1O3AA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3aA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3aA02
1GBHA 1ELCA 1DFPA 1C2LA 1C1OA 1LPKB 4FXGH 4NFEA 1FAXA 2H2ZA 3H5CB 1EAWA 1PPFE 1K9OE 3A7YA 3UTUH 3ZVAA 1TX6A 2J2UA 4BAOB 1T4UH 3MO9A 2A1DB 1BRAA 4A7IB 3I77A 3PLKA 3A7WA 4IW4E 2ZU3A 2P3TB 1CVWH 1QRWA 1T31A 1A0LA 1T8NA 1VCPA 1UTJA 5T3HA 3W95A 1F7ZA 1GBMA 1DXWA 1Z6JH 3NZIA 1C5QA 3MU1A 4H42U 3ODFA 1O3FA 3O8CA 1FDPA 4OS2A 1QRXA 1QURH 3GY6A 4ISOA 1YLDA 5TCCA 4X2WA 3FVFB 1QY6A 3BTQE 4BAMB 2CGAA 2PKAB 1VR1H 4JZDH 3PMJA 1E0FD 1QL7A 5HMAA 1O39A 2WPKS 4H4FA 3RXRA 3RM2H 1EXFA 1OXGA 1GBBA 3ZVEA 3LKWA 1C2GA 1YBWA 2EI6A 4THNH 2F3CE 1FNIA 1NY22 3Q3KA 6GCHF 1C2EA 1DITH 1GI9B 1DT2A 2QXGA 3U69H 3VB7A 4U01A 2J38A 2ZDKA 5IDKA 1K2I1 4INLA 1GHAG 2C8YB 4B2BA 1SHYA 1A0HB 2A4QA 3QTVH 1NTPA 2ZNKH 4ZKOU 1HJ9A 3FP7E 1NRQH 4UE7H 1E36B 1Y3WA 3MNXA 2SGAA 4YTAA 1PPEE 7ESTE 2ZQ2A 4YM9A 1O2TA 2Y5HA 5E0JA 2UWOA 2P59A 4CRBA 3E90B 1K1OA 3FP6E 2GTBA 5DP6A 3E0PB 1O5EH 5HM9A 2TRMA 4JZFH 1HAGE 1BRCE 3PYHA 3UFAA 2XCNA 1TNLA 1TMBH 2BY9X 3LGUA 3RU4D 2DE8A 1BQYA 1O3DA 3UWJH 4ZAEA 2BLVA 1ID5H 3EQ0H 3IITA 4FU7A 3GCTF 2AH4X 3VXFH 1ZSLA 3VGCC 1B0FA 5EPYA 3SQHE 2FMJA 1LHEH 4YOGA 1A5GH 3UPEA 5T6FA 3GCNA 3HK3B 1GMDG 3BG4B 4U2WA 1C2KA 1KXBA 1Z8IB 2AGGX 3VEQB 1W0YH 1UK3A 4DG4A 1OWIA 2BQ7B 3RXTA 3E0NB 1G3CA 4WXVA 4B71A 1AU8A 2TIOA 2FOMB 1MAYA 3U8RH 1A5IA 2W26A 1ETTH 1C5OH 2LPRA 1V2WT 3LJJA 1BHXB 1QQUA 1HXFH 1L4DA 2Y7XA 1EZSC 1AFQC 1B5GH 2SGQE 2VNTA 3MI4A 1A0JA 1SR5C 1P01A 1YC0A 3A89A 3NK8A 1O2LA 1AI8H 3TK9A 1GBIA 2XRCA 1ZGVA 2QCYA 1AY6H 4KP0A 1Y5AT 4X1NU 2Z3DA 4DJZB 2ZDVH 1QJ1B 3E6PH 3ZZ5A 4UFGH 1NO9H 1O2MA 1YPKH 2O8WA 1VZQH 1IQGA 4ABFA 1N8OB 1AN1E 1MMJN 1W3CA 1O3MA 3TK5A 1CHGA 3ATWA 3SJKA 1DUEA 1MBMA 3URDA 5F8XA 2PV9B 1C4V2 3CENA 1XX9A 3M5LA 5HYOA 3D65E 5AF9H 1UTLM 1ESAA 1TPPA 2EI7A 5JBTA 1ELTA 4AZ2B 2O8MA 1DSTA 1GI1A 1BMAA 3LGWA 2UUKB 1G3BA 1O3GA 1P06A 2XBXA 3A7TA 1ZHRA 3ZVDA 5C2ZA 1YPJH 1S82A 1O3BA 4Y8ZA 1CGIE 2GZ9A 1AE8H 1XUFA 1PQ5A 1UTQA 3C1KA 3E3TA 3MFJA 3SN8A 1O3PB 4AFUA 1CA0C 4JYUH 2BOKA 2GCHF 2QAAA 5JB9S 1IQEA 3EAJA 3ZZ9A 3F9FA 1ANEA 2GX4A 3BN9A 3ZZAA 2JKHA 2THFB 1XKBC 3GY5A 1HNEE 3SW2B 2P16A 3O8RA 3SGAE 1Z8RA 1ANCA 1P2KA 4MNYA 2BHGA 4NG9H 2A2XH 1O2VA 4YOIA 5E2PA 1O5CB 1UTNA 1XUIA 4NIWA 1C4U2 3P8FA 5GPIB 5EW1H 1W8BH 3UOPA 4MQAA 3GCHC 1QA0A 4XFQA 1O3KA 1HAIH 4YESB 3RM0H 4OGYA 1HIAA 1F5RA 4AFSA 2Y5GA 1V2RT 4O3TA 4XE4A 3CS0A 3KIDU 5H4IB 5T6GA 1P0SH 1O2WA 1TGCA 1MCVA 5HGGA 4CR9A 2EI8A 1ZZZA 2TGAA 1P03A 2HNTC 3V0XA 2D8WA 2J92A 1KXCA 4INHA 1XUJA 1K22H 3LC5A 5ESBA 1JBUH 2BVRH 1F0RA 2Y80A 3CP7A 1Y3XA 4YLQH 1W12U 1TQ7B 1ZPBA 5C67A 5JDUB 1PPBH 1L1JA 4JZIA 4MTBA 1PPGE 1ARBA 2ASUB 2UUYA 1LHGH 1V2OT 1S0QA 3ATMA 2D26C 4Y79A 2QXIA 1MCTA 1MAXA 1C5LH 2XCFA 2ZHEH 4DCDA 2BXUH 4E05H 1A61H 1IQHA 3RXCA 2F83A 4Z6AH 1GGDB 1O2QA 2J94A 2PGBB 3ZZ3A 1DXPA 2BZAA 1D9IA 2VH0A 3KCGH 1D6WA 1N6YA 3A85A 2FIRH 3SI3H 5FBIA 3GY2A 1MD7A 2R3YA 4OS7A 3LDXH 1MTNC 1VJAU 3MOCA 3RMLH 1CBWC 2Z3EA 1GBDA 1HIAB 1IQMA 3TPIZ 1BOQA 1OP2A 1WOFA 5F8ZA 1HGTH 2CJIA 1BCUH 1GCTB 2HNTE 2VH6A 4UFEH 1SGDE 3GOVB 1Y5BT 4ISLA 3GYMA 1WUNH 1GI6A 4ABEA 1A4WH 2XBWA 5CMXH 3SI4H 4YT6H 1ZJKA 2A5AA 1K1LA 1TABE 1XUHA 2NU4E 3NPSA 1THRH 3A8AA 1O3HA 4QT8C 3OTJE 1NT1A 2Y81A 3DUXH 1TPOA 1GBCA 1O2XA 1G9IE 1FN6A 2A31A 1ZRKA 3RU4E 2ZWLH 1YPEH 2C8ZB 2FOFA 3V13A 1OWEA 2FS8A 4A1TA 4WMDA 2Z9KA 3ZZ8A 3ZVCA 1MUEB 2ZI2H 1DDJA 3M7UA 1P8VC 1WU1A 2BYAX 1C2MA 2XBYA 2R0LA 4CRAA 4FUGA 2IPHA 2ZCKP 4B74A 1O3JA 5LPFA 1VITG 1AZZA 5LH8A 2HOBA 2C4FH 4XSKU 2C8XB 6GCHG 1THPB 5J4QA 4X6PA 4LZ1H 3F9GA 3SNCA 4LK4A 1S6HA 1CT4E 2GCTC 4NZLA 1NFXA 4U30A 3GCOA 1HBTH 3SGQE 4R0IA 9ESTA 1WQSA 3L3TA 2FOGA 5GDSH 1SMFE 3UQOA 1ZTLA 3MH4A 1VGCB 1ESBA 6ESTA 1AVXA 1JWTA 1O36A 4JZEH 3RXDA 1S85A 1W2KH 4IGDA 3RXUA 2ZDMA 3T28A 3LGVA 3GISB 1XUKA 1EATA 1GBAA 2QC2A 2OQUA 2V0BA 1GBJA 3OY5U 1LHCH 4O03A 2VIVA 3U98H 4BANB 4TY7A 1Q2WA 1AWHB 1T4VH 4MDSA 1TNHA 1EZQA 1S5SA 1UCYE 1Y5UT 1MKWH 1QBNA 2I6SA 1QBOA 3UR9A 1FY3A 3RXAA 2GVFA 5I25A 2FI3E 1P2QA 1O2SA 1NRNH 4CREA 3PWCA 1WQVH 2WUCA 4B76A 2VB0A 3LONA 2ZFTA 1GVLA 3DFJA 2WYGA 3P6ZB 1GVKB 1CE5A 1BRBE 4X8UH 1P09A 3TGIE 1C1PA 3QN7A 3R0FA 2W5EA 1QB6A 1C1QA 5DO4H 2ZQ1A 1BA8B 1DSUA 3A8DA 1XKAC 1TNGA 3K2UA 1FJSA 2AS9A 3L6PA 3A86A 3EA9A 1OWJA 3RC4A 3FFGA 1X7AC 3BTHE 1GL1A 1UTKA 2G5VA 4WH6A 4ABJA 3ATKA 1C1MA 3ELAH 3QUMP 3ZV9A 3BTTE 4JMYA 2PFEA 3RXMA 2ESTE 4NWLA 4X6OA 3M5NA 3BEIB 1MQ6A 2CV3A 1BBRH 1P2IA 1W13U 1JIRA 4UONA 3SU5A 3BTDE 4Y7AA 4ZXYH 1SGRE 4Z0KA 1FUJA 4A1XA 3P95A 3FAOA 3EGKH 3RMNH 3TH4H 3MO3A 1SGCA 2HWLB 1C1VH 1CT2E 3ZYDA 3SV9A 2WUBA 1DY9A 2TBSA 2PUQH 1Z7KA 1SGQE 1T8LA 1C5UA 1TGBA 1O30A 4MPUA 4NIVA 3B23B 1ZYOA 2NU2E 5JYIA 1TAWA 1KDQA 2GP9B 1GJ6A 2ZHQH 1C1WH 1L1GA 1TGNA 2P8OC 4GLYA 2W3IA 3E1XB 4ZXXH 5JPMH 3HGNA 3VGCB 2A32A 2BB4A 5A0BA 3RXFA 2VWOA 1QTFA 2HGTH 1RS0A 1ZJDA 2BX3A 3T26A 3VB6A 3SUEA 2CMYA 1CO7E 2WYJA 4MLFB 1W7XH 3UNRA 1SQOA 1ANDA 1BZXE 2WPLS 1WYKA 3S69A 3S9BA 1GJ5H 2J34A 4ZHMU 3ZZ7A 1FPHH 2ALVA 2FXRA 2GZ8A 1H8DH 4AYYB 3TLOA 1EAIA 4KTCA 4TWYA 1GBFA 5F6MA 4ASHA 1LHDH 3OU0A 4JK6A 2PKAA 3QLPH 2J95A 4K3JA 5DP7A 2QXHA 1C5NH 4SGBE 2WPMS 1WSSH 1AFQB 4K2YA 1C2JA 2HPQH 1DS2E 1ZRBA 2ZDNA 1O2RA 2WPIS 1EP6A 4GUXA 1SGTA 1O5BB 4WF8A 4AFQA 1O2PA 1OSSA 3HKJB 1P2MA 2VVUA 4ZROA 1XVMA 1KTTB 4KTUA 3ZVFA 4AFZA 1O38A 3ZYEA 2GDDA 2FWWA 3Q3XA 3P92A 1S0RA 2A2QH 1C5VA 4BTIB 1P10A 1D3PB 2ANYA 2PSYA 1YCPH 1C2DA 4J2YB 3PROA 4ABBA 1TONA 1AB9C 4NGAH 3RXOA 1O2GH 5DKMA 5GIBA 1V2TT 3SHCH 1GI4A 4X1SU 4Y8YA 5L30H 1KDQB 4Q80A 5EQQA 1HAZB 1GDUA 3MWIU 1Y3VA 5AHGH 3AVZA 3STIA 1EJNA 4IC6A 1NZQH 1SHHB 3SUFA 5DK1A 2XBVA 4E06H 2VJ1A 1UVTH 2Y5FA 1CA0B 5DJ7A 5A8YA 1PFXC 4K5ZA 1XXFA 4WXIA 4FUIA 1MKXK 1FAKH 1SQAA 3Q76A 1O2KA 3JZ2B 1EQ9A 1PQAA 1JOUB 1AKSA 4VGCC 1H1BA 2GMTC 1G30B 2HVXA 1KIGH 1EP5A 2ZO3H 2Z6BD 5EXLA 4K1EA 1BTZA 3S0NA 1O3AA 2ZFPH 1O32A 1DPOA 1IQFA 1GPZA 3H7TA 1G2LA 2P3FH 1VITF 3GCHB 5DP4A 1ZHMA 2YNAA 2ANWA 5FXLA 1O5GH 3MMGA 4K8BA 1V2JT 1SGFA 2WINI 1A7SA 1SLVB 1TRNA 1G2MA 3M7QA 1SBWA 1GHZA 2QN5T 1PQ7A 4R8TB 5FAHA 1UTOA 3L33A 4GHTA 4IBLH 2IOTA 1C5SA 3B9FH 2PTCE 1LPGB 3LOXA 1BJUA 1N1LA 2GD4B 4IC5A 2Q6FA 2W7UA 1F0TA 3URCA 2G51A 1TGSZ 2ODYB 2FTMA 4BTUB 2GGVB 1TA2A 3SUGA 1BMNH 1LHFH 3ATLA 2R3UA 1HXEH 1K1PA 2ZA5A 5HXFA 2FX4A 3SHAH 1A46H 4JYTA 1O5FH 1TNJA 3QWCH 2P3UB 1GI7B 1Z1JA 1GBKA 2XXLA 1KXAA 2ZGBH 4B1TA 2DE9A 3RLWH 1AKSB 8GCHF 2NWNA 6CHAC 1YM0A 1G3DA 1SQTA 2FO9A 4BAHB 4MNWA 2WPHS 3R3GB 5EW2H 5C1UA 1YYY1 3UY9A 8ESTE 3TGJE 5K7RA 5C5OA 1MTNB 3A88A 1CA8B 1CBWB 3VB3A 3AAVA 3HKIB 4XOJA 2G4UA 4GHQA 1F5KU 4MPWA 1C2HA 3SV2H 3S7HB 5DP5A 1ZPZA 5E0GA 5SGAE 1K1MA 4GCHF 2P95A 1JRTA 3LH1A 2HRVA 2YOLA 1B7XB 2VIDA 4D76A 3RC6A 3HPTB 4D8NA 5GXPA 4X8SH 3W94A 4F49A 1OKXA 1P57B 3OSYA 3A84A 3D49H 1GHVH 2VINA 2PSXA 1NU7B 3UIRA 4FVDA 1UCYK 2FOCA 3QK1A 3KF2A 5A8XA 1TX7A 2H5CA 4GAWA 2W3KA 3RXHA 2I6QA 4NCYA 5A09A 1QCPA 4IS5A 1UHBA 3RXLA 5FX6A 2TPIZ 4Y0ZE 5AFYH 2A4GA 4ABDA 1E35B 1M9UA 5C1YA 4IMQA 2CF8H 1AD8H 4OS6A 1D4PB 1MQ5A 3SU0A 3TITA 4WVPE 2JH5D 3M61U 5E8EH 1O3NA 4A92A 2F9PA 5AVDA 1K1NA 1TBQH 3EE0B 3BIUH 3BTWE 3DHKH 2AFQB 5A0CA 2VGCC 2GCTB 4X8VH 3SNBA 1QL9A 1IQLA 3A7ZA 4M7GA 2AEIH 3ZVBA 1AWFH 1O5DH 2HALA 3SQEE 1GJBB 3ODDA 1K1IA 1MKXH 3A7XA 4FU9A 3F1SB 1PPZA 3SJIA 1CQQA 4Y76A 3M36A 3OX7U 4A5TS 3TIUA 1TBZH 5TCAA 3SUDA 1QQ4A 2BY6X 2GT8A 5EODA 2F9NA 3NCLA 2ZPSA 2V6NA 2BZ6H 1LTOA 3G01A 1FN8A 1RJXB 4D7GA 1O2JA 2ZFSA 1V2PT 1MKWK 1FONA 1HDTH 2XC4A 2GKVE 1Q3XA 1QIXB 4ZHLU 5AFZH 7GCHG 3ZZDA 2A4RA 4ABHA 4IN1A 3RP2A 3RXSA 2ZDAH 4IMZA 2H5DA 2ZFQH 1KYNA 1P04A 1TBRH 2BDHA 2P94A 4PROA 1UHBB 4FUBA 3RXEA 1C2FA 2ZFRH 4Y6DA 4E7NA 4ESTE 1AIXH 1IHSH 1FY1A 4YOJA 3KN2A 1GBLA 1ORFA 1MD8A 1P12E 2Y6TA 4DVAU 1K21H 1SB1H 5C5NA 3PTBA 4NIXA 1SOTA 1W11U 1C5MD 2Q6GA 1TRMA 3RU4T 4D7FA 2FEQH 1J8AA 4X6NA 2XC0A 2OC7A 4MVNA 8KME2 5C20A 2Z94A 2Z3CA 1AMHA 2WV5A 2OCVB 1CGJE 1G32B 1LVYA 2J9NA 2PKSC 5B6OA 4K1TA 1GWAA 4FUDA 1YLCA 1VCWA 3KQCA 3F68H 4OS5A 4BXWA 1EAUA 1ZMJA 1PYTC 1ZLRA 4BAKB 4MPXA 3GY3A 4B2CA 4TWWA 5F8TA 1JIMA 3A7VA 1JRSA 3LGYA 1BBRK 1FY8E 4AN7A 4NIYA 2Y7ZA 1GI3A 2FYRA 3TNSA 1SLWB 2ZFFH 4I31A 1O34A 3T29A 5E2OA 3SV8A 2VU8E 1ELDE 1JMOH 1Y59T 2ANMH 1GJ8B 3SGBE 2BOHB 3UQVA 1ELEE 1Q31A 2AMDA 1TGTA 1LDTT 4AOQA 1P3CA 1QRZA 3SU1A 1G37A 4GVUA 1KTSB 1TQ0B 2EA3A 1ZMNA 1GBEA 1OYQA 1CU1A 1TFXA 2VIOA 1OYTH 1CHOG 3QZQA 2BDYA 2ZU5A 3ENSB 4I7YH 1BTYA 1QBVH 3BTFE 3A83A 4Q2KA 1HFDA 2GV6A 1Z71A 4D9QA 2SGDE 1W7GH 5LPEA 1Z1IA 1V2NT 2PW8H 3EYDA 2BDCA 2P8OB 1ETSH 3GY8A 1J9CH 3PTNA 3DT0H 3FZDA 1C1SA 4NA9H 2XW9A 1EB1H 2BMGB 2SFAA 2ZHDA 1ABJH 3BTGE 4MPVA 4I8HA 4Y0YE 3IG6B 1TLDA 3SZNA 3M5OA 3ZZ4A 1NPMA 1UCYH 2FDAA 3M3TA 1C5ZB 2GDEH 2V3OH 1EZXC 3LH3A 3LPRA 2NU0E 2BM2A 2Z9IA 4AG1A 5EQRA 4J1YA 5DG6A 4CR5A 1TMUH 3AW1A 1IQIA 2BQWB 1TA6A 2ZP0H 1GJ9B 1EPTC 2CHAC 3C27B 3GYLB 2BVXH 4OS4A 3T27A 1IAUA 2ZGHA 2FP7B 2A4OA 2PTNA 3KHVA 2BDIA 2FS9A 1QB1A 1IQKA 2HLCA 4BNRA 5ABWA 1YCPK 2QYIA 4TPYA 1HLTH 1TOMH 2ZF0H 1AQ7A 1T32A 4AB9A 3M35A 4TYDA 4NWKA 2BY8X 3A8BA 2V35A 1O31A 3M5MA 1RXPA 1U6QA 1DY8A 1ZGIA 1V2QT 4FUEA 1LQDB 3U8TH 2A0QB 1AB9B 2F9VA 1O0DH 1CT0E 2BY5X 1C9PA 3TVJB 1XVOA 2AMQA 2VIQA 1BMMH 1RTKA 2C3SA 3RUOA 5BRRE 5GWZA 3H7OA 1PJPA 1A3EH 1O35A 2C93B 5FPSA 1OS8A 2GT7A 1C5XB 3PV4A 8GCHG 1TOCB 2QA9E 2OD3B 3SOSA 1UO6A 3DA9B 5I46H 1NFWA 4MNXA 4XBDA 3MTYA 5EGMA 1YPLH 1MU8B 1AZ8A 1ELBA 3M3VA 1UK4A 1GJAB 3KEEA 1HAVA 1O2NA 4FUJA 1NFYA 2FI5E 4VGCB 1DLEA 4AX9H 3SNEA 1QGFA 3AAUA 2G81E 2XWBI 1YF4A 9LPRA 2IN2A 1QFKH 4RSPA 2SGFE 4FVBA 2VIWA 3ATIA 3UREA 4A6LA 2EC9H 5A8ZA 1TPSA 2B7DH 1IOEA 1IQNA 2AIQA 4GCHG 2BDGA 1HAYB 3U1JB 1VJ9U 4HFPB 3NUMA 3SO3A 4HZHA 1BMLA 3P17H 5EG4A 1S83A 3FP8E 4ZKNU 1F2SE 1C1TA 1W0ZU 3A80A 1BHXF 1TB6H 1O33A 2BLWA 1OOKB 2ZHWH 1Y8TA 2B8OH 1AVWA 4RN6A 4ZUHA 2PUXB 5GCHG 1EKBB 2W7SA 2D1JA 1FIZA 1KSNA 4O97A 2RA3A 1GG6C 1HUTH 1EZUC 4I8GA 2R0KA 3V7TA 3TJOA 4YO9A 1SC8U 1UTMA 5FX5A 1DE7H 4I8LA 1XM1A 2Y82A 1RFNA 3TJUA 2ZTZA 1C1UH 3KNXA 7GCHF 1FLEE 3TK6A 1BB0B 1NRRH 4INKA 3RXBA 1HAVB 2BD4A 2ZDLA 2VVVA 3PMAB 5CHAC 1WBGB 1FZZA 1QL8A 3UOUA 6CHAB 3UWIA 1SVPA 2OTVA 2ZEBA 1V2MT 2FLBH 2BDAA 1XMNB 3PO1C 3RXVA 4CRCA 1GJDB 4DT7B 3AW0A 5DGJA 1HCGA 1OWKA 3EA8A 3RXKA 1CSOE 3KQDA 3RC5A 1VCQA 3OY6U 2F91A 3ZZBA 3RMOH 2SNWA 3MHWU 3OYPA 2FOEA 5C3NA 1YPHC 1FY5A 3KGPA 1P2OA 3GY7A 1A3BH 5F03A 5C1XA 3MNBA 1QR3E 4X2YA 1A5HA 1ACBE 1E37B 3EA7A 1P2NA 1DM4B 1OP8A 1D6RA 2K1QA 2RA0A 1UTPA 2JETC 2R2MB 2F9BH 1ELGA 1KXFA 3MH6A 4XBBA 1Y3YA 4AGJA 1Z8JB 5FPYA 1KLIH 4HI3A 3RMMH 4NSYA 1EB2A 1GL0E 3GDVA 3T25A 4OGXA 3O8DA 5A0AE 2O8LA 5L6NH 1G36A 1AVGH 1BUIA 3BTKE 3A87A 1SLXB 3BG8A 3QDZB 4E7RG 3O8BA 1BRUP 2AYWA 1MTSA 1MBQA 3S7KB 2STAE 1QB9A 2G00A 2ALPA 2VVCA 3BIVH 1JXPA 4K60A 1MZDA 2FYQA 4AB8A 4JZ1A 3SU4A 1TYNA 1CHOF 2PHBA 2PR3A 3RXQA 2UWPA 1ZHPA 8LPRA 1GI5A 2UUJB 5EPNA 5FHTA 1BIOA 1LKAA 3LT3A 2NU3E 4NA7A 3HATH 1WAYB 1O3IA 1P05A 1SOZA 1DWDH 2XWAA 2OBQA 5JB8S 1P9SA 3SJOA 2VWMA 1O2ZA 4CHAC 1MH0A 1MTWA 2ZTXA 1YPHE 3GDSA 1C1RA 2VGCB 3CS7A 2OLGA 1C5YB 4A1VA 1ARCA 3DFLA 1RTLA 1D3DB 1SGYE 1C5WB 1WTHD 2BXTH 1TPAE 1BJVA 1NROH 1AE5A 2ZTYA 1TALA 1SPJA 4ZH8A 4DGJA 3TH3H 3NWUA 2D2DA 2QIQA 3ZZCA 4LXBH 1GCDA 1H9IE 4FUCA 2ZC9H 3SNDA 2NU1E 3TGKE 1SLUB 3M3SA 1QNJA 2O9QA 4JCNA 4K1SA 2YNBA 3MU8A 1S81A 4UFFH 2FLRH 3SJ8A 2ZCHP 1T7CA 2EEKA 2PLXA 2BD9A 3AASA 2QF0A 3E91A 1SSXA 4B75A 4X2XA 1TE0A 1RTFB 1SGIB 4JK5A 2TGDA 3PMBB 4IN2A 3UR6A 4I32A 1MTVA 2QV1A 4BOHA 1TNIA 3ZVGA 3LJOA 1C5RA 2BX4A 2CXVA 4H6SB 1L2EA 1P3EA 4KELA 1C2IA 2ZKSA 1V3XA 3VXEH 4I33A 1GMHG 3TJVA 2FESH 1RD3B 2O8UA 1C5PA 1EASA 2J4IA 2VWNA 3U9AH 2PKSB 1UJ1A 1HAOH 3WY8A 2JH6D 3P8OA 4CBOA 1PYTD 1D3TB 3SV6A 1L1NA 3LGIA 4X1QU 1KLJH 1UK2A 1UVOA 1V2ST 1ZPCA 4DURA 1N6XA 2B9LA 1S6FA 1EPTA 3TU7H 3MH5A 1KY9A 1ZTJA 3DD2H 1L0ZA 1FY4A 3S9CA 3PB1E 1EJAA 2RG3A 1Z6EA 1OX1A 1NESE 3SV7A 5E0HA 1V2KT 4ABIA 1H4WA 2R9PA 2R2WU 3LIWA 3VB4A 2RDLA 1P02A 4O3UA 3SU2A 1SI5H 4YT7H 1HYLA 1QHRB 1RIWC 3BTME 3BV9B 1ANBA 4RKOB 4NSVA 2FM2A 2A7HA 3VB5A 3SU3A 2OC0A 4X0WU 2A7CA 1HJAC 3NXPA 2JH0D 1O2HA 4CRFA 3RXIA 1D3QB 4ISHH 2OP9A 5FPTA 5GCHF 1UVPA 1AHTH 3B8JA 1GI8B 1UMAH 4MNVA 5LGOA 2G4TA 1QJ6B 1NS3A 4Q7XA 2G5NA 1YP9A 7KMEH 1GHWH 2WV4A 4ISIH 3BEUA 1SL3A 2CHAB 1EPTB 1INCA 5HM2A 1ELAA 5JBCS 1WV7H 1FMGA 2BVSH 5J4SA 1LVOA 1EUFA 1RRKA 2BQ6B 2ZU2A 3KQEA 4WMFA 2FOAA 3HGPA 2H9TH 2OXSA 1GMCG 4UFDH 2ZGCA 1SGFG 1NRSH 2PWXA 4AYVB 4KGAA 1W10U 3VPKA 3QGNB 1OWDA 2ZZUH 3D23A 4CRGA 3VFEA 3TH2H 4CBNA 1BTWA 4LZ4B 3F6UH 3FANA 1C1NA 1BT7A 3EDXB 2M5TA 2XNIA 4AGKA 1AGJA 1J14A 1QJ7B 3T62A 4TY6A 4O9VA 4ABGA 1ZTKA 2TGTA 1DWEH 1F0SA 1LVMA 5GJ4B 2BD5A 4UD9H 1H8IH 1THSH 1XXDA 3K65B 2SNVA 2G52A 3GDUA 1P11E 2QXJA 2CF9H 1L4ZA 2ZGJA 1GVZA 2QY0B 4K69A 3MYWA 4B2AA 1AO5A 1F5LA 1HV7A 2BLOA 1SFQB 2ZG0H 4LOYH 3SU6A 4K8YA 3LC3A 1ESTA 2ODQA 1V2LT 2CN0H 5DP8A 2OINA 4ISNA 1GHBG 3QGJA 3P8GA 3FZZA 3ZZ6A 1EOJA 3I29A 1V2UT 4DY7B 1YCPM 5EXMA 1C9TA 4ABAA 3PLPA 1B0EA 4Y8XA 1O2UA 1ZMLA 4Y7BA 1A2CH 3MU5A 4BTTB 5PTPA 1LKBA 3QO6A 5L2ZH 1LMWB 1O2YA 1W14U 4X1RU 2BLQA 1YKTA 2OBOA 3JZ1B 1TMTH 2QF3A 3BG4C 1HB0B 1J15A 2FX6A 4HGCA 4NA8A 4DIIH 1K28D 1NC6A 5ETXA 1FQ3A 2FOBA 1NN6A 1DWCH 3Q77A 4MG3A 1GG6B 4FUFA 3TNTA 1UVSH 5CE1A 2ZU1A 1O3EA 2Z7FE 5EOKA 1DUAA 1IHTH 1HJ8A 1TIOA 1HRTH 1O2OA 3BEFB 2XTTB 2ZIQH 5DP9A 3ITIA 2XYAA 2H9EH 1SFIA 1DLKB 4TPIZ 3RXGA 2Q6DA 5T6DA 2FZZA 5EXNA 1GDQA 1GHYH 3SJ9A 3K6ZA 1UVUH 1DOJA 1LCYA 3S9AA 5TJXA 5CHAB 1PPCE 2PGQB 1E34B 3TJNA 2OC8A 2Q1JA 1C4Y2 4X1PU 1PPHE 2ULLA 4UEHH 4RKJB 1KXDA 3NKKA 3PO1B 1N8OC 2KAIA 1FI8A 3MO6A 3BSQA 1GHAF 3MU4A 4I8KA 1K1JA 1XUGA 4D9RA 1SG8B 1NRPH 4DOQA 2AGIX 3F9EA 1P9UA 2HPPH 5EQSA 1DANH 1PQ8A 1GMHF 1F0UA 1E38B 3E8LA 1NM6A 2ANKH 3LU9B 2H6MA 1Y3UA 1ELFA 3PM3A 5FCKA 2OQ5A 4WMEA 4X8TH 2JETB 3BTEE 3GICB 4Y10E 5JBAS 2VWLA 1BTUA 1YPMH 3Q00A 5K0HA 2BY7X 1F92A 2GZ7A 1J17T 3I78A 1MZAA 4KKDA 4X6MA 4ZMAH 4NFFA 5BPEA 3P70B 5IYTA 1J16A 1GJ7B 1HAPH 4AG2A 3UUZA 5ESTE 4Y11E 1DWBH 1GJCB 1BTXA 1GDNA 1GMDF 2A45B 1H9HE 3UNQA 1FV9A 4XDEA 4GSOA 1GI2A 2ZU4A 1KXEA 3LGTA 2ZECA 4FU8A 1T8OA 2HNTF 2QGRA 2UUFB 2BD7A 2ODPA 4B73A 1CGHA 3A82A 1Z8GA 1SGPE 1HPGA 2ZCLP 1P2JA 4AORA 1EAXA 1ZSKA 4OS1A 1A1RA 2KAIB 3T2NA 1NU9A 2ZPRA 1TRYA 4CHAB 2G8TA 3MH7A 2C90B 3U1IB 3GCTG 7LPRA 1GJ4H 4ZKSU 5DPAA 1QA7A 4DW2U 4BXSA 1DX5M 1MTUA 2GMTB 1NFUA 4YZUA 4JYVH 4CH8B 3MU0A 5FCRA 1AUJA 3U8OH 2TGPZ 2BD2A 4HTCH 5L2YH 4WH8A 1T8MA 2IJOB 3MNCA 2BDBA 3SBKA 2A7JA 2FI4E 1GI0A 2Z9GA 5FBEA 4GPGA 1S84A 3MNSA 1BTHH 4WY3A 3GY4A 1O2IA 3RDZA 3STJA 4Q7ZA 4U32A 1TX8A 2AMPA 4KTSA 1BDAA 5JBBS 1OP0A 1C5TA 1SGNE 1GGDC 1LPZB 2P93A 4Q7YA 1ZR0A 2OUAA 2SGPE 3D62A 3UNSA 1GHXH 2XC5A 4H6TA 1GMCF 3ESTA 3PWBA 4F4OC 1VITH 2ZHFH 2C8WB 3KQBA 2LNCA 2UWLA 3QTOH 1TWXB 1WCZA 1ZSJA 1AUTC 1DICA 1RGQA 2ILNA 1LO6A 1ETRH 1YGCH 3N7OA 5A2MH 3KL6A 2SGEE 1EJMA 1HAXB 2BD8A 2H9HA 4XBCA 1LQEA 1V2VT 2B5TB 4NZQA 2G55A 2FODA 3BF6H 1GCTC 4WJG2 2Z9JA 2VIPA 4X2VA 1ABIH 1BTPA 2A5IA 1O37A 2FTLE 1ELVA 4ZHAA 1IQJA 4YLUA 4BAQB 2AGEX 3K6YA 3P8NA 3E16B 3IWMA 3Q3YA 2GCHG 2F9OA 3PLBA 3V3MA 2O8TA 5DP3A 3V12A 2FOHA 2STBE 3A8CA 2BD3A 1ZOMA 4DIHH 2OC1A 1TNKA 2AERH 4WWYA 4FUHA 3HK6B 1FXYA 3RLYH 1HAHH 1FIWA 1SGEE 3SNAA 1DVAH 1GHBF 2ZPQA 4UDWH 2WPJS 3QZRA 4CH2B 3RXPA 4CRDA 3ZV8A 1O5AB 1KLTA 1MU6B 6LPRA 3F9HA 2Z9LA 3M7TA 1OWHA 5EU8A 3T5FH 2GV7A 2B0FA 1RIWB 1BBRE 1LVBA 1O3CA 4Y71A 1V6DA 1HJAB 2H1UA 3QX5H 3K9XB 4I8JA 2A5KA 2AIPA 1EOLA 1O3LA 3RXJA 4SGAE 1BITA 1VGCC 1O3OA 2ZGXH 1EX3A 3PMHB 1YPGH 2FPZA 5G4BA 2DUCA 1OPHB 2V3HH 2F9UA 4ZKRU 1AFEH 1H9LB 3SORA 2RCEA 1FPCH 1G3EA 3A81A 3M37A 2BTCE 5LPRA 1GBTA 1WTGH
chains in the Genus database with same CATH superfamily
1GBHA 1ELCA 1DFPA 1C2LA 1C1OA 1LPKB 4FXGH 4NFEA 1FAXA 2H2ZA 3H5CB 1EAWA 1PPFE 1K9OE 3A7YA 3UTUH 3ZVAA 1TX6A 2J2UA 4BAOB 1T4UH 5CHBA 3MO9A 2A1DB 1BRAA 4A7IB 3I77A 3PLKA 3A7WA 4IW4E 2ZU3A 2P3TB 1CVWH 1QRWA 1T31A 1A0LA 1T8NA 1VCPA 1UTJA 5T3HA 3W95A 1F7ZA 4AC9A 1GBMA 1DXWA 1Z6JH 3NZIA 1C5QA 5KECA 3MU1A 2KFWA 4H42U 3ODFA 1O3FA 3O8CA 2KM0A 1FDPA 4OS2A 1QRXA 1QURH 2J97A 3GY6A 4ISOA 1YLDA 5TCCA 4X2WA 3FVFB 1QY6A 3BTQE 4BAMB 5B6LA 2CGAA 2PKAB 1VR1H 4JZDH 3KYGA 3PMJA 1E0FD 1QL7A 5HMAA 4ZCNA 1O39A 2WPKS 4H4FA 3RXRA 3RM2H 3DSPA 1EXFA 1OXGA 1GBBA 5DN6D 3ZVEA 3LKWA 5KEDA 1C2GA 1YBWA 2EI6A 4THNH 2F3CE 1FNIA 1NY22 3Q3KA 6GCHF 1C2EA 1DITH 1GI9B 1DT2A 2QXGA 3U69H 3VB7A 4U01A 2J38A 2ZDKA 5IDKA 1K2I1 4INLA 1GHAG 2C8YB 4B2BA 1SHYA 1A0HB 2A4QA 3QTVH 1NTPA 2ZNKH 4ZKOU 1HJ9A 3FP7E 1NRQH 4UE7H 1E36B 1Y3WA 3MNXA 2SGAA 4YTAA 1PPEE 7ESTE 2ZQ2A 4YM9A 1O2TA 2Y5HA 5E0JA 2UWOA 2P59A 4CRBA 3E90B 1K1OA 3FP6E 2PP6A 2GTBA 5DP6A 3E0PB 1O5EH 5HM9A 2TRMA 4JZFH 1HAGE 1BRCE 3PYHA 3UFAA 2XCNA 1TNLA 1TMBH 2BY9X 3LGUA 3RU4D 2DE8A 1BQYA 1O3DA 3UWJH 4ZAEA 2BLVA 2EY4C 1ID5H 3EQ0H 3IITA 4FU7A 3GCTF 2AH4X 3OAAD 1ZSLA 3VXFH 3VGCC 1B0FA 5EPYA 3SQHE 2FMJA 1LHEH 4Q4LA 1A5GH 4YOGA 3UPEA 5T6FA 3GCNA 1SQRA 3HK3B 1GMDG 3BG4B 4U2WA 1C2KA 1KXBA 1Z8IB 2AGGX 3VEQB 1W0YH 1UK3A 4DG4A 1OWIA 2BQ7B 3RXTA 3E0NB 1G3CA 4WXVA 4B71A 5C0TA 1AU8A 2TIOA 2FOMB 1MAYA 3U8RH 1A5IA 2W26A 1ETTH 1C5OH 2LPRA 1V2WT 3LJJA 1BHXB 1QQUA 1HXFH 1L4DA 2Y7XA 1EZSC 1AFQC 1B5GH 2SGQE 2VNTA 3MI4A 1A0JA 1SR5C 1P01A 1YC0A 3A89A 3NK8A 1O2LA 1AI8H 3TK9A 1GBIA 2XRCA 1ZGVA 2QCYA 1AY6H 4KP0A 1Y5AT 4X1NU 2Z3DA 4DJZB 2ZDVH 1QJ1B 3E6PH 3ZZ5A 4UFGH 1NO9H 1O2MA 1YPKH 2O8WA 1VZQH 1S6LA 1IQGA 4ABFA 1N8OB 1AN1E 1MMJN 1W3CA 1O3MA 3TK5A 1CHGA 3ATWA 3SJKA 1DUEA 1MBMA 3URDA 5F8XA 2PV9B 1C4V2 3CENA 1XX9A 3M5LA 5HYOA 3D65E 5AF9H 1UTLM 1ESAA 1TPPA 2EI7A 5JBTA 1ELTA 4AZ2B 2O8MA 1DSTA 1GI1A 1BMAA 3LGWA 2UUKB 1G3BA 1O3GA 1P06A 2XBXA 3F2GA 3A7TA 1ZHRA 3ZVDA 5C2ZA 1YPJH 1S82A 1O3BA 4Y8ZA 1CGIE 2OK5A 2GZ9A 1AE8H 1XUFA 1PQ5A 1UTQA 3C1KA 3E3TA 3MFJA 3SN8A 1O3PB 4AFUA 1CA0C 4JYUH 2BOKA 2GCHF 2QAAA 5JB9S 1IQEA 3EAJA 3ZZ9A 3F9FA 1ANEA 2GX4A 3BN9A 3ZZAA 2JKHA 2THFB 1XKBC 3GY5A 1HNEE 3SW2B 2P16A 3O8RA 3SGAE 1Z8RA 1ANCA 1P2KA 4MNYA 2BHGA 4NG9H 2A2XH 1O2VA 4YOIA 5E2PA 1O5CB 1UTNA 1XUIA 4NIWA 1C4U2 3P8FA 5GPIB 5EW1H 1W8BH 3UOPA 4MQAA 3GCHC 1QA0A 5GNDA 4XFQA 1O3KA 1HAIH 4YESB 3RM0H 4OGYA 1HIAA 2K8IA 1F5RA 4AFSA 2Y5GA 1V2RT 4O3TA 4XE4A 3CS0A 3KIDU 5H4IB 5T6GA 1P0SH 1O2WA 1TGCA 1MCVA 5HGGA 4CR9A 2EI8A 1ZZZA 2TGAA 2JDID 1P03A 3FN8A 2HNTC 3V0XA 2D8WA 2J92A 1KXCA 4INHA 1XUJA 1K22H 2EQNA 3LC5A 5ESBA 1JBUH 2BVRH 1F0RA 2Y80A 3CP7A 2IJD1 1Y3XA 4YLQH 4F55A 1W12U 1TQ7B 1ZPBA 2KR7A 5C67A 5JDUB 2HLDD 1PPBH 1L1JA 4JZIA 4MTBA 1PPGE 1ARBA 2ASUB 2UUYA 1LHGH 1V2OT 1S0QA 1UW7A 3ATMA 2D26C 4Y79A 2QXIA 1K0HA 1MCTA 1MAXA 1C5LH 2XCFA 2ZHEH 4DCDA 2BXUH 4E05H 1A61H 1IQHA 3RXCA 2F83A 4Z6AH 1GGDB 1O2QA 2J94A 2PGBB 3VG8A 3ZZ3A 1DXPA 2BZAA 1D9IA 2VH0A 3KCGH 1KMHB 1D6WA 1N6YA 3A85A 2FIRH 3SI3H 5FBIA 3GY2A 1MD7A 2R3YA 3CNRA 4OS7A 4ASUD 3LDXH 1MTNC 1VJAU 3MOCA 5HKKD 3RMLH 1CBWC 2Z3EA 1GBDA 1HIAB 1IQMA 3TPIZ 1BOQA 1OP2A 1WOFA 5F8ZA 1HGTH 2CJIA 1BCUH 1GCTB 2HNTE 2VH6A 4UFEH 1SGDE 3GOVB 1Y5BT 4ISLA 3GYMA 1WUNH 1GI6A 4ABEA 1A4WH 2XBWA 5CMXH 3SI4H 4YT6H 1ZJKA 2A5AA 2J98B 1K1LA 1TABE 1XUHA 2NU4E 3NPSA 1THRH 4FETA 3A8AA 1O3HA 4QT8C 3OTJE 1NT1A 2Y81A 3DUXH 1TPOA 1GBCA 1O2XA 1G9IE 1FN6A 2A31A 1ZRKA 3RU4E 2ZWLH 1YPEH 2C8ZB 2FOFA 3V13A 1OWEA 2FS8A 4A1TA 4WMDA 2Z9KA 3ZZ8A 3ZVCA 1MUEB 2ZI2H 1DDJA 3M7UA 1SKYE 1P8VC 1WU1A 2BYAX 1C2MA 2XBYA 2R0LA 4CRAA 4FUGA 2IPHA 2ZCKP 4B74A 1O3JA 4F48B 5LPFA 1VITG 1AZZA 5LH8A 2HOBA 2C4FH 4DT4A 4XSKU 2C8XB 6GCHG 1THPB 5J4QA 4X6PA 4LZ1H 3F9GA 3SNCA 4LK4A 1S6HA 1CT4E 2GCTC 4NZLA 3DCLA 1NFXA 4U30A 3GCOA 1HBTH 3SGQE 4R0IA 9ESTA 1WQSA 3L3TA 2FOGA 5GDSH 1SMFE 3UQOA 1ZTLA 3MH4A 1VGCB 1ESBA 6ESTA 1AVXA 1JWTA 1O36A 4JZEH 3RXDA 1S85A 1W2KH 4IGDA 3RXUA 2ZDMA 3T28A 3LGVA 3GISB 1XUKA 1EATA 1GBAA 2QC2A 2OQUA 2V0BA 1GBJA 3OY5U 1LHCH 4O03A 2VIVA 3U98H 4BANB 4TY7A 1Q2WA 1AWHB 1T4VH 1YWUA 4MDSA 1TNHA 1EZQA 1S5SA 4ACBA 1UCYE 1Y5UT 3H09A 1MKWH 1QBNA 2I6SA 1QBOA 3UR9A 1FY3A 3RXAA 2GVFA 5I25A 2FI3E 1P2QA 1O2SA 1NRNH 4CREA 3PWCA 1WQVH 3DSGA 2WUCA 4B76A 2VB0A 3LONA 2ZFTA 1GVLA 3DFJA 2WYGA 3P6ZB 1GVKB 1CE5A 1BRBE 4X8UH 1P09A 3U28C 3TGIE 1C1PA 3QN7A 3R0FA 2W5EA 1QB6A 1C1QA 5DO4H 2ZQ1A 1BA8B 1DSUA 3A8DA 1XKAC 1TNGA 2W6ID 1FJSA 2AS9A 3K2UA 3L6PA 3A86A 3EA9A 1OWJA 3RC4A 3FFGA 1X7AC 3BTHE 1GL1A 1UTKA 2G5VA 4WH6A 4ABJA 3ATKA 1C1MA 3ELAH 3QUMP 3ZV9A 3BTTE 4JMYA 2PFEA 3RXMA 2ESTE 4NWLA 4X6OA 3M5NA 3BEIB 1MQ6A 2CV3A 1BBRH 1P2IA 1FX0B 1W13U 1JIRA 4UONA 3SU5A 3BTDE 4Y7AA 4ZXYH 1SGRE 4Z0KA 1FUJA 4A1XA 3P95A 3FAOA 3EGKH 3RMNH 3TH4H 3MO3A 1SGCA 2HWLB 1C1VH 4P02A 1CT2E 3ZYDA 3SV9A 2WUBA 1DY9A 2TBSA 2M2AA 1Z7KA 2PUQH 2VBCA 1SGQE 1T8LA 1C5UA 1TGBA 1O30A 4MPUA 4NIVA 3B23B 1ZYOA 2NU2E 5JYIA 1TAWA 1KDQA 2GP9B 1GJ6A 2ZHQH 1C1WH 1L1GA 1TGNA 2P8OC 4GLYA 2W3IA 3E1XB 4ZXXH 5JPMH 3HGNA 3VGCB 2A32A 2BB4A 5A0BA 3RXFA 2VWOA 1QTFA 2HGTH 4Q63A 1RS0A 1ZJDA 2BX3A 3T26A 3VB6A 3SUEA 2CMYA 1CO7E 2WYJA 4MLFB 1W7XH 3UNRA 1SQOA 1ANDA 1BZXE 2WPLS 1WYKA 3EE7A 3S69A 3W1EA 3S9BA 1GJ5H 2J34A 4ZHMU 3ZZ7A 1FPHH 2ALVA 2FXRA 2GZ8A 1H8DH 4AYYB 3TLOA 1EAIA 4KTCA 4TWYA 1GBFA 5F6MA 4ASHA 1LHDH 3OU0A 4JK6A 2PKAA 3QLPH 2J95A 2JJ1D 4K3JA 5DP7A 2QXHA 1C5NH 4SGBE 2WPMS 1WSSH 1AFQB 1OHHD 4K2YA 1C2JA 2HPQH 1DS2E 1ZRBA 2ZDNA 1O2RA 2WPIS 1EP6A 4GUXA 1SGTA 1O5BB 4WF8A 4AFQA 1O2PA 1OSSA 3HKJB 1P2MA 2VVUA 4ZROA 1XVMA 1KTTB 4KTUA 3ZVFA 4AFZA 1O38A 3ZYEA 2GDDA 2FWWA 3Q3XA 3P92A 1S0RA 2A2QH 1C5VA 4BTIB 1P10A 1D3PB 2ANYA 2PSYA 1YCPH 1C2DA 4J2YB 3PROA 1NBME 1TONA 1AB9C 4NGAH 3RXOA 4ABBA 1O2GH 5DKMA 5GIBA 1V2TT 3UB0A 3SHCH 1GI4A 4X1SU 4Y8YA 5L30H 1KDQB 4Q80A 2AHME 5EQQA 1HAZB 1GDUA 3MWIU 1Y3VA 5AHGH 3AVZA 3STIA 1EJNA 4IC6A 5EIYA 5DSFA 1NZQH 1SHHB 3SUFA 5DK1A 2XBVA 4E06H 2VJ1A 1UVTH 2Y5FA 1CA0B 5DJ7A 5A8YA 1PFXC 4K5ZA 1XXFA 4WXIA 4FUIA 1MKXK 1FAKH 1SQAA 3Q76A 1E1RD 1O2KA 3JZ2B 1EQ9A 1PQAA 1JOUB 1AKSA 4VGCC 1H1BA 2GMTC 1G30B 2HVXA 1KIGH 1EP5A 2ZO3H 2Z6BD 5EXLA 1WDIA 4K1EA 1BTZA 3S0NA 1O3AA 2ZFPH 1O32A 1DPOA 1IQFA 1GPZA 3H7TA 1G2LA 2P3FH 1VITF 3GCHB 5DP4A 1ZHMA 2YNAA 2V7QD 2ANWA 5FXLA 1O5GH 3MMGA 4K8BA 1V2JT 1SGFA 2WINI 5C17A 1A7SA 1SLVB 1TRNA 1G2MA 3M7QA 1SBWA 1GHZA 2QN5T 1PQ7A 4R8TB 5FAHA 1UTOA 3L33A 4GHTA 4IBLH 2IOTA 1C5SA 3B9FH 2PTCE 3OE7D 1LPGB 3LOXA 2XOKD 1BJUA 3DSOA 1N1LA 2GD4B 4IC5A 2Q6FA 2W7UA 1F0TA 3URCA 2G51A 1TGSZ 2ODYB 2FTMA 4BTUB 2GGVB 1TA2A 3SUGA 1BMNH 1LHFH 3ATLA 2R3UA 1HXEH 1K1PA 2ZA5A 5HXFA 2FX4A 3SHAH 1A46H 4JYTA 1O5FH 1TNJA 3QWCH 2P3UB 1GI7B 1Z1JA 1GBKA 2XXLA 1KXAA 2ZGBH 4B1TA 2DE9A 3RLWH 1AKSB 8GCHF 2NWNA 6CHAC 1YM0A 3GS9A 1G3DA 1SQTA 2FO9A 4BAHB 4MNWA 2WPHS 3R3GB 5EW2H 5C1UA 1YYY1 3FKSD 1EFRD 3UY9A 4HG6A 8ESTE 3TGJE 5K7RA 5C5OA 1MTNB 3A88A 1CA8B 1CBWB 3VB3A 3AAVA 3HKIB 4XOJA 2G4UA 4GHQA 1F5KU 4MPWA 1C2HA 3SV2H 3S7HB 5DP5A 1ZPZA 5E0GA 5SGAE 1K1MA 4GCHF 2P95A 1JRTA 3LH1A 2HRVA 2YOLA 1B7XB 2VIDA 4D76A 3RC6A 3HPTB 4D8NA 5GXPA 4X8SH 3W94A 4F49A 1OKXA 1P57B 3OSYA 3A84A 3D49H 1GHVH 2VINA 2PSXA 1NU7B 3UIRA 4FVDA 1UCYK 2FOCA 3QK1A 3KF2A 5A8XA 1TX7A 2H5CA 4GAWA 2W3KA 3RXHA 2I6QA 4NCYA 5A09A 2RFKC 1QCPA 4IS5A 1UHBA 3RXLA 5FX6A 2TPIZ 4Y0ZE 5AFYH 2A4GA 4ABDA 1E35B 1M9UA 5C1YA 4IMQA 2CF8H 1AD8H 4OS6A 1D4PB 1MQ5A 3SU0A 3TITA 4WVPE 2JH5D 3M61U 5E8EH 1O3NA 4A92A 2F9PA 5AVDA 1K1NA 1TBQH 3EE0B 3BIUH 3BTWE 3DHKH 2AFQB 3KYFA 5A0CA 2VGCC 2GCTB 4X8VH 3SNBA 1QL9A 1IQLA 3A7ZA 4M7GA 2AEIH 3ZVBA 1AWFH 1O5DH 2HALA 2F4LA 3SQEE 1GJBB 3ODDA 1K1IA 1MKXH 3A7XA 4FU9A 3F1SB 1PPZA 3SJIA 1CQQA 4B6FA 4Y76A 3M36A 3WWBA 3OX7U 4A5TS 3TIUA 4FOUC 1TBZH 5TCAA 3SUDA 1QQ4A 2BY6X 2GT8A 5EODA 2F9NA 3NCLA 2ZPSA 2V6NA 3PRBA 2BZ6H 1LTOA 3G01A 1FN8A 1RJXB 4D7GA 1O2JA 2ZFSA 1V2PT 1MKWK 1FONA 1HDTH 2XC4A 2GKVE 1Q3XA 1QIXB 4ZHLU 5AFZH 7GCHG 3ZZDA 2A4RA 4ABHA 4IN1A 3RP2A 3RXSA 2ZDAH 4IMZA 2H5DA 2ZFQH 1KYNA 1P04A 1TBRH 2BDHA 2P94A 2J98A 4PROA 1UHBB 4FUBA 3RXEA 1C2FA 2ZFRH 4Y6DA 4E7NA 4ESTE 1AIXH 1IHSH 1FY1A 4YOJA 3KN2A 1GBLA 1ORFA 1MD8A 1P12E 2Y6TA 4DVAU 1K21H 1SB1H 5C5NA 1MABB 3PTBA 4NIXA 1SOTA 1W11U 1C5MD 2Q6GA 1TRMA 3RU4T 3F2FA 2FEQH 4D7FA 1J8AA 4X6NA 2XC0A 2OC7A 4MVNA 8KME2 4Z1MD 5C20A 2Z94A 2Z3CA 1AMHA 2WV5A 2OCVB 1CGJE 1G32B 1LVYA 1QZ8A 2J9NA 2PKSC 4K1TA 5B6OA 1GWAA 4FUDA 1YLCA 1VCWA 4OM9A 3KQCA 3F68H 4OS5A 4BXWA 1EAUA 1ZMJA 1PYTC 1ZLRA 4BAKB 4MPXA 3GY3A 4B2CA 4TWWA 5F8TA 1JIMA 3A7VA 1JRSA 3LGYA 1BBRK 1FY8E 4AN7A 4NIYA 2Y7ZA 1GI3A 2FYRA 3TNSA 1SLWB 2ZFFH 4I31A 1O34A 3T29A 5E2OA 3SV8A 2VU8E 1BMFD 1ELDE 1JMOH 1Y59T 2ANMH 1GJ8B 3SGBE 2BOHB 3UQVA 1ELEE 1Q31A 2AMDA 1TGTA 1LDTT 4AOQA 1P3CA 1QRZA 3SU1A 1G37A 4GVUA 1KTSB 1TQ0B 2EA3A 1ZMNA 1GBEA 1OYQA 1CU1A 1TFXA 2VIOA 1OYTH 1CHOG 3QZQA 2BDYA 2ZU5A 3ENSB 4I7YH 1BTYA 1QBVH 5C0UA 3BTFE 3A83A 4Q2KA 1HFDA 2GV6A 1Z71A 4D9QA 1NBMD 2SGDE 1W7GH 5LPEA 1Z1IA 1V2NT 2PW8H 3EYDA 2BDCA 2P8OB 1ETSH 3GY8A 1J9CH 3PTNA 3DT0H 3FZDA 1C1SA 4NA9H 2XW9A 1EB1H 2BMGB 2SFAA 2ZHDA 1ABJH 3BTGE 4MPVA 4I8HA 4Y0YE 3IG6B 1TLDA 3SZNA 3M5OA 3ZZ4A 2CK3D 1NPMA 1UCYH 2FDAA 2RDEA 3M3TA 1C5ZB 2GDEH 2V3OH 1EZXC 3LH3A 3LPRA 3N99A 2NU0E 2BM2A 2Z9IA 4AG1A 5EQRA 4J1YA 5DG6A 4CR5A 1TMUH 3AW1A 1IQIA 2BQWB 2HVYB 2KX4A 1TA6A 2ZP0H 4M9FA 1GJ9B 1EPTC 2CHAC 3C27B 3GYLB 2BVXH 4OS4A 3T27A 1IAUA 2ZGHA 2FP7B 2A4OA 2PTNA 3KHVA 2BDIA 2FS9A 1QB1A 1IQKA 2HLCA 4BNRA 5ABWA 1YCPK 2QYIA 4TPYA 1HLTH 1TOMH 2ZF0H 1AQ7A 1T32A 4AB9A 3M35A 4TYDA 4NWKA 2BY8X 3A8BA 2V35A 1O31A 3M5MA 1RXPA 3SYJA 1YLNA 1U6QA 1DY8A 1ZGIA 1V2QT 2KCPA 4FUEA 1LQDB 3U8TH 2A0QB 1AB9B 2F9VA 1O0DH 1CT0E 2BY5X 1C9PA 3TVJB 1XVOA 2AMQA 2VIQA 2YMSD 1BMMH 1RTKA 2C3SA 3RUOA 5BRRE 5GWZA 3H7OA 1PJPA 1A3EH 1O35A 2C93B 5FPSA 1OS8A 2GT7A 1C5XB 3PV4A 8GCHG 4XRNA 1TOCB 2QA9E 2OD3B 3SOSA 1UO6A 3DA9B 5I46H 1NFWA 4MNXA 4XBDA 3MTYA 3OEED 5EGMA 1YPLH 1MU8B 1AZ8A 1ELBA 3M3VA 1UK4A 1GJAB 3KEEA 1HAVA 1O2NA 4FUJA 1NFYA 2FI5E 1YY3A 1DLEA 4VGCB 4AX9H 3SNEA 1QGFA 3AAUA 2G81E 2XNDD 2XWBI 1YF4A 9LPRA 2IN2A 1QFKH 4RSPA 2SGFE 4FVBA 2VIWA 3ATIA 3UREA 4A6LA 2EC9H 5F53A 5A8ZA 1TPSA 2B7DH 1IOEA 1IQNA 2AIQA 4GCHG 2BDGA 1HAYB 3U1JB 1VJ9U 4HFPB 3NUMA 3SO3A 4HZHA 1BMLA 3P17H 5EG4A 1S83A 3FP8E 4ZKNU 1F2SE 1C1TA 1W0ZU 3A80A 1BHXF 1TB6H 5KGOA 1O33A 2BLWA 1OOKB 2ZHWH 1Y8TA 2B8OH 1AVWA 4RN6A 4ZUHA 2PUXB 5GCHG 1EKBB 2W7SA 2D1JA 1FIZA 1KSNA 4O97A 2RA3A 1GG6C 1HUTH 1EZUC 4I8GA 2JIZD 2R0KA 3V7TA 3TJOA 2LELA 4YO9A 3OFND 1SC8U 2QF5A 1UTMA 5FX5A 1DE7H 4I8LA 1XM1A 2Y82A 1RFNA 3TJUA 2WZQA 4P00A 2ZTZA 5FL7D 1C1UH 3KNXA 7GCHF 1FLEE 3TK6A 1BB0B 1NRRH 4INKA 3RXBA 1HAVB 2BD4A 2ZDLA 2VVVA 3PMAB 5CHAC 1WBGB 1FZZA 1QL8A 3UOUA 6CHAB 3UWIA 1SVPA 2OTVA 2ZEBA 1V2MT 2FLBH 2BDAA 1XMNB 3PO1C 3RXVA 4CRCA 1GJDB 4DT7B 3AW0A 5DGJA 1HCGA 1OWKA 3EA8A 3RXKA 1CSOE 3F0PA 3KQDA 3RC5A 1VCQA 3OY6U 2F91A 3ZZBA 3OTPA 3RMOH 2SNWA 3MHWU 3OYPA 2FOEA 5C3NA 1YPHC 1FY5A 3KGPA 1P2OA 3GY7A 3AK5A 1A3BH 5F03A 5C1XA 3MNBA 3KQ5A 1QR3E 4X2YA 1A5HA 1ACBE 1E37B 3EA7A 1P2NA 1DM4B 1OP8A 1D6RA 2K1QA 2RA0A 1UTPA 2JETC 2R2MB 2F9BH 1ELGA 1KXFA 3MH6A 4XBBA 1COWD 1Y3YA 4AGJA 1Z8JB 5FPYA 1KLIH 4HI3A 3RMMH 4NSYA 1EB2A 1GL0E 3GDVA 3T25A 4OGXA 3O8DA 5A0AE 2O8LA 5L6NH 1G36A 1AVGH 1BUIA 3BTKE 3A87A 1SLXB 3BG8A 3QDZB 4E7RG 3O8BA 1BRUP 2AYWA 1MTSA 1MBQA 3S7KB 2STAE 1QB9A 2G00A 2ALPA 2QE7D 2VVCA 1JXPA 3BIVH 4K60A 1MZDA 2FYQA 4AB8A 4JZ1A 5T1VA 2YMSC 3SU4A 1TYNA 1CHOF 2PHBA 2PR3A 3RXQA 2UWPA 1ZHPA 8LPRA 1GI5A 2UUJB 5EPNA 5FHTA 1BIOA 1LKAA 3LT3A 2NU3E 3WWFA 3ZIAD 4NA7A 3HATH 1WAYB 1O3IA 1P05A 1SOZA 1DWDH 2XWAA 2OBQA 5JB8S 1P9SA 3SJOA 2VWMA 1O2ZA 4CHAC 1MH0A 1MTWA 2ZTXA 1YPHE 3GDSA 1C1RA 2VGCB 3CS7A 2OLGA 1C5YB 4A1VA 1ARCA 3DFLA 1RTLA 1D3DB 1SGYE 1C5WB 3N7EA 1WTHD 2BXTH 1TPAE 1BJVA 1NROH 1AE5A 2ZTYA 1TALA 1SPJA 4ZH8A 4DGJA 3TH3H 3NWUA 2D2DA 2QIQA 1H8HD 2L74A 3ZZCA 4LXBH 1GCDA 1H9IE 4FUCA 2ZC9H 3SNDA 2NU1E 3TGKE 1SLUB 2JJ2D 3M3SA 1QNJA 2O9QA 4JCNA 4K1SA 2YNBA 3MU8A 1S81A 4UFFH 2FLRH 3SJ8A 2ZCHP 1T7CA 2EEKA 2PLXA 2BD9A 3AASA 2QF0A 3E91A 1SSXA 4B75A 4X2XA 1TE0A 1RTFB 1SGIB 4JK5A 2TGDA 3PMBB 4IN2A 3UR6A 4I32A 1MTVA 2QV1A 4BOHA 1TNIA 3ZVGA 3LJOA 1C5RA 2BX4A 2CXVA 2KCYA 3SZEA 4H6SB 1L2EA 1P3EA 4KELA 1C2IA 2ZKSA 1V3XA 3VXEH 4I33A 1GMHG 3TJVA 2FESH 1RD3B 2O8UA 1C5PA 1EASA 2J4IA 2VWNA 3U9AH 2PKSB 1UJ1A 1HAOH 3WY8A 2JH6D 3P8OA 5IK2D 4CBOA 1PYTD 2LP6A 1D3TB 3SV6A 1L1NA 3LGIA 4X1QU 1KLJH 1UK2A 1UVOA 1V2ST 1ZPCA 3F0OA 4DURA 1N6XA 2B9LA 1S6FA 1EPTA 3TU7H 3MH5A 1KY9A 1ZTJA 3DD2H 1L0ZA 1FY4A 3S9CA 3OEHD 3PB1E 1EJAA 2RG3A 1Z6EA 1OX1A 1NESE 2QF4A 3SV7A 5E0HA 1V2KT 4ABIA 1H4WA 2R9PA 2R2WU 3LIWA 3VB4A 2RDLA 1P02A 4O3UA 3SU2A 1SI5H 4YT7H 1E1QD 1HYLA 1QHRB 1RIWC 3BTME 3BV9B 1ANBA 4RKOB 4NSVA 2FM2A 2A7HA 3VB5A 3SU3A 2OC0A 4X0WU 2A7CA 1HJAC 3NXPA 2JH0D 1O2HA 4CRFA 3RXIA 1D3QB 4ISHH 2OP9A 5FPTA 5GCHF 1UVPA 1AHTH 4YXWD 2WSSD 3B8JA 1GI8B 1UMAH 4MNVA 5LGOA 2G4TA 1QJ6B 1NS3A 4Q7XA 2G5NA 2WV9A 1YP9A 4RT0A 7KMEH 1GHWH 5HIYA 2WV4A 4ISIH 3BEUA 1SL3A 2CHAB 1EPTB 1INCA 3PRDA 5HM2A 1VKYA 1ELAA 5JBCS 1WV7H 1FMGA 2BVSH 5J4SA 1LVOA 1EUFA 1RRKA 2BQ6B 2ZU2A 3KQEA 4WMFA 4ACAA 2FOAA 3HGPA 2H9TH 2OXSA 3PV5A 1GMCG 4UFDH 2ZGCA 1SGFG 1NRSH 2PWXA 4AYVB 4KGAA 1W10U 3VPKA 3QGNB 1OWDA 2ZZUH 3D23A 4CRGA 3VFEA 4B6EA 3TH2H 4CBNA 1BTWA 4LZ4B 3F6UH 3FANA 1C1NA 1BT7A 3EDXB 2M5TA 2XNIA 4AGKA 1AGJA 1J14A 1QJ7B 3T62A 4TY6A 4O9VA 4ABGA 1ZTKA 2TGTA 1DWEH 1H8ED 1F0SA 1LVMA 5GJ4B 2BD5A 4UD9H 1H8IH 1THSH 1XXDA 3K65B 2SNVA 2G52A 3GDUA 1P11E 2QXJA 2CF9H 1L4ZA 2ZGJA 1GVZA 5C94A 2QY0B 3PV2A 3MQKC 4K69A 3MYWA 4B2AA 1AO5A 1F5LA 1HV7A 2BLOA 1SFQB 2ZG0H 3F3BA 4LOYH 3SU6A 4K8YA 3LC3A 2K0QA 1ESTA 2ODQA 1V2LT 2CN0H 5DP8A 2OINA 4ISNA 1GHBG 3QGJA 3P8GA 2KCAA 3FZZA 3ZZ6A 1EOJA 3I29A 1V2UT 4DY7B 1YCPM 5EXMA 1C9TA 4ABAA 3PLPA 1B0EA 4Y8XA 1O2UA 1ZMLA 1WXRA 4Y7BA 1A2CH 3MU5A 3F2HA 4BTTB 5PTPA 3WW7A 1LKBA 3QO6A 5L2ZH 1LMWB 1O2YA 1W14U 4X1RU 2BLQA 1YKTA 2OBOA 3JZ1B 1TMTH 2QF3A 3BG4C 1HB0B 1J15A 2FX6A 4HGCA 4NA8A 4DIIH 1K28D 1NC6A 5ETXA 1FQ3A 2FOBA 1NN6A 1DWCH 3Q77A 1W0JD 4MG3A 1GG6B 4FUFA 3TNTA 1UVSH 5CE1A 2ZU1A 1O3EA 2Z7FE 5EOKA 1DUAA 1IHTH 1HJ8A 1TIOA 4I86A 1HRTH 1O2OA 3BEFB 2XTTB 2ZIQH 5DP9A 3ITIA 2XYAA 2H9EH 1SFIA 1DLKB 4TPIZ 3RXGA 2Q6DA 5T6DA 2FZZA 4TSFD 5EXNA 1GDQA 1GHYH 3SJ9A 3K6ZA 1UVUH 1DOJA 1LCYA 3S9AA 5TJXA 5CHAB 1PPCE 2PGQB 1E34B 3TJNA 2OC8A 2Q1JA 1C4Y2 4X1PU 1PPHE 2ULLA 4UEHH 4RKJB 1KXDA 3NKKA 3FOAA 3PO1B 1N8OC 2KAIA 4TT3D 1FI8A 3MO6A 3BSQA 1GHAF 3MU4A 4I8KA 1K1JA 1XUGA 4D9RA 1SG8B 1NRPH 4DOQA 2AGIX 3F9EA 1P9UA 2HPPH 5EQSA 1DANH 1PQ8A 1GMHF 1F0UA 1E38B 3E8LA 3FO8D 1NM6A 2ANKH 3LU9B 2H6MA 1Y3UA 1ELFA 3PM3A 5FCKA 2OQ5A 3NRLA 4WMEA 4X8TH 2JETB 3BTEE 3GICB 4Y10E 5JBAS 2VWLA 1BTUA 1YPMH 3Q00A 5K0HA 2WHXA 5HIZA 2BY7X 1F92A 5EJ1A 2GZ7A 1J17T 3I78A 1MZAA 2F43B 4KKDA 4X6MA 4ZMAH 4NFFA 5BPEA 3P70B 5IYTA 1J16A 1GJ7B 4RI0A 1HAPH 4AG2A 3UUZA 5ESTE 4Y11E 5CDFE 1DWBH 1GJCB 1BTXA 1GDNA 1GMDF 2A45B 1H9HE 3UNQA 1FV9A 4XDEA 4GSOA 2YMSB 1GI2A 2ZU4A 1KXEA 3LGTA 5EJLA 2ZECA 4FU8A 1T8OA 2HNTF 2QGRA 2UUFB 2BD7A 2ODPA 4B73A 1CGHA 3A82A 1Z8GA 1SGPE 1HPGA 2ZCLP 1P2JA 4AORA 4RT1A 2L6OA 1EAXA 1ZSKA 4OS1A 1A1RA 2KAIB 3T2NA 1NU9A 2ZPRA 1TRYA 4CHAB 2G8TA 3MH7A 2C90B 3U1IB 3GCTG 7LPRA 1GJ4H 4ZKSU 5DPAA 1QA7A 4DW2U 4BXSA 1DX5M 1MTUA 2GMTB 1NFUA 4YZUA 4JYVH 4CH8B 3MU0A 5FCRA 1AUJA 1W0KD 3U8OH 2TGPZ 2BD2A 2J5UA 4HTCH 5L2YH 4WH8A 1T8MA 2IJOB 5EJZA 3MNCA 2BDBA 3SBKA 2A7JA 2FI4E 1GI0A 2Z9GA 5FBEA 4GPGA 1S84A 3MNSA 1BTHH 4WY3A 3GY4A 1O2IA 3RDZA 3STJA 4Q7ZA 1E79D 4U32A 1TX8A 2AMPA 4KTSA 1BDAA 5JBBS 1OP0A 1C5TA 1SGNE 1GGDC 1LPZB 2P93A 4Q7YA 1ZR0A 2OUAA 2SGPE 3D62A 3UNSA 1GHXH 2XC5A 4H6TA 1GMCF 3ESTA 3PWBA 4F4OC 1VITH 2ZHFH 2C8WB 3KQBA 2LNCA 2UWLA 3QTOH 1TWXB 1WCZA 1ZSJA 2KZ4A 1AUTC 1DICA 1RGQA 2ILNA 1LO6A 1ETRH 1YGCH 3N7OA 5A2MH 3KL6A 2SGEE 1EJMA 1HAXB 2BD8A 2H9HA 4XBCA 1LQEA 1V2VT 2B5TB 4NZQA 2G55A 2WPDD 2FODA 3BF6H 1GCTC 4WJG2 2Z9JA 2VIPA 4X2VA 1ABIH 1BTPA 2A5IA 1O37A 2FTLE 1ELVA 4ZHAA 1IQJA 4YLUA 4BAQB 2AGEX 3K6YA 3P8NA 3E16B 3IWMA 3Q3YA 3UAIC 2GCHG 2F9OA 3PLBA 3V3MA 2O8TA 5DP3A 3V12A 2FOHA 2STBE 3A8CA 2BD3A 1ZOMA 4DIHH 2OC1A 1TNKA 2AERH 4WWYA 4FUHA 3HK6B 1FXYA 3RLYH 2V3MA 1HAHH 1FIWA 1SGEE 3SNAA 1DVAH 1GHBF 2ZPQA 4UDWH 2WPJS 3QZRA 4CH2B 2IPQX 3RXPA 4CRDA 4XD7D 3ZV8A 1O5AB 1KLTA 1MU6B 6LPRA 2KCOA 3F9HA 2W6JD 2Z9LA 3M7TA 1OWHA 5EU8A 3N7DA 3T5FH 2GV7A 2B0FA 1RIWB 1BBRE 1LVBA 1O3CA 4Y71A 1V6DA 1HJAB 2H1UA 2GJGA 3QX5H 3K9XB 4I8JA 2A5KA 2AIPA 1EOLA 1O3LA 3RXJA 4SGAE 1BITA 1VGCC 1O3OA 2ZGXH 1EX3A 3PMHB 1YPGH 2FPZA 5G4BA 2DUCA 1OPHB 2V3HH 2F9UA 4ZKRU 1AFEH 1H9LB 3SORA 2RCEA 1FPCH 1G3EA 3A81A 3M37A 2BTCE 5LPRA 1GBTA 1WTGH
chains in the Genus database with same CATH topology
1GBHA 1ELCA 1DFPA 1C2LA 1C1OA 1LPKB 4FXGH 4NFEA 1FAXA 2H2ZA 3H5CB 1EAWA 1PPFE 1K9OE 3A7YA 3UTUH 3ZVAA 1TX6A 2J2UA 4BAOB 1T4UH 3MO9A 2A1DB 1BRAA 4A7IB 3I77A 3PLKA 3A7WA 4IW4E 2ZU3A 2P3TB 1CVWH 1QRWA 1T31A 1A0LA 1T8NA 1VCPA 1UTJA 5T3HA 3W95A 1F7ZA 1GBMA 1DXWA 1Z6JH 3NZIA 1C5QA 3MU1A 4H42U 3ODFA 1O3FA 3O8CA 1FDPA 4OS2A 1QRXA 1QURH 3GY6A 4ISOA 1YLDA 5TCCA 4X2WA 3FVFB 1QY6A 3BTQE 4BAMB 2CGAA 2PKAB 1VR1H 4JZDH 3PMJA 1E0FD 1QL7A 5HMAA 1O39A 2WPKS 4H4FA 3RXRA 3RM2H 1EXFA 1OXGA 1GBBA 3ZVEA 3LKWA 1C2GA 1YBWA 2EI6A 4THNH 2F3CE 1FNIA 1NY22 3Q3KA 6GCHF 1C2EA 1DITH 1GI9B 1DT2A 2QXGA 3U69H 3VB7A 4U01A 2J38A 2ZDKA 5IDKA 1K2I1 4INLA 1GHAG 2C8YB 4B2BA 1SHYA 1A0HB 2A4QA 3QTVH 1NTPA 2ZNKH 4ZKOU 1HJ9A 3FP7E 1NRQH 4UE7H 1E36B 1Y3WA 3MNXA 2SGAA 4YTAA 1PPEE 7ESTE 2ZQ2A 4YM9A 1O2TA 2Y5HA 5E0JA 2UWOA 2P59A 4CRBA 3E90B 1K1OA 3FP6E 2GTBA 5DP6A 3E0PB 1O5EH 5HM9A 2TRMA 4JZFH 1HAGE 1BRCE 3PYHA 3UFAA 2XCNA 1TNLA 1TMBH 2BY9X 3LGUA 3RU4D 2DE8A 1BQYA 1O3DA 3UWJH 4ZAEA 2BLVA 1ID5H 3EQ0H 3IITA 4FU7A 3GCTF 2AH4X 3VXFH 1ZSLA 3VGCC 1B0FA 5EPYA 3SQHE 2FMJA 1LHEH 4YOGA 1A5GH 3UPEA 5T6FA 3GCNA 3HK3B 1GMDG 3BG4B 4U2WA 1C2KA 1KXBA 1Z8IB 2AGGX 3VEQB 1W0YH 1UK3A 4DG4A 1OWIA 2BQ7B 3RXTA 3E0NB 1G3CA 4WXVA 4B71A 1AU8A 2TIOA 2FOMB 1MAYA 3U8RH 1A5IA 2W26A 1ETTH 1C5OH 2LPRA 1V2WT 3LJJA 1BHXB 1QQUA 1HXFH 1L4DA 2Y7XA 1EZSC 1AFQC 1B5GH 2SGQE 2VNTA 3MI4A 1A0JA 1SR5C 1P01A 1YC0A 3A89A 3NK8A 1O2LA 1AI8H 3TK9A 1GBIA 2XRCA 1ZGVA 2QCYA 1AY6H 4KP0A 1Y5AT 4X1NU 2Z3DA 4DJZB 2ZDVH 1QJ1B 3E6PH 3ZZ5A 4UFGH 1NO9H 1O2MA 1YPKH 2O8WA 1VZQH 1IQGA 4ABFA 1N8OB 1AN1E 1MMJN 1W3CA 1O3MA 3TK5A 1CHGA 3ATWA 3SJKA 1DUEA 1MBMA 3URDA 5F8XA 2PV9B 1C4V2 3CENA 1XX9A 3M5LA 5HYOA 3D65E 5AF9H 1UTLM 1ESAA 1TPPA 2EI7A 5JBTA 1ELTA 4AZ2B 2O8MA 1DSTA 1GI1A 1BMAA 3LGWA 2UUKB 1G3BA 1O3GA 1P06A 2XBXA 3A7TA 1ZHRA 3ZVDA 5C2ZA 1YPJH 1S82A 1O3BA 4Y8ZA 1CGIE 2GZ9A 1AE8H 1XUFA 1PQ5A 1UTQA 3C1KA 3E3TA 3MFJA 3SN8A 1O3PB 4AFUA 1CA0C 4JYUH 2BOKA 2GCHF 2QAAA 5JB9S 1IQEA 3EAJA 3ZZ9A 3F9FA 1ANEA 2GX4A 3BN9A 3ZZAA 2JKHA 2THFB 1XKBC 3GY5A 1HNEE 3SW2B 2P16A 3O8RA 3SGAE 1Z8RA 1ANCA 1P2KA 4MNYA 2BHGA 4NG9H 2A2XH 1O2VA 4YOIA 5E2PA 1O5CB 1UTNA 1XUIA 4NIWA 1C4U2 3P8FA 5GPIB 5EW1H 1W8BH 3UOPA 4MQAA 3GCHC 1QA0A 4XFQA 1O3KA 1HAIH 4YESB 3RM0H 4OGYA 1HIAA 1F5RA 4AFSA 2Y5GA 1V2RT 4O3TA 4XE4A 3CS0A 3KIDU 5H4IB 5T6GA 1P0SH 1O2WA 1TGCA 1MCVA 5HGGA 4CR9A 2EI8A 1ZZZA 2TGAA 1P03A 2HNTC 3V0XA 2D8WA 2J92A 1KXCA 4INHA 1XUJA 1K22H 3LC5A 5ESBA 1JBUH 2BVRH 1F0RA 2Y80A 3CP7A 1Y3XA 4YLQH 1W12U 1TQ7B 1ZPBA 5C67A 5JDUB 1PPBH 1L1JA 4JZIA 4MTBA 1PPGE 1ARBA 2ASUB 2UUYA 1LHGH 1V2OT 1S0QA 3ATMA 2D26C 4Y79A 2QXIA 1MCTA 1MAXA 1C5LH 2XCFA 2ZHEH 4DCDA 2BXUH 4E05H 1A61H 1IQHA 3RXCA 2F83A 4Z6AH 1GGDB 1O2QA 2J94A 2PGBB 3ZZ3A 1DXPA 2BZAA 1D9IA 2VH0A 3KCGH 1D6WA 1N6YA 3A85A 2FIRH 3SI3H 5FBIA 3GY2A 1MD7A 2R3YA 4OS7A 3LDXH 1MTNC 1VJAU 3MOCA 3RMLH 1CBWC 2Z3EA 1GBDA 1HIAB 1IQMA 3TPIZ 1BOQA 1OP2A 1WOFA 5F8ZA 1HGTH 2CJIA 1BCUH 1GCTB 2HNTE 2VH6A 4UFEH 1SGDE 3GOVB 1Y5BT 4ISLA 3GYMA 1WUNH 1GI6A 4ABEA 1A4WH 2XBWA 5CMXH 3SI4H 4YT6H 1ZJKA 2A5AA 1K1LA 1TABE 1XUHA 2NU4E 3NPSA 1THRH 3A8AA 1O3HA 4QT8C 3OTJE 1NT1A 2Y81A 3DUXH 1TPOA 1GBCA 1O2XA 1G9IE 1FN6A 2A31A 1ZRKA 3RU4E 2ZWLH 1YPEH 2C8ZB 2FOFA 3V13A 1OWEA 2FS8A 4A1TA 4WMDA 2Z9KA 3ZZ8A 3ZVCA 1MUEB 2ZI2H 1DDJA 3M7UA 1P8VC 1WU1A 2BYAX 1C2MA 2XBYA 2R0LA 4CRAA 4FUGA 2IPHA 2ZCKP 4B74A 1O3JA 5LPFA 1VITG 1AZZA 5LH8A 2HOBA 2C4FH 4XSKU 2C8XB 6GCHG 1THPB 5J4QA 4X6PA 4LZ1H 3F9GA 3SNCA 4LK4A 1S6HA 1CT4E 2GCTC 4NZLA 1NFXA 4U30A 3GCOA 1HBTH 3SGQE 4R0IA 9ESTA 1WQSA 3L3TA 2FOGA 5GDSH 1SMFE 3UQOA 1ZTLA 3MH4A 1VGCB 1ESBA 6ESTA 1AVXA 1JWTA 1O36A 4JZEH 3RXDA 1S85A 1W2KH 4IGDA 3RXUA 2ZDMA 3T28A 3LGVA 3GISB 1XUKA 1EATA 1GBAA 2QC2A 2OQUA 2V0BA 1GBJA 3OY5U 1LHCH 4O03A 2VIVA 3U98H 4BANB 4TY7A 1Q2WA 1AWHB 1T4VH 4MDSA 1TNHA 1EZQA 1S5SA 1UCYE 1Y5UT 1MKWH 1QBNA 2I6SA 1QBOA 3UR9A 1FY3A 3RXAA 2GVFA 5I25A 2FI3E 1P2QA 1O2SA 1NRNH 4CREA 3PWCA 1WQVH 2WUCA 4B76A 2VB0A 3LONA 2ZFTA 1GVLA 3DFJA 2WYGA 3P6ZB 1GVKB 1CE5A 1BRBE 4X8UH 1P09A 3TGIE 1C1PA 3QN7A 3R0FA 2W5EA 1QB6A 1C1QA 5DO4H 2ZQ1A 1BA8B 1DSUA 3A8DA 1XKAC 1TNGA 3K2UA 1FJSA 2AS9A 3L6PA 3A86A 3EA9A 1OWJA 3RC4A 3FFGA 1X7AC 3BTHE 1GL1A 1UTKA 2G5VA 4WH6A 4ABJA 3ATKA 1C1MA 3ELAH 3QUMP 3ZV9A 3BTTE 4JMYA 2PFEA 3RXMA 2ESTE 4NWLA 4X6OA 3M5NA 3BEIB 1MQ6A 2CV3A 1BBRH 1P2IA 1W13U 1JIRA 4UONA 3SU5A 3BTDE 4Y7AA 4ZXYH 1SGRE 4Z0KA 1FUJA 4A1XA 3P95A 3FAOA 3EGKH 3RMNH 3TH4H 3MO3A 1SGCA 2HWLB 1C1VH 1CT2E 3ZYDA 3SV9A 2WUBA 1DY9A 2TBSA 2PUQH 1Z7KA 1SGQE 1T8LA 1C5UA 1TGBA 1O30A 4MPUA 4NIVA 3B23B 1ZYOA 2NU2E 5JYIA 1TAWA 1KDQA 2GP9B 1GJ6A 2ZHQH 1C1WH 1L1GA 1TGNA 2P8OC 4GLYA 2W3IA 3E1XB 4ZXXH 5JPMH 3HGNA 3VGCB 2A32A 2BB4A 5A0BA 3RXFA 2VWOA 1QTFA 2HGTH 1RS0A 1ZJDA 2BX3A 3T26A 3VB6A 3SUEA 2CMYA 1CO7E 2WYJA 4MLFB 1W7XH 3UNRA 1SQOA 1ANDA 1BZXE 2WPLS 1WYKA 3S69A 3S9BA 1GJ5H 2J34A 4ZHMU 3ZZ7A 1FPHH 2ALVA 2FXRA 2GZ8A 1H8DH 4AYYB 3TLOA 1EAIA 4KTCA 4TWYA 1GBFA 5F6MA 4ASHA 1LHDH 3OU0A 4JK6A 2PKAA 3QLPH 2J95A 4K3JA 5DP7A 2QXHA 1C5NH 4SGBE 2WPMS 1WSSH 1AFQB 4K2YA 1C2JA 2HPQH 1DS2E 1ZRBA 2ZDNA 1O2RA 2WPIS 1EP6A 4GUXA 1SGTA 1O5BB 4WF8A 4AFQA 1O2PA 1OSSA 3HKJB 1P2MA 2VVUA 4ZROA 1XVMA 1KTTB 4KTUA 3ZVFA 4AFZA 1O38A 3ZYEA 2GDDA 2FWWA 3Q3XA 3P92A 1S0RA 2A2QH 1C5VA 4BTIB 1P10A 1D3PB 2ANYA 2PSYA 1YCPH 1C2DA 4J2YB 3PROA 4ABBA 1TONA 1AB9C 4NGAH 3RXOA 1O2GH 5DKMA 5GIBA 1V2TT 3SHCH 1GI4A 4X1SU 4Y8YA 5L30H 1KDQB 4Q80A 5EQQA 1HAZB 1GDUA 3MWIU 1Y3VA 5AHGH 3AVZA 3STIA 1EJNA 4IC6A 1NZQH 1SHHB 3SUFA 5DK1A 2XBVA 4E06H 2VJ1A 1UVTH 2Y5FA 1CA0B 5DJ7A 5A8YA 1PFXC 4K5ZA 1XXFA 4WXIA 4FUIA 1MKXK 1FAKH 1SQAA 3Q76A 1O2KA 3JZ2B 1EQ9A 1PQAA 1JOUB 1AKSA 4VGCC 1H1BA 2GMTC 1G30B 2HVXA 1KIGH 1EP5A 2ZO3H 2Z6BD 5EXLA 4K1EA 1BTZA 3S0NA 1O3AA 2ZFPH 1O32A 1DPOA 1IQFA 1GPZA 3H7TA 1G2LA 2P3FH 1VITF 3GCHB 5DP4A 1ZHMA 2YNAA 2ANWA 5FXLA 1O5GH 3MMGA 4K8BA 1V2JT 1SGFA 2WINI 1A7SA 1SLVB 1TRNA 1G2MA 3M7QA 1SBWA 1GHZA 2QN5T 1PQ7A 4R8TB 5FAHA 1UTOA 3L33A 4GHTA 4IBLH 2IOTA 1C5SA 3B9FH 2PTCE 1LPGB 3LOXA 1BJUA 1N1LA 2GD4B 4IC5A 2Q6FA 2W7UA 1F0TA 3URCA 2G51A 1TGSZ 2ODYB 2FTMA 4BTUB 2GGVB 1TA2A 3SUGA 1BMNH 1LHFH 3ATLA 2R3UA 1HXEH 1K1PA 2ZA5A 5HXFA 2FX4A 3SHAH 1A46H 4JYTA 1O5FH 1TNJA 3QWCH 2P3UB 1GI7B 1Z1JA 1GBKA 2XXLA 1KXAA 2ZGBH 4B1TA 2DE9A 3RLWH 1AKSB 8GCHF 2NWNA 6CHAC 1YM0A 1G3DA 1SQTA 2FO9A 4BAHB 4MNWA 2WPHS 3R3GB 5EW2H 5C1UA 1YYY1 3UY9A 8ESTE 3TGJE 5K7RA 5C5OA 1MTNB 3A88A 1CA8B 1CBWB 3VB3A 3AAVA 3HKIB 4XOJA 2G4UA 4GHQA 1F5KU 4MPWA 1C2HA 3SV2H 3S7HB 5DP5A 1ZPZA 5E0GA 5SGAE 1K1MA 4GCHF 2P95A 1JRTA 3LH1A 2HRVA 2YOLA 1B7XB 2VIDA 4D76A 3RC6A 3HPTB 4D8NA 5GXPA 4X8SH 3W94A 4F49A 1OKXA 1P57B 3OSYA 3A84A 3D49H 1GHVH 2VINA 2PSXA 1NU7B 3UIRA 4FVDA 1UCYK 2FOCA 3QK1A 3KF2A 5A8XA 1TX7A 2H5CA 4GAWA 2W3KA 3RXHA 2I6QA 4NCYA 5A09A 1QCPA 4IS5A 1UHBA 3RXLA 5FX6A 2TPIZ 4Y0ZE 5AFYH 2A4GA 4ABDA 1E35B 1M9UA 5C1YA 4IMQA 2CF8H 1AD8H 4OS6A 1D4PB 1MQ5A 3SU0A 3TITA 4WVPE 2JH5D 3M61U 5E8EH 1O3NA 4A92A 2F9PA 5AVDA 1K1NA 1TBQH 3EE0B 3BIUH 3BTWE 3DHKH 2AFQB 5A0CA 2VGCC 2GCTB 4X8VH 3SNBA 1QL9A 1IQLA 3A7ZA 4M7GA 2AEIH 3ZVBA 1AWFH 1O5DH 2HALA 3SQEE 1GJBB 3ODDA 1K1IA 1MKXH 3A7XA 4FU9A 3F1SB 1PPZA 3SJIA 1CQQA 4Y76A 3M36A 3OX7U 4A5TS 3TIUA 1TBZH 5TCAA 3SUDA 1QQ4A 2BY6X 2GT8A 5EODA 2F9NA 3NCLA 2ZPSA 2V6NA 2BZ6H 1LTOA 3G01A 1FN8A 1RJXB 4D7GA 1O2JA 2ZFSA 1V2PT 1MKWK 1FONA 1HDTH 2XC4A 2GKVE 1Q3XA 1QIXB 4ZHLU 5AFZH 7GCHG 3ZZDA 2A4RA 4ABHA 4IN1A 3RP2A 3RXSA 2ZDAH 4IMZA 2H5DA 2ZFQH 1KYNA 1P04A 1TBRH 2BDHA 2P94A 4PROA 1UHBB 4FUBA 3RXEA 1C2FA 2ZFRH 4Y6DA 4E7NA 4ESTE 1AIXH 1IHSH 1FY1A 4YOJA 3KN2A 1GBLA 1ORFA 1MD8A 1P12E 2Y6TA 4DVAU 1K21H 1SB1H 5C5NA 3PTBA 4NIXA 1SOTA 1W11U 1C5MD 2Q6GA 1TRMA 3RU4T 4D7FA 2FEQH 1J8AA 4X6NA 2XC0A 2OC7A 4MVNA 8KME2 5C20A 2Z94A 2Z3CA 1AMHA 2WV5A 2OCVB 1CGJE 1G32B 1LVYA 2J9NA 2PKSC 5B6OA 4K1TA 1GWAA 4FUDA 1YLCA 1VCWA 3KQCA 3F68H 4OS5A 4BXWA 1EAUA 1ZMJA 1PYTC 1ZLRA 4BAKB