3UOPA

Bovine trypsin variant x(triplephe227) in complex with small molecule inhibitor
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGFYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 51
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3uopA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3uopA02
1O34A 3VEQB 2OUAA 1WCZA 1XXFA 3CS7A 5F8ZA 3SV9A 1TNLA 1P2QA 4MNXA 2O8MA 1T8OA 3BTWE 4GPGA 4ISHH 4MPVA 1GBIA 2STBE 2BD3A 1EPTC 1EP6A 3K65B 1GBCA 3F9GA 1G2MA 2ZDAH 5DPAA 4NA8A 1K22H 4TY6A 3A8DA 1E34B 2WUBA 1D3QB 3SNAA 2O9QA 3URDA 3M3VA 1GHBG 3FP8E 4X2YA 1IQMA 1Y3XA 4O3TA 1GHZA 3SNEA 4X8UH 1FIWA 2ZCLP 2QV1A 1O2TA 2A45B 3P8OA 4UFDH 3RXVA 4DT7B 1PFXC 4GHQA 1T8NA 4MVNA 1HNEE 3P92A 1D3TB 3MU4A 3SBKA 1MD8A 1B0FA 1O5DH 4BNRA 1GPZA 2P95A 6CHAB 4B73A 2TPIZ 4J2YB 1HIAB 4YLQH 1NRRH 2PR3A 2F9UA 1KXFA 1DY8A 1IAUA 1WTHD 2FOAA 2WYJA 1ANEA 2XC0A 2SGPE 1ZPZA 2FZZA 3R0FA 4UD9H 1T8MA 4FXGH 3NXPA 1L2EA 1O2MA 1ZJDA 3E3TA 4Z6AH 1GVLA 2JH0D 1XXDA 1VITF 3ZVGA 1UCYH 5DP4A 2SGAA 3SO3A 3SU0A 1Z8GA 3VB3A 3TGKE 1NFXA 5F8XA 2ZHQH 2FODA 1V2MT 2BMGB 2O8WA 3STIA 1ELBA 1O3OA 2K1QA 1RTFB 3ZZ5A 1BHXF 2HVXA 3MNCA 2Y5FA 4Y8XA 5E2OA 2ZHWH 1GBEA 2A5AA 2UUFB 1LVBA 4JYTA 1OP8A 1NROH 4BAOB 4ZROA 3A8CA 2W26A 1TRMA 1CGJE 2OP9A 4Y71A 4ZMAH 1P2OA 3ZZ9A 2Q6FA 1O2KA 4I32A 3UY9A 3M3TA 1F5LA 5DP3A 3F9EA 3BTGE 3ZV9A 4NFFA 1QRWA 1GHYH 2PSYA 2F91A 1AN1E 3DHKH 2UWPA 3QWCH 4MNVA 5BPEA 2OINA 2V3OH 1A0HB 1GBLA 2B8OH 2JETB 4JZDH 4TWWA 2W3KA 2G81E 3A82A 4U30A 1ELVA 1C1MA 4D7GA 3BEUA 1C5MD 1TNIA 4MQAA 4B2CA 4FUGA 2J92A 3RXLA 1GCTB 1SMFE 1JMOH 1NRPH 1JIMA 1B0EA 3MH5A 5AFZH 4AG2A 1TX7A 1KY9A 1O3LA 2SNVA 4LK4A 5GIBA 1PYTD 4NG9H 5LPFA 4K8YA 4CRAA 1J16A 4DCDA 2ODQA 1CSOE 2HPQH 3KL6A 1TQ0B 2AERH 5JPMH 1Z1JA 5E2PA 1C2IA 3RXOA 4ABAA 3HK6B 1UHBB 4B1TA 1A2CH 3OY5U 4ZKOU 2RDLA 2XCNA 1YPKH 3ZZAA 1Z71A 2A7HA 1W10U 1TPAE 2FOFA 1GWAA 2C93B 1HJAB 2BHGA 2W7UA 1F92A 1TONA 3ATLA 1S84A 4B2AA 4UEHH 5FAHA 3F9FA 4TPYA 1QRXA 1ZMLA 4CREA 1Y59T 7ESTE 1DOJA 1VZQH 3QLPH 2A32A 3PMBB 5E8EH 4INHA 1O5AB 5FBIA 3SHCH 5LPEA 2PW8H 1C2LA 2HGTH 1ETRH 1MQ6A 1C2HA 2XW9A 8GCHG 1JOUB 2ZKSA 3SU5A 1GGDB 4WVPE 5EXLA 1TPPA 4ABFA 2NU4E 1O3KA 1FV9A 4IMZA 4FVBA 3RXKA 3S9BA 1O0DH 4X1NU 1HAZB 2KAIA 3HPTB 1CHGA 3BF6H 4BXWA 1TQ7B 1G3CA 3RMNH 4XDEA 3SU4A 1ELFA 3DUXH 3PROA 2BY9X 3ZZ6A 4ZHLU 1GJ5H 4Y11E 3E16B 3RXSA 1OP0A 1FLEE 1K1MA 5ABWA 1ZGIA 2QAAA 4XBBA 3SJIA 2BDCA 4U01A 1O3BA 2Y7XA 3LGYA 4IBLH 1QJ1B 3I78A 2FEQH 2ZGXH 1N6XA 1S81A 3H7TA 7GCHF 1HAOH 4TWYA 1PQ5A 4CH8B 1HAGE 2BZAA 4WMFA 1C2DA 1JBUH 1LDTT 4GLYA 3AASA 1UVTH 4YLUA 2P16A 2C8YB 4FUHA 4R0IA 2ZDVH 3HGPA 3FVFB 3E90B 2QXGA 1G36A 1FN8A 1H9IE 4AZ2B 2ZZUH 4QT8C 1AE5A 1TB6H 1EASA 1SGCA 1TA6A 1YLDA 1YM0A 2OXSA 1T4UH 3A7ZA 2GGVB 3A7YA 2ALPA 2GT8A 3S7KB 1GMHG 2XCFA 5FPTA 3CP7A 1C1QA 1C4U2 1TGSZ 4I8HA 4IC6A 1SSXA 3AAVA 1HIAA 5DP7A 1SHYA 2O8UA 2XBWA 1O2PA 1C5XB 2F9PA 4PROA 3SU1A 1BTUA 2F3CE 3RU4D 2BDGA 1CBWC 5A8ZA 3MO9A 1SB1H 1PPFE 4ISIH 1JIRA 1A5HA 3ZV8A 1O3AA 4I8LA 2ZFPH 1HB0B 1THSH 4HTCH 1BRBE 3LPRA 1C5LH 3TVJB 4XSKU 4VGCC 1O2OA 1NU9A 2G5NA 2ZCKP 5DP5A 3O8CA 1S0RA 4NA9H 3ZVEA 1BHXB 4BAHB 3PYHA 3ODFA 3AAUA 1DWCH 1DANH 8ESTE 1GBJA 1LHFH 1S6HA 1EJAA 2ZHEH 1BRCE 1QBVH 1HUTH 2ANMH 1PQAA 2B9LA 1FY5A 5IYTA 1UTJA 2GT7A 2M5TA 3BIUH 1PPHE 1FY8E 3SQHE 3BTKE 1YPEH 5T3HA 1JRSA 4KGAA 3SV8A 4ABBA 2QYIA 1C2EA 2QF3A 2PUQH 1P03A 2VIPA 2QXJA 1AWHB 3V12A 2ZQ1A 2UUJB 3A83A 4GSOA 4R8TB 5F03A 1GBBA 5E0HA 1ARBA 1V2PT 1C1OA 2Y80A 2IPHA 3MMGA 4B2BA 3M7QA 1O2WA 3ELAH 1VITG 1BBRK 1DT2A 3CENA 3UUZA 3RXBA 1YPMH 1UCYE 1SLVB 1UK4A 1O2RA 4IC5A 3MTYA 1T4VH 1PQ7A 1G37A 1KXBA 1B5GH 5C3NA 4FUDA 4O9VA 1UTQA 3AVZA 4JZIA 1M9UA 3BTTE 2HNTF 1EPTA 1UHBA 3RDZA 1J9CH 2VIDA 3UQVA 1N1LA 4Y7BA 2QA9E 2W3IA 3F6UH 2C4FH 2R0LA 3L6PA 5ESTE 3U98H 1BRUP 1H8DH 2H5DA 3A7VA 4WMEA 1GBFA 1O3CA 4E06H 1K21H 1C5PA 1BUIA 1MMJN 3LGUA 1LCYA 1G2LA 1FAXA 1P06A 1JRTA 1S5SA 1SGYE 3Q3XA 4K1SA 4NZQA 3ODDA 3RXMA 2A7JA 3EA7A 2H2ZA 3GCTF 4WH8A 1O35A 1C5NH 5A0AE 2ZFRH 3A87A 1OWHA 1C9PA 4ABJA 3M5MA 1SG8B 1Y3VA 3SGQE 4DOQA 1IHTH 2VIQA 5ESBA 1F7ZA 2BX4A 3ITIA 1AMHA 4DIIH 1C5OH 1NPMA 2FYQA 3A8AA 4NSVA 3RMMH 3STJA 1YC0A 3PMHB 5EODA 4NGAH 1V3XA 2BDBA 2H1UA 2HWLB 4FU8A 4YO9A 1C1UH 1CBWB 1WTGH 2VGCC 2FDAA 4IGDA 1E38B 1GI8B 1FONA 4YT7H 1OWKA 5EQRA 4K8BA 2Z3EA 3PTBA 1DLKB 2JH5D 2ZGHA 1MAXA 4X6MA 4ZKNU 1EZUC 1P11E 2G00A 1CVWH 2ZPRA 1A5IA 1QIXB 3IITA 4VGCB 3W95A 1EZQA 2GCHF 3EQ0H 3SJ9A 4ABIA 3ESTA 4A5TS 1DDJA 1KTSB 2HNTC 1O3NA 3ZVDA 2W7SA 3SV7A 2BLVA 3HATH 2ZGJA 3TIUA 3MH4A 3LDXH 3GCHC 2FTMA 1O37A 1EXFA 3QUMP 2FPZA 3ZZ7A 4Q7YA 1O2JA 2Y5HA 1DICA 1J14A 1PPBH 1XUGA 3A85A 4GHTA 1GVZA 1LKAA 1MTNC 2BXUH 1MZAA 2JH6D 2WPJS 2GKVE 3Q76A 2ZTXA 3SUDA 1N6YA 5EXMA 1G30B 3UR9A 1GVKB 4B76A 1BDAA 5JBBS 4AFUA 4MG3A 4K1TA 1GJ8B 1J8AA 1GI9B 1A1RA 1Q3XA 2ZC9H 1A5GH 5DP6A 2AFQB 2Y81A 4Q7ZA 3RXUA 1QHRB 4DG4A 2QXIA 2XC5A 4B74A 2VVCA 1BBRH 3KNXA 1C5VA 1TIOA 3M5OA 2VIVA 4WXVA 4BTTB 2I6QA 4ZHMU 2Q6DA 3VXEH 1V2LT 1WUNH 3RXCA 7GCHG 3MHWU 4CRDA 1FQ3A 1KLTA 1ZTLA 1FZZA 1NFUA 2ZGCA 4B75A 5JBTA 3KQDA 4D8NA 1O3JA 1P12E 1EZXC 1TMTH 1EAIA 5DK1A 2OC1A 3RP2A 2P59A 3SGAE 1GBMA 3T5FH 3M3SA 3ATIA 1HJ8A 2XBYA 5GJ4B 1TA2A 2ZA5A 4AORA 1GL0E 1U6QA 1T32A 5A0BA 4KKDA 1GJAB 5AHGH 4YOIA 2CN0H 2P3UB 1HRTH 3M5NA 1VGCC 1QA7A 1C9TA 5C2ZA 1YKTA 4UDWH 2R3UA 1RRKA 1ZZZA 4B71A 2FTLE 5JBAS 2RG3A 1HBTH 1KDQB 1QL8A 1Q2WA 3LH3A 2QN5T 1XUFA 3GY5A 2ZFFH 1O36A 6GCHF 1GCTC 3V3MA 1UVOA 4DW2U 1O2QA 4NIYA 2J95A 3LJOA 3SOSA 2VGCB 3WY8A 2YNBA 3AW1A 2HNTE 2VU8E 3QTOH 3U69H 2WV4A 1LQDB 2BQWB 2G5VA 1OYTH 1DWBH 3QDZB 4OS2A 3Q3YA 1TNJA 3O8DA 1Y3WA 4FUBA 3PMJA 2Z9IA 1UMAH 5HGGA 2BYAX 2PTCE 1TNGA 2BD8A 3JZ2B 4ISNA 5BRRE 3U9AH 3ZVAA 1C5UA 1F2SE 1NTPA 1ABIH 1MTVA 1S82A 1TNHA 2BLWA 3UPEA 3GCHB 1TGNA 3NPSA 3T26A 1HJAC 3GY6A 1S83A 3BEFB 4OGYA 1D9IA 4KTSA 4X2XA 3F1SB 1MTNB 2BDYA 1AZ8A 4RN6A 1P3EA 3SNCA 1V2RT 1EJNA 3ZZCA 3M7TA 1LHCH 3P8NA 2ZU2A 1TMUH 4FU9A 5J4SA 4DURA 1FXYA 3UOUA 3RC6A 2BVRH 3KIDU 1GGDC 3AW0A 3E8LA 1FPCH 1O5GH 4X8SH 1LVOA 5HM2A 2R0KA 3MOCA 1PYTC 1TOCB 1D4PB 2NU1E 2VVVA 2JKHA 2WPKS 4OS6A 3ZVCA 1O2YA 4DJZB 1GJ4H 4OS5A 1WV7H 2PSXA 4JYVH 3GDVA 1QY6A 4WH6A 2BQ6B 3SU6A 8KME2 1LHDH 2FMJA 1DFPA 1EAUA 2ZEBA 5GWZA 1AFEH 3A8BA 1BRAA 2ZHDA 5ETXA 2Q1JA 2VWLA 1TOMH 3Q3KA 2A1DB 2YNAA 5DKMA 1YYY1 2ZQ2A 2G4UA 1IQNA 3TLOA 3H7OA 2GVFA 2WPIS 2TBSA 2ESTE 1ESAA 2WINI 4HZHA 3GCTG 2GCTC 3L33A 4HFPB 1EP5A 1AVWA 2BD9A 1HLTH 2QIQA 2C90B 2VH0A 1TPSA 1V6DA 4FUFA 1WOFA 2Y7ZA 2G52A 5HMAA 1MH0A 4AYYB 3RMOH 4O03A 1VGCB 2XC4A 1SLXB 1QJ6B 5E0GA 1SQOA 3HKJB 2BY8X 1GI2A 2BDHA 1SPJA 1LKBA 5FX5A 5C5NA 1EX3A 4WY3A 2ANKH 1QFKH 1ZSKA 3SJKA 1AZZA 1NRSH 3RMLH 4CBOA 2HALA 3NUMA 4NIWA 1AU8A 1C5YB 4AGKA 1P2MA 3VXFH 5C1UA 2VIOA 1TFXA 3PMAB 1AWFH 4AX9H 3PO1C 1C2FA 1W3CA 3HKIB 1BTYA 4ISOA 4Y7AA 5HYOA 3S7HB 1O2GH 4NIXA 1KYNA 3T27A 1OSSA 2GCHG 4CR5A 3ZZDA 1HV7A 1P0SH 1K2I1 1BT7A 3B23B 1AY6H 1L1NA 1CT2E 5AF9H 2BLQA 2NWNA 3P70B 1YPLH 3I29A 2BZ6H 4IN2A 4IN1A 3RC4A 4BAQB 1GL1A 1Y5UT 3RXIA 3URCA 2NU2E 5EG4A 1TBRH 1D3DB 3TJNA 1XMNB 3MNSA 1C5QA 1XVMA 1FPHH 1H4WA 2BDAA 3K9XB 1CE5A 2FS9A 4CH2B 1KIGH 2A5KA 1NC6A 3ZZ8A 5CMXH 1GJBB 3CS0A 2VH6A 1G3EA 1BITA 1UTKA 1W7XH 2P8OC 1QL9A 3KEEA 1VCWA 1Z1IA 2G4TA 1IOEA 2FX6A 1HFDA 1SBWA 1XX9A 1BZXE 2J9NA 2BOKA 1O39A 3RXHA 4BANB 1KDQA 1BCUH 1SFIA 4AFZA 1AGJA 1C5TA 1FMGA 2F9NA 1FIZA 4U2WA 3KHVA 1BBRE 5L2ZH 3F68H 1TYNA 3PWCA 5CHAC 2BOHB 1C5SA 5FPSA 1KXEA 1QA0A 1PPEE 3UFAA 1G9IE 1NFYA 1SGFG 2THFB 4UFGH 3U1JB 1WYKA 4X6OA 3D65E 1RIWC 2ZECA 1GJCB 3HGNA 2PKAB 2P93A 5LGOA 3P17H 1C4V2 3PB1E 3UTUH 3KF2A 2GDEH 2OD3B 1TGCA 4JCNA 5FX6A 1SGDE 1HAYB 3LGIA 2BD4A 1TBQH 1Z8JB 1DLEA 1DUEA 1MBMA 2GCTB 4ABGA 3MU8A 3G01A 1UTNA 1HAVB 1UTOA 1Z6EA 1LMWB 1BJUA 2FIRH 2CF8H 3GY2A 3TK5A 1C1VH 1GMCF 4CRFA 4GUXA 2FLRH 4YESB 2UUYA 1KLJH 2BQ7B 2LNCA 1NESE 1C2KA 1E0FD 4GCHF 5T6FA 1A4WH 4WF8A 6GCHG 2BX3A 2OQUA 3QX5H 3GY8A 3FANA 1QR3E 2TIOA 1HCGA 1J15A 3FZDA 3SNBA 1V2KT 1A46H 1SVPA 1LHGH 4IMQA 1HYLA 5GXPA 1DY9A 1QCPA 3T25A 1TMBH 1GG6C 1S6FA 3PO1B 2ZF0H 1ELAA 3F9HA 4KP0A 5JBCS 1V2TT 1A0LA 1ESBA 4X1SU 1O5FH 4E7NA 2AYWA 2J2UA 4MPUA 2A2QH 1SHHB 3RXPA 2VWOA 3SI3H 1FAKH 2ULLA 1TGTA 2A4OA 4GVUA 5GPIB 1H1BA 3E0PB 2D8WA 5TCCA 4GAWA 2AGGX 2OBQA 3TJOA 5JB8S 2HPPH 4XE4A 4A1TA 1UVSH 1ZHPA 1J17T 1GI6A 1EB2A 1DM4B 1SGTA 2BD5A 1SLWB 3RXTA 4X0WU 2A7CA 1O2VA 2SGFE 2Z3CA 2RCEA 2VWNA 1OWDA 4Q7XA 2VVUA 2P8OB 3U8OH 2GP9B 3TH4H 4JYUH 3LGVA 1CT0E 1P04A 2QCYA 5JYIA 1GMDF 1DWEH 4UFFH 3BN9A 3Q77A 1IQJA 4JZ1A 3BTFE 1BTHH 2AEIH 2FI4E 4K3JA 4NSYA 1F5KU 2RA3A 2Z7FE 4LOYH 2BXTH 2YOLA 2BY5X 1UK3A 4XBDA 1DPOA 1W13U 3BTQE 1IQEA 3LIWA 1UTMA 1GDNA 4JZEH 1S85A 5A8YA 1Y5AT 1ZMJA 2ZDNA 1O33A 3SUEA 3UNRA 2J38A 5CHAB 4Q2KA 4RKJB 2ZTYA 1MQ5A 1Y3UA 1QRZA 3SQEE 1C1SA 1O2NA 4ZXXH 1T31A 1TWXB 1RIWB 1NFWA 1BMAA 3MH7A 3DT0H 4ZAEA 1LTOA 1CHOF 4D76A 1SGFA 4TY7A 4ZXYH 4Y76A 4DY7B 5C1XA 3RXGA 2G8TA 1QB9A 1S0QA 5I46H 5TCAA 2IJOB 2UWOA 2ANYA 1ELTA 2Y6TA 4CBNA 3RM2H 1KXCA 1NRQH 1GJ9B 1O3FA 3E6PH 1H8IH 3RXDA 2Z94A 1K9OE 1OS8A 1NT1A 3M36A 1GCDA 1BIOA 3EYDA 1EB1H 4YOGA 1K1PA 2SNWA 4LZ4B 3SV2H 1VCQA 1EKBB 1XVOA 2A31A 1GDQA 1K1IA 1TX6A 3LC5A 2BDIA 2ZPQA 4Y0YE 4A1XA 3B9FH 3PLBA 3BTDE 2VINA 2ZDKA 2AMQA 5B6OA 1CA8B 2A2XH 5EU8A 1OWJA 1SLUB 1GHWH 4I8KA 1SC8U 4M7GA 1RD3B 2WYGA 3BIVH 1GG6B 4X2VA 4ZHAA 4AGJA 1YP9A 4XOJA 1DSUA 2BD7A 4Q80A 4YM9A 1ZPCA 2VWMA 1MD7A 1ZRKA 5C1YA 4BTUB 2FI3E 2GX4A 1ARCA 1Z6JH 2OC7A 5EOKA 4AFQA 4NZLA 3DD2H 2CJIA 2Y82A 1K1LA 1VR1H 5A0CA 1E36B 2F9VA 2J34A 2PKAA 1O3DA 1CQQA 1ZPBA 1V2ST 1E37B 2EI8A 5PTPA 2AGIX 3R3GB 1P8VC 3KQCA 1LPKB 4ISLA 5JB9S 1TPOA 2DE8A 3O8BA 1A7SA 1Y8TA 1K1JA 2GV7A 1O5CB 3MU1A 5G4BA 1WU1A 1BMLA 2H9HA 3UNSA 3ZZ3A 2WV5A 1T7CA 2PLXA 1DSTA 2VNTA 1HAVA 1SR5C 1P02A 2SGQE 1UTLM 1P9SA 2F9OA 1GI1A 4LXBH 2PKSC 4NIVA 1ZGVA 1Y5BT 1GI7B 3TH3H 2FOCA 1W11U 3MWIU 4ASHA 3TJUA 3VGCC 1P09A 1CA0C 2G51A 4H6TA 4ZKRU 1MTUA 2A0QB 3ZYDA 4FUCA 4NWKA 2D26C 1KLIH 5FPYA 3SHAH 3S0NA 1OXGA 5K0HA 3ZYEA 1NRNH 3ATMA 2XRCA 4Z0KA 2ZGBH 1YLCA 1NO9H 1BMMH 1AKSB 1F0RA 4OS4A 1SGPE 2VJ1A 3FFGA 2CV3A 1FI8A 4MLFB 2G55A 5DO4H 1AVXA 1SL3A 9LPRA 5IDKA 3BEIB 1ZSLA 2R2WU 2BTCE 1AFQC 2PWXA 3MNXA 1QJ7B 1MTWA 1EOLA 1TX8A 1GDUA 1F5RA 3EAJA 1RGQA 1GBAA 3MFJA 4X8TH 1HJ9A 4UFEH 1O3MA 5T6DA 3LKWA 2LPRA 1GJ6A 3UWIA 3TGJE 1GI3A 2BB4A 2ZPSA 2TGDA 2CGAA 4GCHG 1PPZA 3FP6E 2P3FH 1ZMNA 3MU0A 1CO7E 4UONA 1MBQA 4JMYA 1DXPA 2B5TB 1O2LA 5TJXA 5L6NH 1AHTH 1IQHA 2A5IA 3D49H 4Y10E 1CGIE 3ZVFA 4AYVB 1HAIH 3P95A 1YCPK 3C1KA 1V2WT 1GHVH 1GMHF 1HGTH 3TU7H 1E35B 3M5LA 3TK6A 4KTUA 3SI4H 1H9LB 1AB9C 1YGCH 1AD8H 1BTWA 1T8LA 2FOGA 1F0SA 2TGTA 3ZZ4A 4RSPA 2ZP0H 1P2NA 3SUGA 6ESTA 3K6ZA 3KGPA 1OYQA 1PPGE 1Z7KA 2GD4B 1P2IA 2BVXH 3UR6A 1ELCA 1EOJA 3D62A 3GDUA 1Y3YA 5LPRA 5C5OA 1O2HA 1ZLRA 2ODPA 3RXAA 3W94A 1AVGH 1TAWA 1O38A 3GY3A 5EW2H 1WSSH 1KSNA 1PPCE 3DFJA 2FOEA 1DX5M 1EZSC 1P9UA 2PKSB 3BSQA 1O2UA 4K69A 3SV6A 1GMDG 2J4IA 3ATKA 3KQBA 1MTSA 1RS0A 1UVPA 5DP9A 4MTBA 1O5BB 1SGEE 1GHAF 1BOQA 3VGCB 1P57B 2P3TB 1CA0B 4Y8ZA 2D1JA 1WQSA 2H9EH 4O97A 2ZIQH 3MYWA 3ZVBA 3TNTA 4MNYA 5K7RA 4DIHH 1IQKA 2ZNKH 2Z9KA 2XBXA 4WMDA 5GCHF 4Y79A 3RXQA 1UTPA 2FYRA 1LHEH 2Z9GA 1GHXH 3LGWA 1BMNH 1OWEA 3TGIE 1SGIB 2ZU5A 1TRNA 3IWMA 3RLYH 2F9BH 1P10A 3VB6A 4INLA 4BTIB 1CHOG 2QF0A 2ZU3A 2UUKB 2PHBA 3SU3A 3MO6A 3TK9A 1RFNA 1QTFA 5A09A 1TE0A 1THPB 3MO3A 3NK8A 5AVDA 3V7TA 2OBOA 1YPHC 1MU6B 2SFAA 4A6LA 5J4QA 1AFQB 1G3DA 1YBWA 1YF4A 3Q00A 1K28D 4YOJA 1AIXH 3PLPA 1ZOMA 1GI4A 1GJ7B 4OS7A 3SN8A 4WWYA 1CU1A 3K2UA 1TNKA 3KQEA 2OTVA 3VPKA 4H6SB 3RU4T 5EPNA 4MDSA 4FU7A 3KN2A 4D9QA 1QQUA 3QZRA 1O2SA 2XWBI 3LC3A 5EQSA 2Q6GA 3U1IB 5C20A 1KXDA 4TYDA 3LU9B 5L30H 5AFYH 2R9PA 2ZHFH 1RTKA 2DE9A 1RXPA 2H6MA 1O31A 4X6NA 3UREA 3RLWH 2FXRA 3SNDA 1HAHH 1ZTKA 1C1NA 3BG8A 2B7DH 2V3HH 2Z9LA 4K60A 4BXSA 1GBDA 3GYMA 1V2JT 4ABHA 1BA8B 3NCLA 4I8GA 2GZ8A 3A7WA 1O32A 1ZTJA 1DE7H 4K2YA 3SGBE 1YCPH 1BTPA 1UJ1A 1L4DA 4I7YH 1GJDB 1AKSA 5FCKA 1AB9B 1MKXK 3LJJA 2C8XB 1QBOA 3TPIZ 4I31A 3N7OA 2J94A 1O30A 4MNWA 2FOBA 1F0TA 2QGRA 4UE7H 2V0BA 4YTAA 2EI7A 1TABE 3LH1A 4OS1A 4WJG2 1JWTA 4Y0ZE 1DVAH 4XBCA 3VB5A 4AB8A 1AI8H 3QO6A 2AGEX 2WPLS 1EPTB 3PM3A 1HAXB 4ZKSU 5HM9A 3EA8A 3RXRA 5FBEA 3MH6A 1ETSH 3ZZBA 2FP7B 5A2MH 3GY4A 4X6PA 2OC0A 3BV9B 4DGJA 1SFQB 2SGDE 1DUAA 2ZG0H 2A4GA 3QK1A 1LVYA 1FY4A 2ZWLH 3PV4A 2D2DA 1MU8B 2GTBA 2ZFQH 1D6WA 2TGPZ 5GDSH 2FM2A 3A7TA 1FJSA 3V0XA 1QURH 2HLCA 1MCTA 1C4Y2 4NCYA 5EGMA 1GI0A 1V2QT 4LZ1H 1YPHE 1UK2A 3UQOA 4OGXA 2FLBH 2PGQB 2NU0E 1V2OT 1O3EA 2AIQA 3TNSA 3QGJA 3KCGH 3GICB 5EXNA 2Y5GA 4MPWA 2XNIA 4FVDA 1GBKA 3OTJE 1AE8H 3BTEE 2GDDA 2CXVA 4CHAC 2F83A 1L4ZA 2HOBA 3V13A 1O2IA 1V2NT 2ODYB 5JDUB 3MI4A 1LPZB 1A61H 1K1NA 1ZSJA 2GZ9A 2AS9A 3A84A 3RXFA 5T6GA 4AG1A 1QNJA 5C67A 3RC5A 1XUIA 3PTNA 1C1PA 1OWIA 2ZFTA 2A4RA 2OCVB 3NZIA 1IQFA 3BG4C 1SOTA 3DFLA 4D7FA 3A89A 4J1YA 1SGRE 3O8RA 3ENSB 2IN2A 2ILNA 3OSYA 4JK5A 3A88A 4F4OC 3LGTA 1SGQE 4RKOB 3E1XB 1BQYA 3VB4A 1O3PB 3SU2A 3BTHE 2VB0A 5CE1A 1MUEB 2Z3DA 3A81A 1K1OA 1XUHA 3E91A 3SZNA 1VJAU 2AMPA 2FOMB 1ORFA 1O3GA 3L3TA 3T62A 4CRBA 4JZFH 3GCNA 2ZCHP 3NKKA 1MKXH 5FXLA 2AMDA 1NS3A 4O3UA 5DGJA 5SGAE 1KTTB 2NU3E 1LVMA 1YCPM 1X7AC 1QB1A 1XM1A 4MPXA 1BB0B 3T2NA 4INKA 4XFQA 1O3IA 1DWDH 1BTZA 4AN7A 4CR9A 3MNBA 1ZJKA 1VJ9U 4U32A 3ATWA 3P8GA 3RU4E 1ZR0A 3SW2B 1TALA 1QQ4A 4SGAE 4NA7A 2QXHA 1LO6A 1NM6A 3EDXB 1THRH 4E05H 1JXPA 3T28A 1OOKB 1H9HE 1CGHA 1QGFA 1SI5H 3M37A 1GHAG 1W14U 3H5CB 1D6RA 3QTVH 4HGCA 7LPRA 3EGKH 3K6YA 2EEKA 2BD2A 2PV9B 5EQQA 4A92A 1C2MA 2GV6A 1Q31A 1MZDA 1W12U 1XKBC 1C5WB 1ANDA 1GHBF 5GCHG 3SORA 1RJXB 3M35A 8LPRA 3GYLB 5E0JA 1QB6A 5DJ7A 1TLDA 2CF9H 1XUKA 3VB7A 1FY1A 2H9TH 3QZQA 1FN6A 1GI5A 2ZDMA 2ZDLA 1W0ZU 1C2GA 3U8RH 3C27B 2ZU1A 1DXWA 4AOQA 3P8FA 1NY22 2V35A 4FUJA 5DG6A 1MCVA 3RXEA 1A0JA 1ANCA 4CRCA 4KTCA 2BY6X 2PTNA 2IOTA 3GOVB 4CRGA 1P2JA 4JK6A 5F8TA 4CHAB 3S9CA 1G32B 1P3CA 1GBHA 1AUTC 5EPYA 3UIRA 1ESTA 1FUJA 2ANWA 3OU0A 1OX1A 1ELDE 2I6SA 1OKXA 3M7UA 1AUJA 1YPJH 1D3PB 3TH2H 1EAWA 3TJVA 1WAYB 4ESTE 3LOXA 2OQ5A 2EC9H 1V2UT 2FX4A 1UVUH 3BG4B 4ABDA 1FY3A 2BY7X 2QY0B 2VIWA 1RTLA 1OPHB 5FHTA 2ASUB 3S9AA 1HAPH 2BLOA 2WPHS 3M61U 2XBVA 1VCPA 3SJOA 4X1QU 5FCRA 1BTXA 3SJ8A 1XUJA 1LPGB 1N8OC 1O2ZA 3E0NB 1WBGB 1C2JA 1EATA 4NWLA 4BAMB 2W5EA 3OY6U 3RUOA 3I77A 1EAXA 1MKWK 4IS5A 2FOHA 2C8ZB 1PQ8A 3GISB 1ZHMA 1ANBA 2XTTB 4BAKB 3LT3A 4HI3A 1TGBA 3UOPA 2A4QA 2CHAC 2ZU4A 3DA9B 4TPIZ 4F49A 2FESH 2GMTC 4SGBE 4WXIA 4FUEA 2B0FA 4Y6DA 2AH4X 4YT6H 2Z9JA 4YZUA 4D9RA 3RM0H 1QL7A 4DVAU 1FNIA 2Z6BD 5LH8A 3HK3B 2TRMA 1P2KA 3MU5A 2XYAA 2C3SA 3QN7A 1PJPA 1ZHRA 1ABJH 1P05A 3A7XA 2R3YA 4H42U 3RXJA 2OLGA 5DP8A 2CMYA 3EE0B 1DS2E 1ZRBA 3OX7U 2TGAA 2EI6A 2WPMS 3JZ1B 4FUIA 2SGEE 1SGNE 1CT4E 2AIPA 1DITH 4X1RU 1SQTA 1WQVH 3U8TH 4I33A 1C1TA 1AQ7A 3B8JA 4AB9A 1NZQH 5A8XA 1IQIA 9ESTA 1UO6A 2STAE 1SOZA 1NN6A 1W8BH 2ZI2H 1OP2A 4ABEA 1W7GH 1O2XA 4KELA 1QBNA 1INCA 1MAYA 1A3EH 1IQGA 4ZH8A 4THNH 2V6NA 6CHAC 3FP7E 1ETTH 8GCHF 3VFEA 3EA9A 1O5EH 2HRVA 2ZTZA 2FO9A 1SQAA 2ALVA 2ZFSA 4Y8YA 1L1JA 1ELGA 7KMEH 1HDTH 2PGBB 1L1GA 1F0UA 1GBTA 4X2WA 5L2YH 3PWBA 3GY7A 1UCYK 3FAOA 4K5ZA 6LPRA 1A3BH 1HPGA 2ZO3H 1L0ZA 4IW4E 1NU7B 3GDSA 3UWJH 2DUCA 3T29A 1EQ9A 2FS8A 2C8WB 1IHSH 4AFSA 1V2VT 1GMCG 1YPGH 4X8VH 1XKAC 1G3BA 1P01A 5EW1H 4A1VA 1B7XB 1TRYA 4ZUHA 2P94A 2WUCA 1EJMA 3PLKA 2FWWA 1BJVA 2QC2A 2GZ7A 2FI5E 3NWUA 1ACBE 3UNQA 2OC8A 2BVSH 3P6ZB 1Z8IB 2BM2A 2PFEA 1IQLA 4BOHA 2H5CA 3A86A 1C5RA 1Z8RA 3S69A 2XWAA 3IG6B 1C5ZB 4A7IB 4E7RG 1ID5H 2XXLA 3A80A 3FZZA 3LONA 3GCOA 2R2MB 1W0YH 1ZYOA 3OYPA 1C1WH 2O8TA 1N8OB 2O8LA 2JETC 3QGNB 1C1RA 5H4IB 1HXFH 5I25A 1ELEE 4X1PU 2UWLA 4H4FA 3BTME 1FDPA 5HXFA 1MKWH 2KAIB 2PUXB 4K1EA 4I8JA 1AO5A 1VITH 2CHAB 5F6MA 1HXEH 4NFEA 1EUFA 1W2KH 1TBZH 2GMTB 2EA3A 1O3HA 3TITA 2RA0A 1KXAA 3D23A 1LQEA 3SUFA
chains in the Genus database with same CATH superfamily
1O34A 3VEQB 2OUAA 1WCZA 1XXFA 3CS7A 5F8ZA 3SV9A 1TNLA 5HIYA 1P2QA 4MNXA 2O8MA 1T8OA 3BTWE 4GPGA 4ISHH 4MPVA 1GBIA 2STBE 2BD3A 1EPTC 1EP6A 3K65B 3W1EA 1GBCA 3F9GA 1G2MA 2ZDAH 5DPAA 4NA8A 1K22H 4TY6A 3A8DA 1E34B 2WUBA 1D3QB 3SNAA 2O9QA 3URDA 2F43B 4DT4A 3M3VA 1GHBG 3FP8E 4X2YA 1IQMA 1Y3XA 4O3TA 1GHZA 3SNEA 4X8UH 1FIWA 2ZCLP 2QV1A 1O2TA 2A45B 3P8OA 4UFDH 3RXVA 4DT7B 1PFXC 4GHQA 1T8NA 4MVNA 1HNEE 1WXRA 3P92A 1D3TB 3MU4A 3SBKA 1MD8A 2CK3D 1B0FA 1O5DH 4BNRA 1GPZA 2P95A 6CHAB 4B73A 2TPIZ 2W6ID 4J2YB 1HIAB 4YLQH 1NRRH 2PR3A 2F9UA 1KXFA 1DY8A 1IAUA 1WTHD 2FOAA 2WYJA 1ANEA 2XC0A 2SGPE 1ZPZA 2FZZA 3R0FA 4UD9H 1T8MA 4FXGH 3NXPA 1L2EA 1O2MA 1ZJDA 3E3TA 4Z6AH 1GVLA 2JH0D 1XXDA 1VITF 3ZVGA 1UCYH 5DP4A 2SGAA 3SO3A 2EQNA 3SU0A 1Z8GA 3VB3A 3TGKE 1NFXA 5F8XA 2ZHQH 2FODA 1V2MT 5HIZA 2BMGB 2O8WA 3STIA 1ELBA 1O3OA 2K1QA 1RTFB 3ZZ5A 1BHXF 2HVXA 3MNCA 2Y5FA 4Y8XA 5E2OA 2ZHWH 1GBEA 2A5AA 2UUFB 1LVBA 4JYTA 1OP8A 1NROH 5HKKD 4BAOB 4ZROA 3A8CA 2W26A 1TRMA 1CGJE 2OP9A 4Y71A 4ZMAH 1P2OA 3ZZ9A 2Q6FA 1O2KA 4I32A 3UY9A 3M3TA 1F5LA 2KR7A 5DP3A 3F9EA 3BTGE 3ZV9A 2K8IA 4NFFA 1QRWA 1GHYH 2PSYA 2F91A 1AN1E 2HVYB 3DHKH 2UWPA 3QWCH 4MNVA 5BPEA 2OINA 2V3OH 1A0HB 1GBLA 2B8OH 2JETB 4JZDH 4TWWA 2W3KA 2G81E 3A82A 4U30A 1ELVA 1C1MA 4D7GA 3BEUA 1C5MD 1TNIA 4MQAA 4ACAA 4B2CA 4FUGA 2J92A 3RXLA 1GCTB 1SMFE 1JMOH 1NRPH 3N7EA 1JIMA 1B0EA 3MH5A 5AFZH 4AG2A 1TX7A 1KY9A 1O3LA 2SNVA 4LK4A 5GIBA 1PYTD 4NG9H 5LPFA 4K8YA 4CRAA 1J16A 2LP6A 4DCDA 2ODQA 1CSOE 2HPQH 3KL6A 1TQ0B 2AERH 5JPMH 1Z1JA 5E2PA 5GNDA 1C2IA 3RXOA 4ABAA 3HK6B 1UHBB 4B1TA 1A2CH 3OY5U 4ZKOU 2RDLA 2XCNA 1YPKH 3ZZAA 1Z71A 2A7HA 1W10U 1TPAE 2FOFA 1GWAA 2C93B 1HJAB 2YMSD 2BHGA 2W7UA 3FO8D 1F92A 1TONA 3ATLA 1S84A 4B2AA 4B6FA 4UEHH 5FAHA 3F9FA 4TPYA 1QRXA 1ZMLA 4CREA 1Y59T 7ESTE 2KFWA 1DOJA 1VZQH 3QLPH 2A32A 3PMBB 5E8EH 4INHA 1O5AB 2WPDD 5FBIA 3SHCH 5LPEA 2PW8H 1C2LA 2HGTH 1ETRH 1MQ6A 1C2HA 2XW9A 8GCHG 1JOUB 3KQ5A 2ZKSA 3SU5A 1GGDB 4WVPE 5EXLA 1TPPA 4ABFA 2NU4E 1O3KA 1FV9A 4IMZA 4FVBA 2IPQX 3RXKA 5DN6D 1K0HA 3S9BA 1O0DH 4X1NU 1HAZB 2KAIA 3HPTB 1CHGA 3BF6H 4BXWA 1TQ7B 1G3CA 3RMNH 4XDEA 3SU4A 1ELFA 3DUXH 3PROA 2BY9X 3ZZ6A 4ZHLU 3WWBA 1GJ5H 2J97A 4Y11E 3E16B 3RXSA 1OP0A 1FLEE 1K1MA 5ABWA 1ZGIA 2QAAA 4XBBA 3SJIA 2BDCA 4U01A 1O3BA 2Y7XA 3LGYA 4IBLH 1QJ1B 3I78A 2FEQH 2ZGXH 1N6XA 1S81A 3H7TA 7GCHF 1HAOH 4TWYA 1PQ5A 2OK5A 4CH8B 1HAGE 2BZAA 4WMFA 1C2DA 1JBUH 1LDTT 4GLYA 5C17A 3AASA 1UVTH 4YLUA 2P16A 2C8YB 4FUHA 4R0IA 2ZDVH 3HGPA 3FVFB 3E90B 2QXGA 1G36A 1FN8A 1H9IE 4AZ2B 2ZZUH 4QT8C 1AE5A 1TB6H 1EASA 1SGCA 1TA6A 1YLDA 1YM0A 2OXSA 1T4UH 3A7ZA 2GGVB 3A7YA 2ALPA 2GT8A 3S7KB 1GMHG 2XCFA 5FPTA 3CP7A 1C1QA 1C4U2 1TGSZ 4I8HA 4IC6A 1SSXA 3AAVA 1HIAA 5DP7A 1SHYA 2O8UA 2XBWA 1O2PA 1C5XB 2WZQA 2F9PA 4PROA 3SU1A 1BTUA 2F3CE 3RU4D 2BDGA 1CBWC 5A8ZA 3MO9A 1SB1H 1S6LA 5EIYA 1PPFE 4ISIH 1JIRA 3F3BA 1A5HA 3ZV8A 1O3AA 4I8LA 2ZFPH 1HB0B 1THSH 4HTCH 1BRBE 3LPRA 1C5LH 3TVJB 4XSKU 4VGCC 1O2OA 1NU9A 2G5NA 2ZCKP 5DP5A 3O8CA 1S0RA 4NA9H 3ZVEA 1BHXB 4BAHB 3PYHA 3ODFA 3AAUA 3WW7A 1DWCH 1DANH 8ESTE 1GBJA 1LHFH 1S6HA 1EJAA 2ZHEH 1BRCE 1QBVH 1HUTH 2ANMH 1PQAA 2B9LA 1FY5A 5IYTA 1UTJA 2V7QD 2GT7A 2M5TA 3BIUH 1PPHE 1FY8E 3SQHE 3BTKE 1YPEH 5T3HA 1JRSA 4KGAA 3SV8A 4ABBA 2QYIA 1C2EA 2QF3A 2PUQH 1P03A 2VIPA 1QZ8A 3H09A 2QXJA 1AWHB 3V12A 2ZQ1A 2UUJB 3A83A 4GSOA 4R8TB 5F03A 1GBBA 5E0HA 1ARBA 1V2PT 1C1OA 2Y80A 2IPHA 3MMGA 1FX0B 1E1QD 4B2BA 3M7QA 1NBMD 1O2WA 3ELAH 1VITG 1BBRK 2XOKD 1DT2A 3CENA 3UUZA 3RXBA 1YPMH 1UCYE 1SLVB 1UK4A 1O2RA 4IC5A 3MTYA 1T4VH 1PQ7A 1G37A 1KXBA 1B5GH 3FOAA 5C3NA 4FUDA 4O9VA 1UTQA 3AVZA 4JZIA 1M9UA 3BTTE 2HNTF 1EPTA 1UHBA 3RDZA 1J9CH 2VIDA 3UQVA 1N1LA 4Y7BA 2QA9E 2W3IA 3F6UH 2C4FH 2R0LA 3OFND 3L6PA 5ESTE 3U98H 1BRUP 1H8DH 2H5DA 3A7VA 4WMEA 1GBFA 1O3CA 4E06H 1YWUA 1K21H 1C5PA 1BUIA 1MMJN 3LGUA 1LCYA 1G2LA 1FAXA 1P06A 1JRTA 1S5SA 1SGYE 3Q3XA 4K1SA 4NZQA 3ODDA 3RXMA 2A7JA 3EA7A 2H2ZA 3GCTF 4WH8A 1O35A 1C5NH 5A0AE 2ZFRH 3A87A 1OWHA 2WV9A 1C9PA 4ABJA 3M5MA 2KCAA 1SG8B 1Y3VA 3SGQE 4DOQA 1IHTH 3DSGA 2VIQA 5ESBA 1F7ZA 2BX4A 3ITIA 1AMHA 4DIIH 1C5OH 1NPMA 2FYQA 3A8AA 4NSVA 3RMMH 3STJA 1YC0A 3PMHB 5EODA 4NGAH 1V3XA 2BDBA 2H1UA 2HWLB 4FU8A 4YO9A 1C1UH 1CBWB 1WTGH 2VGCC 3NRLA 2FDAA 4IGDA 1E38B 1GI8B 1FONA 4YT7H 1OWKA 5EQRA 4K8BA 2Z3EA 3PTBA 1DLKB 2JH5D 2ZGHA 1MAXA 4X6MA 4ZKNU 1EZUC 1P11E 2G00A 1CVWH 2ZPRA 5FL7D 1A5IA 1QIXB 3IITA 4VGCB 3W95A 1EZQA 2GCHF 3EQ0H 3SJ9A 4ABIA 5CHBA 3ESTA 4A5TS 1DDJA 1KTSB 2HNTC 1O3NA 3ZVDA 2W7SA 3SV7A 2BLVA 3HATH 2ZGJA 3TIUA 3MH4A 3LDXH 3GCHC 2FTMA 1O37A 1EXFA 3QUMP 2FPZA 3ZZ7A 4Q7YA 1O2JA 2Y5HA 1DICA 1J14A 1PPBH 1XUGA 3A85A 4GHTA 1GVZA 1LKAA 1MTNC 2BXUH 2J5UA 3N7DA 1MZAA 1W0JD 2JH6D 2WPJS 2GKVE 3Q76A 2ZTXA 3SUDA 1N6YA 5EXMA 1G30B 3UR9A 1GVKB 4B76A 1BDAA 5JBBS 4P00A 4AFUA 4MG3A 4K1TA 1GJ8B 1J8AA 1BMFD 1GI9B 1A1RA 1Q3XA 1H8ED 1A5GH 2ZC9H 5DP6A 2AFQB 2Y81A 4Q7ZA 3RXUA 1QHRB 4DG4A 2QXIA 2XC5A 1MABB 4B74A 2VVCA 1BBRH 3KNXA 1C5VA 1TIOA 3M5OA 2VIVA 4WXVA 4BTTB 4FOUC 2I6QA 4ZHMU 2Q6DA 3VXEH 1V2LT 1WUNH 3RXCA 7GCHG 3MHWU 4CRDA 3MQKC 1FQ3A 1KLTA 1ZTLA 1FZZA 1NFUA 2ZGCA 4B75A 5JBTA 3KQDA 4D8NA 1O3JA 1P12E 1EZXC 1TMTH 1EAIA 5DK1A 2OC1A 3RP2A 3DSOA 2P59A 3SGAE 1GBMA 3T5FH 3M3SA 3ATIA 1HJ8A 3SYJA 2XBYA 5GJ4B 1TA2A 2ZA5A 4AORA 1GL0E 1U6QA 1T32A 5A0BA 4KKDA 1GJAB 5AHGH 4YOIA 2CN0H 2P3UB 1HRTH 3M5NA 4Q4LA 1VGCC 1QA7A 1C9TA 5C2ZA 1YKTA 4UDWH 2R3UA 1RRKA 1ZZZA 4B71A 2FTLE 5JBAS 2RG3A 1HBTH 1KDQB 1QL8A 1Q2WA 3LH3A 2QN5T 1XUFA 3GY5A 2ZFFH 1O36A 6GCHF 1GCTC 3V3MA 3AK5A 1UVOA 4DW2U 1O2QA 4NIYA 2J95A 3LJOA 3SOSA 2VGCB 3WY8A 2YNBA 3AW1A 2HNTE 2VU8E 3QTOH 3U69H 3FKSD 2WV4A 1LQDB 2BQWB 2G5VA 1OYTH 1DWBH 3QDZB 4OS2A 3Q3YA 1TNJA 3O8DA 1Y3WA 4FUBA 3PMJA 2Z9IA 1UMAH 5HGGA 2BYAX 2PTCE 1TNGA 2BD8A 3JZ2B 4ISNA 5BRRE 3U9AH 3ZVAA 1C5UA 1F2SE 1NTPA 1ABIH 1MTVA 1S82A 1TNHA 2BLWA 3UPEA 3GCHB 1TGNA 3NPSA 3T26A 1HJAC 3GY6A 1S83A 3BEFB 4OGYA 1D9IA 4KTSA 4X2XA 2WHXA 3F1SB 1MTNB 2BDYA 4HG6A 1AZ8A 4RN6A 1P3EA 3SNCA 1V2RT 1EJNA 3ZZCA 3M7TA 1LHCH 3P8NA 2ZU2A 1TMUH 4FU9A 5J4SA 4DURA 1FXYA 3UOUA 3RC6A 2BVRH 2KX4A 3KIDU 1GGDC 3AW0A 3E8LA 5KEDA 1FPCH 1O5GH 4X8SH 2LELA 4XRNA 1LVOA 5HM2A 2R0KA 3MOCA 1PYTC 1TOCB 1D4PB 3GS9A 2NU1E 2VVVA 2JKHA 2WPKS 4OS6A 3ZVCA 1O2YA 4DJZB 1GJ4H 4OS5A 1WV7H 2PSXA 4JYVH 3GDVA 1QY6A 4WH6A 2BQ6B 3SU6A 8KME2 1LHDH 2FMJA 1DFPA 1EAUA 2ZEBA 5GWZA 1AFEH 2YMSC 3A8BA 2EY4C 1BRAA 2ZHDA 5ETXA 2Q1JA 2VWLA 1TOMH 3Q3KA 2A1DB 2YNAA 5DKMA 1YYY1 3SZEA 2ZQ2A 2G4UA 1IQNA 3TLOA 3H7OA 2GVFA 2WPIS 2TBSA 2ESTE 1ESAA 2WINI 4HZHA 3GCTG 4TT3D 2GCTC 3L33A 4HFPB 1EP5A 1AVWA 2BD9A 1HLTH 2QIQA 2C90B 2VH0A 1TPSA 1V6DA 1VKYA 4FUFA 1WOFA 2Y7ZA 2G52A 5HMAA 1MH0A 4AYYB 3RMOH 4O03A 1VGCB 2XC4A 1SLXB 1QJ6B 5E0GA 1SQOA 3HKJB 2BY8X 1GI2A 2BDHA 1SPJA 1LKBA 5FX5A 5C5NA 1EX3A 4WY3A 2ANKH 1QFKH 1ZSKA 3SJKA 1AZZA 1NRSH 3RMLH 4CBOA 2HALA 2JDID 3NUMA 4NIWA 1AU8A 4XD7D 1C5YB 4AGKA 1P2MA 3VXFH 5C1UA 2VIOA 1TFXA 3PMAB 1AWFH 4AX9H 3PO1C 1C2FA 1W3CA 3HKIB 1BTYA 4ISOA 4Y7AA 5HYOA 3S7HB 1O2GH 4Z1MD 4NIXA 1KYNA 3T27A 1OSSA 2GCHG 4CR5A 3ZZDA 1HV7A 1P0SH 1K2I1 1BT7A 3B23B 1AY6H 1L1NA 1CT2E 5AF9H 2BLQA 2NWNA 3P70B 1YPLH 3I29A 2BZ6H 4IN2A 4IN1A 3RC4A 4BAQB 1GL1A 1Y5UT 3RXIA 3URCA 2NU2E 5EG4A 1TBRH 4F48B 1D3DB 3TJNA 1XMNB 3MNSA 1C5QA 1XVMA 1FPHH 1H4WA 4I86A 2BDAA 3K9XB 1CE5A 2FS9A 4CH2B 1KIGH 2A5KA 1NC6A 2HLDD 3ZZ8A 5CMXH 1GJBB 3CS0A 2VH6A 1G3EA 1BITA 1UTKA 1W7XH 2P8OC 1QL9A 3KEEA 1VCWA 1Z1IA 2G4TA 4M9FA 1IOEA 2F4LA 2FX6A 1HFDA 1SBWA 1XX9A 1BZXE 2J9NA 2BOKA 1O39A 3RXHA 4BANB 1KDQA 1BCUH 1KMHB 1SFIA 4AFZA 1AGJA 1C5TA 1FMGA 2F9NA 1SKYE 1FIZA 4U2WA 3KHVA 1BBRE 5L2ZH 3F68H 1TYNA 3PWCA 5CHAC 3DSPA 2BOHB 1C5SA 5FPSA 1KXEA 1QA0A 1PPEE 3UFAA 1G9IE 1NFYA 1SGFG 2THFB 4UFGH 3U1JB 1WYKA 4X6OA 2QF5A 3D65E 1RIWC 2YMSB 2ZECA 1GJCB 3HGNA 2PKAB 2P93A 5LGOA 3P17H 1C4V2 3PB1E 3UTUH 3KF2A 2GDEH 2OD3B 1TGCA 4JCNA 5FX6A 1SGDE 1HAYB 3LGIA 2BD4A 1TBQH 1Z8JB 1DLEA 1DUEA 1MBMA 2GCTB 4ABGA 3MU8A 3G01A 1UTNA 1HAVB 1UTOA 1Z6EA 1LMWB 1BJUA 2FIRH 2CF8H 3GY2A 3TK5A 1C1VH 1GMCF 4CRFA 4GUXA 2FLRH 4YESB 2UUYA 1KLJH 2BQ7B 2LNCA 1NESE 1C2KA 1E0FD 4GCHF 5T6FA 1A4WH 4WF8A 6GCHG 2BX3A 2OQUA 3QX5H 3GY8A 3FANA 1QR3E 2TIOA 1HCGA 1J15A 3FZDA 3SNBA 1V2KT 1A46H 1SVPA 1LHGH 4IMQA 1HYLA 5GXPA 1DY9A 1QCPA 3T25A 1TMBH 1GG6C 1S6FA 3PO1B 2ZF0H 1ELAA 4RI0A 3F9HA 4KP0A 5JBCS 1V2TT 1A0LA 1ESBA 4X1SU 1O5FH 4E7NA 2AYWA 2J2UA 4MPUA 2A2QH 1SHHB 3RXPA 2J98B 2VWOA 3SI3H 1FAKH 2ULLA 1TGTA 2A4OA 3VG8A 4GVUA 5GPIB 1H1BA 3E0PB 2D8WA 5EJZA 5TCCA 4GAWA 2AGGX 2OBQA 3TJOA 5JB8S 2HPPH 4XE4A 4A1TA 1UVSH 1ZHPA 1J17T 1GI6A 1EB2A 1DM4B 1SGTA 2BD5A 1SLWB 3RXTA 4X0WU 2A7CA 1O2VA 2SGFE 2Z3CA 2RCEA 2VWNA 1OWDA 4Q7XA 2VVUA 2P8OB 3U8OH 2GP9B 3TH4H 4JYUH 3LGVA 1CT0E 1P04A 2QCYA 5JYIA 1GMDF 1DWEH 4UFFH 3BN9A 3Q77A 1IQJA 4JZ1A 3BTFE 1BTHH 2AEIH 2FI4E 4K3JA 4NSYA 1F5KU 2RA3A 2Z7FE 4LOYH 2BXTH 2YOLA 2BY5X 1UK3A 4XBDA 1DPOA 1W13U 3BTQE 1IQEA 3LIWA 1UTMA 1GDNA 4JZEH 1S85A 5A8YA 2RFKC 1Y5AT 1ZMJA 2ZDNA 1O33A 3SUEA 3UNRA 5C0UA 2J38A 5CHAB 2PP6A 4Q2KA 4RKJB 2ZTYA 1MQ5A 1Y3UA 1QRZA 3SQEE 1C1SA 1O2NA 4ZXXH 1T31A 1TWXB 1RIWB 1NFWA 4RT1A 1BMAA 3MH7A 3DT0H 4ZAEA 1LTOA 1CHOF 4D76A 1SGFA 4TY7A 4ZXYH 4Y76A 4DY7B 5C1XA 3RXGA 4YXWD 2G8TA 1QB9A 1S0QA 5I46H 5C0TA 3UAIC 5TCAA 2IJOB 2UWOA 2ANYA 1ELTA 1NBME 2Y6TA 4CBNA 3RM2H 1KXCA 1NRQH 1GJ9B 1O3FA 3E6PH 1H8IH 3RXDA 2Z94A 1K9OE 1OS8A 1NT1A 3M36A 1GCDA 1BIOA 3EYDA 1EB1H 4YOGA 1K1PA 2SNWA 4LZ4B 3SV2H 1VCQA 1EKBB 1XVOA 2A31A 1GDQA 1K1IA 2VBCA 1TX6A 3LC5A 2BDIA 2ZPQA 4Y0YE 4A1XA 3B9FH 3PLBA 3BTDE 2VINA 2ZDKA 2AMQA 5B6OA 1CA8B 2A2XH 5EU8A 1OWJA 3F0PA 1SLUB 1GHWH 4I8KA 1SC8U 4M7GA 1RD3B 1UW7A 2WYGA 3BIVH 1GG6B 4X2VA 4ZHAA 4AGJA 1YP9A 4XOJA 1DSUA 2BD7A 4Q80A 4YM9A 1ZPCA 2VWMA 2JJ2D 1MD7A 5B6LA 1ZRKA 5C1YA 4BTUB 2FI3E 2GX4A 1ARCA 1Z6JH 2OC7A 5EOKA 4AFQA 4NZLA 3DD2H 2CJIA 2Y82A 1K1LA 1VR1H 5A0CA 1E36B 2F9VA 2J34A 2PKAA 1O3DA 1CQQA 1ZPBA 1V2ST 1E37B 2EI8A 5PTPA 2AGIX 3R3GB 1P8VC 3KQCA 1LPKB 4ISLA 5JB9S 1TPOA 2DE8A 3O8BA 1A7SA 1Y8TA 1K1JA 2GV7A 1O5CB 3MU1A 5G4BA 1WU1A 1BMLA 2H9HA 3UNSA 3ZZ3A 2WV5A 1T7CA 2PLXA 1DSTA 2VNTA 1HAVA 1SR5C 1P02A 2SGQE 1UTLM 1P9SA 2F9OA 1GI1A 2WSSD 4LXBH 2PKSC 4NIVA 1ZGVA 1Y5BT 1GI7B 3TH3H 2FOCA 1W11U 3MWIU 4ASHA 3TJUA 3VGCC 1COWD 1P09A 1CA0C 2G51A 4H6TA 2GJGA 4ZKRU 1MTUA 2A0QB 3ZYDA 4FUCA 4NWKA 2D26C 1KLIH 5FPYA 3SHAH 3S0NA 1OXGA 5K0HA 3ZYEA 1NRNH 3ATMA 2XRCA 3OAAD 4Z0KA 2ZGBH 1YLCA 1NO9H 1BMMH 1AKSB 1F0RA 4OS4A 1SGPE 2VJ1A 3FFGA 2CV3A 1FI8A 4MLFB 2G55A 5DO4H 1AVXA 2J98A 1SL3A 9LPRA 5IDKA 3BEIB 3N99A 1ZSLA 2R2WU 2BTCE 1AFQC 2PWXA 3MNXA 1QJ7B 1MTWA 1EOLA 1TX8A 1GDUA 1F5RA 3EAJA 1RGQA 1GBAA 3MFJA 4X8TH 1HJ9A 5EJLA 4UFEH 1O3MA 5T6DA 3LKWA 2LPRA 1GJ6A 3UWIA 3TGJE 1GI3A 2BB4A 2ZPSA 2TGDA 2CGAA 4GCHG 1PPZA 5KGOA 3FP6E 2P3FH 1ZMNA 3MU0A 1CO7E 4UONA 1MBQA 4JMYA 1DXPA 2B5TB 3ZIAD 1O2LA 5TJXA 5L6NH 1AHTH 1IQHA 2A5IA 3D49H 4Y10E 1CGIE 3ZVFA 1OHHD 4AYVB 1HAIH 3P95A 1YCPK 3C1KA 1V2WT 1GHVH 1GMHF 1HGTH 3TU7H 1E35B 3M5LA 5EJ1A 3TK6A 4KTUA 3SI4H 1H9LB 1AB9C 1YGCH 1AD8H 1BTWA 2KCYA 1T8LA 2FOGA 1F0SA 2TGTA 3ZZ4A 4RSPA 2ZP0H 1P2NA 3SUGA 6ESTA 3K6ZA 3KGPA 4FETA 1OYQA 1PPGE 1Z7KA 2GD4B 1P2IA 2BVXH 3F2HA 3UR6A 1ELCA 1EOJA 3D62A 3GDUA 1Y3YA 5LPRA 5C5OA 1O2HA 1ZLRA 2ODPA 3RXAA 3W94A 1AVGH 1TAWA 1O38A 3GY3A 5EW2H 1WSSH 1KSNA 1PPCE 3DFJA 2FOEA 1DX5M 1EZSC 1P9UA 2PKSB 3BSQA 1O2UA 4K69A 3SV6A 1GMDG 2J4IA 3ATKA 3KQBA 1MTSA 1RS0A 1UVPA 5DP9A 4MTBA 4ASUD 1O5BB 1SGEE 1GHAF 1BOQA 3OEED 3VGCB 1P57B 2P3TB 1CA0B 4Y8ZA 2D1JA 1WQSA 2H9EH 2IJD1 4O97A 2ZIQH 3MYWA 2K0QA 3ZVBA 3TNTA 4MNYA 5K7RA 4DIHH 1IQKA 2ZNKH 2Z9KA 2XBXA 4WMDA 5GCHF 4Y79A 3RXQA 1UTPA 2FYRA 1LHEH 2Z9GA 1GHXH 3LGWA 1BMNH 1OWEA 3TGIE 1SGIB 2ZU5A 1TRNA 3IWMA 3RLYH 2F9BH 1P10A 3VB6A 4INLA 4BTIB 1CHOG 2QF0A 2ZU3A 2UUKB 2PHBA 3SU3A 3MO6A 3TK9A 1RFNA 2RDEA 1QTFA 5A09A 1TE0A 1THPB 3MO3A 3NK8A 5AVDA 3V7TA 2OBOA 1YPHC 1MU6B 2SFAA 4A6LA 5J4QA 1AFQB 1G3DA 1YBWA 1YF4A 3Q00A 2JIZD 1K28D 4YOJA 1AIXH 1E79D 3PLPA 1ZOMA 1GI4A 1GJ7B 4OS7A 3SN8A 4WWYA 1CU1A 3K2UA 1TNKA 3KQEA 2OTVA 3VPKA 3PV5A 4H6SB 3RU4T 5EPNA 4MDSA 4FU7A 3KN2A 4D9QA 1QQUA 3QZRA 1O2SA 2XWBI 3LC3A 5EQSA 2Q6GA 3U1IB 5C20A 1KXDA 4TYDA 3LU9B 5L30H 5AFYH 2R9PA 2ZHFH 1YY3A 1RTKA 1WDIA 2DE9A 1RXPA 2H6MA 1O31A 3OE7D 4X6NA 3RLWH 2FXRA 3UREA 3SNDA 1HAHH 1ZTKA 1C1NA 3BG8A 2B7DH 2V3HH 2Z9LA 2KM0A 4K60A 4BXSA 1GBDA 3GYMA 1V2JT 4ABHA 1BA8B 5IK2D 3NCLA 4I8GA 2GZ8A 3A7WA 3OEHD 1O32A 1ZTJA 1DE7H 4K2YA 3SGBE 1YCPH 1BTPA 1UJ1A 2KCPA 1L4DA 5DSFA 4I7YH 1GJDB 1AKSA 5FCKA 1AB9B 1MKXK 3LJJA 2C8XB 1QBOA 3TPIZ 4I31A 3N7OA 2J94A 1O30A 4MNWA 2FOBA 1F0TA 2QGRA 4UE7H 2V0BA 4YTAA 2EI7A 1TABE 3LH1A 4OS1A 4WJG2 1JWTA 4Y0ZE 1DVAH 4XBCA 3VB5A 4AB8A 1AI8H 3QO6A 4P02A 3UB0A 2AGEX 2WPLS 1EPTB 3PM3A 1HAXB 4ZKSU 5HM9A 3EA8A 3RXRA 5FBEA 3MH6A 2AHME 1ETSH 3ZZBA 2FP7B 5A2MH 3GY4A 4X6PA 2OC0A 3BV9B 4DGJA 1SFQB 2SGDE 1DUAA 2ZG0H 2A4GA 3QK1A 1LVYA 1FY4A 2ZWLH 3PV4A 2D2DA 1MU8B 2GTBA 2ZFQH 1D6WA 2TGPZ 5GDSH 2FM2A 3A7TA 1FJSA 3V0XA 1QURH 2HLCA 1MCTA 1C4Y2 4NCYA 5EGMA 2L74A 1GI0A 1V2QT 4LZ1H 1YPHE 1UK2A 3FN8A 3UQOA 4OGXA 2FLBH 2PGQB 2NU0E 1V2OT 1O3EA 2AIQA 3TNSA 3QGJA 3KCGH 3GICB 5EXNA 2Y5GA 1YLNA 4MPWA 5KECA 2XNIA 4FVDA 1GBKA 3OTJE 1AE8H 3BTEE 2GDDA 2CXVA 4CHAC 2F83A 1L4ZA 2HOBA 3V13A 1O2IA 1V2NT 2ODYB 5JDUB 3MI4A 1LPZB 1A61H 1K1NA 1ZSJA 2GZ9A 2AS9A 3A84A 3RXFA 5T6GA 4AG1A 1QNJA 5C67A 3RC5A 1XUIA 3PTNA 1C1PA 1OWIA 2ZFTA 2A4RA 2OCVB 3NZIA 1IQFA 3BG4C 1SOTA 3DFLA 4D7FA 3A89A 4J1YA 1SGRE 3O8RA 2QE7D 3ENSB 2IN2A 2ILNA 3OSYA 4JK5A 3A88A 4F4OC 3LGTA 4Q63A 1SGQE 4RKOB 3E1XB 1BQYA 3VB4A 1O3PB 3SU2A 3BTHE 2VB0A 2QF4A 5CE1A 1MUEB 2Z3DA 3A81A 5CDFE 1K1OA 1XUHA 3E91A 3SZNA 1VJAU 2AMPA 2FOMB 1ORFA 1O3GA 3L3TA 3T62A 4CRBA 4JZFH 3GCNA 2ZCHP 3NKKA 1MKXH 5FXLA 2AMDA 1NS3A 4O3UA 5DGJA 5SGAE 2W6JD 1KTTB 2NU3E 1LVMA 1YCPM 1X7AC 1QB1A 1XM1A 4MPXA 1BB0B 3T2NA 4INKA 4XFQA 1O3IA 1DWDH 2XNDD 1BTZA 4AN7A 4CR9A 5F53A 3MNBA 1ZJKA 1VJ9U 4U32A 4TSFD 3ATWA 3P8GA 3RU4E 1ZR0A 3SW2B 1TALA 1QQ4A 4SGAE 4NA7A 2QXHA 1LO6A 1NM6A 3EDXB 1THRH 4E05H 1JXPA 3T28A 1OOKB 1H9HE 1CGHA 1QGFA 1SI5H 3M37A 1GHAG 1W14U 3H5CB 1D6RA 3QTVH 4HGCA 7LPRA 3EGKH 3K6YA 2EEKA 2BD2A 2PV9B 5EQQA 3EE7A 4A92A 1C2MA 2GV6A 1Q31A 1MZDA 1W12U 1XKBC 1C5WB 1ANDA 1GHBF 5GCHG 3SORA 1RJXB 3M35A 8LPRA 3GYLB 2JJ1D 5E0JA 1QB6A 5DJ7A 2V3MA 1TLDA 2CF9H 1XUKA 3VB7A 1FY1A 2H9TH 3QZQA 1FN6A 1GI5A 2ZDMA 2ZDLA 1W0ZU 1W0KD 1C2GA 3U8RH 3C27B 3KYGA 2ZU1A 1DXWA 4AOQA 3P8FA 1NY22 2KCOA 2V35A 4FUJA 5DG6A 1MCVA 3RXEA 4F55A 1A0JA 1ANCA 4CRCA 4KTCA 2BY6X 2PTNA 2IOTA 3GOVB 4CRGA 1P2JA 4JK6A 5F8TA 4CHAB 3S9CA 1SQRA 1G32B 1P3CA 1AUTC 1GBHA 5EPYA 3UIRA 4B6EA 1ESTA 1FUJA 2ANWA 3OU0A 1OX1A 1ELDE 2I6SA 1OKXA 3M7UA 1AUJA 1YPJH 1E1RD 1H8HD 1D3PB 3TH2H 1EAWA 3TJVA 1WAYB 4ESTE 3LOXA 2OQ5A 4ZCNA 2EC9H 1V2UT 2FX4A 1UVUH 3BG4B 4ABDA 1FY3A 2BY7X 3PRBA 2QY0B 2VIWA 1RTLA 3F2GA 1OPHB 5FHTA 2ASUB 3S9AA 1HAPH 2BLOA 2WPHS 3M61U 2XBVA 1VCPA 3DCLA 3SJOA 4X1QU 5FCRA 3PV2A 1BTXA 3SJ8A 1XUJA 1LPGB 1N8OC 1O2ZA 3E0NB 1WBGB 1C2JA 1EATA 4NWLA 4BAMB 2W5EA 3OY6U 3PRDA 3I77A 1EAXA 3RUOA 1MKWK 4IS5A 2FOHA 2C8ZB 1PQ8A 3GISB 1ZHMA 1ANBA 2XTTB 3U28C 4BAKB 3LT3A 4HI3A 1TGBA 3UOPA 2A4QA 2CHAC 2ZU4A 3DA9B 4TPIZ 4F49A 2FESH 3KYFA 2GMTC 4SGBE 4WXIA 4FUEA 2B0FA 4Y6DA 3WWFA 2AH4X 4YT6H 2Z9JA 4YZUA 4D9RA 3RM0H 1QL7A 4DVAU 1FNIA 2M2AA 2Z6BD 5LH8A 3HK3B 2TRMA 1P2KA 3MU5A 2XYAA 2C3SA 3QN7A 1PJPA 1ZHRA 1ABJH 1P05A 3A7XA 2R3YA 4H42U 3RXJA 2OLGA 5DP8A 2CMYA 3EE0B 1DS2E 1ZRBA 3OX7U 2TGAA 2EI6A 2WPMS 3JZ1B 4FUIA 2SGEE 1SGNE 1CT4E 2AIPA 1DITH 4X1RU 1SQTA 1WQVH 3U8TH 4I33A 1C1TA 1AQ7A 3B8JA 4AB9A 1NZQH 5A8XA 1IQIA 9ESTA 1UO6A 2STAE 1SOZA 1NN6A 1W8BH 2ZI2H 1OP2A 4ABEA 1W7GH 1O2XA 4AC9A 4KELA 1QBNA 1INCA 1MAYA 1A3EH 1IQGA 4OM9A 4THNH 4ZH8A 2V6NA 6CHAC 3FP7E 4RT0A 1ETTH 8GCHF 3VFEA 3EA9A 1O5EH 2HRVA 2KZ4A 2ZTZA 2FO9A 1SQAA 2ALVA 2ZFSA 4Y8YA 1L1JA 1ELGA 7KMEH 1HDTH 2PGBB 1L1GA 1F0UA 1GBTA 4X2WA 5L2YH 3PWBA 3GY7A 1UCYK 3FAOA 4K5ZA 6LPRA 1A3BH 1HPGA 2ZO3H 5T1VA 1L0ZA 4IW4E 1NU7B 3GDSA 3UWJH 2DUCA 3T29A 1EQ9A 2FS8A 2C8WB 1IHSH 4AFSA 1V2VT 1GMCG 1YPGH 4X8VH 1XKAC 1G3BA 1P01A 4ACBA 5EW1H 4A1VA 1B7XB 1TRYA 4ZUHA 2P94A 2WUCA 1EJMA 3PLKA 2FWWA 1BJVA 2QC2A 2GZ7A 2FI5E 3NWUA 1ACBE 3UNQA 2OC8A 2BVSH 3P6ZB 5C94A 1Z8IB 2BM2A 2PFEA 1IQLA 4BOHA 2H5CA 3A86A 1C5RA 1Z8RA 3S69A 2XWAA 3F0OA 3IG6B 3CNRA 1C5ZB 4A7IB 4E7RG 1ID5H 2XXLA 3A80A 3FZZA 3LONA 3GCOA 2R2MB 2L6OA 1W0YH 1ZYOA 3OYPA 1C1WH 2O8TA 1N8OB 2O8LA 2JETC 3QGNB 1C1RA 5H4IB 1HXFH 5I25A 1ELEE 4X1PU 2UWLA 4H4FA 3BTME 1FDPA 5HXFA 1MKWH 2KAIB 2PUXB 4K1EA 4I8JA 1AO5A 1VITH 3F2FA 3OTPA 2CHAB 5F6MA 1EFRD 1HXEH 4NFEA 1EUFA 1W2KH 1TBZH 2GMTB 2EA3A 1O3HA 3TITA 2RA0A 1KXAA 3D23A 1LQEA 3SUFA
chains in the Genus database with same CATH topology
1O34A 3VEQB 2OUAA 1WCZA 1XXFA 3CS7A 5F8ZA 3SV9A 1TNLA 1P2QA 4MNXA 2O8MA 1T8OA 3BTWE 4GPGA 4ISHH 4MPVA 1GBIA 2STBE 2BD3A 1EPTC 1EP6A 3K65B 1GBCA 3F9GA 1G2MA 2ZDAH 5DPAA 4NA8A 1K22H 4TY6A 3A8DA 1E34B 2WUBA 1D3QB 3SNAA 2O9QA 3URDA 3M3VA 1GHBG 3FP8E 4X2YA 1IQMA 1Y3XA 4O3TA 1GHZA 3SNEA 4X8UH 1FIWA 2ZCLP 2QV1A 1O2TA 2A45B 3P8OA 4UFDH 3RXVA 4DT7B 1PFXC 4GHQA 1T8NA 4MVNA 1HNEE 3P92A 1D3TB 3MU4A 3SBKA 1MD8A 1B0FA 1O5DH 4BNRA 1GPZA 2P95A 6CHAB 4B73A 2TPIZ 4J2YB 1HIAB 4YLQH 1NRRH 2PR3A 2F9UA 1KXFA 1DY8A 1IAUA 1WTHD 2FOAA 2WYJA 1ANEA 2XC0A 2SGPE 1ZPZA 2FZZA 3R0FA 4UD9H 1T8MA 4FXGH 3NXPA 1L2EA 1O2MA 1ZJDA 3E3TA 4Z6AH 1GVLA 2JH0D 1XXDA 1VITF 3ZVGA 1UCYH 5DP4A 2SGAA 3SO3A 3SU0A 1Z8GA 3VB3A 3TGKE 1NFXA 5F8XA 2ZHQH 2FODA 1V2MT 2BMGB 2O8WA 3STIA 1ELBA 1O3OA 2K1QA 1RTFB 3ZZ5A 1BHXF 2HVXA 3MNCA 2Y5FA 4Y8XA 5E2OA 2ZHWH 1GBEA 2A5AA 2UUFB 1LVBA 4JYTA 1OP8A 1NROH 4BAOB 4ZROA 3A8CA 2W26A 1TRMA 1CGJE 2OP9A 4Y71A 4ZMAH 1P2OA 3ZZ9A 2Q6FA 1O2KA 4I32A 3UY9A 3M3TA 1F5LA 5DP3A 3F9EA 3BTGE 3ZV9A 4NFFA 1QRWA 1GHYH 2PSYA 2F91A 1AN1E 3DHKH 2UWPA 3QWCH 4MNVA 5BPEA 2OINA 2V3OH 1A0HB 1GBLA 2B8OH 2JETB 4JZDH 4TWWA 2W3KA 2G81E 3A82A 4U30A 1ELVA 1C1MA 4D7GA 3BEUA 1C5MD 1TNIA 4MQAA 4B2CA 4FUGA 2J92A 3RXLA 1GCTB 1SMFE 1JMOH 1NRPH 1JIMA 1B0EA 3MH5A 5AFZH 4AG2A 1TX7A 1KY9A 1O3LA 2SNVA 4LK4A 5GIBA 1PYTD 4NG9H 5LPFA 4K8YA 4CRAA 1J16A 4DCDA 2ODQA 1CSOE 2HPQH 3KL6A 1TQ0B 2AERH 5JPMH 1Z1JA 5E2PA 1C2IA 3RXOA 4ABAA 3HK6B 1UHBB 4B1TA 1A2CH 3OY5U 4ZKOU 2RDLA 2XCNA 1YPKH 3ZZAA 1Z71A 2A7HA 1W10U 1TPAE 2FOFA 1GWAA 2C93B 1HJAB 2BHGA 2W7UA 1F92A 1TONA 3ATLA 1S84A 4B2AA 4UEHH 5FAHA 3F9FA 4TPYA 1QRXA 1ZMLA 4CREA 1Y59T 7ESTE 1DOJA 1VZQH 3QLPH 2A32A 3PMBB 5E8EH 4INHA 1O5AB 5FBIA 3SHCH 5LPEA 2PW8H 1C2LA 2HGTH 1ETRH 1MQ6A 1C2HA 2XW9A 8GCHG 1JOUB 2ZKSA 3SU5A 1GGDB 4WVPE 5EXLA 1TPPA 4ABFA 2NU4E 1O3KA 1FV9A 4IMZA 4FVBA 3RXKA 3S9BA 1O0DH 4X1NU 1HAZB 2KAIA 3HPTB 1CHGA 3BF6H 4BXWA 1TQ7B 1G3CA 3RMNH 4XDEA 3SU4A 1ELFA 3DUXH 3PROA 2BY9X 3ZZ6A 4ZHLU 1GJ5H 4Y11E 3E16B 3RXSA 1OP0A 1FLEE 1K1MA 5ABWA 1ZGIA 2QAAA 4XBBA 3SJIA 2BDCA 4U01A 1O3BA 2Y7XA 3LGYA 4IBLH 1QJ1B 3I78A 2FEQH 2ZGXH 1N6XA 1S81A 3H7TA 7GCHF 1HAOH 4TWYA 1PQ5A 4CH8B 1HAGE 2BZAA 4WMFA 1C2DA 1JBUH 1LDTT 4GLYA 3AASA 1UVTH 4YLUA 2P16A 2C8YB 4FUHA 4R0IA 2ZDVH 3HGPA 3FVFB 3E90B 2QXGA 1G36A 1FN8A 1H9IE 4AZ2B 2ZZUH 4QT8C 1AE5A 1TB6H 1EASA 1SGCA 1TA6A 1YLDA 1YM0A 2OXSA 1T4UH 3A7ZA 2GGVB 3A7YA 2ALPA 2GT8A 3S7KB 1GMHG 2XCFA 5FPTA 3CP7A 1C1QA 1C4U2 1TGSZ 4I8HA 4IC6A 1SSXA 3AAVA 1HIAA 5DP7A 1SHYA 2O8UA 2XBWA 1O2PA 1C5XB 2F9PA 4PROA 3SU1A 1BTUA 2F3CE 3RU4D 2BDGA 1CBWC 5A8ZA 3MO9A 1SB1H 1PPFE 4ISIH 1JIRA 1A5HA 3ZV8A 1O3AA 4I8LA 2ZFPH 1HB0B 1THSH 4HTCH 1BRBE 3LPRA 1C5LH 3TVJB 4XSKU 4VGCC 1O2OA 1NU9A 2G5NA 2ZCKP 5DP5A 3O8CA 1S0RA 4NA9H 3ZVEA 1BHXB 4BAHB 3PYHA 3ODFA 3AAUA 1DWCH 1DANH 8ESTE 1GBJA 1LHFH 1S6HA 1EJAA 2ZHEH 1BRCE 1QBVH 1HUTH 2ANMH 1PQAA 2B9LA 1FY5A 5IYTA 1UTJA 2GT7A 2M5TA 3BIUH 1PPHE 1FY8E 3SQHE 3BTKE 1YPEH 5T3HA 1JRSA 4KGAA 3SV8A 4ABBA 2QYIA 1C2EA 2QF3A 2PUQH 1P03A 2VIPA 2QXJA 1AWHB 3V12A 2ZQ1A 2UUJB 3A83A 4GSOA 4R8TB 5F03A 1GBBA 5E0HA 1ARBA 1V2PT 1C1OA 2Y80A 2IPHA 3MMGA 4B2BA 3M7QA 1O2WA 3ELAH 1VITG 1BBRK 1DT2A 3CENA 3UUZA 3RXBA 1YPMH 1UCYE 1SLVB 1UK4A 1O2RA 4IC5A 3MTYA 1T4VH 1PQ7A 1G37A 1KXBA 1B5GH 5C3NA 4FUDA 4O9VA 1UTQA 3AVZA 4JZIA 1M9UA 3BTTE 2HNTF 1EPTA 1UHBA 3RDZA 1J9CH 2VIDA 3UQVA 1N1LA 4Y7BA 2QA9E 2W3IA 3F6UH 2C4FH 2R0LA 3L6PA 5ESTE 3U98H 1BRUP 1H8DH 2H5DA 3A7VA 4WMEA 1GBFA 1O3CA 4E06H 1K21H 1C5PA 1BUIA 1MMJN 3LGUA 1LCYA 1G2LA 1FAXA 1P06A 1JRTA 1S5SA 1SGYE 3Q3XA 4K1SA 4NZQA 3ODDA 3RXMA 2A7JA 3EA7A 2H2ZA 3GCTF 4WH8A 1O35A 1C5NH 5A0AE 2ZFRH 3A87A 1OWHA 1C9PA 4ABJA 3M5MA 1SG8B 1Y3VA 3SGQE 4DOQA 1IHTH 2VIQA 5ESBA 1F7ZA 2BX4A 3ITIA 1AMHA 4DIIH 1C5OH 1NPMA 2FYQA 3A8AA 4NSVA 3RMMH 3STJA 1YC0A 3PMHB 5EODA 4NGAH 1V3XA 2BDBA 2H1UA 2HWLB 4FU8A 4YO9A 1C1UH 1CBWB 1WTGH 2VGCC 2FDAA 4IGDA 1E38B 1GI8B 1FONA 4YT7H 1OWKA 5EQRA 4K8BA 2Z3EA 3PTBA 1DLKB 2JH5D 2ZGHA 1MAXA 4X6MA 4ZKNU 1EZUC 1P11E 2G00A 1CVWH 2ZPRA 1A5IA 1QIXB 3IITA 4VGCB 3W95A 1EZQA 2GCHF 3EQ0H 3SJ9A 4ABIA 3ESTA 4A5TS 1DDJA 1KTSB 2HNTC 1O3NA 3ZVDA 2W7SA 3SV7A 2BLVA 3HATH 2ZGJA 3TIUA 3MH4A 3LDXH 3GCHC 2FTMA 1O37A 1EXFA 3QUMP 2FPZA 3ZZ7A 4Q7YA 1O2JA 2Y5HA 1DICA 1J14A 1PPBH 1XUGA 3A85A 4GHTA 1GVZA 1LKAA 1MTNC 2BXUH 1MZAA 2JH6D 2WPJS 2GKVE 3Q76A 2ZTXA 3SUDA 1N6YA 5EXMA 1G30B 3UR9A 1GVKB 4B76A 1BDAA 5JBBS 4AFUA 4MG3A 4K1TA 1GJ8B 1J8AA 1GI9B 1A1RA 1Q3XA 2ZC9H 1A5GH 5DP6A 2AFQB 2Y81A 4Q7ZA 3RXUA 1QHRB 4DG4A 2QXIA 2XC5A 4B74A 2VVCA 1BBRH 3KNXA 1C5VA 1TIOA 3M5OA 2VIVA 4WXVA 4BTTB 2I6QA 4ZHMU 2Q6DA 3VXEH 1V2LT 1WUNH 3RXCA 7GCHG 3MHWU 4CRDA 1FQ3A 1KLTA 1ZTLA 1FZZA 1NFUA 2ZGCA 4B75A 5JBTA 3KQDA 4D8NA 1O3JA 1P12E 1EZXC 1TMTH 1EAIA 5DK1A 2OC1A 3RP2A 2P59A 3SGAE 1GBMA 3T5FH 3M3SA 3ATIA 1HJ8A 2XBYA 5GJ4B 1TA2A 2ZA5A 4AORA 1GL0E 1U6QA 1T32A 5A0BA 4KKDA 1GJAB 5AHGH 4YOIA 2CN0H 2P3UB 1HRTH 3M5NA 1VGCC 1QA7A 1C9TA 5C2ZA 1YKTA 4UDWH 2R3UA 1RRKA 1ZZZA 4B71A 2FTLE 5JBAS 2RG3A 1HBTH 1KDQB 1QL8A 1Q2WA 3LH3A 2QN5T 1XUFA 3GY5A 2ZFFH 1O36A 6GCHF 1GCTC 3V3MA 1UVOA 4DW2U 1O2QA 4NIYA 2J95A 3LJOA 3SOSA 2VGCB 3WY8A 2YNBA 3AW1A 2HNTE 2VU8E 3QTOH 3U69H 2WV4A 1LQDB 2BQWB 2G5VA 1OYTH 1DWBH 3QDZB 4OS2A 3Q3YA 1TNJA 3O8DA 1Y3WA 4FUBA 3PMJA 2Z9IA 1UMAH 5HGGA 2BYAX 2PTCE 1TNGA 2BD8A 3JZ2B 4ISNA 5BRRE 3U9AH 3ZVAA 1C5UA 1F2SE 1NTPA 1ABIH 1MTVA 1S82A 1TNHA 2BLWA 3UPEA 3GCHB 1TGNA 3NPSA 3T26A 1HJAC 3GY6A 1S83A 3BEFB 4OGYA 1D9IA 4KTSA 4X2XA 3F1SB 1MTNB 2BDYA 1AZ8A 4RN6A 1P3EA 3SNCA 1V2RT 1EJNA 3ZZCA 3M7TA 1LHCH 3P8NA 2ZU2A 1TMUH 4FU9A 5J4SA 4DURA 1FXYA 3UOUA 3RC6A 2BVRH 3KIDU 1GGDC 3AW0A 3E8LA 1FPCH 1O5GH 4X8SH 1LVOA 5HM2A 2R0KA 3MOCA 1PYTC 1TOCB 1D4PB 2NU1E 2VVVA 2JKHA 2WPKS 4OS6A 3ZVCA 1O2YA 4DJZB 1GJ4H 4OS5A 1WV7H 2PSXA 4JYVH 3GDVA 1QY6A 4WH6A 2BQ6B 3SU6A 8KME2 1LHDH 2FMJA 1DFPA 1EAUA 2ZEBA 5GWZA 1AFEH 3A8BA 1BRAA 2ZHDA 5ETXA 2Q1JA 2VWLA 1TOMH 3Q3KA 2A1DB 2YNAA 5DKMA 1YYY1 2ZQ2A 2G4UA 1IQNA 3TLOA 3H7OA 2GVFA 2WPIS 2TBSA 2ESTE 1ESAA 2WINI 4HZHA 3GCTG 2GCTC 3L33A 4HFPB 1EP5A 1AVWA 2BD9A 1HLTH 2QIQA 2C90B 2VH0A 1TPSA 1V6DA 4FUFA 1WOFA 2Y7ZA 2G52A 5HMAA 1MH0A 4AYYB 3RMOH 4O03A 1VGCB 2XC4A 1SLXB 1QJ6B 5E0GA 1SQOA 3HKJB 2BY8X 1GI2A 2BDHA 1SPJA 1LKBA 5FX5A 5C5NA 1EX3A 4WY3A 2ANKH 1QFKH 1ZSKA 3SJKA 1AZZA 1NRSH 3RMLH 4CBOA 2HALA 3NUMA 4NIWA 1AU8A 1C5YB 4AGKA 1P2MA 3VXFH 5C1UA 2VIOA 1TFXA 3PMAB 1AWFH 4AX9H 3PO1C 1C2FA 1W3CA 3HKIB 1BTYA 4ISOA 4Y7AA 5HYOA 3S7HB 1O2GH 4NIXA 1KYNA 3T27A 1OSSA 2GCHG 4CR5A 3ZZDA 1HV7A 1P0SH 1K2I1 1BT7A 3B23B 1AY6H 1L1NA 1CT2E 5AF9H 2BLQA 2NWNA 3P70B 1YPLH 3I29A 2BZ6H 4IN2A 4IN1A 3RC4A 4BAQB 1GL1A 1Y5UT 3RXIA 3URCA 2NU2E 5EG4A 1TBRH 1D3DB 3TJNA 1XMNB 3MNSA 1C5QA 1XVMA 1FPHH 1H4WA 2BDAA 3K9XB 1CE5A 2FS9A 4CH2B 1KIGH 2A5KA 1NC6A 3ZZ8A 5CMXH 1GJBB 3CS0A 2VH6A 1G3EA 1BITA 1UTKA 1W7XH 2P8OC 1QL9A 3KEEA 1VCWA 1Z1IA 2G4TA 1IOEA 2FX6A 1HFDA 1SBWA 1XX9A 1BZXE 2J9NA 2BOKA 1O39A 3RXHA 4BANB 1KDQA 1BCUH 1SFIA 4AFZA 1AGJA 1C5TA 1FMGA 2F9NA 1FIZA 4U2WA 3KHVA 1BBRE 5L2ZH 3F68H 1TYNA 3PWCA 5CHAC 2BOHB 1C5SA 5FPSA 1KXEA 1QA0A 1PPEE 3UFAA 1G9IE 1NFYA 1SGFG 2THFB 4UFGH 3U1JB 1WYKA 4X6OA 3D65E 1RIWC 2ZECA 1GJCB 3HGNA 2PKAB 2P93A 5LGOA 3P17H 1C4V2 3PB1E 3UTUH 3KF2A 2GDEH 2OD3B 1TGCA 4JCNA 5FX6A 1SGDE 1HAYB 3LGIA 2BD4A 1TBQH 1Z8JB 1DLEA 1DUEA 1MBMA 2GCTB 4ABGA 3MU8A 3G01A 1UTNA 1HAVB 1UTOA 1Z6EA 1LMWB 1BJUA 2FIRH 2CF8H 3GY2A 3TK5A 1C1VH 1GMCF 4CRFA 4GUXA 2FLRH 4YESB 2UUYA 1KLJH 2BQ7B 2LNCA 1NESE 1C2KA 1E0FD 4GCHF 5T6FA 1A4WH 4WF8A 6GCHG 2BX3A 2OQUA 3QX5H 3GY8A 3FANA 1QR3E 2TIOA 1HCGA 1J15A 3FZDA 3SNBA 1V2KT 1A46H 1SVPA 1LHGH 4IMQA 1HYLA 5GXPA 1DY9A 1QCPA 3T25A 1TMBH 1GG6C 1S6FA 3PO1B 2ZF0H 1ELAA 3F9HA 4KP0A 5JBCS 1V2TT 1A0LA 1ESBA 4X1SU 1O5FH 4E7NA 2AYWA 2J2UA 4MPUA 2A2QH 1SHHB 3RXPA 2VWOA 3SI3H 1FAKH 2ULLA 1TGTA 2A4OA 4GVUA 5GPIB 1H1BA 3E0PB 2D8WA 5TCCA 4GAWA