1C2LA

Recruiting zinc to mediate potent, specific inhibition of serine proteases
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords TRYPSIN
publication title Design of potent selective zinc-mediated serine protease inhibitors.
pubmed doi rcsb
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c2lA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c2lA02
1ZHRA 2TRMA 2FOGA 1YPMH 3UWIA 2H2ZA 1YCPM 3A7YA 4NZLA 1GVZA 1PYTC 3AASA 3BTHE 1KXDA 1LVBA 2SFAA 1QGFA 3SU2A 5GWZA 2BDHA 1T4UH 1P57B 1UVPA 3RXSA 1GI3A 5C5NA 3Q3YA 4XSKU 1ELTA 3HATH 3SNDA 3M7UA 1W12U 4DOQA 1A0JA 3ZYEA 3WY8A 3TIUA 2XNIA 3HGNA 2GTBA 3TH3H 1GJCB 4Y0YE 2GZ8A 1V2NT 4WY3A 3MO3A 1FXYA 1BIOA 5GPIB 1SGRE 3RXMA 3MH6A 3P70B 4DIHH 2V3OH 3K9XB 3PO1C 1P11E 1B5GH 3MMGA 1GBKA 1VCQA 2GV6A 3SQEE 1KY9A 1U6QA 1NS3A 1AHTH 1ZTJA 2F9PA 3KN2A 4CBNA 4IN2A 5F8TA 1DPOA 3RXEA 1HAPH 4A1TA 3URDA 1J16A 3ZV8A 3GCHC 3SJOA 1W7XH 7KMEH 2O8LA 5C1XA 4X6MA 1INCA 5DGJA 1SLUB 4F4OC 3LDXH 1TBZH 1GBEA 4D8NA 4UD9H 2G4TA 3Q76A 1K22H 1BTWA 1O2KA 1ZPZA 3UIRA 3KIDU 2UWPA 1TNHA 3L3TA 1DXWA 4I31A 1SI5H 4YLQH 1EQ9A 3GISB 4ZH8A 4NIWA 3UPEA 2XC5A 3BG4B 1DS2E 1UVSH 3LGYA 5EPNA 1C5NH 1C2LA 1C5VA 1V2RT 3A8CA 3BTTE 3NXPA 1GJ9B 2A5KA 1EOLA 1O2OA 1HUTH 2FTMA 3E8LA 5EU8A 1QRWA 3P8FA 4X2YA 2A2QH 5ESBA 1P9UA 1S0QA 2ZFRH 4AN7A 1MKWH 1SGDE 1GBMA 1VITF 1OXGA 1DT2A 3M61U 2ZCKP 1CT2E 3F6UH 2F9OA 3RLYH 4AG2A 1KXEA 1NFUA 2A7JA 1BMAA 3PTNA 1C1WH 1JOUB 4D7FA 1F5RA 1AVGH 1TQ0B 3AVZA 5GCHG 1EXFA 2XBXA 3I78A 2JH5D 4WH6A 1QA7A 1WTHD 3D23A 4MNVA 3GYLB 1S0RA 1FY4A 4I8HA 2XBWA 4K1TA 4Y76A 2ANWA 4XOJA 3BTEE 1O3JA 1TNIA 1CU1A 1PQ5A 1TA2A 4B71A 2OBOA 1G3BA 2PKSC 2BYAX 3U98H 2G81E 5CE1A 2H6MA 4FUFA 1UTLM 5EGMA 2ZCLP 3KL6A 1P2QA 3GY8A 1X7AC 2ZDLA 1SLWB 1A2CH 3ITIA 1C5SA 4HFPB 3CS7A 2Z6BD 1N6YA 2W5EA 4GLYA 1S6HA 2BZ6H 1HJAC 1S84A 4JZFH 1A1RA 2VWOA 1C4Y2 3HK3B 1TNGA 2G00A 2F9UA 4K2YA 1QB6A 5LPFA 3RUOA 3ZZCA 1AVWA 3QTOH 5FXLA 2I6SA 1ELEE 3ATIA 4TPYA 3KNXA 5EXLA 1P03A 1ETRH 2PGQB 1VITH 3FP6E 3SUGA 3KEEA 1KLJH 4IMZA 1IQHA 3QX5H 2P3FH 3QLPH 1C5MD 1TNLA 1T8MA 2J92A 1P02A 2VNTA 4NIXA 1UCYE 1GL0E 5A0CA 2FYRA 1C1RA 1DFPA 4UFEH 1O36A 1YF4A 1ZHMA 5A8YA 2CV3A 2JH0D 2QCYA 4FUEA 5EOKA 1N8OB 2R2MB 2PGBB 2RA0A 4ZKOU 1ZMLA 4Y0ZE 1GMDF 1LKAA 2FLRH 4I33A 2OD3B 3ZZAA 4A7IB 2W3KA 5C20A 3RXIA 1OP8A 3BTGE 1NFWA 4CRGA 2JH6D 1L1NA 5HXFA 2EEKA 2C4FH 4Y7AA 2HPPH 3QGJA 1CBWC 8GCHF 1FNIA 3VXEH 1V2OT 1UJ1A 4FUCA 4GAWA 3ZV9A 1QCPA 3RXCA 4GCHF 4ISLA 4WVPE 2CHAB 2F9NA 2BOHB 1A5HA 1GI1A 2AFQB 1BQYA 2FPZA 5E0JA 1J14A 3TH4H 2ZFTA 3SW2B 2ZTXA 4A92A 3M7QA 3A85A 3S0NA 1RIWB 1AQ7A 4FU8A 1DWCH 5DP8A 4NSYA 1V3XA 1C1OA 2FOBA 3SHCH 1PJPA 2ODQA 1QL8A 3F9FA 1FDPA 4DJZB 1OYQA 4THNH 1BTXA 4TWYA 1DY8A 1V2WT 4HGCA 1YLCA 2STAE 2XC4A 1GJ8B 1NY22 1HV7A 2IJOB 1P12E 3GICB 3ZZ3A 5JBBS 4X2WA 3BTME 2ZHEH 4OS7A 1HJ9A 3LGTA 1AZZA 1HGTH 4A1XA 2ANKH 2F83A 3EA7A 3LJJA 4GHTA 2NU0E 1LVYA 5E0HA 1O2WA 1J9CH 4CRDA 1ABIH 3BTQE 1IAUA 1DWDH 2VIOA 1O3MA 1Q2WA 2BX4A 3UREA 1DWEH 2DE8A 3T26A 2WINI 1BDAA 1O3CA 2JETB 1FY8E 1VJAU 5T6DA 2CN0H 1ZTKA 5A09A 3SV9A 2GV7A 1LCYA 3BSQA 2HNTE 1O38A 5A0BA 5HM9A 5SGAE 2A5AA 3VB5A 1SLXB 1O2VA 3A7XA 5IYTA 5HYOA 1Y3XA 2Z9GA 1GMCF 1TOMH 2G52A 5DK1A 3UY9A 2UUJB 3RP2A 1DE7H 1FLEE 3BN9A 2A4GA 5AFZH 4MNXA 2P93A 3I77A 2QGRA 4R8TB 1O5BB 1EP6A 2QF0A 2ODPA 4YZUA 3P8NA 2P16A 1SC8U 2O8MA 3GCOA 2ZGCA 2BY7X 3N7OA 1MD8A 1ZTLA 1LO6A 2BY9X 2BLOA 6CHAC 1KLTA 2BVXH 1G36A 1DOJA 2F91A 1P8VC 1CE5A 1F5LA 2UUYA 4BAHB 1JIRA 1SFIA 1AVXA 1MTNC 2H9TH 2CMYA 3P92A 3ZVCA 1O0DH 5FBIA 1P9SA 1V2QT 4DT7B 4O03A 2HNTC 4X8VH 1SGNE 1QB1A 5JBTA 1HAVB 3BV9B 1YCPK 1Y3YA 4MPXA 1C5LH 1EPTB 1XUHA 2SGAA 1LMWB 3HGPA 5EPYA 4CH8B 2SGEE 1FY1A 2K1QA 4Y7BA 1V2KT 2SNVA 1MQ5A 3M5NA 5GCHF 2BLWA 1EOJA 1O2YA 1ANCA 3OY5U 1PPZA 1VGCC 3QK1A 3M3SA 3UUZA 1BBRE 1AFQB 2BD4A 5FHTA 5DP9A 2WYGA 4OS2A 1SHHB 2ZFSA 1TA6A 4JCNA 2G51A 3GY6A 3QZRA 1AKSB 1O3NA 2FEQH 1KTTB 3TU7H 1YPLH 3A7VA 1SGTA 2XTTB 4AZ2B 4XBCA 3SNEA 1GI8B 3DHKH 5JB9S 2RCEA 2Z9LA 4H6SB 1OS8A 4BAOB 1GHBG 3MYWA 1PFXC 1EB2A 4I8KA 1NTPA 3Q3KA 1K28D 2C8XB 1K1PA 1BMNH 4IGDA 1YLDA 2HNTF 1E34B 5EXNA 5DP5A 4CRCA 1V2VT 1TGCA 1GJDB 2G5VA 4CRAA 1BJVA 1UCYK 1BMMH 2XBYA 3NKKA 3RM0H 1RRKA 5E2PA 1V2MT 1UK2A 1QY6A 2Y5FA 1ANBA 1GG6B 4KELA 1SGFA 3A89A 5LPRA 2ZDVH 3STJA 3JZ1B 1O2GH 1KXAA 4I8GA 3PLBA 1UTKA 4YOJA 1TWXB 1HAVA 1Y5BT 5AHGH 2R3UA 5ABWA 1EPTA 1FQ3A 1NN6A 4AYVB 1HLTH 1FI8A 1GCTC 4AFZA 1BT7A 1C2DA 2OBQA 3RXGA 1MTUA 1KXCA 1SQAA 1AB9C 4FU7A 4WMEA 2OUAA 1O3KA 3PMHB 1E35B 3SV6A 1O2IA 4XDEA 3RXVA 2QXGA 3GCNA 2YNAA 4RKOB 1GPZA 1TRMA 2ZNKH 1O3IA 3NK8A 2FOAA 3NCLA 1PQ7A 4WMDA 2Z3DA 1LPGB 2PUXB 3VGCC 3EYDA 1BITA 2HLCA 1MBMA 5C3NA 4X8SH 1AKSA 1O3FA 1UMAH 3RXKA 1DLKB 3D49H 3O8CA 1WCZA 2QAAA 3SI4H 1G3EA 4CBOA 1SOZA 1LHDH 3BTWE 2ZFPH 3EAJA 2P8OC 1P2JA 1EZXC 3ZZ8A 1F0SA 3STIA 3LH3A 2ILNA 1CHGA 3O8BA 2A5IA 1Y5UT 1IQGA 2H5CA 2WPLS 1O2QA 1O3DA 1D6RA 5EODA 1TE0A 1C5OH 4MLFB 4Z0KA 1JMOH 4DCDA 1B7XB 1MAXA 1RTFB 5TJXA 3BIVH 5DP4A 3QO6A 4MG3A 1UHBB 4INHA 1SPJA 1BHXB 1DUAA 1EUFA 1G32B 1MAYA 1FONA 4IC6A 2GMTB 3U1IB 2B0FA 4OS5A 4MQAA 5F03A 1GJ7B 4K8BA 5FX5A 1TGSZ 4Z6AH 5BRRE 2BTCE 1EZQA 3FVFB 4E7NA 4PROA 1TPPA 2GZ9A 1GJ4H 1HJAB 1DSUA 1TBQH 4GHQA 1NRRH 5HMAA 4M7GA 4TY7A 2EI8A 3OY6U 3S9AA 3UTUH 1HYLA 2VGCB 3TH2H 2OCVB 1C5UA 1SG8B 3RXAA 4AG1A 4A6LA 1ZGVA 4DW2U 3L33A 1F7ZA 1ARCA 2WUBA 2FZZA 3ZVGA 1G37A 1GI6A 1N6XA 3A81A 3OSYA 4YOIA 4OS1A 3UFAA 2F9BH 1QB9A 4LOYH 4OGXA 3ZZ7A 4AB9A 2ZFQH 1AFEH 2QYIA 3SUFA 2VJ1A 4Q7YA 3TGIE 1MMJN 2SGPE 3S9CA 1TMTH 3SNCA 2R0KA 2SGDE 1SGQE 1AO5A 1YPEH 1HAZB 1NT1A 1W3CA 1E36B 2YOLA 1EATA 1TYNA 2FOMB 1TFXA 2A32A 1DXPA 4AB8A 4MPWA 4ZKSU 2JKHA 2C93B 3QTVH 2OQ5A 2NWNA 4CR9A 1FUJA 3ZZDA 1O37A 1P09A 4VGCB 1C2KA 1DUEA 1V2LT 4ZXXH 1BTHH 1O2MA 3A8BA 1KXFA 1UHBA 1LVMA 5DO4H 1AMHA 1DANH 3UOPA 3GCTF 4CR5A 3E16B 2SNWA 2RG3A 3W94A 9LPRA 1RFNA 1GHAG 3CS0A 1BBRK 3FZZA 1GBIA 3QZQA 4ABHA 4JK6A 2AGGX 1XXDA 1ZR0A 3BEUA 1GWAA 2FTLE 1EKBB 1C5RA 1VCPA 3MHWU 1A3BH 2BD5A 3DA9B 1ZPBA 2CF9H 1O2PA 4X8UH 4CRBA 5EW1H 1LHEH 3PMJA 5AVDA 2UWLA 2VB0A 2P95A 1XM1A 1GDQA 4YESB 4NA7A 2UWOA 3LU9B 2BDCA 1OSSA 3UNSA 2AMPA 4CHAC 4WWYA 1K1LA 2DE9A 2FDAA 3GY5A 1PQ8A 4U30A 1LPZB 3P17H 1S81A 3DT0H 5IDKA 1XKBC 3LGVA 2BQWB 4F49A 2XWBI 1W11U 3V0XA 4H6TA 1UTMA 3UNQA 1GI5A 4TY6A 3TGKE 3ZVBA 4ABAA 3SJ9A 3SOSA 1YPJH 1BJUA 1FMGA 3SV2H 4JZ1A 4Y71A 4ZUHA 1MU6B 4TYDA 4D7GA 3TK9A 1H1BA 1HAIH 3TNTA 3RMMH 1AI8H 2ZDMA 3BEIB 2GCHG 1HAOH 3KF2A 1IOEA 1O39A 3KQBA 3PLKA 2A7HA 4YM9A 3VB4A 2O8UA 2IOTA 1VCWA 3MNSA 5GDSH 2ZGXH 4D9QA 2BD9A 6GCHG 1O30A 2O8TA 2EA3A 2BQ6B 5BPEA 4K69A 1W10U 1OOKB 2RDLA 3HK6B 1ESTA 1IQKA 2TGDA 1O3GA 2Y5GA 2XBVA 3PV4A 3ZYDA 4IC5A 2BZAA 1E37B 4NGAH 4ABIA 1GI0A 1P2KA 1WV7H 3TNSA 2D2DA 3DD2H 3QGNB 1O3AA 3ATKA 3V3MA 1A7SA 3U8TH 1ARBA 1GDNA 1THPB 1DY9A 1GVKB 2ZZUH 2A4RA 1O5AB 3F68H 2UUFB 3ZZ4A 2J94A 2PLXA 4K1SA 2ZU2A 1MCTA 4XFQA 1TAWA 1V2TT 2HVXA 2BVRH 1C2GA 1FIWA 1Y3WA 4YT6H 2FESH 3A80A 1CA0B 3DUXH 1S83A 1F92A 2VWLA 1TX6A 1LDTT 4AYYB 1GJAB 1XXFA 4FUIA 2A7CA 2WV4A 2ZDKA 3PM3A 2NU4E 1HFDA 2C8YB 3LONA 2Y82A 2SGFE 1EJMA 1T7CA 1XMNB 2ZC9H 1KYNA 3CP7A 3M7TA 3FZDA 2GCTB 1TPOA 1G9IE 1GGDC 2BDYA 3TK5A 2HPQH 1QJ7B 1HAGE 1HB0B 1AZ8A 3ZVDA 3TK6A 1C1QA 5CHAB 1BRCE 2A45B 2Y7XA 4ZHAA 3RMLH 3SJKA 1ANEA 3VXFH 1AD8H 2ZPQA 1O2HA 1TX7A 1J8AA 2FI4E 1OWJA 1YBWA 3A88A 3RC6A 1MH0A 2BD2A 3LC5A 2ZTYA 2ZDAH 1GCDA 1IQMA 1O3PB 3HKJB 4B73A 4FVDA 2GDEH 3R3GB 1F0UA 1P2MA 4KTUA 4Q7XA 1K1OA 2FXRA 1O3OA 1PPGE 2ZECA 4BXSA 1W8BH 4INKA 4K1EA 2FX6A 1C5QA 1CQQA 2BY8X 5C5OA 4DURA 4AFSA 1NU7B 5FPSA 3S9BA 2VIDA 1ELCA 4E05H 1OPHB 1HAHH 2IPHA 1TNKA 3LKWA 1EAWA 1GHZA 3D62A 1K1NA 1TOCB 1BTYA 1LTOA 1TRYA 1EJAA 2VIPA 6LPRA 1O5EH 2B5TB 3SU1A 1OP0A 2TGPZ 1TPSA 1SL3A 5DPAA 2QA9E 2OXSA 1YPGH 1O2SA 2PV9B 2BLQA 2QV1A 3UWJH 1CVWH 1T4VH 1NROH 2ALPA 1HPGA 3KQDA 4K60A 4O9VA 4TPIZ 4I8LA 1G3DA 4WJG2 1JRTA 1A4WH 5J4SA 1O2TA 3MNCA 1PPHE 4GPGA 4NIVA 2P3UB 4U01A 3S7HB 3SO3A 3ZZ9A 3MO9A 2Z7FE 1ZJKA 1THSH 2XCFA 3GY3A 1P2IA 1O2LA 3BG4C 1K2I1 1BA8B 1MUEB 1Z1IA 2ZF0H 1GHAF 1ZPCA 2P59A 4JK5A 4OGYA 2XWAA 1IQLA 1GMHG 1UTNA 1JBUH 1TALA 1FJSA 2Y7ZA 4LZ4B 4GUXA 8ESTE 4NCYA 4NA8A 1ZSLA 2Q6FA 1GDUA 3V7TA 1FV9A 4OS4A 1SOTA 2WPMS 3IWMA 5I25A 2IN2A 2TIOA 3A82A 1HNEE 1Y8TA 2EI7A 4NFFA 1YCPH 2FMJA 3ODDA 5DKMA 7GCHG 1WAYB 2QY0B 3D65E 1UVTH 2VINA 1M9UA 1BRUP 1O35A 3QDZB 3RXBA 1C9PA 5E2OA 4BOHA 4FUJA 4ISHH 3HPTB 1SBWA 1MD7A 3M36A 4AOQA 1EASA 1ZHPA 5L6NH 4ZROA 4FVBA 2WPKS 3RXFA 4IW4E 2FX4A 2FP7B 2OC8A 3B8JA 1GBHA 1O5GH 2GX4A 1GI2A 4DVAU 2AIPA 2HWLB 4MNWA 1CGJE 2HRVA 2Q6GA 1O3LA 2V0BA 1C5WB 4X1NU 4X1SU 4UFFH 4O3TA 4OS6A 2Y81A 1F5KU 1L0ZA 1O32A 4X8TH 2BXUH 1LVOA 1OP2A 4Y8ZA 1TONA 1NU9A 3PROA 1ESBA 2UUKB 2ULLA 3ATMA 1SFQB 2OC1A 4JZEH 5K0HA 3TGJE 1QBVH 3GYMA 1EB1H 4FUBA 3SU6A 4UFGH 2A4QA 2THFB 1H8DH 3NPSA 1C1NA 3SNBA 1ETSH 6GCHF 1BRAA 2C8WB 3PLPA 1BRBE 1T8NA 2BDIA 3UR6A 1QBNA 1AE8H 1CGIE 1GBCA 2A2XH 3SGBE 4YTAA 1H4WA 1G2LA 1NO9H 2OTVA 4TWWA 3URCA 5LGOA 1EX3A 3BTKE 1C1TA 3T27A 1L4ZA 3T28A 5L30H 2QF3A 2VWNA 3MNBA 3ESTA 1TGBA 4KP0A 1C1SA 4FXGH 2YNBA 5A2MH 3C1KA 1P2NA 2ZDNA 1XUFA 4DG4A 1NC6A 1E38B 1GVLA 2J38A 1OWDA 1AY6H 4Y10E 3PO1B 4BXWA 1N8OC 2GT7A 2STBE 3Q00A 4AORA 1P0SH 1ZYOA 2VH6A 3G01A 1CO7E 4BTTB 1GBAA 1JRSA 4NG9H 1UO6A 3EE0B 1SSXA 1ZZZA 3JZ2B 4XBDA 1ELGA 2CJIA 1NM6A 5FAHA 5L2YH 3GCHB 1MU8B 3ZVEA 1LHCH 1Y59T 3MU5A 2W7SA 1TIOA 2ZU1A 4FUDA 5JBAS 1C5YB 4XE4A 1GHVH 1K1IA 1FAXA 2O9QA 4MNYA 1VITG 4GSOA 4WXVA 5LH8A 1UTPA 1RJXB 3AW0A 1A5GH 1S82A 2CHAC 4X2XA 1C5XB 1C9TA 2QIQA 3MO6A 4BTUB 4IBLH 1SGCA 4KTCA 1BMLA 1WBGB 1GI7B 2VU8E 1AUJA 4ABDA 1DITH 3EA8A 1RIWC 1C2EA 1OWKA 1K9OE 1ELAA 3P6ZB 1QIXB 1P10A 2Z9KA 1P3CA 4SGBE 2BMGB 5L2ZH 1CHOG 1TMUH 5JDUB 2BLVA 1ZSKA 1NRPH 1Z6JH 4AGJA 2GKVE 3GDVA 1AE5A 2QXIA 2QXJA 1QJ6B 5A0AE 2J34A 2OC0A 2FI5E 3EQ0H 2OINA 1QA0A 1Z8IB 1O5DH 1H9HE 2QXHA 1XUJA 2A4OA 3MOCA 2FOCA 1AWFH 1K21H 5AFYH 1QR3E 1IQJA 3LH1A 1SR5C 1WOFA 1D9IA 3KGPA 3ENSB 1O3BA 1TPAE 1YGCH 3U8RH 3OU0A 3PWBA 1EAIA 2A1DB 2G55A 2PSYA 1D3TB 2PW8H 2ZKSA 2JETC 4I32A 6ESTA 3SU4A 3W95A 3SORA 5CMXH 5F6MA 1KLIH 1L1JA 2VIVA 1KIGH 1P3EA 2Q1JA 4Y79A 3K6YA 3BIUH 2PKSB 1UK4A 1H9LB 4BAKB 2ANYA 2AEIH 2R0LA 1AU8A 4X6PA 1D3DB 1QJ1B 1YP9A 1YKTA 1BTPA 3NZIA 2GVFA 1LHFH 1K1JA 3FFGA 4KTSA 1V2PT 4FU9A 3RXPA 1Y5AT 2ESTE 1LQEA 3V12A 1BTZA 2WPHS 3SV8A 4JYVH 4FUGA 4JYTA 4BAQB 1DX5M 4K8YA 2H9HA 5JB8S 3A86A 1TB6H 4JZIA 1MKXK 1GMDG 1HCGA 1S85A 1CA8B 1NFXA 2BVSH 5C1YA 3P95A 1GMHF 1QL7A 3RMNH 2Y80A 1TGTA 2BD7A 5J4QA 5A8XA 3Q3XA 4ABEA 3DFLA 1C1MA 3VFEA 1GHXH 1FPCH 4MVNA 1C2IA 1T8LA 1WUNH 1YC0A 1SVPA 1BBRH 2GZ7A 2VH0A 3RMOH 4GCHG 2TBSA 1ZJDA 5C67A 3SBKA 1BZXE 3RXQA 7GCHF 1EAUA 1EPTC 3VB7A 3TITA 2J2UA 3M37A 5DP7A 3RXRA 1DVAH 1NRSH 4WH8A 3UNRA 1FY3A 4RN6A 5TCCA 1O5FH 1TBRH 2AH4X 1GHYH 2ALVA 3BF6H 1O2XA 4WF8A 2A0QB 1JIMA 3K6ZA 3RU4E 2D1JA 5FX6A 1LHGH 3BTDE 3E90B 1AFQC 5EQQA 1YPKH 3A83A 4HZHA 2KAIB 1HRTH 2ZQ1A 1OKXA 2B7DH 3U9AH 4YLUA 3E91A 1W14U 1CBWB 3SJIA 1QQUA 1H8IH 7LPRA 1QHRB 2ZU4A 1WYKA 2FO9A 4Y8YA 3QN7A 1C4V2 3B9FH 1SQTA 3PMBB 4D76A 1K1MA 1V2UT 2OC7A 2AERH 1Q31A 1ZOMA 4LK4A 3SN8A 3LPRA 1XKAC 1ZGIA 3GY7A 1ELBA 1QNJA 2XC0A 3E0PB 5F8XA 1DICA 3P8GA 1UTQA 2WYJA 2Y5HA 2ZHQH 5AF9H 4UEHH 1O33A 4ISOA 3NWUA 5PTPA 2FYQA 3IG6B 4RSPA 2ANMH 3ZZ5A 1GG6C 1W13U 2H1UA 5DJ7A 2ZTZA 3UOUA 4BTIB 1OWIA 3LGIA 1ZLRA 1Z8GA 4JYUH 1GJ5H 1PPEE 4ISIH 2R2WU 1GMCG 3ZVFA 3OTJE 4X6NA 1V2ST 3M5LA 1W0ZU 2NU3E 1MZDA 2H9EH 3RU4T 1O34A 3VPKA 3RXDA 2BD8A 2ASUB 2F9VA 1C1VH 3RC5A 3A87A 1ID5H 2BQ7B 1GHBF 1BB0B 1SMFE 2PFEA 4CH2B 1D3PB 4K5ZA 1FAKH 1KDQB 1A0LA 2PSXA 1DLEA 3GOVB 3S69A 1XX9A 2AIQA 4SGAE 1L4DA 3EGKH 2WV5A 1HAYB 1OWHA 3MU4A 2KAIA 1VZQH 2VVVA 1FN8A 5K7RA 4A1VA 1GBBA 4E7RG 3QWCH 2P94A 1AGJA 2BY6X 1MBQA 2ZGBH 3UR9A 1WTGH 1ZRKA 1JXPA 4ZKRU 3RXTA 2ZPSA 2Z3CA 4DGJA 4H4FA 1MTSA 2HOBA 2J9NA 1C5PA 1C1PA 3SU0A 3HKIB 1PPBH 1SGEE 3ATLA 1QL9A 4UE7H 4B2BA 1N1LA 3SGAE 1Q3XA 1HJ8A 1BCUH 2TGAA 1CSOE 3GDUA 1Z7KA 1THRH 4R0IA 2ZU5A 4Y11E 3FAOA 1MTVA 3TPIZ 4UONA 2XW9A 6CHAB 1LPKB 4X0WU 3TJOA 3LOXA 1CT4E 4Q7ZA 3C27B 1TMBH 3SGQE 1CHOF 1TLDA 2BY5X 2GGVB 1MTNB 3T62A 2VIWA 4BANB 5GIBA 5G4BA 1P06A 3UQVA 2ZEBA 2GMTC 4E06H 3TVJB 1DWBH 1MKWK 2ZHWH 4DY7B 1QBOA 3SUDA 4HTCH 1FY5A 1C2HA 1S6FA 2ZGHA 3BTFE 2BDBA 3SI3H 1Z71A 2P3TB 5GJ4B 2VIQA 3MI4A 2O8WA 2RA3A 1GI9B 3M5OA 1C4U2 4ABBA 1O2NA 2VGCC 1KDQA 1VGCB 2V3HH 3VB6A 3LIWA 1A0HB 2XCNA 4AFQA 5ETXA 4ABGA 1QQ4A 2Z9IA 5FPTA 3SUEA 4DIIH 2BHGA 4QT8C 4ABFA 4YT7H 3H5CB 3T2NA 1NRNH 2W26A 3GDSA 1HXEH 1O5CB 2AGEX 5DG6A 1L2EA 4AGKA 1HAXB 2EI6A 3M3VA 3SU5A 3FP8E 3MH5A 4JMYA 3SJ8A 3RXLA 2VWMA 5T6GA 3DFJA 2V6NA 4ZAEA 1UVUH 5ESTE 1O2ZA 3TLOA 1TQ7B 2XYAA 2VVUA 3ATWA 5EQRA 2ZG0H 1O2RA 1P01A 1BHXF 1YYY1 2G8TA 3TJVA 1OX1A 5GXPA 5JYIA 2ZFFH 4LZ1H 4LXBH 5C2ZA 3F9GA 2BXTH 2BB4A 2D26C 4B2CA 4MPUA 4VGCC 1AWHB 4X6OA 4Y8XA 5JBCS 3T5FH 4WMFA 2WPJS 1Z8JB 1UVOA 1GBFA 3LT3A 1GBDA 2C3SA 1BUIA 4XBBA 5FBEA 2GT8A 3M35A 1FPHH 3F9EA 4YOGA 2BOKA 5HGGA 3A7ZA 1FZZA 4ZKNU 4ESTE 3VEQB 3AAUA 1NESE 1ELDE 4ZHLU 1SGIB 2PTCE 5EQSA 1TRNA 1GCTB 1C2MA 1EP5A 3U69H 4X2VA 1AB9B 3LC3A 2AS9A 4BAMB 1TX8A 1W2KH 1KTSB 2BX3A 2FS8A 1BOQA 1Y3VA 3A7TA 3FP7E 4J1YA 4O3UA 3MTYA 4JZDH 2LNCA 4Q80A 1BTUA 1YPHE 3E3TA 8KME2 4CREA 4B76A 4X1RU 3BG8A 2C90B 3BEFB 1ACBE 4RKJB 1F0TA 3V13A 2ZO3H 2C8ZB 4B74A 4O97A 1Z6EA 2OQUA 2LPRA 3RXHA 3VGCB 2ZP0H 2B9LA 2PR3A 1IQFA 4MTBA 1NZQH 1L1GA 1S5SA 1PPCE 3LJOA 4KGAA 2PWXA 3RXOA 2WUCA 2P8OB 3QUMP 1IQEA 1SQOA 4YO9A 1ZRBA 1PYTD 2FWWA 3H7TA 2VVCA 2SGQE 3E6PH 2FOFA 1AN1E 2W7UA 1GBJA 1G30B 4MDSA 4Y6DA 2TGTA 3SHAH 2FLBH 1MTWA 1RXPA 1HXFH 4J2YB 1WSSH 4U2WA 1UTJA 5T3HA 2GP9B 2ZU3A 3LGUA 4CRFA 1LQDB 1RD3B 1KXBA 3SV7A 1YPHC 4INLA 3SU3A 5H4IB 1O3HA 1OYTH 4B2AA 1A61H 3K65B 3F1SB 3KQEA 2FM2A 4FUHA 5JPMH 3RC4A 2R9PA 2BDGA 2D8WA 3LGWA 3T29A 1UK3A 1KSNA 1ORFA 4X1PU 1DSTA 1QURH 1HIAB 3UQOA 1DDJA 4ISNA 3RU4D 3B23B 2B8OH 5EW2H 3O8RA 3OX7U 5HM2A 2V35A 5C1UA 1GHWH 4H42U 1UTOA 2ZPRA 3SQHE 3A84A 4NSVA 1Y3UA 2FOEA 2GCHF 2Q6DA 3GY2A 1EZSC 1RTLA 2ZGJA 1TABE 4MPVA 3GCTG 1C1UH 1SGFG 4UDWH 3R0FA 3U1JB 2ZIQH 1IQNA 1F0RA 5FCRA 2ODYB 1CA0C 1QRZA 3MWIU 2GD4B 5EG4A 1UCYH 3MU8A 3PTBA 1CT0E 1LKBA 3M3TA 2CXVA 2TPIZ 3NUMA 1TGNA 1SGYE 2Z9JA 2ZQ2A 3ZZBA 3K2UA 1D3QB 3Q77A 3I29A 3RLWH 1GL1A 1XUIA 3IITA 1T8OA 3KCGH 3MH4A 2NU2E 4IS5A 5FPYA 2GCTC 4I8JA 3ODFA 1YM0A 1J15A 2ZA5A 2GDDA 2PHBA 5LPEA 1XVMA 2CGAA 4D9RA 3F9HA 1OWEA 1QRXA 2AGIX 3M5MA 3E0NB 5F8ZA 1GBLA 5CHAC 4AFUA 1D6WA 2M5TA 3E1XB 1PPFE 3FANA 1GBTA 2XXLA 1SLVB 2H5DA 1A5IA 2HGTH 1HIAA 4X1QU 5A8ZA 2ZCHP 4HI3A 3SZNA 1FIZA 4GVUA 4ABJA 2AMQA 1GJ6A 2AYWA 1W7GH 2Z3EA 1SHYA 1Z1JA 3RDZA 2PTNA 2PKAB 1A3EH 4K3JA 4CHAB 1NPMA 1P05A 5I46H 3GY4A 5FCKA 1C5ZB 2FS9A 1GI4A 1A46H 1RS0A 4UFDH 1CGHA 2BD3A 3AAVA 3PYHA 4A5TS 1RGQA 1QFKH 1EJNA 1C5TA 2F3CE 2XRCA 3MFJA 2FI3E 1EAXA 3CENA 3MU0A 4NIYA 4B1TA 1JWTA 5DP3A 5B6OA 2W3IA 1G3CA 5DP6A 1C2FA 2BM2A 1SGPE 1C2JA 1W0YH 3L6PA 1O31A 3A8AA 3T25A 1T32A 1XVOA 1ZSJA 1ELFA 9ESTA 2CF8H 2FODA 3S7KB 1ELVA 2AMDA 1IHTH 1RTKA 2QC2A 4NWKA 1T31A 3RXUA 2ZHFH 1O2UA 3AW1A 2EC9H 1EZUC 4NA9H 1XUKA 4IN1A 8LPRA 1MKXH 2I6QA 2ZI2H 1ZMJA 1ZMNA 3H7OA 1IHSH 3EDXB 4ZHMU 2R3YA 5TCAA 3EA9A 4IMQA 4AX9H 4ZMAH 4BNRA 1G2MA 4ASHA 3PWCA 2WPIS 2A31A 3ZZ6A 3KQCA 4NWLA 1MZAA 3ELAH 1FN6A 3MU1A 7ESTE 1WQVH 2FIRH 1B0EA 4ZXYH 1MCVA 2NU1E 4I7YH 4NZQA 4U32A 3PB1E 4WXIA 3SNAA 5T6FA 2G4UA 3MH7A 1DM4B 1QTFA 1SB1H 1VJ9U 1E0FD 2Y6TA 1J17T 1HDTH 3A8DA 4NFEA 2PKAA 3PMAB 1NRQH 1H9IE 1VR1H 1ANDA 1WU1A 1P2OA 2ZHDA 1V6DA 1P04A 1F2SE 2J4IA 3A7WA 5E8EH 3P8OA 2QN5T 3U8OH 3MNXA 1AIXH 2J95A 2PUQH 5E0GA 1ABJH 1GJBB 3VB3A 1ETTH 2OP9A 1AUTC 1WQSA 2FOHA 1O3EA 1Z8RA 4KKDA 4B75A 8GCHG 1MQ6A 3KHVA 3OYPA 2ZWLH 5EXMA 1XUGA 3RM2H 3RXJA 3O8DA 1ESAA 2G5NA 1V2JT 2OLGA 4Q2KA 1O2JA 2DUCA 3TJNA 1NFYA 1D4PB 1PQAA 1IQIA 1TNJA 2HALA 3TJUA 1HBTH 1B0FA 1GGDB 2Z94A 3ZVAA 2BDAA
chains in the Genus database with same CATH superfamily
3PRBA 1ZHRA 2TRMA 2FOGA 1YPMH 3UWIA 2H2ZA 1YCPM 3A7YA 4NZLA 1GVZA 1PYTC 3AASA 3BTHE 1KXDA 1LVBA 2SFAA 1QGFA 3SU2A 5GWZA 2W6ID 2BDHA 1T4UH 1P57B 1UVPA 3RXSA 1GI3A 5C5NA 3Q3YA 4XSKU 1ELTA 1WDIA 3HATH 3SNDA 3M7UA 1W12U 4DOQA 1A0JA 3ZYEA 3WY8A 3TIUA 2XNIA 3HGNA 2GTBA 3TH3H 1GJCB 5T1VA 4Y0YE 2GZ8A 1YLNA 1V2NT 4WY3A 3MO3A 1FXYA 1BIOA 5GPIB 1SGRE 3RXMA 3MH6A 3P70B 4DIHH 2V3OH 3K9XB 3PO1C 1P11E 1B5GH 3MMGA 1GBKA 1VCQA 2GV6A 3SQEE 1KY9A 1U6QA 1NS3A 1AHTH 1ZTJA 2F9PA 2WV9A 3KN2A 4IN2A 5F8TA 4CBNA 1DPOA 3RXEA 1HAPH 4A1TA 3URDA 1J16A 3ZV8A 3GCHC 3SJOA 1W7XH 7KMEH 2O8LA 5C1XA 4X6MA 1INCA 5DGJA 1SLUB 4F4OC 3LDXH 1TBZH 1GBEA 4D8NA 4UD9H 2G4TA 3Q76A 1K22H 2KFWA 1BTWA 1O2KA 1ZPZA 3UIRA 3KIDU 2UWPA 1TNHA 3L3TA 1DXWA 4I31A 1SI5H 4YLQH 1EQ9A 3GISB 4ZH8A 4NIWA 3UPEA 2XC5A 3BG4B 1DS2E 1UVSH 3LGYA 5EPNA 1C5NH 1C2LA 4FOUC 1C5VA 1V2RT 3A8CA 3BTTE 3NXPA 1GJ9B 2A5KA 1EOLA 1O2OA 1HUTH 2FTMA 3E8LA 5EU8A 1QRWA 3P8FA 4X2YA 2A2QH 5ESBA 5HIZA 1P9UA 1S0QA 2ZFRH 4AN7A 1MKWH 1SGDE 1GBMA 1VITF 1OXGA 1DT2A 3M61U 2ZCKP 1CT2E 3F6UH 2F9OA 3RLYH 5KGOA 4AG2A 1KXEA 1NFUA 2A7JA 1BMAA 3NRLA 3PTNA 1C1WH 1JOUB 4D7FA 1F5RA 1AVGH 1TQ0B 1H8ED 3AVZA 5F53A 5GCHG 1EXFA 2XBXA 3I78A 2JH5D 4WH6A 1QA7A 1WTHD 3D23A 4MNVA 3GYLB 1S0RA 1FY4A 4I8HA 2XBWA 4K1TA 4Y76A 2ANWA 4XOJA 3BTEE 1O3JA 1TNIA 5C0UA 1CU1A 1PQ5A 1TA2A 4B71A 2OBOA 1G3BA 2PKSC 2BYAX 3OEED 3U98H 2J98A 2G81E 5CE1A 2H6MA 4FUFA 1YY3A 1UTLM 5EGMA 2ZCLP 3KL6A 1P2QA 3GY8A 1X7AC 2ZDLA 1SLWB 1A2CH 3ITIA 1C5SA 4HFPB 3CS7A 2Z6BD 1N6YA 2W5EA 4GLYA 1S6HA 2BZ6H 1HJAC 1S84A 2J97A 4JZFH 1A1RA 2VWOA 1C4Y2 3HK3B 1TNGA 2G00A 2F9UA 4K2YA 1QB6A 5LPFA 3RUOA 3SZEA 3ZZCA 1AVWA 3QTOH 5FXLA 2I6SA 1ELEE 3ATIA 4TPYA 3KNXA 5EXLA 1P03A 1ETRH 2PGQB 1VITH 3FP6E 3SUGA 3KEEA 1KLJH 4IMZA 2JJ1D 1IQHA 3QX5H 2P3FH 3QLPH 1C5MD 1TNLA 1T8MA 2J92A 1P02A 2VNTA 4NIXA 1UCYE 1GL0E 5A0CA 2FYRA 1C1RA 1DFPA 4UFEH 1O36A 1YF4A 1ZHMA 5A8YA 2CV3A 2JH0D 2QCYA 4FUEA 5EOKA 1N8OB 2R2MB 2PGBB 2RA0A 4ZKOU 1ZMLA 4Y0ZE 1GMDF 1LKAA 2FLRH 4I33A 2OD3B 3ZZAA 4A7IB 2W3KA 5EIYA 5C20A 3RXIA 1OP8A 3BTGE 1NFWA 4CRGA 2JH6D 1L1NA 5HXFA 2EEKA 2C4FH 4Y7AA 2HPPH 3QGJA 1CBWC 8GCHF 1FNIA 3VXEH 1V2OT 1UJ1A 4B6EA 4FUCA 4GAWA 3ZV9A 1QCPA 3RXCA 3FN8A 4GCHF 4ISLA 4WVPE 2CHAB 2F9NA 2BOHB 1A5HA 1GI1A 2AFQB 1BQYA 2FPZA 5E0JA 1J14A 3TH4H 2EQNA 2ZFTA 3SW2B 2ZTXA 3N99A 3M7QA 4A92A 3A85A 3S0NA 1RIWB 1AQ7A 4FU8A 2JIZD 1DWCH 5DP8A 4NSYA 1V3XA 1C1OA 2FOBA 3SHCH 1PJPA 2ODQA 1QL8A 3F9FA 1FDPA 4FETA 4DJZB 1OYQA 4THNH 1BTXA 4TWYA 1DY8A 1V2WT 4HGCA 1YLCA 2STAE 2XC4A 1GJ8B 1NY22 2EY4C 1HV7A 2IJOB 1P12E 3GICB 3ZZ3A 5JBBS 4X2WA 3BTME 2ZHEH 4OS7A 1HJ9A 3LGTA 1AZZA 1HGTH 4A1XA 2KCYA 2ANKH 2F83A 3EA7A 3LJJA 4GHTA 2NU0E 1LVYA 5E0HA 1O2WA 1J9CH 4CRDA 1ABIH 3BTQE 1IAUA 4TSFD 1DWDH 2VIOA 1O3MA 4DT4A 1Q2WA 2BX4A 3UREA 1DWEH 2DE8A 3T26A 2WINI 1BDAA 1O3CA 2JETB 1FY8E 1VJAU 5T6DA 1UW7A 2CN0H 1ZTKA 5A09A 3SV9A 2GV7A 1LCYA 3BSQA 2HNTE 1O38A 5A0BA 5HM9A 5SGAE 2A5AA 3VB5A 1SLXB 1O2VA 3A7XA 2KCPA 5IYTA 5HYOA 1Y3XA 2Z9GA 1GMCF 1TOMH 2G52A 5DK1A 3UY9A 2UUJB 3RP2A 1DE7H 1FLEE 3BN9A 2A4GA 5AFZH 4MNXA 2P93A 3I77A 2QGRA 4R8TB 1O5BB 1EP6A 2QF0A 2ODPA 4YZUA 3P8NA 2P16A 2KX4A 1SC8U 2O8MA 3GCOA 2ZGCA 2BY7X 3N7OA 1MD8A 1ZTLA 1LO6A 2BY9X 2BLOA 6CHAC 1KLTA 2BVXH 1G36A 1DOJA 2F91A 1P8VC 1CE5A 1F5LA 2UUYA 4BAHB 1JIRA 1SFIA 1AVXA 1MTNC 2H9TH 3OTPA 2CMYA 3P92A 3ZVCA 1O0DH 5FBIA 1P9SA 1V2QT 4DT7B 5C94A 4O03A 2IPQX 2HNTC 4X8VH 1SGNE 2KCOA 1QB1A 5JBTA 1HAVB 3BV9B 1YCPK 1Y3YA 4MPXA 1C5LH 1EPTB 1XUHA 2SGAA 2V7QD 1LMWB 3HGPA 5EPYA 4CH8B 2SGEE 1FY1A 1E79D 2K1QA 3KYFA 4Y7BA 1V2KT 2SNVA 1MQ5A 3M5NA 5GCHF 2BLWA 1EOJA 1O2YA 1ANCA 3OY5U 1PPZA 1VGCC 3OEHD 3QK1A 3M3SA 3UUZA 1BBRE 1AFQB 2BD4A 5FHTA 5DP9A 2WYGA 4OS2A 1SHHB 2ZFSA 1TA6A 4JCNA 2G51A 3GY6A 3QZRA 1AKSB 1O3NA 2FEQH 1KTTB 3TU7H 1YPLH 3A7VA 1SGTA 2XTTB 4AZ2B 4XBCA 3SNEA 1GI8B 3DHKH 5KEDA 5JB9S 2RCEA 2Z9LA 4H6SB 1OS8A 4BAOB 1GHBG 3MYWA 1PFXC 1EB2A 4I8KA 1NTPA 3Q3KA 1K28D 2C8XB 1K1PA 1BMNH 2YMSC 4IGDA 1YLDA 2HNTF 1E34B 5EXNA 5DP5A 4CRCA 1V2VT 1TGCA 1GJDB 2G5VA 4CRAA 1BJVA 1UCYK 1BMMH 2XBYA 3NKKA 3RM0H 1RRKA 5E2PA 1V2MT 1UK2A 1QY6A 2Y5FA 1ANBA 1GG6B 4KELA 4Z1MD 1SGFA 5CDFE 3A89A 5LPRA 2ZDVH 3OAAD 3STJA 3JZ1B 1O2GH 1KXAA 4I8GA 3PLBA 1UTKA 4YOJA 1TWXB 1HAVA 2RDEA 1Y5BT 5AHGH 2OK5A 2R3UA 5ABWA 1EPTA 3DSOA 1FQ3A 1NN6A 4AYVB 1HLTH 1FI8A 1GCTC 4AFZA 1BT7A 1C2DA 2OBQA 3RXGA 1MTUA 1KXCA 1SQAA 1AB9C 4FU7A 4WMEA 2OUAA 1O3KA 2W6JD 3PMHB 1E35B 3SV6A 1O2IA 4XDEA 3RXVA 2QXGA 3GCNA 2YNAA 3ZIAD 4RKOB 1GPZA 1TRMA 2ZNKH 1O3IA 3NK8A 2FOAA 3NCLA 1PQ7A 4WMDA 2Z3DA 1LPGB 2PUXB 3VGCC 3EYDA 1BITA 2HLCA 1MBMA 5C3NA 4X8SH 1AKSA 1O3FA 1UMAH 3RXKA 1DLKB 3D49H 3O8CA 1WCZA 2QAAA 3SI4H 1G3EA 4CBOA 1SOZA 1LHDH 3BTWE 2ZFPH 3EAJA 2P8OC 1P2JA 1EZXC 3ZZ8A 1F0SA 3STIA 2HVYB 3LH3A 2ILNA 1CHGA 3O8BA 2A5IA 1Y5UT 1IQGA 2H5CA 2WPLS 1O2QA 1O3DA 1D6RA 5EODA 1TE0A 1C5OH 4MLFB 4Z0KA 1JMOH 4DCDA 1B7XB 1MAXA 1RTFB 5TJXA 3BIVH 5DP4A 3QO6A 4MG3A 1UHBB 4INHA 1SPJA 3FKSD 1BHXB 1DUAA 1EUFA 1G32B 1MAYA 1FONA 4IC6A 2GMTB 3U1IB 2B0FA 4OS5A 4MQAA 5F03A 1GJ7B 4K8BA 5FX5A 1TGSZ 4Z6AH 5BRRE 2BTCE 1EZQA 3FVFB 4E7NA 4PROA 1TPPA 2GZ9A 1GJ4H 1HJAB 1DSUA 1TBQH 4GHQA 1NRRH 5HMAA 4M7GA 4TY7A 2EI8A 3OY6U 3S9AA 3U28C 3UTUH 1HYLA 2VGCB 3TH2H 2OCVB 1C5UA 3PV5A 1SG8B 3RXAA 4AG1A 4A6LA 3WW7A 1ZGVA 4DW2U 3L33A 1F7ZA 1ARCA 2WUBA 2FZZA 3ZVGA 1G37A 1GI6A 1N6XA 3A81A 3OSYA 4YOIA 4OS1A 3UFAA 2F9BH 1QB9A 4LOYH 4OGXA 3ZZ7A 4AB9A 2ZFQH 1AFEH 2QYIA 3SUFA 1COWD 2VJ1A 4Q7YA 3TGIE 1MMJN 2SGPE 3S9CA 1TMTH 3SNCA 2R0KA 2SGDE 1SGQE 1AO5A 1YPEH 1HAZB 1NT1A 1W3CA 3WWBA 1E36B 2YOLA 1EATA 1TYNA 5CHBA 2FOMB 1TFXA 2A32A 1DXPA 4AB8A 4MPWA 4ZKSU 2JKHA 2C93B 3QTVH 2OQ5A 1SKYE 2NWNA 4CR9A 1FUJA 3ZZDA 1O37A 1P09A 4VGCB 4P02A 1C2KA 1DUEA 1V2LT 4ZXXH 1BTHH 1O2MA 3A8BA 1KXFA 5EJZA 1UHBA 1LVMA 5DO4H 1AMHA 1DANH 3UOPA 3GCTF 4CR5A 3E16B 1KMHB 2SNWA 4ASUD 2RG3A 3W94A 9LPRA 1RFNA 1GHAG 3CS0A 1BBRK 3FZZA 1GBIA 3QZQA 4ABHA 4JK6A 2AGGX 1XXDA 1ZR0A 3BEUA 1GWAA 2FTLE 1EKBB 1C5RA 1VCPA 2J98B 3MHWU 4Q4LA 1A3BH 2BD5A 3DA9B 1ZPBA 2CF9H 1O2PA 4X8UH 4CRBA 5EW1H 1LHEH 3PMJA 5AVDA 3GS9A 2UWLA 2VB0A 2P95A 1XM1A 1GDQA 4YESB 4NA7A 2UWOA 3LU9B 2BDCA 1OSSA 3UNSA 2AMPA 4CHAC 4WWYA 1K1LA 2DE9A 3VG8A 2FDAA 3GY5A 1PQ8A 4U30A 1LPZB 3P17H 1S81A 3DT0H 5IDKA 1XKBC 3LGVA 2BQWB 4F49A 2XWBI 1W11U 3V0XA 4H6TA 1UTMA 3UNQA 1GI5A 4TY6A 3TGKE 3ZVBA 4ABAA 3SJ9A 3SOSA 1YPJH 1BJUA 1FMGA 3SV2H 4JZ1A 4Y71A 4ZUHA 1MU6B 1YWUA 4TYDA 4D7GA 3TK9A 1H1BA 1HAIH 3TNTA 3RMMH 1AI8H 2ZDMA 3BEIB 2GCHG 1HAOH 1W0JD 3KF2A 1IOEA 1O39A 3KQBA 3PLKA 2A7HA 4YM9A 3VB4A 2WPDD 2O8UA 2IOTA 1VCWA 2QE7D 2XOKD 3MNSA 5GDSH 2ZGXH 4D9QA 2BD9A 6GCHG 1O30A 2O8TA 2EA3A 2PP6A 2L6OA 2BQ6B 5BPEA 4K69A 1W10U 1OOKB 2RDLA 3HK6B 1ESTA 1IQKA 2TGDA 1O3GA 2Y5GA 2XBVA 2YMSD 3PV4A 3ZYDA 4IC5A 2BZAA 1E37B 1NBME 4NGAH 4ABIA 1GI0A 1P2KA 1WV7H 3TNSA 2D2DA 3DD2H 3QGNB 1O3AA 3ATKA 3V3MA 1A7SA 3U8TH 1ARBA 1GDNA 3PRDA 1THPB 1DY9A 1GVKB 2ZZUH 2A4RA 1O5AB 3F68H 2UUFB 3ZZ4A 2J94A 2PLXA 4K1SA 2ZU2A 1MCTA 3DSGA 1TAWA 4XFQA 1V2TT 2HVXA 2BVRH 1C2GA 2JDID 1FIWA 1Y3WA 4YT6H 2FESH 3SYJA 3A80A 1CA0B 3DUXH 1S83A 1F92A 2VWLA 1TX6A 1LDTT 4AYYB 1GJAB 1XXFA 4FUIA 2A7CA 2WV4A 2ZDKA 3PM3A 2NU4E 4P00A 1HFDA 2C8YB 3LONA 2Y82A 2SGFE 1EJMA 4XRNA 1T7CA 1XMNB 2ZC9H 1KYNA 3CP7A 3M7TA 3FZDA 2GCTB 3N7EA 1TPOA 3DCLA 4I86A 1G9IE 1GGDC 2BDYA 3TK5A 2HPQH 1QJ7B 1HAGE 1HB0B 1AZ8A 3ZVDA 3TK6A 1C1QA 5CHAB 1BRCE 3F0OA 3KYGA 2A45B 2Y7XA 4ZHAA 3RMLH 3SJKA 1ANEA 3VXFH 1AD8H 2ZPQA 1O2HA 1TX7A 1J8AA 2FI4E 1OWJA 1YBWA 3A88A 3RC6A 1MH0A 2BD2A 3LC5A 2ZTYA 2ZDAH 1GCDA 1IQMA 1O3PB 3HKJB 4B73A 4FVDA 2GDEH 3R3GB 1F0UA 1P2MA 4KTUA 4Q7XA 1K1OA 2FXRA 1O3OA 1PPGE 5FL7D 2ZECA 4BXSA 1W8BH 4INKA 4K1EA 2FX6A 1C5QA 1CQQA 2BY8X 5C5OA 4DURA 4AFSA 1NU7B 5FPSA 3S9BA 2QF5A 2VIDA 1ELCA 4E05H 1OPHB 1HAHH 2IPHA 1TNKA 3LKWA 1EAWA 1GHZA 3D62A 1K1NA 1TOCB 1BTYA 1LTOA 1TRYA 1EJAA 2VIPA 6LPRA 1O5EH 5EJ1A 2B5TB 3SU1A 1OP0A 2TGPZ 1TPSA 1SL3A 5DPAA 2QA9E 2OXSA 1YPGH 1O2SA 2PV9B 2BLQA 2QV1A 3UWJH 1CVWH 1T4VH 1NROH 2ALPA 1HPGA 4XD7D 3KQDA 4K60A 4O9VA 4TPIZ 2VBCA 4I8LA 1G3DA 4WJG2 1JRTA 3F0PA 1A4WH 5J4SA 1WXRA 1O2TA 3MNCA 1PPHE 4GPGA 4NIVA 2P3UB 4U01A 3S7HB 3SO3A 3ZZ9A 3MO9A 2Z7FE 1ZJKA 1THSH 2XCFA 3GY3A 1P2IA 1O2LA 3BG4C 1K2I1 4OM9A 1BA8B 1MUEB 1Z1IA 2ZF0H 1GHAF 1ZPCA 2P59A 4JK5A 4OGYA 2XWAA 1IQLA 1GMHG 1UTNA 1JBUH 1TALA 1FJSA 5DN6D 2Y7ZA 4LZ4B 4GUXA 8ESTE 4NCYA 4NA8A 1ZSLA 2Q6FA 1GDUA 3EE7A 2K0QA 1FV9A 4OS4A 3V7TA 3N7DA 1SOTA 2WPMS 3IWMA 5I25A 2IN2A 2TIOA 2L74A 3A82A 4F55A 1HNEE 1Y8TA 2EI7A 4NFFA 1YCPH 2FMJA 3ODDA 5DKMA 7GCHG 1WAYB 2QY0B 3D65E 1UVTH 2VINA 1M9UA 1BRUP 1O35A 3QDZB 3RXBA 1C9PA 3UB0A 5E2OA 4BOHA 4FUJA 4ISHH 3HPTB 1SBWA 1MD7A 3M36A 4AOQA 1EASA 1ZHPA 5L6NH 4ZROA 4FVBA 2WPKS 3RXFA 4IW4E 2FX4A 2GJGA 2FP7B 2OC8A 1E1QD 1FX0B 1GBHA 3B8JA 1S6LA 1O5GH 2GX4A 1GI2A 4DVAU 2AIPA 2HWLB 4MNWA 1CGJE 2HRVA 2Q6GA 1O3LA 2K8IA 2V0BA 1C5WB 4X1NU 4X1SU 4UFFH 4O3TA 4OS6A 2Y81A 1F5KU 1L0ZA 1O32A 4X8TH 2BXUH 1LVOA 1OP2A 4Y8ZA 1TONA 1NU9A 2JJ2D 3PROA 1ESBA 2UUKB 2KZ4A 2ULLA 3ATMA 1SFQB 2OC1A 4JZEH 5K0HA 3TGJE 1QBVH 3GYMA 5EJLA 2QF4A 2WSSD 1EB1H 4FUBA 3SU6A 4RT0A 4UFGH 2A4QA 2THFB 1H8DH 3NPSA 1C1NA 3OE7D 1ETSH 3SNBA 6GCHF 1BRAA 2C8WB 3PLPA 1BRBE 1T8NA 2BDIA 3UR6A 1QBNA 1AE8H 1CGIE 1GBCA 2A2XH 3SGBE 5GNDA 5HIYA 4YTAA 1H4WA 1G2LA 1NO9H 2OTVA 4TWWA 3URCA 5LGOA 1EX3A 3BTKE 1C1TA 3T27A 1L4ZA 3T28A 5L30H 2QF3A 2VWNA 3MNBA 3ESTA 1TGBA 4KP0A 1C1SA 4FXGH 2YNBA 3AK5A 5A2MH 3C1KA 1P2NA 2ZDNA 1XUFA 4DG4A 1NC6A 1E38B 1GVLA 2J38A 1OWDA 1AY6H 4Y10E 3PO1B 4BXWA 1N8OC 2GT7A 2STBE 3Q00A 4AORA 1P0SH 1ZYOA 2VH6A 3G01A 1CO7E 4ACBA 4BTTB 1GBAA 1JRSA 4NG9H 1UO6A 3EE0B 1SSXA 1ZZZA 3JZ2B 4XBDA 1ELGA 2CJIA 1NM6A 5FAHA 3H09A 3GCHB 5L2YH 1MU8B 3ZVEA 1LHCH 1Y59T 3MU5A 2W7SA 1TIOA 2ZU1A 4FUDA 5JBAS 1C5YB 4XE4A 5DSFA 1GHVH 1K1IA 1FAXA 2O9QA 4MNYA 1VITG 4GSOA 4WXVA 5LH8A 1UTPA 1RJXB 3AW0A 4M9FA 1A5GH 1S82A 2CHAC 4X2XA 1C5XB 1C9TA 2QIQA 3MO6A 4BTUB 4IBLH 1SGCA 4KTCA 1BMLA 1WBGB 1GI7B 5IK2D 2VU8E 1AUJA 4ABDA 1DITH 3EA8A 1RIWC 1C2EA 1OWKA 1K9OE 1ELAA 3P6ZB 1QIXB 1P10A 2Z9KA 1P3CA 4SGBE 2BMGB 5L2ZH 1CHOG 1TMUH 5JDUB 2BLVA 1ZSKA 1NRPH 1Z6JH 4AGJA 1NBMD 2GKVE 3GDVA 1AE5A 2QXIA 2QXJA 1QJ6B 5A0AE 2J34A 2OC0A 2FI5E 3EQ0H 2OINA 1QA0A 1Z8IB 1O5DH 1H9HE 2QXHA 1XUJA 2A4OA 3MOCA 2FOCA 1AWFH 1K21H 4B6FA 5AFYH 1QR3E 1IQJA 3LH1A 1SR5C 1WOFA 1D9IA 2WHXA 3KGPA 3ENSB 1O3BA 1TPAE 1YGCH 3U8RH 3OU0A 3PWBA 1EAIA 2A1DB 2G55A 2PSYA 1D3TB 2PW8H 2ZKSA 2JETC 4I32A 6ESTA 3SU4A 3W95A 3SORA 5CMXH 5F6MA 1KLIH 1L1JA 2VIVA 1KIGH 1P3EA 2KCAA 2Q1JA 4Y79A 3K6YA 3BIUH 2PKSB 1UK4A 1H9LB 4BAKB 2ANYA 2AEIH 2R0LA 1AU8A 4X6PA 1D3DB 1QJ1B 1YP9A 1YKTA 1BTPA 3NZIA 2GVFA 1LHFH 1K1JA 3FFGA 4KTSA 1V2PT 1OHHD 4FU9A 3RXPA 1Y5AT 2ESTE 1LQEA 3V12A 1BTZA 2WPHS 3SV8A 4JYVH 4FUGA 4JYTA 4BAQB 1DX5M 4K8YA 2H9HA 5JB8S 3A86A 1TB6H 4JZIA 1MKXK 1GMDG 1HCGA 3F2GA 1S85A 3W1EA 1CA8B 1NFXA 2BVSH 5C1YA 1K0HA 3P95A 1GMHF 1QL7A 3RMNH 2Y80A 1TGTA 5B6LA 2BD7A 5J4QA 5A8XA 3Q3XA 4ABEA 3DFLA 1C1MA 3VFEA 1GHXH 1FPCH 4MVNA 1C2IA 1T8LA 1WUNH 1YC0A 1SVPA 1BBRH 2GZ7A 2VH0A 3RMOH 4GCHG 2TBSA 1ZJDA 5C67A 3SBKA 1BZXE 3RXQA 7GCHF 1EAUA 1EPTC 3VB7A 3TITA 2J2UA 4ACAA 3M37A 5DP7A 3RXRA 2XNDD 2F4LA 1DVAH 1NRSH 4WH8A 3UNRA 1FY3A 4RN6A 5TCCA 1O5FH 1TBRH 2AH4X 1GHYH 2ALVA 3BF6H 1O2XA 4WF8A 2AHME 2A0QB 1JIMA 3K6ZA 3RU4E 1VKYA 2D1JA 5FX6A 1LHGH 3BTDE 3E90B 1AFQC 5EQQA 1YPKH 3A83A 4HZHA 3PV2A 2KAIB 1W0KD 2M2AA 1HRTH 2ZQ1A 1OKXA 2B7DH 3U9AH 4YLUA 3E91A 1W14U 1CBWB 3SJIA 1QQUA 1H8IH 7LPRA 1QHRB 2ZU4A 1WYKA 2FO9A 4Y8YA 3QN7A 1C4V2 3B9FH 1SQTA 3PMBB 4D76A 1E1RD 1K1MA 1V2UT 2AERH 2OC7A 1Q31A 1ZOMA 4LK4A 3SN8A 3LPRA 1XKAC 1ZGIA 3GY7A 1ELBA 1QNJA 2XC0A 3E0PB 5F8XA 1DICA 3P8GA 1UTQA 2WYJA 2Y5HA 2ZHQH 5AF9H 4UEHH 1O33A 2J5UA 4ISOA 3NWUA 5PTPA 2FYQA 3IG6B 4RSPA 2ANMH 3ZZ5A 1GG6C 1W13U 2H1UA 5DJ7A 2ZTZA 3UOUA 4BTIB 1OWIA 3LGIA 1ZLRA 2IJD1 1Z8GA 4JYUH 1GJ5H 1PPEE 4ISIH 2R2WU 1GMCG 3ZVFA 3OTJE 4X6NA 1V2ST 3M5LA 1W0ZU 2NU3E 1MZDA 2H9EH 3RU4T 1O34A 3VPKA 3RXDA 2BD8A 2ASUB 2F9VA 1C1VH 3RC5A 3A87A 1ID5H 2BQ7B 1GHBF 1BB0B 1SMFE 2PFEA 4CH2B 1D3PB 4K5ZA 1FAKH 1KDQB 1A0LA 2PSXA 1DLEA 3GOVB 3S69A 1XX9A 2AIQA 4SGAE 1L4DA 2KM0A 3EGKH 2WV5A 1HAYB 1OWHA 3MU4A 2KAIA 1VZQH 2VVVA 3FOAA 1FN8A 5K7RA 4YXWD 4A1VA 1GBBA 4E7RG 4Q63A 3QWCH 1AGJA 2P94A 2BY6X 1MBQA 2ZGBH 3KQ5A 1WTGH 3UR9A 1ZRKA 1JXPA 4ZKRU 3RXTA 2ZPSA 2Z3CA 4DGJA 4H4FA 1MTSA 2HOBA 2J9NA 1C5PA 1C1PA 3SU0A 3HKIB 1PPBH 1SGEE 3ATLA 1QL9A 4UE7H 4B2BA 1N1LA 3SGAE 1Q3XA 1HJ8A 1BCUH 3WWFA 2TGAA 1CSOE 4TT3D 3GDUA 1Z7KA 1THRH 4R0IA 2ZU5A 4Y11E 3FAOA 5C0TA 1MTVA 3TPIZ 4UONA 2XW9A 6CHAB 1LPKB 4X0WU 3TJOA 3LOXA 1CT4E 4Q7ZA 3C27B 1TMBH 3SGQE 1CHOF 1TLDA 2BY5X 2GGVB 1MTNB 3T62A 2VIWA 4BANB 5GIBA 5G4BA 1P06A 3UQVA 2ZEBA 2GMTC 4E06H 2LELA 3TVJB 1DWBH 1MKWK 3OFND 2ZHWH 4DY7B 1QBOA 3SUDA 4HTCH 1FY5A 1C2HA 1S6FA 2ZGHA 3BTFE 3CNRA 2BDBA 3SI3H 1Z71A 2P3TB 5GJ4B 2VIQA 3MI4A 2O8WA 2RA3A 1GI9B 3M5OA 1C4U2 4ABBA 1O2NA 2VGCC 1KDQA 1VGCB 2V3HH 3VB6A 3LIWA 1A0HB 2XCNA 4AFQA 5ETXA 4ABGA 1QQ4A 2Z9IA 5FPTA 3SUEA 4DIIH 2BHGA 4QT8C 4ABFA 4YT7H 3H5CB 3T2NA 1NRNH 2W26A 3GDSA 1HXEH 1O5CB 2AGEX 5DG6A 4F48B 1L2EA 4AGKA 1HAXB 2EI6A 3M3VA 3SU5A 3FP8E 2CK3D 3MH5A 2LP6A 4JMYA 3SJ8A 3RXLA 2VWMA 5T6GA 3DFJA 2V6NA 4ZAEA 1UVUH 5ESTE 1O2ZA 3TLOA 1TQ7B 2XYAA 2VVUA 3ATWA 5EQRA 2ZG0H 2V3MA 1O2RA 1P01A 1BHXF 1YYY1 2HLDD 2G8TA 3TJVA 1OX1A 5GXPA 2YMSB 5JYIA 2ZFFH 4LZ1H 4LXBH 5C2ZA 3F9GA 2BXTH 3DSPA 2BB4A 2D26C 4B2CA 4MPUA 4VGCC 1AWHB 4X6OA 4Y8XA 5JBCS 2WZQA 3T5FH 4WMFA 2WPJS 5HKKD 1Z8JB 1UVOA 1GBFA 3LT3A 1GBDA 2C3SA 1BUIA 4XBBA 5FBEA 2GT8A 3M35A 1FPHH 3F9EA 4YOGA 2BOKA 5HGGA 3A7ZA 1FZZA 4ZKNU 4ESTE 3VEQB 3AAUA 1NESE 1EFRD 1ELDE 4ZHLU 1SGIB 2PTCE 5EQSA 1TRNA 1GCTB 1C2MA 1EP5A 3U69H 4X2VA 1AB9B 3LC3A 2AS9A 4BAMB 1TX8A 1W2KH 4ZCNA 1KTSB 2BX3A 2FS8A 1BOQA 1Y3VA 3A7TA 3FP7E 4J1YA 4O3UA 3MTYA 4JZDH 2LNCA 4Q80A 1BTUA 1YPHE 3E3TA 8KME2 4CREA 4B76A 4X1RU 3BG8A 2C90B 3BEFB 1ACBE 4RKJB 1F0TA 3V13A 2ZO3H 2C8ZB 4B74A 4O97A 1Z6EA 2OQUA 2LPRA 3RXHA 3VGCB 2ZP0H 2B9LA 2PR3A 1IQFA 4MTBA 1NZQH 1L1GA 1S5SA 1PPCE 3LJOA 4KGAA 2PWXA 3RXOA 2WUCA 2P8OB 3QUMP 1IQEA 1SQOA 4YO9A 1ZRBA 1PYTD 2FWWA 3H7TA 2VVCA 2SGQE 3E6PH 2FOFA 1AN1E 2W7UA 1GBJA 1G30B 4MDSA 5KECA 4Y6DA 2TGTA 3SHAH 2FLBH 1MTWA 1RXPA 1HXFH 4J2YB 1WSSH 4U2WA 1UTJA 5T3HA 2KR7A 2GP9B 2ZU3A 3LGUA 4CRFA 1LQDB 1RD3B 1KXBA 3SV7A 1YPHC 4INLA 3F3BA 3SU3A 5H4IB 1O3HA 1OYTH 4B2AA 1A61H 3K65B 3F1SB 3KQEA 2F43B 2FM2A 4FUHA 3RC4A 2R9PA 5JPMH 2BDGA 2D8WA 3LGWA 3T29A 1UK3A 1KSNA 1ORFA 4X1PU 1DSTA 1QURH 1HIAB 3UQOA 1DDJA 4ISNA 3RU4D 3B23B 2B8OH 5EW2H 3O8RA 3OX7U 5HM2A 2V35A 5C1UA 1GHWH 4H42U 1UTOA 2ZPRA 3SQHE 3A84A 4NSVA 1Y3UA 2FOEA 2GCHF 2Q6DA 3GY2A 1EZSC 1RTLA 2ZGJA 1TABE 4MPVA 3GCTG 1C1UH 1SGFG 4UDWH 3R0FA 3U1JB 2ZIQH 3MQKC 1IQNA 1F0RA 5FCRA 2ODYB 1CA0C 1QRZA 3MWIU 2GD4B 5EG4A 1UCYH 3MU8A 3PTBA 1CT0E 1LKBA 3M3TA 2CXVA 2TPIZ 3NUMA 1TGNA 1SGYE 2Z9JA 2ZQ2A 3ZZBA 3K2UA 1D3QB 3Q77A 3I29A 3RLWH 1GL1A 1XUIA 3IITA 1T8OA 3KCGH 3MH4A 2NU2E 4IS5A 5FPYA 2GCTC 4I8JA 1MABB 3ODFA 1YM0A 1J15A 2ZA5A 2GDDA 2PHBA 5LPEA 1XVMA 2CGAA 4D9RA 3F9HA 1OWEA 1QRXA 1H8HD 2AGIX 4AC9A 3M5MA 3E0NB 5F8ZA 1GBLA 1BMFD 5CHAC 4AFUA 1D6WA 2M5TA 3E1XB 1PPFE 3FANA 1GBTA 2XXLA 1SLVB 2H5DA 1A5IA 2HGTH 3UAIC 1HIAA 4X1QU 5A8ZA 2ZCHP 4HI3A 3SZNA 1FIZA 5C17A 4GVUA 4ABJA 2AMQA 1GJ6A 2AYWA 1W7GH 2Z3EA 1SHYA 1Z1JA 3RDZA 1SQRA 2PTNA 4RT1A 2PKAB 1A3EH 4K3JA 4CHAB 1NPMA 1P05A 5I46H 3GY4A 5FCKA 1C5ZB 2FS9A 1GI4A 1A46H 1RS0A 4UFDH 1CGHA 2BD3A 3AAVA 3PYHA 4A5TS 1RGQA 1QFKH 1EJNA 1C5TA 2F3CE 2XRCA 3MFJA 2FI3E 1EAXA 3CENA 3MU0A 4NIYA 4B1TA 1QZ8A 1JWTA 5DP3A 5B6OA 2W3IA 1G3CA 5DP6A 1C2FA 2BM2A 1SGPE 1C2JA 1W0YH 3L6PA 1O31A 3A8AA 3T25A 1T32A 1XVOA 1ZSJA 1ELFA 9ESTA 2CF8H 2FODA 3S7KB 1ELVA 2AMDA 1IHTH 1RTKA 2QC2A 4NWKA 1T31A 3RXUA 2ZHFH 1O2UA 3AW1A 2EC9H 1EZUC 4NA9H 1XUKA 4IN1A 8LPRA 1MKXH 2I6QA 2ZI2H 1ZMJA 1ZMNA 3H7OA 1IHSH 3EDXB 4ZHMU 2RFKC 3F2FA 2R3YA 5TCAA 3EA9A 4IMQA 4AX9H 4ZMAH 4BNRA 1G2MA 4ASHA 3PWCA 2WPIS 2A31A 3ZZ6A 3KQCA 4HG6A 1MZAA 3ELAH 1FN6A 4NWLA 3MU1A 7ESTE 1WQVH 2FIRH 1B0EA 4ZXYH 1MCVA 2NU1E 4I7YH 4NZQA 4U32A 3PB1E 4WXIA 3SNAA 5T6FA 2G4UA 3MH7A 1DM4B 1QTFA 1SB1H 1VJ9U 1E0FD 2Y6TA 1J17T 1HDTH 3A8DA 4NFEA 2PKAA 3PMAB 1NRQH 1H9IE 3FO8D 1VR1H 1ANDA 1WU1A 1P2OA 2ZHDA 1V6DA 1P04A 1F2SE 2J4IA 3A7WA 5E8EH 3P8OA 3F2HA 2QN5T 3U8OH 3MNXA 4RI0A 1AIXH 2J95A 2PUQH 5E0GA 1ABJH 1GJBB 3VB3A 1ETTH 2OP9A 1AUTC 1WQSA 2FOHA 1O3EA 1Z8RA 4KKDA 4B75A 8GCHG 1MQ6A 3KHVA 3OYPA 2ZWLH 5EXMA 1XUGA 3RM2H 3RXJA 3O8DA 1ESAA 2G5NA 1V2JT 2OLGA 4Q2KA 1O2JA 2DUCA 3TJNA 1NFYA 1D4PB 1PQAA 1IQIA 1TNJA 2HALA 3TJUA 1HBTH 1B0FA 1GGDB 2Z94A 3ZVAA 2BDAA
chains in the Genus database with same CATH topology
1ZHRA 2TRMA 2FOGA 1YPMH 3UWIA 2H2ZA 1YCPM 3A7YA 4NZLA 1GVZA 1PYTC 3AASA 3BTHE 1KXDA 1LVBA 2SFAA 1QGFA 3SU2A 5GWZA 2BDHA 1T4UH 1P57B 1UVPA 3RXSA 1GI3A 5C5NA 3Q3YA 4XSKU 1ELTA 3HATH 3SNDA 3M7UA 1W12U 4DOQA 1A0JA 3ZYEA 3WY8A 3TIUA 2XNIA 3HGNA 2GTBA 3TH3H 1GJCB 4Y0YE 2GZ8A 1V2NT 4WY3A 3MO3A 1FXYA 1BIOA 5GPIB 1SGRE 3RXMA 3MH6A 3P70B 4DIHH 2V3OH 3K9XB 3PO1C 1P11E 1B5GH 3MMGA 1GBKA 1VCQA 2GV6A 3SQEE 1KY9A 1U6QA 1NS3A 1AHTH 1ZTJA 2F9PA 3KN2A 4CBNA 4IN2A 5F8TA 1DPOA 3RXEA 1HAPH 4A1TA 3URDA 1J16A 3ZV8A 3GCHC 3SJOA 1W7XH 7KMEH 2O8LA 5C1XA 4X6MA 1INCA 5DGJA 1SLUB 4F4OC 3LDXH 1TBZH 1GBEA 4D8NA 4UD9H 2G4TA 3Q76A 1K22H 1BTWA 1O2KA 1ZPZA 3UIRA 3KIDU 2UWPA 1TNHA 3L3TA 1DXWA 4I31A 1SI5H 4YLQH 1EQ9A 3GISB 4ZH8A 4NIWA 3UPEA 2XC5A 3BG4B 1DS2E 1UVSH 3LGYA 5EPNA 1C5NH 1C2LA 1C5VA 1V2RT 3A8CA 3BTTE 3NXPA 1GJ9B 2A5KA 1EOLA 1O2OA 1HUTH 2FTMA 3E8LA 5EU8A 1QRWA 3P8FA 4X2YA 2A2QH 5ESBA 1P9UA 1S0QA 2ZFRH 4AN7A 1MKWH 1SGDE 1GBMA 1VITF 1OXGA 1DT2A 3M61U 2ZCKP 1CT2E 3F6UH 2F9OA 3RLYH 4AG2A 1KXEA 1NFUA 2A7JA 1BMAA 3PTNA 1C1WH 1JOUB 4D7FA 1F5RA 1AVGH 1TQ0B 3AVZA 5GCHG 1EXFA 2XBXA 3I78A 2JH5D 4WH6A 1QA7A 1WTHD 3D23A 4MNVA 3GYLB 1S0RA 1FY4A 4I8HA 2XBWA 4K1TA 4Y76A 2ANWA 4XOJA 3BTEE 1O3JA 1TNIA 1CU1A 1PQ5A 1TA2A 4B71A 2OBOA 1G3BA 2PKSC 2BYAX 3U98H 2G81E 5CE1A 2H6MA 4FUFA 1UTLM 5EGMA 2ZCLP 3KL6A 1P2QA 3GY8A 1X7AC 2ZDLA 1SLWB 1A2CH 3ITIA 1C5SA 4HFPB 3CS7A 2Z6BD 1N6YA 2W5EA 4GLYA 1S6HA 2BZ6H 1HJAC 1S84A 4JZFH 1A1RA 2VWOA 1C4Y2 3HK3B 1TNGA 2G00A 2F9UA 4K2YA 1QB6A 5LPFA 3RUOA 3ZZCA 1AVWA 3QTOH 5FXLA 2I6SA 1ELEE 3ATIA 4TPYA 3KNXA 5EXLA 1P03A 1ETRH 2PGQB 1VITH 3FP6E 3SUGA 3KEEA 1KLJH 4IMZA 1IQHA 3QX5H 2P3FH 3QLPH 1C5MD 1TNLA 1T8MA 2J92A 1P02A 2VNTA 4NIXA 1UCYE 1GL0E 5A0CA 2FYRA 1C1RA 1DFPA 4UFEH 1O36A 1YF4A 1ZHMA 5A8YA 2CV3A 2JH0D 2QCYA 4FUEA 5EOKA 1N8OB 2R2MB 2PGBB 2RA0A 4ZKOU 1ZMLA 4Y0ZE 1GMDF 1LKAA 2FLRH 4I33A 2OD3B 3ZZAA 4A7IB 2W3KA 5C20A 3RXIA 1OP8A 3BTGE 1NFWA 4CRGA 2JH6D 1L1NA 5HXFA 2EEKA 2C4FH 4Y7AA 2HPPH 3QGJA 1CBWC 8GCHF 1FNIA 3VXEH 1V2OT 1UJ1A 4FUCA 4GAWA 3ZV9A 1QCPA 3RXCA 4GCHF 4ISLA 4WVPE 2CHAB 2F9NA 2BOHB 1A5HA 1GI1A 2AFQB 1BQYA 2FPZA 5E0JA 1J14A 3TH4H 2ZFTA 3SW2B 2ZTXA 4A92A 3M7QA 3A85A 3S0NA 1RIWB 1AQ7A 4FU8A 1DWCH 5DP8A 4NSYA 1V3XA 1C1OA 2FOBA 3SHCH 1PJPA 2ODQA 1QL8A 3F9FA 1FDPA 4DJZB 1OYQA 4THNH 1BTXA 4TWYA 1DY8A 1V2WT 4HGCA 1YLCA 2STAE 2XC4A 1GJ8B 1NY22 1HV7A 2IJOB 1P12E 3GICB 3ZZ3A 5JBBS 4X2WA 3BTME 2ZHEH 4OS7A 1HJ9A 3LGTA 1AZZA 1HGTH 4A1XA 2ANKH 2F83A 3EA7A 3LJJA 4GHTA 2NU0E 1LVYA 5E0HA 1O2WA 1J9CH 4CRDA 1ABIH 3BTQE 1IAUA 1DWDH 2VIOA 1O3MA 1Q2WA 2BX4A 3UREA 1DWEH 2DE8A 3T26A 2WINI 1BDAA 1O3CA 2JETB 1FY8E 1VJAU 5T6DA 2CN0H 1ZTKA 5A09A 3SV9A 2GV7A 1LCYA 3BSQA 2HNTE 1O38A 5A0BA 5HM9A 5SGAE 2A5AA 3VB5A 1SLXB 1O2VA 3A7XA 5IYTA 5HYOA 1Y3XA 2Z9GA 1GMCF 1TOMH 2G52A 5DK1A 3UY9A 2UUJB 3RP2A 1DE7H 1FLEE 3BN9A 2A4GA 5AFZH 4MNXA 2P93A 3I77A 2QGRA 4R8TB 1O5BB 1EP6A 2QF0A 2ODPA 4YZUA 3P8NA 2P16A 1SC8U 2O8MA 3GCOA 2ZGCA 2BY7X 3N7OA 1MD8A 1ZTLA 1LO6A 2BY9X 2BLOA 6CHAC 1KLTA 2BVXH 1G36A 1DOJA 2F91A 1P8VC 1CE5A 1F5LA 2UUYA 4BAHB 1JIRA 1SFIA 1AVXA 1MTNC 2H9TH 2CMYA 3P92A 3ZVCA 1O0DH 5FBIA 1P9SA 1V2QT 4DT7B 4O03A 2HNTC 4X8VH 1SGNE 1QB1A 5JBTA 1HAVB 3BV9B 1YCPK 1Y3YA 4MPXA 1C5LH 1EPTB 1XUHA 2SGAA 1LMWB 3HGPA 5EPYA 4CH8B 2SGEE 1FY1A 2K1QA 4Y7BA 1V2KT 2SNVA 1MQ5A 3M5NA 5GCHF 2BLWA 1EOJA 1O2YA 1ANCA 3OY5U 1PPZA 1VGCC 3QK1A 3M3SA 3UUZA 1BBRE 1AFQB 2BD4A 5FHTA 5DP9A 2WYGA 4OS2A 1SHHB 2ZFSA 1TA6A 4JCNA 2G51A 3GY6A 3QZRA 1AKSB 1O3NA 2FEQH 1KTTB 3TU7H 1YPLH 3A7VA 1SGTA 2XTTB 4AZ2B 4XBCA 3SNEA 1GI8B 3DHKH 5JB9S 2RCEA 2Z9LA 4H6SB 1OS8A 4BAOB 1GHBG 3MYWA 1PFXC 1EB2A 4I8KA 1NTPA 3Q3KA 1K28D 2C8XB 1K1PA 1BMNH 4IGDA 1YLDA 2HNTF 1E34B 5EXNA 5DP5A 4CRCA 1V2VT 1TGCA 1GJDB 2G5VA 4CRAA 1BJVA 1UCYK 1BMMH 2XBYA 3NKKA 3RM0H 1RRKA 5E2PA 1V2MT 1UK2A 1QY6A 2Y5FA 1ANBA 1GG6B 4KELA 1SGFA 3A89A 5LPRA 2ZDVH 3STJA 3JZ1B 1O2GH 1KXAA 4I8GA 3PLBA 1UTKA 4YOJA 1TWXB 1HAVA 1Y5BT 5AHGH 2R3UA 5ABWA 1EPTA 1FQ3A 1NN6A 4AYVB 1HLTH 1FI8A 1GCTC 4AFZA 1BT7A 1C2DA 2OBQA 3RXGA 1MTUA 1KXCA 1SQAA 1AB9C 4FU7A 4WMEA 2OUAA 1O3KA 3PMHB 1E35B 3SV6A 1O2IA 4XDEA 3RXVA 2QXGA 3GCNA 2YNAA 4RKOB 1GPZA 1TRMA 2ZNKH 1O3IA 3NK8A 2FOAA 3NCLA 1PQ7A 4WMDA 2Z3DA 1LPGB 2PUXB 3VGCC 3EYDA 1BITA 2HLCA 1MBMA 5C3NA 4X8SH 1AKSA 1O3FA 1UMAH 3RXKA 1DLKB 3D49H 3O8CA 1WCZA 2QAAA 3SI4H 1G3EA 4CBOA 1SOZA 1LHDH 3BTWE 2ZFPH 3EAJA 2P8OC 1P2JA 1EZXC 3ZZ8A 1F0SA 3STIA 3LH3A 2ILNA 1CHGA 3O8BA 2A5IA 1Y5UT 1IQGA 2H5CA 2WPLS 1O2QA 1O3DA 1D6RA 5EODA 1TE0A 1C5OH 4MLFB 4Z0KA 1JMOH 4DCDA 1B7XB 1MAXA 1RTFB 5TJXA 3BIVH 5DP4A 3QO6A 4MG3A 1UHBB 4INHA 1SPJA 1BHXB 1DUAA 1EUFA 1G32B 1MAYA 1FONA 4IC6A 2GMTB 3U1IB 2B0FA 4OS5A 4MQAA 5F03A 1GJ7B 4K8BA 5FX5A 1TGSZ 4Z6AH 5BRRE 2BTCE 1EZQA 3FVFB 4E7NA 4PROA 1TPPA 2GZ9A 1GJ4H 1HJAB 1DSUA 1TBQH 4GHQA 1NRRH 5HMAA 4M7GA 4TY7A 2EI8A 3OY6U 3S9AA 3UTUH 1HYLA 2VGCB 3TH2H 2OCVB 1C5UA 1SG8B 3RXAA 4AG1A 4A6LA 1ZGVA 4DW2U 3L33A 1F7ZA 1ARCA 2WUBA 2FZZA 3ZVGA 1G37A 1GI6A 1N6XA 3A81A 3OSYA 4YOIA 4OS1A 3UFAA 2F9BH 1QB9A 4LOYH 4OGXA 3ZZ7A 4AB9A 2ZFQH 1AFEH 2QYIA 3SUFA 2VJ1A 4Q7YA 3TGIE 1MMJN 2SGPE 3S9CA 1TMTH 3SNCA 2R0KA 2SGDE 1SGQE 1AO5A 1YPEH 1HAZB 1NT1A 1W3CA 1E36B 2YOLA 1EATA 1TYNA 2FOMB 1TFXA 2A32A 1DXPA 4AB8A 4MPWA 4ZKSU 2JKHA 2C93B 3QTVH 2OQ5A 2NWNA 4CR9A 1FUJA 3ZZDA 1O37A 1P09A 4VGCB 1C2KA 1DUEA 1V2LT 4ZXXH 1BTHH 1O2MA 3A8BA 1KXFA 1UHBA 1LVMA 5DO4H 1AMHA 1DANH 3UOPA 3GCTF 4CR5A 3E16B 2SNWA 2RG3A 3W94A 9LPRA 1RFNA 1GHAG 3CS0A 1BBRK 3FZZA 1GBIA 3QZQA 4ABHA 4JK6A 2AGGX 1XXDA 1ZR0A 3BEUA 1GWAA 2FTLE 1EKBB 1C5RA 1VCPA 3MHWU 1A3BH 2BD5A 3DA9B 1ZPBA 2CF9H 1O2PA 4X8UH 4CRBA 5EW1H 1LHEH 3PMJA 5AVDA 2UWLA 2VB0A 2P95A 1XM1A 1GDQA 4YESB 4NA7A 2UWOA 3LU9B 2BDCA 1OSSA 3UNSA 2AMPA 4CHAC 4WWYA 1K1LA 2DE9A 2FDAA 3GY5A 1PQ8A 4U30A 1LPZB 3P17H 1S81A 3DT0H 5IDKA 1XKBC 3LGVA 2BQWB 4F49A 2XWBI 1W11U 3V0XA 4H6TA 1UTMA 3UNQA 1GI5A 4TY6A 3TGKE 3ZVBA 4ABAA 3SJ9A 3SOSA 1YPJH 1BJUA 1FMGA 3SV2H 4JZ1A 4Y71A 4ZUHA 1MU6B 4TYDA 4D7GA 3TK9A 1H1BA 1HAIH 3TNTA 3RMMH 1AI8H 2ZDMA 3BEIB 2GCHG 1HAOH 3KF2A 1IOEA 1O39A 3KQBA 3PLKA 2A7HA 4YM9A 3VB4A 2O8UA 2IOTA 1VCWA 3MNSA 5GDSH 2ZGXH 4D9QA 2BD9A 6GCHG 1O30A 2O8TA 2EA3A 2BQ6B 5BPEA 4K69A 1W10U 1OOKB 2RDLA 3HK6B 1ESTA 1IQKA 2TGDA 1O3GA 2Y5GA 2XBVA 3PV4A 3ZYDA 4IC5A 2BZAA 1E37B 4NGAH 4ABIA 1GI0A 1P2KA 1WV7H 3TNSA 2D2DA 3DD2H 3QGNB 1O3AA 3ATKA 3V3MA 1A7SA 3U8TH 1ARBA 1GDNA 1THPB 1DY9A 1GVKB 2ZZUH 2A4RA 1O5AB 3F68H 2UUFB 3ZZ4A 2J94A 2PLXA 4K1SA 2ZU2A 1MCTA 4XFQA 1TAWA 1V2TT 2HVXA 2BVRH 1C2GA 1FIWA 1Y3WA 4YT6H 2FESH 3A80A 1CA0B 3DUXH 1S83A 1F92A 2VWLA 1TX6A 1LDTT 4AYYB 1GJAB 1XXFA 4FUIA 2A7CA 2WV4A 2ZDKA 3PM3A 2NU4E 1HFDA 2C8YB 3LONA 2Y82A 2SGFE 1EJMA 1T7CA 1XMNB 2ZC9H 1KYNA 3CP7A 3M7TA 3FZDA 2GCTB 1TPOA 1G9IE 1GGDC 2BDYA 3TK5A 2HPQH 1QJ7B 1HAGE 1HB0B 1AZ8A 3ZVDA 3TK6A 1C1QA 5CHAB 1BRCE 2A45B 2Y7XA 4ZHAA 3RMLH 3SJKA 1ANEA 3VXFH 1AD8H 2ZPQA 1O2HA 1TX7A 1J8AA 2FI4E 1OWJA 1YBWA 3A88A 3RC6A 1MH0A 2BD2A 3LC5A 2ZTYA 2ZDAH 1GCDA 1IQMA 1O3PB 3HKJB 4B73A 4FVDA 2GDEH 3R3GB 1F0UA 1P2MA 4KTUA 4Q7XA 1K1OA 2FXRA 1O3OA 1PPGE 2ZECA 4BXSA 1W8BH 4INKA 4K1EA 2FX6A 1C5QA 1CQQA 2BY8X 5C5OA 4DURA 4AFSA 1NU7B 5FPSA 3S9BA 2VIDA 1ELCA 4E05H 1OPHB 1HAHH 2IPHA 1TNKA 3LKWA 1EAWA 1GHZA 3D62A 1K1NA 1TOCB 1BTYA 1LTOA 1TRYA 1EJAA 2VIPA 6LPRA 1O5EH 2B5TB 3SU1A 1OP0A 2TGPZ 1TPSA 1SL3A 5DPAA 2QA9E 2OXSA 1YPGH 1O2SA 2PV9B 2BLQA 2QV1A 3UWJH 1CVWH 1T4VH 1NROH 2ALPA 1HPGA 3KQDA 4K60A 4O9VA 4TPIZ 4I8LA 1G3DA 4WJG2 1JRTA 1A4WH 5J4SA 1O2TA 3MNCA 1PPHE 4GPGA 4NIVA 2P3UB 4U01A 3S7HB 3SO3A 3ZZ9A 3MO9A 2Z7FE 1ZJKA 1THSH 2XCFA 3GY3A 1P2IA 1O2LA 3BG4C 1K2I1 1BA8B 1MUEB 1Z1IA 2ZF0H 1GHAF 1ZPCA 2P59A 4JK5A 4OGYA 2XWAA 1IQLA 1GMHG 1UTNA 1JBUH 1TALA 1FJSA 2Y7ZA 4LZ4B 4GUXA 8ESTE 4NCYA 4NA8A 1ZSLA 2Q6FA 1GDUA 3V7TA 1FV9A 4OS4A 1SOTA 2WPMS 3IWMA 5I25A 2IN2A 2TIOA 3A82A 1HNEE 1Y8TA 2EI7A 4NFFA 1YCPH 2FMJA 3ODDA 5DKMA 7GCHG