3UOPA

Bovine trypsin variant x(triplephe227) in complex with small molecule inhibitor
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGFYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
publication title Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
pubmed doi rcsb
source organism Bos taurus
total genus 51
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3uopA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3uopA02
1P2QA 2Y5HA 2F9OA 4O3TA 1DWEH 2HVXA 1H9LB 1ZPCA 3G01A 1XXFA 1CGIE 2ZTYA 4LXBH 4X1NU 1ZTLA 2AIPA 2FS9A 4BOHA 2ZGJA 1DICA 1PJPA 4X0WU 5FPYA 1O3KA 1MZDA 2TIOA 1SGQE 1EP5A 1MKWK 5EU8A 1RFNA 1FZZA 1GI8B 2TPIZ 4D9QA 4NGAH 1Z8JB 3ZVDA 2Y80A 1P02A 1V2PT 2TGTA 2QXGA 3FP8E 4Y6DA 4WJG2 1A1RA 3SBKA 1IQJA 1Y3UA 1BRBE 3BTDE 5EQQA 1UK2A 1TA6A 5J4SA 1YF4A 1LVBA 2EEKA 5FX6A 3V0XA 4OGXA 3U69H 2BQ6B 2OD3B 4XE4A 3RLYH 3BTWE 1HRTH 2J94A 1TRYA 1Y3WA 1ZZZA 1J15A 4K2YA 2AMDA 1KSNA 2ZCLP 5E2OA 1CBWB 1BTZA 3MU4A 2XBWA 1O2SA 3C27B 1MQ5A 1O2TA 1W14U 2EI7A 5DG6A 2C8YB 2F91A 1O3JA 1O2XA 1ACBE 3SU1A 4GPGA 1ARBA 3MU1A 1TGCA 2THFB 1RGQA 4GSOA 2UWPA 4IC6A 1BJVA 2OTVA 1GG6C 1DY9A 1P2NA 2ZG0H 3GY6A 3LOXA 1EJMA 3I77A 2HNTE 3RMMH 5GWZA 4Q7ZA 1OP8A 2LPRA 3HKIB 5CHAB 1PFXC 1UTPA 2ZFFH 1P04A 1GHBF 3GDVA 1EX3A 1SLWB 3LGUA 3A85A 2ZCHP 4B76A 4X6NA 2BD2A 3MYWA 3QGNB 4H6SB 1QRWA 3BTQE 1SQAA 3GCTG 1P09A 3LGTA 2ZEBA 1OP0A 1GHBG 5GJ4B 3ESTA 1PPBH 1NZQH 4F49A 1V2OT 2C8XB 3MHWU 3LIWA 3MO6A 1QL9A 1V2VT 3ENSB 4BAOB 1BTUA 2VIPA 1K22H 2ZNKH 3HATH 2ZHQH 2ZI2H 1P01A 1OPHB 1AE8H 3P92A 3PTBA 3URDA 1PPEE 3A7ZA 1RD3B 1MTVA 1DLKB 3UTUH 1YPJH 1OSSA 1W10U 1WTGH 3CP7A 1EAUA 5DP6A 1W12U 3QGJA 3GCOA 5HM9A 3JZ1B 3PROA 3ZZ9A 2HWLB 1WU1A 3UY9A 2G81E 4JK5A 1SOZA 4YOGA 3A7TA 3UNSA 3MNCA 1F7ZA 2ZECA 3A84A 3TIUA 3RMOH 3SUGA 3MH4A 4K69A 1ELDE 2Z9GA 4UFGH 4NG9H 1CHOF 4BTUB 1BMLA 1LKBA 2A4OA 1X7AC 1S82A 3PTNA 3A7XA 1V2NT 3Q3YA 1GMDF 2LNCA 4IC5A 1SGNE 5FHTA 3U8TH 3IWMA 2AGEX 1TQ0B 2IJOB 2ZU3A 4GHQA 1CHOG 2ZDNA 4VGCB 3SV8A 3F9GA 1C9PA 4U32A 4YM9A 2VGCB 4Q7YA 1GMDG 3SHAH 1P8VC 1NTPA 1DM4B 3RXJA 5E0HA 2JKHA 5I46H 2V3OH 3SV2H 1SLXB 5JDUB 1AU8A 1CU1A 1PPFE 3DD2H 3FZZA 1SFQB 4B2BA 2PKAB 2SGEE 2UUFB 3RXUA 1DFPA 1ZLRA 1UO6A 1OKXA 3E90B 4Y8XA 2CV3A 3M5MA 1TMUH 3DHKH 4FUCA 4A5TS 2DUCA 3V3MA 1C2DA 1LHDH 1EOJA 2A5IA 1Y3VA 2AERH 2P93A 3ELAH 3RXIA 4XBDA 1GCDA 3EGKH 1KXBA 1ZSJA 2D2DA 3QUMP 2GP9B 4B75A 1P3EA 4UFDH 1FAKH 4GUXA 4X6OA 2P3TB 3ITIA 3UNQA 1C2MA 4A7IB 2H9EH 1A4WH 1DUEA 3LU9B 2PUQH 1CHGA 1RIWB 1NROH 4RKJB 3CENA 5FBIA 2B0FA 2BDCA 1JIRA 1C2IA 1W0YH 1SLVB 2J34A 4DIHH 6CHAB 4WH8A 3TK6A 3VB5A 1F2SE 1B0EA 4CBNA 5C3NA 1J9CH 2QAAA 3SZNA 1GCTC 5EQSA 1GI7B 3M3TA 4X2WA 3HK3B 1HCGA 1KTSB 1QQ4A 3ZVGA 2XNIA 4YO9A 3AVZA 1O2WA 4Y10E 3STIA 3ZZAA 1AO5A 3BTHE 1AVXA 2UUKB 2VINA 3JZ2B 1ETTH 4U2WA 1YLCA 3QX5H 1AKSA 2ZC9H 3DT0H 5K0HA 4MNWA 7KMEH 4Y8YA 3K2UA 2BB4A 3S69A 1GJAB 1NC6A 5EG4A 4OGYA 4NA8A 5T6DA 4ZHMU 3PMJA 1O32A 3BEUA 4TY6A 4X8UH 1KXDA 1OP2A 1ANEA 1MH0A 3UIRA 2P16A 1YPMH 4B71A 2R9PA 2Y82A 1GJ7B 3E0PB 1O31A 1P05A 1TFXA 1ZOMA 3ZYEA 4HZHA 2A5AA 3BV9B 4ISHH 2O8TA 2H9TH 1CT0E 2BOHB 2Y7ZA 1MCVA 4E7NA 4IMQA 1FJSA 1G2MA 4KKDA 1OXGA 1GVKB 1AD8H 4WMEA 5H4IB 1O2MA 1NU7B 1CGHA 3QWCH 1O5EH 2A4RA 7ESTE 4MG3A 1HAPH 3VGCC 2QA9E 4JYTA 1S84A 6ESTA 1LPZB 1NY22 3MNSA 1XVOA 3RXMA 3AW1A 1CA8B 2QXJA 4HTCH 1HAVA 2OBOA 1JXPA 3QO6A 1SQTA 4BTIB 4X1PU 2R0LA 1S85A 1PYTD 5FBEA 2PGBB 4ZKNU 1THSH 1THRH 3RXDA 5A8ZA 2J95A 3T2NA 1ZGIA 3TJNA 1F0TA 5A0BA 4IW4E 3GY4A 3SNDA 1CT2E 3VEQB 5EGMA 4CRBA 3MNBA 3RXGA 2FTMA 1UMAH 1D6RA 1GVZA 2BLWA 2FOAA 3P70B 5EXNA 1C4U2 3ZZ5A 4I8KA 1ESBA 3ZVBA 3ZZBA 1GBIA 2J2UA 4ISNA 2GGVB 2F9BH 5AHGH 1C5QA 4TPYA 1O37A 1W7XH 1N8OB 2QV1A 3FANA 2WUCA 1V6DA 1P2KA 2FXRA 4AGKA 3KL6A 1GBTA 1JMOH 1OOKB 2ZGBH 1YM0A 1ETRH 1DPOA 3GICB 2RCEA 2ZKSA 1E38B 4NIXA 1MTNB 2QCYA 4Z0KA 4DGJA 1HB0B 2OC0A 3SV6A 5AFYH 1EKBB 3SUEA 3KQBA 1UTLM 2O8LA 4ISOA 3O8RA 2FOBA 1O3HA 3BIVH 1GGDC 1RJXB 3M7UA 2ZHDA 3MMGA 1AN1E 4NA9H 2VIVA 2OP9A 1W8BH 3GY8A 3PLBA 2VIQA 2Z7FE 2BQWB 1L4ZA 5DK1A 4DOQA 1BTWA 2WPLS 5JYIA 2RA3A 4NFFA 3E3TA 1K1OA 1KDQB 2ZDKA 1YPHC 5FAHA 1T8LA 1GHXH 2FP7B 1GI2A 3A87A 1BTYA 2WPIS 1P06A 5FX5A 1MD7A 1TONA 2BYAX 1IQMA 4TYDA 5HYOA 5CE1A 4AG1A 2FOCA 3IITA 1A5HA 4JYUH 1QA7A 3F9HA 2TGPZ 1V2MT 2ODQA 3MU5A 3SNBA 4FUGA 1D9IA 2Y7XA 1L0ZA 4I32A 5I25A 1GHWH 2VIWA 1G36A 2Z6BD 1C5MD 5LPFA 3UNRA 1D3DB 3GDSA 1HXEH 4NZQA 1F0SA 3M35A 3LGVA 4JZ1A 5T6FA 4CR9A 3M7QA 3K6ZA 3L6PA 5PTPA 1O2UA 1A0HB 1HAGE 1GJCB 3AW0A 2SNVA 1GJ6A 3PO1B 3ZVFA 5E0JA 1G3CA 3URCA 2BD8A 3MI4A 1IQLA 1DLEA 2PSYA 1AWFH 4KELA 3UFAA 2BD4A 4CBOA 1HAHH 1G3EA 4WMDA 4XBCA 5F8TA 5C2ZA 1TNGA 2BDIA 3OX7U 3A8DA 1MD8A 3KNXA 2BZ6H 1T8OA 2QGRA 1QQUA 1ELEE 2W5EA 2C93B 2R3UA 2A0QB 1A2CH 2BM2A 2BY9X 1HFDA 3PWBA 2WPHS 1UVPA 5C5NA 1NPMA 1MBQA 4DIIH 2IOTA 2ALPA 2WYGA 2QN5T 1QB9A 4CRDA 4AYYB 2NWNA 1UTQA 1GBFA 1ANBA 1EATA 3LKWA 4ASHA 3TGIE 1FDPA 1EUFA 3FZDA 2BXTH 1TGBA 2CMYA 3ZV9A 4AFZA 1Z8IB 3TH4H 2HNTC 3SV9A 1MQ6A 2QY0B 2HPPH 5DO4H 3QTOH 3HPTB 5B6OA 3UR9A 2Q6DA 1OWHA 2J4IA 1GVLA 1P2IA 4Z6AH 1AQ7A 1JRSA 1B7XB 5C67A 3KCGH 2A5KA 1DITH 5EPYA 1MCTA 1P12E 1T8MA 3RXCA 5GDSH 1BRCE 4MQAA 4AN7A 1A5IA 1AMHA 2F3CE 3E0NB 2GCTC 3Q77A 2OUAA 3SJOA 2C8WB 2AS9A 2JETC 1SGIB 3SN8A 3GY5A 4J1YA 1GDNA 4FU8A 5T6GA 4BAKB 2W26A 4FVBA 1Y3YA 3NKKA 4JK6A 1F5KU 3RU4T 1TPPA 1FY1A 1BJUA 1E36B 2W3IA 1HJ9A 3TGKE 1V2JT 5L2ZH 3V12A 5EPNA 5A0AE 1GMHF 2G5VA 4WF8A 3H7TA 1HPGA 4RSPA 2A7HA 1EJAA 1GHAF 1OWDA 3M37A 3PWCA 3LC5A 4MDSA 2AGIX 1YPKH 2OINA 4X1SU 3TNSA 2BX4A 1LCYA 2ULLA 2FI4E 3SOSA 5C1YA 1GMHG 1J16A 2RDLA 5C1UA 8GCHF 2BX3A 2NU1E 1GHAG 1Q3XA 3SGQE 1TB6H 5TCCA 3ZZ3A 3AASA 1XX9A 3MH7A 3ZVEA 5ESBA 4LOYH 1KXCA 1ORFA 1PQ5A 1Y59T 1GBLA 2OLGA 4ABJA 5LPRA 3GY7A 3SU2A 5JBTA 2BD3A 3T26A 4GHTA 8GCHG 5DP7A 4DVAU 1N6XA 4TWWA 1CGJE 1IQNA 1O3CA 4X8VH 1OX1A 1OYQA 2VVUA 1GWAA 1QBVH 1KTTB 4MPXA 5FCRA 2RA0A 4THNH 4A1VA 1HJAC 3EA7A 3SU0A 1K9OE 3A7YA 1CA0B 3LH3A 1CE5A 3NUMA 3GCTF 1ZTJA 4ABDA 1HIAB 2P59A 3QLPH 2BZAA 3ODFA 2WPKS 1VJAU 2XBXA 1TQ7B 3BTKE 3TK9A 1MBMA 4JMYA 2XC0A 1LVMA 1T8NA 1WV7H 1MKXK 1ELBA 1T32A 1P9SA 2TGAA 2XC4A 4OS7A 4JZFH 1P57B 3KF2A 2STBE 1C5WB 1AHTH 1FY4A 2FOGA 3P8GA 2PHBA 1O2VA 2O8WA 4X1QU 3BG4B 2SGQE 3UPEA 1SL3A 1FUJA 3SUDA 4F4OC 3LC3A 1FQ3A 4YOIA 2Z3EA 2VNTA 3KQCA 5LPEA 2VWOA 2GDDA 2RG3A 1OWKA 2TRMA 3ZZCA 2FODA 3ATWA 3M5OA 3SNAA 3UOUA 3ZZ8A 1GI9B 3MWIU 2V35A 3RMNH 3PM3A 4CHAB 2VVCA 1U6QA 2QIQA 5EOKA 1MMJN 1GBBA 3MNXA 4R8TB 1JBUH 4Y0ZE 4B74A 1DOJA 4K8YA 2D1JA 1CBWC 1H9HE 3MTYA 3S9AA 1INCA 2A2QH 4YZUA 1XKBC 2GMTB 4UONA 1C4V2 3S0NA 2AEIH 4X2VA 1PPZA 3P6ZB 2R0KA 3TGJE 4FUHA 1SGEE 2ZFRH 1FV9A 2D26C 1DWDH 4IS5A 2VIOA 1SVPA 3A88A 1NS3A 2R3YA 2Z9KA 1OWEA 3R3GB 1DWBH 3U1JB 3RXPA 2CN0H 1KXAA 2Y5GA 1F0UA 4UEHH 3T5FH 1V2WT 3B8JA 1N6YA 5CHAC 1SGYE 1EPTB 3LPRA 4DG4A 4JYVH 1H8IH 3UWJH 3RXQA 3ZVCA 1V2ST 2ZP0H 1ELGA 1UVTH 1YCPH 4JZDH 1IQIA 2WV5A 2GKVE 1K1LA 1S6HA 3W95A 1ZHPA 5FPTA 1UHBB 3K6YA 2ZZUH 1EOLA 1SGFG 2B5TB 1C1PA 4A1XA 3SQEE 2O8UA 3TLOA 4O9VA 1QL8A 5FXLA 3SV7A 1C9TA 1EZXC 4FU7A 2A45B 3KHVA 3GDUA 4B2AA 2PKSB 3E91A 1JIMA 2VH0A 2F83A 3LONA 1A61H 1SSXA 1WUNH 1YYY1 1TLDA 1BOQA 1RXPA 2CF9H 3F6UH 1A0JA 1G3BA 1HAOH 3RC5A 3RXKA 1DY8A 3NWUA 4ZHAA 1LTOA 3F9EA 3EA8A 3GYLB 1O2RA 4O97A 1EAXA 4ZKRU 3QZQA 4JZIA 2CHAB 4GLYA 1VJ9U 3RP2A 3PLPA 1G2LA 2BY6X 2XBYA 1DT2A 2Q6GA 1B0FA 2FESH 3VXFH 4AB8A 2G55A 3M5LA 2VH6A 1B5GH 2QF0A 2P3FH 1BRAA 1LKAA 1MTUA 2GX4A 4FUEA 3T25A 2OQ5A 5A2MH 1EASA 2ZU2A 1EXFA 1Q2WA 4SGBE 1MU8B 1KXEA 2P94A 1ABJH 1D3QB 2CF8H 4VGCC 5K7RA 4BXWA 4K5ZA 1BQYA 1S83A 2J38A 2VGCC 1TAWA 1IQKA 2H9HA 4FUIA 1AUTC 1O3EA 1O2KA 2FI3E 3FFGA 3HK6B 1OYTH 5A8YA 3VB6A 2R2MB 2ZWLH 2OCVB 1O34A 1FY5A 1O2YA 2F9VA 1C5VA 3RC6A 5AFZH 1V2UT 1SBWA 2ILNA 1SGTA 4I8GA 1ZPZA 2KAIB 5SGAE 1AFQB 1O3BA 1BB0B 5DJ7A 5DPAA 2IPHA 2WV4A 4D76A 4O3UA 4U01A 3A81A 3R0FA 3SO3A 1SLUB 3TNTA 1QJ7B 1C1OA 1QNJA 1AZ8A 1BBRH 3HGPA 3PMHB 3VFEA 5JBBS 7GCHF 4ZAEA 4H4FA 2AGGX 2PKSC 2G00A 3RXSA 1P11E 1S6FA 4K60A 1O33A 3O8BA 1O2NA 1ANCA 1O3OA 3O8DA 2XBVA 4YLQH 1ZHMA 1O2IA 4I33A 4WMFA 4R0IA 7GCHG 1A0LA 3RXOA 4ZUHA 3A8BA 1E0FD 1RIWC 2ZF0H 2ZU5A 1NM6A 4J2YB 1JWTA 2ZU1A 2GDEH 3AAUA 1VCQA 6CHAC 3TJUA 1O30A 1Y8TA 2CHAC 1NFWA 3UOPA 3WY8A 4WVPE 4K1EA 1C5LH 4ISLA 4E06H 1XUHA 1BZXE 2BDGA 1K1PA 1ELAA 4DT7B 3BTME 3V13A 3PMAB 4Q7XA 3SJIA 1TPOA 1AWHB 2Z3DA 4YLUA 3KN2A 1NRQH 2OQUA 1AUJA 1KLIH 4YT6H 1GJ8B 2JH5D 8KME2 5TJXA 1P9UA 2ZFQH 5A8XA 1ZMLA 2PWXA 5DP8A 4A1TA 2BVRH 3PV4A 4XDEA 1EZSC 3QK1A 1G3DA 1C5YB 2FLBH 4Y7AA 4A6LA 1Z8GA 1TPAE 3ODDA 1QHRB 1VITH 3MO3A 4FUDA 4GCHF 1K1NA 2G5NA 1H8DH 2BD7A 3E16B 3GY2A 4E7RG 2OBQA 3DUXH 1GBHA 1A5GH 4AOQA 1IQEA 2CJIA 4ZMAH 5GPIB 2SGPE 3OY5U 1TWXB 3BTGE 4ZKSU 1BMNH 3SGBE 4GCHG 5F6MA 4ESTE 3A8CA 5EQRA 5EXLA 2B7DH 1KY9A 1KIGH 4KTSA 3RXAA 1GI6A 4CR5A 1GL0E 2ZCKP 2P8OB 1E37B 1FONA 3PMBB 1AZZA 2NU0E 1ELTA 1OWIA 2GZ8A 4O03A 5JBCS 1UTNA 1BMMH 1J14A 1O3PB 4KP0A 1VCPA 1G32B 4OS6A 3A83A 3PLKA 3D62A 1V2QT 3GCHB 3A8AA 3EYDA 1O0DH 2Z3CA 1UVSH 2PGQB 1TRNA 1IOEA 1QBNA 2FOFA 4JZEH 4ZH8A 2WINI 3GCNA 3Q3XA 4ABGA 3NZIA 3UQOA 2HALA 2R2WU 4NA7A 2ESTE 5F8XA 4CH2B 1RTFB 5EW2H 2WPMS 3TH2H 1XUGA 1QB1A 1K21H 5EODA 3ZZ4A 4BAQB 1GBAA 3E6PH 4AFUA 2ZO3H 3RM0H 1FPHH 2GZ7A 4DCDA 4FUJA 1NRNH 4IGDA 1TNLA 2HOBA 4OS4A 1LVOA 1GBMA 1ZSLA 2I6QA 3GOVB 1QB6A 1C2EA 4I7YH 2BVXH 3BEFB 4NWKA 1QY6A 2VIDA 5C1XA 1O3LA 1VGCB 3A80A 1IQFA 1AVWA 1QA0A 1N8OC 3BEIB 1TGTA 2QC2A 2BDBA 4DJZB 5LH8A 1C5TA 1XUKA 1ELCA 4HFPB 3OSYA 1S0QA 4FVDA 5F8ZA 2QXIA 1YC0A 2BDAA 4NFEA 4WXVA 4KTCA 1VCWA 5IYTA 5E0GA 3VPKA 4ABBA 1SOTA 2EA3A 5CMXH 2K1QA 3M61U 3RC4A 1MTNC 1MKWH 3NCLA 3SHCH 2PKAA 1HAZB 2A31A 3E8LA 3TH3H 1HAXB 1TGNA 3A7VA 3BIUH 2A7CA 3RXRA 1HJ8A 2ODYB 1G30B 2F9PA 2YOLA 2DE8A 3DA9B 3SORA 2VB0A 2Z9IA 3MU0A 1SQOA 1KXFA 3A82A 1JRTA 1Z8RA 2BY5X 2PTNA 2VJ1A 3NPSA 1V2RT 1C1WH 2FIRH 3U9AH 2Z9LA 2FDAA 3T62A 4D9RA 1T31A 1EAIA 4IN1A 2ZPQA 3H7OA 3LH1A 3EAJA 1NFUA 1TRMA 2BLOA 2Y81A 4AFQA 2PLXA 1DSUA 2ZPRA 1O3FA 3TPIZ 1D6WA 3P8OA 2ZTXA 3LGWA 3PYHA 1TBZH 3LGIA 1JOUB 1QURH 2OC1A 2B9LA 4INLA 3D49H 1C5PA 1O3DA 4DY7B 1ANDA 1TOMH 4XOJA 4NIWA 2C8ZB 3T27A 4XFQA 1M9UA 1YBWA 3RU4E 1SGCA 1WSSH 2AMPA 4CRAA 4I8JA 4MPUA 5DKMA 2BLVA 2H2ZA 4WY3A 4DURA 1DWCH 1WTHD 4QT8C 1G9IE 5EW1H 1ZRKA 4MNXA 3SNCA 1IQGA 6GCHF 1Y3XA 2BVSH 1HUTH 1VITF 1GI1A 1O2OA 1NU9A 2ZFTA 3ZV8A 2ASUB 2G4UA 3EE0B 1SHYA 3TK5A 3V7TA 2FM2A 1UCYH 4H6TA 2VWMA 2ODPA 1TGSZ 1YP9A 3OY6U 3ATKA 6GCHG 2GZ9A 2M5TA 3LDXH 1TPSA 1VITG 2FPZA 5DP4A 1BITA 2VVVA 3BSQA 2JH6D 1QFKH 4LZ4B 2J9NA 5JB8S 1C5ZB 4B1TA 4UE7H 5L6NH 1V2LT 1SMFE 1Z6JH 3M36A 1Z1IA 1HGTH 1DXWA 1Z1JA 1K1MA 1K2I1 1OWJA 2C4FH 2STAE 1SGFA 3AAVA 1UTOA 1AKSB 4ABFA 1PPGE 3PO1C 2H5DA 4INHA 1GG6B 2P3UB 1T4UH 3RM2H 4K1SA 4X2YA 3N7OA 1MTWA 1GI0A 2EI6A 1DSTA 1C5SA 1FNIA 4LK4A 1GBCA 3RXHA 1ZJKA 1TALA 1XUIA 1QIXB 3F1SB 1LQEA 1P2JA 1KYNA 2H5CA 2WUBA 1EB2A 4YTAA 2FOEA 2TBSA 3RXLA 4Q80A 4TPIZ 2ZDLA 1GHZA 3F68H 1Y5BT 2FZZA 4ZKOU 2O9QA 3MO9A 1CVWH 3SI3H 1SGDE 2YNAA 1TBQH 1O5FH 2F9UA 4RN6A 4FXGH 2ANMH 3L3TA 4M7GA 4BAMB 1J17T 3UWIA 1XKAC 4INKA 1ZMJA 1DE7H 2FOHA 1GL1A 1O2ZA 3C1KA 2GT7A 1EQ9A 1EP6A 4D7GA 1RS0A 1SGRE 1SFIA 1SC8U 3Q76A 5A09A 2FYQA 1TOCB 4H42U 3M7TA 1HAVB 3MH6A 1W11U 2FO9A 3BTTE 1GPZA 1BMAA 3UUZA 4AFSA 1ZTKA 1YCPM 2C3SA 1Y5AT 1QJ6B 1IHSH 3SW2B 1PQ8A 1V2TT 3SU5A 1Z6EA 4MVNA 3NXPA 1C5OH 1P0SH 1WOFA 3SU6A 1AFEH 1XXDA 1O5AB 1TMTH 2Q1JA 1BHXF 3FVFB 1HBTH 1BTHH 2GV6A 9ESTA 1MAYA 5HGGA 4NSYA 3UR6A 2CXVA 5GXPA 3KIDU 4SGAE 4NCYA 2VU8E 1QRXA 1P3CA 1EZQA 2FTLE 1FPCH 1UTJA 4NSVA 1DX5M 1C2KA 4X8SH 1ZGVA 4BANB 2BMGB 4AX9H 2SNWA 4MTBA 3ZVAA 3PB1E 1O2LA 2XCNA 5C5OA 1QBOA 5ABWA 3U8RH 1P2OA 4ISIH 1UCYK 3HGNA 5E2PA 4AGJA 4I8LA 4NIYA 1BTXA 2BD9A 2BLQA 2GTBA 3UQVA 1BT7A 3CS7A 4D8NA 1O3GA 1QRZA 2WYJA 1TMBH 5DP9A 1W2KH 3DFLA 2DE9A 3A86A 1KDQA 1C1MA 1AB9B 1YKTA 1RTKA 3TITA 2BY7X 1S5SA 1FIZA 1QTFA 4MNVA 1BRUP 1MUEB 4K3JA 4K1TA 3W94A 1YLDA 1G37A 1ETSH 2D8WA 1AE5A 1WCZA 1FLEE 1YGCH 4ZXXH 1TNKA 1C1NA 2BY8X 3S9CA 3SU4A 5EXMA 1XUJA 4KGAA 3M5NA 2ZGHA 1UVOA 3TJOA 2JH0D 1O5CB 1FY3A 5HM2A 3RU4D 4AORA 1O5BB 5AVDA 4XSKU 1ID5H 1CA0C 2SGDE 3OTJE 2PV9B 2FMJA 5JBAS 3MFJA 3I29A 3Q3KA 3D65E 1C1TA 1GCTB 1UJ1A 2NU4E 1ELFA 1E34B 2PW8H 2AMQA 1NRPH 4Y8ZA 2B8OH 2ZA5A 2UUJB 4NZLA 1C1UH 4Q2KA 1H1BA 1BA8B 4ZROA 3ATLA 4X6PA 1K28D 2XWAA 3RUOA 3EA9A 1IAUA 1HAIH 1BHXB 1GJ9B 3STJA 4IN2A 2NU3E 3DFJA 1ESAA 1QCPA 3LJOA 2W3KA 3BG4C 1C5UA 1BBRE 1QR3E 2G4TA 2ZHFH 4ABHA 1LHCH 1C5XB 2HRVA 2I6SA 1UK4A 2C90B 1L4DA 5C20A 1AIXH 3VB7A 3RXBA 4IBLH 1SI5H 4CH8B 1TA2A 3SGAE 2BDHA 1RTLA 1NT1A 3RMLH 4AYVB 4ZHLU 4OS1A 4CHAC 1EAWA 1AB9C 2BDYA 4RKOB 1MZAA 1O2QA 2G51A 1ESTA 1Z7KA 1FMGA 4I31A 4UFFH 3O8CA 2UUYA 1AY6H 1GJ5H 3KEEA 2GMTC 1NFXA 2EC9H 2ZDAH 1ZR0A 2VWLA 2V3HH 1D3TB 3E1XB 1AVGH 1TNJA 2ZQ1A 2ANKH 3VGCB 5J4QA 1O36A 1TE0A 5FPSA 2P95A 2GT8A 2A1DB 3B23B 2J92A 1CO7E 3EQ0H 4CREA 5A0CA 2A32A 1EJNA 2OXSA 2ANWA 1ZYOA 5HMAA 2ZIQH 1IQHA 3OYPA 2XC5A 1XVMA 1V3XA 3ZZ7A 1DXPA 5JB9S 1C5RA 1GMCF 1MAXA 2ZFPH 4X6MA 3T28A 5L30H 4ABIA 1EPTC 1QJ1B 4TWYA 1QGFA 2XW9A 1NRSH 3FAOA 2TGDA 1O5GH 2GVFA 1WAYB 2BTCE 2FX6A 4X1RU 4TY7A 1GMCG 3LJJA 3NK8A 4YT7H 1ZRBA 2XWBI 2SFAA 5LGOA 2ZPSA 1LHGH 2A4QA 2GCHF 1O3AA 1O2GH 4NWLA 4E05H 4UFEH 1GBEA 1TX8A 1EZUC 5TCAA 2PSXA 2V0BA 1SG8B 1XM1A 1H4WA 1O5DH 1DDJA 2ZDVH 3M3SA 3BTFE 1A46H 2GCHG 4OS5A 3OU0A 3HKJB 3I78A 3GYMA 4PROA 1NO9H 2O8MA 1FN6A 1N1LA 5L2YH 3FP6E 2EI8A 1MTSA 1Q31A 2PR3A 2HPQH 1P2MA 2ZU4A 1J8AA 1K1IA 2QF3A 1TBRH 1LVYA 5JPMH 4B73A 1HAYB 3P17H 1C4Y2 2PTCE 4Y7BA 4ABEA 3BN9A 1GGDB 1XUFA 1YCPK 2AFQB 1ZPBA 3VB4A 2H6MA 2GV7A 1S81A 2ZHWH 3LGYA 3LT3A 3SU3A 4CRCA 1O35A 4Y79A 1SHHB 3ZYDA 3P8FA 1T4VH 2W7UA 3MH5A 1C1SA 4FUBA 2QYIA 1DS2E 4AB9A 3K65B 2HNTF 3SJ8A 3SUFA 3M3VA 1W3CA 3Q00A 1HIAA 3S9BA 1GJDB 1D4PB 2FI5E 1C2GA 1GI5A 1GJBB 5DGJA 5DP3A 1HXFH 2F9NA 1A3BH 1OS8A 1ZJDA 3VXEH 4A92A 1WQVH 1FI8A 1ARCA 1ZMNA 7LPRA 1AFQC 4ABAA 5IDKA 2WPJS 1UVUH 2PUXB 5ESTE 3TVJB 1HV7A 3QN7A 3TJVA 3QTVH 1L1GA 1O2JA 4K8BA 4U30A 4GAWA 1C5NH 3U98H 3ATIA 2AH4X 1GJ4H 2QXHA 2SGFE 4WWYA 1O3IA 5GCHF 3B9FH 1PQAA 4IMZA 4AG2A 4Y71A 4ZXYH 2W7SA 1WBGB 1DVAH 3P8NA 1L1JA 3RXEA 1C2LA 5E8EH 4BTTB 4MPVA 3L33A 1SPJA 1CSOE 1VZQH 3TU7H 1ELVA 3S7KB 1NRRH 4CRFA 5GCHG 4WH6A 1RRKA 4MLFB 1XMNB 2ZQ2A 4Y11E 6LPRA 3GY3A 3RXTA 3S7HB 2FS8A 3RXFA 1O38A 2ZDMA 1LDTT 1PPHE 1VR1H 3SJ9A 2XXLA 4X2XA 3RXVA 2HLCA 2A4GA 4X8TH 1E35B 5F03A 4D7FA 1TNIA 4YESB 5ETXA 2FWWA 1H9IE 1LO6A 3BTEE 3RDZA 1AGJA 1BBRK 1GBKA 2Y5FA 4CRGA 1NESE 1NFYA 1P03A 3UREA 3U1IB 3BG8A 1EB1H 4BNRA 1O3MA 2CGAA 1LPGB 1UCYE 8LPRA 4B2CA 5FCKA 3A7WA 4HI3A 1EPTA 1V2KT 1NN6A 2BQ7B 3MU8A 1C1RA 1F5LA 1BDAA 1A7SA 3SI4H 1W13U 1C2JA 1SGPE 1BUIA 2OC7A 4HGCA 2Y6TA 1BCUH 2NU2E 3ZZ6A 1Z71A 2ZGXH 3CS0A 1THPB 1T7CA 1UK3A 1HDTH 2SGAA 1C2FA 1L2EA 1MU6B 2XTTB 4MNYA 1TYNA 3SJKA 4JCNA 1UHBA 1GI4A 2Z94A 1W0ZU 2UWOA 1TNHA 1HYLA 1Y5UT 2AYWA 3A89A 4BXSA 5HXFA 2P8OC 1GDUA 3GISB 2XRCA 2G8TA 1ABIH 1DANH 3IG6B 1BIOA 1GDQA 4Y0YE 3KGPA 3GCHC 2Q6FA 1C1VH 1IHTH 3MOCA 2GCTB 1LHFH 2GD4B 1LHEH 2JETB 1HLTH 1O3NA 4Y76A 1K1JA 3SNEA 1S0RA 1GHYH 2ANYA 4YOJA 2FLRH 9LPRA 3EDXB 1P10A 2ZTZA 2VWNA 4I8HA 1FN8A 1SR5C 4MPWA 1O39A 1UTMA 2OC8A 1GI3A 1BTPA 5AF9H 2V6NA 3H5CB 4KTUA 2G52A 2PFEA 5DP5A 1A3EH 2YNBA 2FYRA 1W7GH 2FX4A 3FP7E 1CT4E 4FUFA 2BD5A 1ZHRA 1GHVH 1TIOA 3F9FA 5G4BA 1D3PB 1LMWB 1TABE 1L1NA 1VGCC 1TX7A 2ZGCA 4LZ1H 1DUAA 8ESTE 2AIQA 1F5RA 3RLWH 5BRRE 2FOMB 4GVUA 2IN2A 3K9XB 1MKXH 2XCFA 1LQDB 1ZSKA 2FEQH 4XBBA 3VB3A 2A7JA 3SQHE 3QDZB 1FIWA 1WQSA 1GBJA 1C1QA 1LPKB 3T29A 4WXIA 1YPHE 2BXUH 1PPCE 2BOKA 1O2HA 5BPEA 1KLTA 3QZRA 4AZ2B 5T3HA 1HNEE 2A2XH 1O2PA 1WYKA 2KAIA 3BF6H 3ATMA 3ZZDA 1F0RA 4UDWH 1AI8H 1FXYA 1QL7A 1YPEH 1YPLH 3U8OH 2Z9JA 2BHGA 2ZHEH 5GIBA 1HJAB 3KQEA 3D23A 1SB1H 4UD9H 4FU9A 1FY8E 1TX6A 4BAHB 2XYAA 3KQDA 1UTKA 4DW2U 2HGTH 1C2HA 1CQQA 2UWLA 2H1UA 1YPGH 3P95A 1KLJH 2ALVA 1F92A 1PQ7A 1PYTC 4OS2A 1FAXA 4NIVA 1GBDA 2ZFSA
chains in the Genus database with same CATH superfamily
1P2QA 2Y5HA 2F9OA 4O3TA 1DWEH 2HVXA 5C17A 1H9LB 1ZPCA 3G01A 1XXFA 1CGIE 2ZTYA 3OE7D 4LXBH 4X1NU 1ZTLA 2AIPA 2FS9A 4BOHA 2ZGJA 1DICA 1PJPA 4X0WU 5FPYA 1O3KA 1MZDA 2TIOA 4Z1MD 1SGQE 1EP5A 1MKWK 5EU8A 1RFNA 1FZZA 1GI8B 2TPIZ 4D9QA 4NGAH 1UW7A 1Z8JB 3ZVDA 2Y80A 1P02A 1V2PT 2TGTA 2QXGA 3FP8E 4Y6DA 4WJG2 1A1RA 3SBKA 1IQJA 1Y3UA 1BRBE 3BTDE 5EQQA 5HKKD 1UK2A 1TA6A 5J4SA 1YF4A 1LVBA 2EEKA 5FX6A 3V0XA 4OGXA 3U69H 2BQ6B 2OD3B 4XE4A 3RLYH 3BTWE 1HRTH 2J94A 1TRYA 1Y3WA 1ZZZA 1J15A 4K2YA 2AMDA 1KSNA 2ZCLP 5E2OA 1CBWB 1BTZA 3MU4A 2XBWA 4ACBA 1O2SA 3C27B 1MQ5A 1O2TA 1W14U 2EI7A 5DG6A 2C8YB 3N7EA 2F91A 1O3JA 1O2XA 1ACBE 3SU1A 4GPGA 5HIYA 1ARBA 3MU1A 1TGCA 2THFB 2HVYB 1RGQA 4GSOA 2UWPA 4IC6A 1BJVA 2OTVA 1GG6C 1DY9A 1P2NA 2ZG0H 3GY6A 3LOXA 1EJMA 3I77A 2HNTE 3RMMH 5GWZA 4Q7ZA 1OP8A 2LPRA 3HKIB 5CHAB 1PFXC 1UTPA 2ZFFH 1P04A 1GHBF 3GDVA 1EX3A 1SLWB 3UAIC 3LGUA 2KFWA 3A85A 2ZCHP 4B76A 4X6NA 5EJ1A 2BD2A 3DSGA 3MYWA 3QGNB 4H6SB 1QRWA 4F48B 3BTQE 1SQAA 3GCTG 1P09A 3LGTA 2ZEBA 1OP0A 1GHBG 5GJ4B 3ESTA 1PPBH 1NZQH 4F49A 1V2OT 4ZCNA 2C8XB 1WDIA 3MHWU 3LIWA 3MO6A 1QL9A 1V2VT 3ENSB 4BAOB 1BTUA 2VIPA 2W6JD 1K22H 2ZNKH 3HATH 2ZHQH 2ZI2H 1P01A 1OPHB 1AE8H 3P92A 3PTBA 3URDA 1PPEE 3A7ZA 1RD3B 1MTVA 1DLKB 3H09A 3UTUH 1YPJH 1OSSA 1W10U 1WTGH 3CP7A 1EAUA 2L74A 5DP6A 1W12U 3QGJA 3GCOA 5HM9A 2HLDD 3JZ1B 3PROA 3ZZ9A 2HWLB 1WU1A 3UY9A 2G81E 4JK5A 1SOZA 4YOGA 3A7TA 2KCOA 3UNSA 3MNCA 1F7ZA 2ZECA 3A84A 3TIUA 3RMOH 3SUGA 3MH4A 5IK2D 4K69A 1ELDE 2Z9GA 4UFGH 2K0QA 4NG9H 1CHOF 4BTUB 1BMLA 3VG8A 1LKBA 2A4OA 1X7AC 1S82A 3PTNA 3A7XA 1V2NT 3Q3YA 1GMDF 2LNCA 4IC5A 1SGNE 5FHTA 3U8TH 3IWMA 2AGEX 1TQ0B 2IJOB 2ZU3A 4GHQA 1CHOG 2ZDNA 4VGCB 3SV8A 1E79D 3F9GA 1C9PA 4U32A 4YM9A 2VGCB 4Q7YA 1GMDG 2LELA 3SHAH 1P8VC 1NTPA 1DM4B 3RXJA 5E0HA 2JKHA 5I46H 2V3OH 3SV2H 1SLXB 5JDUB 1AU8A 1CU1A 1PPFE 3DD2H 3FZZA 1SFQB 4B2BA 2PKAB 2SGEE 2UUFB 3RXUA 1DFPA 1ZLRA 1UO6A 1OKXA 3E90B 4Y8XA 2CV3A 3M5MA 1TMUH 3DHKH 4FUCA 4A5TS 2DUCA 3V3MA 1C2DA 1LHDH 1EOJA 2A5IA 1Y3VA 2AERH 2P93A 3ELAH 3RXIA 4XBDA 1GCDA 3EGKH 1KXBA 1ZSJA 2D2DA 3QUMP 2GP9B 4B75A 1P3EA 4UFDH 1FAKH 4GUXA 4X6OA 2P3TB 3ITIA 3UNQA 1C2MA 4A7IB 2H9EH 1A4WH 1DUEA 3LU9B 2PUQH 1CHGA 1RIWB 1NROH 4RKJB 3CENA 5FBIA 2B0FA 2BDCA 1JIRA 1C2IA 1W0YH 1SLVB 2J34A 4DIHH 6CHAB 4WH8A 3TK6A 3VB5A 1F2SE 3F2FA 1B0EA 4CBNA 5C3NA 1J9CH 2QAAA 3SZNA 1GCTC 5EQSA 1GI7B 3M3TA 4X2WA 3HK3B 2KCPA 1HCGA 5EJLA 1KTSB 2CK3D 1QQ4A 3ZVGA 2XNIA 3PV2A 4YO9A 3AVZA 1O2WA 4Y10E 3STIA 3ZZAA 1AO5A 3PRDA 3BTHE 1AVXA 2UUKB 2VINA 3JZ2B 1ETTH 4U2WA 1YLCA 3QX5H 1AKSA 2ZC9H 3DT0H 5K0HA 4MNWA 7KMEH 4Y8YA 3K2UA 2BB4A 3S69A 1GJAB 1NC6A 5EG4A 4OGYA 4NA8A 3FKSD 5T6DA 4ZHMU 3PMJA 3FOAA 1O32A 3BEUA 4TY6A 4X8UH 4P00A 4RI0A 1KXDA 1OP2A 1ANEA 1MH0A 3UIRA 2P16A 1YPMH 4B71A 2R9PA 2Y82A 2YMSC 1GJ7B 3E0PB 1O31A 1P05A 1TFXA 1ZOMA 3ZYEA 4HZHA 2A5AA 3BV9B 4ISHH 2O8TA 2H9TH 1CT0E 2BOHB 2Y7ZA 1MCVA 4E7NA 4IMQA 1FJSA 1G2MA 4KKDA 1OXGA 1GVKB 1AD8H 4WMEA 5H4IB 1O2MA 1NU7B 1CGHA 3QWCH 1O5EH 2A4RA 2KCAA 7ESTE 4MG3A 1HAPH 3VGCC 2QA9E 4JYTA 1S84A 6ESTA 1LPZB 1NY22 3MNSA 1XVOA 3RXMA 3AW1A 1CA8B 2QXJA 4HTCH 1HAVA 1MABB 1JXPA 2OBOA 3QO6A 1SQTA 4BTIB 4ACAA 4X1PU 2R0LA 1S85A 1PYTD 5FBEA 2PGBB 4ZKNU 1THSH 1THRH 3RXDA 5A8ZA 2J95A 3T2NA 1ZGIA 3TJNA 1F0TA 5A0BA 4IW4E 3GY4A 3SNDA 1CT2E 3VEQB 5EGMA 4CRBA 3MNBA 4XRNA 3RXGA 2FTMA 1UMAH 1D6RA 1GVZA 1QZ8A 2BLWA 2FOAA 3P70B 5EXNA 1C4U2 3ZZ5A 4I8KA 1ESBA 3ZVBA 3ZZBA 1GBIA 4TSFD 2J2UA 4ISNA 2GGVB 2F9BH 5AHGH 1C5QA 4TPYA 1O37A 1W7XH 1N8OB 2QV1A 3FANA 2WUCA 1V6DA 1P2KA 2FXRA 4AGKA 3KL6A 1GBTA 1JMOH 1OOKB 2ZGBH 2J98A 1YM0A 1ETRH 1DPOA 3GICB 2RCEA 2ZKSA 4FETA 1E38B 4NIXA 1MTNB 2QCYA 4Z0KA 4DGJA 1HB0B 2OC0A 2XOKD 3SV6A 5AFYH 1EKBB 3SUEA 3KQBA 3FO8D 1UTLM 2O8LA 4ISOA 3O8RA 2FOBA 1O3HA 3BIVH 1GGDC 1RJXB 3M7UA 2ZHDA 3MMGA 1AN1E 4NA9H 2VIVA 2OP9A 1W8BH 3GY8A 3PLBA 2VIQA 2Z7FE 2BQWB 1L4ZA 5DK1A 4DOQA 1BTWA 2WPLS 5JYIA 2RA3A 4NFFA 3E3TA 1K1OA 1KDQB 2ZDKA 1YPHC 5FAHA 2W6ID 1T8LA 1GHXH 2FP7B 1YWUA 1GI2A 3A87A 1BTYA 2WPIS 1P06A 5FX5A 1MD7A 1TONA 2BYAX 1IQMA 3OAAD 4TYDA 5HYOA 5CE1A 4AG1A 2FOCA 3IITA 1A5HA 4JYUH 1QA7A 3F9HA 2TGPZ 1V2MT 2ODQA 3MU5A 3SNBA 4FUGA 4F55A 3F0OA 1D9IA 2Y7XA 1L0ZA 4I32A 5I25A 1GHWH 2VIWA 1G36A 2Z6BD 1C5MD 5LPFA 5DN6D 3UNRA 1D3DB 3GDSA 1HXEH 4NZQA 1F0SA 3M35A 4OM9A 3LGVA 4JZ1A 5T6FA 4CR9A 3M7QA 3K6ZA 3L6PA 1E1RD 1O2UA 1A0HB 1BMFD 1HAGE 5PTPA 1GJCB 3AW0A 2SNVA 1GJ6A 3PO1B 3ZVFA 5E0JA 1G3CA 3EE7A 4DT4A 3URCA 2BD8A 3MI4A 1IQLA 1DLEA 2PSYA 1AWFH 4KELA 3UFAA 2BD4A 4CBOA 1HAHH 1G3EA 4WMDA 4XBCA 5F8TA 5C2ZA 1TNGA 2BDIA 3OX7U 3A8DA 1MD8A 3KNXA 2BZ6H 1T8OA 2QGRA 3NRLA 1QQUA 1ELEE 2W5EA 2C93B 2R3UA 2A0QB 1A2CH 2BM2A 2BY9X 4XD7D 1HFDA 3PWBA 2WPHS 1UVPA 5C5NA 1NPMA 1MBQA 2V3MA 4DIIH 2IOTA 4Q4LA 2ALPA 2WYGA 2QN5T 1QB9A 4CRDA 4AYYB 2NWNA 1UTQA 1GBFA 1ANBA 1EATA 3LKWA 4ASHA 3TGIE 1FDPA 1EUFA 2F4LA 3FZDA 2BXTH 1TGBA 2CMYA 3ZV9A 4AFZA 1Z8IB 3TH4H 2HNTC 2EY4C 3SV9A 1MQ6A 2QY0B 2HPPH 5DO4H 3QTOH 3HPTB 5B6OA 3UR9A 2Q6DA 1OWHA 2J4IA 1GVLA 1P2IA 4Z6AH 1AQ7A 1JRSA 1B7XB 5C67A 3KCGH 2A5KA 3OEED 1DITH 5EPYA 1MCTA 1P12E 1T8MA 3RXCA 5GDSH 1BRCE 4MQAA 4AN7A 1A5IA 1AMHA 2F3CE 3E0NB 2GCTC 3Q77A 2OUAA 3SJOA 2C8WB 2AS9A 2JETC 1SGIB 3SN8A 3GY5A 4J1YA 1GDNA 4FU8A 5T6GA 3KQ5A 4BAKB 2W26A 4FVBA 1Y3YA 3NKKA 4JK6A 1F5KU 3RU4T 1TPPA 1FY1A 1BJUA 1E36B 2W3IA 1HJ9A 3TGKE 1V2JT 5L2ZH 3V12A 5EPNA 5A0AE 1GMHF 2G5VA 4WF8A 3H7TA 1HPGA 4RSPA 2A7HA 1EJAA 1GHAF 1OWDA 3M37A 3PWCA 3LC5A 4MDSA 2AGIX 1YPKH 1EFRD 2OINA 4X1SU 3TNSA 2BX4A 2XNDD 1LCYA 2ULLA 2FI4E 3SOSA 5C1YA 1GMHG 1J16A 2RDLA 5C1UA 8GCHF 2YMSD 2BX3A 2NU1E 1GHAG 1Q3XA 3SGQE 1TB6H 5TCCA 3ZZ3A 3AASA 1XX9A 3MH7A 3ZVEA 5ESBA 4LOYH 1KXCA 1ORFA 1PQ5A 1Y59T 1GBLA 2OLGA 4ABJA 5LPRA 3GY7A 3SU2A 3SZEA 5JBTA 2BD3A 3T26A 4GHTA 8GCHG 5DP7A 4DVAU 1N6XA 4TWWA 1CGJE 1IQNA 1O3CA 4X8VH 1OX1A 1OYQA 2VVUA 1GWAA 1QBVH 1KTTB 4MPXA 5FCRA 2RA0A 4THNH 4A1VA 1HJAC 3EA7A 3SU0A 1K9OE 3A7YA 1CA0B 3LH3A 1CE5A 3NUMA 3GCTF 1ZTJA 4ABDA 1HIAB 2P59A 3QLPH 2BZAA 3ODFA 2F43B 2WPKS 1VJAU 2XBXA 1TQ7B 3BTKE 3TK9A 1MBMA 4JMYA 2XC0A 1LVMA 1T8NA 1WV7H 1MKXK 1ELBA 1T32A 1P9SA 2TGAA 2XC4A 4OS7A 4JZFH 1P57B 3KF2A 2STBE 1C5WB 1AHTH 1FY4A 2FOGA 3P8GA 2PHBA 1O2VA 2O8WA 2WPDD 4X1QU 3BG4B 2SGQE 3UPEA 1SL3A 1FUJA 3N99A 3SUDA 4F4OC 3LC3A 1FQ3A 1OHHD 2Z3EA 4YOIA 2VNTA 3KQCA 5LPEA 2VWOA 2GDDA 1NBME 2RG3A 1OWKA 2PP6A 2TRMA 3ZZCA 2FODA 3ATWA 3OFND 3M5OA 3SNAA 3UOUA 3ZZ8A 4AC9A 1GI9B 3MWIU 2V35A 3RMNH 3PM3A 4CHAB 2VVCA 1U6QA 2QIQA 5EOKA 1MMJN 1GBBA 3MNXA 4R8TB 1JBUH 4Y0ZE 4B74A 1DOJA 4K8YA 2D1JA 1CBWC 1H9HE 3MTYA 3S9AA 1INCA 2A2QH 4YZUA 1XKBC 2GMTB 4UONA 1C4V2 3S0NA 2AEIH 4X2VA 1PPZA 3P6ZB 2R0KA 3TGJE 4FUHA 3MQKC 1SGEE 2ZFRH 1FV9A 2D26C 1DWDH 4IS5A 2VIOA 1SVPA 3A88A 1NS3A 2R3YA 2Z9KA 1OWEA 3R3GB 1DWBH 3U1JB 5HIZA 1W0KD 3RXPA 2CN0H 1KXAA 2Y5GA 1F0UA 4UEHH 3T5FH 1V2WT 3B8JA 1N6YA 5CHAC 2IJD1 1SGYE 1EPTB 3LPRA 4DG4A 3CNRA 4JYVH 1H8IH 1K0HA 3UWJH 3RXQA 3ZVCA 5CDFE 1V2ST 2ZP0H 4B6FA 1ELGA 1UVTH 1YCPH 4JZDH 1IQIA 2WV5A 2GKVE 1K1LA 1S6HA 3W95A 1ZHPA 5FPTA 1UHBB 3K6YA 2ZZUH 1EOLA 1SGFG 2B5TB 1C1PA 4A1XA 3SQEE 2O8UA 3TLOA 4O9VA 1QL8A 4RT1A 5FXLA 3SV7A 1C9TA 1EZXC 4FU7A 2A45B 3KHVA 3GDUA 4B2AA 2PKSB 3E91A 1JIMA 2VH0A 2F83A 3LONA 1A61H 1SSXA 1WUNH 1YYY1 1TLDA 1BOQA 1RXPA 2CF9H 3F6UH 1A0JA 1G3BA 1HAOH 3RC5A 3RXKA 1DY8A 3NWUA 4ZHAA 5FL7D 1LTOA 3F9EA 3EA8A 3GYLB 1O2RA 4O97A 1EAXA 4ZKRU 3QZQA 4JZIA 2CHAB 4GLYA 1VJ9U 3RP2A 3PLPA 1G2LA 2BY6X 2XBYA 1DT2A 2Q6GA 1B0FA 2FESH 3VXFH 4AB8A 2G55A 3M5LA 2VH6A 1B5GH 2QF0A 1YLNA 1BRAA 2P3FH 2KZ4A 1LKAA 1MTUA 2GX4A 4FUEA 3OTPA 3T25A 2OQ5A 5A2MH 1EASA 2ZU2A 1EXFA 1Q2WA 4SGBE 1MU8B 1KXEA 2P94A 1ABJH 1D3QB 2CF8H 4VGCC 5K7RA 4BXWA 4K5ZA 1BQYA 1S83A 2J38A 2VGCC 1TAWA 1IQKA 2H9HA 4FUIA 1AUTC 1O3EA 1O2KA 2FI3E 3FFGA 3HK6B 1OYTH 5A8YA 3VB6A 2R2MB 2ZWLH 2OCVB 1O34A 1FY5A 1O2YA 2F9VA 1C5VA 2GJGA 3RC6A 5AFZH 3WWBA 1V2UT 1SBWA 2ILNA 1SGTA 4I8GA 1ZPZA 2KAIB 5SGAE 1AFQB 1O3BA 1BB0B 5DJ7A 5DPAA 2IPHA 2WV4A 4D76A 4O3UA 4U01A 3A81A 3R0FA 3SO3A 1SLUB 3TNTA 1QJ7B 1C1OA 1QNJA 1AZ8A 1BBRH 3HGPA 3PMHB 3VFEA 5JBBS 7GCHF 4ZAEA 4H4FA 2AGGX 2PKSC 2G00A 3RXSA 1P11E 1S6FA 4K60A 1O33A 3O8BA 1O2NA 1ANCA 1O3OA 2WZQA 3O8DA 2XBVA 4YLQH 1ZHMA 1O2IA 4I33A 4WMFA 4R0IA 7GCHG 1A0LA 3RXOA 4ZUHA 3A8BA 1E0FD 1RIWC 2ZF0H 3DSOA 2ZU5A 1NM6A 4J2YB 1JWTA 2ZU1A 2GDEH 3AAUA 1VCQA 6CHAC 3TJUA 1O30A 1Y8TA 2CHAC 2LP6A 3F3BA 1NFWA 3UOPA 3WY8A 4WVPE 4K1EA 1C5LH 4ISLA 4E06H 1NBMD 1XUHA 1BZXE 2BDGA 1K1PA 1ELAA 4DT7B 3BTME 3V13A 3PMAB 4Q7XA 3SJIA 1TPOA 1AWHB 2Z3DA 4YLUA 3KN2A 1COWD 1NRQH 2OQUA 1AUJA 1KLIH 4YT6H 1GJ8B 2JH5D 8KME2 5TJXA 1P9UA 3WW7A 2ZFQH 5A8XA 1ZMLA 2PWXA 5DP8A 4A1TA 2BVRH 3PV4A 4XDEA 2JJ1D 1EZSC 3QK1A 1G3DA 1C5YB 2FLBH 4Y7AA 4A6LA 1Z8GA 1TPAE 3ODDA 1QHRB 1VITH 3MO3A 4FUDA 4GCHF 1K1NA 2G5NA 1H8DH 2BD7A 3E16B 3GY2A 4E7RG 2OBQA 3DUXH 1GBHA 1A5GH 4AOQA 4Q63A 1IQEA 2CJIA 4ZMAH 5GPIB 2SGPE 3OY5U 1TWXB 3BTGE 4ZKSU 1BMNH 3SGBE 4GCHG 5F6MA 4ESTE 3A8CA 5EQRA 5EXLA 2B7DH 1KY9A 1KIGH 4KTSA 3RXAA 1H8ED 1GI6A 4CR5A 1GL0E 2ZCKP 2P8OB 1E37B 1FONA 3PMBB 1AZZA 2NU0E 1ELTA 1OWIA 2GZ8A 4O03A 1S6LA 5JBCS 1UTNA 1BMMH 1J14A 1O3PB 4KP0A 1VCPA 1G32B 4OS6A 3A83A 3PLKA 5CHBA 3D62A 1V2QT 3GCHB 3A8AA 3EYDA 1O0DH 2Z3CA 1UVSH 2PGQB 1TRNA 1IOEA 1QBNA 2FOFA 4JZEH 2RDEA 4ZH8A 2WINI 3GCNA 3Q3XA 4ABGA 3NZIA 3UQOA 4HG6A 2HALA 2R2WU 4NA7A 2ESTE 5F8XA 4CH2B 1RTFB 5EW2H 2WPMS 3TH2H 1XUGA 1QB1A 1K21H 5EODA 3ZZ4A 5GNDA 1FX0B 4BAQB 1GBAA 3E6PH 4AFUA 2ZO3H 3RM0H 1FPHH 2GZ7A 4DCDA 4FUJA 1NRNH 4IGDA 1TNLA 2HOBA 4OS4A 1LVOA 1GBMA 1ZSLA 2I6QA 3GOVB 1QB6A 1C2EA 4I7YH 3WWFA 2BVXH 3BEFB 4NWKA 1QY6A 2VIDA 5C1XA 1O3LA 1VGCB 3A80A 1IQFA 1AVWA 1QA0A 1N8OC 3BEIB 1TGTA 2QC2A 2BDBA 4DJZB 5LH8A 1C5TA 1XUKA 1ELCA 4HFPB 3OSYA 1S0QA 4FVDA 5F8ZA 2QXIA 1YC0A 2BDAA 4NFEA 4WXVA 4KTCA 1VCWA 5IYTA 1WXRA 5E0GA 3VPKA 4ABBA 1SOTA 2EA3A 5CMXH 2K1QA 3M61U 3RC4A 1MTNC 1MKWH 3NCLA 3SHCH 2PKAA 1HAZB 2A31A 3E8LA 3TH3H 1HAXB 1TGNA 3A7VA 3BIUH 2A7CA 3RXRA 1HJ8A 2ODYB 1G30B 2F9PA 2YOLA 2DE8A 3DA9B 3SORA 2VB0A 2Z9IA 3MU0A 1SQOA 1KXFA 3A82A 1JRTA 1Z8RA 2BY5X 2PTNA 2VJ1A 3NPSA 1V2RT 1C1WH 2FIRH 3U9AH 2Z9LA 2FDAA 4P02A 3T62A 4D9RA 1T31A 1EAIA 4IN1A 2ZPQA 3H7OA 3LH1A 3EAJA 1NFUA 1TRMA 2BLOA 2Y81A 4AFQA 2PLXA 1DSUA 2ZPRA 1O3FA 3TPIZ 1D6WA 3P8OA 2ZTXA 3LGWA 3PYHA 1TBZH 3LGIA 1JOUB 1QURH 2OC1A 2B9LA 4FOUC 4INLA 3D49H 4B6EA 1C5PA 1O3DA 4DY7B 1ANDA 1TOMH 4XOJA 4NIWA 2C8ZB 3T27A 4XFQA 1M9UA 1YBWA 1W0JD 2KCYA 1SGCA 3RU4E 1WSSH 2AMPA 4CRAA 4I8JA 4MPUA 5DKMA 2BLVA 2H2ZA 4WY3A 4DURA 1DWCH 1WTHD 1SKYE 4QT8C 1G9IE 5EW1H 1ZRKA 4MNXA 3SNCA 1IQGA 6GCHF 1Y3XA 2BVSH 1HUTH 1VITF 1GI1A 1O2OA 1NU9A 2ZFTA 3ZV8A 2ASUB 2G4UA 3EE0B 1SHYA 3TK5A 3V7TA 2FM2A 1UCYH 4H6TA 2VWMA 2ODPA 1TGSZ 1YP9A 3OY6U 3ATKA 6GCHG 2GZ9A 2M5TA 3LDXH 1TPSA 1VITG 2FPZA 5DP4A 1BITA 2VVVA 3BSQA 2JH6D 1QFKH 4LZ4B 2J9NA 5JB8S 1C5ZB 4B1TA 4UE7H 5L6NH 1V2LT 1SMFE 1Z6JH 3M36A 2KX4A 1Z1IA 1HGTH 1DXWA 1Z1JA 1K1MA 1K2I1 1OWJA 2C4FH 2STAE 1SGFA 3AAVA 1UTOA 1AKSB 2WV9A 4ABFA 5KEDA 1PPGE 3PO1C 2H5DA 4INHA 1GG6B 1T4UH 2P3UB 3RM2H 4K1SA 4X2YA 3N7OA 1MTWA 1GI0A 2EI6A 1DSTA 1C5SA 1FNIA 4LK4A 1GBCA 3RXHA 2KM0A 1ZJKA 1TALA 1XUIA 1QIXB 3F1SB 1LQEA 1P2JA 2QF5A 1KYNA 2VBCA 2H5CA 2WUBA 1EB2A 4YTAA 2FOEA 2TBSA 3RXLA 4Q80A 4TPIZ 3UB0A 2ZDLA 1GHZA 3F68H 1Y5BT 2FZZA 4ZKOU 2O9QA 3MO9A 1CVWH 3SI3H 1SGDE 2YNAA 1TBQH 1O5FH 2F9UA 4RN6A 4FXGH 2ANMH 3L3TA 4I86A 4M7GA 5T1VA 4BAMB 1J17T 3UWIA 1XKAC 4INKA 1ZMJA 1DE7H 2FOHA 1GL1A 1O2ZA 3C1KA 2GT7A 1EQ9A 1EP6A 4D7GA 1RS0A 1SGRE 1SFIA 1SC8U 3Q76A 5A09A 2FYQA 1TOCB 4H42U 3M7TA 1HAVB 3MH6A 1W11U 2FO9A 3BTTE 1GPZA 1BMAA 3UUZA 4AFSA 1ZTKA 4TT3D 1YCPM 2C3SA 1Y5AT 1QJ6B 1IHSH 3SW2B 1PQ8A 1V2TT 3SU5A 1Z6EA 4MVNA 1KMHB 3NXPA 1C5OH 1P0SH 1WOFA 3SU6A 1AFEH 1XXDA 1O5AB 5EJZA 1TMTH 1E1QD 2Q1JA 1BHXF 3FVFB 2JDID 1HBTH 1BTHH 2GV6A 9ESTA 1MAYA 5HGGA 4NSYA 3UR6A 2CXVA 5GXPA 3KIDU 3DSPA 4SGAE 4NCYA 5F53A 2VU8E 1QRXA 2IPQX 3DCLA 3SYJA 1P3CA 1EZQA 2FTLE 1FPCH 1UTJA 3GS9A 4NSVA 1DX5M 1C2KA 4X8SH 1ZGVA 4BANB 2BMGB 4AX9H 2SNWA 4MTBA 3ZVAA 3PB1E 2J98B 1O2LA 2XCNA 5C5OA 1QBOA 5ABWA 3U8RH 1P2OA 4ISIH 1UCYK 3HGNA 2JIZD 5E2PA 4AGJA 4I8LA 4NIYA 1BTXA 2BD9A 2BLQA 2GTBA 3UQVA 1BT7A 3CS7A 4D8NA 1O3GA 1QRZA 2WYJA 1TMBH 5DP9A 1W2KH 3DFLA 2RFKC 2DE9A 3A86A 1KDQA 1C1MA 1AB9B 1YKTA 1RTKA 3TITA 2BY7X 1S5SA 1FIZA 2QE7D 1QTFA 4MNVA 1BRUP 1MUEB 4K3JA 4K1TA 3W94A 1YLDA 1G37A 1ETSH 2D8WA 1AE5A 1WCZA 1FLEE 1YGCH 4ZXXH 1TNKA 1C1NA 2BY8X 3S9CA 3SU4A 5EXMA 1XUJA 4KGAA 3M5NA 2ZGHA 1UVOA 3TJOA 2JH0D 1O5CB 1FY3A 5HM2A 3RU4D 4AORA 1O5BB 5AVDA 4XSKU 5KECA 1ID5H 1CA0C 2SGDE 3OTJE 2PV9B 2FMJA 5JBAS 3MFJA 3I29A 3Q3KA 3D65E 1C1TA 1GCTB 1UJ1A 2NU4E 1ELFA 1E34B 2PW8H 2AMQA 1NRPH 4Y8ZA 2B8OH 2ZA5A 2UUJB 4NZLA 1C1UH 4Q2KA 1H1BA 1BA8B 4ZROA 3ATLA 4X6PA 1K28D 2XWAA 2WSSD 3RUOA 3EA9A 1IAUA 1HAIH 1BHXB 1GJ9B 3STJA 4IN2A 2NU3E 3DFJA 1ESAA 1QCPA 3LJOA 2W3KA 3F0PA 3BG4C 1C5UA 1BBRE 1QR3E 2G4TA 2ZHFH 4ABHA 4YXWD 1LHCH 1C5XB 2HRVA 2I6SA 1UK4A 2C90B 3AK5A 1L4DA 5C20A 1AIXH 3VB7A 3RXBA 5B6LA 4IBLH 1SI5H 4CH8B 1TA2A 2YMSB 3SGAE 2BDHA 1RTLA 1NT1A 3RMLH 4AYVB 4ZHLU 4OS1A 4CHAC 1EAWA 1AB9C 2JJ2D 2BDYA 4RKOB 1MZAA 1O2QA 2G51A 1ESTA 1Z7KA 1FMGA 4I31A 4UFFH 3O8CA 2UUYA 1AY6H 1GJ5H 3KEEA 2GMTC 1NFXA 2EC9H 2ZDAH 1ZR0A 2VWLA 2V3HH 1D3TB 3E1XB 1AVGH 1TNJA 2ZQ1A 2ANKH 3VGCB 5J4QA 1O36A 1TE0A 3KYGA 2P95A 5FPSA 2GT8A 2A1DB 3B23B 2J92A 1CO7E 3EQ0H 4CREA 5A0CA 2A32A 1EJNA 2OXSA 2ANWA 1ZYOA 3PV5A 3OEHD 3F2GA 5HMAA 2ZIQH 1IQHA 3OYPA 2XC5A 1XVMA 1V3XA 3ZZ7A 1DXPA 5JB9S 1C5RA 1GMCF 1MAXA 2ZFPH 4X6MA 3T28A 5L30H 4ABIA 4ASUD 1EPTC 1QJ1B 4TWYA 1QGFA 2XW9A 1NRSH 3FAOA 2TGDA 1O5GH 2GVFA 1WAYB 2BTCE 2FX6A 4X1RU 4TY7A 4RT0A 1GMCG 3LJJA 1H8HD 2K8IA 3FN8A 3NK8A 4YT7H 1ZRBA 2XWBI 2SFAA 2WHXA 5LGOA 2ZPSA 1LHGH 2A4QA 2GCHF 1O3AA 1O2GH 4NWLA 4E05H 4UFEH 1GBEA 1TX8A 1EZUC 5TCAA 2PSXA 2V0BA 1SG8B 1XM1A 1H4WA 1O5DH 1DDJA 2ZDVH 3M3SA 3BTFE 1A46H 2GCHG 4OS5A 3OU0A 3HKJB 3I78A 3GYMA 4PROA 1NO9H 2O8MA 1FN6A 1N1LA 5L2YH 3FP6E 2EI8A 1MTSA 1Q31A 2PR3A 2HPQH 1P2MA 2ZU4A 1J8AA 1K1IA 2QF3A 1TBRH 1LVYA 5JPMH 4B73A 1HAYB 3P17H 1C4Y2 2V7QD 2PTCE 4Y7BA 4ABEA 3BN9A 1GGDB 1XUFA 1YCPK 2AFQB 1ZPBA 3VB4A 2H6MA 2GV7A 1S81A 2ZHWH 3F2HA 3LGYA 3LT3A 3SU3A 4CRCA 1O35A 4Y79A 3PRBA 1SHHB 3ZYDA 3P8FA 1T4VH 2W7UA 2AHME 3MH5A 1C1SA 4FUBA 2QYIA 1DS2E 4AB9A 3K65B 2EQNA 2HNTF 3SJ8A 5KGOA 3SUFA 3M3VA 1W3CA 3Q00A 1HIAA 3S9BA 1GJDB 1D4PB 2FI5E 1C2GA 1GI5A 1GJBB 5DGJA 5DP3A 1HXFH 2F9NA 1A3BH 1OS8A 1ZJDA 3VXEH 4A92A 1WQVH 1FI8A 1ARCA 1ZMNA 7LPRA 1AFQC 4ABAA 5IDKA 2WPJS 1UVUH 2PUXB 5ESTE 3TVJB 1HV7A 3QN7A 3TJVA 3QTVH 1L1GA 1O2JA 4K8BA 4U30A 4GAWA 1C5NH 3U98H 3ATIA 2AH4X 1GJ4H 2QXHA 2SGFE 4WWYA 1O3IA 5GCHF 3B9FH 1PQAA 4IMZA 4AG2A 4Y71A 4ZXYH 2W7SA 1WBGB 1DVAH 1YY3A 1L1JA 3P8NA 1C2LA 5DSFA 3RXEA 5E8EH 4BTTB 4MPVA 2J97A 2OK5A 3L33A 1SPJA 1CSOE 1VZQH 3TU7H 1ELVA 3S7KB 1NRRH 4CRFA 5GCHG 4WH6A 1RRKA 4MLFB 1XMNB 2ZQ2A 4Y11E 6LPRA 3GY3A 3RXTA 3S7HB 2FS8A 3RXFA 1O38A 2ZDMA 1LDTT 1PPHE 1VR1H 3ZIAD 3SJ9A 2XXLA 4X2XA 3RXVA 2HLCA 2A4GA 5C0TA 4X8TH 1E35B 5F03A 4D7FA 1TNIA 4YESB 5ETXA 2FWWA 1H9IE 2M2AA 3U28C 1LO6A 3BTEE 3RDZA 1AGJA 1BBRK 1GBKA 2Y5FA 4CRGA 1NESE 1NFYA 1P03A 3UREA 3U1IB 3BG8A 1EB1H 4BNRA 1O3MA 2CGAA 1LPGB 1UCYE 8LPRA 4B2CA 5FCKA 3A7WA 4HI3A 1EPTA 1V2KT 1NN6A 2BQ7B 3MU8A 1C1RA 1F5LA 1BDAA 1A7SA 3SI4H 2L6OA 1W13U 1C2JA 1SGPE 1BUIA 2OC7A 3KYFA 4HGCA 2Y6TA 1BCUH 2NU2E 1SQRA 3ZZ6A 1Z71A 2ZGXH 3CS0A 1THPB 1T7CA 1UK3A 1HDTH 2SGAA 1C2FA 1L2EA 1MU6B 2XTTB 4MNYA 1TYNA 3SJKA 4JCNA 1UHBA 1GI4A 5C0UA 2J5UA 2Z94A 1W0ZU 2UWOA 1TNHA 1HYLA 1Y5UT 2AYWA 3A89A 4BXSA 5HXFA 2P8OC 1GDUA 3GISB 2XRCA 2G8TA 1ABIH 1DANH 3IG6B 2QF4A 1BIOA 1GDQA 4Y0YE 3KGPA 3GCHC 2Q6FA 1C1VH 1IHTH 3MOCA 2GCTB 1LHFH 2GD4B 1LHEH 2JETB 1HLTH 1O3NA 4Y76A 1K1JA 3SNEA 1S0RA 1GHYH 5EIYA 2ANYA 4YOJA 2FLRH 9LPRA 3EDXB 1P10A 2ZTZA 2VWNA 4I8HA 1FN8A 1SR5C 4MPWA 1O39A 1UTMA 2OC8A 1GI3A 1BTPA 5AF9H 2V6NA 3W1EA 3H5CB 4KTUA 2G52A 2PFEA 5DP5A 1A3EH 2YNBA 2FYRA 1W7GH 2FX4A 3FP7E 1CT4E 4FUFA 2BD5A 1ZHRA 1GHVH 1TIOA 3F9FA 5G4BA 1D3PB 1LMWB 1TABE 2KR7A 1L1NA 1VGCC 1TX7A 2ZGCA 4LZ1H 1DUAA 4M9FA 8ESTE 2AIQA 1F5RA 3RLWH 5BRRE 2FOMB 4GVUA 2IN2A 3K9XB 1MKXH 2XCFA 1LQDB 1ZSKA 2FEQH 4XBBA 3VB3A 2A7JA 3SQHE 3QDZB 1FIWA 1WQSA 1GBJA 1C1QA 1LPKB 3T29A 4WXIA 1YPHE 1VKYA 2BXUH 5C94A 1PPCE 2BOKA 1O2HA 5BPEA 1KLTA 3QZRA 4AZ2B 5T3HA 1HNEE 2A2XH 1O2PA 1WYKA 3N7DA 2KAIA 3BF6H 3ATMA 3ZZDA 1F0RA 4UDWH 1AI8H 1FXYA 1QL7A 1YPEH 1YPLH 3U8OH 2Z9JA 2BHGA 2ZHEH 5GIBA 1HJAB 3KQEA 3D23A 1SB1H 4UD9H 4FU9A 1FY8E 1TX6A 4BAHB 2XYAA 3KQDA 1UTKA 4DW2U 2HGTH 1C2HA 1CQQA 2UWLA 2H1UA 1YPGH 3P95A 1KLJH 2ALVA 1F92A 1PQ7A 1PYTC 4OS2A 1FAXA 4NIVA 1GBDA 2ZFSA
chains in the Genus database with same CATH topology
1P2QA 2Y5HA 2F9OA 4O3TA 1DWEH 2HVXA 1H9LB 1ZPCA 3G01A 1XXFA 1CGIE 2ZTYA 4LXBH 4X1NU 1ZTLA 2AIPA 2FS9A 4BOHA 2ZGJA 1DICA 1PJPA 4X0WU 5FPYA 1O3KA 1MZDA 2TIOA 1SGQE 1EP5A 1MKWK 5EU8A 1RFNA 1FZZA 1GI8B 2TPIZ 4D9QA 4NGAH 1Z8JB 3ZVDA 2Y80A 1P02A 1V2PT 2TGTA 2QXGA 3FP8E 4Y6DA 4WJG2 1A1RA 3SBKA 1IQJA 1Y3UA 1BRBE 3BTDE 5EQQA 1UK2A 1TA6A 5J4SA 1YF4A 1LVBA 2EEKA 5FX6A 3V0XA 4OGXA 3U69H 2BQ6B 2OD3B 4XE4A 3RLYH 3BTWE 1HRTH 2J94A 1TRYA 1Y3WA 1ZZZA 1J15A 4K2YA 2AMDA 1KSNA 2ZCLP 5E2OA 1CBWB 1BTZA 3MU4A 2XBWA 1O2SA 3C27B 1MQ5A 1O2TA 1W14U 2EI7A 5DG6A 2C8YB 2F91A 1O3JA 1O2XA 1ACBE 3SU1A 4GPGA 1ARBA 3MU1A 1TGCA 2THFB 1RGQA 4GSOA 2UWPA 4IC6A 1BJVA 2OTVA 1GG6C 1DY9A 1P2NA 2ZG0H 3GY6A 3LOXA 1EJMA 3I77A 2HNTE 3RMMH 5GWZA 4Q7ZA 1OP8A 2LPRA 3HKIB 5CHAB 1PFXC 1UTPA 2ZFFH 1P04A 1GHBF 3GDVA 1EX3A 1SLWB 3LGUA 3A85A 2ZCHP 4B76A 4X6NA 2BD2A 3MYWA 3QGNB 4H6SB 1QRWA 3BTQE 1SQAA 3GCTG 1P09A 3LGTA 2ZEBA 1OP0A 1GHBG 5GJ4B 3ESTA 1PPBH 1NZQH 4F49A 1V2OT 2C8XB 3MHWU 3LIWA 3MO6A 1QL9A 1V2VT 3ENSB 4BAOB 1BTUA 2VIPA 1K22H 2ZNKH 3HATH 2ZHQH 2ZI2H 1P01A 1OPHB 1AE8H 3P92A 3PTBA 3URDA 1PPEE 3A7ZA 1RD3B 1MTVA 1DLKB 3UTUH 1YPJH 1OSSA 1W10U 1WTGH 3CP7A 1EAUA 5DP6A 1W12U 3QGJA 3GCOA 5HM9A 3JZ1B 3PROA 3ZZ9A 2HWLB 1WU1A 3UY9A 2G81E 4JK5A 1SOZA 4YOGA 3A7TA 3UNSA 3MNCA 1F7ZA 2ZECA 3A84A 3TIUA 3RMOH 3SUGA 3MH4A 4K69A 1ELDE 2Z9GA 4UFGH 4NG9H 1CHOF 4BTUB 1BMLA 1LKBA 2A4OA 1X7AC 1S82A 3PTNA 3A7XA 1V2NT 3Q3YA 1GMDF 2LNCA 4IC5A 1SGNE 5FHTA 3U8TH 3IWMA 2AGEX 1TQ0B 2IJOB 2ZU3A 4GHQA 1CHOG 2ZDNA 4VGCB 3SV8A 3F9GA 1C9PA 4U32A 4YM9A 2VGCB 4Q7YA 1GMDG 3SHAH 1P8VC 1NTPA 1DM4B 3RXJA 5E0HA 2JKHA 5I46H 2V3OH 3SV2H 1SLXB 5JDUB 1AU8A 1CU1A 1PPFE 3DD2H 3FZZA 1SFQB 4B2BA 2PKAB 2SGEE 2UUFB 3RXUA 1DFPA 1ZLRA 1UO6A 1OKXA 3E90B 4Y8XA 2CV3A 3M5MA 1TMUH 3DHKH 4FUCA 4A5TS 2DUCA 3V3MA 1C2DA 1LHDH 1EOJA 2A5IA 1Y3VA 2AERH 2P93A 3ELAH 3RXIA 4XBDA 1GCDA 3EGKH 1KXBA 1ZSJA 2D2DA 3QUMP 2GP9B 4B75A 1P3EA 4UFDH 1FAKH 4GUXA 4X6OA 2P3TB 3ITIA 3UNQA 1C2MA 4A7IB 2H9EH 1A4WH 1DUEA 3LU9B 2PUQH 1CHGA 1RIWB 1NROH 4RKJB 3CENA 5FBIA 2B0FA 2BDCA 1JIRA 1C2IA 1W0YH 1SLVB 2J34A 4DIHH 6CHAB 4WH8A 3TK6A 3VB5A 1F2SE 1B0EA 4CBNA 5C3NA 1J9CH 2QAAA 3SZNA 1GCTC 5EQSA 1GI7B 3M3TA 4X2WA 3HK3B 1HCGA 1KTSB 1QQ4A 3ZVGA 2XNIA 4YO9A 3AVZA 1O2WA 4Y10E 3STIA 3ZZAA 1AO5A 3BTHE 1AVXA 2UUKB 2VINA 3JZ2B 1ETTH 4U2WA 1YLCA 3QX5H 1AKSA 2ZC9H 3DT0H 5K0HA 4MNWA 7KMEH 4Y8YA 3K2UA 2BB4A 3S69A 1GJAB 1NC6A 5EG4A 4OGYA 4NA8A 5T6DA 4ZHMU 3PMJA 1O32A 3BEUA 4TY6A 4X8UH 1KXDA 1OP2A 1ANEA 1MH0A 3UIRA 2P16A 1YPMH 4B71A 2R9PA 2Y82A 1GJ7B 3E0PB 1O31A 1P05A 1TFXA 1ZOMA 3ZYEA 4HZHA 2A5AA 3BV9B 4ISHH 2O8TA 2H9TH 1CT0E 2BOHB 2Y7ZA 1MCVA 4E7NA 4IMQA 1FJSA 1G2MA 4KKDA 1OXGA 1GVKB 1AD8H 4WMEA 5H4IB 1O2MA 1NU7B 1CGHA 3QWCH 1O5EH 2A4RA 7ESTE 4MG3A 1HAPH 3VGCC 2QA9E 4JYTA 1S84A 6ESTA 1LPZB 1NY22 3MNSA 1XVOA 3RXMA 3AW1A 1CA8B 2QXJA 4HTCH 1HAVA 2OBOA 1JXPA 3QO6A 1SQTA 4BTIB 4X1PU 2R0LA 1S85A 1PYTD 5FBEA 2PGBB 4ZKNU 1THSH 1THRH 3RXDA 5A8ZA 2J95A 3T2NA 1ZGIA 3TJNA 1F0TA 5A0BA 4IW4E 3GY4A 3SNDA 1CT2E 3VEQB 5EGMA 4CRBA 3MNBA 3RXGA 2FTMA 1UMAH 1D6RA 1GVZA 2BLWA 2FOAA 3P70B 5EXNA 1C4U2 3ZZ5A 4I8KA 1ESBA 3ZVBA 3ZZBA 1GBIA 2J2UA 4ISNA 2GGVB 2F9BH 5AHGH 1C5QA 4TPYA 1O37A 1W7XH 1N8OB 2QV1A 3FANA 2WUCA 1V6DA 1P2KA 2FXRA 4AGKA 3KL6A 1GBTA 1JMOH 1OOKB 2ZGBH 1YM0A 1ETRH 1DPOA 3GICB 2RCEA 2ZKSA 1E38B 4NIXA 1MTNB 2QCYA 4Z0KA 4DGJA 1HB0B 2OC0A 3SV6A 5AFYH 1EKBB 3SUEA 3KQBA 1UTLM 2O8LA 4ISOA 3O8RA 2FOBA 1O3HA 3BIVH 1GGDC 1RJXB 3M7UA 2ZHDA 3MMGA 1AN1E 4NA9H 2VIVA 2OP9A 1W8BH 3GY8A 3PLBA 2VIQA 2Z7FE 2BQWB 1L4ZA 5DK1A 4DOQA 1BTWA 2WPLS 5JYIA 2RA3A 4NFFA 3E3TA 1K1OA 1KDQB 2ZDKA 1YPHC 5FAHA 1T8LA 1GHXH 2FP7B 1GI2A 3A87A 1BTYA 2WPIS 1P06A 5FX5A 1MD7A 1TONA 2BYAX 1IQMA 4TYDA 5HYOA 5CE1A 4AG1A 2FOCA 3IITA 1A5HA 4JYUH 1QA7A 3F9HA 2TGPZ 1V2MT 2ODQA 3MU5A 3SNBA 4FUGA 1D9IA 2Y7XA 1L0ZA 4I32A 5I25A 1GHWH 2VIWA 1G36A 2Z6BD 1C5MD 5LPFA 3UNRA 1D3DB 3GDSA 1HXEH 4NZQA 1F0SA 3M35A 3LGVA 4JZ1A 5T6FA 4CR9A 3M7QA 3K6ZA 3L6PA 5PTPA 1O2UA 1A0HB 1HAGE 1GJCB 3AW0A 2SNVA 1GJ6A 3PO1B 3ZVFA 5E0JA 1G3CA 3URCA 2BD8A 3MI4A 1IQLA 1DLEA 2PSYA 1AWFH 4KELA 3UFAA 2BD4A 4CBOA 1HAHH 1G3EA 4WMDA 4XBCA 5F8TA 5C2ZA 1TNGA 2BDIA 3OX7U 3A8DA 1MD8A 3KNXA 2BZ6H 1T8OA 2QGRA 1QQUA 1ELEE 2W5EA 2C93B 2R3UA 2A0QB 1A2CH 2BM2A 2BY9X 1HFDA 3PWBA 2WPHS 1UVPA 5C5NA 1NPMA 1MBQA 4DIIH 2IOTA 2ALPA 2WYGA 2QN5T 1QB9A 4CRDA 4AYYB 2NWNA 1UTQA 1GBFA 1ANBA 1EATA 3LKWA 4ASHA 3TGIE 1FDPA 1EUFA 3FZDA 2BXTH 1TGBA 2CMYA 3ZV9A 4AFZA 1Z8IB 3TH4H 2HNTC 3SV9A 1MQ6A 2QY0B 2HPPH 5DO4H 3QTOH 3HPTB 5B6OA 3UR9A 2Q6DA 1OWHA 2J4IA 1GVLA 1P2IA 4Z6AH 1AQ7A 1JRSA 1B7XB 5C67A 3KCGH 2A5KA 1DITH 5EPYA 1MCTA 1P12E 1T8MA 3RXCA 5GDSH 1BRCE 4MQAA 4AN7A 1A5IA 1AMHA 2F3CE 3E0NB 2GCTC 3Q77A 2OUAA 3SJOA 2C8WB 2AS9A 2JETC 1SGIB 3SN8A 3GY5A 4J1YA 1GDNA 4FU8A 5T6GA 4BAKB 2W26A 4FVBA 1Y3YA 3NKKA 4JK6A 1F5KU 3RU4T 1TPPA 1FY1A 1BJUA 1E36B 2W3IA 1HJ9A 3TGKE 1V2JT 5L2ZH 3V12A 5EPNA 5A0AE 1GMHF 2G5VA 4WF8A 3H7TA 1HPGA 4RSPA 2A7HA 1EJAA 1GHAF 1OWDA 3M37A 3PWCA 3LC5A 4MDSA 2AGIX 1YPKH 2OINA 4X1SU 3TNSA 2BX4A 1LCYA 2ULLA 2FI4E 3SOSA 5C1YA 1GMHG 1J16A 2RDLA 5C1UA 8GCHF 2BX3A 2NU1E 1GHAG 1Q3XA 3SGQE 1TB6H 5TCCA 3ZZ3A 3AASA 1XX9A 3MH7A 3ZVEA 5ESBA 4LOYH 1KXCA 1ORFA 1PQ5A 1Y59T 1GBLA 2OLGA 4ABJA 5LPRA 3GY7A 3SU2A 5JBTA 2BD3A 3T26A 4GHTA 8GCHG 5DP7A 4DVAU 1N6XA 4TWWA 1CGJE 1IQNA 1O3CA 4X8VH 1OX1A 1OYQA 2VVUA 1GWAA 1QBVH 1KTTB 4MPXA 5FCRA 2RA0A 4THNH 4A1VA 1HJAC 3EA7A 3SU0A 1K9OE 3A7YA 1CA0B 3LH3A 1CE5A 3NUMA 3GCTF 1ZTJA 4ABDA 1HIAB 2P59A 3QLPH 2BZAA 3ODFA 2WPKS 1VJAU 2XBXA 1TQ7B 3BTKE 3TK9A 1MBMA 4JMYA 2XC0A 1LVMA 1T8NA 1WV7H 1MKXK 1ELBA 1T32A 1P9SA 2TGAA 2XC4A 4OS7A 4JZFH 1P57B 3KF2A 2STBE 1C5WB 1AHTH 1FY4A 2FOGA 3P8GA 2PHBA 1O2VA 2O8WA 4X1QU 3BG4B 2SGQE 3UPEA 1SL3A 1FUJA 3SUDA 4F4OC 3LC3A 1FQ3A 4YOIA 2Z3EA 2VNTA 3KQCA 5LPEA 2VWOA 2GDDA 2RG3A 1OWKA 2TRMA 3ZZCA 2FODA 3ATWA 3M5OA 3SNAA 3UOUA 3ZZ8A 1GI9B 3MWIU 2V35A 3RMNH 3PM3A 4CHAB 2VVCA 1U6QA 2QIQA 5EOKA 1MMJN 1GBBA 3MNXA 4R8TB 1JBUH 4Y0ZE 4B74A 1DOJA 4K8YA 2D1JA 1CBWC 1H9HE 3MTYA 3S9AA 1INCA 2A2QH 4YZUA 1XKBC 2GMTB 4UONA 1C4V2 3S0NA 2AEIH 4X2VA 1PPZA 3P6ZB 2R0KA 3TGJE 4FUHA 1SGEE 2ZFRH 1FV9A 2D26C 1DWDH 4IS5A 2VIOA 1SVPA 3A88A 1NS3A 2R3YA 2Z9KA 1OWEA 3R3GB 1DWBH 3U1JB 3RXPA 2CN0H 1KXAA 2Y5GA 1F0UA 4UEHH 3T5FH 1V2WT 3B8JA 1N6YA 5CHAC 1SGYE 1EPTB 3LPRA 4DG4A 4JYVH 1H8IH 3UWJH 3RXQA 3ZVCA 1V2ST 2ZP0H 1ELGA 1UVTH 1YCPH 4JZDH 1IQIA 2WV5A 2GKVE 1K1LA 1S6HA 3W95A 1ZHPA 5FPTA 1UHBB 3K6YA 2ZZUH 1EOLA 1SGFG 2B5TB 1C1PA 4A1XA 3SQEE 2O8UA 3TLOA 4O9VA 1QL8A 5FXLA 3SV7A 1C9TA 1EZXC 4FU7A 2A45B 3KHVA 3GDUA 4B2AA 2PKSB 3E91A 1JIMA 2VH0A 2F83A 3LONA 1A61H 1SSXA 1WUNH 1YYY1 1TLDA 1BOQA 1RXPA 2CF9H 3F6UH 1A0JA 1G3BA 1HAOH 3RC5A 3RXKA 1DY8A 3NWUA 4ZHAA 1LTOA 3F9EA 3EA8A 3GYLB 1O2RA 4O97A 1EAXA 4ZKRU 3QZQA 4JZIA 2CHAB 4GLYA 1VJ9U 3RP2A 3PLPA 1G2LA 2BY6X 2XBYA 1DT2A 2Q6GA 1B0FA 2FESH 3VXFH 4AB8A 2G55A 3M5LA 2VH6A 1B5GH 2QF0A 2P3FH 1BRAA 1LKAA 1MTUA 2GX4A 4FUEA 3T25A 2OQ5A 5A2MH 1EASA 2ZU2A 1EXFA 1Q2WA 4SGBE 1MU8B 1KXEA 2P94A 1ABJH 1D3QB 2CF8H 4VGCC 5K7RA 4BXWA 4K5ZA 1BQYA 1S83A 2J38A 2VGCC 1TAWA 1IQKA 2H9HA 4FUIA 1AUTC 1O3EA 1O2KA 2FI3E 3FFGA 3HK6B 1OYTH 5A8YA 3VB6A 2R2MB 2ZWLH 2OCVB 1O34A 1FY5A 1O2YA 2F9VA 1C5VA 3RC6A 5AFZH 1V2UT 1SBWA 2ILNA 1SGTA 4I8GA 1ZPZA 2KAIB 5SGAE 1AFQB 1O3BA 1BB0B 5DJ7A 5DPAA 2IPHA 2WV4A 4D76A 4O3UA 4U01A 3A81A 3R0FA 3SO3A 1SLUB 3TNTA 1QJ7B 1C1OA 1QNJA 1AZ8A 1BBRH 3HGPA 3PMHB 3VFEA 5JBBS 7GCHF 4ZAEA 4H4FA 2AGGX 2PKSC 2G00A 3RXSA 1P11E 1S6FA 4K60A 1O33A 3O8BA 1O2NA 1ANCA 1O3OA 3O8DA 2XBVA 4YLQH 1ZHMA 1O2IA 4I33A 4WMFA 4R0IA 7GCHG 1A0LA 3RXOA 4ZUHA 3A8BA 1E0FD 1RIWC 2ZF0H 2ZU5A 1NM6A 4J2YB 1JWTA 2ZU1A 2GDEH 3AAUA 1VCQA 6CHAC 3TJUA 1O30A 1Y8TA 2CHAC 1NFWA 3UOPA 3WY8A 4WVPE 4K1EA 1C5LH 4ISLA 4E06H 1XUHA 1BZXE 2BDGA 1K1PA 1ELAA 4DT7B 3BTME 3V13A 3PMAB 4Q7XA 3SJIA 1TPOA 1AWHB