3UOPA

Bovine trypsin variant x(triplephe227) in complex with small molecule inhibitor
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGFYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 51
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3uopA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3uopA02
1SG8B 5T3HA 4BXSA 2WPHS 4TPYA 3SU5A 1PPZA 2P3TB 1TQ0B 1RFNA 2FOEA 4ZMAH 4E06H 2Y5HA 2R0KA 4ZROA 3QK1A 4JCNA 3TGIE 3Q3YA 2Y80A 3SNBA 2WV4A 2B5TB 2UUJB 3BIUH 4LZ1H 5ABWA 1D4PB 1WU1A 1TFXA 1GJ8B 1Y5UT 1EB2A 4NSYA 1FJSA 1WYKA 3ZVGA 2SFAA 1HJAC 2AMQA 1HAXB 2AEIH 2C93B 1C5LH 1O2PA 2BX3A 3SI4H 1O30A 1ZTLA 4A7IB 1ZJDA 2GCHF 4CH2B 4H42U 1SLVB 3LGWA 1DE7H 1XVMA 2PGQB 2PWXA 3PWCA 1YCPH 1ZR0A 3P8OA 3OX7U 4K1SA 2A7CA 2FOBA 1AHTH 2ZO3H 3RXUA 4LZ4B 2VVUA 3R0FA 3RU4T 2BOHB 4NA9H 1P0SH 3ATMA 3HPTB 3ZYEA 3JZ2B 3EA8A 5CMXH 2HWLB 1GHWH 4Q7ZA 3BG8A 3ZZ8A 1HJAB 3KEEA 4TYDA 1RGQA 4YOGA 1GBHA 4Y6DA 1DWEH 2C8ZB 1LQDB 3QN7A 1ANCA 1MBQA 3M3SA 3ZVBA 1V2OT 2WPMS 1N8OB 1TGTA 3O8DA 4J2YB 2BVRH 1O0DH 5GPIB 1IHSH 3U9AH 1YPMH 4QT8C 1A3BH 9LPRA 3M7UA 2VWLA 1ANEA 1DM4B 4OGXA 4MNWA 4F49A 1GHBF 1YPHE 1ELDE 3O8RA 1XVOA 3MYWA 3SU1A 3GCTG 4HZHA 1YPGH 3F6UH 3LC3A 1LVOA 1UCYE 1B7XB 2SGFE 3PYHA 1O39A 5EW2H 1RD3B 1S81A 3A8CA 2PUQH 3U69H 1SGCA 3ATKA 2XBVA 2AMDA 4IGDA 1C5WB 3S7KB 2GTBA 1A7SA 2BDHA 1A2CH 1QL7A 1Z7KA 1A5GH 9ESTA 1O2TA 1KY9A 1BRAA 2OP9A 1QURH 4DJZB 2JETB 1T31A 1TABE 1QBOA 1PJPA 4Y0ZE 1MTNC 1P2JA 4WWYA 5T6FA 4IN2A 2OQUA 4RN6A 2A7JA 2R9PA 2XRCA 1TBRH 1GDQA 2J4IA 2ZCHP 4FUHA 1KXDA 1GJ6A 1F92A 1NROH 1QQ4A 3MHWU 4Y7BA 1BRCE 2PUXB 1KXBA 2VNTA 4Y8YA 1SLWB 1UTPA 1TE0A 3ZZ4A 1ARCA 2OUAA 4IC6A 4MG3A 1VITF 4ZH8A 4K60A 4FUIA 1BMMH 5C5OA 1UO6A 3MU0A 3B9FH 1AD8H 5EGMA 2FS8A 2NU1E 1JRSA 1W8BH 1Y3WA 3B8JA 2BLWA 3PROA 2OC7A 1MTNB 1BTZA 1WTHD 4MLFB 5TJXA 3LJJA 1V2TT 1HAVA 2FODA 3SI3H 1ZPZA 5AFZH 1IQEA 3UIRA 2J95A 1ZGVA 1SI5H 3BTHE 1DSUA 1GJBB 2UUKB 3UY9A 3BTWE 1UVPA 1DT2A 5JPMH 1TNKA 1A0JA 1BHXB 1BIOA 2GDDA 3LIWA 3BEIB 3S0NA 3BTKE 3U8TH 3RP2A 2G55A 3SZNA 2UUFB 4FUFA 1ETSH 4Q80A 1MKXK 1DOJA 1DY8A 3PB1E 1GI7B 3RXPA 5ESTE 5TCAA 2FLBH 1CVWH 2AH4X 1VCQA 3A7TA 1NN6A 2HRVA 1FMGA 1SGNE 1MAXA 2R2WU 3VXEH 2P16A 2Q6GA 2D2DA 1C5SA 1E35B 3TITA 4X2XA 2FDAA 1YCPK 4NWLA 4DURA 3F9GA 4ABGA 1OXGA 2BTCE 3V0XA 2FMJA 3SU4A 1Y3UA 4INHA 1DANH 1ORFA 1HAYB 3RC6A 1UTQA 1O2HA 1UTMA 3SNEA 1V2ST 1HAIH 3DFLA 4ABJA 1F0TA 1AUJA 3A80A 4JMYA 3ENSB 3FP7E 3VXFH 4B76A 3SW2B 3HK3B 3UPEA 1TNJA 4BANB 2BDCA 1GI0A 4K3JA 1ZPBA 3K9XB 3FAOA 3MNCA 1FV9A 3RXKA 1HIAA 4I33A 1CGIE 2D26C 1ZMLA 1EPTC 5GJ4B 2SGPE 1SBWA 2FLRH 3QGJA 2TGDA 1ANBA 1INCA 5EPNA 1AKSB 4JYTA 1TMUH 1C5XB 4GCHG 2SGDE 4AX9H 1W2KH 8ESTE 1PYTD 2BOKA 1AVGH 4X6NA 3D49H 2QYIA 2FS9A 4FUBA 4AOQA 1EQ9A 1GBCA 5DP4A 1CO7E 1O3EA 1HLTH 3A7VA 3S9AA 5A8YA 3UWJH 1EPTB 2BD5A 2Z9JA 3LGUA 3OY6U 2ZZUH 1ZSLA 3TNSA 2OXSA 1D3QB 1S85A 3GICB 4KELA 4MVNA 5JBBS 3MNSA 4B74A 1A46H 5JBTA 1RTKA 1Z8JB 1UTNA 1SHHB 2HOBA 1NS3A 4O97A 3TGKE 1TQ7B 3LGIA 2C3SA 2ANYA 4X2WA 1O2ZA 1QY6A 1PPGE 2H5DA 2M5TA 3KCGH 2D1JA 3LU9B 3E0PB 1TMBH 1XUHA 3NCLA 1GMHG 2O8WA 1FXYA 1JIRA 1THRH 4AB8A 4A92A 4E05H 1CT0E 2VGCC 1HXEH 1LO6A 1JXPA 4CRDA 4Y0YE 2XCFA 1BBRH 2PSYA 1XUJA 3MU5A 1GBEA 1NU7B 1ZZZA 2G5NA 4K1TA 1KIGH 5F6MA 2QXGA 3MH7A 7KMEH 2BY9X 3RM0H 4AFQA 4WXIA 2BVXH 3MO6A 1O2YA 4Y7AA 1O3HA 1ELBA 1EZQA 1TA2A 1U6QA 4YESB 4CRFA 1D3DB 5HGGA 1QBVH 5FCRA 1DY9A 5BPEA 4RKOB 1NRQH 1O2SA 3FFGA 5EG4A 2CHAB 2VGCB 3MMGA 3I29A 2Z9KA 4OS7A 6CHAC 5FBEA 2ZU2A 2GZ9A 2DUCA 1MQ5A 3A81A 2UWOA 1KXEA 3T26A 2FZZA 2VIWA 1C4V2 1TB6H 5A0BA 5C2ZA 4ABAA 1TNHA 1O2UA 1BTWA 3BEUA 1VITH 1BTYA 2AFQB 3RXFA 1CSOE 1O3NA 1ELAA 1OKXA 4DT7B 1GHAG 1L4DA 2FOHA 2QV1A 7ESTE 1CT2E 2DE8A 6CHAB 1AE5A 1J17T 3RXOA 1C1NA 3BTGE 4GUXA 1KSNA 3SOSA 3SUDA 2BQ6B 3T5FH 1SSXA 2FYRA 3M5MA 4XDEA 3TNTA 1P9SA 1BJVA 1MTVA 4NIVA 2R2MB 4YT6H 4GSOA 1EJNA 1QR3E 1UVUH 3SNCA 1AZZA 2O8TA 4TWWA 1P06A 4X6OA 1O2XA 1T32A 3GCNA 1SPJA 8GCHF 2BZ6H 1HUTH 1H8DH 2FTMA 2GMTC 1MTUA 3LT3A 1FDPA 5JB8S 2G8TA 2EC9H 1UVSH 1SGRE 1QB1A 1LHGH 1E34B 2FOMB 5A0CA 3ESTA 2W7SA 3M3VA 3SJ8A 4GHQA 5HXFA 1XUKA 4X0WU 3F9HA 3CP7A 2P3UB 5GWZA 3SU0A 5JBCS 1AY6H 1MU6B 3P92A 2BDGA 1IQLA 2ZIQH 2H6MA 3DFJA 1O2IA 4JYUH 3EYDA 3IG6B 1O38A 2F9OA 1ID5H 2A31A 2PTNA 1SVPA 1OP0A 3E8LA 4VGCC 1SC8U 1YYY1 2WPKS 3E0NB 1HXFH 2GMTB 1BCUH 1O5EH 1C9PA 2TIOA 3U1JB 3MTYA 2BD4A 5ESBA 1A3EH 3T28A 2HALA 2J38A 3TGJE 1G32B 1ELVA 1O5AB 1VR1H 1E37B 2ZDVH 5C1XA 1UTJA 2P94A 1PFXC 3AASA 3AW0A 2OCVB 3GY3A 1Y3XA 1OX1A 3RMOH 1AWHB 1E0FD 4TPIZ 5A2MH 2ZFQH 3ATWA 3SQHE 1C1RA 4CBNA 2BD9A 3BTQE 3LC5A 2XNIA 4KTCA 2BDAA 1OP2A 1ESBA 1Q31A 1SGQE 4ABEA 3KF2A 3T27A 2A2XH 1WOFA 1DS2E 4A6LA 1BBRK 3DD2H 3T29A 1PPCE 1BA8B 3MNXA 2JH6D 6LPRA 3TH3H 4WF8A 3SGAE 1O3DA 1UVOA 1G3DA 3PTBA 3K6ZA 2A0QB 2ZFFH 2BY7X 1BHXF 4DIHH 4YTAA 3K65B 4JK6A 1SLXB 4OS1A 3VB3A 1KTTB 3UOUA 2WV5A 1CHOG 4B2CA 1XXFA 4XBCA 1QJ1B 1ZYOA 1X7AC 3HK6B 1GCTC 2QY0B 3GY7A 1TBQH 2G4TA 5E0HA 3TH2H 2PGBB 1V2VT 5F8XA 3BG4B 1FQ3A 5FPSA 5DP6A 3UOPA 1EAIA 4Y10E 5AHGH 3RMMH 1BITA 4UFDH 1XMNB 1Y8TA 1ESAA 2WPJS 3RXTA 1K1JA 4UFFH 4KTSA 3SGQE 2SNVA 1C5NH 3HKIB 1GHXH 4WXVA 2GCTC 4BNRA 1NFXA 1DXPA 3MO9A 4YLUA 2CGAA 2H5CA 3TIUA 4AFUA 1V2KT 2AERH 1ZPCA 1LDTT 1AFEH 4K5ZA 4UFGH 1GCTB 5EPYA 2CMYA 1HAPH 1O5FH 3SV7A 4GAWA 2NU3E 5T6DA 1IAUA 4ZAEA 1C1MA 2TPIZ 5GCHF 1O3JA 3PMHB 1HJ9A 3GCHC 3D62A 3A89A 5TCCA 1DWCH 3RXHA 5GXPA 1C1TA 4ISHH 2GCTB 1GJAB 1GJ5H 1C1PA 2BD7A 4MTBA 3M37A 5E2PA 1F5LA 3STJA 1C5RA 2OTVA 1K9OE 1O3OA 1MZDA 1XUFA 1Y3YA 4KKDA 4WJG2 4K1EA 3KQEA 1NRRH 3SUEA 1CA0C 3MU8A 4X1QU 2HVXA 1V2QT 1DLEA 3VB5A 1B0FA 1ZHRA 3OU0A 3RC5A 3GCHB 1W11U 2ZEBA 1O2WA 1PQ7A 1IQMA 2EI6A 1TONA 4X6MA 1KTSB 2BZAA 2GKVE 1GG6B 3VPKA 2Y82A 1F5RA 3S9BA 1C2HA 2ZPSA 3KL6A 5LPRA 3F9FA 1N8OC 1LQEA 1GJ4H 1LCYA 4OGYA 1NFYA 2GDEH 2TGPZ 5EW1H 1P2QA 1TRYA 2PV9B 2OBQA 1P3CA 4DG4A 1MD8A 2D8WA 4D9RA 1CA0B 1QL8A 1MTSA 4XBDA 3ZVFA 2ZG0H 1ZSJA 5C5NA 4CRBA 4NA8A 3LOXA 2VH0A 1LVBA 4Y71A 1NY22 3RXDA 2AGEX 1PQ8A 1MZAA 1C5YB 2JKHA 1LVMA 2C8YB 1OWEA 2QGRA 2O8MA 1EZSC 4ZXXH 2FTLE 5GIBA 4A5TS 3U98H 1QQUA 3SUGA 1G3CA 1S0RA 2V3OH 4J1YA 1F2SE 1SGYE 1LMWB 2PR3A 1YP9A 3VGCB 1TGSZ 2CF9H 3BF6H 1TYNA 1S82A 2ANMH 3KQBA 2ZKSA 3R3GB 3ZZAA 2BMGB 4D9QA 1TX7A 5IDKA 1K1OA 1KDQB 1GI4A 2H9TH 4DGJA 5A0AE 1A4WH 1MTWA 1QA7A 2YNBA 4XE4A 1P2OA 2BD2A 4RKJB 1C5PA 2JETC 5HM9A 1W7XH 1LHEH 5EOKA 1EKBB 1GI3A 1YBWA 1B0EA 2STBE 2G4UA 3E6PH 1PQ5A 3LGVA 2Q6FA 4TWYA 2JH0D 2RDLA 3RDZA 5EXMA 3GY2A 1V6DA 1QCPA 3HKJB 3E90B 4I8GA 1CU1A 1BDAA 1SOZA 2CN0H 2JH5D 3Q00A 4NCYA 2IN2A 2NU0E 2GZ8A 1ELGA 1S6HA 2Y5GA 3ZZ3A 5GDSH 2FP7B 2UUYA 5K7RA 4NIWA 1VCWA 2SGEE 5PTPA 1O3AA 2XYAA 2Z6BD 3KHVA 1RJXB 2FX4A 3SJKA 1ELCA 1TGNA 1BTPA 1L1GA 2BLOA 2ZGHA 2VVVA 2XWBI 1H9LB 1TWXB 3BV9B 2FO9A 1ZTKA 4FU9A 1MKWK 4D8NA 2QIQA 4FXGH 1IOEA 1BBRE 2C4FH 2W26A 1QL9A 2LNCA 2VVCA 2W5EA 2Y7ZA 4U30A 3TK9A 1BMAA 3PV4A 3MH5A 2ODPA 1AUTC 4IC5A 1K1IA 3OYPA 3SJOA 3I77A 1WAYB 2ZFSA 1GJCB 3TH4H 3P8FA 1J15A 2B9LA 1QB9A 4BAOB 2F9BH 1K1NA 1O2KA 1RS0A 3QTVH 4A1VA 1C2LA 3QX5H 4E7NA 2XBXA 1EXFA 3A85A 1ABIH 1GGDC 2Y81A 3RUOA 2XBWA 1IQKA 4X1SU 1ZHPA 1ANDA 2R3UA 3STIA 1DWDH 3RC4A 1F5KU 3WY8A 1C5TA 1LVYA 1GHAF 2VIOA 1WQSA 5C20A 5FCKA 5LGOA 1BTHH 1QGFA 3NKKA 3T25A 3VEQB 5DG6A 3I78A 4UE7H 1DUEA 2PTCE 1O2OA 1O2VA 4CBOA 1AGJA 2F91A 1QBNA 3L6PA 2A1DB 1O34A 1ZRBA 3A83A 3UUZA 1GGDB 3GYMA 2O8UA 1C5OH 1W0YH 2G52A 4ABFA 1DX5M 4FU8A 3P6ZB 4H4FA 3VB4A 2V35A 1DICA 1GBJA 2CV3A 1EAUA 1DXWA 2WUBA 1O36A 2P3FH 4ABIA 2DE9A 1A5IA 1YC0A 3E91A 1CGJE 1SGFG 1QRXA 1TAWA 1O2RA 1WV7H 3RXVA 2OC0A 3UNRA 1MD7A 2UWLA 2QC2A 1L4ZA 2R0LA 3RMNH 2FXRA 2ZHDA 5I46H 3A88A 5DPAA 5FBIA 1S5SA 4Y11E 2VIQA 3GDUA 4KTUA 1C9TA 3QO6A 3TJOA 1F0SA 1GMDG 2ZPRA 4OS6A 1GPZA 1S6FA 1UHBA 2AMPA 1OSSA 1H4WA 3P70B 7LPRA 3RXGA 1H9HE 1FY3A 2AYWA 1HGTH 2ULLA 2KAIA 1C2IA 1TPAE 3RM2H 2A7HA 2ZU4A 3RXCA 1FIZA 1G36A 1T8NA 3A84A 4FUGA 1P2IA 1EAWA 3F68H 1YF4A 2ESTE 3H5CB 5J4SA 5JBAS 3P8GA 1C4U2 2ZU3A 5EODA 1C5VA 4BAQB 2QN5T 1AQ7A 1SGIB 3IITA 3RXLA 2RG3A 3RXQA 1ZHMA 3F9EA 1K1PA 3K6YA 3M5NA 1ZTJA 1ESTA 3TPIZ 2BHGA 2NWNA 1NFUA 6GCHF 1P2NA 5H4IB 3SV6A 4Z6AH 1GI6A 1O3LA 1V2MT 2A4RA 1GI9B 4OS4A 4Y76A 1JOUB 1SOTA 1Z71A 1W10U 1FY4A 5LPEA 1G37A 3GY6A 1P12E 5C1UA 3W94A 2PW8H 1CHOF 3M7QA 4MNVA 3C27B 1V2NT 1HRTH 4INLA 4ZHMU 4CR5A 2B0FA 4XFQA 2Z3DA 5DP3A 4WMFA 2H2ZA 5DP9A 1QRZA 3ODDA 1A61H 1CHGA 1S83A 4AG2A 1N1LA 3M3TA 1GHBG 1Z6JH 1FY1A 1EJAA 1FN8A 1UVTH 2CHAC 3ZZCA 3VB6A 1KLJH 1O3MA 3RU4E 5EQSA 2H9HA 3OY5U 1AI8H 1BMLA 2I6SA 4BTIB 1O3FA 1PPBH 1FAXA 1G2MA 1P04A 1P3EA 5FPTA 3ATLA 4JK5A 1GBAA 1SGPE 1A0LA 3SORA 4AFSA 1N6XA 3BSQA 5FX6A 5EXLA 1TOMH 1W14U 3SNAA 1FY8E 3E3TA 2AS9A 3UREA 1C2FA 1GBBA 3OTJE 5L2ZH 3SGBE 1G2LA 4GPGA 3UFAA 2A5KA 4UD9H 1ZRKA 1VCPA 5FX5A 2PKSB 2OD3B 1EUFA 2FOAA 1V2UT 1P11E 3U8RH 5JYIA 1S84A 1K2I1 1UTKA 3ATIA 1P10A 2BB4A 1VITG 3P17H 2XXLA 1KXFA 1A5HA 3JZ1B 1CT4E 3URCA 2H1UA 1D3PB 1TPPA 2ZU5A 4MPWA 1O2NA 4X6PA 1TX6A 1P2MA 2ZA5A 4WH6A 1WBGB 3RXJA 1OWJA 1WCZA 2P93A 4AZ2B 3F1SB 1HAVB 1GBTA 3BIVH 3A7YA 1Y59T 1ZMNA 1NESE 1P03A 1HAHH 2F83A 2BQWB 4NFFA 2VH6A 3UNSA 1OWKA 3N7OA 5A09A 1CQQA 1IQIA 1QJ6B 1ETTH 1PPEE 2PSXA 4FUDA 2HGTH 1NTPA 1WUNH 3A86A 1EP5A 3SO3A 1G9IE 3D23A 3TK6A 4IMQA 1YPKH 2A4QA 4X8UH 2WYGA 1RIWC 1O3GA 1A1RA 3GY5A 2VB0A 2ZP0H 4FVBA 4U2WA 1UTLM 3RLYH 4ABDA 4X1RU 1C2JA 1L0ZA 3E16B 2FESH 4FU7A 1J9CH 4NZLA 1G3EA 4LOYH 1V3XA 3EAJA 4NGAH 1P09A 3A8BA 4GVUA 4FVDA 1RIWB 1EX3A 3PWBA 3SV2H 2H9EH 1HFDA 1HNEE 1Y3VA 3GCTF 1WTGH 2QA9E 1O5DH 4ZKRU 1FPCH 4HGCA 1PYTC 1QIXB 1K1MA 3TJUA 2J92A 5FAHA 2Z3EA 1VZQH 1SLUB 3PMJA 1ZLRA 2ANWA 2QAAA 5T6GA 5JDUB 3E1XB 1BQYA 3ZYDA 3QWCH 2BD3A 1DWBH 1HPGA 1UHBB 3QUMP 1HIAB 2BLQA 1D6RA 3M5OA 1UMAH 1GHYH 1C2GA 1C5QA 1TA6A 5CHAB 1HCGA 2Y6TA 3BG4C 2FEQH 2PHBA 5DP8A 1EP6A 2BX4A 1GBMA 1DLKB 3G01A 3L3TA 1P8VC 1TNLA 3O8BA 4ZKOU 2BDIA 1AFQB 1NC6A 2ZTYA 4X1NU 1YKTA 4YZUA 2QF0A 1TMTH 4O3TA 4TY7A 5E2OA 4HI3A 1B5GH 2PKAA 3RMLH 4Z0KA 3KQCA 3UNQA 1DDJA 3H7TA 1SGEE 1O31A 4IN1A 3FP6E 1C2KA 2O8LA 5HYOA 3MWIU 1C2DA 1P57B 1MH0A 3RLWH 1VJ9U 1O2QA 2G81E 2ZTZA 2R3YA 3MH6A 3MO3A 2NU2E 4KP0A 4FUCA 3Q3XA 5DJ7A 3TVJB 1T7CA 5C3NA 5I25A 1BOQA 2HNTF 2ZFRH 2WYJA 2RCEA 3EGKH 1XUGA 2GVFA 1QHRB 3IWMA 2AGIX 2V6NA 2TBSA 2ZDKA 4I8LA 7GCHG 1LKBA 1FUJA 2XC4A 2TGAA 2ZHQH 3LGYA 3MFJA 1GI5A 1PQAA 1AVWA 1W7GH 3QZRA 1FLEE 1GHZA 1VGCC 2YOLA 5DKMA 1D6WA 1O33A 2V0BA 3QTOH 4NFEA 2AIPA 3A87A 2ZHFH 5SGAE 1UK2A 2IOTA 1KLTA 3DT0H 3PLKA 3SU3A 2ZDLA 2BLVA 1SQAA 5C1YA 1GG6C 1RTFB 2Y5FA 2ZPQA 8LPRA 1AZ8A 1T8MA 4OS2A 4UEHH 3ZZ5A 5L30H 1GI1A 3LPRA 4Y8XA 1T8LA 1FAKH 1BMNH 3A82A 1LKAA 2P8OC 5IYTA 2OQ5A 2FOCA 4INKA 1XXDA 2GX4A 3BEFB 2ODYB 3A8DA 3CS0A 4B2AA 1VGCB 2F9VA 2ZDAH 2W3KA 5EQRA 4HTCH 1SGFA 1GVZA 4AORA 4O03A 3GDSA 3MU4A 5F03A 1KLIH 3ZZ9A 3ITIA 1DVAH 2HPQH 2GD4B 2PFEA 1FZZA 1MCVA 3ZVAA 4WY3A 2XWAA 4UFEH 1GMCG 2TGTA 1GMDF 4NA7A 2QXIA 1O5BB 4YOIA 2FWWA 3SV8A 3VGCC 1QNJA 1T8OA 4CHAB 1W0ZU 2P8OB 3FZZA 4X8VH 1W13U 1MKXH 3AAVA 3KNXA 1TLDA 4X8SH 1FPHH 3S69A 1F0RA 4CR9A 1MU8B 2QCYA 1AKSA 2QXHA 1OYQA 1O3CA 1XKBC 1FIWA 1TX8A 4NIYA 1ARBA 4GCHF 4YLQH 2BY6X 3TU7H 2XC0A 1NPMA 3KQDA 1O3KA 5EU8A 1P01A 4D76A 1Z1IA 1SQTA 2VWOA 8GCHG 1EPTA 5FHTA 2WPIS 4ABHA 4R8TB 3GDVA 3L33A 4IMZA 3T62A 3KIDU 2ASUB 5A8ZA 1WSSH 4MPVA 2QF3A 2PLXA 4AYVB 3ZZDA 1TPOA 3DA9B 3ZV8A 5L2YH 1WQVH 1NRPH 2OC8A 2FIRH 1J14A 3UR9A 2BQ7B 3UQOA 4THNH 4ISLA 3RXAA 2VINA 1SMFE 4AN7A 4I8JA 2HLCA 4BXWA 1GWAA 2SGQE 1IQGA 1JRTA 2A4GA 4X2VA 1GMHF 2WINI 2GV7A 2ZDNA 1TIOA 2C90B 1GI8B 1Z8GA 1YM0A 4ZUHA 1THSH 1TRMA 3ZZ7A 4I8HA 2GT7A 5CE1A 1C1WH 2K1QA 4XOJA 4K8YA 1GVLA 1C2MA 4FUEA 1DFPA 1BTUA 3ELAH 3EDXB 1BRUP 5HM2A 1D3TB 1NT1A 1F7ZA 1GL1A 1NFWA 5FXLA 5AF9H 3SHCH 1UK4A 4I31A 3ZVCA 3V7TA 3BTDE 1IQFA 3S7HB 1J8AA 1FNIA 2STAE 1PPFE 3LKWA 3TJNA 3EA9A 1BRBE 2QXJA 1Z6EA 1OWHA 2FPZA 2W7UA 3GISB 1CE5A 1W12U 3MNBA 1TOCB 3VB7A 4B71A 2ILNA 3VFEA 1EOJA 1CGHA 4X8TH 3Q77A 4H6SB 2Q6DA 3A7ZA 3UWIA 1XKAC 4A1XA 4YO9A 1SFIA 2HNTC 4WH8A 1UTOA 1O37A 2F9UA 4B73A 2FI4E 2PKAB 3RXMA 4U01A 4PROA 1YPEH 3NWUA 1HDTH 4ZKNU 4NIXA 1GHVH 5DGJA 1Y5AT 3BTTE 4GHTA 4I32A 1XUIA 3LJOA 1LHFH 4R0IA 2BY8X 2P95A 3PLPA 4UONA 2Z9GA 2EA3A 1K1LA 3RXBA 2BDBA 4B1TA 2Z3CA 1XX9A 3LONA 2AGGX 1P9UA 2FYQA 1V2LT 2WUCA 2ZI2H 1UJ1A 1MQ6A 3DHKH 4B75A 1EJMA 4AG1A 4RSPA 3P95A 1P02A 4DOQA 5E8EH 1GDNA 1G3BA 1O2GH 3SN8A 1Q2WA 2BD8A 5J4QA 1KXCA 1NO9H 1L1NA 1GVKB 1E38B 1FY5A 2XTTB 3MI4A 4MQAA 1L2EA 5GCHG 1LTOA 4CRCA 1C1QA 4AFZA 1O3BA 2J94A 1GBKA 1Z1JA 2ALPA 4X2YA 3SHAH 4WMDA 1CA8B 1RTLA 1GBFA 4I8KA 3OSYA 3ZV9A 4IW4E 2ZU1A 1OWIA 4JZDH 3A7XA 2ODQA 3NXPA 2ZGCA 3U1IB 1IQJA 2I6QA 1SL3A 3M36A 3KN2A 1AE8H 1ELEE 5E0GA 1HAZB 5G4BA 4KGAA 2J9NA 2ZF0H 2ZGBH 2BM2A 1MMJN 2BXUH 1OS8A 3EE0B 1FN6A 3DUXH 2J2UA 4ZXYH 3QGNB 2A32A 3W95A 4Q7XA 1AB9C 1SR5C 1TALA 4F4OC 5AFYH 3TK5A 3O8CA 2ZECA 1J16A 4DIIH 2GCHG 1GL0E 1GJ7B 4FUJA 3SNDA 3ZZBA 1T4VH 2F3CE 1YPHC 4IS5A 2XC5A 2Z7FE 2A2QH 1OP8A 3BTEE 1SGDE 2ZGXH 3GCOA 1JWTA 3ZZ6A 3HGNA 1HBTH 3QZQA 2ZNKH 1O5CB 2ZHWH 3NUMA 4X1PU 3SV9A 5DO4H 4BAHB 1AB9B 1BUIA 5EXNA 2F9PA 4MDSA 2FI5E 4DW2U 3TJVA 4UDWH 1O32A 1C2EA 2OC1A 2ZWLH 5BRRE 2CF8H 2Y7XA 2ZDMA 1FONA 3HATH 4E7RG 1QJ7B 3NZIA 3CENA 4MPUA 4ZKSU 4LXBH 2ZFPH 3RXSA 3GOVB 2BY5X 1UCYH 3RU4D 2O9QA 3EA7A 1ZSKA 2PKSC 2TRMA 1OPHB 2ZFTA 1OOKB 1GI2A 2A4OA 2J34A 3GY8A 1SQOA 2A5IA 1F0UA 1TNGA 2Z9LA 4JZ1A 1SHYA 3V12A 2A5AA 1TNIA 7GCHF 1BZXE 4U32A 3PMAB 1P2KA 2XW9A 4XBBA 2XBYA 5HMAA 1FI8A 2SGAA 1C1UH 2ZQ1A 4ISOA 4K8BA 1EATA 3H7OA 4JZIA 1DITH 1OWDA 4CRAA 4A1TA 1T4UH 4JZFH 2VIVA 5B6OA 2FI3E 1GBIA 2FOGA 4SGAE 1IHTH 1ACBE 2VWMA 1Q3XA 3LH3A 2G5VA 2P59A 1RRKA 3CS7A 5JB9S 1GJ9B 1LHDH 3ZVEA 3S9CA 4ABBA 1V2RT 1QTFA 2G51A 3M5LA 1LPZB 5K0HA 4WMEA 1V2WT 5L6NH 4Y8ZA 2W3IA 2OINA 8KME2 1ZGIA 2OLGA 1QB6A 1JIMA 3PM3A 4Y79A 1THPB 2FX6A 1LHCH 2IJOB 5C67A 1GBLA 4MPXA 4ISNA 1GMCF 4AYYB 1MAYA 1H9IE 3V13A 2Q1JA 1OYTH 3PTNA 3SQEE 2BVSH 1G30B 5E0JA 3RXIA 1O3PB 2ALVA 5AVDA 5A8XA 4AGJA 1H8IH 3A8AA 4TY6A 3AAUA 1ZMJA 4DCDA 2ZCLP 1ABJH 2Z9IA 2BYAX 4YOJA 2GV6A 3GYLB 2RA0A 1SB1H 3B23B 4NSVA 1PPHE 1C5MD 4D7FA 1S0QA 2A45B 5DK1A 1QA0A 2GZ7A 4MNYA 3D65E 1YLCA 5F8ZA 1V2PT 2WPLS 1XM1A 1NRNH 2VJ1A 4ESTE 3K2UA 3LH1A 2NU4E 3ODFA 4BAMB 1ELTA 3SJ9A 3RXRA 4DY7B 4NWKA 3A7WA 3FANA 1QRWA 1AN1E 1YPLH 4NG9H 4BOHA 1KDQA 1C1SA 1Y5BT 1YLDA 2ZHEH 1O2MA 1BJUA 2GGVB 4Q7YA 2HPPH 2YNAA 1EOLA 3M7TA 4YT7H 4IBLH 4I7YH 2EI7A 1UK3A 5ETXA 2V3HH 3T2NA 5LPFA 2BDYA 4K2YA 1GBDA 1O2LA 3Q76A 1YGCH 2EEKA 2VIDA 5CHAC 4HFPB 4CH8B 4NZQA 6ESTA 1ETRH 1DSTA 2UWPA 2B8OH 2VU8E 2CJIA 1GCDA 1AIXH 1ZJKA 3FZDA 4YM9A 4LK4A 1AFQC 1DUAA 1MBMA 3AVZA 1C5ZB 3BTME 3QDZB 3SBKA 1C5UA 5LH8A 1EZUC 4DVAU 3ZVDA 1TGBA 3FVFB 3NPSA 1IQNA 1GJDB 1UCYK 4ZHLU 2B7DH 1O2JA 3C1KA 3SUFA 3PMBB 2GP9B 4O3UA 1HAGE 1VJAU 2KAIB 3MH4A 3QLPH 3M61U 3PO1C 2OBOA 3BN9A 4AB9A 1H1BA 2EI8A 3P8NA 1Z8IB 1GDUA 3RXEA 2SNWA 4ZHAA 2IPHA 3KGPA 3LGTA 1HB0B 3V3MA 1AMHA 1O3IA 1IQHA 1E36B 4VGCB 1TGCA 4Q2KA 3SJIA 2AIQA 1NZQH 2F9NA 4K69A 1MCTA 1EAXA 2C8XB 4MNXA 2FOFA 3UR6A 1SGTA 1RXPA 1DPOA 1AO5A 3GY4A 2RA3A 6GCHG 3UQVA 5F8TA 5EQQA 1TPSA 1BTXA 1BB0B 1EB1H 1K22H 1V2JT 4H6TA 1C4Y2 2G00A 3UTUH 4B2BA 3PO1B 4OS5A 1TRNA 1W3CA 2GT8A 4M7GA 1HYLA 1K28D 2ZGJA 2THFB 1LPKB 2ZC9H 4CRGA 4WVPE 1ZOMA 3BTFE 3NK8A 3U8OH 1HV7A 1KYNA 1NU9A 3AW1A 1K21H 1O5GH 1EZXC 1LPGB 4CREA 2FM2A 2BXTH 2CXVA 5FPYA 4AGKA 1L1JA 2ZTXA 3EQ0H 1HJ8A 1AU8A 1NM6A 1YPJH 2LPRA 4XSKU 1YCPM 3MOCA 1CBWC 4SGBE 4JZEH 1AWFH 3M35A 1SFQB 3TLOA 4ASHA 2XCNA 4BTUB 1C1OA 4O9VA 1JBUH 2ANKH 1C1VH 5DP5A 2VWNA 1MKWH 2ZCKP 3HGPA 5DP7A 2C8WB 4JYVH 3URDA 3SU6A 4GLYA 1Z8RA 3MU1A 1A0HB 4ISIH 1AVXA 1BT7A 4BAKB 4D7GA 1JMOH 1QFKH 1P05A 1M9UA 4CHAC 1N6YA 2HNTE 3PLBA 1CBWB 1ELFA 1MUEB 2ZQ2A 3Q3KA 2Z94A 3FP8E 1TBZH 2VIPA 1NRSH 1D9IA 1HAOH 4BTTB 1EASA 3SU2A 3LDXH 1KXAA 1O35A
chains in the Genus database with same CATH superfamily
1SG8B 5T3HA 4BXSA 2WPHS 4TPYA 3SU5A 1PPZA 2P3TB 1TQ0B 1RFNA 2FOEA 4ZMAH 4E06H 2Y5HA 2R0KA 4ZROA 3QK1A 4JCNA 3TGIE 3Q3YA 2Y80A 3SNBA 2WV4A 2B5TB 2UUJB 3BIUH 4LZ1H 2YMSB 5ABWA 1D4PB 1WU1A 1TFXA 1GJ8B 1Y5UT 1EB2A 4NSYA 1FJSA 1WYKA 3ZVGA 2SFAA 1HJAC 2AMQA 1HAXB 2AEIH 4ACAA 2C93B 1C5LH 1O2PA 2BX3A 3SI4H 1O30A 1ZTLA 4A7IB 1ZJDA 2GCHF 4CH2B 4H42U 1SLVB 3LGWA 1DE7H 1XVMA 2PGQB 2PWXA 3PWCA 1YCPH 1ZR0A 3P8OA 3OX7U 4K1SA 2A7CA 2FOBA 1AHTH 2ZO3H 3RXUA 4LZ4B 3OFND 2VVUA 3R0FA 3RU4T 2BOHB 4NA9H 1P0SH 3ATMA 3HPTB 3ZYEA 3JZ2B 3EA8A 4B6EA 4Z1MD 5CMXH 2HWLB 1GHWH 4Q7ZA 3FOAA 3BG8A 3ZZ8A 1HJAB 3KEEA 4TYDA 2CK3D 1RGQA 4YOGA 1GBHA 4Y6DA 3W1EA 1DWEH 2C8ZB 1LQDB 3QN7A 1ANCA 1MBQA 3M3SA 3ZVBA 1V2OT 2WPMS 1N8OB 1TGTA 3O8DA 4J2YB 2BVRH 1O0DH 5GPIB 1IHSH 3U9AH 1YPMH 4QT8C 1A3BH 9LPRA 3DCLA 3M7UA 2VWLA 1ANEA 1DM4B 3OEED 4OGXA 4MNWA 4F49A 1GHBF 1YPHE 1ELDE 3O8RA 1XVOA 3MYWA 3SU1A 3GCTG 4HZHA 1YPGH 3F6UH 3LC3A 1LVOA 1UCYE 1B7XB 2SGFE 3PYHA 1O39A 5EW2H 1RD3B 1S81A 3A8CA 2KCAA 2PUQH 3U69H 1SGCA 3ATKA 2XBVA 2AMDA 4IGDA 1C5WB 3S7KB 2GTBA 1A7SA 2BDHA 1A2CH 1QL7A 1Z7KA 1A5GH 9ESTA 1O2TA 1KY9A 1BRAA 2OP9A 1QURH 2F43B 4DJZB 2JETB 1T31A 1TABE 1QBOA 1PJPA 4Y0ZE 1MTNC 1P2JA 4WWYA 3PV5A 5T6FA 4IN2A 2OQUA 4RN6A 2A7JA 2R9PA 2XRCA 1TBRH 1GDQA 2J4IA 2ZCHP 4FUHA 1KXDA 1GJ6A 1F92A 1NROH 1QQ4A 3MHWU 4Y7BA 1BRCE 2PUXB 1KXBA 2VNTA 4Y8YA 1SLWB 1UTPA 1TE0A 3ZZ4A 1ARCA 2OUAA 4IC6A 4MG3A 1VITF 4ZH8A 4K60A 1S6LA 4FUIA 1BMMH 5C5OA 1UO6A 3MU0A 3B9FH 1AD8H 5EGMA 2FS8A 2NU1E 1JRSA 1W8BH 1Y3WA 3B8JA 2BLWA 3PROA 2OC7A 2QE7D 1MTNB 1BTZA 1WTHD 4MLFB 5TJXA 3LJJA 1V2TT 1HAVA 2FODA 3SI3H 1ZPZA 5AFZH 1IQEA 3UIRA 2J95A 1ZGVA 3F3BA 1SI5H 3BTHE 1DSUA 1GJBB 2UUKB 3UY9A 3BTWE 1UVPA 1DT2A 5JPMH 1TNKA 1A0JA 1BHXB 1BIOA 2GDDA 3KQ5A 3LIWA 3BEIB 3S0NA 3BTKE 3U8TH 3RP2A 2G55A 3SZNA 2UUFB 4FUFA 1ETSH 4Q80A 1MKXK 1DOJA 1EFRD 1DY8A 3CNRA 3PB1E 1GI7B 3RXPA 5ESTE 5TCAA 2FLBH 1CVWH 2AH4X 1VCQA 1SKYE 3A7TA 1NN6A 2HRVA 3N99A 1FMGA 1SGNE 1MAXA 2R2WU 3VXEH 2P16A 2Q6GA 2D2DA 1C5SA 1E35B 3TITA 4X2XA 2FDAA 1YCPK 4NWLA 4RT1A 4DURA 3F9GA 4ABGA 1OXGA 2BTCE 3V0XA 2FMJA 3SU4A 1Y3UA 4INHA 1DANH 1ORFA 1HAYB 3RC6A 1UTQA 1O2HA 1UTMA 3SNEA 1V2ST 1HAIH 3DFLA 4ABJA 2J97A 1F0TA 1AUJA 3A80A 4JMYA 3ENSB 3FP7E 3VXFH 4B76A 3SW2B 3HK3B 3UPEA 1TNJA 4BANB 2BDCA 1GI0A 4K3JA 1ZPBA 3K9XB 4F48B 3FAOA 3MNCA 1FV9A 3RXKA 1HIAA 4I33A 1CGIE 2D26C 1ZMLA 1EPTC 5GJ4B 2SGPE 1SBWA 2FLRH 3QGJA 2TGDA 1ANBA 1INCA 5EPNA 2RFKC 1AKSB 5FL7D 4JYTA 1TMUH 1C5XB 4GCHG 2SGDE 4AX9H 1W2KH 8ESTE 1PYTD 2BOKA 1AVGH 4X6NA 3D49H 2EQNA 2QYIA 2FS9A 4FUBA 4AOQA 1EQ9A 1GBCA 5DP4A 1CO7E 1O3EA 1HLTH 3A7VA 3S9AA 5A8YA 2JDID 3UWJH 1EPTB 2BD5A 2Z9JA 3LGUA 3OY6U 2ZZUH 1ZSLA 3TNSA 2OXSA 1D3QB 1S85A 3GICB 4KELA 4MVNA 5JBBS 3MNSA 4B74A 1A46H 5JBTA 1RTKA 1Z8JB 1UTNA 1SHHB 2HOBA 1NS3A 4O97A 3TGKE 1TQ7B 3LGIA 2C3SA 2ANYA 4F55A 4X2WA 1O2ZA 1QY6A 1PPGE 2H5DA 2M5TA 3KCGH 2D1JA 3LU9B 3E0PB 1TMBH 1XUHA 3NCLA 1GMHG 2O8WA 1FXYA 1JIRA 1THRH 4AB8A 4A92A 4E05H 1CT0E 2VGCC 1HXEH 1LO6A 1JXPA 4CRDA 4Y0YE 2XCFA 3OEHD 1BBRH 2LELA 2PSYA 1XUJA 3MU5A 1GBEA 1NU7B 1ZZZA 2G5NA 4K1TA 1KIGH 5F6MA 2QXGA 3MH7A 7KMEH 2BY9X 3RM0H 4AFQA 4WXIA 2BVXH 3MO6A 1O2YA 4Y7AA 1O3HA 1ELBA 1EZQA 1TA2A 1U6QA 4YESB 4CRFA 1D3DB 5HGGA 1QBVH 5FCRA 1DY9A 5BPEA 4RKOB 1NRQH 1O2SA 3FFGA 5EG4A 2CHAB 2VGCB 3MMGA 3I29A 2Z9KA 4OS7A 6CHAC 5FBEA 2ZU2A 2GZ9A 3FN8A 2KCOA 2DUCA 1MQ5A 3A81A 2UWOA 1KXEA 3T26A 2FZZA 2VIWA 3H09A 1C4V2 1TB6H 5A0BA 5C2ZA 4ABAA 1TNHA 1O2UA 1BTWA 3BEUA 1VITH 1BTYA 2AFQB 3RXFA 1CSOE 1O3NA 1ELAA 1OKXA 4DT7B 1GHAG 1L4DA 2M2AA 2FOHA 2QV1A 7ESTE 1CT2E 2DE8A 6CHAB 1AE5A 1J17T 3RXOA 1C1NA 3BTGE 4GUXA 1KSNA 3SOSA 3SUDA 2BQ6B 3T5FH 1SSXA 2FYRA 2JIZD 3M5MA 4XDEA 3TNTA 1P9SA 1BJVA 1MTVA 4NIVA 2R2MB 4YT6H 4GSOA 1E1RD 1EJNA 1QR3E 1UVUH 2WPDD 3SNCA 1AZZA 4HG6A 2O8TA 4TWWA 1P06A 4X6OA 1O2XA 1T32A 3GCNA 1SPJA 2KFWA 8GCHF 2BZ6H 1HUTH 1H8DH 2FTMA 2GMTC 1MTUA 3LT3A 1FDPA 5JB8S 2G8TA 2EC9H 1UVSH 1YWUA 1SGRE 1QB1A 1LHGH 1E34B 2FOMB 5A0CA 3ESTA 2W7SA 3M3VA 3SJ8A 4GHQA 5HXFA 1XUKA 4X0WU 3F9HA 3CP7A 2P3UB 5GWZA 3SU0A 5JBCS 1AY6H 1MU6B 3P92A 2BDGA 1IQLA 2ZIQH 2H6MA 3DFJA 1O2IA 4JYUH 3EYDA 3IG6B 1O38A 2F9OA 1ID5H 2A31A 2PTNA 1SVPA 1OP0A 3E8LA 3SZEA 4VGCC 1SC8U 1YYY1 2WPKS 3E0NB 1HXFH 2GMTB 1BCUH 1O5EH 1C9PA 2TIOA 3U1JB 3MTYA 2BD4A 5ESBA 1A3EH 3T28A 2HALA 2J38A 3TGJE 1G32B 1ELVA 1O5AB 1VR1H 1E37B 2ZDVH 5C1XA 1UTJA 2P94A 1PFXC 3AASA 3AW0A 2OCVB 3GY3A 1Y3XA 1OX1A 3RMOH 1AWHB 1E0FD 4TPIZ 5A2MH 2ZFQH 3ATWA 3SQHE 1C1RA 4CBNA 2BD9A 3BTQE 3LC5A 2XNIA 4KTCA 2BDAA 1OP2A 1ESBA 1Q31A 1SGQE 2J98B 3KF2A 3T27A 4ABEA 2A2XH 1WOFA 1DS2E 4A6LA 1BBRK 3DD2H 3T29A 1PPCE 1BA8B 3MNXA 2JH6D 6LPRA 3TH3H 4WF8A 3SGAE 1W0JD 1O3DA 1UVOA 1G3DA 3PTBA 3K6ZA 2A0QB 2ZFFH 2BY7X 1BHXF 4DIHH 4YTAA 3K65B 4JK6A 1SLXB 4OS1A 3VB3A 1KTTB 3UOUA 2WV5A 1CHOG 4B2CA 1XXFA 4XBCA 1QJ1B 1ZYOA 1X7AC 3HK6B 1GCTC 2QY0B 3GY7A 1TBQH 2G4TA 5E0HA 3TH2H 2PGBB 1V2VT 5F8XA 3BG4B 1FQ3A 5FPSA 5DP6A 3UOPA 1EAIA 4Y10E 5AHGH 5F53A 3RMMH 1BITA 4UFDH 1XMNB 3OE7D 1Y8TA 1ESAA 2WPJS 3RXTA 1K1JA 4UFFH 4KTSA 2GJGA 3SGQE 2SNVA 1C5NH 3HKIB 3WW7A 1GHXH 4WXVA 2GCTC 4BNRA 1NFXA 1DXPA 3MO9A 4YLUA 2CGAA 2H5CA 3TIUA 4AFUA 1V2KT 2AERH 1ZPCA 1LDTT 1AFEH 4K5ZA 4UFGH 1GCTB 5EPYA 2CMYA 1HAPH 1O5FH 3SV7A 4GAWA 2NU3E 5T6DA 1IAUA 4ZAEA 1C1MA 2TPIZ 5GCHF 1O3JA 3PMHB 1HJ9A 3GCHC 3D62A 3A89A 3FKSD 5TCCA 1DWCH 3RXHA 5GXPA 1C1TA 4ISHH 2GCTB 1GJAB 1GJ5H 1C1PA 2BD7A 4MTBA 3M37A 5E2PA 1F5LA 2V7QD 4XRNA 3STJA 1C5RA 2OTVA 1K9OE 1O3OA 1MZDA 1XUFA 1Y3YA 4KKDA 4WJG2 4K1EA 3KQEA 1NRRH 3SUEA 1CA0C 3MU8A 4X1QU 2W6ID 2HVXA 1V2QT 2HLDD 1DLEA 3VB5A 1B0FA 1ZHRA 3OU0A 3RC5A 3GCHB 1W11U 2ZEBA 1O2WA 1PQ7A 1IQMA 2EI6A 1TONA 4X6MA 1KTSB 2BZAA 2GKVE 1GG6B 3VPKA 2Y82A 1F5RA 3S9BA 1C2HA 2ZPSA 3KL6A 5LPRA 3F9FA 1N8OC 1LQEA 1GJ4H 1LCYA 4OGYA 1NFYA 2GDEH 2TGPZ 5EW1H 1P2QA 1TRYA 2PV9B 4FOUC 2OBQA 1P3CA 4DG4A 1MD8A 2D8WA 2KR7A 1CA0B 1QL8A 4D9RA 1MTSA 4XBDA 3ZVFA 2ZG0H 1ZSJA 5C5NA 4CRBA 4NA8A 3LOXA 2VH0A 1LVBA 4Y71A 1NY22 3RXDA 2AGEX 5EJ1A 1PQ8A 1MZAA 1C5YB 2JKHA 1LVMA 2C8YB 1OWEA 2QGRA 2O8MA 1EZSC 4ZXXH 2FTLE 5GIBA 4A5TS 3U98H 1QQUA 3SUGA 1G3CA 1S0RA 2V3OH 4J1YA 1F2SE 1SGYE 1LMWB 2PR3A 1YP9A 3VGCB 1TGSZ 2CF9H 3BF6H 1TYNA 1S82A 2ANMH 3KQBA 2ZKSA 3R3GB 4Q4LA 2BMGB 3ZZAA 4D9QA 1TX7A 5IDKA 1K1OA 1KDQB 1GI4A 2H9TH 4DGJA 5A0AE 1A4WH 1MTWA 1QA7A 2YNBA 4XE4A 1P2OA 2BD2A 4RKJB 1C5PA 2JETC 2F4LA 5HM9A 1W7XH 1LHEH 3PRDA 1EKBB 1GI3A 5EOKA 1YBWA 1B0EA 2STBE 2G4UA 3E6PH 1PQ5A 3LGVA 2Q6FA 4TWYA 2JH0D 2RDLA 3RDZA 5EXMA 3GY2A 1V6DA 1QCPA 3HKJB 3E90B 4I8GA 1CU1A 1BDAA 1SOZA 2CN0H 2JH5D 1UW7A 3Q00A 4NCYA 2IN2A 2NU0E 2GZ8A 1ELGA 1S6HA 2Y5GA 3ZZ3A 5GDSH 2FP7B 2UUYA 5K7RA 4NIWA 1VCWA 2SGEE 5PTPA 1O3AA 2XYAA 2Z6BD 3KHVA 3U28C 1RJXB 2FX4A 3SJKA 1ELCA 1TGNA 1BTPA 1L1GA 2BLOA 2ZGHA 2VVVA 2XWBI 1H9LB 1TWXB 3BV9B 2FO9A 1ZTKA 4DT4A 4FU9A 1MKWK 4D8NA 2QIQA 4FXGH 1IOEA 1BBRE 2C4FH 2W26A 1QL9A 2LNCA 2VVCA 2W5EA 2Y7ZA 4U30A 5C17A 3TK9A 1BMAA 3PV4A 3MH5A 2ODPA 1AUTC 4IC5A 1K1IA 2J5UA 3OYPA 3SJOA 3I77A 1WAYB 2ZFSA 1GJCB 3TH4H 3P8FA 1J15A 2B9LA 1QB9A 4BAOB 3KYFA 2F9BH 1K1NA 1O2KA 1RS0A 3QTVH 4A1VA 1C2LA 3QX5H 4E7NA 2XBXA 1EXFA 3A85A 1ABIH 1GGDC 2Y81A 3RUOA 2XBWA 1IQKA 4X1SU 1ZHPA 1ANDA 2R3UA 3STIA 1DWDH 3RC4A 1F5KU 3WY8A 1C5TA 1LVYA 1GHAF 2VIOA 3N7DA 1WQSA 5C20A 5FCKA 5LGOA 1BTHH 1QGFA 3NKKA 3T25A 3VEQB 5DG6A 3I78A 4UE7H 1WDIA 1DUEA 3OAAD 2PTCE 1O2OA 1O2VA 4CBOA 1AGJA 2F91A 3F2HA 1QBNA 3L6PA 2A1DB 1O34A 1ZRBA 3A83A 3UUZA 1GGDB 3GYMA 2O8UA 1C5OH 1W0YH 2G52A 4ABFA 1DX5M 4FU8A 3P6ZB 4H4FA 3VB4A 2V35A 1DICA 1GBJA 2CV3A 1EAUA 2K8IA 2LP6A 1DXWA 2WUBA 1O36A 2P3FH 4ABIA 2DE9A 1A5IA 1YC0A 3E91A 1CGJE 1SGFG 1QRXA 1TAWA 1O2RA 1WV7H 3RXVA 2OC0A 3UNRA 1MD7A 2UWLA 2QC2A 1L4ZA 2R0LA 3RMNH 2FXRA 2ZHDA 5I46H 3A88A 5DPAA 5FBIA 1S5SA 4Y11E 2VIQA 3GDUA 4KTUA 1C9TA 3QO6A 3TJOA 1F0SA 1GMDG 2ZPRA 4OS6A 1GPZA 1S6FA 1UHBA 2AMPA 1OSSA 1H4WA 3P70B 7LPRA 3RXGA 1H9HE 1FY3A 2AYWA 1HGTH 2ULLA 2KAIA 1C2IA 1TPAE 3RM2H 2A7HA 2ZU4A 3RXCA 1FIZA 1G36A 1T8NA 3A84A 4FUGA 1P2IA 1EAWA 3F68H 4FETA 1YF4A 2ESTE 3H5CB 5J4SA 3ZIAD 5JBAS 3P8GA 1C4U2 2ZU3A 5EODA 1C5VA 4BAQB 2QN5T 1AQ7A 1SGIB 3IITA 3RXLA 2RG3A 3RXQA 1ZHMA 3F9EA 1K1PA 3K6YA 3M5NA 1ZTJA 1ESTA 3UAIC 3TPIZ 2BHGA 2NWNA 1NFUA 6GCHF 1P2NA 5H4IB 3SV6A 4Z6AH 1GI6A 1O3LA 1V2MT 2A4RA 1GI9B 4OS4A 4Y76A 1JOUB 1SOTA 1Z71A 4M9FA 1W10U 1H8ED 4RT0A 1FY4A 5LPEA 4ACBA 1G37A 3GY6A 1P12E 5C1UA 3W94A 2PW8H 1CHOF 3M7QA 4MNVA 3C27B 1V2NT 1HRTH 4INLA 2OK5A 4ZHMU 4CR5A 2B0FA 4XFQA 2Z3DA 3PRBA 4WMFA 5DP3A 2H2ZA 5DP9A 1QRZA 3ODDA 1A61H 1CHGA 1S83A 4AG2A 1N1LA 3M3TA 1GHBG 1Z6JH 1FY1A 1EJAA 1FN8A 1UVTH 2CHAC 3ZZCA 3VB6A 1KLJH 1O3MA 3RU4E 5EQSA 2H9HA 3OY5U 1AI8H 1BMLA 2I6SA 4BTIB 1O3FA 1PPBH 1FAXA 1G2MA 1P04A 1P3EA 5FPTA 3ATLA 4JK5A 1GBAA 1SGPE 1A0LA 3SORA 4AFSA 1N6XA 3BSQA 4AC9A 5FX6A 5EXLA 1TOMH 1W14U 3SNAA 1FY8E 3E3TA 2AS9A 3UREA 1C2FA 1GBBA 3OTJE 1OHHD 5L2ZH 3SGBE 1G2LA 4GPGA 3UFAA 2A5KA 4UD9H 1ZRKA 1VCPA 5FX5A 2PKSB 2OD3B 1EUFA 2FOAA 1V2UT 1P11E 3U8RH 5JYIA 1S84A 1K2I1 1UTKA 3ATIA 1P10A 2BB4A 1VITG 3P17H 2XXLA 1KXFA 1A5HA 3JZ1B 1CT4E 3URCA 2H1UA 1D3PB 1TPPA 2ZU5A 5C0TA 4MPWA 1O2NA 4X6PA 1TX6A 1P2MA 2WSSD 2ZA5A 4WH6A 1WBGB 3RXJA 1OWJA 5KGOA 1WCZA 2P93A 4AZ2B 3F1SB 1HAVB 1GBTA 2L74A 3BIVH 2YMSD 3A7YA 1Y59T 1ZMNA 1NESE 1P03A 1HAHH 2F83A 2BQWB 4Q63A 4NFFA 2VH6A 3UNSA 1OWKA 3F0PA 3N7OA 1VKYA 5A09A 1CQQA 1IQIA 1SQRA 1QJ6B 1ETTH 1PPEE 5HIYA 2PSXA 2RDEA 4FUDA 2HGTH 1NTPA 1WUNH 3A86A 1EP5A 3SO3A 1G9IE 3D23A 3TK6A 4IMQA 1YPKH 2A4QA 4X8UH 5C94A 2WYGA 1RIWC 1O3GA 1A1RA 3GY5A 1E79D 2VB0A 2ZP0H 5CDFE 4FVBA 4U2WA 1E1QD 1UTLM 3RLYH 4ABDA 5C0UA 4X1RU 1C2JA 1L0ZA 3E16B 2FESH 2IPQX 4FU7A 1J9CH 4NZLA 1G3EA 4LOYH 1V3XA 3EAJA 4NGAH 1P09A 3A8BA 4GVUA 4FVDA 1RIWB 1EX3A 3PWBA 3SV2H 2H9EH 1HFDA 1HNEE 1Y3VA 2WV9A 3GCTF 1WTGH 2QA9E 1O5DH 4ZKRU 1FPCH 4HGCA 1PYTC 1QIXB 1K1MA 3TJUA 2J92A 5FAHA 2Z3EA 1VZQH 1SLUB 3PMJA 3PV2A 1ZLRA 2ANWA 2QAAA 5T6GA 2JJ2D 5JDUB 3E1XB 1BQYA 3ZYDA 3QWCH 2BD3A 1DWBH 1HPGA 1UHBB 3QUMP 2KCPA 1HIAB 2BLQA 1D6RA 3M5OA 1UMAH 1GHYH 1YLNA 5EJLA 1C2GA 1C5QA 1TA6A 5CHAB 1HCGA 2Y6TA 3BG4C 3OTPA 2FEQH 2PHBA 5DP8A 1EP6A 2BX4A 1GBMA 1DLKB 3G01A 3SYJA 3L3TA 4TSFD 1P8VC 1TNLA 3O8BA 4ZKOU 2BDIA 1AFQB 1NC6A 2ZTYA 4X1NU 1YKTA 4YZUA 2QF0A 1TMTH 4O3TA 4TY7A 5E2OA 4HI3A 1B5GH 2PKAA 3RMLH 4Z0KA 3KQCA 3UNQA 1DDJA 3H7TA 1SGEE 5HKKD 1O31A 4IN1A 3FP6E 1C2KA 2O8LA 5HYOA 3MWIU 1C2DA 1P57B 1MH0A 3RLWH 1VJ9U 1O2QA 2G81E 2ZTZA 2R3YA 3MH6A 3MO3A 2NU2E 4KP0A 4FUCA 3Q3XA 5DJ7A 3TVJB 1T7CA 5C3NA 5I25A 1BOQA 2HNTF 2ZFRH 2WYJA 2RCEA 3EGKH 1XUGA 2GVFA 5DN6D 4P02A 1QHRB 3WWFA 3IWMA 2AGIX 2V6NA 3NRLA 2TBSA 3EE7A 2ZDKA 4I8LA 7GCHG 1LKBA 1FUJA 2XC4A 2TGAA 2ZHQH 3LGYA 3MFJA 1GI5A 1PQAA 1AVWA 1W7GH 3QZRA 1FLEE 1GHZA 1VGCC 2YOLA 5DKMA 1D6WA 2XNDD 1O33A 1MABB 2V0BA 3QTOH 4NFEA 2AIPA 3A87A 2ZHFH 5SGAE 1UK2A 2IOTA 1KLTA 3DT0H 3PLKA 3SU3A 2ZDLA 2BLVA 1SQAA 5C1YA 1GG6C 1RTFB 2Y5FA 2ZPQA 8LPRA 1AZ8A 1T8MA 4OS2A 4UEHH 3ZZ5A 5L30H 1GI1A 3LPRA 4Y8XA 1T8LA 1FAKH 1BMNH 3A82A 1LKAA 2P8OC 5IYTA 2OQ5A 2FOCA 3VG8A 4INKA 1XXDA 2GX4A 3BEFB 2ODYB 3A8DA 3CS0A 2PP6A 4B2AA 1VGCB 2F9VA 2KM0A 2W3KA 2ZDAH 5EQRA 4HTCH 1SGFA 1GVZA 4AORA 4O03A 3GDSA 3MU4A 5F03A 1KLIH 3ZZ9A 3F2FA 3ITIA 1DVAH 2HPQH 2GD4B 2PFEA 1FZZA 1MCVA 3ZVAA 4WY3A 2XWAA 4UFEH 1GMCG 2TGTA 1GMDF 4NA7A 2QXIA 1O5BB 4YOIA 2FWWA 3SV8A 3VGCC 1QNJA 1T8OA 4CHAB 1W0ZU 2P8OB 3FZZA 4RI0A 4X8VH 1W13U 1MKXH 3AAVA 3KNXA 1TLDA 4X8SH 1FPHH 2AHME 3S69A 1F0RA 4CR9A 1MU8B 2QCYA 1AKSA 2QXHA 1OYQA 3KYGA 1O3CA 1XKBC 1FIWA 1TX8A 4NIYA 1ARBA 5B6LA 4GCHF 4YLQH 2BY6X 3TU7H 2XC0A 1NPMA 3KQDA 1O3KA 5EU8A 1P01A 4D76A 1Z1IA 1SQTA 2VWOA 8GCHG 1EPTA 5FHTA 2WPIS 4ABHA 4R8TB 3GDVA 3L33A 4IMZA 3T62A 3KIDU 2ASUB 2KX4A 5GNDA 5A8ZA 1H8HD 1WSSH 4MPVA 2K0QA 2QF3A 2PLXA 4AYVB 3ZZDA 1TPOA 3DA9B 3ZV8A 5L2YH 4P00A 1WQVH 1NRPH 2OC8A 2FIRH 1J14A 3UR9A 2BQ7B 3UQOA 4THNH 4ISLA 3RXAA 2VINA 1SMFE 4AN7A 1K0HA 4I8JA 2HLCA 4BXWA 1GWAA 2SGQE 1IQGA 1JRTA 2A4GA 4X2VA 1GMHF 2WINI 2GV7A 2ZDNA 1TIOA 2C90B 1GI8B 1Z8GA 1YM0A 4ZUHA 2KZ4A 1THSH 1TRMA 3ZZ7A 4I8HA 2GT7A 5CE1A 1C1WH 2K1QA 4XOJA 4K8YA 1GVLA 1C2MA 4FUEA 1DFPA 1BTUA 3ELAH 3GS9A 3EDXB 1BRUP 5HM2A 1D3TB 1NT1A 1F7ZA 1GL1A 1NFWA 5FXLA 5AF9H 3SHCH 1UK4A 4I31A 3ZVCA 3V7TA 3BTDE 1IQFA 3S7HB 1J8AA 1FNIA 2STAE 1PPFE 3LKWA 3TJNA 3EA9A 1BRBE 2QXJA 1Z6EA 1OWHA 2FPZA 2W7UA 3GISB 1CE5A 1W12U 3MNBA 1TOCB 3VB7A 4B71A 2ILNA 3VFEA 1EOJA 1CGHA 4X8TH 2KCYA 3Q77A 4H6SB 2Q6DA 3A7ZA 3UWIA 1XKAC 4A1XA 4YO9A 1SFIA 2HNTC 4WH8A 1UTOA 1O37A 2F9UA 2WHXA 4B73A 2FI4E 2PKAB 3RXMA 4U01A 4PROA 1YPEH 3NWUA 1HDTH 4ZKNU 4NIXA 1GHVH 5DGJA 1Y5AT 3BTTE 4GHTA 4I32A 1XUIA 3LJOA 1LHFH 4R0IA 2BY8X 2P95A 3PLPA 2EY4C 4UONA 2Z9GA 2EA3A 1K1LA 3RXBA 2BDBA 4B1TA 2Z3CA 1XX9A 3LONA 2AGGX 1P9UA 2FYQA 1V2LT 2WUCA 2ZI2H 3MQKC 1UJ1A 1MQ6A 3DHKH 4B75A 1EJMA 4AG1A 4RSPA 3P95A 1P02A 2WZQA 4DOQA 5E8EH 1GDNA 1G3BA 1O2GH 3SN8A 1Q2WA 2BD8A 5J4QA 1KXCA 1NO9H 1L1NA 1GVKB 1E38B 1FY5A 2XTTB 3MI4A 4MQAA 1L2EA 2XOKD 5GCHG 1LTOA 4CRCA 1C1QA 4AFZA 1O3BA 2J94A 1GBKA 1Z1JA 2ALPA 4X2YA 3SHAH 4WMDA 1CA8B 1RTLA 1GBFA 5EJZA 4I8KA 3OSYA 2JJ1D 3ZV9A 4IW4E 2ZU1A 1OWIA 1YY3A 4JZDH 3A7XA 2ODQA 3NXPA 2ZGCA 3U1IB 1IQJA 2I6QA 1SL3A 3M36A 3KN2A 1AE8H 1ELEE 5E0GA 5T1VA 1HAZB 5G4BA 4KGAA 2J9NA 2ZF0H 1NBMD 2ZGBH 2BM2A 1MMJN 2BXUH 1OS8A 3EE0B 1FN6A 3DUXH 2J2UA 4ZXYH 3QGNB 5EIYA 2A32A 3W95A 1NBME 4Q7XA 1AB9C 1SR5C 1TALA 4F4OC 5AFYH 4TT3D 3TK5A 3O8CA 2ZECA 1J16A 3DSOA 4DIIH 2GCHG 1GL0E 1GJ7B 4FUJA 3SNDA 3WWBA 3ZZBA 1T4VH 2F3CE 1YPHC 4IS5A 2XC5A 2Z7FE 2A2QH 1OP8A 3BTEE 1SGDE 2ZGXH 3GCOA 5CHBA 1JWTA 3ZZ6A 2J98A 3HGNA 1HBTH 3QZQA 2ZNKH 1O5CB 2ZHWH 3NUMA 4X1PU 3SV9A 5DO4H 4BAHB 1AB9B 1BUIA 5EXNA 3DSPA 2F9PA 4MDSA 2FI5E 4DW2U 3TJVA 4UDWH 2QF4A 1O32A 1C2EA 2OC1A 2ZWLH 1WXRA 2VBCA 5BRRE 2CF8H 2Y7XA 2ZDMA 1FONA 3HATH 4E7RG 1QJ7B 2W6JD 3NZIA 3CENA 4MPUA 4ZKSU 4LXBH 2ZFPH 3RXSA 3GOVB 2BY5X 1UCYH 3RU4D 2O9QA 3FO8D 3EA7A 1ZSKA 2PKSC 2TRMA 1OPHB 2ZFTA 1OOKB 1GI2A 2A4OA 2J34A 3GY8A 1SQOA 2A5IA 1F0UA 1TNGA 2V3MA 2Z9LA 4JZ1A 1SHYA 3V12A 2A5AA 1TNIA 7GCHF 1BZXE 4U32A 3PMAB 1P2KA 2XW9A 4XBBA 2XBYA 5HMAA 5DSFA 1COWD 1FI8A 2SGAA 1C1UH 2ZQ1A 4ISOA 4K8BA 1EATA 3H7OA 4JZIA 4ASUD 1DITH 1OWDA 4CRAA 4A1TA 1T4UH 4JZFH 2VIVA 2HVYB 5B6OA 1QZ8A 2FI3E 1GBIA 2FOGA 4SGAE 1IHTH 1ACBE 2VWMA 1Q3XA 3F2GA 3LH3A 2G5VA 4B6FA 2P59A 1RRKA 3CS7A 5JB9S 1GJ9B 1LHDH 3ZVEA 3S9CA 4ABBA 1V2RT 1QTFA 2G51A 3M5LA 1LPZB 5K0HA 4WMEA 1V2WT 5L6NH 4Y8ZA 2W3IA 2OINA 8KME2 1ZGIA 2OLGA 4I86A 1QB6A 1JIMA 3PM3A 4Y79A 1THPB 2FX6A 5HIZA 1LHCH 2IJOB 5C67A 1GBLA 4MPXA 4ISNA 4OM9A 1GMCF 4AYYB 1MAYA 1H9IE 3V13A 2Q1JA 1OYTH 1W0KD 3PTNA 2BVSH 3SQEE 1G30B 5E0JA 3RXIA 1O3PB 2ALVA 5AVDA 5A8XA 4AGJA 1H8IH 3A8AA 4TY6A 3AAUA 1ZMJA 4DCDA 2ZCLP 1ABJH 2Z9IA 2BYAX 4YOJA 2GV6A 3GYLB 2RA0A 1SB1H 3B23B 4NSVA 1PPHE 1C5MD 4D7FA 1S0QA 2A45B 5DK1A 1QA0A 2GZ7A 4MNYA 3D65E 1YLCA 5F8ZA 1V2PT 2WPLS 1XM1A 1NRNH 2VJ1A 4ESTE 3K2UA 3LH1A 2NU4E 3ODFA 4BAMB 1ELTA 3SJ9A 3RXRA 4DY7B 4NWKA 3A7WA 3FANA 1QRWA 1AN1E 1YPLH 4NG9H 3F0OA 4BOHA 1KDQA 1C1SA 1Y5BT 3N7EA 1YLDA 2ZHEH 1O2MA 1BJUA 2GGVB 4Q7YA 2HPPH 2YNAA 1EOLA 3M7TA 4YT7H 4IBLH 4I7YH 2EI7A 1UK3A 5ETXA 2V3HH 3T2NA 5LPFA 2BDYA 4K2YA 1GBDA 1O2LA 3Q76A 1YGCH 2EEKA 2VIDA 3DSGA 4HFPB 5CHAC 4CH8B 4NZQA 6ESTA 1ETRH 1DSTA 2UWPA 2B8OH 2L6OA 2VU8E 2CJIA 1GCDA 1AIXH 1ZJKA 3FZDA 4YM9A 4LK4A 1AFQC 1DUAA 1MBMA 3AVZA 4ZCNA 1C5ZB 1FX0B 3BTME 3QDZB 3SBKA 1C5UA 5LH8A 1EZUC 4YXWD 4DVAU 3ZVDA 1TGBA 3FVFB 3NPSA 1IQNA 1GJDB 1UCYK 4ZHLU 2B7DH 5IK2D 3UB0A 1O2JA 3C1KA 3SUFA 3PMBB 2GP9B 4O3UA 1HAGE 1VJAU 2KAIB 3MH4A 3QLPH 3M61U 3PO1C 2OBOA 3BN9A 4AB9A 1H1BA 2EI8A 3P8NA 1Z8IB 1GDUA 3RXEA 2SNWA 1BMFD 4ZHAA 2IPHA 3KGPA 3LGTA 1HB0B 3V3MA 1AMHA 1O3IA 1IQHA 1E36B 4VGCB 1TGCA 4Q2KA 3SJIA 2AIQA 1NZQH 2F9NA 4K69A 1MCTA 1EAXA 2C8XB 4MNXA 2FOFA 3UR6A 1SGTA 2QF5A 1RXPA 1DPOA 1AO5A 3GY4A 2RA3A 6GCHG 3UQVA 5F8TA 5EQQA 1TPSA 1BTXA 1BB0B 1EB1H 1K22H 1V2JT 4H6TA 1C4Y2 2G00A 3UTUH 4B2BA 3PO1B 4OS5A 1TRNA 2IJD1 1W3CA 2GT8A 4M7GA 1HYLA 1K28D 2ZGJA 2THFB 1LPKB 3AK5A 2ZC9H 4CRGA 4WVPE 1ZOMA 3BTFE 3NK8A 3U8OH 1HV7A 1KYNA 1NU9A 3AW1A 1K21H 1O5GH 1EZXC 1LPGB 4CREA 2FM2A 2BXTH 2CXVA 5FPYA 4AGKA 1L1JA 2ZTXA 3EQ0H 1HJ8A 1AU8A 1NM6A 1YPJH 2LPRA 4XSKU 1YCPM 3MOCA 1CBWC 4SGBE 4JZEH 1AWFH 3M35A 1SFQB 3TLOA 4ASHA 2XCNA 4BTUB 1C1OA 4O9VA 1JBUH 2ANKH 1C1VH 5DP5A 2VWNA 1MKWH 2ZCKP 3HGPA 5DP7A 2C8WB 4JYVH 3URDA 1KMHB 3SU6A 4GLYA 5KEDA 1Z8RA 3MU1A 1A0HB 4ISIH 1AVXA 1BT7A 4BAKB 4D7GA 1JMOH 1QFKH 5KECA 1P05A 1M9UA 4CHAC 1N6YA 2HNTE 3PLBA 2YMSC 1CBWB 1ELFA 1MUEB 2ZQ2A 3Q3KA 2Z94A 4XD7D 3FP8E 1TBZH 2VIPA 1NRSH 1D9IA 1HAOH 4BTTB 1EASA 3SU2A 3LDXH 1KXAA 1O35A
chains in the Genus database with same CATH topology
1SG8B 5T3HA 4BXSA 2WPHS 4TPYA 3SU5A 1PPZA 2P3TB 1TQ0B 1RFNA 2FOEA 4ZMAH 4E06H 2Y5HA 2R0KA 4ZROA 3QK1A 4JCNA 3TGIE 3Q3YA 2Y80A 3SNBA 2WV4A 2B5TB 2UUJB 3BIUH 4LZ1H 5ABWA 1D4PB 1WU1A 1TFXA 1GJ8B 1Y5UT 1EB2A 4NSYA 1FJSA 1WYKA 3ZVGA 2SFAA 1HJAC 2AMQA 1HAXB 2AEIH 2C93B 1C5LH 1O2PA 2BX3A 3SI4H 1O30A 1ZTLA 4A7IB 1ZJDA 2GCHF 4CH2B 4H42U 1SLVB 3LGWA 1DE7H 1XVMA 2PGQB 2PWXA 3PWCA 1YCPH 1ZR0A 3P8OA 3OX7U 4K1SA 2A7CA 2FOBA 1AHTH 2ZO3H 3RXUA 4LZ4B 2VVUA 3R0FA 3RU4T 2BOHB 4NA9H 1P0SH 3ATMA 3HPTB 3ZYEA 3JZ2B 3EA8A 5CMXH 2HWLB 1GHWH 4Q7ZA 3BG8A 3ZZ8A 1HJAB 3KEEA 4TYDA 1RGQA 4YOGA 1GBHA 4Y6DA 1DWEH 2C8ZB 1LQDB 3QN7A 1ANCA 1MBQA 3M3SA 3ZVBA 1V2OT 2WPMS 1N8OB 1TGTA 3O8DA 4J2YB 2BVRH 1O0DH 5GPIB 1IHSH 3U9AH 1YPMH 4QT8C 1A3BH 9LPRA 3M7UA 2VWLA 1ANEA 1DM4B 4OGXA 4MNWA 4F49A 1GHBF 1YPHE 1ELDE 3O8RA 1XVOA 3MYWA 3SU1A 3GCTG 4HZHA 1YPGH 3F6UH 3LC3A 1LVOA 1UCYE 1B7XB 2SGFE 3PYHA 1O39A 5EW2H 1RD3B 1S81A 3A8CA 2PUQH 3U69H 1SGCA 3ATKA 2XBVA 2AMDA 4IGDA 1C5WB 3S7KB 2GTBA 1A7SA 2BDHA 1A2CH 1QL7A 1Z7KA 1A5GH 9ESTA 1O2TA 1KY9A 1BRAA 2OP9A 1QURH 4DJZB 2JETB 1T31A 1TABE 1QBOA 1PJPA 4Y0ZE 1MTNC 1P2JA 4WWYA 5T6FA 4IN2A 2OQUA 4RN6A 2A7JA 2R9PA 2XRCA 1TBRH 1GDQA 2J4IA 2ZCHP 4FUHA 1KXDA 1GJ6A 1F92A 1NROH 1QQ4A 3MHWU 4Y7BA 1BRCE 2PUXB 1KXBA 2VNTA 4Y8YA 1SLWB 1UTPA 1TE0A 3ZZ4A 1ARCA 2OUAA 4IC6A 4MG3A 1VITF 4ZH8A 4K60A 4FUIA 1BMMH 5C5OA 1UO6A 3MU0A 3B9FH 1AD8H 5EGMA 2FS8A 2NU1E 1JRSA 1W8BH 1Y3WA 3B8JA 2BLWA 3PROA 2OC7A 1MTNB 1BTZA 1WTHD 4MLFB 5TJXA 3LJJA 1V2TT 1HAVA 2FODA 3SI3H 1ZPZA 5AFZH 1IQEA 3UIRA 2J95A 1ZGVA 1SI5H 3BTHE 1DSUA 1GJBB 2UUKB 3UY9A 3BTWE 1UVPA 1DT2A 5JPMH 1TNKA 1A0JA 1BHXB 1BIOA 2GDDA 3LIWA 3BEIB 3S0NA 3BTKE 3U8TH 3RP2A 2G55A 3SZNA 2UUFB 4FUFA 1ETSH 4Q80A 1MKXK 1DOJA 1DY8A 3PB1E 1GI7B 3RXPA 5ESTE 5TCAA 2FLBH 1CVWH 2AH4X 1VCQA 3A7TA 1NN6A 2HRVA 1FMGA 1SGNE 1MAXA 2R2WU 3VXEH 2P16A 2Q6GA 2D2DA 1C5SA 1E35B 3TITA 4X2XA 2FDAA 1YCPK 4NWLA 4DURA 3F9GA 4ABGA 1OXGA 2BTCE 3V0XA 2FMJA 3SU4A 1Y3UA 4INHA 1DANH 1ORFA 1HAYB 3RC6A 1UTQA 1O2HA 1UTMA 3SNEA 1V2ST 1HAIH 3DFLA 4ABJA 1F0TA 1AUJA 3A80A 4JMYA 3ENSB 3FP7E 3VXFH 4B76A 3SW2B 3HK3B 3UPEA 1TNJA 4BANB 2BDCA 1GI0A 4K3JA 1ZPBA 3K9XB 3FAOA 3MNCA 1FV9A 3RXKA 1HIAA 4I33A 1CGIE 2D26C 1ZMLA 1EPTC 5GJ4B 2SGPE 1SBWA 2FLRH 3QGJA 2TGDA 1ANBA 1INCA 5EPNA 1AKSB 4JYTA 1TMUH 1C5XB 4GCHG 2SGDE 4AX9H 1W2KH 8ESTE 1PYTD 2BOKA 1AVGH 4X6NA 3D49H 2QYIA 2FS9A 4FUBA 4AOQA 1EQ9A 1GBCA 5DP4A 1CO7E 1O3EA 1HLTH 3A7VA 3S9AA 5A8YA 3UWJH 1EPTB 2BD5A 2Z9JA 3LGUA 3OY6U 2ZZUH 1ZSLA 3TNSA 2OXSA 1D3QB 1S85A 3GICB 4KELA 4MVNA 5JBBS 3MNSA 4B74A 1A46H 5JBTA 1RTKA 1Z8JB 1UTNA 1SHHB 2HOBA 1NS3A 4O97A 3TGKE 1TQ7B 3LGIA 2C3SA 2ANYA 4X2WA 1O2ZA 1QY6A 1PPGE 2H5DA 2M5TA 3KCGH 2D1JA 3LU9B 3E0PB 1TMBH 1XUHA 3NCLA 1GMHG 2O8WA 1FXYA 1JIRA 1THRH 4AB8A 4A92A 4E05H 1CT0E 2VGCC 1HXEH 1LO6A 1JXPA 4CRDA 4Y0YE 2XCFA 1BBRH 2PSYA 1XUJA 3MU5A 1GBEA 1NU7B 1ZZZA 2G5NA 4K1TA 1KIGH 5F6MA 2QXGA 3MH7A 7KMEH 2BY9X 3RM0H 4AFQA 4WXIA 2BVXH 3MO6A 1O2YA 4Y7AA 1O3HA 1ELBA 1EZQA 1TA2A 1U6QA 4YESB 4CRFA 1D3DB 5HGGA 1QBVH 5FCRA 1DY9A 5BPEA 4RKOB 1NRQH 1O2SA 3FFGA 5EG4A 2CHAB 2VGCB 3MMGA 3I29A 2Z9KA 4OS7A 6CHAC 5FBEA 2ZU2A 2GZ9A 2DUCA 1MQ5A 3A81A 2UWOA 1KXEA 3T26A 2FZZA 2VIWA 1C4V2 1TB6H 5A0BA 5C2ZA 4ABAA 1TNHA 1O2UA 1BTWA 3BEUA 1VITH 1BTYA 2AFQB 3RXFA 1CSOE 1O3NA 1ELAA 1OKXA 4DT7B 1GHAG 1L4DA 2FOHA 2QV1A 7ESTE 1CT2E 2DE8A 6CHAB 1AE5A 1J17T 3RXOA 1C1NA 3BTGE 4GUXA 1KSNA 3SOSA 3SUDA 2BQ6B 3T5FH 1SSXA 2FYRA 3M5MA 4XDEA 3TNTA 1P9SA 1BJVA 1MTVA 4NIVA 2R2MB 4YT6H 4GSOA 1EJNA 1QR3E 1UVUH 3SNCA 1AZZA 2O8TA 4TWWA 1P06A 4X6OA 1O2XA 1T32A 3GCNA 1SPJA 8GCHF 2BZ6H 1HUTH 1H8DH 2FTMA 2GMTC 1MTUA 3LT3A 1FDPA 5JB8S 2G8TA 2EC9H 1UVSH 1SGRE 1QB1A 1LHGH 1E34B 2FOMB 5A0CA 3ESTA 2W7SA 3M3VA 3SJ8A 4GHQA 5HXFA 1XUKA 4X0WU 3F9HA 3CP7A 2P3UB 5GWZA 3SU0A 5JBCS 1AY6H 1MU6B 3P92A 2BDGA 1IQLA 2ZIQH 2H6MA 3DFJA 1O2IA 4JYUH 3EYDA 3IG6B 1O38A 2F9OA 1ID5H 2A31A 2PTNA 1SVPA 1OP0A 3E8LA 4VGCC 1SC8U 1YYY1 2WPKS 3E0NB 1HXFH 2GMTB 1BCUH 1O5EH 1C9PA 2TIOA 3U1JB 3MTYA 2BD4A 5ESBA 1A3EH 3T28A 2HALA 2J38A 3TGJE 1G32B 1ELVA 1O5AB 1VR1H 1E37B 2ZDVH 5C1XA 1UTJA 2P94A 1PFXC 3AASA 3AW0A 2OCVB 3GY3A 1Y3XA 1OX1A 3RMOH 1AWHB 1E0FD 4TPIZ 5A2MH 2ZFQH 3ATWA 3SQHE 1C1RA 4CBNA 2BD9A 3BTQE 3LC5A 2XNIA 4KTCA 2BDAA 1OP2A 1ESBA 1Q31A 1SGQE 4ABEA 3KF2A 3T27A 2A2XH 1WOFA 1DS2E 4A6LA 1BBRK 3DD2H 3T29A 1PPCE 1BA8B 3MNXA 2JH6D 6LPRA 3TH3H 4WF8A 3SGAE 1O3DA 1UVOA 1G3DA 3PTBA 3K6ZA 2A0QB 2ZFFH 2BY7X 1BHXF 4DIHH 4YTAA 3K65B 4JK6A 1SLXB 4OS1A 3VB3A 1KTTB 3UOUA 2WV5A 1CHOG 4B2CA 1XXFA 4XBCA 1QJ1B 1ZYOA 1X7AC 3HK6B 1GCTC 2QY0B 3GY7A 1TBQH 2G4TA 5E0HA 3TH2H 2PGBB 1V2VT 5F8XA 3BG4B 1FQ3A 5FPSA 5DP6A 3UOPA 1EAIA 4Y10E 5AHGH 3RMMH 1BITA 4UFDH 1XMNB 1Y8TA 1ESAA 2WPJS 3RXTA 1K1JA 4UFFH 4KTSA 3SGQE 2SNVA 1C5NH 3HKIB 1GHXH 4WXVA 2GCTC 4BNRA 1NFXA 1DXPA 3MO9A 4YLUA 2CGAA 2H5CA 3TIUA 4AFUA 1V2KT 2AERH 1ZPCA 1LDTT 1AFEH 4K5ZA 4UFGH 1GCTB 5EPYA 2CMYA 1HAPH 1O5FH 3SV7A 4GAWA 2NU3E 5T6DA 1IAUA 4ZAEA 1C1MA 2TPIZ 5GCHF 1O3JA 3PMHB 1HJ9A 3GCHC 3D62A 3A89A 5TCCA 1DWCH 3RXHA 5GXPA 1C1TA 4ISHH 2GCTB 1GJAB 1GJ5H 1C1PA 2BD7A 4MTBA 3M37A 5E2PA 1F5LA 3STJA 1C5RA 2OTVA 1K9OE 1O3OA 1MZDA 1XUFA 1Y3YA 4KKDA 4WJG2 4K1EA 3KQEA 1NRRH 3SUEA 1CA0C 3MU8A 4X1QU 2HVXA 1V2QT 1DLEA 3VB5A 1B0FA 1ZHRA 3OU0A 3RC5A 3GCHB 1W11U 2ZEBA 1O2WA 1PQ7A 1IQMA 2EI6A 1TONA 4X6MA 1KTSB 2BZAA 2GKVE 1GG6B 3VPKA 2Y82A 1F5RA 3S9BA 1C2HA 2ZPSA 3KL6A 5LPRA 3F9FA 1N8OC 1LQEA 1GJ4H 1LCYA 4OGYA 1NFYA 2GDEH 2TGPZ 5EW1H 1P2QA 1TRYA 2PV9B 2OBQA 1P3CA 4DG4A 1MD8A 2D8WA 4D9RA 1CA0B 1QL8A 1MTSA 4XBDA 3ZVFA 2ZG0H 1ZSJA 5C5NA 4CRBA 4NA8A 3LOXA 2VH0A 1LVBA 4Y71A 1NY22 3RXDA 2AGEX 1PQ8A 1MZAA 1C5YB 2JKHA 1LVMA 2C8YB 1OWEA 2QGRA 2O8MA 1EZSC 4ZXXH 2FTLE 5GIBA 4A5TS 3U98H 1QQUA 3SUGA 1G3CA 1S0RA 2V3OH 4J1YA 1F2SE 1SGYE 1LMWB 2PR3A 1YP9A 3VGCB 1TGSZ 2CF9H 3BF6H 1TYNA 1S82A 2ANMH 3KQBA 2ZKSA 3R3GB 3ZZAA 2BMGB 4D9QA 1TX7A 5IDKA 1K1OA 1KDQB 1GI4A 2H9TH 4DGJA 5A0AE 1A4WH 1MTWA 1QA7A 2YNBA 4XE4A 1P2OA 2BD2A 4RKJB 1C5PA 2JETC 5HM9A 1W7XH 1LHEH 5EOKA 1EKBB 1GI3A 1YBWA 1B0EA 2STBE 2G4UA 3E6PH 1PQ5A 3LGVA 2Q6FA 4TWYA 2JH0D 2RDLA 3RDZA 5EXMA 3GY2A 1V6DA 1QCPA 3HKJB 3E90B 4I8GA 1CU1A 1BDAA 1SOZA 2CN0H 2JH5D 3Q00A 4NCYA 2IN2A 2NU0E 2GZ8A 1ELGA 1S6HA 2Y5GA 3ZZ3A 5GDSH 2FP7B 2UUYA 5K7RA 4NIWA 1VCWA 2SGEE 5PTPA 1O3AA 2XYAA 2Z6BD 3KHVA 1RJXB 2FX4A 3SJKA 1ELCA 1TGNA 1BTPA 1L1GA 2BLOA 2ZGHA 2VVVA 2XWBI 1H9LB 1TWXB 3BV9B 2FO9A 1ZTKA 4FU9A 1MKWK 4D8NA 2QIQA 4FXGH 1IOEA 1BBRE 2C4FH 2W26A 1QL9A 2LNCA 2VVCA 2W5EA 2Y7ZA 4U30A 3TK9A 1BMAA 3PV4A 3MH5A 2ODPA 1AUTC 4IC5A 1K1IA 3OYPA 3SJOA 3I77A 1WAYB 2ZFSA 1GJCB 3TH4H 3P8FA 1J15A 2B9LA 1QB9A 4BAOB 2F9BH 1K1NA 1O2KA 1RS0A 3QTVH 4A1VA 1C2LA 3QX5H 4E7NA 2XBXA 1EXFA 3A85A 1ABIH 1GGDC 2Y81A 3RUOA 2XBWA 1IQKA 4X1SU 1ZHPA 1ANDA 2R3UA 3STIA 1DWDH 3RC4A 1F5KU 3WY8A 1C5TA 1LVYA 1GHAF 2VIOA 1WQSA 5C20A 5FCKA 5LGOA 1BTHH 1QGFA 3NKKA 3T25A 3VEQB 5DG6A 3I78A 4UE7H 1DUEA 2PTCE 1O2OA 1O2VA 4CBOA 1AGJA 2F91A 1QBNA 3L6PA 2A1DB 1O34A 1ZRBA 3A83A 3UUZA 1GGDB 3GYMA 2O8UA 1C5OH 1W0YH 2G52A 4ABFA 1DX5M 4FU8A 3P6ZB 4H4FA 3VB4A 2V35A 1DICA 1GBJA 2CV3A 1EAUA 1DXWA 2WUBA 1O36A 2P3FH 4ABIA 2DE9A 1A5IA 1YC0A 3E91A 1CGJE 1SGFG 1QRXA 1TAWA 1O2RA 1WV7H 3RXVA 2OC0A 3UNRA 1MD7A 2UWLA 2QC2A 1L4ZA 2R0LA 3RMNH 2FXRA 2ZHDA 5I46H 3A88A 5DPAA 5FBIA 1S5SA 4Y11E 2VIQA 3GDUA 4KTUA 1C9TA 3QO6A 3TJOA 1F0SA 1GMDG 2ZPRA 4OS6A 1GPZA 1S6FA 1UHBA 2AMPA 1OSSA 1H4WA 3P70B 7LPRA 3RXGA 1H9HE 1FY3A 2AYWA 1HGTH 2ULLA 2KAIA 1C2IA 1TPAE 3RM2H 2A7HA 2ZU4A 3RXCA 1FIZA 1G36A 1T8NA 3A84A 4FUGA 1P2IA 1EAWA 3F68H 1YF4A 2ESTE 3H5CB 5J4SA 5JBAS 3P8GA 1C4U2 2ZU3A 5EODA 1C5VA 4BAQB 2QN5T 1AQ7A 1SGIB 3IITA 3RXLA 2RG3A 3RXQA 1ZHMA 3F9EA 1K1PA 3K6YA 3M5NA 1ZTJA 1ESTA 3TPIZ 2BHGA 2NWNA 1NFUA 6GCHF 1P2NA 5H4IB 3SV6A 4Z6AH 1GI6A 1O3LA 1V2MT 2A4RA 1GI9B 4OS4A 4Y76A 1JOUB 1SOTA 1Z71A 1W10U 1FY4A 5LPEA 1G37A