3RXOA

Crystal structure of trypsin complexed with (3-pyrrol-1-ylphenyl)methanamine
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In-crystal affinity ranking of fragment hit compounds reveals a relationship with their inhibitory activities
doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxoA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxoA02
2R2MB 2PUXB 1C2MA 1O3NA 1HB0B 6GCHF 1UVUH 1GHBG 1F2SE 4MLFB 2J9NA 1TA2A 3F68H 1ELAA 1A4WH 1OP2A 3GCHC 2SGAA 1XUJA 1TBRH 3LC5A 1Z8IB 4AB9A 3LGWA 5EXMA 5A8XA 1ELVA 4U30A 3SOSA 4ISOA 1SLUB 2UUJB 4WXVA 4KTCA 1WQSA 1FJSA 3F9HA 1O33A 4WXIA 1C5MD 3P17H 5GCHG 4WF8A 1JIMA 2WYJA 1DVAH 1TPAE 3EGKH 1QB9A 2AH4X 4Y7AA 5DO4H 1IQKA 1JIRA 2J2UA 3VEQB 7ESTE 5J4SA 4A92A 6GCHG 4RN6A 1O2LA 2A7JA 3F6UH 3K65B 4I32A 1O3HA 1SFQB 4Y10E 1IQJA 1YCPH 1A5GH 1S84A 2A5IA 5JYIA 1G32B 3LC3A 4VGCB 4Y76A 1H9LB 3QLPH 3RLWH 2F9OA 3FAOA 3BTWE 1HYLA 4PROA 1GG6C 3NXPA 1NFWA 4AFZA 4FUCA 3PMBB 4X6PA 2QXHA 4AG2A 4MPVA 3MFJA 3FZDA 7GCHG 3M3TA 1IQLA 3OX7U 2AEIH 1O37A 2TPIZ 2WPHS 4K69A 1O5EH 1FLEE 1Q3XA 4ZXXH 5A0CA 2XCFA 1MMJN 3T26A 1SG8B 4B2BA 1SGIB 3ZZ9A 4B2AA 3EE0B 2BZ6H 1LKAA 1EB2A 3BV9B 3SV8A 2O8UA 1AZZA 1B0FA 4D8NA 1AIXH 2RCEA 2XC5A 4WY3A 2P16A 1S6FA 3A7TA 1AO5A 4D9QA 5K0HA 1JRTA 4FUEA 3RXMA 4D9RA 2XNIA 4U01A 4ABEA 1UTMA 4CRAA 1O3IA 1NTPA 4MVNA 1QL7A 2QF3A 2AYWA 2FLRH 3A86A 3M5NA 3ZV8A 5JBBS 4AZ2B 2FOMB 4JZDH 4MNWA 1GI1A 4AG1A 1HPGA 1S0RA 1LHGH 1L4ZA 4DOQA 4H6SB 1C5LH 1HDTH 1P2JA 1QL8A 1W11U 1C2DA 1FDPA 2F91A 1EP6A 1K1JA 2OXSA 1CA8B 1BRBE 3GYMA 5F8ZA 4I8LA 2AS9A 1RTKA 3QTOH 1PPBH 1YPMH 1FNIA 4AFQA 1TIOA 1EB1H 2AFQB 4YOIA 2ZGXH 1ARCA 1J15A 1BTUA 1AUJA 1LHEH 2FTMA 3ODFA 2C8ZB 1C1TA 1LO6A 3A83A 2AIQA 1THSH 5C20A 1DXWA 4BTTB 1DWDH 1TMUH 1XUHA 2ZO3H 1V2WT 3LOXA 1FMGA 1BMNH 1YBWA 1OWJA 4DY7B 3BTFE 2BZAA 1O3BA 1P05A 2B9LA 3U9AH 1VJAU 5EW2H 1SOTA 4FUGA 1V2TT 1P12E 2A5AA 5CHAB 3AAVA 3H7TA 3HGNA 3SORA 2EC9H 1QQUA 1ELTA 1SGDE 2GDDA 4FXGH 1B0EA 3T5FH 1C2HA 1ANEA 2Y5HA 3M5LA 2KAIB 4TY7A 3BIUH 1G37A 1H9IE 1C1QA 1OPHB 3SV6A 1MTVA 2ZFTA 2BDBA 2XYAA 3VB4A 2IJOB 3M5OA 3RLYH 3ZVAA 4E06H 5FBIA 4DT7B 1TB6H 3SU2A 1GG6B 3HK6B 3ZZCA 2CMYA 5F6MA 3UTUH 1GDQA 1GVLA 3W95A 1P2KA 5HM9A 1YCPM 4B73A 1ZOMA 2Q6FA 2XBVA 1N1LA 1C5TA 4UDWH 1GHVH 1RIWB 1A3BH 3UQOA 4INLA 3BEIB 1MTUA 4K8BA 1ELEE 1RXPA 4FU9A 2GV7A 2SGEE 1W13U 2EI7A 1CHGA 4Y0YE 1BHXF 1FQ3A 3LONA 4O9VA 1HFDA 1M9UA 1GHXH 1G36A 1TGCA 4X0WU 2CN0H 4AGJA 1ZRBA 1G9IE 4Z0KA 3A8DA 1C5QA 3KGPA 2O8TA 1NC6A 5JPMH 2RDLA 3I77A 1LVMA 1IQIA 3U8RH 1HXFH 1QBOA 1O5FH 3TJUA 1L4DA 5EPNA 4WVPE 4K5ZA 1YLCA 2K1QA 3RMLH 1EZXC 4D76A 3BG8A 1ZPCA 2GKVE 5TCCA 5LGOA 2VJ1A 3RP2A 3A7ZA 1TNJA 1P01A 2BD8A 1SPJA 9ESTA 2ZFPH 1E0FD 3MNBA 4FU7A 1PPGE 4ABAA 1YF4A 1V3XA 3SU6A 3K9XB 2FS9A 2HNTC 2ZGJA 1PPFE 3UQVA 2W3KA 5DP8A 3ZZ4A 3AW1A 4XE4A 5EXNA 1WUNH 2C8WB 1P9UA 1T8MA 4AFUA 2UUKB 2JH6D 2CF8H 1YP9A 3E3TA 1TPOA 1A0JA 1MU6B 1NY22 1Q31A 3ZZDA 2BDYA 2QY0B 2AMPA 2I6QA 1KXEA 3LT3A 2VNTA 2VIPA 3V7TA 3QZQA 1WAYB 1V2RT 7KMEH 1BBRH 3IWMA 1BTPA 2BDHA 4UONA 2THFB 1W0YH 1NN6A 4WMFA 1Z1IA 2A31A 1FAXA 4XSKU 2LNCA 2VB0A 2OUAA 4LK4A 1Y5BT 2PWXA 2GCTC 3SU5A 2JETC 1O2NA 5E0HA 3VXFH 1KLIH 2AGIX 3A7VA 3PLKA 4ZKOU 3A81A 5HYOA 1C5OH 1RFNA 1GI5A 4IN2A 3ZZ7A 2VINA 1C5WB 3RU4T 2SNWA 1RGQA 1FY8E 1ZMJA 4IC5A 1GBFA 5BPEA 1Z7KA 3QK1A 3EA8A 4SGBE 2TGTA 2A4QA 3T29A 2BQ7B 1AHTH 1NS3A 4I8JA 1GI2A 3SJ8A 1K2I1 3UY9A 2HNTF 5FX6A 1C2IA 5A8ZA 1ZSKA 1UMAH 1QIXB 1QBNA 3SQHE 2VVVA 3N7OA 1F0UA 1SGCA 1GBLA 1O3GA 2ANYA 2O8WA 3RC4A 1N6YA 1D4PB 1GDNA 2BHGA 5HMAA 2HVXA 1EPTC 1O2HA 3TK6A 1W2KH 2HGTH 2XC0A 1O3OA 4HTCH 1V2JT 2FOHA 3A89A 2C4FH 2D26C 1D3TB 1O31A 2GV6A 2VH6A 2CV3A 4I8KA 1N6XA 4FUFA 3UNQA 1ZTKA 1O2RA 1KXCA 1Q2WA 2HPPH 2DE9A 1W10U 1P03A 1T8LA 2ZFSA 3U8TH 2ZU3A 3SUDA 2DUCA 4JK5A 2Z3EA 8ESTE 2PKAA 1O2OA 2OC7A 3LJOA 1WOFA 1YPLH 1MKWH 1AKSB 4X8TH 1ELGA 2ANMH 1QL9A 3PMAB 5J4QA 2BDAA 1H8DH 2PTNA 2AGEX 2ZFFH 3GY5A 4TWYA 1ZHRA 2EI6A 1K1IA 2BDCA 2AMQA 1BCUH 5ESTE 3O8CA 4KGAA 3EA9A 2AERH 2ZU2A 3CP7A 1SGRE 1T7CA 1ZGIA 3TK5A 2BVSH 1JWTA 1GL0E 1BRUP 2H5CA 1DITH 3A7WA 3UREA 3S69A 1C1UH 2GMTB 4ZHMU 1GJDB 1JRSA 2IOTA 1A7SA 1EAUA 4MNYA 4CRCA 1ZSJA 4JZIA 3V12A 3A8CA 1DLEA 1HIAA 2ANKH 1FY4A 1LQDB 1XXFA 2GDEH 1A3EH 4CHAC 2PLXA 4NZLA 3SU4A 2PKSB 3KL6A 1QBVH 3SJKA 1EAWA 3RU4D 1YPHE 1UVSH 5EGMA 5FPTA 5L2YH 2WPLS 1OYTH 4LXBH 4U32A 1HAZB 1VITH 2FOAA 1GJ4H 4JK6A 1LMWB 1FI8A 1HLTH 1PQ7A 3SGAE 1EXFA 3RXVA 4XFQA 4BNRA 4AX9H 3P8FA 2HLCA 2GZ8A 1C2JA 2R2WU 1UCYK 2C93B 4GSOA 2PGBB 1GCDA 1O30A 2B0FA 3JZ1B 1BBRK 2G00A 4X6NA 1EZUC 1NROH 4ZUHA 1OSSA 3L6PA 3QUMP 2XBWA 1RS0A 3M7TA 3RMOH 2HALA 3ESTA 3MO3A 2J38A 2F9BH 1C9PA 1AZ8A 4BTIB 2ZZUH 2FOBA 5ABWA 2GCTB 3PO1C 1AE8H 5K7RA 1GI7B 1TRMA 2D8WA 4VGCC 1BIOA 2A32A 2JH0D 2H9EH 1LHDH 1TGSZ 3GCTF 3UFAA 3BTQE 1AB9C 4DIIH 3M3SA 3ZZBA 1G3CA 1SB1H 3KNXA 5LH8A 1C2KA 1JXPA 2WPKS 4Y8ZA 2J95A 1DSTA 4Q2KA 2R3YA 4DURA 2SNVA 3RC5A 2Q1JA 1YC0A 1QNJA 1EPTA 2SGFE 2NU1E 4YLUA 1QJ1B 1AFEH 1GMHF 2PGQB 1VCWA 1ELFA 1HIAB 1O2SA 3A82A 1GMCG 1NRPH 1DLKB 5DPAA 4CRGA 3RXPA 4A5TS 1MKXH 1Z6JH 4YOJA 2ZCLP 3RXGA 1NFYA 1UTNA 2QXIA 4BAQB 1DWCH 3QGNB 4Y71A 4ABJA 1GJ9B 2W3IA 3STIA 3DUXH 2FIRH 3NK8A 2XRCA 5AHGH 1THRH 1S85A 3ZZAA 4ZXYH 1C1NA 4MPUA 3VB7A 1PQ5A 1EJNA 2H2ZA 1SGQE 3SV7A 1YPHC 1IHTH 1O5BB 4SGAE 2TGAA 1PPZA 4UFFH 2XC4A 4A1XA 1VCPA 1SQAA 1Y59T 1NESE 2FODA 3MYWA 5A8YA 1PYTD 1O0DH 3SI3H 1C2LA 5EODA 1QRWA 2FOFA 3HKIB 5GWZA 3ATIA 1AFQB 1EJAA 4NCYA 3MMGA 1T32A 2BOHB 3VGCB 1LKBA 1YCPK 4Q7XA 4I7YH 2FYRA 4Y11E 5I46H 2G52A 1BA8B 1G30B 1WTGH 1DSUA 3QWCH 5L6NH 1EQ9A 1ZMNA 4IN1A 1ZHPA 5DP9A 5FCRA 4INHA 2XBYA 3HPTB 2ASUB 1VITF 1AWFH 4DGJA 1GL1A 4O3UA 4WH8A 2EA3A 2VVCA 1CSOE 2BX4A 3P70B 4K3JA 3A7YA 4Y7BA 2Y82A 1FONA 1ZZZA 4JYUH 1T31A 3SJOA 1O35A 4INKA 3T28A 8KME2 4CR5A 3P8GA 3FZZA 3PMHB 2GTBA 2ALPA 2ZPRA 3RM0H 3SV2H 1O2KA 4YLQH 3RXDA 2OINA 5JBAS 4Y6DA 2WUCA 2ZI2H 1DOJA 1L1JA 1LVYA 2WPIS 1KYNA 4F49A 2GT7A 1C5ZB 4H42U 2VWOA 3LGUA 3QN7A 2ZHQH 1TPPA 3URCA 1ANBA 4ABHA 2FOGA 3E6PH 4FUJA 1UHBA 4WMEA 1PPCE 4HZHA 2BD7A 4WJG2 1A1RA 1SFIA 2P3UB 1QTFA 4JZ1A 2B7DH 1V2NT 1DFPA 4U2WA 3RXUA 1C5XB 1FY3A 1GGDC 1Z1JA 2XBXA 1VZQH 1O5DH 2F83A 1KLTA 4TPYA 5DKMA 3RXAA 2Z9GA 2BD9A 4ZMAH 3BTGE 1ZJDA 3KQDA 1G3DA 2ZHDA 4DIHH 1HAGE 1TYNA 2OLGA 4B75A 1F5RA 4FVBA 2ODQA 2BX3A 1TBZH 5DP6A 3D65E 3STJA 3L33A 2PFEA 1AQ7A 1UTOA 1OWIA 2Y81A 4CR9A 5AFYH 1KTTB 1GI9B 2VWLA 1S83A 1GHZA 3HKJB 2Y7ZA 1RJXB 3TPIZ 1CGJE 3OY5U 3LH3A 1Z8RA 3KN2A 4JZFH 4E7NA 1GHAG 1B5GH 1P2OA 1H8IH 4GVUA 4MNVA 1DY8A 2CF9H 1BUIA 2BD4A 4CH2B 3LH1A 1AY6H 2A0QB 2V3HH 2G51A 4E7RG 3KQBA 1SHHB 2F9UA 5JBTA 1A5HA 2ILNA 2O8MA 2QXGA 4KELA 2UWPA 4DCDA 3NCLA 4NIWA 1BJVA 3GY7A 4Y0ZE 1KDQB 4IBLH 3OYPA 4I8HA 4NSYA 2FI5E 3A8AA 5GXPA 4CH8B 1CBWC 1XUGA 4ABBA 1BTXA 2W5EA 3ITIA 3M37A 2BY6X 1MAXA 1XUFA 3R0FA 1GHYH 2UUYA 2ZTXA 5LPFA 1G2MA 4RKOB 4YO9A 1GBDA 2AGGX 3EDXB 1Z6EA 2F3CE 3EQ0H 2VH0A 5F03A 1KTSB 1DT2A 1GGDB 1GJBB 2ZGHA 4ZKRU 1SGFA 1AB9B 1TONA 3D23A 2FZZA 1AU8A 2GP9B 4X6OA 1SQOA 2BD3A 3ENSB 1Y5AT 1GWAA 4KTSA 3A80A 1BB0B 3PWBA 1C1OA 1C1VH 1A0HB 1CT4E 4R0IA 1MD8A 4AGKA 1DANH 1AD8H 1V2QT 1UCYE 1UVOA 2LPRA 2G8TA 1V2UT 5BRRE 1SGEE 4X8VH 1TOCB 4YTAA 2FMJA 3ZVEA 1MAYA 4GHTA 1WV7H 2WYGA 1TNIA 1GBCA 3BTEE 4HFPB 3PYHA 1C5RA 2BLQA 3GDSA 5A0BA 4X2XA 2WINI 5F8XA 1O38A 1EZSC 1BMMH 3GY6A 4NIYA 4ASHA 1ZYOA 2XW9A 1TRNA 1TX7A 3E1XB 2FS8A 4DW2U 3AASA 2P95A 2P3FH 1SSXA 3BIVH 5E0JA 3AW0A 1XX9A 1LHFH 1AI8H 2GCHG 1GBHA 3ZVDA 4ZAEA 1ANDA 4Y79A 2ZDVH 2QA9E 1CA0B 2FEQH 2BM2A 3RC6A 4B1TA 3RXIA 2Z9JA 6ESTA 1ESTA 1EP5A 1OWHA 4HGCA 1ZLRA 3I29A 1TX6A 1FV9A 1P2NA 3P8NA 1D3DB 4TPIZ 1MBMA 1QQ4A 1SMFE 1HJAC 1MTSA 5DJ7A 1O5GH 1H1BA 1O32A 2Z7FE 3T2NA 4FUHA 2BY9X 1C4V2 1TFXA 3SNDA 3DD2H 4AYVB 2CGAA 1O3AA 2A4RA 2HNTE 4AYYB 2PUQH 1ELBA 1O2TA 1ELCA 2BXUH 2SGPE 1HV7A 2A5KA 3SGBE 1XUIA 2PSXA 1XKAC 3KF2A 2GCHF 3OTJE 4IGDA 4X6MA 5LPRA 1MU8B 1EOLA 3EYDA 1TBQH 1EX3A 2BDGA 4ISLA 1DUAA 1SOZA 3B23B 3SHAH 4K2YA 1YYY1 2CHAB 2OD3B 4A7IB 4I33A 1O3JA 3W94A 1TX8A 5TCAA 1D3QB 1MCVA 1ETRH 3GDUA 2GZ7A 1TQ7B 5GPIB 3UIRA 1BDAA 2BQWB 2Z9IA 1MD7A 2ZA5A 1P02A 4ABIA 3LIWA 3FP7E 1THPB 3MNXA 2XTTB 3SQEE 2CXVA 1FAKH 2B5TB 3CS0A 3C27B 1MTNB 3SNCA 1KSNA 1DY9A 1U6QA 2ZU5A 1NRNH 2ZCKP 3QZRA 1FN6A 1P3CA 3RXQA 5EQSA 5EOKA 1AMHA 3SNBA 1KY9A 2BB4A 1AFQC 3V3MA 3L3TA 3Q3XA 1O2YA 5A09A 5IDKA 2F9VA 1UTPA 2UWOA 4Q7YA 4GCHF 1DE7H 4CRDA 1BOQA 4I31A 4OS5A 4ZHAA 1RRKA 2ZTYA 1W3CA 3MH7A 3BG4B 4X2VA 1S82A 4NWLA 1NRSH 3E90B 1NT1A 1K1LA 3SNAA 3LGIA 1QB1A 1T8NA 2G4TA 2P8OC 2GD4B 2ZTZA 1MTNC 1WBGB 1MCTA 4A6LA 1CT0E 1GHBF 1IOEA 2PTCE 4X2YA 3TH2H 2AMDA 5FBEA 9LPRA 2Z3CA 1SQTA 1RTLA 1HAOH 2FTLE 4UD9H 1KIGH 3BEUA 1DWBH 4TY6A 3FVFB 1YPKH 2O8LA 3KHVA 2TGPZ 2A45B 1Z71A 2BDIA 2W7SA 1E35B 1F5KU 1ID5H 3MU4A 1FIZA 2FOEA 3UR9A 1UK3A 4UFDH 1G2LA 1S5SA 4ABFA 7GCHF 3SBKA 3SN8A 1NPMA 3RU4E 3O8BA 2OBOA 4MPXA 1EOJA 2BLWA 5C1XA 2BVRH 3Q76A 4XDEA 1GJCB 2Q6GA 1P8VC 2ZF0H 5T6DA 2VGCB 4NA8A 1GBJA 3M7QA 1T4UH 1PQAA 2QYIA 3GY8A 4XOJA 4B71A 1P57B 2Y7XA 1W8BH 2IN2A 1JBUH 4MTBA 1JOUB 1YPEH 1BMAA 1TNGA 5HXFA 3ZVCA 1UHBB 1GDUA 1QB6A 1NU9A 3UOPA 1C5UA 3NWUA 3MNSA 2ESTE 1YGCH 1XMNB 3RMMH 3VB6A 1C5VA 2Z9LA 1GBIA 4BAHB 1ARBA 1LPKB 1GCTB 1HJAB 3M7UA 4CBNA 3MI4A 2ZDAH 3AVZA 3UWIA 3AAUA 3H5CB 2UWLA 3BF6H 4YOGA 1IQMA 5AFZH 3T25A 2C90B 1FY1A 2C3SA 1O2MA 1O2WA 5I25A 1GCTC 1LTOA 2OC1A 1FY5A 1TAWA 3GDVA 4X8UH 5E2PA 3UNRA 3JZ2B 1IQHA 1V6DA 1MTWA 2TGDA 4FUBA 5L2ZH 2ZHWH 3K2UA 4OS7A 2STBE 3SU3A 4D7GA 3E91A 2H6MA 4Q7ZA 1FN8A 1EUFA 1UTKA 1YPJH 1MKWK 2SFAA 1DX5M 3ATKA 3H7OA 3PLPA 3BG4C 4J1YA 4KTUA 1ZGVA 4YESB 1D6WA 1K28D 1GVKB 1ZSLA 1TGTA 4ABGA 3LDXH 3PB1E 4GUXA 2J34A 2B8OH 1AUTC 3V13A 2Y6TA 4NZQA 2P8OB 3V0XA 4O3TA 1KXFA 2Z9KA 3SGQE 2H1UA 1YPGH 2AIPA 1X7AC 2ZFQH 3FFGA 1J16A 3U1IB 2ALVA 1C2EA 2QAAA 1HNEE 2GMTC 3VB5A 2A4GA 1TWXB 1O2UA 1C1RA 4UEHH 3GY3A 1NZQH 1J9CH 2BY8X 2ULLA 3SU0A 2V6NA 2VWMA 3HGPA 4LZ4B 2ZU1A 1QRZA 1QY6A 1O2PA 3WY8A 2G81E 5EPYA 2EI8A 2XWAA 2D1JA 2UUFB 2J92A 2P59A 2G5VA 3BN9A 3TGJE 2WUBA 1OS8A 5IYTA 1SHYA 1C4Y2 5PTPA 1O3LA 1K1NA 3TH3H 1C2FA 4WMDA 3IITA 4AFSA 2H9HA 1C1MA 4WH6A 5JB8S 1GBAA 1D9IA 1GBEA 3BTTE 2ZGBH 2ZIQH 4OS1A 3PTNA 3GCTG 3U98H 4X8SH 2JETB 2GZ9A 3O8RA 1P06A 3ATMA 4ISNA 4NIXA 3SZNA 1GHAF 1HGTH 2TBSA 3O8DA 2ZPSA 1GBTA 6CHAB 2SGQE 5SGAE 3RXHA 2G5NA 1ACBE 1GJ7B 2OC0A 1UVTH 3RXBA 1Z8JB 1ANCA 1P04A 4GPGA 3Q3YA 1O39A 3MNCA 4UE7H 2Y80A 1GJAB 3QO6A 4FUDA 2RA3A 1LCYA 5E8EH 1HAXB 2I6SA 2OQUA 1HRTH 3QDZB 3LGYA 1P09A 3S9CA 1ZTJA 3M3VA 2ZP0H 5E0GA 1V2ST 1XM1A 5TJXA 1F92A 4IMZA 2Q6DA 2VIVA 3RXRA 3B8JA 5DP4A 3S7KB 3ZV9A 2BOKA 1AE5A 2A7CA 3UR6A 1A5IA 1OP0A 1Y3YA 3ZZ8A 5CHAC 1P9SA 1TNLA 3RXEA 1ETTH 3TITA 4NA9H 2W26A 4YZUA 1TALA 3GICB 2OCVB 3MH6A 4OS2A 1O2JA 4K8YA 4JYTA 4X1RU 2BXTH 1RIWC 5ETXA 1H9HE 1EATA 4OGYA 1YLDA 1P2MA 3MHWU 4THNH 4X1SU 1TPSA 2QGRA 3E0NB 2BTCE 1V2KT 4FVDA 3E16B 3RXTA 1PFXC 5FAHA 3EA7A 1O2XA 3F9FA 4BTUB 4UFGH 1WCZA 2VU8E 3LPRA 5EQRA 2R3UA 3D62A 3RXKA 1CT2E 2PKAB 4XBDA 4B2CA 1WU1A 1TMTH 4Y8XA 5C1UA 1K21H 2ZPQA 3TNSA 5T6FA 1HAHH 2QF0A 1B7XB 3FP8E 1OYQA 1BT7A 3I78A 1MUEB 2P3TB 2Z94A 3GYLB 2NU0E 1EKBB 3UPEA 1PQ8A 3K6YA 4ZH8A 1KDQA 4ISHH 1BRCE 1W14U 3S0NA 1GI4A 2ZGCA 4H6TA 5AF9H 1SGTA 3ATLA 1MH0A 1CHOF 1HAVB 2BYAX 4IS5A 4A1TA 5FXLA 3SJIA 1ZMLA 4GCHG 3ZYDA 2BY7X 1TABE 1ABJH 2BLVA 2BMGB 4GAWA 1DPOA 3G01A 1F7ZA 4OS6A 1GVZA 1C1PA 1Z8GA 4XBBA 1V2MT 1HAIH 1Y8TA 1TGBA 2GVFA 6LPRA 1GMDF 1ELDE 3MH4A 3GCOA 1CGHA 4E05H 2WPJS 1NU7B 1SL3A 5T3HA 2XCNA 1V2PT 1LPGB 3RDZA 5JBCS 4YT6H 3DHKH 3PM3A 4K1TA 1LVBA 1FZZA 1TRYA 4JCNA 3DFJA 1IQNA 2ODPA 2VVUA 3TIUA 1VITG 1ZTLA 3HK3B 2VIWA 1KXBA 3TU7H 1GI6A 1ETSH 1ZRKA 3SNEA 4JYVH 2PR3A 3D49H 2BQ6B 5T6GA 5CMXH 2P94A 1GMDG 1UTQA 5L30H 2FI3E 1QRXA 3A88A 2HRVA 1G3EA 4JZEH 1AVGH 3CS7A 3LKWA 5EXLA 2BY5X 1HAPH 1BBRE 4NFFA 3MH5A 3MO6A 1W12U 1P3EA 1SLXB 4NWKA 3RXJA 1V2LT 2H5DA 2A4OA 3PMJA 1DM4B 4NA7A 1GJ8B 3QTVH 3RUOA 1W7GH 5FPSA 3VPKA 3P92A 5GJ4B 2ZQ2A 4MNXA 1AN1E 1O3EA 4B74A 1DICA 2SGDE 2F9PA 3LGVA 1CO7E 1JMOH 1L0ZA 4X1PU 5C2ZA 2ZDKA 1ZHMA 3PO1B 2TRMA 3GCHB 3RMNH 1PJPA 2NU3E 4XBCA 4CRBA 2C8XB 4DVAU 2Y5GA 3NKKA 1O2GH 1P0SH 1AVWA 1AWHB 1RD3B 2ZKSA 2VWNA 5EW1H 4BAKB 4ZKSU 1NO9H 2FX4A 3MU1A 1V2OT 2FLBH 1O2VA 3ZYEA 2ZC9H 1XVOA 2A2QH 5JB9S 1DXPA 4BANB 1CVWH 2QCYA 2OP9A 4K60A 3U1JB 2ZEBA 1TE0A 1XXDA 1SGYE 3MU8A 1LPZB 5EG4A 4ABDA 1AVXA 4AOQA 3T27A 3MWIU 3R3GB 1OXGA 1SLWB 2XWBI 4BOHA 5DP5A 2D2DA 1FUJA 1HXEH 1P2QA 2F9NA 2QXJA 4X1QU 1N8OC 4BXWA 1GMCF 5B6OA 1BHXB 3ZZ6A 5JDUB 1UTLM 3DA9B 1GHWH 1HAYB 2HOBA 3RXFA 2BD2A 1GI8B 3NUMA 2EEKA 1A0LA 2FP7B 2CHAC 3GY2A 3DT0H 3A7XA 3SUGA 1K1MA 1HJ9A 3CENA 3MO9A 1QJ7B 3MTYA 3U8OH 7LPRA 4CBOA 3BEFB 3SV9A 2QIQA 1O2ZA 1VJ9U 4K1EA 5C5NA 2R0LA 4OGXA 1UO6A 1EAXA 3ZVGA 1CGIE 3EAJA 4M7GA 2W7UA 3KCGH 1ESAA 1MZDA 1OWKA 1DS2E 3FANA 1F0TA 1RTFB 3ODDA 1C1SA 1D3PB 1GJ5H 1UCYH 2G55A 3IG6B 1NFXA 4FU8A 2BLOA 1QA0A 2ZG0H 4NFEA 3TJOA 2ZQ1A 2OTVA 4MQAA 1LQEA 1S81A 2VGCC 3GCNA 1MQ5A 5DP3A 2Z6BD 1O34A 1A46H 5DP7A 4B76A 2C8YB 3UWJH 3TGKE 1XVMA 3U69H 4YT7H 1E34B 1IQFA 5C3NA 3OSYA 4H4FA 1GBMA 3RXOA 4F4OC 1D6RA 2FX6A 4O03A 5EU8A 5A2MH 1ESBA 1O3CA 5H4IB 5HGGA 1PPHE 2A1DB 3FP6E 3SUEA 3RXLA 1AGJA 1GPZA 1PYTC 2NWNA 1SR5C 5HM2A 3TJVA 1OP8A 1KLJH 3TLOA 1S0QA 3S9AA 3TGIE 5E2OA 1EJMA 1Y3XA 4DG4A 4RSPA 3MU5A 1KXDA 2JKHA 1BITA 1C5NH 4X1NU 1F0SA 3BSQA 4MPWA 1C5SA 4JMYA 1LHCH 2J4IA 3F9EA 2OC8A 3PTBA 1XUKA 4AB8A 3F1SB 4BAMB 1BTWA 4KP0A 3SW2B 3LJJA 4ESTE 1K22H 3K6ZA 1LDTT 2FYQA 5DG6A 3UUZA 3GISB 4HI3A 4A1VA 3PLBA 5A0AE 3C1KA 2YNAA 3F9GA 2GT8A 2R9PA 8LPRA 1ZJKA 2YOLA 5DK1A 3URDA 1CA0C 4KKDA 3NZIA 4FUIA 8GCHF 2ANWA 1WSSH 3ZZ3A 1F5LA 1P2IA 1VR1H 1BJUA 1HBTH 1QJ6B 4NIVA 1BQYA 2V3OH 1N8OB 1GBKA 1C4U2 1NRQH 1Y3UA 1YKTA 2PHBA 3SO3A 3A85A 1UJ1A 2ZFRH 3SUFA 2ZHEH 1GJ6A 5CE1A 2PV9B 2HPQH 1SLVB 1SBWA 4NSVA 1O5AB 3VB3A 1F0RA 1E38B 1MZAA 1Y3WA 3A87A 1O3PB 4QT8C 3MU0A 1E36B 2ZCHP 1INCA 1UTJA 1UK4A 2VIQA 1YM0A 1C5PA 4CRFA 1VGCC 2VIOA 5GIBA 2FI4E 1MQ6A 4BAOB 3BTHE 2P93A 2ZNKH 2WPMS 4ZHLU 3ELAH 4IC6A 5EQQA 3RM2H 5LPEA 5F8TA 2QC2A 3SHCH 1XKBC 1O3FA 2XXLA 2A2XH 1NFUA 2QN5T 4DJZB 2V0BA 1QR3E 2BD5A 2FWWA 1L1NA 1SGPE 1FIWA 3TVJB 3ZZ5A 1C1WH 1QGFA 3VFEA 2OBQA 1TNHA 1WYKA 1HAVA 1WTHD 4AN7A 1DWEH 4D7FA 3KQEA 1SGFG 3TH4H 2J94A 1QA7A 1L1GA 1J14A 2ODYB 1BTYA 3NPSA 4ISIH 1K1PA 1T4VH 1L2EA 2ZWLH 2WV4A 4CREA 1FPHH 1HUTH 1ZPBA 3KEEA 3Q77A 1A2CH 1W0ZU 3PWCA 2BVXH 3BTDE 2M5TA 2PKSC 2ZDMA 1HCGA 3TK9A 4UFEH 1QFKH 1MKXK 1O2QA 4WWYA 1EZQA 1Y3VA 1UK2A 4IMQA 3QGJA 4I8GA 1FPCH 1SI5H 4O97A 1CU1A 1OWEA 2H9TH 4BXSA 1TNKA 1O3KA 1O3MA 1CQQA 2NU2E 2VIDA 1IQEA 1QHRB 2ZDNA 1BTZA 4GHQA 2FXRA 5C1YA 4K1SA 4MG3A 3PV4A 1GI3A 2ZECA 1TOMH 4LOYH 5GDSH 3KIDU 1EAIA 1EASA 1UVPA 3QX5H 1C5YB 3GOVB 1ZR0A 1TMBH 1LVOA 3T62A 4R8TB 6CHAC 1IHSH 3ATWA 2GX4A 2HWLB 2Z3DA 3SI4H 2ZHFH 3ZVBA 1C2GA 1TGNA 2FESH 3Q00A 1A61H 1SC8U 1W7XH 2RG3A 1O5CB 3OU0A 3MOCA 1SVPA 4Z6AH 2IPHA 4NG9H 5FCKA 1WQVH 1TQ0B 2KAIA 1CHOG 1ZPZA 3E8LA 3TNTA 4TYDA 5C67A 3RXCA 1CBWB 2ZDLA 3P6ZB 4X2WA 4OS4A 1Y5UT 3SJ9A 1G3BA 1KXAA 1TA6A 3P8OA 3BTKE 1FXYA 1K9OE 2RA0A 1TLDA 3UNSA 2GGVB 3BTME 2Y5FA 2NU4E 1NRRH 2YNBA 5FPYA 4RKJB 1EPTB 2JH5D 3SU1A 2OQ5A 3E0PB 3S9BA 1NM6A 1GI0A 1ORFA 5DGJA 1IQGA 1OKXA 2FM2A 3KQCA 3LGTA 4Q80A 5C5OA 1BZXE 3TJNA 1OOKB 3M35A 2O9QA 3UOUA 3ZVFA 1O36A 2R0KA 1O3DA 1DUEA 2G4UA 3RXSA 2FDAA 5AVDA 3B9FH 5G4BA 1AKSA 1QURH 2FPZA 1ABIH 4NGAH 1S6HA 3M5MA 2FOCA 3PROA 2STAE 3OY6U 4IW4E 1P10A 1OX1A 3M36A 1H4WA 3A84A 3LU9B 1PPEE 1BRAA 4GLYA 4YM9A 5GCHF 2CJIA 3S7HB 2WV5A 1BMLA 1C9TA 3A8BA 1CE5A 1E37B 2QV1A 2V35A 3Q3KA 3HATH 2FO9A 2PSYA 1T8OA 3VGCC 1V2VT 1IAUA 2ZU4A 4ZKNU 1GBBA 1OWDA 2DE8A 4ZROA 4CHAB 3M61U 1O2IA 4AORA 1BTHH 2TIOA 4LZ1H 1VCQA 3VXEH 5FHTA 1DDJA 5ESBA 1GMHG 2PW8H 5FX5A 1J8AA 4Y8YA 1P11E 1HJ8A 4J2YB 4TWWA 2A7HA 3DFLA 1J17T 8GCHG 1VGCB 3P95A 1QCPA 3GY4A 1K1OA 4MDSA 1MBQA 1SGNE
chains in the Genus database with same CATH superfamily
2R2MB 2PUXB 1C2MA 1O3NA 1HB0B 6GCHF 1UVUH 1GHBG 1F2SE 4MLFB 2J9NA 1TA2A 3F68H 1ELAA 5C0TA 1A4WH 1OP2A 3GCHC 2SGAA 1XUJA 1TBRH 3LC5A 1Z8IB 4AB9A 3LGWA 2IJD1 5EXMA 5A8XA 1ELVA 4U30A 3SOSA 4ISOA 1SLUB 2UUJB 4WXVA 4KTCA 1WQSA 1FJSA 3F9HA 1O33A 4WXIA 1C5MD 3P17H 5GCHG 4WF8A 1JIMA 2WYJA 1DVAH 1TPAE 3EGKH 1QB9A 2AH4X 4Y7AA 5IK2D 5DO4H 1IQKA 1JIRA 2J2UA 3VEQB 7ESTE 5J4SA 4A92A 6GCHG 4RN6A 4P02A 1O2LA 2QF4A 2A7JA 3F6UH 3K65B 4I32A 1O3HA 1SFQB 4Y10E 1IQJA 1YCPH 1A5GH 1S84A 2A5IA 5JYIA 1G32B 3LC3A 4VGCB 4Y76A 1H9LB 3QLPH 3RLWH 2F9OA 2WSSD 3FAOA 2KCOA 1HYLA 3BTWE 4PROA 4RI0A 5FL7D 1GG6C 2XOKD 3NXPA 1NFWA 4AFZA 4FUCA 3PMBB 4X6PA 2QXHA 4AG2A 4MPVA 3MFJA 3FZDA 7GCHG 3M3TA 1IQLA 3OX7U 2AEIH 1O37A 2TPIZ 2WPHS 4ASUD 4K69A 1O5EH 1FLEE 1Q3XA 4ZXXH 5A0CA 2XCFA 1MMJN 3T26A 1SG8B 4B2BA 1SGIB 3ZZ9A 4B2AA 3EE0B 2BZ6H 1LKAA 1EB2A 3BV9B 3VG8A 3SV8A 2O8UA 1AZZA 1B0FA 4D8NA 1AIXH 2RCEA 2XC5A 4WY3A 2P16A 1S6FA 3A7TA 1AO5A 4D9QA 5K0HA 1JRTA 4FUEA 3RXMA 4D9RA 2XNIA 4U01A 4ABEA 1UTMA 4CRAA 3OFND 1O3IA 1NTPA 4MVNA 1QL7A 2QF3A 2AYWA 2FLRH 3A86A 3M5NA 3ZV8A 5JBBS 4AZ2B 2FOMB 4JZDH 4MNWA 1GI1A 4AG1A 1HPGA 1S0RA 1LHGH 1L4ZA 4DOQA 4H6SB 1C5LH 1HDTH 1P2JA 1QL8A 1W11U 1C2DA 1FDPA 2F91A 1EP6A 1K1JA 2OXSA 1CA8B 1BRBE 1E1QD 3GYMA 5F8ZA 4I8LA 2AS9A 1RTKA 5F53A 2JJ2D 3QTOH 1PPBH 1YPMH 1FNIA 1YWUA 4AFQA 1TIOA 1EB1H 2AFQB 4YOIA 2ZGXH 3OAAD 1ARCA 1J15A 1BTUA 1AUJA 1LHEH 2FTMA 3ODFA 2C8ZB 1C1TA 1LO6A 3A83A 2AIQA 1THSH 5C20A 1DXWA 4BTTB 1DWDH 1TMUH 1XUHA 2ZO3H 1V2WT 3LOXA 1FMGA 1BMNH 1YBWA 1OWJA 4DY7B 3BTFE 2BZAA 1O3BA 1P05A 2B9LA 3U9AH 1VJAU 5EW2H 1SOTA 4FUGA 1V2TT 1P12E 2A5AA 5CHAB 3AAVA 3H7TA 3HGNA 3SORA 2EC9H 1QQUA 1ELTA 1SGDE 2GDDA 2LELA 3OEHD 4FXGH 1B0EA 3T5FH 1C2HA 1ANEA 2Y5HA 3M5LA 2KAIB 4TY7A 3BIUH 1G37A 4XRNA 1H9IE 1C1QA 1OPHB 3SV6A 1MTVA 2ZFTA 2BDBA 2XYAA 3VB4A 2IJOB 3M5OA 3RLYH 3ZVAA 4E06H 5FBIA 4DT7B 1TB6H 3SU2A 5C0UA 1GG6B 3HK6B 3ZZCA 2CMYA 5F6MA 3UTUH 1GDQA 1GVLA 3W95A 1P2KA 5HM9A 1YCPM 4B73A 1ZOMA 2Q6FA 2XBVA 1N1LA 1C5TA 4UDWH 1GHVH 1RIWB 5T1VA 1A3BH 3UQOA 4INLA 3BEIB 1MTUA 4K8BA 1ELEE 1RXPA 4FU9A 2GV7A 2SGEE 1W13U 2EI7A 1CHGA 4Y0YE 1BHXF 1FQ3A 3LONA 4O9VA 1HFDA 1M9UA 1GHXH 1G36A 1TGCA 4X0WU 2CN0H 4AGJA 1ZRBA 1G9IE 4Z0KA 3A8DA 1C5QA 3KGPA 2O8TA 1NC6A 5JPMH 2RDLA 3I77A 1LVMA 1IQIA 3U8RH 1HXFH 1QBOA 1O5FH 3TJUA 1L4DA 5EPNA 4WVPE 4K5ZA 1YLCA 2K1QA 3RMLH 1EZXC 4D76A 3BG8A 1ZPCA 2GKVE 5TCCA 5LGOA 2VJ1A 3RP2A 3A7ZA 1TNJA 2YMSB 1P01A 2BD8A 1SPJA 9ESTA 2ZFPH 1E0FD 3MNBA 4FU7A 1PPGE 4ABAA 1YF4A 1V3XA 1WDIA 3SU6A 3OE7D 3K9XB 2FS9A 2HNTC 2ZGJA 1PPFE 3UQVA 2W3KA 5DP8A 3ZZ4A 3AW1A 4XE4A 2J98A 5EXNA 1COWD 1WUNH 2C8WB 1P9UA 1T8MA 4AFUA 2UUKB 2JH6D 2CF8H 1YP9A 3E3TA 1TPOA 1A0JA 1MU6B 1NY22 1Q31A 3ZZDA 2BDYA 2QY0B 2AMPA 2I6QA 1KXEA 3LT3A 2VNTA 2VIPA 3V7TA 3QZQA 1WAYB 1V2RT 7KMEH 3GS9A 1BBRH 3IWMA 1BTPA 2BDHA 4UONA 2THFB 1W0YH 1NN6A 2M2AA 4WMFA 1Z1IA 2A31A 1FAXA 4XSKU 2LNCA 2VB0A 2RDEA 2OUAA 4LK4A 1Y5BT 2PWXA 2GCTC 2KZ4A 3SU5A 2JETC 1O2NA 1YY3A 5E0HA 3VXFH 1KLIH 2AGIX 2W6JD 3A7VA 3PLKA 4ZKOU 3A81A 5HYOA 1C5OH 1RFNA 1GI5A 4IN2A 3ZZ7A 2VINA 1C5WB 3RU4T 2SNWA 1RGQA 1FY8E 1ZMJA 4IC5A 1GBFA 5BPEA 1Z7KA 3QK1A 3EA8A 4SGBE 2KR7A 2TGTA 2A4QA 3T29A 2BQ7B 1AHTH 1NS3A 2JIZD 4I8JA 1GI2A 3SJ8A 1K2I1 3UY9A 2HNTF 5FX6A 1C2IA 5A8ZA 1ZSKA 1UMAH 1QIXB 1QBNA 3SQHE 2VVVA 3N7OA 1F0UA 1SGCA 5CDFE 1GBLA 1O3GA 2ANYA 2O8WA 3RC4A 1N6YA 1D4PB 1GDNA 2BHGA 2YMSC 5HMAA 2HVXA 1EPTC 1O2HA 3TK6A 1W2KH 2HGTH 2XC0A 1O3OA 4HTCH 1V2JT 2FOHA 3A89A 2C4FH 2D26C 1D3TB 1O31A 2GV6A 2HVYB 2VH6A 2CV3A 4I8KA 1N6XA 4FUFA 3UNQA 1ZTKA 1O2RA 1KXCA 1Q2WA 2HPPH 2K8IA 2DE9A 1W10U 1P03A 1T8LA 2ZFSA 3U8TH 2ZU3A 3SUDA 2DUCA 4JK5A 2Z3EA 8ESTE 2PKAA 1O2OA 1K0HA 2OC7A 3LJOA 1WOFA 1YPLH 1MKWH 1AKSB 4X8TH 1ELGA 2ANMH 1QL9A 4B6FA 3PMAB 5J4QA 2BDAA 1H8DH 2PTNA 2AGEX 2ZFFH 3GY5A 4TWYA 1ZHRA 4Z1MD 2EI6A 1K1IA 2BDCA 2AMQA 1BCUH 5ESTE 3O8CA 4KGAA 3EA9A 2AERH 2ZU2A 3CP7A 1SGRE 1T7CA 1ZGIA 3TK5A 2BVSH 1JWTA 1GL0E 1BRUP 2H5CA 1DITH 3A7WA 3UREA 3S69A 1C1UH 2GMTB 4ZHMU 1GJDB 1JRSA 2IOTA 1A7SA 1EAUA 4MNYA 4CRCA 1ZSJA 4JZIA 3V12A 3A8CA 1DLEA 1HIAA 2ANKH 1FY4A 1LQDB 1XXFA 2GDEH 1A3EH 4CHAC 2PLXA 4NZLA 2L6OA 3SU4A 2PKSB 3KL6A 1QBVH 3SJKA 1EAWA 3RU4D 1YPHE 1UVSH 5EGMA 5FPTA 5L2YH 2WPLS 1OYTH 4LXBH 4U32A 1HAZB 1VITH 2FOAA 1GJ4H 4JK6A 1LMWB 2J97A 1FI8A 1HLTH 1PQ7A 3SGAE 1EXFA 3RXVA 4XFQA 4BNRA 5KECA 4AX9H 2EQNA 3P8FA 2HLCA 2GZ8A 1C2JA 2R2WU 1UCYK 2C93B 5EJZA 4GSOA 2PGBB 1GCDA 1O30A 2B0FA 3JZ1B 1BBRK 2G00A 4X6NA 1EZUC 1NROH 4ZUHA 1OSSA 3L6PA 3QUMP 2XBWA 1RS0A 3M7TA 3RMOH 2HALA 3ESTA 3MO3A 2J38A 2F9BH 1C9PA 4ACAA 1AZ8A 4BTIB 2ZZUH 2FOBA 5ABWA 2GCTB 3PO1C 1AE8H 5K7RA 1GI7B 1TRMA 2D8WA 4P00A 4VGCC 1BIOA 2A32A 2JH0D 2H9EH 1LHDH 1TGSZ 3GCTF 3UFAA 3BTQE 1AB9C 4DIIH 3M3SA 3ZZBA 1G3CA 1SB1H 3KNXA 5LH8A 1C2KA 1JXPA 2WPKS 4Y8ZA 2J95A 3F3BA 1DSTA 4Q2KA 2R3YA 4DURA 2SNVA 3RC5A 2Q1JA 1YC0A 2JJ1D 1QNJA 1EPTA 2SGFE 2NU1E 4YLUA 3DSPA 1QJ1B 1AFEH 1GMHF 2PGQB 1VCWA 1ELFA 1HIAB 1O2SA 3A82A 1GMCG 1NRPH 1DLKB 5DPAA 4CRGA 3RXPA 4A5TS 1MKXH 1Z6JH 4YOJA 2ZCLP 3RXGA 1NFYA 1UTNA 2QXIA 4BAQB 1DWCH 3QGNB 4Y71A 4ABJA 1GJ9B 2W3IA 3STIA 3DUXH 2FIRH 3NK8A 2XRCA 5AHGH 1THRH 2V3MA 4I86A 1S85A 3ZZAA 4ZXYH 1C1NA 4MPUA 3VB7A 1PQ5A 1EJNA 2H2ZA 1SGQE 3SV7A 1YPHC 1IHTH 1O5BB 4SGAE 2TGAA 1PPZA 4UFFH 2XC4A 4A1XA 1VCPA 1SQAA 1Y59T 1NESE 2FODA 3MYWA 2VBCA 5A8YA 1PYTD 1O0DH 3SI3H 1C2LA 3WWBA 5EODA 1QRWA 2FOFA 3HKIB 5GWZA 3ATIA 1AFQB 1EJAA 4NCYA 3MMGA 1T32A 2BOHB 3VGCB 1LKBA 1YCPK 4Q7XA 4I7YH 1YLNA 2FYRA 4Y11E 5I46H 2G52A 1BA8B 1G30B 1WTGH 1DSUA 3QWCH 5L6NH 1EQ9A 1ZMNA 4IN1A 1ZHPA 5DP9A 5FCRA 4INHA 2XBYA 3HPTB 2ASUB 1VITF 1AWFH 4DGJA 1GL1A 4O3UA 4WH8A 2EA3A 2VVCA 1CSOE 2BX4A 3P70B 2WPDD 3A7YA 4K3JA 4Y7BA 3EE7A 2Y82A 1FONA 1ZZZA 4JYUH 1T31A 3SJOA 1O35A 4INKA 3T28A 8KME2 4CR5A 3P8GA 3FZZA 3PMHB 2GTBA 2ALPA 2ZPRA 3RM0H 3SV2H 1O2KA 4YLQH 3RXDA 2OINA 5JBAS 4Y6DA 2WUCA 2ZI2H 1DOJA 1L1JA 1LVYA 2WPIS 1KYNA 4F49A 2GT7A 1C5ZB 4H42U 2VWOA 3LGUA 3QN7A 2ZHQH 1TPPA 3URCA 1ANBA 4ABHA 2FOGA 3E6PH 4FUJA 1UHBA 4WMEA 1PPCE 4HZHA 2BD7A 4WJG2 1A1RA 3KYGA 1SFIA 3KQ5A 2P3UB 1QTFA 4JZ1A 2B7DH 1V2NT 1DFPA 4U2WA 3RXUA 1C5XB 1FY3A 1GGDC 1Z1JA 2XBXA 1VZQH 1O5DH 2F83A 1KLTA 4TPYA 5DKMA 3RXAA 2Z9GA 2BD9A 4ZMAH 3BTGE 1ZJDA 3KQDA 1G3DA 2ZHDA 4DIHH 1HAGE 1TYNA 2OLGA 4B75A 1F5RA 4FVBA 2ODQA 2BX3A 1TBZH 5DP6A 3DCLA 3D65E 3STJA 3L33A 2PFEA 1AQ7A 1UTOA 1OWIA 2Y81A 4CR9A 5AFYH 1KTTB 1GI9B 2VWLA 1S83A 1GHZA 3HKJB 2Y7ZA 1RJXB 3TPIZ 1CGJE 3OY5U 3LH3A 1Z8RA 3KN2A 4JZFH 4E7NA 1GHAG 1B5GH 1P2OA 3N7DA 1H8IH 4GVUA 2JDID 4MNVA 1DY8A 2CF9H 1SKYE 4RT0A 3FOAA 1BUIA 4F55A 2BD4A 4CH2B 3LH1A 1AY6H 2A0QB 2V3HH 2G51A 4E7RG 3KQBA 1SHHB 2F9UA 5JBTA 1A5HA 2ILNA 2O8MA 2QXGA 4KELA 2UWPA 4DCDA 3NCLA 4NIWA 1BJVA 3GY7A 4Y0ZE 1NBME 1KDQB 4IBLH 3OYPA 1S6LA 1H8HD 4I8HA 4NSYA 2FI5E 3A8AA 5GXPA 4CH8B 1CBWC 1XUGA 4ABBA 1BTXA 2W5EA 2EY4C 3ITIA 3M37A 2BY6X 1MAXA 1XUFA 3R0FA 1GHYH 2UUYA 2ZTXA 5LPFA 1G2MA 4RKOB 4YO9A 1GBDA 2AGGX 3EDXB 1Z6EA 2F3CE 3EQ0H 2VH0A 1QZ8A 1KTSB 5F03A 3W1EA 1DT2A 1GGDB 1GJBB 2ZGHA 4ZKRU 1SGFA 1AB9B 1TONA 3D23A 2FZZA 1AU8A 2GP9B 4X6OA 1SQOA 2BD3A 3ENSB 1Y5AT 1GWAA 4KTSA 3A80A 1BB0B 3PWBA 1C1OA 1C1VH 1A0HB 1CT4E 4R0IA 1MD8A 4AGKA 1DANH 1AD8H 1V2QT 2W6ID 1UCYE 1UVOA 2LPRA 2G8TA 1V2UT 5BRRE 1SGEE 3F0OA 4X8VH 1TOCB 4YTAA 5GNDA 2FMJA 3ZVEA 1MAYA 4GHTA 1WV7H 2WYGA 1TNIA 1GBCA 3MQKC 3BTEE 4HFPB 3PYHA 1C5RA 2BLQA 3GDSA 5A0BA 4HG6A 4X2XA 2WINI 5F8XA 1O38A 1EZSC 1BMMH 3GY6A 4NIYA 4ASHA 1ZYOA 2XW9A 1TRNA 1TX7A 3E1XB 2FS8A 4DW2U 3AASA 2P95A 2P3FH 1SSXA 3BIVH 4Q4LA 5E0JA 3AW0A 1XX9A 3WWFA 1LHFH 1AI8H 2GCHG 3FO8D 1GBHA 3ZVDA 4ZAEA 1ANDA 4Y79A 2ZDVH 2QA9E 1CA0B 2FEQH 2BM2A 3RC6A 4B1TA 3RXIA 2Z9JA 6ESTA 1ESTA 1EP5A 1OWHA 4HGCA 1ZLRA 3I29A 1TX6A 1FV9A 1P2NA 3P8NA 1D3DB 4TPIZ 1MBMA 1QQ4A 1SMFE 1HJAC 1MTSA 5DJ7A 1O5GH 1H1BA 1O32A 2Z7FE 3T2NA 4FUHA 2BY9X 1C4V2 1TFXA 3SNDA 3DD2H 4AYVB 2CGAA 1O3AA 2A4RA 2HNTE 4AYYB 2PUQH 1ELBA 1O2TA 1ELCA 2BXUH 2SGPE 1HV7A 2A5KA 3SGBE 1XUIA 2PSXA 1XKAC 3KF2A 2GCHF 3OTJE 4IGDA 4X6MA 5LPRA 1MU8B 1EOLA 3EYDA 1TBQH 1EX3A 2BDGA 4ISLA 1DUAA 1SOZA 3B23B 3SHAH 4K2YA 1YYY1 2CHAB 2OD3B 4FETA 4A7IB 4I33A 1O3JA 3W94A 1TX8A 5TCAA 1D3QB 1MCVA 1ETRH 3GDUA 2GZ7A 1TQ7B 5GPIB 3UIRA 1BDAA 2BQWB 2Z9IA 1MD7A 2ZA5A 1P02A 1KMHB 3FKSD 4ABIA 3KYFA 3OEED 3LIWA 3FP7E 1THPB 3MNXA 3UB0A 2XTTB 3SQEE 2CXVA 1FAKH 2B5TB 3CS0A 3C27B 1MTNB 2YMSD 3SNCA 1KSNA 1DY9A 1U6QA 2ZU5A 1NRNH 2ZCKP 4OM9A 3QZRA 1FN6A 1P3CA 3RXQA 5EQSA 5EOKA 1AMHA 3SNBA 5EJ1A 2KCPA 1KY9A 4B6EA 2BB4A 1AFQC 3V3MA 3L3TA 3Q3XA 1O2YA 5A09A 5IDKA 2F9VA 1UTPA 2UWOA 1WXRA 4Q7YA 4GCHF 1DE7H 4CRDA 1BOQA 4I31A 4OS5A 4ZHAA 1RRKA 2ZTYA 1W3CA 3MH7A 3BG4B 4X2VA 1S82A 4NWLA 1NRSH 3E90B 1NT1A 1K1LA 3SNAA 3LGIA 1QB1A 1T8NA 2G4TA 2P8OC 2GD4B 2ZTZA 1MTNC 1WBGB 1MCTA 4A6LA 1CT0E 1GHBF 1IOEA 2PTCE 4X2YA 3TH2H 2AMDA 5FBEA 9LPRA 2Z3CA 1SQTA 1RTLA 1HAOH 2FTLE 4UD9H 1KIGH 3BEUA 1DWBH 4TY6A 3FVFB 1YPKH 2O8LA 3KHVA 2TGPZ 2A45B 1Z71A 2BDIA 2W7SA 1E35B 1F5KU 1ID5H 1BMFD 3MU4A 1FIZA 2FOEA 3UR9A 1UK3A 4UFDH 1G2LA 1S5SA 4ABFA 7GCHF 4ACBA 3SBKA 3SN8A 1NPMA 3RU4E 3O8BA 2OBOA 4MPXA 1EOJA 2BLWA 5C1XA 3PRBA 2BVRH 3Q76A 4XDEA 1GJCB 2Q6GA 1P8VC 2ZF0H 5T6DA 2VGCB 4NA8A 1GBJA 3M7QA 1T4UH 1PQAA 2QYIA 3GY8A 4XOJA 4B71A 1P57B 2Y7XA 1W8BH 2IN2A 1JBUH 4MTBA 1JOUB 1YPEH 1BMAA 1TNGA 5HXFA 3ZVCA 1UHBB 1GDUA 1QB6A 1NU9A 3UOPA 1C5UA 3NWUA 3MNSA 2ESTE 1YGCH 1XMNB 2KFWA 3RMMH 3VB6A 4ZCNA 1C5VA 2Z9LA 1GBIA 4BAHB 1ARBA 1LPKB 1GCTB 2V7QD 1HJAB 3M7UA 4CBNA 3MI4A 2ZDAH 3AVZA 3UWIA 3AAUA 3H5CB 2UWLA 3BF6H 4YOGA 3AK5A 1IQMA 5AFZH 3T25A 2C90B 1FY1A 2C3SA 1O2MA 1O2WA 5I25A 1GCTC 1LTOA 2OC1A 1FY5A 1TAWA 3GDVA 4X8UH 5E2PA 3UNRA 3JZ2B 1IQHA 1V6DA 1MTWA 2TGDA 4FUBA 5L2ZH 2ZHWH 3K2UA 4OS7A 2WZQA 2STBE 3F2FA 3SU3A 4D7GA 2F4LA 3E91A 2H6MA 4Q7ZA 1FN8A 1EUFA 1UTKA 1YPJH 1MKWK 2SFAA 1DX5M 3ATKA 3H7OA 3PLPA 3BG4C 4RT1A 4J1YA 4KTUA 1ZGVA 4YESB 1D6WA 1K28D 1GVKB 1SQRA 1ZSLA 1TGTA 4ABGA 3LDXH 3PB1E 4GUXA 2J34A 2B8OH 1AUTC 3V13A 2Y6TA 4NZQA 2P8OB 3V0XA 4O3TA 2QE7D 1KXFA 2Z9KA 3SGQE 2H1UA 1YPGH 2AIPA 1X7AC 2ZFQH 3FFGA 1J16A 3U1IB 2ALVA 1C2EA 2QAAA 1HNEE 2GMTC 3VB5A 2A4GA 1TWXB 1O2UA 1C1RA 4UEHH 3GY3A 1NZQH 1J9CH 2BY8X 2ULLA 3SU0A 2V6NA 2VWMA 3HGPA 4LZ4B 2ZU1A 1QRZA 1QY6A 1O2PA 3SZEA 3WY8A 2G81E 5EPYA 2EI8A 5B6LA 2XWAA 2D1JA 2UUFB 2J92A 2P59A 2G5VA 3BN9A 3TGJE 2WUBA 1OS8A 5IYTA 1SHYA 1C4Y2 5PTPA 1O3LA 1K1NA 3TH3H 1C2FA 2L74A 4WMDA 3IITA 4AFSA 2H9HA 1C1MA 4WH6A 5JB8S 5HIZA 1GBAA 1D9IA 1GBEA 3BTTE 2ZGBH 2ZIQH 4OS1A 3PTNA 3GCTG 3U98H 4X8SH 2JETB 2GZ9A 3O8RA 1P06A 2J5UA 3ATMA 4ISNA 4NIXA 1W0KD 1GHAF 3SZNA 1HGTH 2TBSA 3O8DA 2ZPSA 1GBTA 2LP6A 6CHAB 2SGQE 5SGAE 3RXHA 3ZIAD 2G5NA 1ACBE 1GJ7B 2OC0A 1UVTH 3RXBA 1Z8JB 1ANCA 5HKKD 1P04A 4GPGA 3Q3YA 1O39A 3MNCA 4UE7H 2Y80A 1GJAB 3QO6A 4FUDA 2RA3A 1LCYA 5E8EH 1HAXB 2I6SA 2OQUA 1HRTH 3QDZB 3LGYA 1P09A 3S9CA 1ZTJA 3M3VA 2ZP0H 5E0GA 1V2ST 1XM1A 5TJXA 1F92A 2GJGA 4IMZA 2Q6DA 2VIVA 3RXRA 3B8JA 5DP4A 3S7KB 3ZV9A 2BOKA 1AE5A 2A7CA 3UR6A 1A5IA 1OP0A 1Y3YA 3DSGA 5CHAC 1P9SA 3ZZ8A 4F48B 1TNLA 3RXEA 1ETTH 3TITA 4NA9H 2W26A 4YZUA 1TALA 3GICB 1OHHD 2OCVB 3MH6A 4OS2A 1O2JA 4K8YA 4JYTA 4X1RU 2BXTH 1RIWC 5ETXA 1H9HE 1EATA 4OGYA 1YLDA 1P2MA 3MHWU 4THNH 4X1SU 1TPSA 2QGRA 3E0NB 2BTCE 1V2KT 4FVDA 3E16B 3RXTA 1PFXC 5FAHA 3EA7A 1O2XA 3F9FA 4BTUB 4UFGH 1WCZA 2VU8E 3LPRA 5EQRA 2R3UA 3D62A 3RXKA 2PKAB 1CT2E 4XBDA 4B2CA 1WU1A 1TMTH 4Y8XA 5C1UA 1K21H 2ZPQA 3TNSA 1NBMD 5T6FA 1HAHH 2QF0A 1B7XB 3FP8E 1OYQA 1BT7A 3I78A 5DSFA 1MUEB 2P3TB 2Z94A 3GYLB 2NU0E 1EKBB 3UPEA 1PQ8A 3K6YA 4ZH8A 4TSFD 1KDQA 3F2GA 4ISHH 1BRCE 1W14U 3S0NA 1GI4A 2ZGCA 4H6TA 5AF9H 1SGTA 3ATLA 1MH0A 1CHOF 1HAVB 2BYAX 4IS5A 4A1TA 5FXLA 3SJIA 1ZMLA 4GCHG 3ZYDA 2BY7X 1TABE 1ABJH 5HIYA 2BLVA 2BMGB 4GAWA 5EIYA 1DPOA 3G01A 1F7ZA 4OS6A 1GVZA 1C1PA 1Z8GA 4XBBA 1V2MT 1HAIH 1Y8TA 1TGBA 5EJLA 2GVFA 6LPRA 1GMDF 1ELDE 3MH4A 3GCOA 1CGHA 4E05H 2WPJS 1NU7B 1SL3A 5T3HA 2XCNA 1V2PT 1LPGB 3RDZA 5JBCS 4YT6H 3DHKH 3F0PA 3PM3A 4K1TA 1LVBA 1FZZA 1TRYA 4JCNA 3DFJA 1IQNA 2ODPA 2VVUA 3TIUA 1VITG 1ZTLA 3HK3B 2VIWA 1KXBA 2HLDD 3TU7H 1GI6A 1ETSH 1ZRKA 3SNEA 4JYVH 2PR3A 3D49H 2BQ6B 5T6GA 5CMXH 2P94A 1GMDG 1UTQA 5L30H 2FI3E 1QRXA 3A88A 1FX0B 2HRVA 1G3EA 4JZEH 1AVGH 3CS7A 3LKWA 5EXLA 2BY5X 3F2HA 1HAPH 1BBRE 4NFFA 3PV5A 3MH5A 3MO6A 1W12U 1P3EA 1SLXB 2WV9A 4NWKA 3RXJA 1V2LT 2H5DA 2A4OA 3PMJA 1DM4B 4NA7A 1GJ8B 3QTVH 3RUOA 1W7GH 5FPSA 2XNDD 3VPKA 3P92A 5GJ4B 2ZQ2A 4MNXA 1AN1E 1O3EA 4B74A 1DICA 2SGDE 2F9PA 3LGVA 1CO7E 1JMOH 1L0ZA 4X1PU 5C2ZA 2ZDKA 1ZHMA 1VKYA 3PO1B 2TRMA 3GCHB 3RMNH 1PJPA 2NU3E 4XBCA 4CRBA 2C8XB 4DVAU 2Y5GA 3NKKA 1O2GH 1P0SH 1AVWA 1AWHB 1RD3B 2ZKSA 1W0JD 2VWNA 5EW1H 4BAKB 4ZKSU 1NO9H 2FX4A 3MU1A 1V2OT 2FLBH 1O2VA 3ZYEA 2ZC9H 1XVOA 2A2QH 5JB9S 1DXPA 4BANB 5CHBA 5C17A 1CVWH 2QCYA 2OP9A 4K60A 3U1JB 2ZEBA 1TE0A 1XXDA 1SGYE 3MU8A 1LPZB 5EG4A 4ABDA 5DN6D 5KGOA 1AVXA 4AOQA 3T27A 3MWIU 3R3GB 1OXGA 1SLWB 2XWBI 4BOHA 5DP5A 2D2DA 2F43B 1FUJA 1HXEH 1P2QA 2RFKC 2F9NA 2QXJA 4X1QU 4M9FA 1N8OC 4BXWA 1GMCF 5B6OA 1BHXB 3ZZ6A 5JDUB 1UTLM 3DA9B 1GHWH 1HAYB 2HOBA 3RXFA 2BD2A 1GI8B 2OK5A 3NUMA 2EEKA 1A0LA 3NRLA 2FP7B 2CHAC 3GY2A 3DT0H 3A7XA 3SUGA 1K1MA 1HJ9A 3CENA 3MO9A 1QJ7B 3MTYA 3U8OH 7LPRA 4CBOA 3BEFB 3SV9A 2QIQA 3OTPA 1O2ZA 1VJ9U 4K1EA 5C5NA 2R0LA 4OGXA 1UO6A 1EAXA 3ZVGA 1CGIE 3EAJA 4M7GA 4TT3D 2W7UA 3KCGH 1ESAA 1MZDA 1OWKA 1DS2E 3FANA 1F0TA 1RTFB 3ODDA 1C1SA 1D3PB 1GJ5H 1UCYH 2G55A 3IG6B 1NFXA 4FU8A 2BLOA 3SYJA 1QA0A 2ZG0H 4NFEA 3TJOA 2ZQ1A 2OTVA 4MQAA 1LQEA 1S81A 2VGCC 3GCNA 1MQ5A 5DP3A 2Z6BD 1O34A 1A46H 5DP7A 4B76A 2C8YB 3UWJH 3TGKE 1XVMA 3U69H 4YT7H 1E34B 2CK3D 1IQFA 5C3NA 3OSYA 4H4FA 1GBMA 3RXOA 1E79D 4DT4A 4F4OC 1D6RA 2FX6A 4O03A 5EU8A 5A2MH 1ESBA 1O3CA 5H4IB 5HGGA 1PPHE 2A1DB 3FP6E 3SUEA 3RXLA 5C94A 1AGJA 1GPZA 3H09A 1PYTC 2NWNA 1SR5C 5HM2A 3TJVA 1OP8A 1KLJH 3TLOA 1S0QA 3S9AA 3TGIE 5E2OA 1EJMA 1Y3XA 4DG4A 4RSPA 3MU5A 1KXDA 2JKHA 1BITA 1C5NH 4X1NU 1F0SA 3BSQA 4MPWA 1C5SA 4JMYA 1LHCH 2J4IA 3F9EA 2OC8A 3PTBA 1XUKA 2PP6A 4AB8A 3F1SB 4BAMB 1BTWA 4KP0A 3SW2B 3LJJA 4ESTE 1K22H 3K6ZA 1LDTT 2FYQA 5DG6A 3UUZA 3GISB 3PV2A 4HI3A 4A1VA 3PLBA 5A0AE 3N7EA 3C1KA 2YNAA 3F9GA 2GT8A 2R9PA 8LPRA 1ZJKA 2YOLA 5DK1A 3URDA 3DSOA 1CA0C 4KKDA 3NZIA 4FUIA 8GCHF 2ANWA 1WSSH 3UAIC 3ZZ3A 1F5LA 1P2IA 1VR1H 1BJUA 1HBTH 1QJ6B 4NIVA 1BQYA 2V3OH 1N8OB 1GBKA 1C4U2 1NRQH 1Y3UA 1YKTA 2PHBA 3SO3A 3A85A 1UJ1A 2ZFRH 3SUFA 2ZHEH 1EFRD 1GJ6A 5CE1A 2PV9B 2HPQH 1SLVB 1SBWA 4NSVA 1O5AB 3VB3A 1F0RA 3U28C 1E38B 1MZAA 1Y3WA 3A87A 1O3PB 4QT8C 3MU0A 1E36B 2ZCHP 1INCA 1UTJA 1UK4A 2VIQA 1YM0A 1C5PA 4CRFA 1VGCC 2VIOA 5GIBA 2FI4E 1MQ6A 4BAOB 3BTHE 2P93A 2KX4A 1E1RD 2ZNKH 3PRDA 2WPMS 4ZHLU 3ELAH 4IC6A 5EQQA 3RM2H 5LPEA 5F8TA 2QC2A 3SHCH 1XKBC 1O3FA 2XXLA 2A2XH 1NFUA 2QN5T 4DJZB 2V0BA 4YXWD 1QR3E 2BD5A 2FWWA 1L1NA 1SGPE 1FIWA 3TVJB 3ZZ5A 1C1WH 1QGFA 3VFEA 2OBQA 1TNHA 1WYKA 1HAVA 1WTHD 4AN7A 1DWEH 4D7FA 2AHME 1SGFG 3KQEA 2J94A 3TH4H 1QA7A 1L1GA 1J14A 2ODYB 1BTYA 3NPSA 4ISIH 1K1PA 1T4VH 1L2EA 2J98B 2ZWLH 2WV4A 4CREA 1FPHH 1HUTH 1ZPBA 3KEEA 3Q77A 1A2CH 1W0ZU 3PWCA 2BVXH 2QF5A 3BTDE 1UW7A 2M5TA 2PKSC 2ZDMA 1HCGA 3TK9A 4UFEH 1QFKH 1MKXK 1O2QA 4WWYA 1EZQA 1Y3VA 1UK2A 4IMQA 3QGJA 4I8GA 1FPCH 1SI5H 4O97A 1CU1A 1H8ED 1OWEA 2WHXA 2H9TH 4BXSA 1TNKA 1O3KA 1O3MA 1CQQA 2NU2E 2VIDA 1IQEA 1QHRB 2ZDNA 1BTZA 4GHQA 2FXRA 5C1YA 4K1SA 4MG3A 3PV4A 1GI3A 2ZECA 1TOMH 4LOYH 5GDSH 3KIDU 1EAIA 1EASA 1UVPA 2KCYA 3QX5H 1C5YB 3GOVB 1ZR0A 1TMBH 1LVOA 3T62A 4R8TB 6CHAC 1IHSH 2IPQX 2GX4A 2HWLB 2Z3DA 3ATWA 2ZHFH 3SI4H 1C2GA 3ZVBA 1TGNA 2FESH 3Q00A 5KEDA 1A61H 1SC8U 1W7XH 2RG3A 1MABB 1O5CB 3OU0A 3MOCA 1SVPA 4Z6AH 2IPHA 4NG9H 5FCKA 1WQVH 1TQ0B 2KAIA 1CHOG 1ZPZA 3E8LA 3TNTA 4TYDA 5C67A 3RXCA 1CBWB 2ZDLA 3P6ZB 4X2WA 4OS4A 1Y5UT 3SJ9A 1G3BA 1KXAA 1TA6A 3N99A 3P8OA 3BTKE 4XD7D 1FXYA 1K9OE 2RA0A 1TLDA 2KM0A 3UNSA 2GGVB 3BTME 2Y5FA 2NU4E 1NRRH 2YNBA 5FPYA 4RKJB 1EPTB 2JH5D 3SU1A 2OQ5A 3CNRA 3E0PB 3S9BA 1NM6A 1GI0A 1ORFA 5DGJA 1IQGA 1OKXA 2FM2A 3KQCA 3LGTA 4Q80A 3WW7A 5C5OA 1BZXE 3TJNA 1OOKB 3M35A 2O9QA 3UOUA 3ZVFA 1O36A 2R0KA 1O3DA 1DUEA 2G4UA 3RXSA 2FDAA 5AVDA 3B9FH 5G4BA 1AKSA 1QURH 2FPZA 1ABIH 4NGAH 1S6HA 4FOUC 3M5MA 2FOCA 3PROA 2STAE 3OY6U 4IW4E 1P10A 4Q63A 1OX1A 3M36A 1H4WA 2KCAA 3A84A 1PPEE 3LU9B 1BRAA 4GLYA 4YM9A 5GCHF 2CJIA 3S7HB 2WV5A 1BMLA 1C9TA 3A8BA 1CE5A 1E37B 2QV1A 2V35A 3Q3KA 3HATH 2FO9A 2PSYA 1T8OA 3VGCC 1V2VT 1IAUA 2ZU4A 4ZKNU 1GBBA 1OWDA 2DE8A 4ZROA 4CHAB 3M61U 1O2IA 4AORA 1BTHH 2TIOA 4LZ1H 1VCQA 4AC9A 3VXEH 5FHTA 1DDJA 3FN8A 5ESBA 1GMHG 2PW8H 5FX5A 1J8AA 4Y8YA 1P11E 1HJ8A 4J2YB 4TWWA 2A7HA 2K0QA 3DFLA 1J17T 8GCHG 1VGCB 3P95A 1QCPA 3GY4A 1K1OA 4MDSA 1MBQA 1SGNE
chains in the Genus database with same CATH topology
2R2MB 2PUXB 1C2MA 1O3NA 1HB0B 6GCHF 1UVUH 1GHBG 1F2SE 4MLFB 2J9NA 1TA2A 3F68H 1ELAA 1A4WH 1OP2A 3GCHC 2SGAA 1XUJA 1TBRH 3LC5A 1Z8IB 4AB9A 3LGWA 5EXMA 5A8XA 1ELVA 4U30A 3SOSA 4ISOA 1SLUB 2UUJB 4WXVA 4KTCA 1WQSA 1FJSA 3F9HA 1O33A 4WXIA 1C5MD 3P17H 5GCHG 4WF8A 1JIMA 2WYJA 1DVAH 1TPAE 3EGKH 1QB9A 2AH4X 4Y7AA 5DO4H 1IQKA 1JIRA 2J2UA 3VEQB 7ESTE 5J4SA 4A92A 6GCHG 4RN6A 1O2LA 2A7JA 3F6UH 3K65B 4I32A 1O3HA 1SFQB 4Y10E 1IQJA 1YCPH 1A5GH 1S84A 2A5IA 5JYIA 1G32B 3LC3A 4VGCB 4Y76A 1H9LB 3QLPH 3RLWH 2F9OA 3FAOA 3BTWE 1HYLA 4PROA 1GG6C 3NXPA 1NFWA 4AFZA 4FUCA 3PMBB 4X6PA 2QXHA 4AG2A 4MPVA 3MFJA 3FZDA 7GCHG 3M3TA 1IQLA 3OX7U 2AEIH 1O37A 2TPIZ 2WPHS 4K69A 1O5EH 1FLEE 1Q3XA 4ZXXH 5A0CA 2XCFA 1MMJN 3T26A 1SG8B 4B2BA 1SGIB 3ZZ9A 4B2AA 3EE0B 2BZ6H 1LKAA 1EB2A 3BV9B 3SV8A 2O8UA 1AZZA 1B0FA 4D8NA 1AIXH 2RCEA 2XC5A 4WY3A 2P16A 1S6FA 3A7TA 1AO5A 4D9QA 5K0HA 1JRTA 4FUEA 3RXMA 4D9RA 2XNIA 4U01A 4ABEA 1UTMA 4CRAA 1O3IA 1NTPA 4MVNA 1QL7A 2QF3A 2AYWA 2FLRH 3A86A 3M5NA 3ZV8A 5JBBS 4AZ2B 2FOMB 4JZDH 4MNWA 1GI1A 4AG1A 1HPGA 1S0RA 1LHGH 1L4ZA 4DOQA 4H6SB 1C5LH 1HDTH 1P2JA 1QL8A 1W11U 1C2DA 1FDPA 2F91A 1EP6A 1K1JA 2OXSA 1CA8B 1BRBE 3GYMA 5F8ZA 4I8LA 2AS9A 1RTKA 3QTOH 1PPBH 1YPMH 1FNIA 4AFQA 1TIOA 1EB1H 2AFQB 4YOIA 2ZGXH 1ARCA 1J15A 1BTUA 1AUJA 1LHEH 2FTMA 3ODFA 2C8ZB 1C1TA 1LO6A 3A83A 2AIQA 1THSH 5C20A 1DXWA 4BTTB 1DWDH 1TMUH 1XUHA 2ZO3H 1V2WT 3LOXA 1FMGA 1BMNH 1YBWA 1OWJA 4DY7B 3BTFE 2BZAA 1O3BA 1P05A 2B9LA 3U9AH 1VJAU 5EW2H 1SOTA 4FUGA 1V2TT 1P12E 2A5AA 5CHAB 3AAVA 3H7TA 3HGNA 3SORA 2EC9H 1QQUA 1ELTA 1SGDE 2GDDA 4FXGH 1B0EA 3T5FH 1C2HA 1ANEA 2Y5HA 3M5LA 2KAIB 4TY7A 3BIUH 1G37A 1H9IE 1C1QA 1OPHB 3SV6A 1MTVA 2ZFTA 2BDBA 2XYAA 3VB4A 2IJOB 3M5OA 3RLYH 3ZVAA 4E06H 5FBIA 4DT7B 1TB6H 3SU2A 1GG6B 3HK6B 3ZZCA 2CMYA 5F6MA 3UTUH 1GDQA 1GVLA 3W95A 1P2KA 5HM9A 1YCPM 4B73A 1ZOMA 2Q6FA 2XBVA 1N1LA 1C5TA 4UDWH 1GHVH 1RIWB 1A3BH 3UQOA 4INLA 3BEIB 1MTUA 4K8BA 1ELEE 1RXPA 4FU9A 2GV7A 2SGEE 1W13U 2EI7A 1CHGA 4Y0YE 1BHXF 1FQ3A 3LONA 4O9VA 1HFDA 1M9UA 1GHXH 1G36A 1TGCA 4X0WU 2CN0H 4AGJA 1ZRBA 1G9IE 4Z0KA 3A8DA 1C5QA 3KGPA 2O8TA 1NC6A 5JPMH 2RDLA 3I77A 1LVMA 1IQIA 3U8RH 1HXFH 1QBOA 1O5FH 3TJUA 1L4DA 5EPNA 4WVPE 4K5ZA 1YLCA 2K1QA 3RMLH 1EZXC 4D76A 3BG8A 1ZPCA 2GKVE 5TCCA 5LGOA 2VJ1A 3RP2A 3A7ZA 1TNJA 1P01A 2BD8A 1SPJA 9ESTA 2ZFPH 1E0FD 3MNBA 4FU7A 1PPGE 4ABAA 1YF4A 1V3XA 3SU6A 3K9XB 2FS9A 2HNTC 2ZGJA 1PPFE 3UQVA 2W3KA 5DP8A 3ZZ4A 3AW1A 4XE4A 5EXNA 1WUNH 2C8WB 1P9UA 1T8MA 4AFUA 2UUKB 2JH6D 2CF8H 1YP9A 3E3TA 1TPOA 1A0JA 1MU6B 1NY22 1Q31A 3ZZDA 2BDYA 2QY0B 2AMPA 2I6QA 1KXEA 3LT3A 2VNTA 2VIPA 3V7TA 3QZQA 1WAYB 1V2RT 7KMEH 1BBRH 3IWMA 1BTPA 2BDHA 4UONA 2THFB 1W0YH 1NN6A 4WMFA 1Z1IA 2A31A 1FAXA 4XSKU 2LNCA 2VB0A 2OUAA 4LK4A 1Y5BT 2PWXA 2GCTC 3SU5A 2JETC 1O2NA 5E0HA 3VXFH 1KLIH 2AGIX 3A7VA 3PLKA 4ZKOU 3A81A 5HYOA 1C5OH 1RFNA 1GI5A 4IN2A 3ZZ7A 2VINA 1C5WB 3RU4T 2SNWA 1RGQA 1FY8E 1ZMJA 4IC5A 1GBFA 5BPEA 1Z7KA 3QK1A 3EA8A 4SGBE 2TGTA 2A4QA 3T29A 2BQ7B 1AHTH 1NS3A 4I8JA 1GI2A 3SJ8A 1K2I1 3UY9A 2HNTF 5FX6A 1C2IA 5A8ZA 1ZSKA 1UMAH 1QIXB 1QBNA 3SQHE 2VVVA 3N7OA 1F0UA 1SGCA 1GBLA 1O3GA 2ANYA 2O8WA 3RC4A 1N6YA 1D4PB 1GDNA 2BHGA 5HMAA 2HVXA 1EPTC 1O2HA 3TK6A 1W2KH 2HGTH 2XC0A 1O3OA 4HTCH 1V2JT 2FOHA 3A89A 2C4FH 2D26C 1D3TB 1O31A 2GV6A 2VH6A 2CV3A 4I8KA 1N6XA 4FUFA 3UNQA 1ZTKA 1O2RA 1KXCA 1Q2WA 2HPPH 2DE9A 1W10U 1P03A 1T8LA 2ZFSA 3U8TH 2ZU3A 3SUDA 2DUCA 4JK5A 2Z3EA 8ESTE 2PKAA 1O2OA 2OC7A 3LJOA 1WOFA 1YPLH 1MKWH 1AKSB 4X8TH 1ELGA 2ANMH 1QL9A 3PMAB 5J4QA 2BDAA 1H8DH 2PTNA 2AGEX 2ZFFH 3GY5A 4TWYA 1ZHRA 2EI6A 1K1IA 2BDCA 2AMQA 1BCUH 5ESTE 3O8CA 4KGAA 3EA9A 2AERH 2ZU2A 3CP7A 1SGRE 1T7CA 1ZGIA 3TK5A 2BVSH 1JWTA 1GL0E 1BRUP 2H5CA 1DITH 3A7WA 3UREA 3S69A 1C1UH 2GMTB 4ZHMU 1GJDB 1JRSA 2IOTA 1A7SA 1EAUA 4MNYA 4CRCA 1ZSJA 4JZIA 3V12A 3A8CA 1DLEA 1HIAA 2ANKH 1FY4A 1LQDB 1XXFA 2GDEH 1A3EH 4CHAC 2PLXA 4NZLA 3SU4A 2PKSB 3KL6A 1QBVH 3SJKA 1EAWA 3RU4D 1YPHE 1UVSH 5EGMA 5FPTA 5L2YH 2WPLS 1OYTH 4LXBH 4U32A 1HAZB 1VITH 2FOAA 1GJ4H 4JK6A 1LMWB 1FI8A 1HLTH 1PQ7A 3SGAE 1EXFA 3RXVA 4XFQA 4BNRA 4AX9H 3P8FA 2HLCA 2GZ8A 1C2JA 2R2WU 1UCYK 2C93B 4GSOA 2PGBB 1GCDA 1O30A 2B0FA 3JZ1B 1BBRK 2G00A 4X6NA 1EZUC 1NROH 4ZUHA 1OSSA 3L6PA 3QUMP 2XBWA 1RS0A 3M7TA 3RMOH 2HALA 3ESTA 3MO3A 2J38A 2F9BH 1C9PA 1AZ8A 4BTIB 2ZZUH 2FOBA 5ABWA 2GCTB 3PO1C 1AE8H 5K7RA 1GI7B 1TRMA 2D8WA 4VGCC 1BIOA 2A32A 2JH0D 2H9EH 1LHDH 1TGSZ 3GCTF 3UFAA 3BTQE 1AB9C 4DIIH 3M3SA 3ZZBA 1G3CA 1SB1H 3KNXA 5LH8A 1C2KA 1JXPA 2WPKS 4Y8ZA 2J95A 1DSTA 4Q2KA 2R3YA 4DURA 2SNVA 3RC5A 2Q1JA 1YC0A 1QNJA 1EPTA 2SGFE 2NU1E 4YLUA 1QJ1B 1AFEH 1GMHF 2PGQB 1VCWA 1ELFA 1HIAB 1O2SA 3A82A 1GMCG 1NRPH 1DLKB 5DPAA 4CRGA 3RXPA 4A5TS 1MKXH 1Z6JH 4YOJA 2ZCLP 3RXGA 1NFYA 1UTNA 2QXIA 4BAQB 1DWCH 3QGNB 4Y71A 4ABJA 1GJ9B 2W3IA 3STIA 3DUXH 2FIRH 3NK8A 2XRCA 5AHGH 1THRH 1S85A 3ZZAA 4ZXYH 1C1NA 4MPUA 3VB7A 1PQ5A 1EJNA 2H2ZA 1SGQE 3SV7A 1YPHC 1IHTH 1O5BB 4SGAE 2TGAA 1PPZA 4UFFH 2XC4A 4A1XA 1VCPA 1SQAA 1Y59T 1NESE 2FODA 3MYWA 5A8YA 1PYTD 1O0DH 3SI3H 1C2LA 5EODA 1QRWA 2FOFA 3HKIB 5GWZA 3ATIA 1AFQB 1EJAA 4NCYA 3MMGA 1T32A 2BOHB 3VGCB 1LKBA 1YCPK 4Q7XA 4I7YH 2FYRA 4Y11E 5I46H 2G52A 1BA8B 1G30B 1WTGH 1DSUA 3QWCH 5L6NH 1EQ9A 1ZMNA 4IN1A 1ZHPA 5DP9A 5FCRA 4INHA 2XBYA 3HPTB 2ASUB 1VITF 1AWFH 4DGJA 1GL1A 4O3UA 4WH8A 2EA3A 2VVCA 1CSOE 2BX4A 3P70B 4K3JA 3A7YA 4Y7BA 2Y82A 1FONA 1ZZZA 4JYUH 1T31A 3SJOA 1O35A 4INKA 3T28A 8KME2 4CR5A 3P8GA 3FZZA 3PMHB 2GTBA 2ALPA 2ZPRA 3RM0H 3SV2H 1O2KA 4YLQH 3RXDA 2OINA 5JBAS 4Y6DA 2WUCA 2ZI2H 1DOJA 1L1JA 1LVYA 2WPIS 1KYNA 4F49A 2GT7A 1C5ZB 4H42U 2VWOA 3LGUA 3QN7A 2ZHQH 1TPPA 3URCA 1ANBA 4ABHA 2FOGA 3E6PH 4FUJA 1UHBA 4WMEA 1PPCE 4HZHA 2BD7A 4WJG2 1A1RA 1SFIA 2P3UB 1QTFA 4JZ1A 2B7DH 1V2NT 1DFPA 4U2WA 3RXUA 1C5XB 1FY3A 1GGDC 1Z1JA 2XBXA 1VZQH 1O5DH 2F83A 1KLTA 4TPYA 5DKMA 3RXAA 2Z9GA 2BD9A 4ZMAH 3BTGE 1ZJDA 3KQDA 1G3DA 2ZHDA 4DIHH 1HAGE 1TYNA 2OLGA 4B75A 1F5RA 4FVBA 2ODQA 2BX3A 1TBZH 5DP6A 3D65E 3STJA 3L33A 2PFEA 1AQ7A 1UTOA 1OWIA 2Y81A 4CR9A 5AFYH 1KTTB 1GI9B 2VWLA 1S83A 1GHZA 3HKJB 2Y7ZA 1RJXB 3TPIZ 1CGJE 3OY5U 3LH3A 1Z8RA 3KN2A 4JZFH 4E7NA 1GHAG 1B5GH 1P2OA 1H8IH 4GVUA 4MNVA 1DY8A 2CF9H 1BUIA 2BD4A 4CH2B 3LH1A 1AY6H 2A0QB 2V3HH 2G51A 4E7RG 3KQBA 1SHHB 2F9UA 5JBTA 1A5HA 2ILNA 2O8MA 2QXGA 4KELA 2UWPA 4DCDA 3NCLA 4NIWA 1BJVA 3GY7A 4Y0ZE 1KDQB 4IBLH 3OYPA 4I8HA 4NSYA 2FI5E 3A8AA 5GXPA 4CH8B 1CBWC 1XUGA 4ABBA 1BTXA 2W5EA 3ITIA 3M37A 2BY6X 1MAXA 1XUFA 3R0FA 1GHYH 2UUYA 2ZTXA 5LPFA 1G2MA 4RKOB 4YO9A 1GBDA 2AGGX 3EDXB 1Z6EA 2F3CE 3EQ0H 2VH0A 5F03A 1KTSB 1DT2A 1GGDB 1GJBB 2ZGHA 4ZKRU 1SGFA 1AB9B 1TONA 3D23A 2FZZA 1AU8A 2GP9B 4X6OA 1SQOA 2BD3A 3ENSB 1Y5AT 1GWAA 4KTSA 3A80A 1BB0B 3PWBA 1C1OA 1C1VH 1A0HB 1CT4E 4R0IA 1MD8A 4AGKA 1DANH 1AD8H 1V2QT 1UCYE 1UVOA 2LPRA 2G8TA 1V2UT 5BRRE 1SGEE 4X8VH 1TOCB 4YTAA 2FMJA 3ZVEA 1MAYA 4GHTA 1WV7H 2WYGA 1TNIA 1GBCA 3BTEE 4HFPB 3PYHA 1C5RA 2BLQA 3GDSA 5A0BA 4X2XA 2WINI 5F8XA 1O38A 1EZSC 1BMMH 3GY6A 4NIYA 4ASHA 1ZYOA 2XW9A 1TRNA 1TX7A 3E1XB 2FS8A 4DW2U 3AASA 2P95A 2P3FH 1SSXA 3BIVH 5E0JA 3AW0A 1XX9A 1LHFH 1AI8H 2GCHG 1GBHA 3ZVDA 4ZAEA 1ANDA 4Y79A 2ZDVH 2QA9E 1CA0B 2FEQH 2BM2A 3RC6A 4B1TA 3RXIA 2Z9JA 6ESTA 1ESTA 1EP5A 1OWHA 4HGCA 1ZLRA 3I29A 1TX6A 1FV9A 1P2NA 3P8NA 1D3DB 4TPIZ 1MBMA 1QQ4A 1SMFE 1HJAC 1MTSA 5DJ7A 1O5GH 1H1BA 1O32A 2Z7FE 3T2NA 4FUHA 2BY9X 1C4V2 1TFXA 3SNDA 3DD2H 4AYVB 2CGAA 1O3AA 2A4RA 2HNTE 4AYYB 2PUQH 1ELBA 1O2TA 1ELCA 2BXUH 2SGPE 1HV7A 2A5KA 3SGBE 1XUIA 2PSXA 1XKAC 3KF2A 2GCHF 3OTJE 4IGDA 4X6MA 5LPRA 1MU8B 1EOLA 3EYDA 1TBQH 1EX3A 2BDGA 4ISLA 1DUAA 1SOZA 3B23B 3SHAH 4K2YA 1YYY1 2CHAB 2OD3B 4A7IB 4I33A 1O3JA 3W94A 1TX8A 5TCAA 1D3QB 1MCVA 1ETRH 3GDUA 2GZ7A 1TQ7B 5GPIB 3UIRA 1BDAA 2BQWB 2Z9IA 1MD7A 2ZA5A 1P02A 4ABIA 3LIWA 3FP7E 1THPB 3MNXA 2XTTB 3SQEE 2CXVA 1FAKH 2B5TB 3CS0A 3C27B 1MTNB 3SNCA 1KSNA 1DY9A 1U6QA 2ZU5A 1NRNH 2ZCKP 3QZRA 1FN6A 1P3CA 3RXQA 5EQSA 5EOKA 1AMHA 3SNBA 1KY9A 2BB4A