1C2LA

Recruiting zinc to mediate potent, specific inhibition of serine proteases
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Design of potent selective zinc-mediated serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c2lA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c2lA02
5CHAB 4B2AA 5DP9A 5I25A 4FVDA 1ZSKA 1THSH 2ZDAH 1G32B 3KIDU 2O9QA 5E2OA 2C3SA 1UTQA 3SJIA 1GJBB 2A0QB 3SW2B 1DITH 3SO3A 1WQSA 1F92A 3SU1A 1GMDF 3SHAH 2UUKB 1HRTH 1KXEA 1CBWB 2GZ8A 3M3VA 2JH5D 1AI8H 1GCTC 1SVPA 4CREA 3DD2H 3FP7E 3MH4A 3IG6B 1NS3A 2PSXA 1O3CA 1ZRBA 2AGGX 2BDYA 3HATH 3N7OA 1IQIA 1NRNH 3BTDE 1NPMA 2BD4A 1NU7B 3E3TA 2OBQA 2ZKSA 1B0EA 1QIXB 1SGTA 4A1TA 1LKBA 4D9RA 1QL7A 1UJ1A 4UFFH 5DP5A 1P8VC 3VEQB 1TRNA 1XM1A 1N8OC 2JH0D 5GWZA 3UUZA 2VU8E 3U98H 3QLPH 1NZQH 1Z6EA 4WMDA 1U6QA 1SFIA 3A8AA 1BMMH 5EQRA 1AB9C 3QGNB 1XUKA 1LMWB 2OBOA 1H4WA 3SUEA 1T7CA 1ESBA 2FOMB 2A2QH 2FTLE 1THRH 1DDJA 3A88A 2C8ZB 5DO4H 3ZZBA 1O2XA 4ASHA 1SBWA 1Y8TA 3D62A 5EW2H 3GISB 2O8MA 1C2JA 2J9NA 2ZNKH 2P8OB 2PUXB 2PKSC 1LKAA 3A84A 4WH6A 1A0HB 1FY4A 2HWLB 4B75A 1O3AA 4OS6A 1GGDB 3BIUH 3O8BA 1AWFH 4ZKOU 4X6MA 1EPTC 2XCNA 4XFQA 3KQBA 2W7UA 5EXMA 1AY6H 3RP2A 4B2BA 1P9UA 5J4SA 3RMNH 3F9HA 1SC8U 3T62A 1G3BA 2WV4A 3RXEA 2BLWA 2F9NA 1K22H 3A80A 3GDSA 1V2LT 5FCRA 2FI3E 1GBDA 1XVOA 3A8BA 1TPAE 2ANYA 3V13A 1PPEE 4NCYA 3SJOA 2HALA 3D65E 1YM0A 3FFGA 1J9CH 1ETRH 2QXIA 3LGTA 4INKA 5EGMA 1TPPA 3RXHA 1V2TT 1PQ7A 1O2NA 1TX6A 3KEEA 2VIQA 1J17T 3U8RH 1TYNA 1ELGA 3M37A 4Z6AH 5C1UA 2A1DB 1V2RT 3C1KA 1AKSA 3SNEA 5J4QA 2FLRH 3OU0A 4XSKU 3SZNA 1PPFE 5FPTA 4GHTA 2IPHA 1ID5H 5DP4A 3LDXH 1SPJA 3M7UA 4CHAC 3U1IB 3DFLA 1XUJA 1DT2A 1QURH 2VB0A 2J34A 4X0WU 5ESTE 1IQGA 1CGHA 2UWOA 2DE8A 1PPZA 3ODFA 2AFQB 3LGUA 1GVLA 1S82A 1YC0A 1H8DH 1UVTH 3ATLA 1UTOA 3O8CA 2ESTE 3PMAB 2CGAA 2O8WA 4U30A 1BBRE 1UVSH 1EP5A 2XCFA 3BG8A 5EG4A 1SGYE 3M3SA 3TK9A 1GJCB 3VB4A 5JBAS 3SJ8A 1H1BA 4AFSA 1QBNA 3E16B 1XXDA 1YP9A 5A0AE 3SJKA 2WPJS 4ISOA 5GCHG 1FY8E 1SB1H 1EP6A 2Z94A 3FZDA 4ESTE 1ZGIA 2O8UA 4MNYA 1HNEE 1Q2WA 1NO9H 1PQAA 2XWBI 7GCHG 1GDQA 2G8TA 5GDSH 2ZGHA 1ZHPA 3RC4A 3FANA 3RXKA 1A3BH 1LVBA 1C1VH 4LXBH 3R3GB 4GCHG 3MH5A 4HI3A 3ZV9A 2FS9A 3A7XA 4VGCB 2HVXA 4NIWA 3T29A 1Y3XA 1O34A 1AFQC 2G81E 1NRPH 1P05A 2EI8A 3URCA 1WUNH 1NC6A 2ODQA 1TQ0B 6CHAB 3RMMH 3EQ0H 1P2KA 1SOTA 1GVZA 5LH8A 1FIZA 1C5LH 1NN6A 4X6OA 1Z8IB 3GDVA 2RG3A 3GCHC 4TYDA 1QCPA 3M7TA 1O2RA 2PR3A 1HJ9A 2FOCA 4D9QA 3SU0A 1YKTA 5IDKA 1SR5C 5HXFA 3A7WA 1E36B 4ABIA 1ESTA 5ETXA 2FYRA 3LT3A 1O3LA 1Z7KA 2AERH 3CENA 2RCEA 3RMOH 2BOHB 2BLVA 3HKIB 1C1NA 3BV9B 3P8FA 2NU3E 1HJAB 1OWJA 3ZZ8A 3U8OH 1GJ9B 3TNTA 6LPRA 1HAVB 4ABAA 1C5NH 1P9SA 4MPXA 4A92A 1VCPA 1GHBG 1EQ9A 3K6YA 4IC5A 1QBVH 1DPOA 3EDXB 1C5VA 7LPRA 3GY8A 3MMGA 1F7ZA 2Y81A 5LPFA 1C5SA 1F0TA 1KXFA 5T6DA 5GIBA 3ZZ7A 1GJ8B 4X8SH 1PQ8A 2W3IA 1F5LA 2JETC 4DJZB 1F0RA 1QB1A 2VGCC 1GI5A 4HZHA 5C5OA 1AWHB 1KYNA 4MNXA 4ZKNU 3BIVH 1SGDE 4YOGA 4ABDA 4Y8ZA 1DLKB 3KN2A 2VIPA 1DWEH 4XBBA 3LH1A 1EAWA 2OUAA 4SGBE 3HGPA 3RLYH 4DURA 1V2PT 4IC6A 2OP9A 1BCUH 5FBEA 1NRQH 1TOCB 2A4RA 2FMJA 1MKXK 3MU1A 4AG2A 2H2ZA 2BXTH 2Z7FE 1SGCA 4RSPA 1TONA 3QDZB 1ABJH 1DX5M 2AH4X 3FVFB 3PMHB 3RXSA 1HGTH 3AW0A 1DXWA 2ZF0H 4GVUA 1MTWA 2FLBH 3CS7A 3TNSA 3E8LA 1HAVA 1O30A 1IQMA 1RIWC 2OLGA 1Z8JB 2LPRA 3KGPA 1C5OH 1E37B 1UTMA 2J38A 2CXVA 1GHAF 2JKHA 1EOLA 1DUEA 2HRVA 2P94A 2ZHEH 3RLWH 3EGKH 4AORA 2ZFQH 5LPRA 3S7HB 1A4WH 4OS1A 1P2OA 1MKXH 1ZYOA 3K2UA 1O5AB 1V6DA 1FUJA 3AW1A 1ZPCA 1JMOH 2VWLA 5DPAA 2SGQE 5FBIA 1A5HA 3P8GA 2Q6GA 1FDPA 4YT7H 1O37A 3VB6A 1V2MT 4D76A 4K60A 3RXIA 1O3JA 4CRBA 3Q3YA 1SFQB 1G3DA 4ZMAH 2BYAX 1TOMH 4XOJA 2ASUB 2Y5HA 1VR1H 1WU1A 1P3EA 5A8YA 2BDGA 1WTHD 2FXRA 5JB8S 2TGAA 1TGCA 1ZHRA 4IGDA 2GCTC 1W14U 2VIDA 1K1MA 2PKAB 1JXPA 1HJ8A 2AEIH 1LTOA 2WUBA 4Y76A 1AVGH 4O3TA 1P2NA 3T26A 3RXQA 1NM6A 5GXPA 1UO6A 1FZZA 1GMHG 2A5IA 2BY7X 2FI5E 2H1UA 3QK1A 4DVAU 1O2LA 1K9OE 4FUGA 1V3XA 1BRAA 2SGAA 3LKWA 1J15A 1DOJA 2STAE 4AX9H 5TCAA 4CRFA 1K1OA 5T3HA 1EB2A 2VH6A 1O3BA 3NUMA 1UK3A 4AGJA 5F6MA 1FPHH 1IAUA 2VINA 4O9VA 1VJ9U 2ZIQH 1EPTB 3F9FA 2IN2A 3BG4B 1C1QA 1T8NA 2FP7B 5A0BA 1HAYB 3T28A 1BBRK 1AU8A 1DSTA 1PPCE 1WYKA 4JZFH 1P12E 2GZ9A 4CR5A 1QJ6B 3HGNA 3GCNA 4MDSA 4NA8A 1ZMNA 2TRMA 2FS8A 1RTFB 1BUIA 3U9AH 5C67A 4DT7B 2ZPQA 1GJ4H 1A1RA 3ATMA 1RJXB 1BTZA 2QF0A 1VITF 2ULLA 1AO5A 2P3UB 3UREA 1Z8RA 3SI4H 3TK5A 4BNRA 1RD3B 3LC5A 4B76A 1P2JA 1A0JA 4NFFA 1Y3YA 2O8TA 2PKAA 2ZU2A 3EE0B 3KF2A 1TBRH 1O5BB 3H5CB 1BTPA 1BQYA 4ZROA 3M5LA 1GJAB 4GSOA 1BBRH 3ATWA 3SU2A 1ANCA 1W11U 1UTNA 3BF6H 1TABE 4ABGA 2A4QA 3QGJA 3RXRA 4X8TH 4O3UA 1C1OA 1YPJH 1SGFA 1NY22 1BHXB 3M5MA 1GBAA 1Y5UT 4I31A 2ZECA 3RMLH 1KXAA 2SGPE 3GICB 5F8XA 1ETTH 2ZI2H 4Y6DA 2HNTE 2H9EH 3KCGH 1DUAA 1O2HA 1A7SA 1D3DB 3MO9A 5EXLA 1WSSH 3UIRA 2QA9E 9ESTA 1TMUH 4FUEA 2Z3DA 3A81A 1GG6C 1WCZA 1B7XB 1HAXB 1O2PA 1MAXA 1TNHA 3A82A 5EOKA 1MD7A 4AN7A 2WPLS 1BRCE 4M7GA 4MTBA 4Q7ZA 5G4BA 1YPMH 3QZRA 3M7QA 2ALPA 5AVDA 2XBVA 2ZFTA 5HMAA 4ZXYH 2J94A 2KAIA 1HYLA 1C2IA 1SSXA 3DUXH 3NKKA 1MKWK 3E90B 2Z9JA 3TJUA 1C1SA 4YLQH 2PV9B 2W26A 2CJIA 3ZVEA 1THPB 3P8OA 2F9VA 2XBXA 1EAIA 3QWCH 1PPBH 3RU4E 3SQEE 4ABFA 1MUEB 2NU1E 2FOEA 3PWCA 1OX1A 1HAIH 5GJ4B 4ZKRU 1J14A 1D9IA 2FIRH 2ZFPH 1GI2A 3A87A 3UY9A 1QQ4A 3M5OA 1B0FA 2GT8A 3GY7A 1O2GH 5TJXA 2XBYA 4X6NA 2FESH 1MBQA 2EA3A 3RXMA 1GBBA 4E7NA 1GMCG 2D8WA 3P92A 2GV7A 1HIAB 1J8AA 2J2UA 1IQFA 2R2MB 3SV6A 2GCHG 1Y3VA 4I8HA 4UE7H 1MCTA 4TY7A 2Z9KA 5EPNA 1MKWH 1EOJA 2WPKS 3SN8A 2BM2A 1FV9A 1HBTH 4MG3A 1RXPA 1OWKA 4ZHAA 1P06A 4UFDH 1AUTC 2XTTB 1O3EA 4GHQA 4FUJA 1O39A 2WPIS 4UFGH 2P16A 1ABIH 3LGWA 1WQVH 2K1QA 4X6PA 3E1XB 1K1PA 3RXCA 1GBKA 1OWHA 1GBJA 2WPHS 1ELFA 1ELVA 1QRZA 4UFEH 3K65B 2F9UA 1DS2E 1JIMA 3ZZ5A 3CS0A 7ESTE 2HNTF 1O3PB 3NZIA 1P57B 2AIQA 3MNCA 1O31A 2VNTA 8ESTE 3U8TH 1O2WA 1O2UA 2C4FH 1JIRA 3RC5A 2ZU5A 1G2LA 2PHBA 2XWAA 2ZGXH 4H4FA 2WPMS 3BTTE 3V7TA 2ZZUH 3ZVFA 2VIOA 1V2KT 3SBKA 1Q31A 1UHBB 4RN6A 5FHTA 1GJ7B 2B7DH 2VH0A 5JDUB 1SHHB 3E6PH 1DICA 3DA9B 3L33A 4YO9A 1GBHA 4AFQA 2ZWLH 3SUFA 2BOKA 1KSNA 3RXOA 3SV2H 1AGJA 1VITH 4HGCA 2BQ7B 4IMQA 3PWBA 4WWYA 4A1VA 3TITA 2WYGA 1HCGA 2FOHA 3TK6A 3VXEH 2R9PA 1D3PB 3RXDA 1TGSZ 1ZTKA 1N6XA 2H6MA 1OP0A 2ODYB 1D6WA 1SGNE 1O32A 1A3EH 4MNWA 4ABHA 5FXLA 2ZGCA 1D6RA 4MNVA 1P01A 2B9LA 1ZTLA 1CVWH 2R2WU 3P17H 2Y6TA 2ZQ2A 1CA0B 4TPIZ 2F83A 1CU1A 3RXUA 1A61H 3SU6A 1ELBA 1MH0A 2ZFFH 3DFJA 4R8TB 1BA8B 2FEQH 1TAWA 2TBSA 3ZYEA 4FUDA 1EJMA 2W7SA 1C2MA 1TNLA 1CA8B 2FYQA 4A7IB 4THNH 2GVFA 3PLPA 1PYTC 2Y80A 2Y7XA 1O2IA 2A45B 1TMTH 1YCPK 2EI6A 3KQCA 1W7GH 1GHYH 1P02A 3SGQE 1HPGA 3EYDA 1V2UT 2OTVA 3TPIZ 3UQVA 1W0YH 4NIVA 3UR9A 1O2TA 3UWJH 1G2MA 4BAQB 3PO1C 1ELEE 2TGPZ 5GCHF 1O5DH 3BEUA 4F4OC 1KXDA 2Y5FA 3TVJB 2HGTH 1Q3XA 1C2KA 4HTCH 1FQ3A 1H9HE 1KXCA 3RXAA 1FI8A 7GCHF 3ZVCA 1S6FA 2BY5X 3S9BA 1TNJA 1WOFA 2P93A 4I8JA 2BD5A 4GCHF 1GHXH 1P10A 4BAHB 2G4UA 3U1JB 1YCPH 1K1LA 1FONA 2CHAB 1HFDA 1D3QB 1V2NT 1IHTH 1W0ZU 4Y11E 2QY0B 4JZ1A 2ZCLP 3TLOA 1O3MA 1Y5BT 4Y0YE 3ZVAA 1CT0E 3T25A 1C1PA 2QCYA 1HXFH 1TNIA 1K28D 3GY2A 2PWXA 2H9TH 1Z1IA 1GI6A 3AASA 2Z9IA 1VJAU 1W10U 1X7AC 4I32A 5DJ7A 1HAZB 1YYY1 2BDAA 1IOEA 2AGIX 3ZZDA 4E7RG 2GGVB 1ZJKA 4Y8XA 1FPCH 2ZU1A 4TY6A 2A7JA 2UUYA 4AB8A 2NU4E 2V3HH 3RXBA 4F49A 3NK8A 3RXFA 4CH8B 3OY6U 3K6ZA 1C9TA 3D49H 1GHBF 2O8LA 1C5WB 1BMNH 1TBZH 1UVOA 1M9UA 2SGFE 2C8YB 2ILNA 5CHAC 1T8LA 4KTUA 4OGYA 1C9PA 1GBIA 4JZDH 1MAYA 4YM9A 3W95A 3OY5U 3ITIA 4UEHH 4BAMB 1UTLM 2Z3EA 4Z0KA 1V2ST 4JZEH 4YOIA 2ZPRA 1C2GA 4BANB 5C5NA 2ODPA 1KY9A 1MTNC 2Y5GA 3V12A 1GJDB 1UCYK 1TX7A 1CBWC 1AN1E 2A5AA 1E0FD 1MZAA 4ZKSU 3S0NA 3GY6A 3RXPA 2ZG0H 4XBDA 1VCWA 4JYUH 4BXWA 2P59A 1EATA 1QQUA 4NIYA 3RM0H 1LQEA 3LPRA 3RC6A 4TWWA 2YNBA 2ZU4A 4KTCA 1LCYA 1BB0B 1S81A 6GCHG 1C1RA 3TGIE 4KTSA 2QXHA 5IYTA 1IQLA 8KME2 2Q6DA 5AHGH 2OC8A 3ZVBA 4IMZA 1O3NA 1WBGB 3I77A 1GG6B 2XXLA 3JZ1B 1O2MA 1TIOA 2BD8A 3UOUA 2ZHWH 2GTBA 2OQ5A 1UCYH 4NZQA 4U01A 1C2LA 1IQNA 1P3CA 2AS9A 2F9OA 2QGRA 1SGFG 1BTXA 1O2OA 2CF9H 1XUIA 1RFNA 4JMYA 1SGIB 1C5YB 1TNKA 1S6HA 3FZZA 4I8GA 3PV4A 1SGEE 2ANWA 4I7YH 2PUQH 2ZO3H 5C1YA 2C8WB 3OX7U 3TJOA 1YBWA 4WXIA 1DM4B 3L6PA 1ELCA 5C20A 2M5TA 5A2MH 1QR3E 3STJA 4ZXXH 2R3YA 2P8OC 4OS5A 2AGEX 1T31A 1QRXA 4A6LA 1N6YA 3Q00A 5K7RA 4AG1A 1O3KA 3P6ZB 2XYAA 1TNGA 2OC7A 3H7OA 2ZDVH 5T6GA 3ZV8A 3O8RA 1GCTB 4GPGA 1LHEH 3ENSB 2OQUA 1DXPA 1FJSA 5DGJA 1JRSA 3VGCC 1RRKA 3ZZCA 1AVWA 4DGJA 1NFWA 3EAJA 1O0DH 1OP2A 1QL9A 2Z9LA 3AVZA 2BZ6H 3BTFE 3ZYDA 1G3EA 2JH6D 3A7VA 5K0HA 1SHYA 1YLCA 3UNQA 1CGIE 2AMDA 2FOAA 2Z3CA 3MHWU 4GUXA 4BTUB 4J2YB 3BTHE 4D7GA 4ZAEA 1NROH 4ISLA 3SV7A 1OKXA 3H7TA 1UMAH 3P95A 2ZPSA 2TGTA 3A86A 2F91A 1N8OB 1BIOA 1GMHF 2H5CA 4IN1A 2R0LA 4B74A 3A7TA 4FUCA 2ZC9H 1EXFA 3LGIA 3SOSA 3F9EA 2AIPA 1TB6H 5DP3A 3TH3H 1AB9B 3BN9A 3A8CA 1LQDB 4JZIA 2I6SA 1W13U 4INHA 2B5TB 3MU0A 4GAWA 1BMAA 1P03A 1KXBA 1YGCH 3RU4T 3GYMA 3F1SB 2BMGB 1OXGA 1LHCH 1UTPA 1A2CH 2XC0A 4ABBA 8GCHG 2SNWA 4Y79A 2GT7A 3VPKA 1LHGH 1AUJA 1GPZA 1ARBA 4I8LA 3Q77A 1O2KA 1YPLH 1UVPA 2W5EA 3MNXA 1FY5A 2QN5T 3MU5A 3SORA 1BRUP 5JBCS 4A1XA 2PKSB 3SQHE 3LJJA 3ELAH 2BX4A 2A4OA 1C1TA 4FUHA 4AFUA 1QB9A 3B23B 3RU4D 1EZXC 4X8UH 3MH7A 5LGOA 4ISIH 4JYVH 4Q7XA 4CBNA 6ESTA 1P2IA 1LHDH 2VWOA 3NXPA 1O3HA 1D3TB 1QJ7B 5E0JA 3T27A 1AIXH 2PLXA 3OTJE 4DY7B 3VFEA 3LIWA 3TH4H 3D23A 2VJ1A 5L30H 3AAUA 1GWAA 3GCTG 2HNTC 1TA2A 1ZLRA 2THFB 3KNXA 3SI3H 2AMPA 2ZDKA 4Y71A 1SGQE 1PFXC 1DWCH 1LVOA 5A8XA 1O5GH 1TLDA 1F0UA 1ZJDA 2CV3A 1DANH 1EAXA 3A85A 3PTBA 1FNIA 1P09A 3MTYA 1H9IE 4AYYB 1C5RA 1QBOA 1O5CB 1OYQA 4WY3A 4X2XA 1V2WT 3BSQA 4BTIB 3HK3B 5JYIA 2Y7ZA 1RTLA 1TGTA 1L1NA 3TJVA 2Y82A 1QL8A 1ELAA 1O2VA 1NRRH 2Q1JA 4TWYA 1GJ5H 5C1XA 3ATIA 4KP0A 2IOTA 2A5KA 4CRDA 4KELA 4CHAB 3GY3A 1HAOH 1QNJA 1Y59T 4NSYA 4WXVA 1TMBH 4IN2A 5DK1A 2BD2A 3FAOA 1IQHA 2BXUH 4D8NA 2YNAA 1D4PB 1K1IA 1W3CA 1EPTA 1GHWH 1HJAC 2XNIA 2HOBA 1GI7B 3UQOA 4SGAE 1L4ZA 3U69H 4H6TA 5H4IB 1EZSC 1FY3A 3T2NA 2J92A 3I78A 4X1NU 5A09A 3A7YA 2OC0A 8LPRA 2NWNA 1EKBB 3STIA 1AZ8A 3EA9A 1ZGVA 3BTWE 3EA8A 3LH3A 1OS8A 1CHOG 2H9HA 3KHVA 4ABEA 3Q3KA 2V35A 4FUFA 4BXSA 1QA0A 3M5NA 2D2DA 1AE5A 3SU3A 2Z6BD 4IS5A 2BD3A 1HDTH 1SLUB 1GMCF 1TGNA 2FODA 4NG9H 3ZZ9A 4IBLH 4K69A 2EC9H 2FWWA 2GCHF 1P2MA 2UUFB 1LHFH 2NU0E 4LZ4B 2BQWB 5AFZH 2G51A 4BTTB 1NTPA 1OWIA 2SFAA 1SQTA 5PTPA 1LVMA 1AFQB 1XUHA 2ZU3A 2ZCKP 2ZTXA 2GKVE 1UCYE 2ZTYA 1EB1H 5FPSA 4H6SB 1BTHH 3MFJA 2QF3A 4FUIA 4FUBA 2NU2E 1ZMJA 5JB9S 1FIWA 3A89A 3GCHB 1AFEH 4Y8YA 1EZUC 3BEIB 2BVSH 2BDCA 3A7ZA 1HXEH 1C4Y2 1O33A 1JRTA 5FCKA 1MZDA 2RA3A 4INLA 2ZHDA 2G00A 4WVPE 3UNRA 1K21H 1LPZB 2ZP0H 3I29A 3SUGA 1MTNB 2A7CA 3TIUA 1OWEA 1O3DA 1ELDE 1ARCA 1T4UH 5ABWA 3T5FH 1MU6B 1FXYA 1MTSA 1RS0A 3TJNA 1O5EH 4X8VH 1CHGA 5C2ZA 1V2JT 1GVKB 4K5ZA 1V2QT 1UVUH 3FP6E 1YPGH 2CF8H 1O36A 5FX5A 1J16A 4E05H 1YPEH 3LGVA 1O38A 2G5VA 1C2DA 3C27B 1S5SA 4NIXA 1O2SA 3S9CA 2SGEE 2BD9A 2JETB 1CGJE 4OS2A 2VGCB 4NGAH 1BTWA 4DCDA 2F9PA 1GMDG 5L6NH 3PMJA 1VGCC 1C2HA 2TIOA 1GBLA 2BB4A 1PYTD 1YPHC 2XW9A 5DP6A 4LZ1H 2FDAA 1PPHE 1O2QA 4BAOB 2GMTC 1HAPH 2FX6A 2UWLA 1AZZA 4ZH8A 1MTVA 3MI4A 2VIVA 1XUGA 1AE8H 5BRRE 1C5XB 1L1JA 2ZDLA 3PTNA 4RKJB 1HIAA 1C5TA 1XUFA 4OS7A 4AGKA 3M36A 3QX5H 1ZZZA 2V3OH 1C2EA 1S84A 1AKSB 2D1JA 1SQOA 1W2KH 2BDIA 1V2OT 4ISHH 1AVXA 3NWUA 1OP8A 3CP7A 3TH2H 2WYJA 3VB7A 4K2YA 2ZHQH 2XC5A 4AOQA 1C1WH 2QIQA 4FU9A 4E06H 1DWDH 5JBBS 1NESE 3GDUA 2GX4A 2ZQ1A 3F9GA 1G30B 1GBEA 1RIWB 2SGDE 3URDA 5B6OA 5TCCA 1WV7H 1YF4A 1ZRKA 1E35B 4O03A 1YPHE 1O3OA 3DT0H 4WMEA 4MQAA 3BG4C 1FAKH 1G37A 1ANDA 2J4IA 3VGCB 4I33A 1EJNA 3SUDA 1MBMA 5L2YH 4U32A 5A8ZA 2HLCA 1BJVA 3EA7A 1Y3UA 4NWLA 3UTUH 3MU8A 1S85A 1C4U2 5E0HA 3B8JA 3RM2H 1W8BH 3MOCA 5L2ZH 3L3TA 4JCNA 5EW1H 7KMEH 2XBWA 1UHBA 1EUFA 1E34B 2AYWA 1BOQA 4U2WA 1ZSJA 5EQSA 1TX8A 1V2VT 1A0LA 3ZVGA 1CT2E 1G9IE 2BD7A 1SOZA 3ATKA 3RXVA 4LOYH 1AHTH 2BY6X 1BT7A 4X1PU 2R3UA 2GCTB 4RKOB 3SNCA 3R0FA 3ZZ3A 5F8ZA 1PQ5A 2A32A 3B9FH 1BRBE 1GDUA 2OD3B 3BTME 2CN0H 1ZPZA 2EEKA 1P11E 3KQEA 3PLBA 5JBTA 1BTYA 2I6QA 2Z9GA 4ABJA 3F68H 5F8TA 5SGAE 1QY6A 1UK2A 3RXJA 3VB3A 4Q7YA 3QTOH 1GHZA 1ESAA 1EAUA 1O2ZA 1BDAA 1B5GH 3IITA 9LPRA 3ODDA 1MU8B 4YZUA 1SMFE 1XMNB 5GPIB 1C4V2 2D26C 2ZCHP 1PJPA 2RA0A 1OWDA 1VZQH 2DE9A 3LGYA 1EJAA 3NPSA 1HAGE 1ZOMA 4XDEA 3M3TA 1H9LB 3GOVB 3WY8A 1GHVH 3GY5A 4J1YA 4KGAA 1WAYB 2FO9A 4X2WA 1SGPE 5JPMH 3MYWA 3SNDA 1FN8A 1MMJN 2F9BH 4Y10E 3GCOA 1OPHB 2B8OH 1FLEE 1HB0B 1GBTA 1AMHA 2F3CE 5DG6A 3OSYA 1T4VH 4LK4A 3M35A 3V0XA 4B71A 2A31A 1SLWB 5DP8A 4ZHMU 1TPOA 1KIGH 3ZZ4A 1VCQA 3E0PB 4NWKA 3HPTB 1HV7A 1QRWA 3RXLA 4JK5A 1QGFA 4MLFB 1GI9B 5AFYH 1QJ1B 4Q80A 1AQ7A 1O3GA 4AFZA 3BTQE 6GCHF 4TPYA 1O2YA 1OSSA 2PTNA 1UK4A 5EPYA 2RDLA 2FI4E 3KQDA 3HK6B 2ZA5A 2PGQB 1T8MA 1UTJA 3A83A 3SNBA 3S69A 2PFEA 1DY8A 1TQ7B 2QV1A 1DSUA 4WMFA 4MPVA 1JBUH 3PLKA 3Q76A 3LOXA 3OYPA 4DIIH 1DY9A 3F6UH 3O8DA 2C90B 2HPQH 3UNSA 5AF9H 2GV6A 3BTEE 2GDEH 3UPEA 1SL3A 4ZUHA 1HLTH 4O97A 3G01A 4MVNA 4DIHH 1SQAA 1ZMLA 2C93B 2BVRH 4X2YA 1A5GH 1LPKB 4NA7A 2ZGBH 4NZLA 1ZR0A 4B1TA 2PGBB 4BAKB 1TGBA 2VVVA 1MQ6A 1EX3A 1P0SH 2FOBA 1GL0E 1S83A 3GY4A 3MWIU 1FMGA 2A4GA 2H5DA 1GL1A 4ZHLU 1TRMA 1O35A 1MD8A 5HGGA 1LDTT 4CRGA 2QXGA 1HAHH 3ESTA 2ALVA 4YESB 1QB6A 1F5RA 5EU8A 5EQQA 1ANEA 3UR6A 4YOJA 3QTVH 1QHRB 1P04A 2WINI 4UD9H 1IQEA 1FAXA 1C5UA 1IHSH 2FOFA 4JK6A 5E2PA 1ETSH 1KLJH 2DUCA 3NCLA 4R0IA 3KL6A 1DE7H 1EASA 1LO6A 3HKJB 1ELTA 1XXFA 4I8KA 4YLUA 2SNVA 1IQJA 2BX3A 3LU9B 2HPPH 1ZPBA 3VXFH 2XC4A 2W3KA 1TFXA 1Y3WA 5E8EH 2AMQA 1LPGB 1XX9A 3LC3A 3PMBB 3SU4A 4GLYA 1BHXF 1GGDC 4MPUA 1QA7A 4K8YA 2G5NA 4YTAA 2ZTZA 1GI4A 2VIWA 2VVUA 3SU5A 3PYHA 4AYVB 1K2I1 1KDQB 2YOLA 5E0GA 1BJUA 1PPGE 2FZZA 1L2EA 2BDHA 4DW2U 2TGDA 2ZEBA 3ZZ6A 4XBCA 4MPWA 2G55A 3MO6A 1RGQA 1CA0C 1TBQH 1EZQA 2B0FA 3MU4A 3PROA 4Y7BA 3W94A 1ORFA 3E0NB 3GYLB 2IJOB 1YLDA 1NFXA 2BTCE 3BTKE 3BEFB 1IQKA 3LONA 8GCHF 1QFKH 1MCVA 2FTMA 1BZXE 1GI0A 1LVYA 1TWXB 4FU8A 1F2SE 5LPEA 4Y0ZE 5F03A 2QC2A 2UWPA 3RXGA 2EI7A 2P3TB 1S0QA 2FX4A 4Q2KA 1SGRE 3VB5A 1TRYA 2FOGA 1UTKA 4XE4A 1JOUB 4K1TA 3M61U 1Y5AT 1GBCA 4YT6H 1Z71A 1C1MA 1WTGH 2VWMA 1KLIH 1CE5A 2XRCA 3SV9A 3TU7H 5HYOA 1JWTA 1VGCB 2J95A 1GHAG 2WV5A 2QYIA 1AD8H 3TGKE 1INCA 2V0BA 1YPKH 2GDDA 3S7KB 2GMTB 2ZFRH 2ZDNA 4H42U 1FN6A 1P2QA 4X1SU 1NRSH 2ZGJA 3MNSA 1H8IH 1NU9A 2OXSA 1CQQA 3K9XB 1W12U 3UOPA 3GCTF 1DLEA 4FVBA 2CMYA 1O2JA 2UUJB 1DFPA 2ZDMA 1KDQA 1A46H 2G52A 2BLQA 1N1LA 1YCPM 5I46H 1SG8B 1GI8B 2TPIZ 1O3IA 1L1GA 4CR9A 1CO7E 2PW8H 4AB9A 3RDZA 5HM9A 1L0ZA 1RTKA 1T32A 2CHAC 4QT8C 5EXNA 4DG4A 2BQ6B 4FU7A 1NFUA 1SI5H 2PSYA 2BY9X 4FXGH 1GJ6A 2P95A 2Q6FA 1GCDA 1KTSB 3FP8E 4JYTA 3P8NA 1FY1A 4Y7AA 4B73A 5CE1A 2VVCA 2GP9B 4WJG2 5ESBA 3ZVDA 1OYTH 2GD4B 1TPSA 4CBOA 4HFPB 1ZHMA 2A7HA 3RXTA 1K1JA 3QZQA 1BTUA 2VWNA 1GI3A 4D7FA 3QUMP 1C1UH 1QTFA 1T8OA 3PM3A 2LNCA 3P70B 4VGCC 3BTGE 1OOKB 2BLOA 4WF8A 3UFAA 2OINA 1NT1A 4ISNA 1KTTB 3IWMA 2ANMH 6CHAC 5BPEA 1Z6JH 1F5KU 3S9AA 2BY8X 3MH6A 5DKMA 4OS4A 1ZTJA 1W7XH 4NA9H 3MO3A 2KAIB 1CSOE 3RUOA 1O5FH 2FM2A 2QXJA 1O3FA 1G36A 1GI1A 4CRAA 3JZ2B 1K1NA 2OC1A 4X1RU 4A5TS 1XKAC 1CHOF 4CH2B 5DP7A 4WH8A 1Z1JA 3PO1B 2BDBA 2C8XB 1HUTH 1BITA 2QAAA 5A0CA 2R0KA 1TE0A 4K8BA 1XKBC 1GBFA 1L4DA 2BVXH 2ANKH 3QN7A 1F0SA 4CRCA 5C3NA 3LJOA 3SV8A 4NSVA 2V6NA 1VITG 1MQ5A 3PB1E 1DVAH 1NFYA 3Q3XA 2WUCA 1E38B 2G4TA 4OGXA 1A5IA 1C5PA 2BHGA 1TA6A 3DHKH 5FPYA 3AAVA 4X2VA 1C2FA 1MTUA 3A8DA 4X1QU 3SHCH 1GDNA 3E91A 1C5QA 2FPZA 1Z8GA 4UDWH 1TALA 4B2CA 3UWIA 2STBE 4IW4E 3MNBA 1ZSLA 4AZ2B 5FAHA 2ZHFH 1C5MD 4DOQA 2GZ7A 3QO6A 3TGJE 1C5ZB 5CMXH 1KLTA 1SLVB 3SNAA 3ZZAA 1ACBE 1BMLA 1S0RA 4K1SA 1CT4E 3SJ9A 1DWBH 3V3MA 2BZAA 4PROA 3SGBE 2ZFSA 2A2XH 4UONA 2OCVB 1GBMA 4BOHA 1SLXB 5T6FA 3SGAE 1G3CA 5HM2A 1XVMA 4NFEA 4K3JA 2P3FH 4KKDA 4K1EA 5EODA 1ANBA 5FX6A 2PTCE
chains in the Genus database with same CATH superfamily
5CHAB 4B2AA 5DP9A 5I25A 4FVDA 1ZSKA 1THSH 2ZDAH 1G32B 3KIDU 2O9QA 5E2OA 5IK2D 2C3SA 1UTQA 3SJIA 1GJBB 2A0QB 3SW2B 1DITH 3SO3A 1WQSA 1F92A 3SU1A 1GMDF 2KM0A 3SHAH 2UUKB 1HRTH 1KXEA 1CBWB 2GZ8A 3M3VA 2JH5D 1AI8H 1GCTC 1SVPA 4CREA 3DD2H 2JJ2D 3FP7E 3MH4A 3IG6B 1NS3A 2PSXA 1O3CA 1ZRBA 2AGGX 2BDYA 3HATH 3N7OA 1IQIA 1NRNH 3BTDE 1NPMA 2BD4A 1NU7B 3E3TA 2OBQA 2XOKD 2ZKSA 1B0EA 1QIXB 1SGTA 4A1TA 3AK5A 1LKBA 4D9RA 1QL7A 2J98B 1UJ1A 4UFFH 5DP5A 1P8VC 3VEQB 1TRNA 1XM1A 1N8OC 2JH0D 5GWZA 3UUZA 2VU8E 3U98H 3QLPH 1NZQH 1Z6EA 4HG6A 4WMDA 1U6QA 1SFIA 3A8AA 1BMMH 5EQRA 1AB9C 3QGNB 1XUKA 1LMWB 2OBOA 1H4WA 3SUEA 1T7CA 1ESBA 2FOMB 2A2QH 2FTLE 1THRH 1DDJA 3A88A 2JIZD 2C8ZB 5DO4H 3ZZBA 1O2XA 4ASHA 1SBWA 1Y8TA 3D62A 5EW2H 3GISB 2O8MA 1C2JA 2J9NA 2ZNKH 2P8OB 2PUXB 2PKSC 1LKAA 3A84A 4WH6A 1A0HB 1FY4A 2HWLB 3F0OA 4B75A 1O3AA 4OS6A 1GGDB 3BIUH 3O8BA 1AWFH 2VBCA 4ZKOU 4X6MA 1EPTC 2XCNA 4XFQA 3KQBA 2W7UA 5EXMA 1AY6H 3RP2A 4B2BA 1P9UA 5J4SA 3RMNH 3F9HA 1SC8U 3T62A 1G3BA 5DSFA 2WV4A 3RXEA 4B6FA 2BLWA 4XD7D 2IPQX 2F9NA 1K22H 3A80A 3GDSA 1V2LT 5FCRA 2J98A 2FI3E 1GBDA 1XVOA 3A8BA 1TPAE 2ANYA 3V13A 1PPEE 4NCYA 3SJOA 2HALA 3D65E 1YM0A 3FFGA 1J9CH 1ETRH 2QXIA 5CDFE 3LGTA 4INKA 5EGMA 1TPPA 3RXHA 1V2TT 1PQ7A 1O2NA 1TX6A 3KEEA 2VIQA 1J17T 3U8RH 1TYNA 1ELGA 3M37A 4Z6AH 5C1UA 2A1DB 1V2RT 3C1KA 1AKSA 3SNEA 5J4QA 3FOAA 2FLRH 3OU0A 4XSKU 3SZNA 1PPFE 5FPTA 4GHTA 2IPHA 1ID5H 5DP4A 3LDXH 1SPJA 3M7UA 4CHAC 3U1IB 1NBME 3DFLA 1XUJA 1DT2A 1QURH 2VB0A 2J34A 4X0WU 5ESTE 1IQGA 1CGHA 2UWOA 2DE8A 1PPZA 3ODFA 2AFQB 3LGUA 1GVLA 1S82A 1YC0A 1H8DH 1UVTH 3ATLA 1UTOA 3O8CA 2ESTE 3PMAB 2CGAA 2O8WA 4U30A 1BBRE 1UVSH 1EP5A 2XCFA 3BG8A 5EG4A 1SGYE 3M3SA 3TK9A 1GJCB 3VB4A 2CK3D 3SJ8A 5JBAS 1H1BA 4AFSA 1QBNA 3E16B 1XXDA 1YP9A 5A0AE 3SJKA 2WPJS 4ISOA 5GCHG 1FY8E 1SB1H 1EP6A 2Z94A 3FZDA 4ESTE 1ZGIA 4YXWD 2O8UA 4MNYA 1HNEE 1Q2WA 1NO9H 1PQAA 2XWBI 7GCHG 1GDQA 2G8TA 5GDSH 2ZGHA 1ZHPA 3RC4A 3FANA 3RXKA 1A3BH 1LVBA 1C1VH 4LXBH 3R3GB 3F0PA 4GCHG 3MH5A 4HI3A 3ZV9A 2FS9A 3A7XA 4VGCB 2HVXA 4NIWA 3T29A 1Y3XA 1O34A 1AFQC 2G81E 1NRPH 1P05A 2EI8A 3URCA 1WUNH 1NC6A 2ODQA 1TQ0B 3N7DA 6CHAB 3RMMH 3EQ0H 1P2KA 1SOTA 1GVZA 5LH8A 1FIZA 1C5LH 1NN6A 4X6OA 1Z8IB 3SYJA 3GDVA 2RG3A 3GCHC 4TYDA 1QCPA 3M7TA 1O2RA 2PR3A 1HJ9A 2FOCA 4D9QA 3SU0A 1YKTA 5IDKA 1SR5C 5HXFA 3A7WA 1E36B 4ABIA 1ESTA 5ETXA 2FYRA 2M2AA 3LT3A 3ZIAD 1O3LA 1Z7KA 2AERH 3CENA 2RCEA 3RMOH 2BOHB 2BLVA 3HKIB 1C1NA 3BV9B 3P8FA 2NU3E 1HJAB 1OWJA 3ZZ8A 3U8OH 1GJ9B 1H8HD 3TNTA 6LPRA 1HAVB 4ABAA 3OTPA 1C5NH 1P9SA 4MPXA 4A92A 1VCPA 1GHBG 1EQ9A 3K6YA 4IC5A 1QBVH 1DPOA 3EDXB 1C5VA 7LPRA 3GY8A 3MMGA 1F7ZA 2Y81A 5LPFA 1C5SA 3WWFA 1F0TA 1KXFA 5T6DA 5GIBA 3ZZ7A 1GJ8B 4X8SH 1PQ8A 2W3IA 1F5LA 2JETC 4DJZB 1F0RA 1QB1A 2VGCC 1GI5A 4HZHA 5C5OA 1AWHB 1KYNA 4MNXA 4ZKNU 3BIVH 1SGDE 4YOGA 3FKSD 4ABDA 4Y8ZA 1DLKB 3KN2A 2VIPA 1DWEH 4XBBA 3LH1A 1EAWA 2OUAA 4SGBE 3HGPA 3RLYH 4DURA 1V2PT 4IC6A 2OP9A 1BCUH 5FBEA 1NRQH 1TOCB 2A4RA 2FMJA 3GS9A 2KCAA 4I86A 1MKXK 3MU1A 4AG2A 2H2ZA 2BXTH 2Z7FE 1SGCA 4RSPA 1TONA 5GNDA 3QDZB 1ABJH 1DX5M 2AH4X 3FVFB 3PMHB 3RXSA 1HGTH 3AW0A 1DXWA 2ZF0H 4GVUA 1MTWA 2FLBH 3CS7A 3TNSA 3E8LA 1HAVA 1O30A 1IQMA 1RIWC 2LPRA 1Z8JB 2OLGA 1S6LA 3KGPA 1C5OH 1E37B 1UTMA 2J38A 2CXVA 1GHAF 2EY4C 2JKHA 1EOLA 1DUEA 2HRVA 2P94A 2ZHEH 3RLWH 3EGKH 4AORA 2ZFQH 5LPRA 3S7HB 1A4WH 4OS1A 1P2OA 1MKXH 1ZYOA 3K2UA 1O5AB 1V6DA 1FUJA 3AW1A 1ZPCA 1JMOH 2VWLA 5DPAA 3OFND 2SGQE 3FO8D 5FBIA 1A5HA 2HLDD 3P8GA 5HKKD 2Q6GA 1FDPA 4YT7H 1O37A 4TSFD 1V2MT 3VB6A 4D76A 4K60A 3RXIA 1O3JA 4CRBA 3Q3YA 1SFQB 1G3DA 4ZMAH 2BYAX 1TOMH 4XOJA 2ASUB 2Y5HA 1VR1H 1WU1A 1P3EA 5A8YA 2BDGA 1WTHD 2FXRA 5JB8S 2TGAA 1TGCA 1ZHRA 5HIZA 4IGDA 2GCTC 1W14U 2VIDA 1K1MA 2PKAB 1JXPA 1YLNA 1HJ8A 3UAIC 2AEIH 1LTOA 2WUBA 4Y76A 3KYGA 1AVGH 4O3TA 1P2NA 3T26A 3RXQA 1NM6A 5GXPA 1UO6A 1FZZA 1GMHG 2A5IA 2BY7X 2FI5E 2H1UA 3QK1A 4DVAU 4F55A 1O2LA 1K9OE 4FUGA 1V3XA 1BRAA 2SGAA 3LKWA 1J15A 1DOJA 2STAE 4AX9H 5TCAA 4CRFA 1K1OA 5T3HA 1EB2A 2VH6A 3H09A 1O3BA 3NUMA 1UK3A 4AGJA 5F6MA 3WW7A 1FPHH 1IAUA 2VINA 4O9VA 1VJ9U 2ZIQH 1EPTB 3F9FA 2IN2A 3BG4B 1C1QA 1T8NA 5T1VA 2FP7B 5A0BA 1HAYB 3T28A 1BBRK 1AU8A 1DSTA 1PPCE 1WYKA 4JZFH 1P12E 2GZ9A 4CR5A 3SZEA 1QJ6B 3HGNA 3GCNA 4MDSA 4NA8A 1ZMNA 2TRMA 2FS8A 1RTFB 1BUIA 3U9AH 5C67A 4DT7B 2ZPQA 1GJ4H 4RT0A 1A1RA 3ATMA 1RJXB 1BTZA 2QF0A 1VITF 2ULLA 1AO5A 2P3UB 3UREA 1Z8RA 3SI4H 3TK5A 4BNRA 1RD3B 3LC5A 4B76A 1P2JA 1A0JA 4NFFA 1Y3YA 2O8TA 2PKAA 2ZU2A 3EE0B 3KF2A 1TBRH 1O5BB 3H5CB 1BTPA 1BQYA 4ZROA 3M5LA 1GJAB 4GSOA 1BBRH 3ATWA 3SU2A 1ANCA 1W11U 1UTNA 3BF6H 1TABE 4ABGA 2A4QA 3QGJA 3RXRA 2L74A 4X8TH 1W0JD 4O3UA 1C1OA 1YPJH 2YMSC 1SGFA 1NY22 1BHXB 3M5MA 1GBAA 1Y5UT 4I31A 2WPDD 2ZECA 3RMLH 1KXAA 2SGPE 3GICB 5F53A 5F8XA 1ETTH 2ZI2H 4AC9A 4Y6DA 2HNTE 2H9EH 3KCGH 1DUAA 1O2HA 1A7SA 1D3DB 3MO9A 5EXLA 1WSSH 3UIRA 2QA9E 9ESTA 1TMUH 4FUEA 2Z3DA 3A81A 4B6EA 1GG6C 1WCZA 1B7XB 1HAXB 1O2PA 1MAXA 1TNHA 3A82A 5EOKA 1MD7A 4AN7A 2WPLS 1BRCE 4M7GA 4MTBA 4Q7ZA 5G4BA 1YPMH 3QZRA 3M7QA 2ALPA 5AVDA 2XBVA 2ZFTA 5HMAA 4ZXYH 2J94A 2KAIA 1HYLA 1C2IA 1SSXA 1WDIA 3DUXH 3NKKA 1MKWK 3E90B 2Z9JA 3TJUA 1C1SA 4YLQH 2PV9B 2W26A 2CJIA 3ZVEA 1THPB 3P8OA 2F9VA 2XBXA 1EAIA 3QWCH 1PPBH 3RU4E 3SQEE 4ABFA 1MUEB 2NU1E 2FOEA 3PWCA 1OX1A 1HAIH 5GJ4B 4ZKRU 1J14A 1D9IA 2FIRH 2ZFPH 1GI2A 3A87A 3UY9A 1QQ4A 3M5OA 1B0FA 2GT8A 2L6OA 3GY7A 1O2GH 5TJXA 2XBYA 4X6NA 2FESH 1MBQA 2EA3A 3RXMA 1GBBA 4E7NA 1GMCG 2D8WA 3P92A 2GV7A 1HIAB 1J8AA 2J2UA 1IQFA 2R2MB 3SV6A 2GCHG 1Y3VA 4I8HA 4UE7H 1MCTA 4TY7A 2Z9KA 5EPNA 1MKWH 1EOJA 2WPKS 3SN8A 2BM2A 1FV9A 1HBTH 4MG3A 1RXPA 1OWKA 4ZHAA 1P06A 4UFDH 1AUTC 1UW7A 2XTTB 1O3EA 1NBMD 4GHQA 4FUJA 1O39A 2WPIS 2WZQA 4UFGH 2P16A 1ABIH 3LGWA 1WQVH 2K1QA 4X6PA 3E1XB 1K1PA 3RXCA 1GBKA 1OWHA 2K0QA 1GBJA 2WPHS 1ELFA 1ELVA 1QRZA 4UFEH 2RFKC 3K65B 2F9UA 1DS2E 1SQRA 1JIMA 3VG8A 3ZZ5A 3CS0A 7ESTE 2HNTF 4FOUC 1O3PB 3NZIA 1P57B 2AIQA 3MNCA 1O31A 2VNTA 8ESTE 3U8TH 1O2WA 1O2UA 5CHBA 2C4FH 1JIRA 3RC5A 2ZU5A 1G2LA 2PHBA 2XWAA 2ZGXH 4H4FA 2WPMS 3BTTE 3V7TA 2ZZUH 3ZVFA 2VIOA 1V2KT 3SBKA 1Q31A 1UHBB 4RN6A 5FHTA 1GJ7B 2B7DH 2VH0A 5JDUB 1SHHB 3E6PH 1DICA 3DA9B 3L33A 4YO9A 1GBHA 4AFQA 2ZWLH 3U28C 3SUFA 2BOKA 1KSNA 3RXOA 3SV2H 1AGJA 1VITH 4HGCA 2BQ7B 4IMQA 3PWBA 4WWYA 4A1VA 3TITA 2WYGA 1HCGA 2FOHA 3TK6A 3VXEH 2R9PA 1D3PB 3RXDA 1TGSZ 1ZTKA 1N6XA 1H8ED 2H6MA 1OP0A 1D6WA 2ODYB 1SGNE 1O32A 1A3EH 2J97A 4ASUD 4MNWA 4ABHA 5FXLA 2ZGCA 1D6RA 4MNVA 1P01A 2B9LA 1ZTLA 1CVWH 2R2WU 3P17H 2Y6TA 2ZQ2A 1CA0B 4TPIZ 2F83A 1CU1A 3RXUA 1A61H 3SU6A 2V3MA 1ELBA 1MH0A 2ZFFH 3DFJA 4R8TB 1BA8B 2FEQH 1TAWA 2TBSA 3ZYEA 4FUDA 1EJMA 1E79D 2W7SA 1C2MA 1TNLA 1CA8B 2FYQA 4A7IB 4THNH 2GVFA 3PLPA 1PYTC 2Y80A 2Y7XA 1O2IA 2A45B 1TMTH 1YCPK 2EI6A 3KQCA 1W7GH 3DSGA 1GHYH 1P02A 3SGQE 1HPGA 3EYDA 1V2UT 2OTVA 3TPIZ 3UQVA 1W0YH 4NIVA 3UR9A 1O2TA 3UWJH 1G2MA 4BAQB 3PO1C 1ELEE 2TGPZ 5GCHF 1O5DH 3BEUA 4F4OC 1KXDA 2Y5FA 3W1EA 3TVJB 2HGTH 1Q3XA 1C2KA 4HTCH 1FQ3A 2HVYB 1H9HE 1KXCA 3RXAA 3N99A 1FI8A 7GCHF 3ZVCA 1S6FA 2BY5X 3S9BA 1TNJA 1WOFA 2P93A 4I8JA 2BD5A 4GCHF 4FETA 1GHXH 1P10A 4TT3D 5KECA 4BAHB 2G4UA 3U1JB 1YCPH 1K1LA 1FONA 2CHAB 1HFDA 1D3QB 1V2NT 1IHTH 1W0ZU 4Y11E 2QY0B 4JZ1A 2ZCLP 3TLOA 1O3MA 1Y5BT 4Y0YE 3ZVAA 1CT0E 3T25A 1C1PA 2QCYA 1HXFH 1TNIA 1K28D 3DSOA 3GY2A 2PWXA 2H9TH 1Z1IA 5DN6D 1GI6A 3AASA 2Z9IA 1VJAU 1W10U 1X7AC 3DCLA 4I32A 5DJ7A 1HAZB 1YYY1 2JJ1D 2BDAA 1IOEA 2AGIX 3ZZDA 4E7RG 2GGVB 1ZJKA 4Y8XA 1FPCH 2ZU1A 4TY6A 2A7JA 2UUYA 4AB8A 2NU4E 2V3HH 3RXBA 4F49A 3NK8A 3RXFA 4CH8B 1W0KD 3OY6U 3K6ZA 1C9TA 3D49H 4ZCNA 1GHBF 2O8LA 1C5WB 1BMNH 1TBZH 1UVOA 1M9UA 2SGFE 2C8YB 2ILNA 5CHAC 1T8LA 4KTUA 4OGYA 1C9PA 1GBIA 4JZDH 1MAYA 4YM9A 3W95A 3OY5U 3ITIA 4UEHH 4BAMB 1UTLM 2Z3EA 4Z0KA 1V2ST 2AHME 4JZEH 4YOIA 2ZPRA 1C2GA 4BANB 5C5NA 2ODPA 1KY9A 1MTNC 2Y5GA 3V12A 1GJDB 3UB0A 1UCYK 1TX7A 3OE7D 1CBWC 2KX4A 1AN1E 2A5AA 1E0FD 1MZAA 4ZKSU 3S0NA 3GY6A 3RXPA 2ZG0H 4XBDA 1VCWA 4JYUH 4BXWA 2P59A 1EATA 1QQUA 4NIYA 3RM0H 1LQEA 3LPRA 3RC6A 4TWWA 2YNBA 2ZU4A 4KTCA 1LCYA 1BB0B 1S81A 6GCHG 1C1RA 3TGIE 4KTSA 2QXHA 5IYTA 1IQLA 8KME2 2Q6DA 5AHGH 2OC8A 3ZVBA 4IMZA 1O3NA 1WBGB 3I77A 2OK5A 1GG6B 2XXLA 3JZ1B 1O2MA 1TIOA 2BD8A 3UOUA 2ZHWH 2GTBA 2OQ5A 1UCYH 4NZQA 4U01A 1C2LA 1IQNA 1P3CA 2AS9A 2F9OA 2QGRA 1SGFG 1BTXA 1O2OA 2CF9H 1XUIA 1RFNA 4JMYA 1SGIB 1C5YB 1TNKA 1S6HA 3FZZA 4I8GA 1K0HA 5B6LA 3PV4A 1SGEE 2ANWA 4I7YH 3PRDA 2PUQH 2ZO3H 5C1YA 2C8WB 3OX7U 3TJOA 1YBWA 4WXIA 1DM4B 3L6PA 1ELCA 5C20A 2M5TA 5A2MH 3PV2A 1QR3E 3STJA 4ZXXH 2R3YA 2P8OC 4OS5A 2AGEX 1T31A 1QRXA 4A6LA 1N6YA 3Q00A 5K7RA 4AG1A 1O3KA 3P6ZB 2XYAA 1TNGA 2QE7D 2OC7A 3H7OA 2ZDVH 5T6GA 3ZV8A 3O8RA 1GCTB 4GPGA 1LHEH 3ENSB 2OQUA 1DXPA 1FJSA 5DGJA 1JRSA 3VGCC 1RRKA 1KMHB 3ZZCA 1AVWA 4DGJA 1NFWA 3EAJA 1O0DH 1OP2A 1QL9A 2Z9LA 3AVZA 2BZ6H 3BTFE 3ZYDA 1G3EA 2JH6D 3A7VA 5K0HA 1SHYA 1YLCA 3UNQA 1CGIE 2AMDA 2FOAA 2Z3CA 3MHWU 4GUXA 4BTUB 4J2YB 3BTHE 4D7GA 4ZAEA 4Z1MD 1NROH 4ISLA 3SV7A 1OKXA 3H7TA 1UMAH 3P95A 2ZPSA 2TGTA 3A86A 2F91A 1N8OB 1BIOA 1GMHF 2H5CA 4IN1A 2R0LA 4B74A 3A7TA 4FUCA 2ZC9H 1EXFA 3LGIA 3SOSA 3F9EA 2AIPA 1TB6H 5DP3A 3TH3H 1AB9B 3BN9A 3A8CA 1LQDB 4JZIA 2I6SA 1W13U 4INHA 2B5TB 3MU0A 4GAWA 1BMAA 1SKYE 1P03A 1KXBA 1YGCH 3RU4T 3GYMA 3F1SB 2BMGB 1OXGA 1LHCH 1UTPA 1A2CH 2XC0A 4ABBA 8GCHG 2F4LA 2SNWA 4Y79A 2GT7A 3VPKA 1LHGH 1AUJA 1GPZA 1ARBA 4I8LA 3Q77A 1O2KA 1YPLH 1UVPA 2W5EA 3MNXA 1FY5A 2QN5T 3MU5A 3SORA 2YMSD 1BRUP 5JBCS 4A1XA 2PKSB 3SQHE 3LJJA 5FL7D 3ELAH 2BX4A 2A4OA 1C1TA 4FUHA 4AFUA 1QB9A 1E1RD 3B23B 3RU4D 1EZXC 4X8UH 3MH7A 3KQ5A 5LGOA 4ISIH 4JYVH 2KCPA 4Q7XA 4CBNA 6ESTA 3N7EA 1P2IA 1LHDH 2VWOA 3NXPA 1O3HA 1D3TB 2IJD1 1QJ7B 5E0JA 3T27A 1AIXH 2PLXA 3OTJE 4DY7B 3VFEA 3LIWA 3F3BA 3TH4H 3D23A 2VJ1A 5L30H 3AAUA 1GWAA 3GCTG 2HNTC 1TA2A 1ZLRA 2THFB 3KNXA 3SI3H 2AMPA 2ZDKA 4Y71A 1SGQE 1PFXC 1DWCH 1LVOA 5A8XA 1O5GH 1TLDA 5C0UA 1F0UA 1ZJDA 2CV3A 1DANH 1EAXA 3A85A 3PTBA 1FNIA 1P09A 3MTYA 1H9IE 4AYYB 1C5RA 1QBOA 1O5CB 1OYQA 4WY3A 4X2XA 1V2WT 3BSQA 3F2HA 4BTIB 3HK3B 5JYIA 2Y7ZA 1RTLA 1TGTA 1E1QD 1L1NA 3TJVA 2Y82A 1QL8A 1WXRA 1ELAA 1O2VA 1NRRH 2Q1JA 4TWYA 1GJ5H 5C1XA 3ATIA 4KP0A 2IOTA 2A5KA 4CRDA 4KELA 4CHAB 3GY3A 1HAOH 1QNJA 1Y59T 4NSYA 4WXVA 1TMBH 4IN2A 5DK1A 2BD2A 3FAOA 1IQHA 2BXUH 4D8NA 2YNAA 1D4PB 1K1IA 1W3CA 1EPTA 1GHWH 2V7QD 1HJAC 2XNIA 2HOBA 1GI7B 3UQOA 4SGAE 1L4ZA 3U69H 4H6TA 5H4IB 1EZSC 1FY3A 3T2NA 2J92A 3I78A 4X1NU 5A09A 3A7YA 2OC0A 8LPRA 2NWNA 1EKBB 3STIA 1AZ8A 3EA9A 1ZGVA 3BTWE 3EA8A 3LH3A 1OS8A 1CHOG 2H9HA 3KHVA 4ABEA 3Q3KA 2V35A 4FUFA 4BXSA 1QA0A 3M5NA 2D2DA 3DSPA 1AE5A 3SU3A 2Z6BD 4IS5A 2BD3A 1HDTH 1SLUB 1GMCF 1TGNA 2FODA 4NG9H 3ZZ9A 4IBLH 4K69A 2EC9H 2FWWA 2GCHF 1P2MA 2UUFB 1LHFH 2NU0E 4LZ4B 2BQWB 5AFZH 2G51A 4BTTB 1NTPA 5KEDA 1OWIA 2SFAA 1SQTA 5PTPA 1LVMA 1AFQB 1XUHA 2ZU3A 2ZCKP 2ZTXA 2GKVE 1UCYE 2ZTYA 1EB1H 5FPSA 4H6SB 1BTHH 3MFJA 2QF3A 2KZ4A 4FUIA 4FUBA 2NU2E 1ZMJA 5JB9S 1FIWA 2EQNA 3A89A 3GCHB 1AFEH 4Y8YA 1EZUC 3BEIB 2BVSH 2BDCA 3A7ZA 1HXEH 1C4Y2 1O33A 1JRTA 5FCKA 1MZDA 2WSSD 2RA3A 4INLA 3WWBA 4ACBA 2ZHDA 2G00A 4WVPE 3UNRA 1K21H 1LPZB 2ZP0H 3I29A 3SUGA 1MTNB 2A7CA 3TIUA 1OWEA 1O3DA 1ELDE 1ARCA 1T4UH 5ABWA 3T5FH 1MU6B 1FXYA 1MTSA 1RS0A 3TJNA 1O5EH 4X8VH 1CHGA 5C2ZA 1V2JT 1GVKB 4K5ZA 1V2QT 1UVUH 3FP6E 1YPGH 2CF8H 1O36A 5FX5A 1J16A 4E05H 1YPEH 3LGVA 1O38A 2G5VA 2RDEA 1C2DA 3OEHD 3C27B 1S5SA 4NIXA 1O2SA 3S9CA 2SGEE 2BD9A 2JETB 1CGJE 4OS2A 5EIYA 2VGCB 4NGAH 1BTWA 4DCDA 2F9PA 1GMDG 5L6NH 3PMJA 1VGCC 1C2HA 1YY3A 2TIOA 1GBLA 2BB4A 1PYTD 1YPHC 2XW9A 5DP6A 4LZ1H 2FDAA 1PPHE 2KR7A 1O2QA 4BAOB 2GMTC 2QF5A 1HAPH 2FX6A 4XRNA 2UWLA 1AZZA 2KCYA 2W6ID 4ZH8A 1MTVA 3MI4A 2VIVA 1XUGA 1AE8H 5BRRE 1C5XB 1L1JA 2ZDLA 3PTNA 4RKJB 1HIAA 1C5TA 1XUFA 4OS7A 4AGKA 3M36A 3QX5H 1ZZZA 2V3OH 1C2EA 1S84A 1AKSB 2D1JA 1SQOA 1W2KH 2BDIA 4DT4A 1V2OT 4ISHH 1AVXA 3NWUA 1OP8A 3CP7A 3TH2H 2WYJA 3VB7A 4K2YA 2ZHQH 2XC5A 4AOQA 1C1WH 2QIQA 4FU9A 4E06H 1DWDH 5JBBS 1NESE 3GDUA 2GX4A 2ZQ1A 3F9GA 1G30B 4OM9A 2J5UA 1GBEA 1RIWB 2SGDE 5EJ1A 3URDA 5B6OA 5TCCA 1WV7H 1YF4A 1ZRKA 2K8IA 1E35B 2GJGA 1YPHE 4O03A 1O3OA 3DT0H 4WMEA 4MQAA 3BG4C 1FAKH 1G37A 1ANDA 2J4IA 3VGCB 4I33A 1EJNA 3SUDA 1MBMA 5L2YH 4U32A 5A8ZA 2HLCA 1BJVA 3EA7A 1Y3UA 2W6JD 4NWLA 3UTUH 3MU8A 1S85A 1C4U2 5E0HA 3B8JA 3RM2H 1W8BH 3MOCA 5L2ZH 3L3TA 4JCNA 5EW1H 7KMEH 2WV9A 2XBWA 1UHBA 1EUFA 1E34B 2AYWA 1BOQA 4U2WA 1ZSJA 5EQSA 1TX8A 1V2VT 1A0LA 3ZVGA 2PP6A 1CT2E 1G9IE 2BD7A 1SOZA 3ATKA 3RXVA 4LOYH 3OAAD 1AHTH 2BY6X 1BT7A 4X1PU 2R3UA 2GCTB 3KYFA 4RKOB 3SNCA 3R0FA 3ZZ3A 5F8ZA 1PQ5A 2A32A 3B9FH 2WHXA 1BRBE 1GDUA 2OD3B 3BTME 2CN0H 1ZPZA 2EEKA 1P11E 3KQEA 3PLBA 5JBTA 1BTYA 2I6QA 3NRLA 2Z9GA 4ABJA 3F68H 5F8TA 5SGAE 1QY6A 1UK2A 3RXJA 3VB3A 4Q7YA 3QTOH 1GHZA 1ESAA 1EAUA 1O2ZA 1BDAA 1B5GH 3IITA 9LPRA 3ODDA 1MU8B 4Q63A 4YZUA 1SMFE 1XMNB 5GPIB 1C4V2 2D26C 2ZCHP 1PJPA 2RA0A 1OWDA 1VZQH 2DE9A 3LGYA 1EJAA 3NPSA 1HAGE 1ZOMA 4XDEA 3M3TA 1H9LB 3GOVB 3WY8A 1GHVH 2LELA 3GY5A 4J1YA 4KGAA 1WAYB 2FO9A 4X2WA 1SGPE 5JPMH 3PRBA 3MYWA 3MQKC 3SNDA 1FN8A 1BMFD 1MMJN 2F9BH 4Y10E 3GCOA 1OPHB 5C17A 2B8OH 1FLEE 1HB0B 1FX0B 1GBTA 4P00A 1AMHA 2F3CE 5DG6A 3OSYA 1T4VH 4LK4A 3M35A 3V0XA 4B71A 2KFWA 2A31A 1SLWB 5DP8A 4ZHMU 1TPOA 1KIGH 3ZZ4A 4ACAA 1VCQA 3E0PB 4NWKA 3HPTB 1HV7A 1QRWA 3RXLA 4JK5A 1QGFA 4MLFB 1GI9B 5AFYH 1QJ1B 4Q80A 1AQ7A 1O3GA 4AFZA 3BTQE 6GCHF 4TPYA 4RT1A 1O2YA 1OSSA 2PTNA 1UK4A 5EPYA 2RDLA 2FI4E 4P02A 3KQDA 3HK6B 2ZA5A 2PGQB 1T8MA 1UTJA 3A83A 3SNBA 3S69A 2PFEA 1DY8A 1TQ7B 2QV1A 2YMSB 1DSUA 4WMFA 3PV5A 4MPVA 1JBUH 3PLKA 3Q76A 3LOXA 3OYPA 4DIIH 1DY9A 3F6UH 3O8DA 2C90B 2HPQH 3UNSA 5AF9H 2GV6A 3BTEE 2GDEH 3UPEA 1SL3A 4ZUHA 1HLTH 4O97A 3G01A 4MVNA 4DIHH 1SQAA 1ZMLA 2C93B 2BVRH 4X2YA 1A5GH 1LPKB 4NA7A 2ZGBH 4NZLA 1ZR0A 4B1TA 2PGBB 3EE7A 4BAKB 1TGBA 2VVVA 1MQ6A 1EX3A 1P0SH 2FOBA 1GL0E 1S83A 3GY4A 3MWIU 1FMGA 2A4GA 2XNDD 2H5DA 1GL1A 3F2GA 4ZHLU 1TRMA 1O35A 1MD8A 5HGGA 1LDTT 4CRGA 2QXGA 1HAHH 3ESTA 2ALVA 4YESB 1QB6A 1F5RA 5EU8A 5EQQA 1OHHD 1ANEA 3UR6A 4YOJA 3QTVH 1QHRB 1P04A 2WINI 4UD9H 1IQEA 1COWD 1FAXA 1C5UA 1IHSH 2FOFA 4JK6A 4RI0A 5E2PA 1ETSH 1KLJH 2DUCA 3NCLA 4R0IA 3KL6A 1DE7H 1EASA 1LO6A 3HKJB 1ELTA 1XXFA 4I8KA 4YLUA 2SNVA 1IQJA 2BX3A 3LU9B 2HPPH 1ZPBA 3VXFH 2XC4A 2W3KA 1TFXA 1Y3WA 5E8EH 2AMQA 1LPGB 1XX9A 3LC3A 3PMBB 3SU4A 4GLYA 1BHXF 1GGDC 4MPUA 1QA7A 4K8YA 2G5NA 4YTAA 2ZTZA 1GI4A 2VIWA 2VVUA 3SU5A 3PYHA 4AYVB 1K2I1 1KDQB 2YOLA 5E0GA 1BJUA 1PPGE 2FZZA 1L2EA 2BDHA 4DW2U 2TGDA 2ZEBA 3ZZ6A 4XBCA 4MPWA 2G55A 3MO6A 1RGQA 1CA0C 1TBQH 1EZQA 2B0FA 3MU4A 2QF4A 3PROA 4Y7BA 3W94A 1ORFA 3E0NB 3GYLB 2IJOB 5HIYA 1YLDA 1NFXA 2BTCE 3BTKE 3BEFB 1IQKA 3LONA 8GCHF 1QFKH 1MCVA 2FTMA 5C94A 1BZXE 1GI0A 1LVYA 1TWXB 4FU8A 1F2SE 5LPEA 4Y0ZE 5F03A 2QC2A 2UWPA 3RXGA 2EI7A 2P3TB 1S0QA 2FX4A 4Q2KA 1SGRE 3VB5A 1TRYA 2FOGA 1UTKA 4XE4A 1JOUB 4K1TA 3FN8A 3M61U 1Y5AT 1GBCA 4YT6H 1Z71A 1EFRD 1C1MA 1WTGH 2VWMA 1KLIH 1CE5A 2XRCA 3SV9A 3TU7H 5HYOA 1JWTA 1VGCB 2J95A 1GHAG 2WV5A 2QYIA 1AD8H 3TGKE 1INCA 2V0BA 1YPKH 2GDDA 3S7KB 2GMTB 2ZFRH 2ZDNA 4H42U 1FN6A 1P2QA 4X1SU 1NRSH 2ZGJA 2JDID 3MNSA 1H8IH 1NU9A 2OXSA 1CQQA 3K9XB 1W12U 3UOPA 3GCTF 1DLEA 4FVBA 2CMYA 1O2JA 2UUJB 5C0TA 1DFPA 2ZDMA 1KDQA 1A46H 2G52A 2BLQA 1N1LA 1YCPM 1VKYA 5I46H 1SG8B 1GI8B 2KCOA 2TPIZ 1O3IA 1L1GA 4CR9A 4F48B 1CO7E 2PW8H 4AB9A 3RDZA 5HM9A 1L0ZA 1RTKA 1T32A 2CHAC 4QT8C 5EXNA 4DG4A 2BQ6B 4FU7A 1NFUA 1SI5H 2PSYA 2BY9X 4FXGH 1GJ6A 2P95A 2Q6FA 1GCDA 1KTSB 3FP8E 4JYTA 3P8NA 1FY1A 4M9FA 4Y7AA 4B73A 5KGOA 5CE1A 2VVCA 2GP9B 4WJG2 5ESBA 3ZVDA 1OYTH 2GD4B 1TPSA 4CBOA 4Q4LA 4HFPB 1ZHMA 2A7HA 3RXTA 1K1JA 3QZQA 5EJLA 1BTUA 2VWNA 1GI3A 4D7FA 3QUMP 1C1UH 1QTFA 1T8OA 3PM3A 2LNCA 3P70B 4VGCC 3BTGE 2F43B 1OOKB 2BLOA 4WF8A 3UFAA 2OINA 1NT1A 4ISNA 5EJZA 1KTTB 3IWMA 2ANMH 6CHAC 5BPEA 1Z6JH 1F5KU 3S9AA 2BY8X 3MH6A 5DKMA 1QZ8A 4OS4A 1ZTJA 1W7XH 4NA9H 3MO3A 2KAIB 1CSOE 3RUOA 1O5FH 2FM2A 2QXJA 1O3FA 1G36A 2LP6A 1GI1A 4CRAA 3JZ2B 1K1NA 2OC1A 4X1RU 4A5TS 1XKAC 1CHOF 4CH2B 5DP7A 4WH8A 1Z1JA 3PO1B 2BDBA 2C8XB 1HUTH 1BITA 2QAAA 5A0CA 2R0KA 1TE0A 4K8BA 1XKBC 1GBFA 1L4DA 2BVXH 2ANKH 3QN7A 1MABB 1F0SA 4CRCA 5C3NA 3LJOA 3SV8A 4NSVA 2V6NA 1VITG 1MQ5A 3PB1E 1DVAH 1NFYA 3Q3XA 2WUCA 1E38B 2G4TA 4OGXA 1A5IA 1C5PA 2BHGA 1TA6A 3DHKH 5FPYA 3AAVA 4X2VA 1C2FA 1MTUA 3A8DA 3F2FA 4X1QU 3SHCH 3CNRA 3OEED 1GDNA 3E91A 1C5QA 2FPZA 1Z8GA 4UDWH 1TALA 4B2CA 3UWIA 2STBE 4IW4E 3MNBA 1ZSLA 4AZ2B 5FAHA 2ZHFH 1C5MD 4DOQA 2GZ7A 1YWUA 3QO6A 3TGJE 1C5ZB 5CMXH 1KLTA 1SLVB 3SNAA 3ZZAA 1ACBE 1BMLA 1S0RA 4K1SA 1CT4E 3SJ9A 1DWBH 3V3MA 2BZAA 4PROA 3SGBE 2ZFSA 2A2XH 4UONA 2OCVB 1GBMA 4BOHA 1SLXB 5T6FA 3SGAE 1G3CA 5HM2A 1XVMA 4NFEA 4K3JA 2P3FH 4KKDA 4K1EA 5EODA 1ANBA 5FX6A 2PTCE
chains in the Genus database with same CATH topology
5CHAB 4B2AA 5DP9A 5I25A 4FVDA 1ZSKA 1THSH 2ZDAH 1G32B 3KIDU 2O9QA 5E2OA 2C3SA 1UTQA 3SJIA 1GJBB 2A0QB 3SW2B 1DITH 3SO3A 1WQSA 1F92A 3SU1A 1GMDF 3SHAH 2UUKB 1HRTH 1KXEA 1CBWB 2GZ8A 3M3VA 2JH5D 1AI8H 1GCTC 1SVPA 4CREA 3DD2H 3FP7E 3MH4A 3IG6B 1NS3A 2PSXA 1O3CA 1ZRBA 2AGGX 2BDYA 3HATH 3N7OA 1IQIA 1NRNH 3BTDE 1NPMA 2BD4A 1NU7B 3E3TA 2OBQA 2ZKSA 1B0EA 1QIXB 1SGTA 4A1TA 1LKBA 4D9RA 1QL7A 1UJ1A 4UFFH 5DP5A 1P8VC 3VEQB 1TRNA 1XM1A 1N8OC 2JH0D 5GWZA 3UUZA 2VU8E 3U98H 3QLPH 1NZQH 1Z6EA 4WMDA 1U6QA 1SFIA 3A8AA 1BMMH 5EQRA 1AB9C 3QGNB 1XUKA 1LMWB 2OBOA 1H4WA 3SUEA 1T7CA 1ESBA 2FOMB 2A2QH 2FTLE 1THRH 1DDJA 3A88A 2C8ZB 5DO4H 3ZZBA 1O2XA 4ASHA 1SBWA 1Y8TA 3D62A 5EW2H 3GISB 2O8MA 1C2JA 2J9NA 2ZNKH 2P8OB 2PUXB 2PKSC 1LKAA 3A84A 4WH6A 1A0HB 1FY4A 2HWLB 4B75A 1O3AA 4OS6A 1GGDB 3BIUH 3O8BA 1AWFH 4ZKOU 4X6MA 1EPTC 2XCNA 4XFQA 3KQBA 2W7UA 5EXMA 1AY6H 3RP2A 4B2BA 1P9UA 5J4SA 3RMNH 3F9HA 1SC8U 3T62A 1G3BA 2WV4A 3RXEA 2BLWA 2F9NA 1K22H 3A80A 3GDSA 1V2LT 5FCRA 2FI3E 1GBDA 1XVOA 3A8BA 1TPAE 2ANYA 3V13A 1PPEE 4NCYA 3SJOA 2HALA 3D65E 1YM0A 3FFGA 1J9CH 1ETRH 2QXIA 3LGTA 4INKA 5EGMA 1TPPA 3RXHA 1V2TT 1PQ7A 1O2NA 1TX6A 3KEEA 2VIQA 1J17T 3U8RH 1TYNA 1ELGA 3M37A 4Z6AH 5C1UA 2A1DB 1V2RT 3C1KA 1AKSA 3SNEA 5J4QA 2FLRH 3OU0A 4XSKU 3SZNA 1PPFE 5FPTA 4GHTA 2IPHA 1ID5H 5DP4A 3LDXH 1SPJA 3M7UA 4CHAC 3U1IB 3DFLA 1XUJA 1DT2A 1QURH 2VB0A 2J34A 4X0WU 5ESTE 1IQGA 1CGHA 2UWOA 2DE8A 1PPZA 3ODFA 2AFQB 3LGUA 1GVLA 1S82A 1YC0A 1H8DH 1UVTH 3ATLA 1UTOA 3O8CA 2ESTE 3PMAB 2CGAA 2O8WA 4U30A 1BBRE 1UVSH 1EP5A 2XCFA 3BG8A 5EG4A 1SGYE 3M3SA 3TK9A 1GJCB 3VB4A 5JBAS 3SJ8A 1H1BA 4AFSA 1QBNA 3E16B 1XXDA 1YP9A 5A0AE 3SJKA 2WPJS 4ISOA 5GCHG 1FY8E 1SB1H 1EP6A 2Z94A 3FZDA 4ESTE 1ZGIA 2O8UA 4MNYA 1HNEE 1Q2WA 1NO9H 1PQAA 2XWBI 7GCHG 1GDQA 2G8TA 5GDSH 2ZGHA 1ZHPA 3RC4A 3FANA 3RXKA 1A3BH 1LVBA 1C1VH 4LXBH 3R3GB 4GCHG 3MH5A 4HI3A 3ZV9A 2FS9A 3A7XA 4VGCB 2HVXA 4NIWA 3T29A 1Y3XA 1O34A 1AFQC 2G81E 1NRPH 1P05A 2EI8A 3URCA 1WUNH 1NC6A 2ODQA 1TQ0B 6CHAB 3RMMH 3EQ0H 1P2KA 1SOTA 1GVZA 5LH8A 1FIZA 1C5LH 1NN6A 4X6OA 1Z8IB 3GDVA 2RG3A 3GCHC 4TYDA 1QCPA 3M7TA 1O2RA 2PR3A 1HJ9A 2FOCA 4D9QA 3SU0A 1YKTA 5IDKA 1SR5C 5HXFA 3A7WA 1E36B 4ABIA 1ESTA 5ETXA 2FYRA 3LT3A 1O3LA 1Z7KA 2AERH 3CENA 2RCEA 3RMOH 2BOHB 2BLVA 3HKIB 1C1NA 3BV9B 3P8FA 2NU3E 1HJAB 1OWJA 3ZZ8A 3U8OH 1GJ9B 3TNTA 6LPRA 1HAVB 4ABAA 1C5NH 1P9SA 4MPXA 4A92A 1VCPA 1GHBG 1EQ9A 3K6YA 4IC5A 1QBVH 1DPOA 3EDXB 1C5VA 7LPRA 3GY8A 3MMGA 1F7ZA 2Y81A 5LPFA 1C5SA 1F0TA 1KXFA 5T6DA 5GIBA 3ZZ7A 1GJ8B 4X8SH 1PQ8A 2W3IA 1F5LA 2JETC 4DJZB 1F0RA 1QB1A 2VGCC 1GI5A 4HZHA 5C5OA 1AWHB 1KYNA 4MNXA 4ZKNU 3BIVH 1SGDE 4YOGA 4ABDA 4Y8ZA 1DLKB 3KN2A 2VIPA 1DWEH 4XBBA 3LH1A 1EAWA 2OUAA 4SGBE 3HGPA 3RLYH 4DURA 1V2PT 4IC6A 2OP9A 1BCUH 5FBEA 1NRQH 1TOCB 2A4RA 2FMJA 1MKXK 3MU1A 4AG2A 2H2ZA 2BXTH 2Z7FE 1SGCA 4RSPA 1TONA 3QDZB 1ABJH 1DX5M 2AH4X 3FVFB 3PMHB 3RXSA 1HGTH 3AW0A 1DXWA 2ZF0H 4GVUA 1MTWA 2FLBH 3CS7A 3TNSA 3E8LA 1HAVA 1O30A 1IQMA 1RIWC 2OLGA 1Z8JB 2LPRA 3KGPA 1C5OH 1E37B 1UTMA 2J38A 2CXVA 1GHAF 2JKHA 1EOLA 1DUEA 2HRVA 2P94A 2ZHEH 3RLWH 3EGKH 4AORA 2ZFQH 5LPRA 3S7HB 1A4WH 4OS1A 1P2OA 1MKXH 1ZYOA 3K2UA 1O5AB 1V6DA 1FUJA 3AW1A 1ZPCA 1JMOH 2VWLA 5DPAA 2SGQE 5FBIA 1A5HA 3P8GA 2Q6GA 1FDPA 4YT7H 1O37A 3VB6A 1V2MT 4D76A 4K60A 3RXIA 1O3JA 4CRBA 3Q3YA 1SFQB 1G3DA 4ZMAH 2BYAX 1TOMH 4XOJA 2ASUB 2Y5HA 1VR1H 1WU1A 1P3EA 5A8YA 2BDGA 1WTHD 2FXRA 5JB8S 2TGAA 1TGCA 1ZHRA 4IGDA 2GCTC 1W14U 2VIDA 1K1MA 2PKAB 1JXPA 1HJ8A 2AEIH 1LTOA 2WUBA 4Y76A 1AVGH 4O3TA 1P2NA 3T26A 3RXQA 1NM6A 5GXPA 1UO6A 1FZZA 1GMHG 2A5IA 2BY7X 2FI5E 2H1UA 3QK1A 4DVAU 1O2LA 1K9OE 4FUGA 1V3XA 1BRAA 2SGAA 3LKWA 1J15A 1DOJA 2STAE 4AX9H 5TCAA 4CRFA 1K1OA 5T3HA 1EB2A 2VH6A 1O3BA 3NUMA 1UK3A 4AGJA 5F6MA 1FPHH 1IAUA 2VINA 4O9VA 1VJ9U 2ZIQH 1EPTB 3F9FA 2IN2A 3BG4B 1C1QA 1T8NA 2FP7B 5A0BA 1HAYB 3T28A 1BBRK 1AU8A 1DSTA 1PPCE 1WYKA 4JZFH 1P12E 2GZ9A 4CR5A 1QJ6B 3HGNA 3GCNA 4MDSA 4NA8A 1ZMNA 2TRMA 2FS8A 1RTFB 1BUIA 3U9AH 5C67A 4DT7B 2ZPQA 1GJ4H 1A1RA 3ATMA 1RJXB 1BTZA 2QF0A 1VITF 2ULLA 1AO5A 2P3UB 3UREA 1Z8RA 3SI4H 3TK5A 4BNRA 1RD3B 3LC5A 4B76A 1P2JA 1A0JA 4NFFA 1Y3YA 2O8TA 2PKAA 2ZU2A 3EE0B 3KF2A 1TBRH 1O5BB 3H5CB 1BTPA 1BQYA 4ZROA 3M5LA 1GJAB 4GSOA 1BBRH 3ATWA 3SU2A 1ANCA 1W11U 1UTNA 3BF6H 1TABE 4ABGA 2A4QA 3QGJA 3RXRA 4X8TH 4O3UA 1C1OA 1YPJH 1SGFA 1NY22 1BHXB 3M5MA 1GBAA 1Y5UT 4I31A 2ZECA 3RMLH 1KXAA 2SGPE 3GICB 5F8XA 1ETTH 2ZI2H 4Y6DA 2HNTE 2H9EH 3KCGH 1DUAA 1O2HA 1A7SA 1D3DB 3MO9A 5EXLA 1WSSH 3UIRA 2QA9E 9ESTA 1TMUH 4FUEA 2Z3DA 3A81A 1GG6C 1WCZA 1B7XB 1HAXB 1O2PA 1MAXA 1TNHA 3A82A 5EOKA 1MD7A 4AN7A 2WPLS 1BRCE 4M7GA 4MTBA 4Q7ZA 5G4BA 1YPMH 3QZRA 3M7QA 2ALPA 5AVDA 2XBVA 2ZFTA 5HMAA 4ZXYH 2J94A 2KAIA 1HYLA 1C2IA 1SSXA 3DUXH 3NKKA 1MKWK 3E90B 2Z9JA 3TJUA 1C1SA 4YLQH 2PV9B 2W26A 2CJIA 3ZVEA 1THPB 3P8OA 2F9VA 2XBXA 1EAIA 3QWCH 1PPBH 3RU4E 3SQEE 4ABFA 1MUEB 2NU1E 2FOEA 3PWCA 1OX1A 1HAIH 5GJ4B 4ZKRU 1J14A 1D9IA 2FIRH 2ZFPH 1GI2A 3A87A 3UY9A 1QQ4A 3M5OA 1B0FA 2GT8A 3GY7A 1O2GH 5TJXA 2XBYA 4X6NA 2FESH 1MBQA 2EA3A 3RXMA 1GBBA 4E7NA 1GMCG 2D8WA 3P92A 2GV7A 1HIAB 1J8AA 2J2UA 1IQFA 2R2MB 3SV6A 2GCHG 1Y3VA 4I8HA 4UE7H 1MCTA 4TY7A 2Z9KA 5EPNA 1MKWH 1EOJA 2WPKS 3SN8A 2BM2A 1FV9A 1HBTH 4MG3A 1RXPA 1OWKA 4ZHAA 1P06A 4UFDH 1AUTC 2XTTB 1O3EA 4GHQA 4FUJA 1O39A 2WPIS 4UFGH 2P16A 1ABIH 3LGWA 1WQVH 2K1QA 4X6PA 3E1XB 1K1PA 3RXCA 1GBKA 1OWHA 1GBJA 2WPHS 1ELFA 1ELVA 1QRZA 4UFEH 3K65B 2F9UA 1DS2E 1JIMA 3ZZ5A 3CS0A 7ESTE 2HNTF 1O3PB 3NZIA 1P57B 2AIQA 3MNCA 1O31A 2VNTA 8ESTE 3U8TH 1O2WA 1O2UA 2C4FH 1JIRA 3RC5A 2ZU5A 1G2LA 2PHBA 2XWAA 2ZGXH 4H4FA 2WPMS 3BTTE 3V7TA 2ZZUH 3ZVFA 2VIOA 1V2KT 3SBKA 1Q31A 1UHBB 4RN6A 5FHTA 1GJ7B 2B7DH 2VH0A 5JDUB 1SHHB 3E6PH 1DICA 3DA9B 3L33A 4YO9A 1GBHA 4AFQA 2ZWLH 3SUFA 2BOKA 1KSNA 3RXOA 3SV2H 1AGJA 1VITH 4HGCA 2BQ7B 4IMQA 3PWBA 4WWYA 4A1VA 3TITA 2WYGA 1HCGA 2FOHA 3TK6A 3VXEH 2R9PA 1D3PB 3RXDA 1TGSZ 1ZTKA 1N6XA 2H6MA 1OP0A 2ODYB 1D6WA 1SGNE 1O32A 1A3EH 4MNWA 4ABHA 5FXLA 2ZGCA 1D6RA 4MNVA 1P01A 2B9LA 1ZTLA 1CVWH 2R2WU 3P17H 2Y6TA 2ZQ2A 1CA0B 4TPIZ 2F83A 1CU1A 3RXUA 1A61H 3SU6A 1ELBA 1MH0A 2ZFFH 3DFJA 4R8TB 1BA8B 2FEQH 1TAWA 2TBSA 3ZYEA 4FUDA 1EJMA 2W7SA 1C2MA 1TNLA 1CA8B 2FYQA 4A7IB 4THNH 2GVFA 3PLPA 1PYTC 2Y80A 2Y7XA 1O2IA 2A45B 1TMTH 1YCPK 2EI6A 3KQCA 1W7GH 1GHYH 1P02A 3SGQE 1HPGA 3EYDA 1V2UT 2OTVA 3TPIZ 3UQVA 1W0YH 4NIVA 3UR9A 1O2TA 3UWJH 1G2MA 4BAQB 3PO1C 1ELEE 2TGPZ 5GCHF 1O5DH 3BEUA 4F4OC 1KXDA 2Y5FA 3TVJB 2HGTH 1Q3XA 1C2KA 4HTCH 1FQ3A 1H9HE 1KXCA 3RXAA 1FI8A 7GCHF 3ZVCA 1S6FA 2BY5X 3S9BA 1TNJA 1WOFA 2P93A 4I8JA 2BD5A 4GCHF 1GHXH 1P10A 4BAHB 2G4UA 3U1JB 1YCPH 1K1LA 1FONA 2CHAB 1HFDA 1D3QB 1V2NT 1IHTH 1W0ZU 4Y11E 2QY0B 4JZ1A 2ZCLP 3TLOA 1O3MA 1Y5BT 4Y0YE 3ZVAA 1CT0E 3T25A 1C1PA 2QCYA 1HXFH 1TNIA 1K28D 3GY2A 2PWXA 2H9TH 1Z1IA 1GI6A 3AASA 2Z9IA 1VJAU 1W10U 1X7AC 4I32A 5DJ7A 1HAZB 1YYY1 2BDAA 1IOEA 2AGIX 3ZZDA 4E7RG 2GGVB 1ZJKA 4Y8XA 1FPCH 2ZU1A 4TY6A 2A7JA 2UUYA 4AB8A 2NU4E 2V3HH 3RXBA 4F49A 3NK8A 3RXFA 4CH8B 3OY6U 3K6ZA 1C9TA 3D49H 1GHBF 2O8LA 1C5WB 1BMNH 1TBZH 1UVOA 1M9UA 2SGFE 2C8YB 2ILNA 5CHAC 1T8LA 4KTUA 4OGYA 1C9PA 1GBIA 4JZDH 1MAYA 4YM9A 3W95A 3OY5U 3ITIA 4UEHH 4BAMB 1UTLM 2Z3EA 4Z0KA 1V2ST 4JZEH 4YOIA 2ZPRA 1C2GA 4BANB 5C5NA 2ODPA 1KY9A 1MTNC 2Y5GA 3V12A 1GJDB 1UCYK 1TX7A 1CBWC 1AN1E 2A5AA 1E0FD 1MZAA 4ZKSU 3S0NA 3GY6A 3RXPA 2ZG0H 4XBDA 1VCWA 4JYUH 4BXWA 2P59A 1EATA 1QQUA 4NIYA 3RM0H 1LQEA 3LPRA 3RC6A 4TWWA 2YNBA 2ZU4A 4KTCA 1LCYA 1BB0B 1S81A 6GCHG 1C1RA 3TGIE 4KTSA 2QXHA 5IYTA 1IQLA 8KME2 2Q6DA 5AHGH 2OC8A 3ZVBA 4IMZA 1O3NA 1WBGB 3I77A 1GG6B 2XXLA 3JZ1B 1O2MA 1TIOA 2BD8A 3UOUA 2ZHWH 2GTBA 2OQ5A 1UCYH 4NZQA 4U01A 1C2LA 1IQNA 1P3CA 2AS9A 2F9OA 2QGRA 1SGFG 1BTXA 1O2OA 2CF9H 1XUIA 1RFNA 4JMYA 1SGIB 1C5YB 1TNKA 1S6HA 3FZZA 4I8GA 3PV4A 1SGEE 2ANWA 4I7YH 2PUQH 2ZO3H 5C1YA 2C8WB 3OX7U 3TJOA 1YBWA 4WXIA 1DM4B 3L6PA 1ELCA 5C20A 2M5TA 5A2MH 1QR3E 3STJA 4ZXXH 2R3YA 2P8OC 4OS5A