BIVH 4X8UH 1V6DA 5FAHA 2BLVA 1BMFD 2BXTH 1GJ6A 4CH8B 1H8HD 1P2MA 6GCHG 5DKMA 3ZVFA 4ABAA 1C5WB 1C1PA 2H5DA 1NBMD 4JYVH 1V2UT 1O2GH 1O5DH 1GHWH 2AMPA 4I8GA 2HPPH 2ODYB 4AGJA 1GJAB 3MH6A 4ABBA 1B5GH 2BDGA 4YLUA 1C2IA 2OD3B 4NCYA 1PFXC 1QB1A 3BTTE 2NU0E 2FX4A 1RIWB 3DSPA 5JDUB 1J9CH 2VGCC 3NKKA 2FODA 1BRBE 3KGPA 1EP6A 3E16B 1BDAA 1RRKA 3BTGE 3QTVH 2FOCA 1LVMA 4YTAA 3AK5A 1O31A 4NA7A 2FIRH 1C5MD 2G81E 1YLDA 2VWMA 2VNTA 5KECA 2ZCKP 1QBNA 1QJ7B 1GBEA 1PPGE 2CF8H 1O3EA 4YM9A 1HJAB 2TBSA 4FUCA 4OS2A 3FP7E 3KQEA 1CQQA 1DSUA 2C8WB 3FZDA 1ORFA 1S81A 2BX3A 1C5YB 2PR3A 3SV2H 4BAOB 1RTKA 1O2OA 5LPEA 1SBWA 3L33A 4WMEA 1C1QA 2DUCA 4IS5A 2SGFE 3SU4A 3F2HA 2WUCA 5EPNA 5C2ZA 1FNIA 1S83A 2OC7A 5BPEA 1YPKH 3SW2B 1BJUA 3QZRA 3U9AH 2L74A 3V13A 3Q00A 1E35B 2PKAA 2QF4A 1QRXA 5LGOA 1LHCH 5L30H 2EY4C 2QYIA 1O2KA 1L0ZA 3LPRA 3A7TA 3T25A 4BAMB 1CA8B 5ABWA 4FVDA 1GI4A 2A7CA 1Z8RA 1MABB 1G30B 2HALA 1OYTH 7KMEH 3QUMP 1TQ0B 4Q63A 3ZZ6A 3PV4A 3SUDA 3F9HA 4Y11E 3BF6H 2F43B 4LK4A 1GHXH 1AI8H 1COWD 4MVNA 4GAWA 3ZYDA 4BTUB 2UUKB 1W3CA 1AD8H 2ZO3H 2B0FA 1ELDE 2HNTE 3E6PH 1C5UA 2OQ5A 2G4UA 2NU3E 3MYWA 2PHBA 1KTSB 4Q2KA 1CT0E 3MH7A 4XOJA 3N7EA 3BTEE 3GY6A 2J92A 4XBDA 2ZPRA 5LPFA 4X1PU 4NFFA 1TABE 4K1TA 5EJLA 1D9IA 2BLOA 3BEUA 2ZTZA 1QR3E 4WMDA 3GCHC 3PO1C 4R0IA 4WVPE 5F8XA 3HPTB 3SV9A 1QFKH 2XYAA 1QB9A 1C5SA 4ISOA 1TLDA 3M5LA 3TGIE 1MMJN 2BY6X 4I8JA 3TH4H 3BTDE 1P03A 1UK2A 2ULLA 1ZJDA 1LO6A 3O8CA 3TH2H 3UUZA 2BY8X 3PTNA 3A88A 5C1YA 3QN7A 1SGQE 4MNVA 2XCNA 4ISNA 1DANH 1QIXB 1V2KT 4BAKB 2ALPA 6GCHF 1XVOA 5FCKA 5K7RA 1FPCH 1ANEA 1L1GA 2GDDA 4GLYA 4ZKNU 4BXSA 1LQEA 4FUDA 5CHAC 1O3OA 3STJA 1C1WH 3M3TA 5HIZA 2NU1E 4ASHA 2SGAA 3P6ZB 3QO6A 1TNHA 4FUEA 2YMSC 2AMDA 3QZQA 2ZTYA 3KYFA 1PPEE 4HTCH 1RJXB 1KMHB 3K2UA 1BA8B 2GKVE 4BOHA 1IQJA 1C4Y2 1WCZA 1E36B 3TNSA 4ZUHA 3HK6B 1FJSA 1TA2A 1LPGB 3MTYA 3O8BA 1T31A 1Y3UA 2AGEX 2OQUA 3FVFB 4ASUD 1HAVA 1E37B 3ZVBA 1CO7E 1ZPBA 2F91A 3MO3A 1OWKA 3A8CA 2OXSA 2A5KA 3SGQE 5C20A 3MU0A 3GY4A 1BTYA 1DDJA 4KTUA 4BTTB 5DP8A 1UVOA 1SFQB 3RP2A 4X6NA 4YZUA 1O3CA 1VCPA 3HGPA 5IK2D 1BBRK 1KLJH 1L4ZA 2XC5A 5B6LA 3TNTA 3V3MA 3DUXH 1EB2A 2PW8H 1YC0A 4MNXA 1FY3A 5DK1A 3K6ZA 2VGCB 4I8HA 1QL7A 1QCPA 3UTUH 1LDTT 3DSOA 2VINA 4Y8YA 2ZKSA 1S82A 1GJ9B 3RXFA 4J1YA 4Q7XA 3SNBA 4UFDH 1P05A 3RXCA 2VBCA 2PKSC 3LH3A 1DS2E 1UCYK 1BMNH 1GL0E 4F49A 3ZVGA 1H9HE 2AMQA 3AVZA 1EAWA 1C5OH 1DFPA 5EXMA 3SHAH 1AN1E 3ZZ8A 3F9GA 5A0AE 3TGJE 3QLPH 2RA3A 1GMHG 2VVVA 1EZUC 2O8TA 4ISLA 2R2MB 1AY6H 1CU1A 1K1OA 1G2MA 1THRH 2J5UA 1Y5AT 2XTTB 3RXLA 1YLNA 4XD7D 1KDQA 2B9LA 1O2VA 4LZ4B 1BMAA 3MH4A 1KXFA 1JXPA 4K69A 2HLCA 2P16A 1P9UA 3CP7A 3ESTA 2ZCLP 2QA9E 4RT0A 5GDSH 3MFJA 1T8OA 1UVSH 1W2KH 1YGCH 1SSXA 2J97A 2JH5D 2KFWA 3DFJA 3LU9B 4FU9A 3SNDA 4X2XA 2FX6A 2K8IA 4GVUA 3QWCH 4TPYA 3UNSA 2VIDA 4GCHF 1D6RA 3LKWA 1O2JA 3NRLA 1P11E 1BTXA 1C5VA 4UFEH 2ZU1A 2FS8A 1KLTA 2PUXB 2WV5A 1IQHA 2BDBA 2A4RA 1K1LA 4MTBA 2M5TA 3QX5H 4J2YB 5F53A 5GNDA 2WYJA 1D3QB 1C2GA 3TJNA 3TJUA 2WPLS 5A8YA 1UK4A 2BQ6B 3HGNA 2Q1JA 4R8TB 3KQCA 3GCHB 1FZZA 3CS7A 3PLPA 4FUFA 3SI3H 1N1LA 4D9QA 3B8JA 5EODA 1LVYA 1SGFA 8KME2 3PTBA 1NESE 1P2QA 4D7FA 4ZROA 5DGJA 1O38A 4DVAU 2ZTXA 1TMBH 2IJD1 1HNEE 1PPBH 1S84A 1EUFA 3VXEH 1F5LA 4Y8XA 5DP3A 3PLBA 3GYMA 1NPMA 1Q3XA 1HB0B 4FUJA 1MKWK 1O2PA 3FO8D 1O2QA 3SU1A 3OFND 1AB9B 4A1VA 2RG3A 1NFYA 1LVOA 5CHAB 1E1QD 4MPVA 1MH0A 3BG8A 1XUFA 2B8OH 1FQ3A 3LGVA 3MH5A 1GI7B 1EAXA 3W94A 4AGKA 4UFGH 2GCTC 3VGCB 1NRQH 4M7GA 1FMGA 1Y5BT 2YMSB 2C3SA 1C5RA 1NZQH 1IQFA 3GDVA 3OAAD 1B0FA 4TY6A 4WH8A 1YCPH 2JIZD 1WXRA 3PLKA 1K0HA 3E3TA 3ELAH 1V2TT 4DIIH 1NTPA 5JBTA 4WXVA 5DN6D 1T7CA 6LPRA 2BD8A 3GY3A 3N7DA 4OGYA 3A7YA 4X2WA 1UTNA 1PYTC 1XUIA 2EI7A 2QF3A 3I77A 2R0LA 1A5IA 2XW9A 4X6MA 2FYRA 1C2EA 1QL9A 1LHDH 2JH0D 3M35A 3ZV9A 2QXGA 1GCTC 4YOGA 1HJ8A 1O2LA 1ESTA 1GHVH 1EXFA 4I8LA 1ZRKA 4DW2U 2QC2A 2Z3CA 3RXOA 1GMHF 2PLXA 4MPWA 1QQUA 3RDZA 1TPSA 5FL7D 1F5RA 2F9OA 2W6JD 4F48B 5J4QA 1Y8TA 1VJAU 3RXRA 1S5SA 3IG6B 1TIOA 2K0QA 4PROA 3GDUA 1EZQA 1SGYE 2FMJA 2GZ9A 1AVWA 3DFLA 3S9BA 1XMNB 1ZLRA 1VZQH 3BG4C 3SN8A 2Y81A 3G01A 1LQDB 1SGCA 3SORA 2BDIA 3EQ0H 2FZZA 2H6MA 2PKSB 2ZFQH 3LONA 3E8LA 3PRDA 4KP0A 4YO9A 2GV6A 1W7GH 4P02A 1MUEB 3LDXH 3PM3A 4GUXA 1D3PB 3SO3A 2W3KA 1M9UA 2ZHWH 2YMSD 3SU6A 1EJMA 3ZZAA 3RXKA 4Y76A 1HFDA 5DP4A 3D49H 1ZHRA 1KXEA 1PQ7A 1O32A 1V3XA 1UTMA 2J38A 1BTPA 1VR1H 2VWNA 4YOIA 3Q3KA 3P92A 3VXFH 2UUJB 1O5GH 2ZGXH 2Z9IA 1NRRH 1C1RA 4NSVA 1GI0A 1UCYH 2YOLA 1TMUH 4JYUH 2XBYA 1HGTH 1ZHMA 1A3EH 3LC3A 2ZU2A 1EASA 2BDHA 3M61U 2VJ1A 1L1JA 4P00A 2GCHG 2G51A 4U30A 2JJ2D 1TBRH 2G8TA 4JYTA 3KQBA 1TFXA 1YPLH 1V2LT 1NRSH 5HMAA 4TPIZ 2A32A 2JKHA 1TNIA 4MG3A 3LJOA 2G5NA 3MU1A 2WPHS 3C27B 2CF9H 3RLWH 1S85A 1SOZA 2OINA 3TK9A 1ANDA 1XXDA 4CBOA 4B6FA 3SUEA 2WZQA 2YNBA 4E05H 2TGPZ 2H9HA 2SGQE 3KHVA 1NBME 4X0WU 1C5LH 3RXBA 1MTWA 1UO6A 1K1IA 5HIYA 2R3YA 1G3BA 1UHBA 2VU8E 3A82A 1TA6A 1U6QA 4NSYA 3RXAA 2XNIA 4OM9A 4CH2B 2PUQH 2SNWA 3K65B 2D2DA 4Z6AH 3S9CA 1C2DA 2R0KA 1LPZB 5E8EH 1WBGB 2A4GA 3S69A 3GY7A 4YT7H 2Y6TA 1GBIA 1WYKA 1P04A 2OLGA 3K6YA 4CRDA 3MMGA 1C2JA 1BIOA 2ZGHA 1XVMA 1YWUA 1QTFA 1T8LA 2FI5E 4ZXYH 2JDID 4NZQA 4Z0KA 1GBBA 1UK3A 4AYVB 2Z9LA 2HGTH 2STBE 1GBKA 2BVXH 4A5TS 2F9UA 3URCA 2BM2A 1PQ8A 2Z7FE 3HKIB 3IITA 1LHGH 4I7YH 4WXIA 1F0TA 1KTTB 4MPUA 1XUGA 2CV3A 5F03A 3M7UA 1FV9A 1ZRBA 2GCTB 3UWIA 1T8MA 5DP5A 2HRVA 1K1JA 1MQ6A 4H42U 4Y6DA 4CRCA 4ZH8A 1GPZA 1TRYA 3PV2A 4IGDA 1O34A 1H8IH 1HAIH 4B6EA 4JCNA 1O3BA 5EJZA 3ZZ7A 3R3GB 1DX5M 4HZHA 3EYDA 3OSYA 5GWZA 2P95A 4NA9H 2GMTB 4CR9A 1Z6EA 4YESB 3GISB 3U98H 1BTUA 1MKWH 2GX4A 3RXTA 1ZMNA 3VB6A 4JZEH 1VJ9U 3MU8A 1MD8A 1O3MA 3ZVAA 2F83A 1Q2WA 2A5IA 2A7JA 4YOJA 1KXDA 3H7TA 3BTFE 1C9PA 1GCTB 1SR5C 3F9EA 1IHSH 1K1MA 1Y3XA 3RXSA 3SQEE 4DT4A 3A89A 1ZGIA 3EA8A 3UQVA 2RFKC 3UNRA 1A0HB 1K22H 3SU3A 1HRTH 1F7ZA 3RXMA 5EXLA 5DO4H 5TCCA 1EP5A 2ZHDA 2AYWA 1CT2E 1YPGH 5AFZH 1TOMH 5F8ZA 5GJ4B 3SNEA 1EKBB 4CREA 5FX6A 3ZZ4A 1O30A 1V2VT 2BD9A 1AZZA 3F1SB 1MTVA 3BG4B 3FANA 1BITA 1NRNH 1TPOA 5JBAS 1EOJA 1C5ZB 4VGCB 1FDPA 1C2MA 2QF0A 4IBLH 5AFYH 2ZDVH 1GGDB 1XKAC 3NPSA 1AVGH 4RI0A 3P8GA 2A31A 2XWBI 5GXPA 1MZDA 2CHAB 2AGIX 2GCHF 4KELA 2FP7B 4D8NA 3BEFB 5IDKA 1O35A 1YP9A 1C2HA 2ANWA 2VH0A 1PJPA 1P2IA 5GCHF 4NG9H 1O39A 3RC5A 1O2WA 3KNXA 1SQOA 2OCVB 4FU7A 1N8OC 3MU5A 5DPAA 1ZR0A 3UR9A 1X7AC 1DVAH 1QNJA 4Y7BA 5EG4A 4OS7A 1RTFB 1FX0B 1JBUH 1GJ8B 4U32A 4X2VA 2EI8A 2V35A 3VEQB 3A87A 1PYTD 5CHBA 4ABGA 4AX9H 1LHEH 3PB1E 4M9FA 6ESTA 2GZ8A 3IWMA 5JB8S 1QZ8A 5J4SA 5DJ7A 2Q6GA 3E0PB 3SGAE 2KCAA 1ZSKA 3OY6U 1OP0A 3BEIB 3CS0A 2BD3A 4TWYA 2H9EH 1YY3A 1VCWA 1MTSA 2A2XH 4KTSA 1ETTH 2ZFFH 8GCHF 1GJ7B 1HAZB 5IYTA 3D65E 4GHQA 4WF8A 4CRAA 5CE1A 1YCPK 1TNKA 2TGDA 2V6NA 3ENSB 3MNBA 2PKAB 3KCGH 2Z3EA 3UREA 1T4VH 2ZI2H 2BHGA 3ZV8A 4GCHG 3PROA 1O37A 2WPDD 2VIPA 3KEEA 4ZHAA 2B7DH 2FOEA 1A1RA 1E34B 1AIXH 1IQKA 1S6LA 2QXIA 1IQEA 1TE0A 4ZKSU 2G4TA 1SGFG 2D26C 1HAYB 3VB5A 1BOQA 3UY9A 1HIAA 1JRSA 3RC4A 1OYQA 3DD2H 4TYDA 2M2AA 2ZC9H 1BTZA 4A6LA 2WUBA 1Z8IB 2BZAA 2HWLB 3Q3YA 5FPYA 4IN1A 1ZOMA 3WWBA 1O3DA 2G00A 1AU8A 1GHYH 1PQAA 1CGJE 1DOJA 2FOAA 1G3EA 4AFZA 2OC0A 5SGAE 2G55A 2IPQX 4O97A 1RD3B 5AVDA 1B7XB 2B5TB 1FLEE 1TPAE 1GCDA 1TQ7B 4SGBE 5FBEA 1Y59T 3PRBA 1GJDB 1C1OA 4AC9A 2ILNA 1CBWC 1QY6A 1HAGE 1ELBA 1WQVH 1ARBA 1IQNA 2Y5HA 2IN2A 3MQKC 1GVZA 1JOUB 1QBOA 3AW0A 1GHBG 1GDQA 1JWTA 1WTGH 3VB3A 2BOHB 1RXPA 4ABJA 1PPHE 4MQAA 2G5VA 3AASA 1V2OT 1A0JA 5C1UA 1YPHE 1O2MA 1V2MT 1J14A 1BZXE 4MLFB 4BXWA 5E2OA 3RU4E 1PQ5A 1G3CA 2BVRH 1ANCA 1ELCA 5E0JA 3STIA 3F6UH 1MD7A 2ZA5A 3T26A 3VB7A 2F3CE 2FI3E 1QA0A 1TMTH 1P06A 1GBAA 3RU4T 1GMCG 2QN5T 1IAUA 1EAIA 4X6OA 3RXIA 2RDLA 4DIHH 1ELAA 1DPOA 2FYQA 3MOCA 1NS3A 2ANYA 3A8AA 3E91A 1YCPM 4DY7B 5DP7A 3TVJB 1AWFH 1C2KA 1F2SE 5A8ZA 3VB4A 3SV6A 1DWCH 1DE7H 3OYPA 4BAHB 2A1DB 3M7QA 1NT1A 2EC9H 1ELEE 5GPIB 2H5CA 3RU4D 4UD9H 1AFEH 1TGNA 2D8WA 5EJ1A 3LC5A 1P3EA 1C5NH 2UUFB 2I6QA 5C3NA 1O5CB 1FN8A 4ABIA 1T32A 3Q3XA 1HAPH 1DUAA 1HAVB 2F9VA 4ZKRU 2FS9A 5KEDA 3UNQA 4ABEA 1SFIA 4NIXA 5A0CA 2XBVA 4INHA 4KKDA 4A92A 4HG6A 4YT6H 1O2SA 2Y82A 2C8XB 3ATKA 4I8KA 2BMGB 2GTBA 2ODPA 3PMAB 1ZPCA 1OX1A 3ITIA 2Z3DA 3M36A 4B2AA 1AFQC 4ZMAH 2CN0H 3U28C 2AGGX 2P3FH 1GWAA 5C67A 1ABJH 1ELGA 2XC4A 2BZ6H 1SI5H 1ZMJA 4Z1MD 1YF4A 5GIBA 1GBDA 1EATA 1O5FH 3GY5A 1O2RA 3A7ZA 4ABHA 2VIVA 4WH6A 3N99A 4BAQB 3OEHD 2JETC 1MBMA 1NO9H 3TITA 1AKSA 4H4FA 1ZTKA 3CENA 4ZXXH 2THFB 2J34A 4I33A 3MO6A 1SGTA 1N8OB 3LT3A 1O2HA 1ESAA 3OX7U 1H8DH 5HYOA 1FPHH 2PTNA 1P9SA 1AUTC 4B74A 2P93A 1G36A 1F0UA 1LMWB 2ZFTA 4TSFD 3UWJH 1W8BH 3B9FH 2FWWA 3QGJA 4ABFA 1AZ8A 1AHTH 2QY0B 1A61H 3I29A 3A7VA 3S7KB 1GI3A 3BTKE 2OK5A 3PO1B 1G32B 1MTUA 1KDQB 1A4WH 2P3TB 5CMXH 2OUAA 3SZEA 1L4DA 1K1PA 3RMLH 1KY9A 1S0RA 3AAUA 2BD7A 2KAIA 4GHTA 5EPYA 3E90B 3SU2A 1OS8A 1HUTH 1V2QT 4O3TA 2BB4A 1GHBF 1V2WT 1L2EA 1ZGVA 3ODDA 5C5NA 3BTHE 1A3BH 1QRWA 2BQWB 1MQ5A 4FUIA 1ETSH 1CHOF 5EIYA 2SFAA 2C93B 1ELFA 1SOTA 3SJ8A 5BRRE 1O33A 1P0SH 3NCLA 5T6FA 1W0JD 2ZIQH 3BIUH 3TK6A 4A7IB 3BSQA 4E7RG 2ASUB 2OP9A 1P09A 3ZVEA 2VB0A 1EPTA 1FIZA 2GDEH 1C4V2 1EAUA 1GMCF 3RXPA 3T29A 1BT7A 4WY3A 2KCOA 2ESTE 2ZGBH 4XE4A 2AFQB 5L2YH 3FFGA 2ZFPH 3TJOA 2TPIZ 1DXPA 3K9XB 2WINI 3ODFA 1CGIE 3DCLA 1HAOH 1CBWB 5T1VA 4F55A 5T6DA 1B0EA 2KX4A 3SUFA 5C94A 1QJ6B 3F3BA 4FU8A 4X1RU 5ESTE 2GGVB 4FUGA 3PMJA 1G2LA 7ESTE 1JIRA 1GBHA 4ZCNA 1TBQH 4B1TA 3GICB 2A7HA 4AN7A 3UOUA 3OTPA 2HVYB 3RXJA 1KXBA 2Z9GA 4DOQA 3DA9B 1GDUA 4AFUA 2BDAA 4BNRA 1CSOE 1GI2A 2FM2A 2J98A 2V3MA 2QGRA 1YPEH 1GMDF 4IC6A 3A84A 4HFPB 4HI3A 3HATH 1SG8B 3M3SA 1O3GA 3F0PA 3CNRA 3DSGA 1DWEH 3SYJA 1S0QA 4AFQA 1C1NA 3ZZ3A 1O3IA 5EGMA 1MZAA 1F92A 3ZIAD 2HNTC 4Y71A 1A5GH 4QT8C 1GJBB 5A8XA 4BANB 3ZVCA 3S9AA 2FLRH 2RDEA 2OC1A 3OTJE 1BRCE 1GI1A 2ZPQA 2D1JA 2BLQA 1AWHB 1W13U 2P8OC 2XWAA 2C8ZB 1SGPE 4E7NA 4YLQH 3MNSA 4CRBA 2P3UB 1BRAA 4Y10E 1BHXF 1RGQA 5F8TA 1UVUH 1Z71A 3DT0H 4B2BA 2BXUH 2HPQH 3L6PA 1SLXB 1FAKH 1WQSA 5C5OA 3C1KA 1UMAH 1OWJA 1UTKA 3UFAA 1MKXK 1K1NA 4FETA 4AYYB 1DWBH 2HOBA 1SVPA 1FY4A 3QGNB 1GBLA 3P95A 1P57B 5EOKA 3H09A 1E0FD 2BTCE 1AFQB 1N6XA 1O2IA 2A4OA 2LPRA 1TGSZ 1BMLA 2J94A 2AEIH 5LH8A 1Z8GA 1W10U 3WWFA 2QIQA 1SMFE 7GCHG 4A1XA 3O8DA 2FTLE 2JETB 2R2WU 4DCDA 3M3VA 5GCHG 4X1QU 4UONA 3LIWA 1ZSJA 1A5HA 1YM0A 3PMHB 3RXEA 3TIUA 3NUMA 1DY8A 2LP6A 1HAHH 1QB6A 2CJIA 2EA3A 1D3DB 3S7HB 4LXBH 1AO5A 3SNCA 5FCRA 1O3JA 5HXFA 3RMNH 3LGWA 1OXGA 5EQSA 3SV7A 2AS9A 2Q6DA 1KXCA 2BDCA 3NXPA 3BTME 4UFFH 4ZHMU 5DP6A 1O2TA 4FUBA 4X8TH 1FXYA 4AB9A 1A7SA 4TY7A 1BCUH 1OPHB 1ESBA 2K1QA 1QRZA 1O0DH 1W11U 1QA7A 8GCHG 4K1SA 1J16A 3QTOH 1O5AB 1IQMA 3MO9A 1GHAG 1WTHD 1ZHPA 3LJJA 2DE8A 5EQQA 3TLOA 1UVPA 1WOFA 1SPJA 3FN8A 4OS1A 2XCFA 2P94A 5C17A 1V2PT 3A8DA 3ATWA 1E38B 1QHRB 2VVCA 3U1JB 4O3UA 2WHXA 4I86A 4JZIA 4CHAC 1LHFH 2HNTF 3M7TA 1G9IE 2W7UA 4WWYA 1MU6B 3U8TH 1IHTH 1DLKB 1P3CA 4E06H 2VVUA 1L1NA 2QCYA 3GY8A 2FTMA 2ZDNA 2VH6A 2ZPSA 2ANKH 5DSFA 4AG2A 1GJ5H 4DURA 2J4IA 4O03A 3PYHA 4YXWD 5FPTA 5TCAA 1DXWA 2KCYA 2PP6A 1GVKB 2BQ7B 3SQHE 4IN2A 2QV1A 1ACBE 3EAJA 4LZ1H 3RXVA 5A0BA 3RXDA 2BD4A 2F4LA 2PWXA 3ATLA 2AIPA 3SGBE 3RXQA 3GS9A 3N7OA 1UHBB 4K60A 2J2UA 3U8OH 2WPMS 4AZ2B 1W12U 1HV7A 1QJ1B 2BD5A 1E79D 5T3HA 1TRNA 1ZTJA 4ZAEA 4B76A 1DT2A 3P8OA 2Y80A 1C9TA 1LKBA 2WSSD 3GCOA 7LPRA 3SHCH 1HLTH 8LPRA 3GCNA 1IOEA 3NZIA 2ZWLH 4IMQA 3PWCA 4AFSA 1NC6A 4XBCA 5EU8A 4XFQA 3LH1A 1ZMLA 2ZQ2A 1YLCA 1F0RA 2OBQA 1CVWH 3ZVDA 4ISIH 1UTQA 1DY9A 1SGNE 2BY5X 1W7XH 1SGRE 1C5XB 1OKXA 1YPJH 3ATMA 1SKYE 4IW4E 1NROH 1TNJA 3A86A 4CBNA 2TGTA 2SGEE 4CRGA 2ZHFH 1FI8A 3LGUA 2BD2A 5L6NH 1S6FA 1AE5A 2H1UA 1NU7B 7GCHF 2JH6D 3EA9A 2P8OB 3RLYH 4B73A 2FESH 3TGKE 1BTHH 5AHGH 2BDYA 1C1TA 3MU4A 2Y7ZA 2F9NA 3QK1A 1O2YA 5JB9S 1EZSC 4ABDA 2A4QA 3OEED 4NFEA 3W1EA 2STAE 3SU0A 1DLEA 1VGCC 5I25A 1EOLA 1OSSA 1VITH 1OWHA 1TGTA 4X1NU 1SQRA 4Y7AA 3ZYEA 1CE5A 4TT3D 3AW1A 4CR5A 1O3HA 5HM9A 1DWDH 1UJ1A 4B71A 2AIQA 3LGYA 1Z1IA 3P8NA 5H4IB 1OP2A 1FUJA 3ZZBA 4AORA 2Y5FA 3T28A 1TNGA 4JMYA 1DICA 2WV4A 1GHAF 3O8RA 2PSXA 1TPPA 2O8WA 1JIMA 1SC8U 1AGJA 4U2WA 1VKYA 1T4UH 1VITG 4OS5A 1W0ZU 3PMBB 1AMHA 5EW2H 2C8YB 1GBJA 2XXLA 3F2FA 4KGAA 2R9PA 3MNXA 3GOVB 5TJXA 5I46H 1J8AA 3TH3H 5C0TA 4D9RA 4ZHLU 6CHAC 2BLWA 4H6SB 4XRNA 2OTVA 4IC5A 2PGQB 1MKXH 1C1VH 3KQ5A 1ELVA 1P8VC 1QL8A 1XUKA 2V3HH 3KL6A 1C2LA 2W7SA 3E1XB 2XOKD 1P02A 2XBWA 4DT7B 3FZZA 1BJVA 3FOAA 3JZ1B 1NRPH 2ZDAH 3URDA 1OHHD 3FKSD 2IPHA 3UIRA 1SHYA 2SGPE 1AB9C 2JJ1D 1J15A 4OGXA 3U69H 3FAOA 2VWLA 2WPJS 4Q7YA 1ELTA 1MTNC 3M37A 5EXNA 1HAXB 2FPZA 3VG8A 4FXGH 1V2RT 1SB1H 3RM2H 3SZNA 1TALA 3VGCC 3RXGA 1P2KA 5B6OA 3NK8A 1O3KA 2FOFA 1TX8A 1FIWA 2ANMH 1O2XA 2NWNA 4ISHH 1Z6JH 1UTPA 4CHAB 1CHOG 3BN9A 2ZF0H 3SOSA
chains in the Genus database with same CATH topology
2YNAA 2BY7X 1BRUP 1RTLA 5JBBS 1TRMA 2ZU4A 1BBRE 2XC0A 2PV9B 2CXVA 4Y8ZA 3E0NB 4XDEA 2DE9A 4U01A 1D4PB 3RM0H 2FEQH 2SGDE 1TYNA 3F68H 3HK3B 1HIAB 4Q7ZA 1KLIH 1TB6H 1BUIA 3MI4A 2RA0A 2GT8A 1CA0C 1MCVA 5EQRA 1EPTC 1AVXA 3TPIZ 1UCYE 1LKAA 1P2JA 1O5EH 1THPB 1ZTLA 4NWLA 1GI6A 1GBTA 1TGCA 2GVFA 1MAYA 1P2NA 2F9PA 4UDWH 2W5EA 1AE8H 1DUEA 2H2ZA 2VIQA 1GBCA 4Q80A 1PPFE 1GI5A 4WMFA 5EW1H 3OY5U 3A81A 3GCTG 1F0SA 1XKBC 1SLVB 1ZYOA 2BVSH 2FOGA 2NU4E 2ZECA 4X1SU 4X8VH 5ESBA 2PSYA 1NM6A 3V12A 2FO9A 1H9IE 1TWXB 4JK6A 1IQLA 1OWDA 2FI4E 4DJZB 1IQGA 1C4U2 1OOKB 3SBKA 2BX4A 3M5NA 4B75A 1DM4B 3RUOA 5C1XA 1G3DA 3SUGA 1GMDG 2Z6BD 1CHGA 1C2FA 2ZG0H 3UQOA 2SNVA 1SLWB 4K2YA 3RXHA 4NZLA 2GD4B 1SQAA 4AB8A 1GHZA 3H7OA 1FY1A 4NIYA 3P8FA 4INLA 3OU0A 1NN6A 3A83A 2FOMB 2GT7A 1KIGH 3M5OA 1AUJA 4RSPA 1A2CH 1LCYA 4O9VA 1XX9A 2W26A 4XBBA 1P2OA 1O5BB 2O8LA 3U8RH 1TGBA 3Q76A 1VITF 4KTCA 3Q77A 1FONA 1O3NA 1SQTA 1QGFA 3JZ2B 3R0FA 2ZFSA 1SGEE 2W3IA 5K0HA 3SJ9A 1TX6A 4CRFA 4INKA 1UVTH 3T27A 3MNCA 1SGDE 1W0YH 1HPGA 3F9FA 1INCA 1O3AA 3GDSA 4K8BA 3V0XA 1NFUA 1TONA 1RS0A 2ZDLA 1VGCB 2P59A 1NFWA 1VCQA 2QXHA 2UWOA 1NU9A 1EQ9A 4JZDH 2V0BA 2AH4X 2C90B 1GG6C 4K8YA 3UOPA 3DHKH 5ETXA 4B2CA 5AF9H 5G4BA 1T8NA 1H4WA 2GV7A 4JK5A 1Y3VA 3AAVA 3RXUA 1KSNA 4X6PA 1A0LA 1V2JT 2WYGA 2ZGJA 3SU5A 3HKJB 1MU8B 1Q31A 4FVBA 3U1IB 1LPKB 3D62A 3NWUA 4AOQA 1KYNA 3SV8A 1O3PB 4GPGA 5HM2A 1EJAA 3LOXA 4RKOB 2ZHQH 1MCTA 3QDZB 1ID5H 4UEHH 1V2NT 2R3UA 3MHWU 6CHAB 1SL3A 1GI8B 2ZP0H 1UTJA 1AKSB 1TAWA 1TBZH 5JPMH 2CMYA 1D6WA 2EI6A 1V2ST 2GZ7A 3EE0B 3M5MA 3T5FH 2IOTA 1YYY1 3A7WA 1C1SA 4WJG2 1A46H 5JBCS 4Y0ZE 3BTWE 2A2QH 4RKJB 5F6MA 3S0NA 1EJNA 3KIDU 1ANBA 2VIWA 4Y0YE 1YBWA 3A80A 3BV9B 3LGTA 1BB0B 3KQDA 5PTPA 3SJIA 2LNCA 2WPIS 1UTLM 4D7GA 1FAXA 1FY8E 4IMZA 1O3FA 3B23B 2FDAA 1MTNB 1HYLA 5HGGA 4I31A 4X2YA 2QXJA 3ZZCA 1GBMA 3ZZ5A 4I32A 1RIWC 2QAAA 2A5AA 2OC8A 4TWWA 1WSSH 1XXFA 1N6YA 1Y3WA 2H9TH 2KAIB 2A45B 2Z94A 3W95A 3GCTF 3SJOA 1JRTA 2A0QB 2VIOA 2PTCE 3RMMH 2RCEA 2ZZUH 1D3TB 3ZZ9A 3EGKH 1H1BA 4H6TA 2ZGCA 3FP6E 1SHHB 3T2NA 2GMTC 3MWIU 1OP8A 2I6SA 1QQ4A 4AG1A 2J9NA 1HCGA 1Y5UT 2BYAX 3TJVA 2FLBH 1HXFH 1J17T 5L2ZH 1HJAC 1TOCB 2ZCHP 1BMMH 1G37A 2TRMA 4NGAH 2ZEBA 5T6GA 4RN6A 4DG4A 3GY2A 1BQYA 1ZZZA 4DGJA 2AERH 4BTIB 4F4OC 3VFEA 3I78A 1K28D 2EEKA 1CA0B 3VPKA 1Z7KA 1EPTB 4MNYA 5FBIA 3BTQE 2Z9JA 4MNWA 1P10A 1Z1JA 2GP9B 3ATIA 3A85A 2OBOA 1EX3A 4NA8A 2ZU3A 1NFXA 1EB1H 1ZSLA 2O8UA 3V7TA 4OS6A 2C4FH 5A2MH 5E2PA 1P12E 1C1UH 2BY9X 4SGAE 1O36A 2XRCA 3KN2A 2ALVA 3D23A 1HBTH 1THSH 1O3LA 1PPZA 2J95A 9ESTA 2ZDKA 3H5CB 1TX7A 2FOHA 1C5TA 1O2ZA 1XM1A 4VGCC 4D76A 4X8SH 1GGDC 2O8MA 3SNAA 1TNLA 1SGIB 1W14U 1NY22 8ESTE 2ZNKH 9LPRA 2CHAC 1HJ9A 2UWLA 4K1EA 4K5ZA 3A7XA 1GI9B 1ETRH 3L3TA 2UUYA 3KF2A 1WAYB 1XUJA 2ZHEH 4GSOA 2ODQA 1K21H 1C1MA 5DG6A 1YPMH 1BBRH 4HGCA 4K3JA 2ZQ1A 4JZFH 3RC6A 1K2I1 4LOYH 4NIVA 2G52A 3UPEA 1MBQA 2F9BH 4OS4A 2O9QA 2VWOA 3UR6A 1WUNH 3EA7A 4ESTE 2TGAA 2Q6FA 1QBVH 1OWIA 5A09A 1GVLA 4UE7H 3ZZDA 1C5PA 1ABIH 1EZXC 2Z9KA 3P17H 4A1TA 1JMOH 3WY8A 1DITH 1MAXA 2WPKS 2Y5GA 2Y7XA 1ZJKA 3EDXB 1C5QA 3TK5A 5E0HA 2FXRA 1PPCE 1GBFA 1ZPZA 1F5KU 2ZDMA 3P70B 3TU7H 4THNH 5DP9A 1BTWA 4NIWA 2PFEA 2NU2E 1GG6B 5FXLA 2HVXA 2BOKA 1H9LB 2ZU5A 5JYIA 3SJKA 1Y3YA 1FY5A 1OWEA 5E0GA 1GJCB 1YPHC 2FOBA 1LTOA 1QURH 4XSKU 3A8BA 3GYLB 1KXAA 1BHXB 2CGAA 5FX5A 1WV7H 5LPRA 1P01A 1K9OE 3T62A 1AQ7A 1O2UA 1SLUB 1WU1A 2PGBB 1Z8JB 3LGIA 4ZKOU 1LVBA 1YKTA 2TIOA 3RMOH 1RFNA 1GJ4H 3PWBA 5FHTA 1CGHA 1HXEH 4Y79A 2UWPA 1CT4E 1S6HA 1O2NA 5FPSA 4FUHA 3FP8E 1GDNA 4JZ1A 1DSTA 4MPXA 4NWKA 1HDTH 2ZFRH 1ARCA 1GL1A 3SI4H 2V3OH 4MDSA 1IQIA 1FN6A 1UTOA 2IJOB 2XBXA 1XUHA 3BIVH 4X8UH 1V6DA 5FAHA 2BLVA 2BXTH 1GJ6A 4CH8B 6GCHG 1P2MA 5DKMA 3ZVFA 4ABAA 1C5WB 1C1PA 2H5DA 4JYVH 1V2UT 1O2GH 1O5DH 1GHWH 2AMPA 4I8GA 2HPPH 2ODYB 4AGJA 1GJAB 3MH6A 4ABBA 1B5GH 2BDGA 4YLUA 1C2IA 2OD3B 4NCYA 1PFXC 1QB1A 3BTTE 2NU0E 2FX4A 1RIWB 5JDUB 1J9CH 2VGCC 3NKKA 2FODA 1BRBE 3KGPA 1EP6A 3E16B 1BDAA 1RRKA 3BTGE 3QTVH 2FOCA 1LVMA 4YTAA 1O31A 4NA7A 2FIRH 1C5MD 2G81E 1YLDA 2VWMA 2VNTA 2ZCKP 1QBNA 1QJ7B 1GBEA 1PPGE 2CF8H 1O3EA 4YM9A 1HJAB 2TBSA 4FUCA 4OS2A 3FP7E 3KQEA 1CQQA 1DSUA 2C8WB 3FZDA 1ORFA 1S81A 2BX3A 1C5YB 2PR3A 3SV2H 4BAOB 1RTKA 1O2OA 5LPEA 1SBWA 3L33A 4WMEA 1C1QA 2DUCA 4IS5A 2SGFE 3SU4A 2WUCA 5EPNA 5C2ZA 1FNIA 1S83A 2OC7A 5BPEA 1YPKH 3SW2B 1BJUA 3QZRA 3U9AH 3V13A 3Q00A 1E35B 2PKAA 1QRXA 5LGOA 1LHCH 5L30H 2QYIA 1O2KA 1L0ZA 3LPRA 3A7TA 3T25A 4BAMB 1CA8B 5ABWA 4FVDA 1GI4A 2A7CA 1Z8RA 1G30B 2HALA 1OYTH 7KMEH 3QUMP 1TQ0B 3ZZ6A 3PV4A 3SUDA 3F9HA 4Y11E 3BF6H 4LK4A 1GHXH 1AI8H 4MVNA 4GAWA 3ZYDA 4BTUB 2UUKB 1W3CA 1AD8H 2ZO3H 2B0FA 1ELDE 2HNTE 3E6PH 1C5UA 2OQ5A 2G4UA 2NU3E 3MYWA 2PHBA 1KTSB 4Q2KA 1CT0E 3MH7A 4XOJA 3BTEE 3GY6A 2J92A 4XBDA 2ZPRA 5LPFA 4X1PU 4NFFA 1TABE 4K1TA 1D9IA 2BLOA 3BEUA 2ZTZA 1QR3E 4WMDA 3GCHC 3PO1C 4R0IA 4WVPE 5F8XA 3HPTB 3SV9A 1QFKH 2XYAA 1QB9A 1C5SA 4ISOA 1TLDA 3M5LA 3TGIE 1MMJN 2BY6X 4I8JA 3TH4H 3BTDE 1P03A 1UK2A 2ULLA 1ZJDA 1LO6A 3O8CA 3TH2H 3UUZA 2BY8X 3PTNA 3A88A 5C1YA 3QN7A 1SGQE 4MNVA 2XCNA 4ISNA 1DANH 1QIXB 1V2KT 4BAKB 2ALPA 6GCHF 1XVOA 5FCKA 5K7RA 1FPCH 1ANEA 1L1GA 2GDDA 4GLYA 4ZKNU 4BXSA 1LQEA 4FUDA 5CHAC 1O3OA 3STJA 1C1WH 3M3TA 2NU1E 4ASHA 2SGAA 3P6ZB 3QO6A 1TNHA 4FUEA 2AMDA 3QZQA 2ZTYA 1PPEE 4HTCH 1RJXB 3K2UA 1BA8B 2GKVE 4BOHA 1IQJA 1C4Y2 1WCZA 1E36B 3TNSA 4ZUHA 3HK6B 1FJSA 1TA2A 1LPGB 3MTYA 3O8BA 1T31A 1Y3UA 2AGEX 2OQUA 3FVFB 1HAVA 1E37B 3ZVBA 1CO7E 1ZPBA 2F91A 3MO3A 1OWKA 3A8CA 2OXSA 2A5KA 3SGQE 5C20A 3MU0A 3GY4A 1BTYA 1DDJA 4KTUA 4BTTB 5DP8A 1UVOA 1SFQB 3RP2A 4X6NA 4YZUA 1O3CA 1VCPA 3HGPA 1BBRK 1KLJH 1L4ZA 2XC5A 3TNTA 3V3MA 3DUXH 1EB2A 2PW8H 1YC0A 4MNXA 1FY3A 5DK1A 3K6ZA 2VGCB 4I8HA 1QL7A 1QCPA 3UTUH 1LDTT 2VINA 4Y8YA 2ZKSA 1S82A 1GJ9B 3RXFA 4J1YA 4Q7XA 3SNBA 4UFDH 1P05A 3RXCA 2PKSC 3LH3A 1DS2E 1UCYK 1BMNH 1GL0E 4F49A 3ZVGA 1H9HE 2AMQA 3AVZA 1EAWA 1C5OH 1DFPA 5EXMA 3SHAH 1AN1E 3ZZ8A 3F9GA 5A0AE 3TGJE 3QLPH 2RA3A 1GMHG 2VVVA 1EZUC 2O8TA 4ISLA 2R2MB 1AY6H 1CU1A 1K1OA 1G2MA 1THRH 2XTTB 1Y5AT 3RXLA 1KDQA 2B9LA 1O2VA 4LZ4B 1BMAA 3MH4A 1KXFA 1JXPA 4K69A 2HLCA 2P16A 1P9UA 3CP7A 3ESTA 2ZCLP 2QA9E 5GDSH 3MFJA 1T8OA 1UVSH 1W2KH 1YGCH 1SSXA 2JH5D 3DFJA 3LU9B 3SNDA 4FU9A 7LPRA 4X2XA 2FX6A 4GVUA 3QWCH 4TPYA 3UNSA 2VIDA 4GCHF 1D6RA 3LKWA 1O2JA 1P11E 1BTXA 1C5VA 4UFEH 2ZU1A 2FS8A 1KLTA 2PUXB 2WV5A 1IQHA 2BDBA 2A4RA 1K1LA 4MTBA 2M5TA 3QX5H 4J2YB 2WYJA 1D3QB 1C2GA 3TJNA 3TJUA 2WPLS 5A8YA 1UK4A 2BQ6B 3HGNA 2Q1JA 4R8TB 3KQCA 3GCHB 1FZZA 3CS7A 3PLPA 4FUFA 3SI3H 1N1LA 4D9QA 3B8JA 5EODA 1LVYA 1SGFA 8KME2 3PTBA 1NESE 1P2QA 4D7FA 4ZROA 5DGJA 1O38A 4DVAU 2ZTXA 1TMBH 1HNEE 1PPBH 1S84A 1EUFA 3VXEH 1F5LA 4Y8XA 5DP3A 3PLBA 3GYMA 1NPMA 1Q3XA 1HB0B 4FUJA 1MKWK 1O2PA 1O2QA 3SU1A 1AB9B 4A1VA 2RG3A 1NFYA 1LVOA 5CHAB 4MPVA 1MH0A 3BG8A 1XUFA 2B8OH 1FQ3A 3LGVA 3MH5A 1GI7B 1EAXA 3W94A 4AGKA 4UFGH 2GCTC 3VGCB 1NRQH 4M7GA 1FMGA 1Y5BT 2C3SA 1C5RA 1NZQH 1IQFA 3GDVA 1B0FA 4TY6A 4WH8A 1YCPH 3PLKA 3E3TA 3ELAH 1V2TT 4DIIH 1NTPA 5JBTA 4WXVA 1T7CA 6LPRA 2BD8A 3GY3A 4OGYA 3A7YA 4X2WA 1UTNA 1PYTC 1XUIA 2EI7A 2QF3A 3I77A 2R0LA 1A5IA 2XW9A 4X6MA 2FYRA 1C2EA 1QL9A 1LHDH 2JH0D 3M35A 3ZV9A 2QXGA 1GCTC 4YOGA 1HJ8A 1O2LA 1ESTA 1GHVH 1EXFA 4I8LA 1ZRKA 4DW2U 2QC2A 2Z3CA 3RXOA 1GMHF 2PLXA 4MPWA 1QQUA 3RDZA 1TPSA 1F5RA 2F9OA 5J4QA 1Y8TA 1VJAU 3RXRA 1S5SA 3IG6B 1TIOA 4PROA 3GDUA 1EZQA 1SGYE 2FMJA 2GZ9A 1AVWA 3DFLA 3S9BA 1XMNB 1ZLRA 1VZQH 3BG4C 3SN8A 2Y81A 3G01A 1LQDB 1SGCA 3SORA 2BDIA 3EQ0H 2FZZA 2H6MA 2PKSB 2ZFQH 3LONA 3E8LA 4KP0A 4YO9A 2GV6A 1W7GH 1MUEB 3LDXH 3PM3A 4GUXA 1D3PB 3SO3A 2W3KA 1M9UA 2ZHWH 3SU6A 1EJMA 3ZZAA 3RXKA 4Y76A 1HFDA 5DP4A 3D49H 1ZHRA 1KXEA 1PQ7A 1O32A 1V3XA 1UTMA 2J38A 1BTPA 1VR1H 2VWNA 4YOIA 3Q3KA 3P92A 3VXFH 2UUJB 1O5GH 2ZGXH 2Z9IA 1NRRH 1C1RA 4NSVA 1GI0A 1UCYH 2YOLA 1TMUH 4JYUH 2XBYA 1HGTH 1ZHMA 1A3EH 3LC3A 2ZU2A 1EASA 2BDHA 3M61U 2VJ1A 1L1JA 2GCHG