3RXOA

Crystal structure of trypsin complexed with (3-pyrrol-1-ylphenyl)methanamine
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
publication title In-crystal affinity ranking of fragment hit compounds reveals a relationship with their inhibitory activities
doi rcsb
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxoA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxoA02
1UJ1A 1EB2A 1ABJH 4BAMB 2CHAB 1THRH 4B1TA 1TPPA 5TJXA 1TGSZ 2ZHDA 3AAVA 1GBMA 4E06H 2H9HA 1GVZA 5GCHG 1V2VT 3VXFH 3FZZA 1U6QA 2QCYA 3SU3A 1N6YA 2C8WB 3WY8A 2LNCA 3KQDA 5DK1A 5E0HA 5EW2H 2D1JA 5AFYH 3RXOA 1F0RA 1F0SA 3SNCA 1FY4A 2OQUA 3PTBA 4NA7A 3EAJA 4GHQA 1P0SH 3GCTF 1PPEE 1EP5A 4R0IA 3KN2A 2YOLA 3TK5A 1Y5BT 1SPJA 4CH2B 4I8KA 5JPMH 2FOFA 4FUFA 1J9CH 3HKJB 1C1TA 1ELDE 1BMNH 1K2I1 4NIYA 2W7SA 1O3PB 1GHVH 2UWLA 1YKTA 4GLYA 4WJG2 2PKSC 3MNSA 2H9TH 3I78A 2FMJA 2A31A 2Z9KA 3C1KA 1EQ9A 2FS9A 3GICB 3P70B 1RIWB 2FTLE 1XKBC 5SGAE 2Z3DA 1UHBB 1BJUA 5C2ZA 1TNJA 1B0FA 1IQKA 5HMAA 1K21H 2IN2A 1GBBA 5C1XA 3ZYDA 1D3TB 2IPHA 1LCYA 4AORA 5CHAC 3Q76A 1P11E 2I6SA 2G81E 2Y5FA 1BITA 1GJ9B 1MZAA 1S84A 1GVKB 1DANH 1BZXE 1HAVA 4INLA 5EPNA 3LGUA 5DP8A 3LT3A 3M3TA 4YT7H 4JK5A 4FUHA 3AW1A 3GY4A 2ASUB 2XYAA 3A8BA 1P2NA 2JETC 2ZGJA 4D7GA 3HATH 5FX5A 4ZAEA 1TPSA 4FUGA 3I77A 1B7XB 3SO3A 1IQIA 2OXSA 3BTQE 4ZH8A 2F9NA 2QIQA 1FZZA 3A7WA 1ZZZA 2J38A 3PMHB 1LPGB 3SN8A 5C67A 1BRBE 1J14A 1YM0A 1CT2E 4K8BA 3U9AH 1MTNB 4AFSA 4NSYA 2ZWLH 1QBNA 1G3EA 4WMDA 1HAVB 1BRUP 1O3KA 1C1UH 2H5DA 2V0BA 1P2JA 1Z8IB 3BG8A 2C8YB 1Y3XA 1SOTA 3QDZB 4MPXA 1INCA 2R3YA 4ZKNU 4A7IB 1S81A 1Z8JB 2F3CE 1GDQA 5IDKA 1NRNH 3KQCA 1O2RA 2VWNA 3ZZ6A 4NZQA 1VCWA 1O3BA 2VJ1A 1BTZA 3RXHA 1S0QA 1KDQA 1A4WH 2OQ5A 4TYDA 1BDAA 4A1TA 1SB1H 3D62A 4CBOA 1SGRE 1VR1H 1MBQA 1N1LA 4MTBA 5EXMA 3KEEA 8LPRA 1P01A 2V35A 2O8UA 1DITH 2QXJA 1PPGE 1D6RA 2ZDKA 4GVUA 3O8RA 2QA9E 1DT2A 1TABE 1V2WT 4I8LA 1ZGIA 1L1GA 5JBCS 4GCHG 1KXDA 3TJOA 2Z94A 4XOJA 2BLWA 2FXRA 2C93B 3SW2B 2GZ8A 1PQ5A 1HUTH 2VVVA 3LJOA 1SI5H 1T8NA 1W13U 2FI5E 1KDQB 1EOLA 3QLPH 4JYVH 3SOSA 2XNIA 4Q2KA 1GBDA 5EQSA 3SBKA 1TRMA 1ZRKA 4UE7H 1Q2WA 4SGBE 3RLYH 1PPZA 3P92A 1SC8U 2CGAA 2ZQ1A 1K1JA 1A2CH 1H4WA 2G55A 2WYGA 1UCYE 3A8CA 1V2RT 1K28D 1GI2A 2PTCE 2PW8H 1UTMA 4A1XA 1C2MA 1CU1A 1D3PB 2QXHA 5EW1H 1HJAC 1AIXH 1UK3A 2ZG0H 4ESTE 1MZDA 4ZXXH 4ZHLU 2TRMA 4ABGA 1P09A 1P12E 4KELA 3EGKH 3ZZAA 1UVSH 3SU1A 3LGYA 4IN1A 3RXPA 3UUZA 1CBWC 3SJKA 3SU4A 9ESTA 1TGNA 4DCDA 1FPCH 1O5EH 1EATA 1OP0A 3SQHE 5BRRE 3A7XA 4A6LA 2FI4E 1C5NH 3BG4C 1HAPH 1SLVB 5JB9S 4I8HA 1CHGA 1KXBA 1SOZA 1ZJKA 1G37A 1SLWB 1EZSC 2G4TA 3AASA 4I31A 2AYWA 1DWCH 4X1PU 3LJJA 1FQ3A 1GHBF 1AKSA 3ODFA 4INHA 1QY6A 2HPPH 4LOYH 1OP2A 3RXUA 3RXSA 1NESE 1O2JA 1FV9A 1WV7H 1BRAA 1MCTA 1QRWA 3TK6A 2WUCA 4BOHA 2VWMA 4ISIH 1J15A 1C4U2 2ZFSA 3QZRA 2BVXH 1ACBE 1IQNA 1F5RA 3MH6A 3GISB 1AE8H 3KQEA 1AB9B 1EAUA 3Q3XA 1V2LT 3PLPA 2GZ9A 2AFQB 1MCVA 1ZSKA 1RIWC 1W8BH 2OBQA 1ARBA 1EPTC 2NU2E 1P06A 4ABIA 1THSH 1D4PB 1DLEA 1EXFA 1IQGA 3SGBE 3QTOH 1DM4B 1P8VC 2DUCA 2KAIA 1ZHMA 2I6QA 4BTTB 1H9HE 3U98H 4KTUA 1AKSB 2FODA 5I46H 3SNEA 3ZZ4A 2Q6DA 3I29A 2LPRA 1O3LA 4GHTA 4X2VA 1P2MA 1ZPBA 1CVWH 2BOHB 7KMEH 3SU0A 1SGFA 5TCCA 4K1TA 5EQQA 1ESTA 1KLTA 1BTHH 1NZQH 4KGAA 5LPFA 1GI5A 5C1YA 3K6ZA 2TGAA 1WTHD 2FOGA 1Q3XA 1AFQC 2Y6TA 4B76A 1O2UA 2W3KA 2GMTC 4XE4A 3ZZBA 1F0TA 2O8TA 3SNAA 2KAIB 1HNEE 1ZMNA 3TIUA 4YOIA 5LGOA 1AU8A 3RC6A 4FXGH 3F9FA 1BQYA 1EUFA 5F8XA 1C2JA 3VB3A 2VGCC 1BMAA 2BD5A 2GCHG 2ZDLA 1FY3A 1XUGA 1BJVA 1L1NA 1ESBA 1QL7A 1TIOA 1GGDB 3MNXA 2GCTB 1E0FD 2W5EA 4RSPA 2CN0H 1Y8TA 1YCPK 3SGAE 3OY5U 4ISOA 2O8WA 2WINI 2FOAA 4E7RG 2TBSA 1AD8H 2J34A 1GG6C 3D23A 4X1QU 7GCHF 2SGEE 3E0PB 1TONA 1TPOA 1V3XA 1CQQA 1HAIH 2AMDA 1IAUA 3LGTA 1O36A 4YZUA 3RMOH 4BNRA 3BTGE 2Q6GA 2RG3A 1GBIA 5HGGA 4UDWH 4JYTA 1ETSH 2TGTA 3M5NA 4HI3A 2A4QA 3QGNB 1FXYA 3ATKA 1PQ8A 1YLDA 4OGYA 1Y5AT 3VB4A 1DY8A 3UWIA 1O31A 1QCPA 2BDIA 3ESTA 2XCFA 4M7GA 2VU8E 4Y10E 2G8TA 1LHEH 2XBXA 3PV4A 4XBDA 1TGBA 2ESTE 3TJUA 2ZPQA 5PTPA 4YLUA 1BOQA 1RTLA 3P8NA 1Z1IA 1NFYA 1GMDF 2R0LA 2ZZUH 1DS2E 2WPMS 1H8IH 1ZLRA 3OYPA 2Z3EA 2JH5D 4XSKU 4CRBA 4DURA 1FY5A 1IQEA 3BTHE 4HTCH 1ZMLA 1W7GH 4WWYA 6ESTA 1A0LA 2UWPA 1G30B 4JZIA 1YPMH 2ODYB 1F7ZA 3A87A 3KHVA 3M5LA 1NPMA 2ZPSA 2ZHFH 3DA9B 2Z7FE 2Z6BD 1H9IE 1C2EA 3CS0A 1LVYA 1HJ9A 1P9SA 1HXEH 4R8TB 1C5QA 5FPYA 4ABAA 3PMBB 1QL9A 1O5BB 5K0HA 1C5TA 1K9OE 1FLEE 2PKAA 3GY3A 5A0AE 4D9RA 2GVFA 3NZIA 4JMYA 2P8OB 4X6PA 1DVAH 1A7SA 1TBQH 1CT0E 2HPQH 1OWKA 1C5LH 5ETXA 2R3UA 1O5AB 3BTEE 3MU8A 1DX5M 4CH8B 1A46H 1F5LA 3A89A 3MU0A 2PLXA 2SFAA 1BB0B 2J95A 2VIOA 2UWOA 3EQ0H 1AUTC 3BEUA 2GT7A 3A86A 1WYKA 3STIA 4TWYA 1AB9C 4J1YA 2QXIA 1O2WA 2ANMH 3LC5A 1AVGH 1C1SA 1XUHA 1HV7A 3O8DA 3B9FH 1WSSH 2PKAB 1ELGA 4FUIA 1LPKB 1LMWB 4THNH 1THPB 1NT1A 2GGVB 3ZV8A 1XVMA 1V2NT 5JBBS 1NRPH 4K3JA 5EOKA 3PMAB 1G2MA 1NFXA 1UMAH 3GYLB 4CRCA 3OTJE 1EX3A 3IWMA 3OSYA 1Z8RA 3LONA 4KTCA 1O3FA 4I33A 1CHOF 2WPJS 1O2XA 4ZMAH 3UOUA 2ZCLP 3M7UA 1L0ZA 2DE8A 3PLKA 3SUDA 1F2SE 3ODDA 3MNBA 3SJIA 1MH0A 4B71A 1C5OH 3ZYEA 4AG1A 6GCHF 1MQ5A 1FN8A 2AS9A 1ORFA 2OLGA 1IQMA 1W7XH 1QB6A 1GI6A 1DWBH 4BTIB 2OC7A 1DLKB 1SGQE 5A8XA 3T28A 2ZTYA 3FP8E 2AERH 2F9UA 1XMNB 3VB5A 1KTSB 2ALVA 4FUDA 5TCAA 4Y11E 2BLVA 1ELVA 1SGNE 1SG8B 1XUJA 2G00A 1TGTA 1O3GA 1K1IA 1ELTA 4X6OA 1UVOA 1C5RA 2OC0A 2A7CA 4K1SA 1HAYB 4K8YA 2ZTXA 1GGDC 2GCTC 4O97A 5EODA 4FU9A 1KYNA 2A7HA 4X2WA 2HGTH 1DPOA 3MO3A 3DFJA 1LQDB 4Y0YE 1BTXA 4DT7B 2Z9GA 4OS5A 1KTTB 3RP2A 1BCUH 4D7FA 3HGPA 2BLQA 2BZAA 4Y8YA 1C5PA 4MQAA 2CF8H 4TWWA 4BTUB 5C5NA 1P04A 2OTVA 3S0NA 2FX6A 1A0JA 4NFEA 1FAXA 3LIWA 1BUIA 1TALA 4UFGH 1O37A 1CGIE 1SQOA 1TOCB 5E8EH 5H4IB 2TGDA 4DJZB 1O2OA 1QA0A 2BY6X 2P93A 3O8CA 3NPSA 4CR5A 3P8OA 3T62A 3V0XA 1S83A 4ZKRU 4NZLA 1HAHH 1LHFH 1C9TA 1C4Y2 3RMMH 1S0RA 4FUCA 4DGJA 1VJ9U 2ILNA 3A84A 2HNTC 5FBEA 1K1LA 4XBCA 1OPHB 5DGJA 3A82A 3RC5A 1UTQA 1C5UA 1SLXB 3EDXB 1QJ7B 4Y7AA 1XUIA 5T6FA 5A2MH 1OWEA 1ESAA 3U1JB 1QQ4A 1BTPA 1SGDE 5C5OA 2NU0E 2Z9IA 2PGQB 3SJ9A 3LC3A 1SGCA 1GHAG 4YOGA 1VCPA 3GCHC 1C1OA 3HK6B 2F83A 1AHTH 4DY7B 1DUAA 2ZGHA 3RMLH 1Y3WA 1OS8A 3T5FH 1ETRH 1FPHH 5FPTA 3ZVEA 1NRQH 4DVAU 1ANBA 1WQSA 4GPGA 2HVXA 3SNBA 2K1QA 2NU3E 1GL0E 5BPEA 1TNGA 4ABHA 2F9PA 3ZVCA 2BQ7B 1LKBA 4DOQA 2WPHS 1O3JA 1EASA 3F6UH 3TH4H 1P3CA 3MYWA 3E16B 2PHBA 1AN1E 2CV3A 1BIOA 1GJ4H 3GCNA 3NUMA 2ZCHP 1CSOE 2GDEH 4CR9A 1WAYB 3SI4H 4VGCB 2PUQH 5DP6A 1O3NA 3QO6A 1GBHA 1IQLA 5E0JA 4ZKOU 4MPVA 1QB1A 4NCYA 3QX5H 1EZUC 1ELFA 1C1RA 2D26C 1Z6EA 1C1QA 2HRVA 4BAOB 2ZP0H 1DFPA 1ZHRA 1Y5UT 1N8OB 1ZTKA 1W0YH 3D49H 1GMHG 1RGQA 3JZ2B 3STJA 2BX3A 5FAHA 1O3OA 2AMQA 3PTNA 1N6XA 2B7DH 5EGMA 5ESTE 1VCQA 2EI8A 3LH3A 1FUJA 3HK3B 1ZOMA 4MG3A 2ODPA 3MO9A 3RXRA 4Q80A 3DD2H 1TAWA 1HIAA 5EQRA 2PTNA 1MTUA 3S9BA 1S6FA 2OD3B 1JXPA 1T31A 1UCYH 4FVBA 2JH0D 3A7TA 1QURH 1BBRE 3K9XB 4B2CA 1DUEA 1HXFH 2BD4A 1MD8A 3TNSA 1GI0A 1TQ7B 3ZVDA 1Z1JA 1TNHA 5GCHF 1O3DA 4ABBA 1AQ7A 3VB6A 4CRGA 4HFPB 1UVUH 4IBLH 1SHYA 2ZQ2A 1GMCG 1V2QT 1XXDA 3RXTA 5FHTA 1ZHPA 5GJ4B 3ZVFA 4ABDA 4Y8ZA 3QUMP 1NY22 3FP6E 2XWBI 1G3CA 4I8GA 2AIQA 3SHCH 1PPBH 5L2ZH 2NWNA 3RXMA 1ZPZA 2A5IA 1HIAB 1ELCA 1TNIA 2FS8A 5F6MA 1UTNA 1YYY1 1TA2A 4OS2A 2HLCA 5DKMA 2ZU4A 3IG6B 4AN7A 1L4DA 1HB0B 2P94A 2A1DB 1NROH 2YNBA 1XM1A 1D6WA 1FDPA 1UK4A 4LXBH 1KLJH 2CHAC 1LDTT 3K6YA 1AVXA 5DP3A 2A45B 2STBE 2BD7A 1A3EH 2WV5A 4X1SU 5I25A 3OX7U 3TVJB 1O2LA 4B2AA 3M3VA 1S82A 1TMBH 4AOQA 1O30A 3KCGH 1SGEE 2JH6D 1RFNA 1MKWH 2OC1A 1GJAB 4YM9A 1JBUH 3NCLA 3NK8A 4B74A 1GJ8B 3D65E 2F9OA 4D8NA 8GCHG 2TIOA 1SGYE 2D2DA 4BAKB 1IQHA 3QK1A 1YPJH 3U1IB 1AO5A 2EC9H 1SSXA 3LGWA 3UNRA 1O2VA 2Y80A 1C2KA 1EB1H 2ODQA 1EOJA 2A2QH 2XRCA 5B6OA 5LPEA 5ABWA 1DSTA 4TY6A 5A8YA 2QF3A 1ZMJA 2G5NA 1EZXC 3RXIA 4ZHMU 2VIDA 2O8LA 2UUKB 2GDDA 4AGKA 1IOEA 4X0WU 1TFXA 3QWCH 2BDHA 1DY9A 1MUEB 2PV9B 3BTTE 1Y59T 2THFB 1RXPA 5G4BA 3UWJH 3Q3YA 1UO6A 5JBTA 3BEFB 1O32A 1PPHE 1ZGVA 3IITA 3MTYA 8ESTE 2OCVB 4WMEA 2F9VA 1CA8B 1GBAA 1K1PA 3ZZ3A 2B5TB 1XXFA 3RXAA 1CGJE 2BD2A 1OOKB 1TLDA 2G51A 2W26A 1VITG 3ZZCA 3E6PH 2GV6A 9LPRA 4JZDH 3VGCB 3UQVA 1TGCA 3RMNH 3MU4A 3NXPA 2ZECA 5C3NA 1GBFA 1HDTH 5T6DA 4ZKSU 2QF0A 2RCEA 3PWBA 3ZV9A 1O2SA 1O0DH 1UTKA 1GBJA 3QN7A 1C2LA 1FMGA 3FVFB 3JZ1B 5DPAA 3V13A 1MU8B 1O2GH 5JYIA 1O2PA 4K2YA 2FOBA 2NU1E 3VEQB 2B0FA 4GUXA 2ZGXH 4WXVA 1TPAE 4K5ZA 1HAZB 2W7UA 3HPTB 3A88A 3GCOA 1A0HB 1VGCB 1L1JA 1JIMA 1NTPA 1PYTD 1GPZA 5DP7A 1W0ZU 2D8WA 1G9IE 1RS0A 1SLUB 2ZU2A 3B8JA 4VGCC 1RRKA 1D3QB 2Y81A 1EAIA 3PO1B 1A3BH 7LPRA 1MTNC 2VIVA 3RDZA 2V3HH 1FI8A 5EG4A 4LZ4B 4GCHF 3M61U 1EJAA 2Y7ZA 5HYOA 1H9LB 2C8ZB 2QXGA 2GD4B 2P3FH 1Y3YA 1OWJA 2ANKH 2DE9A 3W95A 3PROA 1HCGA 2ZIQH 1AWFH 2FI3E 1TBRH 1O34A 2VIQA 4X6MA 4YOJA 1SQAA 1ETTH 1OSSA 2C90B 3H7TA 5DP5A 3ZZ5A 3H7OA 2OUAA 2XC4A 3DHKH 1YPHC 1XX9A 1O39A 1H8DH 3ZZ8A 3ATLA 1FIZA 3F68H 3GY2A 1NRRH 2VIPA 1GCTB 4TPYA 1IHTH 3E0NB 1J8AA 1HRTH 1V2ST 3LKWA 3KNXA 5EXLA 3QGJA 3SUFA 3VB7A 1AMHA 3BTWE 2Y5HA 1S85A 4OS7A 4Z6AH 3RXQA 2G5VA 4KTSA 1OWDA 4ISNA 1HBTH 2GV7A 1ABIH 2AGGX 1QB9A 3TU7H 1TE0A 1GJDB 1AFEH 5DG6A 1T8OA 4Y7BA 2XC5A 3KQBA 4X1RU 1NC6A 1OYQA 1TNLA 2R0KA 6CHAB 1KIGH 3T27A 1Z8GA 3TLOA 1SGTA 1OX1A 2ZPRA 2HOBA 3RXKA 1ZTJA 3BEIB 3ITIA 2P95A 4NIVA 4XDEA 2P3TB 3MO6A 3TNTA 3Q3KA 2H9EH 3P8GA 4IS5A 4E05H 4CRFA 1P2KA 3OU0A 2BDAA 2O8MA 1C5MD 3VFEA 4AZ2B 2H5CA 2PKSB 5L6NH 3PMJA 3S7HB 1O2IA 1SL3A 5A0CA 1FIWA 1TMTH 2Y5GA 1C2HA 2BY9X 3CS7A 3SV6A 5HM9A 1MU6B 2FOEA 2Z9JA 3GDVA 2BDGA 1CGHA 1GI8B 3TPIZ 3U8RH 1TX8A 1O2HA 3M35A 1CA0B 1PPFE 5CHAB 1MKXH 3U8OH 2VNTA 1TA6A 1K1MA 4ZHAA 4MDSA 4BXWA 4BAQB 1SFQB 3GCTG 3RM2H 2SGDE 5E2OA 2HALA 2B9LA 3NWUA 2R9PA 3S69A 1P3EA 1PYTC 1K1OA 1O5FH 6LPRA 2P59A 3R0FA 4X8SH 1C4V2 3QZQA 2JETB 3G01A 4MNYA 1GJ6A 1L4ZA 2HNTE 4Q7YA 4WH8A 2FDAA 4J2YB 1MAXA 2XC0A 1A5HA 3MH5A 3T26A 3RLWH 1F5KU 2FPZA 2ZKSA 1E36B 4QT8C 4H6SB 1WTGH 1TRNA 1MQ6A 4SGAE 3SUEA 2ZDVH 3LGVA 2ZFQH 1GJ5H 5EPYA 1QBOA 3F1SB 1W3CA 1CT4E 2GCHF 3BSQA 2ZFFH 3L6PA 4MNVA 2P16A 1C2GA 3S7KB 4Y8XA 3F9EA 4Y6DA 2OINA 4AB8A 1CO7E 1LKAA 2EEKA 3A83A 2XBWA 1BA8B 3RXDA 4XFQA 1AY6H 3KL6A 3TK9A 3MOCA 2J92A 1TB6H 1E35B 4HZHA 3BTME 3W94A 3MHWU 1K1NA 1Z7KA 1UCYK 3V7TA 2F91A 1C1NA 4MVNA 1O2QA 1ZSLA 5K7RA 2ZU3A 3A81A 1MTSA 4D76A 3BTFE 4AGJA 5F8TA 4INKA 1VGCC 3MMGA 1RTFB 2BTCE 2R2MB 5DP9A 1HAGE 2BMGB 4O3TA 5A09A 2AGIX 2J94A 3GY6A 4UFEH 1YPEH 3H5CB 3M3SA 1K22H 2ULLA 1DWDH 4JK6A 1B0EA 3LH1A 3UIRA 1F0UA 3GY8A 4A92A 3RXCA 2SGPE 2PWXA 1F92A 1LVBA 1H1BA 1BMLA 1O2KA 3MU5A 3MH4A 1GVLA 1A1RA 2BVSH 1IQJA 5AHGH 1WBGB 4OS6A 1LO6A 3RXGA 2Z3CA 1SGPE 2QN5T 2ZGCA 1WQVH 1KXFA 2QV1A 2PSXA 4DG4A 2BX4A 4AX9H 2P3UB 4FU7A 1GBCA 2FZZA 4ZXYH 1D3DB 1BTWA 3GY5A 3M7TA 1MKWK 1P9UA 1V2OT 3BIVH 3PB1E 3UPEA 1HJAB 2PUXB 1O5GH 1ZJDA 4JZFH 4LK4A 1JWTA 1GJBB 1CBWB 1E34B 3M36A 1QNJA 1FJSA 1GDUA 2FIRH 1YGCH 2CF9H 2PGBB 1GDNA 8KME2 1EPTA 2BD8A 5C20A 1V2TT 1UHBA 3BG4B 1UTOA 2ZGBH 2FX4A 3EE0B 5A8ZA 6CHAC 2ANYA 3OY6U 2O9QA 4WH6A 4I32A 1GHWH 3TGKE 1TYNA 2FOMB 2WYJA 4FUEA 4WF8A 3QTVH 1GJCB 1LHGH 2BB4A 4B2BA 3SZNA 3VXEH 4GSOA 4IC5A 4Y76A 1EP6A 1ZR0A 4U30A 1QL8A 5HM2A 1JMOH 2BDYA 2G4UA 1LVOA 2ZNKH 1ANCA 1P10A 1S5SA 3UTUH 5CMXH 3KF2A 2FO9A 3UFAA 4YLQH 1YPGH 1QQUA 1V2JT 1IHSH 2BZ6H 2VVUA 2AMPA 5AVDA 4X8TH 1EPTB 5F8ZA 5LH8A 1JOUB 1GHZA 3SJ8A 1NN6A 4AB9A 1G2LA 4HGCA 2TGPZ 1UVPA 4KKDA 4WXIA 1AE5A 2BD3A 1C2IA 1A5IA 1W12U 1CA0C 3A7ZA 4WVPE 1GCDA 4I7YH 1GI7B 3DT0H 1WUNH 2FEQH 2P8OC 2RDLA 4XBBA 2EI7A 4BXSA 2BQ6B 4JCNA 1GHBG 4X6NA 2XTTB 3K2UA 1V2PT 4I8JA 1TQ0B 3CENA 1T8LA 2QC2A 1FY8E 3FP7E 5EU8A 3MNCA 3URDA 2ZFRH 3EA7A 4GAWA 1SHHB 3SU5A 2PFEA 3UOPA 1PPCE 2F9BH 1BBRH 2ZU5A 1W11U 1E37B 1O5CB 3KGPA 1NU7B 1ELEE 4JZEH 4DIHH 1P2IA 1AFQB 2HWLB 5FXLA 4U01A 1LVMA 4AFUA 1OYTH 2FLBH 1C9PA 2GKVE 2GMTB 3TGIE 2FOCA 1VZQH 5FCKA 4DW2U 1YF4A 3Q00A 2BXTH 1TX7A 3UQOA 3DFLA 1OWIA 2VH6A 1QA7A 2JKHA 5FBIA 2VGCB 2VH0A 1QTFA 2BQWB 2GZ7A 3M5MA 3T2NA 3RXFA 1RD3B 4A5TS 1QJ6B 5FCRA 1KXCA 1GHXH 1C5VA 1SFIA 4ISLA 1MAYA 2G52A 2A4GA 1AUJA 1XUKA 1YLCA 3UNQA 1T7CA 1SQTA 2QAAA 4X2XA 1C5ZB 5J4SA 4AYVB 3EA8A 5L30H 1O3HA 1GG6B 4UEHH 1C2FA 1UTPA 2PR3A 2J4IA 4NA8A 2A4OA 2WUBA 2GX4A 1O38A 2PSYA 2ZC9H 1AZZA 1HPGA 1B5GH 1ARCA 2IOTA 3ZZ7A 2J9NA 1C5WB 1O2NA 3GOVB 3RXEA 5L2YH 3ATWA 1J16A 1MTVA 1SBWA 4B73A 1YPKH 1G32B 1CE5A 2SGAA 3Q77A 3HKIB 4NIXA 1P2OA 2XBYA 3E91A 4NWKA 4DIIH 2XXLA 3RXBA 1P2QA 1QIXB 1SGFG 2ZEBA 2BYAX 2FTMA 1AGJA 2IJOB 4PROA 1ZSJA 3UNSA 3MWIU 3SHAH 3U69H 1GI9B 3B23B 1XKAC 3P95A 4X1NU 4K60A 2QY0B 4BAHB 4WY3A 1PFXC 5DP4A 1Z71A 3O8BA 3SV8A 2ZF0H 3ZVAA 1LTOA 1NFWA 1YPLH 2BY5X 3URCA 7GCHG 4MLFB 2UUYA 1FY1A 1YPHE 2V6NA 2A2XH 4ABEA 1DXWA 1ZPCA 4RN6A 1GHAF 3ATIA 3SV9A 1EKBB 1SVPA 3N7OA 4RKOB 3RXJA 3BV9B 3V12A 3FANA 1PQAA 5CE1A 1KXEA 1OXGA 4WMFA 1MKXK 3ZVBA 2QGRA 1Q31A 1TMUH 3PWCA 1T8MA 1GBKA 2FYRA 2NU4E 2FOHA 2EI6A 3RU4D 3RU4E 1HFDA 2XWAA 3SV2H 1WU1A 3NKKA 3SORA 1C1WH 1HAOH 5GXPA 1T32A 1MTWA 2Y7XA 3P6ZB 4IGDA 4KP0A 2AIPA 3M5OA 1BTUA 1GMDG 5EXNA 2ZU1A 1JRTA 4FUBA 3M37A 2VIWA 2ZDMA 1TOMH 2GTBA 1O33A 1XUFA 1NO9H 4AFQA 4YO9A 1SGIB 2ZDNA 2WPLS 3LDXH 4IN2A 2BDBA 2FLRH 3RXLA 1WOFA 2H1UA 3L33A 3BN9A 1NU9A 1EAWA 2TPIZ 5T3HA 3U8TH 3TGJE 1QBVH 1BMMH 1Y3UA 3SI3H 2WPKS 3LPRA 4MNWA 3TJNA 3AAUA 1ELBA 2B8OH 2VWOA 3E8LA 3F9HA 1LHDH 1FAKH 2C8XB 1YC0A 4CBNA 2FP7B 3SNDA 1HLTH 4NA9H 5GWZA 5E0GA 1GMHF 1O2ZA 4H4FA 4NG9H 4F4OC 1EJMA 1KSNA 3VPKA 1LPZB 4H6TA 4Y0ZE 4Q7XA 1TNKA 3SV7A 5AF9H 4O3UA 5GDSH 2A4RA 1NFUA 2AEIH 3LOXA 4B75A 1SMFE 5J4QA 3A8DA 1S6HA 4RKJB 4CRAA 1TRYA 3BTDE 2XBVA 3T25A 2C4FH 3GDSA 2BVRH 1AI8H 4CHAB 2YNAA 1KY9A 4IMQA 1GI3A 1LQEA 3AVZA 4UFDH 3UR6A 4OGXA 2OBOA 1HAXB 1KXAA 1O3IA 3GY7A 1T4UH 1DE7H 4U2WA 1GJ7B 1GMCF 1P02A 5JB8S 2AGEX 1C1VH 1EZQA 3LU9B 2ZI2H 2BHGA 1N8OC 1GI1A 2STAE 3PLBA 4Y71A 4JYUH 4JZ1A 1O2MA 1MMJN 1V6DA 1KLIH 1QRZA 2Y82A 1J17T 3SJOA 2WPIS 1BRCE 1GL1A 5JDUB 5IYTA 1A5GH 1DWEH 2BOKA 1QRXA 1MBMA 1V2KT 2GP9B 3R3GB 5FX6A 5ESBA 3DUXH 5JBAS 4IW4E 1CHOG 1GI4A 1W2KH 1O5DH 2Q1JA 2VVCA 1DOJA 1HYLA 3FAOA 1DXPA 1V2MT 3EYDA 4NWLA 2ZO3H 2CMYA 3A7VA 2H6MA 3SGQE 3F9GA 1ANEA 1FN6A 3RUOA 6GCHG 1T4VH 1O2TA 2ZHEH 1G36A 1P57B 1XVOA 2BXUH 1C1MA 1UVTH 2ZFTA 2OC8A 4IMZA 1C2DA 5DJ7A 1P03A 3MI4A 2ANWA 5C1UA 8GCHF 1GBEA 1GHYH 1UK2A 4ABFA 3P17H 4K69A 3RC4A 3UR9A 3ENSB 1RTKA 3FFGA 1G3BA 2ZHWH 1TWXB 1GWAA 2XCNA 4TPIZ 4K1EA 3ELAH 1YP9A 1PJPA 1BTYA 3MH7A 3SU2A 2BDCA 1QFKH 1DDJA 3ZZ9A 1NS3A 1C5YB 2HNTF 4FU8A 4MPWA 2ZA5A 3SU6A 4AYYB 5GPIB 3ZVGA 3E1XB 2VWLA 3ZZDA 1ZRBA 1GBTA 1W14U 4UD9H 1O3AA 3LGIA 1AZ8A 4FUJA 2FYQA 2BLOA 1M9UA 3GDUA 5GIBA 1JRSA 2GT8A 2RA0A 2Q6FA 3FZDA 1NM6A 3CP7A 3T29A 1VITF 1A61H 2VB0A 3GCHB 3BF6H 4F49A 1QGFA 1DSUA 3A7YA 3TITA 2WV4A 2VINA 4LZ1H 1NRSH 3UY9A 1O3MA 1UTLM 3KIDU 1SR5C 1VITH 1YCPM 4Q7ZA 2SGFE 2ZHQH 1LHCH 4U32A 1D9IA 2BD9A 4MNXA 4NGAH 3EA9A 4YTAA 2CJIA 1AWHB 2H2ZA 5AFZH 3SQEE 1O2YA 2FESH 3PYHA 2A32A 3E3TA 1ELAA 2ALPA 4ZUHA 4BANB 1O3CA 2Z9LA 1E38B 3GYMA 4D9QA 4UONA 2ZTZA 3S9AA 7ESTE 1EJNA 4YESB 1BBRK 1ZYOA 3L3TA 5E2PA 3SUGA 1ANDA 3S9CA 3C27B 4UFFH 4X8VH 2OP9A 1TX6A 5DO4H 1RJXB 3V3MA 1W10U 4OS4A 3E90B 1P05A 2SGQE 1ZTLA 1BHXF 4H42U 3A85A 4MPUA 4X2YA 4O9VA 3RXVA 3TH2H 1OP8A 2ZDAH 2M5TA 1BHXB 1GBLA 3P8FA 3VGCC 3MFJA 4Y79A 2A5AA 1G3DA 5A0BA 3A8AA 4TY7A 1OWHA 4CRDA 4O03A 4E7NA 1UTJA 5FPSA 1FONA 2BM2A 1FNIA 3ATMA 4IC6A 2C3SA 3RM0H 1QR3E 1DICA 1X7AC 2FWWA 1VJAU 1PQ7A 1L2EA 3AW0A 1HJ8A 4A1VA 4ASHA 2CXVA 2UUJB 2UUFB 3MU1A 1C5SA 2W3IA 1C1PA 3BIUH 5T6GA 1Y3VA 1O35A 2BY7X 1HGTH 2FM2A 1ID5H 4CHAC 2A5KA 1MD7A 2EA3A 1JIRA 3BTKE 4AG2A 1EAXA 3TH3H 4NFFA 3PO1C 2ZFPH 2AH4X 4ISHH 3K65B 4X8UH 3TJVA 1IQFA 4OS1A 1AVWA 4ABJA 3A80A 1V2UT 1QJ1B 2R2WU 1OKXA 3PM3A 1C5XB 4AFZA 1O3EA 4FVDA 5LPRA 2RA3A 2SNWA 1Z6JH 3UREA 5F03A 2BY8X 4NIWA 5HXFA 4ZROA 4CREA 2SNVA 2ZCKP 4NSVA 4Z0KA 1WCZA 2J2UA 1YCPH 1QHRB 2A7JA 1YBWA 1TBZH 3RU4T 1BT7A 3M7QA 1GCTC 2QYIA 4YT6H 2XW9A 2A0QB 3HGNA 2V3OH
chains in the Genus database with same CATH superfamily
1UJ1A 1EB2A 5KEDA 1ABJH 4BAMB 2CHAB 1THRH 4B1TA 1TPPA 5TJXA 1TGSZ 2ZHDA 3AAVA 1GBMA 4E06H 2H9HA 1GVZA 5GCHG 1V2VT 3VXFH 3FZZA 1U6QA 2QCYA 3SU3A 1N6YA 2C8WB 3WY8A 2LNCA 3KQDA 5DK1A 5E0HA 5EW2H 2D1JA 5AFYH 3RXOA 1F0RA 1F0SA 3SNCA 1FY4A 2OQUA 3PTBA 4NA7A 3EAJA 4GHQA 2J97A 1P0SH 2J98A 3GCTF 1PPEE 1EP5A 4R0IA 3KN2A 2YOLA 3TK5A 1Y5BT 1SPJA 4CH2B 4I8KA 5JPMH 2FOFA 4FUFA 1J9CH 3HKJB 1C1TA 1ELDE 1BMNH 1K2I1 4NIYA 2W7SA 1O3PB 1GHVH 2UWLA 1YKTA 2WHXA 4GLYA 4WJG2 2PKSC 3PV5A 3MNSA 2H9TH 3I78A 2FMJA 2A31A 2Z9KA 3C1KA 1EQ9A 1SQRA 2FS9A 3GICB 3P70B 1RIWB 4ZCNA 2FTLE 1XKBC 5SGAE 2Z3DA 1UHBB 1BJUA 5C2ZA 1TNJA 4RT0A 1B0FA 1IQKA 5HMAA 1K21H 2IN2A 1GBBA 5C1XA 3F3BA 1D3TB 3ZYDA 2IPHA 1LCYA 2J98B 4RI0A 4AORA 5CHAC 3Q76A 1P11E 2I6SA 2G81E 2Y5FA 1BITA 1GJ9B 1MZAA 1S84A 1GVKB 1DANH 5DSFA 1BZXE 1HAVA 4INLA 1K0HA 5EPNA 3LGUA 5DP8A 4Q63A 3LT3A 3M3TA 4YT7H 4JK5A 4FUHA 3AW1A 3GY4A 2ASUB 2XYAA 3A8BA 1P2NA 2JETC 2ZGJA 4D7GA 3HATH 5FX5A 4ZAEA 1TPSA 4FUGA 3I77A 1B7XB 3SO3A 1IQIA 2OXSA 3BTQE 4ZH8A 2F9NA 2QIQA 1FZZA 3A7WA 1ZZZA 2J38A 3PMHB 1LPGB 3SN8A 5C67A 1BRBE 1J14A 1YM0A 1CT2E 4K8BA 3U9AH 1MTNB 4AFSA 4I86A 4NSYA 2ZWLH 1QBNA 1G3EA 2M2AA 4WMDA 1HAVB 1BRUP 1O3KA 1C1UH 2H5DA 2V0BA 1P2JA 1Z8IB 3DSGA 3BG8A 2C8YB 1Y3XA 1SOTA 3QDZB 4MPXA 1INCA 2R3YA 4ZKNU 4A7IB 5B6LA 1S81A 1Z8JB 2F3CE 1GDQA 5IDKA 1NRNH 3KQCA 1O2RA 2VWNA 3ZZ6A 4NZQA 1VCWA 1O3BA 2VJ1A 1BTZA 3RXHA 1S0QA 1KDQA 1A4WH 2OQ5A 4TYDA 1BDAA 4A1TA 1SB1H 3D62A 4CBOA 1SGRE 1VR1H 2F4LA 1MBQA 1N1LA 4MTBA 5EXMA 3KEEA 8LPRA 1P01A 2V35A 1UW7A 2O8UA 1DITH 2QXJA 1PPGE 1D6RA 2ZDKA 4GVUA 3O8RA 2QA9E 1DT2A 1TABE 1V2WT 4I8LA 1ZGIA 1L1GA 5JBCS 4GCHG 1KXDA 3TJOA 2Z94A 4XOJA 2BLWA 2FXRA 2C93B 3SW2B 2GZ8A 1PQ5A 1HUTH 2VVVA 3LJOA 1SI5H 1T8NA 1W13U 2FI5E 1KDQB 1EOLA 3QLPH 4JYVH 3SOSA 2XNIA 4Q2KA 1GBDA 5EQSA 3SBKA 1TRMA 1ZRKA 4UE7H 3EE7A 1Q2WA 4SGBE 3RLYH 1PPZA 3P92A 1SC8U 2CGAA 2KFWA 2ZQ1A 1K1JA 1A2CH 1H4WA 2G55A 2WYGA 1UCYE 3A8CA 1V2RT 1K28D 1GI2A 2PTCE 2PW8H 1UTMA 4A1XA 1C2MA 2WV9A 1CU1A 1D3PB 3N7EA 2QXHA 2XNDD 5EW1H 1HJAC 1AIXH 1UK3A 2ZG0H 4ESTE 1MZDA 4ZXXH 4ZHLU 2TRMA 4ABGA 3OAAD 1P09A 1P12E 4KELA 3EGKH 3ZZAA 1UVSH 3SU1A 3LGYA 4IN1A 3RXPA 3UUZA 1CBWC 3SJKA 3SU4A 9ESTA 1TGNA 4DCDA 1FPCH 1O5EH 1EATA 1OP0A 3SQHE 5BRRE 3A7XA 4A6LA 2FI4E 4Z1MD 3N99A 1C5NH 3BG4C 3F0PA 1HAPH 1SLVB 5JB9S 4I8HA 1CHGA 1KXBA 1SOZA 1ZJKA 1G37A 1SLWB 1EZSC 2G4TA 3AASA 4I31A 2AYWA 1DWCH 4X1PU 3LJJA 1FQ3A 1GHBF 1AKSA 3ODFA 4INHA 1QY6A 2HPPH 4LOYH 1OP2A 3RXUA 3RXSA 1NESE 1O2JA 1FV9A 1WV7H 1BRAA 1MCTA 1QRWA 3TK6A 2GJGA 2WUCA 4BOHA 2VWMA 4ISIH 1J15A 1C4U2 2ZFSA 3QZRA 2BVXH 1ACBE 1IQNA 1F5RA 3MH6A 3GISB 1AE8H 3KQEA 1AB9B 1EAUA 3Q3XA 1V2LT 3DCLA 2GZ9A 2AFQB 3PLPA 1MCVA 1ZSKA 1RIWC 1W8BH 1ARBA 1EPTC 2OBQA 3F0OA 2NU2E 1P06A 4ABIA 1THSH 1D4PB 1DLEA 1EXFA 1IQGA 3SGBE 3QTOH 1DM4B 1P8VC 2DUCA 2KAIA 3DSPA 1ZHMA 2I6QA 4BTTB 1H9HE 3U98H 4KTUA 1AKSB 2FODA 5I46H 3F2GA 3SNEA 3ZZ4A 2Q6DA 3I29A 2LPRA 1O3LA 4GHTA 4X2VA 1P2MA 1ZPBA 1CVWH 2BOHB 7KMEH 3SU0A 1SGFA 5TCCA 4FOUC 4K1TA 5F53A 5EQQA 1ESTA 1KLTA 1BTHH 1NZQH 4KGAA 5LPFA 1GI5A 5C1YA 3K6ZA 2TGAA 1WTHD 2FOGA 4P00A 1Q3XA 1AFQC 2Y6TA 4B76A 1O2UA 2W3KA 2GMTC 4XE4A 3ZZBA 1F0TA 2O8TA 3SNAA 2KAIB 1HNEE 1ZMNA 3TIUA 4YOIA 5LGOA 1AU8A 3RC6A 4FXGH 3F9FA 1BQYA 1EUFA 5F8XA 1C2JA 3VB3A 1E79D 2VGCC 1BMAA 2BD5A 2GCHG 2ZDLA 1FY3A 1XUGA 1BJVA 1L1NA 1ESBA 1QL7A 1TIOA 1GGDB 3MNXA 2GCTB 1E0FD 2W5EA 4RSPA 2CN0H 1Y8TA 1YCPK 3SGAE 3OY5U 4ISOA 2O8WA 2WINI 2FOAA 4E7RG 2TBSA 1AD8H 2PP6A 2J34A 1GG6C 3D23A 4X1QU 7GCHF 2SGEE 3E0PB 1TONA 1TPOA 1V3XA 1CQQA 1HAIH 2AMDA 1IAUA 3LGTA 1O36A 4YZUA 3RMOH 4BNRA 3BTGE 2Q6GA 2RG3A 1GBIA 5HGGA 4UDWH 4JYTA 1ETSH 2TGTA 3M5NA 4HI3A 2A4QA 3QGNB 1FXYA 3ATKA 1PQ8A 1YLDA 4OGYA 1Y5AT 3VB4A 1DY8A 3UWIA 1O31A 1QCPA 2BDIA 3ESTA 2XCFA 4M7GA 2VU8E 4Y10E 3NRLA 2G8TA 1LHEH 2XBXA 3PV4A 4XBDA 1TGBA 2ESTE 3TJUA 2ZPQA 5PTPA 2VBCA 4YLUA 1BOQA 1RTLA 3P8NA 1Z1IA 1NFYA 1GMDF 2R0LA 2ZZUH 1DS2E 2WPMS 1H8IH 1ZLRA 3OYPA 2Z3EA 2JH5D 4XSKU 4CRBA 4DURA 1FY5A 1IQEA 3BTHE 4HTCH 1ZMLA 1W7GH 4WWYA 6ESTA 1A0LA 2UWPA 1G30B 4JZIA 1YPMH 2ODYB 1F7ZA 3A87A 3KHVA 3M5LA 1NPMA 2ZPSA 2ZHFH 3DA9B 2Z7FE 2Z6BD 1H9IE 1C2EA 3CS0A 1LVYA 1HJ9A 1P9SA 1HXEH 4R8TB 1C5QA 5FPYA 4ABAA 3PMBB 1QL9A 1O5BB 5K0HA 1C5TA 2HLDD 1K9OE 1FLEE 2PKAA 3GY3A 5A0AE 4D9RA 2GVFA 3NZIA 4JMYA 2P8OB 4X6PA 3UB0A 1DVAH 1A7SA 1TBQH 1CT0E 2HPQH 1OWKA 1C5LH 5ETXA 2R3UA 1O5AB 3BTEE 3MU8A 1DX5M 4CH8B 1A46H 1F5LA 3A89A 3MU0A 2PLXA 2SFAA 1BB0B 2J95A 2VIOA 2UWOA 3EQ0H 1AUTC 3BEUA 2GT7A 3A86A 1WYKA 1VKYA 3STIA 4TWYA 1AB9C 4J1YA 2QXIA 1O2WA 2ANMH 3LC5A 1SKYE 1AVGH 1C1SA 1XUHA 1HV7A 3O8DA 3B9FH 1WSSH 2PKAB 1ELGA 4FUIA 1LPKB 1LMWB 4THNH 1THPB 1NT1A 2GGVB 3ZV8A 1XVMA 1V2NT 5JBBS 1NRPH 4K3JA 5EOKA 3PMAB 1G2MA 1NFXA 1UMAH 3GYLB 4CRCA 3OTJE 1EX3A 3IWMA 3OSYA 1Z8RA 3LONA 4KTCA 1O3FA 4I33A 3KYFA 1CHOF 2WPJS 1O2XA 4ZMAH 3UOUA 2ZCLP 3M7UA 3N7DA 1L0ZA 2DE8A 3PLKA 3SUDA 1F2SE 3ODDA 3MNBA 3SJIA 1MH0A 1WDIA 4B71A 1C5OH 3ZYEA 4AG1A 6GCHF 2LELA 1MQ5A 1FN8A 2AS9A 3FN8A 1ORFA 2OLGA 1IQMA 1W7XH 1QB6A 1GI6A 1DWBH 4BTIB 2OC7A 1DLKB 1SGQE 5A8XA 3T28A 2ZTYA 3FP8E 2AERH 2F9UA 1XMNB 3VB5A 1KTSB 2ALVA 4FUDA 5TCAA 4Y11E 2BLVA 1ELVA 1SGNE 1SG8B 1XUJA 2G00A 1TGTA 1O3GA 2IPQX 1K1IA 1ELTA 4X6OA 2WSSD 1UVOA 1C5RA 2OC0A 2A7CA 4K1SA 1HAYB 4K8YA 2ZTXA 1GGDC 1E1RD 2GCTC 4O97A 5EODA 4FU9A 1KYNA 2A7HA 4X2WA 2HGTH 1DPOA 3MO3A 3DFJA 1LQDB 4Y0YE 1BTXA 4DT7B 2Z9GA 4OS5A 1KTTB 3RP2A 1BCUH 4D7FA 3HGPA 2BLQA 2BZAA 4Y8YA 1C5PA 4MQAA 2CF8H 4TWWA 4BTUB 5C5NA 1P04A 2OTVA 3S0NA 1MABB 2FX6A 1A0JA 4NFEA 1FAXA 3LIWA 4XD7D 1BUIA 1TALA 4UFGH 1O37A 1CGIE 1SQOA 1TOCB 5E8EH 5H4IB 2TGDA 4DJZB 1O2OA 1QA0A 2BY6X 2P93A 3O8CA 3NPSA 4CR5A 3P8OA 3T62A 3V0XA 1S6LA 1S83A 4ZKRU 4NZLA 1HAHH 1LHFH 1C9TA 1YWUA 1C4Y2 3RMMH 2KR7A 1S0RA 4FUCA 4DGJA 1VJ9U 2ILNA 3A84A 2HNTC 5FBEA 4XRNA 1K1LA 4XBCA 1OPHB 5DGJA 1E1QD 3A82A 3RC5A 1UTQA 1C5UA 1SLXB 3EDXB 1QJ7B 4Y7AA 1XUIA 5T6FA 5A2MH 1OWEA 1ESAA 3U1JB 1QQ4A 1BTPA 1SGDE 5C5OA 2NU0E 2Z9IA 2PGQB 3SJ9A 3LC3A 1SGCA 1GHAG 4YOGA 1VCPA 3GCHC 1C1OA 3HK6B 2F83A 1AHTH 4DY7B 1DUAA 2ZGHA 3RMLH 1Y3WA 1OS8A 3T5FH 1ETRH 2RDEA 1FPHH 5FPTA 3ZVEA 1NRQH 4DVAU 1ANBA 1WQSA 4GPGA 2HVXA 3SNBA 2K1QA 2NU3E 3MQKC 1GL0E 5BPEA 1TNGA 4ABHA 2F9PA 3ZVCA 2BQ7B 1LKBA 4DOQA 2WPHS 1O3JA 1EASA 3F6UH 3TH4H 1P3CA 3MYWA 3E16B 2PHBA 1AN1E 2CV3A 1BIOA 1GJ4H 3GCNA 3NUMA 2ZCHP 1CSOE 2GDEH 4CR9A 1WAYB 3SI4H 4VGCB 2PUQH 5DP6A 1O3NA 3QO6A 1GBHA 1IQLA 5E0JA 4ZKOU 5C94A 4MPVA 1QB1A 4NCYA 3QX5H 2KCAA 1EZUC 1ELFA 1C1RA 3SYJA 2D26C 1Z6EA 2AHME 1C1QA 2HRVA 4BAOB 2ZP0H 1DFPA 1ZHRA 1Y5UT 1N8OB 2K0QA 1ZTKA 1W0YH 3D49H 1GMHG 1RGQA 2LP6A 3JZ2B 3STJA 2BX3A 5FAHA 1NBMD 1O3OA 2AMQA 3PTNA 1N6XA 2B7DH 5EGMA 2JJ2D 5ESTE 1VCQA 2EI8A 3LH3A 1FUJA 3HK3B 1ZOMA 4MG3A 2ODPA 3MO9A 3RXRA 4Q80A 3DD2H 1TAWA 1HIAA 5EQRA 2PTNA 1MTUA 3S9BA 1S6FA 2OD3B 1JXPA 2W6ID 1T31A 1UCYH 4FVBA 2JH0D 3A7TA 1QURH 1BBRE 3K9XB 4B2CA 3UAIC 1DUEA 1HXFH 2BD4A 1MD8A 3TNSA 1GI0A 1TQ7B 3ZVDA 1Z1JA 1TNHA 5GCHF 1O3DA 4ABBA 1AQ7A 2KCYA 3VB6A 4CRGA 4HFPB 1UVUH 4IBLH 1SHYA 2ZQ2A 1GMCG 1V2QT 1XXDA 3RXTA 5FHTA 1ZHPA 5GJ4B 3ZVFA 4ABDA 4Y8ZA 3QUMP 1NY22 3FP6E 2XWBI 1G3CA 3CNRA 4I8GA 2AIQA 3SHCH 1PPBH 5L2ZH 2NWNA 2KCOA 3RXMA 1ZPZA 2A5IA 1HIAB 3FO8D 5C0TA 1ELCA 1TNIA 2FS8A 5F6MA 1UTNA 1YYY1 1TA2A 4FETA 4OS2A 2HLCA 5DKMA 2ZU4A 3IG6B 4AN7A 4YXWD 1L4DA 1HB0B 2P94A 2A1DB 1NROH 2YNBA 3FKSD 1XM1A 1D6WA 1FDPA 1UK4A 4LXBH 5T1VA 1KLJH 2CHAC 1LDTT 3K6YA 1AVXA 5DP3A 2A45B 2STBE 2BD7A 1A3EH 2WV5A 4X1SU 5I25A 3OX7U 3TVJB 1O2LA 4B2AA 3M3VA 1S82A 1TMBH 4AOQA 1O30A 3KCGH 1SGEE 5CDFE 2JH6D 1RFNA 1MKWH 1EFRD 2OC1A 1GJAB 4YM9A 1JBUH 3NCLA 3NK8A 4B74A 1GJ8B 3D65E 3KYGA 2F9OA 4D8NA 8GCHG 2TIOA 1SGYE 2D2DA 4BAKB 1IQHA 3QK1A 1YPJH 3U1IB 1AO5A 2EC9H 1SSXA 3LGWA 3UNRA 1O2VA 2Y80A 1C2KA 1EB1H 2ODQA 1EOJA 2A2QH 2XRCA 5B6OA 5LPEA 5ABWA 1DSTA 4TY6A 5A8YA 2WPDD 2QF3A 1ZMJA 2W6JD 2G5NA 1EZXC 3RXIA 4HG6A 4ZHMU 2VIDA 2O8LA 2UUKB 2GDDA 4AGKA 1IOEA 3OEED 4X0WU 1TFXA 3QWCH 2BDHA 1DY9A 1MUEB 2PV9B 3BTTE 1Y59T 2THFB 1RXPA 5G4BA 3UWJH 3Q3YA 1UO6A 5JBTA 3BEFB 1O32A 1PPHE 1ZGVA 3IITA 3MTYA 8ESTE 2OCVB 4WMEA 2F9VA 1CA8B 1GBAA 1K1PA 3ZZ3A 3F2FA 2B5TB 4OM9A 1XXFA 3RXAA 1CGJE 2BD2A 1OOKB 1TLDA 2G51A 2W26A 1VITG 3ZZCA 3E6PH 2GV6A 9LPRA 4JZDH 3VGCB 3UQVA 1TGCA 3RMNH 3MU4A 3NXPA 2ZECA 5C3NA 1GBFA 1HDTH 5T6DA 4ZKSU 2QF0A 2RCEA 3PWBA 3ZV9A 1O2SA 1O0DH 1UTKA 1GBJA 3QN7A 1C2LA 1FMGA 3FVFB 3JZ1B 5DPAA 3V13A 1MU8B 1O2GH 5JYIA 3AK5A 1O2PA 4K2YA 2FOBA 2NU1E 3VEQB 2B0FA 4GUXA 2ZGXH 4WXVA 1TPAE 4K5ZA 1HAZB 2W7UA 3HPTB 3A88A 3GCOA 1A0HB 1VGCB 1L1JA 1KMHB 1JIMA 1NTPA 1PYTD 1GPZA 5DP7A 1W0ZU 3F2HA 2D8WA 1G9IE 1RS0A 1SLUB 2ZU2A 3B8JA 4VGCC 1RRKA 1D3QB 2Y81A 1EAIA 3PO1B 1A3BH 7LPRA 1MTNC 2VIVA 3RDZA 2V3HH 1FI8A 5EG4A 4LZ4B 4GCHF 3M61U 1EJAA 2Y7ZA 5HYOA 1H9LB 2C8ZB 2QXGA 1FX0B 2GD4B 2P3FH 1Y3YA 1OWJA 4DT4A 2ANKH 2DE9A 3W95A 3PROA 1HCGA 2ZIQH 1AWFH 2FI3E 1TBRH 1O34A 2VIQA 4X6MA 4YOJA 1SQAA 1ETTH 1OSSA 2C90B 3H7TA 5DP5A 3ZZ5A 3H09A 3H7OA 2OUAA 2XC4A 3DHKH 1YPHC 1XX9A 5C17A 1O39A 1H8DH 3ZZ8A 3ATLA 1FIZA 3F68H 3GY2A 1NRRH 2VIPA 1GCTB 4TPYA 1IHTH 3E0NB 1J8AA 1HRTH 1V2ST 3LKWA 3KNXA 5EXLA 3QGJA 3SUFA 3VB7A 1AMHA 3BTWE 2Y5HA 1S85A 4OS7A 4Z6AH 3GS9A 3RXQA 2G5VA 4KTSA 1OWDA 4ISNA 1HBTH 2GV7A 1ABIH 2AGGX 1QB9A 3TU7H 1TE0A 1GJDB 1AFEH 5DG6A 1T8OA 4Y7BA 2XC5A 3KQBA 4X1RU 1NC6A 1OYQA 1TNLA 2R0KA 6CHAB 1KIGH 3T27A 1Z8GA 3TLOA 1SGTA 1OX1A 2ZPRA 2HOBA 3RXKA 1ZTJA 3BEIB 3ITIA 2P95A 4NIVA 4XDEA 3FOAA 2P3TB 3MO6A 3TNTA 1COWD 3Q3KA 2H9EH 3P8GA 4IS5A 4E05H 4CRFA 1P2KA 3OU0A 2BDAA 2O8MA 1C5MD 3VFEA 4AZ2B 2H5CA 2PKSB 5L6NH 3PMJA 3S7HB 1O2IA 1SL3A 5A0CA 1FIWA 1TMTH 2Y5GA 1C2HA 2BY9X 3CS7A 3SV6A 5HM9A 1MU6B 2FOEA 2Z9JA 3GDVA 2BDGA 1CGHA 1GI8B 3TPIZ 3U8RH 3KQ5A 1TX8A 1O2HA 3M35A 1CA0B 1PPFE 5CHAB 1MKXH 3U8OH 2VNTA 1TA6A 1K1MA 4ZHAA 4MDSA 3U28C 4BXWA 4BAQB 1SFQB 3GCTG 3RM2H 2SGDE 5E2OA 2HALA 2B9LA 3NWUA 2R9PA 3S69A 1P3EA 1PYTC 1K1OA 1O5FH 6LPRA 2P59A 3R0FA 1OHHD 4X8SH 1C4V2 3QZQA 2JETB 3G01A 4MNYA 1GJ6A 1L4ZA 2HNTE 4Q7YA 4WH8A 2FDAA 4J2YB 1MAXA 1W0KD 2XC0A 1A5HA 5HIZA 3MH5A 3T26A 3RLWH 1F5KU 2FPZA 2ZKSA 1E36B 4QT8C 4H6SB 1WTGH 1TRNA 4Q4LA 1MQ6A 4SGAE 3SUEA 2ZDVH 3LGVA 2ZFQH 1GJ5H 5EPYA 1QBOA 2JJ1D 3F1SB 1W3CA 1CT4E 2GCHF 3BSQA 2ZFFH 3L6PA 4MNVA 2P16A 1C2GA 3S7KB 4Y8XA 3F9EA 4Y6DA 2OINA 4ACAA 4AB8A 1CO7E 1LKAA 2EEKA 3A83A 2XBWA 1BA8B 3RXDA 4XFQA 1AY6H 3KL6A 3TK9A 5HKKD 3MOCA 2J92A 1TB6H 2QF5A 1E35B 4HZHA 1H8HD 3BTME 3W94A 3MHWU 1K1NA 1BMFD 1Z7KA 1UCYK 3V7TA 2F91A 1C1NA 4MVNA 1O2QA 1ZSLA 5K7RA 2ZU3A 3A81A 1MTSA 4D76A 3BTFE 4AGJA 5F8TA 4INKA 1VGCC 3MMGA 1RTFB 2BTCE 2R2MB 4B6FA 5DP9A 1HAGE 2BMGB 4O3TA 5A09A 2AGIX 2J94A 3GY6A 5CHBA 4UFEH 1YPEH 5KECA 3H5CB 3M3SA 1K22H 2ULLA 1DWDH 4JK6A 1B0EA 3LH1A 1WXRA 2EY4C 3UIRA 1F0UA 3GY8A 4A92A 3PV2A 3RXCA 2SGPE 2PWXA 1F92A 1LVBA 1H1BA 1BMLA 1O2KA 3MU5A 2XOKD 3MH4A 1GVLA 1A1RA 2BVSH 1IQJA 5AHGH 1WBGB 4OS6A 1LO6A 3RXGA 2Z3CA 1SGPE 2QN5T 2ZGCA 1WQVH 1KXFA 2QV1A 3DSOA 2PSXA 4DG4A 2BX4A 4AX9H 2P3UB 4FU7A 1GBCA 2FZZA 4ZXYH 1D3DB 1BTWA 3GY5A 3M7TA 1MKWK 1P9UA 1V2OT 3BIVH 3PB1E 3UPEA 1HJAB 2PUXB 1O5GH 1ZJDA 4JZFH 4LK4A 2JDID 1JWTA 1GJBB 1CBWB 1E34B 3M36A 1QNJA 1FJSA 1GDUA 2FIRH 1YGCH 2CF9H 2PGBB 1GDNA 8KME2 1EPTA 2BD8A 5C20A 1V2TT 1UHBA 3WWFA 5C0UA 3BG4B 1UTOA 2ZGBH 2FX4A 3EE0B 5A8ZA 6CHAC 2ANYA 3OY6U 2O9QA 4WH6A 4I32A 3ZIAD 1GHWH 3TGKE 1TYNA 2FOMB 2WYJA 4FUEA 4WF8A 3QTVH 1GJCB 1LHGH 2BB4A 3SZEA 3SZNA 4B2BA 3VXEH 1W0JD 4GSOA 4IC5A 4Y76A 1EP6A 1ZR0A 4U30A 1QL8A 5HM2A 1JMOH 2BDYA 2G4UA 2V7QD 1LVOA 2ZNKH 1ANCA 1P10A 1S5SA 3UTUH 5CMXH 3KF2A 2FO9A 3UFAA 4YLQH 1YPGH 1QQUA 1V2JT 1IHSH 2BZ6H 2VVUA 2AMPA 5AVDA 4X8TH 1EPTB 5F8ZA 5LH8A 1JOUB 1GHZA 3SJ8A 1NN6A 4AB9A 1G2LA 4HGCA 2TGPZ 1UVPA 4KKDA 4WXIA 1AE5A 2BD3A 1C2IA 1A5IA 1W12U 1CA0C 3A7ZA 4WVPE 1GCDA 2V3MA 4I7YH 1GI7B 3DT0H 1WUNH 2FEQH 2P8OC 2RDLA 4XBBA 2F43B 2EI7A 4BXSA 2BQ6B 4JCNA 1GHBG 4X6NA 2XTTB 3K2UA 1V2PT 4I8JA 1TQ0B 3CENA 1T8LA 2QC2A 1FY8E 3FP7E 5EU8A 3MNCA 3URDA 2ZFRH 4ASUD 3EA7A 4GAWA 1SHHB 3SU5A 2PFEA 3UOPA 1PPCE 2F9BH 1BBRH 2ZU5A 1W11U 1E37B 1O5CB 3KGPA 1NU7B 1ELEE 4JZEH 4DIHH 1P2IA 4M9FA 1AFQB 4RT1A 2HWLB 5FXLA 4U01A 1LVMA 4AFUA 1OYTH 2FLBH 1C9PA 2GKVE 2GMTB 2YMSB 3TGIE 2FOCA 1VZQH 3PRDA 5FCKA 4DW2U 1YF4A 3Q00A 2BXTH 1TX7A 3UQOA 3DFLA 1OWIA 1NBME 2VH6A 1QA7A 2JKHA 5FBIA 2VGCB 2VH0A 1QTFA 4F48B 2BQWB 2GZ7A 3M5MA 3T2NA 3RXFA 1RD3B 4A5TS 1QJ6B 5FCRA 1KXCA 4AC9A 1GHXH 1C5VA 1SFIA 4ISLA 1MAYA 2G52A 2A4GA 1AUJA 1XUKA 1YLCA 3UNQA 1T7CA 1SQTA 2QAAA 4X2XA 1C5ZB 5J4SA 4AYVB 3EA8A 5L30H 1O3HA 2QE7D 1GG6B 4UEHH 3VG8A 1C2FA 1UTPA 2PR3A 2J4IA 4NA8A 2A4OA 2WUBA 2GX4A 1O38A 2PSYA 2ZC9H 1AZZA 1HPGA 1H8ED 1B5GH 1ARCA 2IOTA 3ZZ7A 2J9NA 1C5WB 1O2NA 3GOVB 3RXEA 4B6EA 5L2YH 3ATWA 1J16A 5EJZA 2J5UA 1MTVA 1SBWA 4B73A 1YPKH 1G32B 1CE5A 2SGAA 3Q77A 3HKIB 4NIXA 1P2OA 2XBYA 3E91A 4NWKA 4DIIH 2XXLA 3RXBA 1P2QA 1QIXB 1SGFG 2ZEBA 2BYAX 2FTMA 1AGJA 2IJOB 4PROA 1ZSJA 2YMSD 3UNSA 3MWIU 3SHAH 3U69H 1GI9B 3B23B 1XKAC 3P95A 4X1NU 4K60A 2QY0B 4BAHB 4WY3A 1PFXC 5DP4A 1Z71A 3O8BA 3SV8A 2ZF0H 3ZVAA 1LTOA 1NFWA 1YPLH 2BY5X 3URCA 7GCHG 4MLFB 2UUYA 1FY1A 1YPHE 2V6NA 2A2XH 4ABEA 1DXWA 1ZPCA 4RN6A 1GHAF 3ATIA 3SV9A 1EKBB 1SVPA 3N7OA 4RKOB 3RXJA 3BV9B 3V12A 3FANA 1PQAA 5CE1A 1KXEA 1OXGA 4WMFA 1MKXK 3ZVBA 2QGRA 1Q31A 1TMUH 3PWCA 1T8MA 1GBKA 2FYRA 2NU4E 2FOHA 2EI6A 3RU4D 3RU4E 1HFDA 2XWAA 3SV2H 1WU1A 3NKKA 3SORA 1YLNA 1YY3A 1C1WH 1HAOH 5GXPA 1T32A 1MTWA 2Y7XA 3P6ZB 4IGDA 4KP0A 2AIPA 3M5OA 1BTUA 1GMDG 5EXNA 2ZU1A 1JRTA 4FUBA 2KZ4A 3M37A 2VIWA 2ZDMA 1TOMH 2GTBA 1O33A 1XUFA 1NO9H 4AFQA 4YO9A 1SGIB 2ZDNA 2WPLS 5GNDA 3LDXH 4IN2A 2BDBA 2FLRH 3RXLA 1WOFA 2H1UA 3L33A 3BN9A 1NU9A 1EAWA 2TPIZ 5T3HA 3U8TH 3TGJE 1QBVH 5FL7D 1BMMH 1Y3UA 3SI3H 2WPKS 3LPRA 4MNWA 3TJNA 3AAUA 1ELBA 2B8OH 5KGOA 2VWOA 3E8LA 3F9HA 1LHDH 1FAKH 2C8XB 1YC0A 4CBNA 2FP7B 3SNDA 1HLTH 4NA9H 5GWZA 5E0GA 1GMHF 1O2ZA 4H4FA 4NG9H 4F4OC 1EJMA 1KSNA 3OEHD 3VPKA 1LPZB 4H6TA 4Y0ZE 4Q7XA 1TNKA 3SV7A 5AF9H 4O3UA 5GDSH 2A4RA 1NFUA 2AEIH 3LOXA 4B75A 1SMFE 5J4QA 3A8DA 1S6HA 4RKJB 4CRAA 1TRYA 3BTDE 2XBVA 3OFND 3T25A 2C4FH 3GDSA 2BVRH 1AI8H 4CHAB 2YNAA 1KY9A 4IMQA 1GI3A 1LQEA 3AVZA 4UFDH 3UR6A 4OGXA 2OBOA 1HAXB 1KXAA 1O3IA 3GY7A 1T4UH 1DE7H 4U2WA 2KCPA 1GJ7B 1GMCF 1P02A 5JB8S 2AGEX 1C1VH 1EZQA 3LU9B 2YMSC 2BHGA 2ZI2H 1N8OC 1GI1A 2STAE 3PLBA 4Y71A 4JYUH 4JZ1A 1O2MA 1MMJN 1V6DA 2IJD1 1KLIH 1QRZA 2Y82A 1J17T 3SJOA 2WPIS 1BRCE 1GL1A 5JDUB 5IYTA 1A5GH 1DWEH 2BOKA 1QRXA 1MBMA 1V2KT 2GP9B 4ACBA 2QF4A 3R3GB 5EJLA 5FX6A 5ESBA 3DUXH 5JBAS 4IW4E 1CHOG 1GI4A 1W2KH 1O5DH 2Q1JA 2VVCA 1DOJA 1HYLA 3OE7D 3FAOA 1DXPA 1V2MT 3EYDA 4NWLA 2ZO3H 2CMYA 3A7VA 3WW7A 2H6MA 3SGQE 3F9GA 1ANEA 1FN6A 3RUOA 6GCHG 1T4VH 2EQNA 1O2TA 2ZHEH 3WWBA 1G36A 1P57B 1XVOA 2BXUH 1C1MA 1UVTH 2ZFTA 2OC8A 4IMZA 1C2DA 5DJ7A 1P03A 3MI4A 2ANWA 5C1UA 8GCHF 1GBEA 1GHYH 1UK2A 4ABFA 3P17H 4K69A 3RC4A 3UR9A 3ENSB 1RTKA 3FFGA 1G3BA 2ZHWH 1TWXB 1GWAA 2XCNA 4TPIZ 2WZQA 4K1EA 3ELAH 1YP9A 1PJPA 1BTYA 3MH7A 3SU2A 2BDCA 1QFKH 1DDJA 3ZZ9A 1NS3A 1C5YB 2HNTF 2OK5A 4FU8A 4MPWA 2ZA5A 3SU6A 4AYYB 5GPIB 3ZVGA 3E1XB 2VWLA 5HIYA 3ZZDA 1ZRBA 1GBTA 1W14U 4UD9H 1O3AA 3LGIA 1AZ8A 4FUJA 2KX4A 2FYQA 2BLOA 1M9UA 5EJ1A 3GDUA 5GIBA 1JRSA 2GT8A 2RA0A 2L74A 2Q6FA 3FZDA 1NM6A 3CP7A 3T29A 1VITF 1A61H 2VB0A 3GCHB 3BF6H 4F49A 1QGFA 1DSUA 3A7YA 3TITA 2WV4A 2VINA 4LZ1H 1NRSH 3UY9A 1O3MA 1UTLM 3KIDU 1SR5C 1VITH 3PRBA 1YCPM 4Q7ZA 2SGFE 2ZHQH 1LHCH 4P02A 4U32A 2L6OA 1D9IA 2BD9A 4MNXA 4NGAH 3W1EA 3EA9A 4YTAA 2CJIA 1AWHB 2H2ZA 5AFZH 3SQEE 1O2YA 2FESH 3PYHA 2A32A 3E3TA 1ELAA 2ALPA 4ZUHA 4BANB 1O3CA 2Z9LA 1E38B 3GYMA 4D9QA 4UONA 2ZTZA 3S9AA 7ESTE 1EJNA 4YESB 1BBRK 1ZYOA 3L3TA 5E2PA 3SUGA 1ANDA 3S9CA 3C27B 4UFFH 4X8VH 2OP9A 1TX6A 5DO4H 2HVYB 1RJXB 3V3MA 1W10U 4OS4A 3E90B 1P05A 2SGQE 1ZTLA 3OTPA 4F55A 1BHXF 4H42U 3A85A 4MPUA 4X2YA 4O9VA 3RXVA 3TH2H 5IK2D 1OP8A 2ZDAH 5EIYA 2M5TA 1BHXB 1GBLA 3P8FA 3VGCC 3MFJA 4Y79A 2A5AA 1G3DA 5A0BA 3A8AA 4TY7A 1OWHA 4CRDA 4O03A 4E7NA 1UTJA 5FPSA 1FONA 2BM2A 1FNIA 3ATMA 4IC6A 2C3SA 3RM0H 2KM0A 5DN6D 1QR3E 1DICA 1X7AC 2FWWA 1VJAU 1PQ7A 1L2EA 3AW0A 1HJ8A 4A1VA 4ASHA 2CXVA 2UUJB 2JIZD 2UUFB 3MU1A 1C5SA 2W3IA 1C1PA 3BIUH 5T6GA 1Y3VA 1O35A 2BY7X 1HGTH 2K8IA 2FM2A 1ID5H 4CHAC 2A5KA 1MD7A 2EA3A 1JIRA 3BTKE 4AG2A 1EAXA 4TSFD 3TH3H 4NFFA 3PO1C 2ZFPH 2AH4X 4ISHH 3K65B 4X8UH 3TJVA 1IQFA 4OS1A 1AVWA 4TT3D 4ABJA 3A80A 1V2UT 1QJ1B 2R2WU 1OKXA 2RFKC 3PM3A 1C5XB 4AFZA 1O3EA 4FVDA 5LPRA 2RA3A 2SNWA 1Z6JH 3UREA 5F03A 2BY8X 2CK3D 4NIWA 5HXFA 4ZROA 1QZ8A 4CREA 2SNVA 2ZCKP 4NSVA 4Z0KA 1WCZA 2J2UA 1YCPH 1QHRB 2A7JA 1YBWA 1TBZH 3RU4T 1BT7A 3M7QA 1GCTC 2QYIA 4YT6H 2XW9A 2A0QB 3HGNA 2V3OH
chains in the Genus database with same CATH topology
1UJ1A 1EB2A 1ABJH 4BAMB 2CHAB 1THRH 4B1TA 1TPPA 5TJXA 1TGSZ 2ZHDA 3AAVA 1GBMA 4E06H 2H9HA 1GVZA 5GCHG 1V2VT 3VXFH 3FZZA 1U6QA 2QCYA 3SU3A 1N6YA 2C8WB 3WY8A 2LNCA 3KQDA 5DK1A 5E0HA 5EW2H 2D1JA 5AFYH 3RXOA 1F0RA 1F0SA 3SNCA 1FY4A 2OQUA 3PTBA 4NA7A 3EAJA 4GHQA 1P0SH 3GCTF 1PPEE 1EP5A 4R0IA 3KN2A 2YOLA 3TK5A 1Y5BT 1SPJA 4CH2B 4I8KA 5JPMH 2FOFA 4FUFA 1J9CH 3HKJB 1C1TA 1ELDE 1BMNH 1K2I1 4NIYA 2W7SA 1O3PB 1GHVH 2UWLA 1YKTA 4GLYA 4WJG2 2PKSC 3MNSA 2H9TH 3I78A 2FMJA 2A31A 2Z9KA 3C1KA 1EQ9A 2FS9A 3GICB 3P70B 1RIWB 2FTLE 1XKBC 5SGAE 2Z3DA 1UHBB 1BJUA 5C2ZA 1TNJA 1B0FA 1IQKA 5HMAA 1K21H 2IN2A 1GBBA 5C1XA 3ZYDA 1D3TB 2IPHA 1LCYA 4AORA 5CHAC 3Q76A 1P11E 2I6SA 2G81E 2Y5FA 1BITA 1GJ9B 1MZAA 1S84A 1GVKB 1DANH 1BZXE 1HAVA 4INLA 5EPNA 3LGUA 5DP8A 3LT3A 3M3TA 4YT7H 4JK5A 4FUHA 3AW1A 3GY4A 2ASUB 2XYAA 3A8BA 1P2NA 2JETC 2ZGJA 4D7GA 3HATH 5FX5A 4ZAEA 1TPSA 4FUGA 3I77A 1B7XB 3SO3A 1IQIA 2OXSA 3BTQE 4ZH8A 2F9NA 2QIQA 1FZZA 3A7WA 1ZZZA 2J38A 3PMHB 1LPGB 3SN8A 5C67A 1BRBE 1J14A 1YM0A 1CT2E 4K8BA 3U9AH 1MTNB 4AFSA 4NSYA 2ZWLH 1QBNA 1G3EA 4WMDA 1HAVB 1BRUP 1O3KA 1C1UH 2H5DA 2V0BA 1P2JA 1Z8IB 3BG8A 2C8YB 1Y3XA 1SOTA 3QDZB 4MPXA 1INCA 2R3YA 4ZKNU 4A7IB 1S81A 1Z8JB 2F3CE 1GDQA 5IDKA 1NRNH 3KQCA 1O2RA 2VWNA 3ZZ6A 4NZQA 1VCWA 1O3BA 2VJ1A 1BTZA 3RXHA 1S0QA 1KDQA 1A4WH 2OQ5A 4TYDA 1BDAA 4A1TA 1SB1H 3D62A 4CBOA 1SGRE 1VR1H 1MBQA 1N1LA 4MTBA 5EXMA 3KEEA 8LPRA 1P01A 2V35A 2O8UA 1DITH 2QXJA 1PPGE 1D6RA 2ZDKA 4GVUA 3O8RA 2QA9E 1DT2A 1TABE 1V2WT 4I8LA 1ZGIA 1L1GA 5JBCS 4GCHG 1KXDA 3TJOA 2Z94A 4XOJA 2BLWA 2FXRA 2C93B 3SW2B 2GZ8A 1PQ5A 1HUTH 2VVVA 3LJOA 1SI5H 1T8NA 1W13U 2FI5E 1KDQB 1EOLA 3QLPH 4JYVH 3SOSA 2XNIA 4Q2KA 1GBDA 5EQSA 3SBKA 1TRMA 1ZRKA 4UE7H 1Q2WA 4SGBE 3RLYH 1PPZA 3P92A 1SC8U 2CGAA 2ZQ1A 1K1JA 1A2CH 1H4WA 2G55A 2WYGA 1UCYE 3A8CA 1V2RT 1K28D 1GI2A 2PTCE 2PW8H 1UTMA 4A1XA 1C2MA 1CU1A 1D3PB 2QXHA 5EW1H 1HJAC 1AIXH 1UK3A 2ZG0H 4ESTE 1MZDA 4ZXXH 4ZHLU 2TRMA 4ABGA 1P09A 1P12E 4KELA 3EGKH 3ZZAA 1UVSH 3SU1A 3LGYA 4IN1A 3RXPA 3UUZA 1CBWC 3SJKA 3SU4A 9ESTA 1TGNA 4DCDA 1FPCH 1O5EH 1EATA 1OP0A 3SQHE 5BRRE 3A7XA 4A6LA 2FI4E 1C5NH 3BG4C 1HAPH 1SLVB 5JB9S 4I8HA 1CHGA 1KXBA 1SOZA 1ZJKA 1G37A 1SLWB 1EZSC 2G4TA 3AASA 4I31A 2AYWA 1DWCH 4X1PU 3LJJA 1FQ3A 1GHBF 1AKSA 3ODFA 4INHA 1QY6A 2HPPH 4LOYH 1OP2A 3RXUA 3RXSA 1NESE 1O2JA 1FV9A 1WV7H 1BRAA 1MCTA 1QRWA 3TK6A 2WUCA 4BOHA 2VWMA 4ISIH 1J15A 1C4U2 2ZFSA 3QZRA 2BVXH 1ACBE 1IQNA 1F5RA 3MH6A 3GISB 1AE8H 3KQEA 1AB9B 1EAUA 3Q3XA 1V2LT 3PLPA 2GZ9A 2AFQB 1MCVA 1ZSKA 1RIWC 1W8BH 2OBQA 1ARBA 1EPTC 2NU2E 1P06A 4ABIA 1THSH 1D4PB 1DLEA 1EXFA 1IQGA 3SGBE 3QTOH 1DM4B 1P8VC 2DUCA 2KAIA 1ZHMA 2I6QA 4BTTB 1H9HE 3U98H 4KTUA 1AKSB 2FODA 5I46H 3SNEA 3ZZ4A 2Q6DA 3I29A 2LPRA 1O3LA 4GHTA 4X2VA 1P2MA 1ZPBA 1CVWH 2BOHB 7KMEH 3SU0A 1SGFA 5TCCA 4K1TA 5EQQA 1ESTA 1KLTA 1BTHH 1NZQH 4KGAA 5LPFA 1GI5A 5C1YA 3K6ZA 2TGAA 1WTHD 2FOGA 1Q3XA 1AFQC 2Y6TA 4B76A 1O2UA 2W3KA 2GMTC 4XE4A 3ZZBA 1F0TA 2O8TA 3SNAA 2KAIB 1HNEE 1ZMNA 3TIUA 4YOIA 5LGOA 1AU8A 3RC6A 4FXGH 3F9FA 1BQYA 1EUFA 5F8XA 1C2JA 3VB3A 2VGCC 1BMAA 2BD5A 2GCHG 2ZDLA 1FY3A 1XUGA 1BJVA 1L1NA 1ESBA 1QL7A 1TIOA 1GGDB 3MNXA 2GCTB 1E0FD 2W5EA 4RSPA 2CN0H 1Y8TA 1YCPK 3SGAE 3OY5U 4ISOA 2O8WA 2WINI 2FOAA 4E7RG 2TBSA 1AD8H 2J34A 1GG6C 3D23A 4X1QU 7GCHF 2SGEE 3E0PB 1TONA 1TPOA 1V3XA 1CQQA 1HAIH 2AMDA 1IAUA 3LGTA 1O36A 4YZUA 3RMOH 4BNRA 3BTGE 2Q6GA 2RG3A 1GBIA 5HGGA 4UDWH 4JYTA 1ETSH 2TGTA 3M5NA 4HI3A 2A4QA 3QGNB 1FXYA 3ATKA 1PQ8A 1YLDA 4OGYA 1Y5AT 3VB4A 1DY8A 3UWIA 1O31A 1QCPA 2BDIA 3ESTA 2XCFA 4M7GA 2VU8E 4Y10E 2G8TA 1LHEH 2XBXA 3PV4A 4XBDA 1TGBA 2ESTE 3TJUA 2ZPQA 5PTPA 4YLUA 1BOQA 1RTLA 3P8NA 1Z1IA 1NFYA 1GMDF 2R0LA 2ZZUH 1DS2E 2WPMS 1H8IH 1ZLRA 3OYPA 2Z3EA 2JH5D 4XSKU 4CRBA 4DURA 1FY5A 1IQEA 3BTHE 4HTCH 1ZMLA 1W7GH 4WWYA 6ESTA 1A0LA 2UWPA 1G30B 4JZIA 1YPMH 2ODYB 1F7ZA 3A87A 3KHVA 3M5LA 1NPMA 2ZPSA 2ZHFH 3DA9B 2Z7FE 2Z6BD 1H9IE 1C2EA 3CS0A 1LVYA 1HJ9A 1P9SA 1HXEH 4R8TB 1C5QA 5FPYA 4ABAA 3PMBB 1QL9A 1O5BB 5K0HA 1C5TA 1K9OE 1FLEE 2PKAA 3GY3A 5A0AE 4D9RA 2GVFA 3NZIA 4JMYA 2P8OB 4X6PA 1DVAH 1A7SA 1TBQH 1CT0E 2HPQH 1OWKA 1C5LH 5ETXA 2R3UA 1O5AB 3BTEE 3MU8A 1DX5M 4CH8B 1A46H 1F5LA 3A89A 3MU0A 2PLXA 2SFAA 1BB0B 2J95A 2VIOA 2UWOA 3EQ0H 1AUTC 3BEUA 2GT7A 3A86A 1WYKA 3STIA 4TWYA 1AB9C 4J1YA 2QXIA 1O2WA 2ANMH 3LC5A 1AVGH 1C1SA 1XUHA 1HV7A 3O8DA 3B9FH 1WSSH 2PKAB 1ELGA 4FUIA 1LPKB 1LMWB 4THNH 1THPB 1NT1A 2GGVB 3ZV8A 1XVMA 1V2NT 5JBBS 1NRPH 4K3JA 5EOKA 3PMAB 1G2MA 1NFXA 1UMAH 3GYLB 4CRCA 3OTJE 1EX3A 3IWMA 3OSYA 1Z8RA 3LONA 4KTCA 1O3FA 4I33A 1CHOF 2WPJS 1O2XA 4ZMAH 3UOUA 2ZCLP 3M7UA 1L0ZA 2DE8A 3PLKA 3SUDA 1F2SE 3ODDA 3MNBA 3SJIA 1MH0A 4B71A 1C5OH 3ZYEA 4AG1A 6GCHF 1MQ5A 1FN8A 2AS9A 1ORFA 2OLGA 1IQMA 1W7XH 1QB6A 1GI6A 1DWBH 4BTIB 2OC7A 1DLKB 1SGQE 5A8XA 3T28A 2ZTYA 3FP8E 2AERH 2F9UA 1XMNB 3VB5A 1KTSB 2ALVA 4FUDA 5TCAA 4Y11E 2BLVA 1ELVA 1SGNE 1SG8B 1XUJA 2G00A 1TGTA 1O3GA 1K1IA 1ELTA 4X6OA 1UVOA 1C5RA 2OC0A 2A7CA 4K1SA 1HAYB 4K8YA 2ZTXA 1GGDC 2GCTC 4O97A 5EODA 4FU9A 1KYNA 2A7HA 4X2WA 2HGTH 1DPOA 3MO3A 3DFJA 1LQDB 4Y0YE 1BTXA 4DT7B 2Z9GA 4OS5A 1KTTB 3RP2A 1BCUH 4D7FA 3HGPA 2BLQA 2BZAA 4Y8YA 1C5PA 4MQAA 2CF8H 4TWWA 4BTUB 5C5NA 1P04A 2OTVA 3S0NA 2FX6A 1A0JA 4NFEA 1FAXA 3LIWA 1BUIA 1TALA 4UFGH 1O37A 1CGIE 1SQOA 1TOCB 5E8EH 5H4IB 2TGDA 4DJZB 1O2OA 1QA0A 2BY6X 2P93A 3O8CA 3NPSA 4CR5A 3P8OA 3T62A 3V0XA 1S83A 4ZKRU 4NZLA 1HAHH 1LHFH 1C9TA 1C4Y2 3RMMH 1S0RA 4FUCA 4DGJA 1VJ9U 2ILNA 3A84A 2HNTC 5FBEA 1K1LA 4XBCA 1OPHB 5DGJA 3A82A 3RC5A 1UTQA 1C5UA 1SLXB 3EDXB 1QJ7B 4Y7AA 1XUIA 5T6FA 5A2MH 1OWEA 1ESAA 3U1JB 1QQ4A 1BTPA 1SGDE 5C5OA 2NU0E 2Z9IA 2PGQB 3SJ9A 3LC3A 1SGCA 1GHAG 4YOGA 1VCPA 3GCHC 1C1OA 3HK6B 2F83A 1AHTH 4DY7B 1DUAA 2ZGHA 3RMLH 1Y3WA 1OS8A 3T5FH 1ETRH 1FPHH 5FPTA 3ZVEA 1NRQH 4DVAU 1ANBA 1WQSA 4GPGA 2HVXA 3SNBA 2K1QA 2NU3E 1GL0E 5BPEA 1TNGA 4ABHA 2F9PA 3ZVCA 2BQ7B 1LKBA 4DOQA 2WPHS 1O3JA 1EASA 3F6UH 3TH4H 1P3CA 3MYWA 3E16B 2PHBA 1AN1E 2CV3A 1BIOA 1GJ4H 3GCNA 3NUMA 2ZCHP 1CSOE 2GDEH 4CR9A 1WAYB 3SI4H 4VGCB 2PUQH 5DP6A 1O3NA 3QO6A 1GBHA 1IQLA 5E0JA 4ZKOU 4MPVA 1QB1A 4NCYA 3QX5H 1EZUC 1ELFA 1C1RA 2D26C 1Z6EA 1C1QA 2HRVA 4BAOB 2ZP0H 1DFPA 1ZHRA 1Y5UT 1N8OB 1ZTKA 1W0YH 3D49H 1GMHG 1RGQA 3JZ2B 3STJA 2BX3A 5FAHA 1O3OA 2AMQA 3PTNA 1N6XA 2B7DH 5EGMA 5ESTE 1VCQA 2EI8A 3LH3A 1FUJA 3HK3B 1ZOMA 4MG3A 2ODPA 3MO9A 3RXRA 4Q80A 3DD2H 1TAWA 1HIAA 5EQRA 2PTNA 1MTUA 3S9BA 1S6FA 2OD3B 1JXPA 1T31A 1UCYH 4FVBA 2JH0D 3A7TA 1QURH 1BBRE 3K9XB 4B2CA 1DUEA 1HXFH 2BD4A 1MD8A 3TNSA 1GI0A 1TQ7B 3ZVDA 1Z1JA 1TNHA 5GCHF 1O3DA 4ABBA 1AQ7A 3VB6A 4CRGA 4HFPB 1UVUH 4IBLH 1SHYA 2ZQ2A 1GMCG 1V2QT 1XXDA 3RXTA 5FHTA 1ZHPA 5GJ4B 3ZVFA 4ABDA 4Y8ZA 3QUMP 1NY22 3FP6E 2XWBI 1G3CA 4I8GA 2AIQA 3SHCH 1PPBH 5L2ZH 2NWNA 3RXMA 1ZPZA 2A5IA 1HIAB 1ELCA 1TNIA 2FS8A 5F6MA 1UTNA 1YYY1 1TA2A 4OS2A 2HLCA 5DKMA 2ZU4A 3IG6B 4AN7A 1L4DA 1HB0B 2P94A 2A1DB 1NROH 2YNBA 1XM1A 1D6WA 1FDPA 1UK4A 4LXBH 1KLJH 2CHAC 1LDTT 3K6YA 1AVXA 5DP3A 2A45B 2STBE 2BD7A 1A3EH 2WV5A 4X1SU 5I25A 3OX7U 3TVJB 1O2LA 4B2AA 3M3VA 1S82A 1TMBH 4AOQA 1O30A 3KCGH 1SGEE 2JH6D 1RFNA 1MKWH 2OC1A 1GJAB 4YM9A 1JBUH 3NCLA 3NK8A 4B74A 1GJ8B 3D65E 2F9OA 4D8NA 8GCHG 2TIOA 1SGYE 2D2DA 4BAKB 1IQHA 3QK1A 1YPJH 3U1IB 1AO5A 2EC9H 1SSXA 3LGWA 3UNRA 1O2VA 2Y80A 1C2KA 1EB1H 2ODQA 1EOJA 2A2QH 2XRCA 5B6OA 5LPEA 5ABWA 1DSTA 4TY6A 5A8YA 2QF3A 1ZMJA 2G5NA 1EZXC 3RXIA 4ZHMU 2VIDA 2O8LA 2UUKB 2GDDA 4AGKA 1IOEA 4X0WU 1TFXA 3QWCH 2BDHA 1DY9A 1MUEB 2PV9B 3BTTE 1Y59T 2THFB 1RXPA 5G4BA 3UWJH 3Q3YA 1UO6A 5JBTA 3BEFB 1O32A 1PPHE 1ZGVA 3IITA 3MTYA 8ESTE 2OCVB 4WMEA 2F9VA 1CA8B 1GBAA 1K1PA 3ZZ3A 2B5TB 1XXFA 3RXAA 1CGJE 2BD2A 1OOKB 1TLDA 2G51A 2W26A 1VITG 3ZZCA 3E6PH 2GV6A 9LPRA 4JZDH 3VGCB 3UQVA 1TGCA 3RMNH 3MU4A 3NXPA 2ZECA 5C3NA 1GBFA 1HDTH 5T6DA 4ZKSU 2QF0A 2RCEA 3PWBA 3ZV9A 1O2SA 1O0DH 1UTKA 1GBJA 3QN7A 1C2LA 1FMGA 3FVFB 3JZ1B 5DPAA 3V13A 1MU8B 1O2GH 5JYIA 1O2PA 4K2YA 2FOBA 2NU1E 3VEQB 2B0FA 4GUXA