1O33A

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o33A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o33A02
3C1KA 1EOJA 4AFSA 2BLQA 1T8MA 4AB8A 4MDSA 3LPRA 4B74A 1GMCF 2BY5X 1L4ZA 3CP7A 1ZSJA 1XVOA 1MD7A 2QXIA 3GOVB 1FY3A 3A7XA 4O3TA 1LHCH 3A88A 1CO7E 1RRKA 1VR1H 3M7QA 4JK5A 2BVXH 2J34A 4OS6A 1BJVA 2BQ7B 4BANB 1C5YB 2XWAA 4OS4A 3QTVH 2R2MB 1JBUH 5T6DA 2GV7A 2A1DB 3SUDA 1ZHPA 1TX6A 1ZTKA 1TA6A 4UD9H 3R0FA 1F0TA 3PB1E 1ZOMA 1MKXH 3SN8A 1OP8A 1Q31A 2W7UA 4BXWA 3Q76A 3SHAH 1QJ7B 3PTBA 1V2ST 4NA9H 1EX3A 4Q7ZA 1GHBF 3E6PH 1O3AA 3D62A 4ZKNU 1HAGE 6CHAB 1SGRE 1QCPA 4XBBA 1QY6A 3RU4E 1ARCA 1GBBA 3I78A 1C2JA 2WPMS 3F9FA 2ZHDA 2FLRH 3E1XB 2SNVA 1EAUA 1Z7KA 3BTEE 1FY8E 4Y7BA 1ZRBA 2HGTH 1TONA 3O8RA 2ODQA 1WTGH 2ZU4A 3M35A 4X6MA 4MNXA 5E0JA 4K2YA 3EA8A 4IN1A 1LPKB 4Y7AA 4HI3A 3BEUA 3LGYA 4X6PA 2UUJB 2XTTB 2VINA 3F1SB 1AD8H 2KAIA 1UVUH 1O32A 3SJOA 2R3YA 1K1PA 1WU1A 1ZR0A 2FTMA 1MTNC 2JETB 3SORA 1C5TA 1RIWC 1O3HA 1SGEE 1BOQA 1PPZA 3MH7A 2QGRA 1GMHF 5ESBA 1C2DA 2FESH 1NRNH 3SV7A 3MYWA 1C2LA 1ETTH 1MTSA 4TWYA 2VJ1A 1SHHB 4E05H 2O8MA 4I7YH 3VXFH 2V0BA 3SGQE 3P8GA 4TPYA 1CGJE 1GPZA 2OBQA 2K1QA 2SGDE 3A80A 1OYQA 4B2BA 2FS9A 4CH8B 2Z9IA 4E7NA 1AU8A 3PO1C 1CBWC 1EJNA 2BB4A 1F5RA 2BXTH 1EJAA 4ABDA 5AFZH 1MAYA 3M36A 3CS0A 1C1MA 4A1TA 5GXPA 1GJ5H 2ZO3H 2RDLA 1LHDH 5B6OA 3TU7H 1GHVH 1HNEE 1SPJA 2AGGX 3BTQE 1DY9A 5IDKA 2GD4B 4TYDA 4O97A 2ZPQA 1AN1E 2DE9A 3RU4D 2BX3A 1P9SA 5GWZA 1PQ5A 2P3TB 3O8DA 3ZZ5A 4UE7H 1JXPA 4NG9H 2PKSB 3RDZA 4MPWA 5A8XA 3F6UH 3UR9A 3Q00A 3LH3A 2OQUA 2EA3A 1O3OA 2PGQB 5A09A 4H42U 8GCHG 1TNKA 1HGTH 1XM1A 4NFFA 3A85A 1T8LA 1WOFA 1CHGA 1HRTH 4JYTA 1GHWH 3AASA 1HV7A 1O35A 2GDEH 5E0HA 1B5GH 1RS0A 2P8OC 2TPIZ 4GVUA 1BMLA 1THPB 4DJZB 1O2IA 5FX6A 2Y5FA 3GY5A 5JBAS 1MBMA 4IBLH 4NSVA 4FXGH 1CA0B 4Y11E 3P92A 3B23B 3EDXB 3ZVEA 4AORA 1EJMA 3U8OH 2OP9A 1KLJH 1UK4A 1C2FA 1KIGH 1GBJA 3KF2A 1WV7H 4BNRA 2HNTC 3NWUA 1C5MD 2FIRH 1N8OC 2ZCLP 3M7TA 6CHAC 3UR6A 1GHAG 3U1JB 4I8LA 3BEIB 5DP5A 3SV8A 1W8BH 2F9VA 1ANBA 3HGPA 1AHTH 3QTOH 1EUFA 1O3KA 1GBEA 1GI6A 2R0LA 5JDUB 1XUHA 4NA8A 2W7SA 2FOFA 1D3PB 1KTTB 3SOSA 3EA7A 4XOJA 2GCTC 3GICB 1J14A 2ZU1A 3STJA 1HAVA 3PLKA 1P11E 2RA3A 1ZLRA 5ETXA 4FUBA 4MG3A 4AG2A 2Z6BD 4MTBA 1GI3A 1XKAC 1XXDA 4ZUHA 3MHWU 1AZ8A 1S5SA 7LPRA 1EATA 1C5LH 5FCRA 3BG4B 4FU9A 2OC7A 2FOEA 3GDVA 3BF6H 1V2TT 3RXMA 4KGAA 1O2TA 3P8FA 2JETC 1DITH 3OX7U 1FAXA 1H9LB 4YOJA 1YPJH 1OWDA 2HOBA 2SNWA 2YNAA 3PWBA 2AMPA 3IG6B 1BMNH 2OTVA 1GI9B 1O5GH 5EW2H 2BDHA 2ZF0H 1HAZB 2B7DH 2P94A 1C2IA 1TNGA 4J1YA 1WUNH 2BLOA 5F6MA 2XNIA 1YPLH 3UNSA 4ABIA 2ZFQH 1W10U 2B0FA 2VGCB 3H7TA 3BIUH 3B9FH 1AWHB 1SFQB 2O8TA 2Q6FA 1AE8H 2UUKB 2FLBH 1H9HE 1P9UA 3S7KB 1P57B 3A7VA 1P2QA 2D1JA 3P95A 1TNLA 2OINA 4Y0ZE 1F92A 2O9QA 1O39A 1QBOA 1O2UA 1FPHH 1CHOF 1NTPA 3RXEA 1V3XA 7GCHG 1GVLA 4LXBH 2AMQA 5JBBS 2Y7ZA 1SGCA 2FOHA 1IHTH 3VXEH 1PYTD 1Z6EA 1CGIE 2VIVA 1G9IE 4U2WA 3GY3A 4XFQA 5J4SA 1QQUA 1F5LA 3SGAE 4H6SB 1ZPZA 4K3JA 2P3UB 5E2PA 4UDWH 2ZFRH 3MU8A 2FOBA 3SBKA 5J4QA 2C4FH 3M7UA 5H4IB 2G52A 4X6OA 3VB3A 3FANA 2UWLA 2PKSC 2A4GA 5SGAE 1ESAA 4IW4E 1HAOH 2FS8A 1H8IH 4TWWA 6LPRA 4X2VA 4X6NA 1LVMA 2BVSH 1C2EA 1K1JA 1MQ6A 4WY3A 2EI6A 3M5LA 3PLPA 4X2XA 3SU6A 1O2KA 1SL3A 1ELAA 1DFPA 2FYQA 1ARBA 4B76A 1UJ1A 4ISIH 3TNTA 1D3TB 3L3TA 1MCTA 1HAIH 4AGKA 5K7RA 1T32A 1A5HA 3TIUA 1SLVB 1MKWK 4BTTB 3TJNA 1ELDE 1V2JT 1FXYA 1EXFA 3DHKH 2HNTF 3BTME 1CA0C 2WINI 1ELEE 2ZI2H 1SLWB 4BOHA 3SZNA 1QNJA 4LZ1H 1C5QA 2YOLA 2Z3EA 1FN6A 3PMHB 1GGDB 1C2MA 1EPTA 3VB6A 1WTHD 2BQ6B 2PTNA 1P2OA 4KTCA 1Z8GA 1V2RT 2ASUB 2AMDA 2Y5GA 2BTCE 2BY7X 2VIOA 5L30H 9ESTA 4X1QU 3ZYDA 4ISOA 1K2I1 3TNSA 2V3OH 1Y8TA 1CU1A 1L1NA 1SLUB 1DANH 4B71A 3RXCA 3GCHC 3RMMH 1JIRA 1EKBB 3F9HA 2G8TA 3CENA 1C5ZB 3ATKA 1WSSH 1CE5A 2F9UA 1NU9A 1ABIH 1SQTA 4AG1A 4GHQA 4F49A 4BAMB 3RXAA 3U9AH 2J4IA 3BG4C 1T31A 4HTCH 4AOQA 3E3TA 1W2KH 5JB8S 4XDEA 1VITH 2ZGXH 1GVKB 1OWIA 3SO3A 5JPMH 5JBCS 1VJAU 3M3VA 4GSOA 1TFXA 3VB4A 3NK8A 1V2QT 1EZQA 2WYJA 2JH0D 3OY5U 4ISHH 4JMYA 1GJ9B 4K1SA 2WUCA 2BOHB 2LNCA 1S0RA 3LGWA 5EPYA 2Z9LA 4HFPB 4D76A 2A5IA 1RJXB 3UNQA 4GUXA 1UO6A 3LOXA 1O3FA 1KXDA 1V2KT 2VGCC 1HFDA 3GY8A 2OC0A 1GJ7B 2TRMA 2XBWA 3PMAB 2CN0H 2QIQA 2PW8H 4FVBA 4AYYB 3A8AA 1P2NA 3TGJE 1HJAB 1A0HB 1YGCH 5AVDA 4ISLA 3A7TA 1GJ6A 3T2NA 1UTNA 5E0GA 2ZTYA 1DWCH 4AB9A 2BDBA 1B7XB 2B5TB 3LONA 1RXPA 3EE0B 4KTUA 7ESTE 4ASHA 2I6QA 1ZPBA 2OUAA 1O3LA 2A4OA 2A45B 4O3UA 1K9OE 4Y79A 1MTNB 1L2EA 3UTUH 4TY6A 4FUJA 1RTKA 1FPCH 2G5VA 1PQ8A 2BX4A 4NGAH 1THRH 2VWOA 1AUJA 2BZAA 1A5GH 1O2QA 1ZSKA 4OS2A 2TGAA 2QA9E 2G55A 1EAXA 2BD2A 1KLIH 3LDXH 4FUCA 4H6TA 3VB7A 1ETRH 1K28D 1WBGB 2OD3B 1L1JA 2Y80A 4CREA 4I32A 1SVPA 1NFXA 3P17H 2TGTA 3SU3A 3VB5A 1OX1A 4YTAA 4BAOB 1EOLA 3P6ZB 4RN6A 4RSPA 1GVZA 4A6LA 3DA9B 3PO1B 4RKOB 1OOKB 3R3GB 4HZHA 4Y71A 2Z94A 5JB9S 2ILNA 4X8VH 1GBHA 2TIOA 2ALVA 2JH5D 1P3CA 4JZDH 1L0ZA 1W12U 1O2NA 1THSH 2HWLB 3LC3A 1GGDC 2WV4A 1P03A 1DICA 1LVOA 2VU8E 1PJPA 1OPHB 3RLWH 2AS9A 2BDIA 2UUFB 5EPNA 3RXJA 4GCHG 3URDA 1NRSH 1ZZZA 4MVNA 5A0BA 1F0RA 5FPTA 1PPCE 1KXEA 4JYVH 3L6PA 1MKWH 4BAKB 1MD8A 4YZUA 1XUKA 3FFGA 3RU4T 4K69A 2V3HH 1C9TA 3B8JA 1AB9B 1BTHH 1E0FD 5HM9A 1TNJA 3KQBA 2GZ8A 8GCHF 3QN7A 3F68H 3Q77A 1QGFA 5EXLA 1YLDA 4IN2A 2KAIB 1QRXA 3ATWA 1AUTC 2P8OB 1P05A 2BLWA 1P2KA 3PM3A 3RXUA 3UPEA 2FZZA 2F9NA 3MNCA 1ACBE 2GDDA 4UFEH 2AGEX 2I6SA 3TJOA 1FIWA 4I31A 2PFEA 4YESB 3GCNA 1DWDH 1UVPA 1D4PB 1QL7A 4WMEA 1TOMH 3SJ8A 2A7CA 3BV9B 3KNXA 2GT8A 2NU1E 4I8KA 1ETSH 2BDCA 1GG6B 1GI8B 5LH8A 1QB1A 1TPSA 2ZU2A 1IOEA 2W3KA 1N8OB 3TH3H 4YO9A 1TRYA 2GT7A 1YYY1 1GDQA 5EXNA 1BQYA 1Z8IB 1W13U 3CS7A 1UK2A 1HJAC 1BTXA 1A3EH 1GHXH 2GCTB 5DG6A 2IPHA 1DOJA 1FQ3A 1MU8B 2QXJA 1Y3XA 1P01A 4ZHAA 3KIDU 2W26A 1C1WH 3DFJA 4DG4A 4K5ZA 1HAYB 1TMBH 4TPIZ 3A87A 3MU0A 1HAXB 1GCDA 2ODPA 1T8OA 1MZDA 4KP0A 3N7OA 3GY7A 5DK1A 1G32B 2ZFSA 3W94A 1TB6H 1TWXB 3TK6A 2XC0A 1ELVA 1MU6B 1TBZH 1G37A 3ZZ6A 1W11U 1VCPA 3ENSB 1DVAH 3TJVA 2J9NA 3ZVGA 1GBIA 1TGNA 1Z1JA 5DP4A 2ZNKH 1KXCA 1HYLA 1Y3WA 1S84A 1TQ0B 2Y7XA 1GBAA 1GJBB 2Y82A 3AVZA 1P09A 1GHZA 3PWCA 1PPEE 1TGTA 1NT1A 2BDGA 4YM9A 4GHTA 3SU0A 3MFJA 4AGJA 2D8WA 1SOTA 1AFQC 1DLEA 2ZDAH 1O31A 1JIMA 1MBQA 1C5OH 3BTWE 2VVUA 3M5NA 3S69A 2ZDKA 2F9BH 5C5NA 5EW1H 1YKTA 1FONA 3ODFA 1C2HA 1KXAA 1TRNA 3A8CA 5DP3A 2XRCA 1SC8U 3LH1A 1DXWA 1GBFA 4I8GA 1FZZA 7GCHF 2BQWB 4UFDH 2BY8X 1C1PA 1SQAA 2HPQH 1QA0A 1SGYE 5A8ZA 2H1UA 1FI8A 3ATIA 3QZRA 2FX4A 3DFLA 3LGUA 1NFYA 1NS3A 3A81A 2IOTA 3OSYA 4A92A 1P8VC 3KQEA 1Q3XA 3DD2H 5EG4A 2AH4X 1HPGA 1QL9A 1SGTA 1A1RA 2ZP0H 3MOCA 3V13A 1SGQE 1TALA 1BTWA 4IS5A 1HAVB 1VITG 2ZDNA 1YPHC 1C5XB 2PR3A 2QN5T 1AB9C 3RXRA 1VCWA 1RTLA 1T4UH 4ESTE 1RGQA 2ZPSA 2GCHG 1ZJDA 3V7TA 1E34B 1AO5A 3K9XB 4B75A 1C1SA 5EQQA 2FI3E 3SU2A 1C5RA 1C5PA 5FBIA 1W7XH 1AFEH 5GPIB 2O8UA 1MTUA 2VIDA 2ZTXA 3HPTB 1PQAA 4BTIB 1A3BH 4CH2B 2PKAA 1BRBE 1RFNA 4GPGA 1GJDB 5AHGH 2PV9B 2P3FH 1TABE 1DPOA 4E7RG 5DKMA 1GG6C 5L2ZH 4DT7B 1GBDA 2FWWA 2NU4E 3GCTG 1O3EA 5EU8A 1O3DA 2GX4A 3KHVA 5DO4H 2HVXA 3JZ1B 2EI7A 3GY2A 1G3CA 2ZA5A 3S9CA 5C1YA 2R9PA 4NZQA 1UTKA 3K6YA 1TE0A 2XBYA 4DY7B 1QJ6B 1S6HA 1WAYB 3RXVA 1G2MA 1C1TA 2Z9GA 2OC1A 1GI0A 5G4BA 3GCHB 1AZZA 1E38B 3EQ0H 3QUMP 2AERH 3VFEA 3W95A 2BD3A 4WMFA 1OP2A 1F2SE 1L4DA 1IQHA 5HXFA 2Q6GA 1O3MA 3OU0A 4ZKOU 3V0XA 2GTBA 4WF8A 4NCYA 1BMAA 4K8YA 4JK6A 1ANEA 2ULLA 2BD8A 2Z9JA 5EOKA 3GCOA 1ZGVA 1PFXC 1A4WH 2A2XH 6GCHG 1K1IA 1BBRK 3SV2H 1F0UA 1PPHE 4IC5A 2ZZUH 3RXOA 1J16A 1SGPE 1IQNA 3TK5A 5IYTA 5C3NA 2STAE 1BBRE 1HIAA 1OSSA 1W14U 5FBEA 4B2AA 1GBLA 4FUIA 4X8TH 1C5NH 3FVFB 4NWLA 1FDPA 1XXFA 2VWNA 1NN6A 3ZZBA 3HK6B 1TA2A 1B0FA 1BIOA 3LC5A 3P70B 3T27A 3NUMA 1A5IA 1GDUA 3RMLH 1FMGA 3EGKH 1V2NT 3H5CB 2PHBA 1JWTA 4VGCC 1ELCA 3A8DA 3URCA 1UHBA 2H9HA 3MU1A 2PWXA 1P2IA 2TGPZ 3T5FH 1VZQH 2FDAA 1O5FH 3QGJA 3BEFB 1B0EA 1V2LT 4D8NA 2P95A 4MNVA 1EPTB 3OYPA 3KL6A 1BTYA 1ELFA 1SHYA 2ZHEH 1J15A 4DURA 1Q2WA 1T7CA 1Z1IA 4Y10E 2VH0A 1P12E 1XVMA 2ZGBH 4Q80A 3FP7E 1NRRH 2FX6A 1O37A 1QJ1B 4ZMAH 1XUJA 2A4RA 9LPRA 3K65B 3ZZAA 4LK4A 1ZYOA 2BOKA 4ZKSU 1T8NA 2A32A 3ZVDA 1C1QA 4X8SH 3RXPA 1UVSH 2SGQE 1IAUA 1XX9A 1XUGA 3U98H 1KLTA 2OCVB 2VIWA 5C5OA 3AAVA 3MWIU 2A31A 5DJ7A 1C5SA 1E35B 3M3SA 4XBCA 5EODA 1ZRKA 2A7HA 3MI4A 3MTYA 3BTDE 1K21H 1HBTH 4IMQA 3ZVBA 3HKIB 1O2YA 4OGXA 4OS5A 3SUFA 2WYGA 1D6RA 1NRPH 2CV3A 2G51A 3KGPA 3RXGA 2ZHQH 1HJ8A 5FAHA 1AGJA 2RA0A 4Q7XA 3KQDA 5FPYA 1GI2A 1O3NA 3QO6A 1HAPH 3QDZB 1N1LA 1DLKB 1ABJH 4FUFA 3LJJA 3SJIA 2ZG0H 1XKBC 1T4VH 3PROA 3UOPA 4UFGH 3LGIA 1PYTC 1UCYK 2ZU5A 2WV5A 1E37B 1OWJA 1DUAA 2C3SA 3EAJA 4LOYH 4Y8YA 4TY7A 1EAIA 2A2QH 3QK1A 3MO3A 2AIPA 4ZHLU 1IQMA 1JMOH 1UCYE 3SNDA 4XBDA 4BAHB 1GCTC 5HYOA 1BT7A 1CT4E 1O30A 1A2CH 3LGTA 2V35A 1DWEH 1M9UA 2UWPA 2TBSA 4AZ2B 4INHA 1TNHA 4E06H 3UWJH 4JZIA 3ZVCA 3TITA 4B2CA 4AFZA 1RTFB 2XBVA 5FPSA 4K1TA 3JZ2B 3ZZDA 1FV9A 1SGNE 1Z8RA 1MH0A 2WPHS 1O2WA 3BTHE 2XW9A 2BDYA 5F8TA 2SGEE 1P3EA 1KXBA 1SI5H 4ZH8A 1OXGA 3EA9A 3ELAH 3SU1A 4ZROA 1BRUP 1QA7A 1K1OA 4WXVA 4NWKA 4UFFH 2O8LA 4NSYA 3SUEA 3UWIA 4D7FA 3OY6U 1KXFA 4AX9H 4JZFH 8LPRA 4GAWA 1CQQA 1IQEA 1TYNA 3KN2A 3LJOA 3RUOA 5FCKA 1C4V2 1BITA 1O2PA 1MTVA 3Q3YA 1MZAA 4WMDA 1O33A 3MO9A 1BBRH 1BMMH 1OP0A 2C90B 4ABJA 1NM6A 3UUZA 1D9IA 3ATLA 4A1VA 1W3CA 1O3PB 3GDUA 1GMDG 4INKA 4NIXA 1ZTLA 4NA7A 2VWMA 1EPTC 1O3GA 3HATH 3Q3XA 1IQKA 1TPPA 1NFUA 4NIYA 4CRGA 4B1TA 1BJUA 2GZ9A 2H9EH 2XXLA 2FEQH 1O3BA 3S9AA 4AYVB 1C1RA 1HB0B 1AQ7A 1YF4A 3MU5A 1U6QA 4YOIA 3UIRA 1O38A 4SGBE 1DT2A 1EQ9A 1AKSA 1HAHH 3MNXA 6ESTA 1FNIA 1OWEA 5HGGA 2OBOA 4JZEH 4BXSA 8KME2 5DP6A 1OYTH 3TK9A 2A4QA 4X1PU 5T3HA 4AFQA 1ZJKA 1LHGH 4Q7YA 5JBTA 1PPFE 2SGPE 1HLTH 1GWAA 1ZHRA 5T6FA 3RMNH 1EASA 1AFQB 1AIXH 3M61U 3TH4H 3FP6E 1S85A 2QXGA 5GJ4B 3RXLA 3TPIZ 1LVYA 3A8BA 3RM0H 2XYAA 5T6GA 3E0PB 2H2ZA 4MQAA 2BM2A 1ID5H 1C1UH 1LHEH 3LGVA 3AW1A 1AMHA 5E8EH 2P93A 3RC6A 5EGMA 2ZECA 1YCPH 3KCGH 1OWKA 5EQRA 4WJG2 3A84A 2CJIA 1TPOA 1WQVH 1FY4A 1O2LA 5F8ZA 1K1LA 1ANDA 1F7ZA 1QRWA 3D65E 3GISB 2GMTC 3ZYEA 3TVJB 1HJ9A 2GP9B 2ANWA 4FUEA 4LZ4B 1Y3UA 2AEIH 1TAWA 5DPAA 3LT3A 1G3BA 1V6DA 5BPEA 3Q3KA 1SBWA 2FOGA 5FHTA 2ODYB 3FAOA 2ZIQH 1ESTA 5CHAB 1LPZB 2ZHFH 4U30A 3QGNB 1TQ7B 4CHAB 5LPEA 5F8XA 3SNAA 1QIXB 2CMYA 2F9PA 1AWFH 1Y5BT 3RXKA 1OS8A 3EYDA 3VPKA 2GZ7A 4ZKRU 1SMFE 2GCHF 4FVDA 1NU7B 1V2VT 2C8WB 3FP8E 2CF8H 4I33A 3SNEA 1FY5A 3A7YA 1QB9A 5GIBA 1TRMA 1GJ8B 3MH4A 1O5CB 2W5EA 1UCYH 4ABEA 1INCA 3UY9A 1EB2A 3U8TH 2HNTE 3S7HB 2RG3A 3ZZ4A 2QF0A 4CRBA 1E36B 3NKKA 1DM4B 1GJ4H 3GCTF 1AI8H 2FO9A 3GYMA 2PSXA 1PPBH 2UWOA 1J17T 1TX8A 3ESTA 1GHAF 2Z3CA 2VNTA 1JRSA 1YLCA 2FOMB 2CHAC 2QY0B 4DIIH 2CF9H 1TMTH 1XUIA 1HXEH 4D9RA 1H9IE 3HGNA 2BD5A 3LKWA 1YCPM 1X7AC 4U32A 4DVAU 3GY4A 4ABAA 3SU4A 4ABHA 3UNRA 1UTOA 1O3JA 1SG8B 5GCHG 1DWBH 1EAWA 3ZZ9A 2HPPH 1P02A 1EZUC 2BD4A 4FUDA 3SNCA 4D9QA 3TGKE 1SB1H 4ABGA 1WQSA 2W3IA 2P59A 7KMEH 2Z7FE 5C1UA 3RMOH 3V12A 3A7WA 4X2WA 3MNBA 2QV1A 1V2WT 3NCLA 1G3DA 4ZAEA 5BRRE 4X1SU 2VVCA 2ZGCA 3RXHA 1C9PA 1CT2E 2ZC9H 1K22H 2ZTZA 5HMAA 1GI4A 4I8HA 1GL0E 3RC5A 2Q1JA 4NFEA 3TH2H 2BLVA 3SJ9A 6GCHF 2PUXB 1G36A 2PSYA 1IHSH 4ZXYH 3UOUA 4Z0KA 2JH6D 3F9EA 2VH6A 1TLDA 1KTSB 2B8OH 4MPVA 1QBVH 3OTJE 1A0JA 1ORFA 2BD9A 1BZXE 1IQIA 1QQ4A 1V2UT 3RXFA 3DUXH 2AGIX 1SSXA 3GDSA 2OQ5A 2PGBB 1LTOA 2ZGHA 1QURH 5DP9A 1J9CH 1C1VH 2EC9H 1L1GA 1O2XA 1SGDE 4F4OC 4NZLA 4CRCA 2ALPA 1H4WA 1O2JA 3SV6A 2WPLS 4IC6A 3RM2H 4VGCB 3T29A 1FAKH 1UK3A 3SGBE 1UTJA 1XMNB 1UTMA 1FY1A 1IQJA 3GYLB 3H7OA 2PKAB 3S9BA 3O8BA 3T25A 3G01A 2Y81A 4YLQH 1Y3VA 1F5KU 3UQVA 1TMUH 3ZVAA 3ITIA 4ISNA 1DSUA 1O2OA 1ZMNA 3T26A 1RD3B 1KSNA 1ANCA 5FXLA 2SFAA 2D2DA 4WVPE 5A0CA 1TGSZ 3BTGE 3GY6A 2VIQA 2XCFA 2J95A 1NY22 1ZGIA 1KYNA 3BTKE 4OGYA 4Y8ZA 5CHAC 2F91A 5GDSH 1SLXB 2HLCA 2ZWLH 2VB0A 3VEQB 1QL8A 4CHAC 2F83A 3IITA 1GL1A 3ZVFA 1GDNA 3ZV8A 4X0WU 1UVTH 2IJOB 1BDAA 1H1BA 1YPKH 2R0KA 3A83A 2FP7B 1HUTH 3ZZ7A 3UFAA 1IQFA 1C5VA 1GMCG 3RXIA 3E16B 4CBOA 1DDJA 1NFWA 2H5DA 2HRVA 1P2MA 1P04A 1CSOE 3SQHE 5CE1A 1YPEH 1ZPCA 5C20A 3QLPH 4B73A 2QC2A 4D7GA 1GBMA 2DUCA 3MH6A 3ATMA 2ANYA 5ESTE 2J92A 1FLEE 1C4Y2 1CVWH 3C27B 4MLFB 1BHXF 1V2PT 4KTSA 1NO9H 3SUGA 1HIAB 1PPGE 4JCNA 2J2UA 4WH6A 1BTZA 3STIA 5C2ZA 1CA8B 2O8WA 1IQLA 1TOCB 1EZXC 2IN2A 1LHFH 2NU2E 3QWCH 4Y0YE 1GHBG 1WCZA 3RLYH 2TGDA 2OXSA 4ZHMU 2BMGB 2VVVA 1Y59T 4Y8XA 1AVXA 2AIQA 2NU0E 1P06A 2G81E 3MO6A 5L2YH 5DGJA 1QRZA 1YBWA 3MNSA 1SR5C 1TPAE 1UHBB 1DSTA 1GCTB 4NIWA 4Y6DA 2BY6X 1NROH 1J8AA 1MAXA 5EQSA 5L6NH 2FTLE 2EI8A 3TLOA 2BY9X 2SGAA 5DP7A 1C5UA 1YPMH 3F9GA 3LIWA 2FODA 1G3EA 1OKXA 4O9VA 2ZCHP 4DGJA 2ZKSA 3QZQA 4A7IB 2H6MA 3MH5A 1TGCA 4UEHH 5I25A 3FZZA 1YM0A 5EXMA 1QB6A 1K1NA 5CMXH 1QHRB 5HM2A 5TJXA 2G4UA 2XC5A 4Q2KA 1K1MA 1UMAH 2ZHWH 3D49H 4YOGA 1MMJN 2FI4E 1GMHG 1HDTH 2C8YB 2GKVE 3SI3H 4FUGA 3AAUA 3HK3B 1GJAB 1S83A 1SQOA 4WXIA 5A2MH 1O3CA 2UUYA 4J2YB 5K0HA 2ESTE 1NESE 1W0ZU 1MCVA 3VGCB 3ZZ8A 1V2OT 1ZTJA 1S0QA 4IGDA 1O2ZA 3HKJB 4FUHA 3P8OA 3WY8A 2QXHA 1UTQA 5LPRA 4QT8C 3TGIE 3U8RH 1FUJA 3PMBB 4WWYA 1P0SH 1BTUA 2FM2A 1A0LA 1O5BB 3BIVH 1AY6H 1ESBA 2J38A 3O8CA 4H4FA 1ZMJA 1GMDF 2BDAA 2ZFFH 4BTUB 3RXSA 1UVOA 1C5WB 2FOCA 2HALA 3PMJA 1TBRH 4K1EA 1LO6A 2H5CA 1O2SA 3U69H 4FU8A 1BRAA 2FMJA 4MNYA 4RKJB 1S6FA 1NZQH 3SW2B 2B9LA 2VWLA 1W0YH 4R8TB 1VGCB 1YCPK 2XBXA 2STBE 2PUQH 2XC4A 2A5AA 3TJUA 1SGIB 2ANMH 2R3UA 2RCEA 3ZV9A 4M7GA 2ZFTA 3PV4A 1CT0E 1ELTA 1XUFA 1D6WA 3L33A 5TCCA 5FX5A 1UTPA 2G00A 1A61H 2D26C 2ZQ2A 4HGCA 3NPSA 2FOAA 5TCAA 3SHCH 5C67A 2AFQB 4DW2U 3BTTE 2FPZA 3I77A 2BYAX 2G4TA 3ZZCA 1BRCE 1TIOA 8ESTE 3U1IB 1A46H 4CRAA 4Z6AH 2BD7A 1HCGA 1ZMLA 1N6XA 1F0SA 1SGFG 3ZZ3A 2R2WU 3BSQA 1PQ7A 2ZDMA 2FXRA 2ZDLA 2ZFPH 3SI4H 2YNBA 4A5TS 1BCUH 1EB1H 4DCDA 1P2JA 1LPGB 3BTFE 4ABBA 1MTWA 3A7ZA 1BUIA 2OLGA 2DE8A 2GMTB 1C2GA 1S82A 2WPIS 1LCYA 1LKBA 2WPJS 1Z71A 1A7SA 4GCHF 3RC4A 1GJCB 1HXFH 2GVFA 1V2MT 5E2OA 1GI7B 2QYIA 1DUEA 1DE7H 3RXQA 1MQ5A 2C8ZB 1JRTA 5F03A 1ELBA 1O2GH 1QR3E 3ODDA 1D3QB 1FJSA 3M5OA 1C1NA 5A0AE 4Y76A 1MKXK 2CGAA 4K8BA 3T62A 2ZCKP 4SGAE 2C8XB 2A0QB 1P10A 1G30B 4YT6H 4XSKU 1DXPA 1LKAA 2M5TA 3RP2A 4IMZA 3A86A 1O0DH 3RXTA 4INLA 1D3DB 2PLXA 1Y5AT 1DY8A 2AYWA 2BVRH 1KDQB 1AE5A 1C4U2 4OS1A 1GI5A 4O03A 2BHGA 1AKSB 5LGOA 4YT7H 1EP5A 3SU5A 5AF9H 3A89A 1IQGA 4AN7A 2LPRA 4K60A 2ZDVH 3QX5H 3KEEA 4ZXXH 1LDTT 1FIZA 1ZSLA 1BTPA 1YP9A 1GBKA 1TX7A 1GBTA 4X1NU 1SFIA 2F9OA 3M37A 4CBNA 2Y6TA 2CHAB 1BHXB 3KQCA 2ZQ1A 3SQEE 3BG8A 3VGCC 3MU4A 1MUEB 4XE4A 1O2MA 2ZU3A 1LQEA 1O2VA 1Z8JB 4FU7A 2A7JA 2G5NA 1H8DH 1NRQH 3UQOA 1O34A 2P16A 5GCHF 3A82A 2Z3DA 3PTNA 2ANKH 4UONA 2EEKA 5AFYH 1ZHMA 2QAAA 2GV6A 2C93B 2Z9KA 2SGFE 3PYHA 3E90B 3UREA 2FI5E 3K2UA 1O2HA 1CGHA 1CHOG 2PTCE 1AVWA 3FZDA 1SOZA 2BXUH 3NXPA 1KDQA 1TGBA 1FN8A 3M3TA 3DT0H 1W7GH 1NC6A 3SNBA 4DIHH 2NU3E 1VGCC 1YC0A 4CRDA 1EP6A 5ABWA 2A5KA 2Y5HA 2FYRA 1VJ9U 2H9TH 1YPGH 2F3CE 1NPMA 4MNWA 4MPUA 1O5EH 5JYIA 5A8YA 2QF3A 4JZ1A 4A1XA 1O2RA 1C1OA 4GLYA 1SGFA 1TBQH 3LU9B 2ZEBA 1RIWB 3E91A 1AVGH 2OC8A 3K6ZA 3NZIA 4DOQA 1GBCA 1UTLM 4CRFA 3S0NA 1S81A 1LQDB 4X2YA 4KKDA 1DX5M 1TNIA 1ELGA 1KY9A 3SV9A 2J94A 2Q6DA 1GI1A 1LVBA 1QBNA 1Z6JH 1DS2E 1VCQA 2WPKS 4MPXA 4JYUH 3BN9A 3I29A 3V3MA 3M5MA 1BA8B 4CR9A 4R0IA 1QTFA 5C1XA 1O5AB 3RXDA 4AFUA 1O36A 1O3IA 3P8NA 4ABFA 4U01A 2VIPA 5I46H 2GGVB 4OS7A 2ZPRA 2QCYA 2NWNA 1JOUB 1Y3YA 3PLBA 1C2KA 3RXBA 2V6NA 3E8LA 1CBWB 2XCNA 1EZSC 3E0NB 4KELA 2JKHA 1Y5UT 4X8UH 5DP8A 5PTPA 1BB0B 4PROA 1LMWB 4CR5A 3MMGA 4THNH 4YLUA 3SJKA 2CXVA 1N6YA 1WYKA 1QFKH 4BAQB 3AW0A 3D23A 1GHYH 1YPHE 3T28A 5LPFA 1O5DH 4I8JA 2ZGJA 3IWMA 4X1RU 4NIVA 1OWHA 1VITF 2WUBA 1G2LA 2THFB 4WH8A 2BZ6H 2XWBI
chains in the Genus database with same CATH superfamily
3C1KA 1EOJA 4AFSA 2BLQA 1T8MA 4AB8A 4MDSA 3LPRA 4B74A 1GMCF 2BY5X 1L4ZA 3OFND 3CP7A 1ZSJA 1XVOA 1MD7A 2QXIA 3GOVB 1FY3A 3A7XA 4O3TA 1LHCH 3A88A 1CO7E 1RRKA 1VR1H 3M7QA 2YMSD 2BVXH 4JK5A 2J34A 4OS6A 1BJVA 2BQ7B 4BANB 1C5YB 2XWAA 4OS4A 3QTVH 2R2MB 3F0OA 1JBUH 5T6DA 2GV7A 2A1DB 3SUDA 1ZHPA 1TX6A 1ZTKA 1TA6A 4UD9H 3R0FA 2IJD1 5CHBA 1F0TA 3PB1E 1ZOMA 1MKXH 3SN8A 1OP8A 1Q31A 2W7UA 4BXWA 3Q76A 3SHAH 1QJ7B 5KECA 3PTBA 1V2ST 4NA9H 1EX3A 4Q7ZA 1GHBF 3E6PH 1O3AA 3D62A 4ZKNU 1HAGE 6CHAB 1SGRE 1QCPA 4XBBA 1QY6A 3RU4E 1ARCA 1GBBA 3I78A 1C2JA 2WPMS 3F9FA 2ZHDA 2FLRH 3E1XB 2SNVA 1EAUA 1Z7KA 3BTEE 1FY8E 4Y7BA 1ZRBA 2HGTH 1TONA 3O8RA 2ODQA 1WTGH 2ZU4A 3M35A 4X6MA 4MNXA 5E0JA 4K2YA 3EA8A 4IN1A 1LPKB 4Y7AA 4HI3A 3BEUA 3DSPA 3LGYA 4X6PA 2UUJB 2XTTB 2VINA 3F1SB 1AD8H 2KAIA 1UVUH 1O32A 3SJOA 2R3YA 1K1PA 1WU1A 1ZR0A 2FTMA 4TSFD 1MTNC 2JETB 3SORA 2YMSC 1C5TA 1RIWC 1O3HA 1SGEE 1BOQA 1PPZA 3MH7A 2QGRA 1GMHF 5ESBA 2WZQA 1C2DA 2FESH 1NRNH 3SV7A 3MYWA 1C2LA 1ETTH 1MTSA 4TWYA 2VJ1A 1SHHB 4E05H 2KCOA 2IPQX 2O8MA 4I7YH 3VXFH 1FX0B 2V0BA 3SGQE 3P8GA 4TPYA 1CGJE 1GPZA 2OBQA 2K1QA 2SGDE 3A80A 1OYQA 4B2BA 3WWBA 2FS9A 4CH8B 2Z9IA 4E7NA 1AU8A 3PO1C 5EJ1A 1CBWC 1EJNA 2BB4A 1F5RA 2BXTH 1EJAA 4ABDA 5AFZH 1MAYA 3M36A 3CS0A 1C1MA 4A1TA 5GXPA 1GJ5H 2ZO3H 2J98A 2RDLA 1LHDH 5F53A 5B6OA 3TU7H 1GHVH 1HNEE 1SPJA 2AGGX 3BTQE 1DY9A 5IDKA 2GD4B 4TYDA 4O97A 3N99A 2ZPQA 1AN1E 2DE9A 3DCLA 3RU4D 2BX3A 1P9SA 5GWZA 1PQ5A 2P3TB 3O8DA 3ZZ5A 4UE7H 1JXPA 4NG9H 2PKSB 3RDZA 4MPWA 5A8XA 3F6UH 3UR9A 3Q00A 1UW7A 3LH3A 2OQUA 2KM0A 2EA3A 1O3OA 2PGQB 3ZIAD 5A09A 4H42U 8GCHG 1TNKA 1HGTH 1XM1A 4NFFA 3A85A 4OM9A 1T8LA 1WOFA 1CHGA 1HRTH 4JYTA 1GHWH 3AASA 1HV7A 1O35A 2GDEH 5E0HA 1B5GH 5EJLA 1RS0A 2P8OC 2TPIZ 4GVUA 1BMLA 1THPB 4DJZB 5IK2D 1O2IA 5FX6A 2Y5FA 3GY5A 5JBAS 1MBMA 4IBLH 4NSVA 4FXGH 1CA0B 4Y11E 3P92A 3B23B 3EDXB 3ZVEA 4AORA 1EJMA 3U8OH 2OP9A 1KLJH 1UK4A 1C2FA 1KIGH 1GBJA 3KF2A 1WV7H 4BNRA 2HNTC 3NWUA 1C5MD 4CREA 2FIRH 1N8OC 2ZCLP 3M7TA 6CHAC 3UR6A 1GHAG 3U1JB 4I8LA 3BEIB 5DP5A 3SV8A 1W8BH 2F9VA 1ANBA 3HGPA 1AHTH 3QTOH 1EUFA 1O3KA 1SKYE 1GBEA 1GI6A 2R0LA 5JDUB 1XUHA 4NA8A 2W7SA 2FOFA 1D3PB 1KTTB 3SOSA 3WWFA 3EA7A 4XOJA 2GCTC 3GICB 1J14A 2ZU1A 3STJA 1HAVA 3PLKA 1P11E 2RA3A 1ZLRA 5ETXA 4FUBA 4MG3A 4AG2A 2Z6BD 4MTBA 1GI3A 1XKAC 4RT1A 1XXDA 4ZUHA 3MHWU 1AZ8A 1S5SA 2LP6A 1EATA 7LPRA 1C5LH 5FCRA 3BG4B 4FU9A 2OC7A 2FOEA 3GDVA 3BF6H 1V2TT 3RXMA 4KGAA 1O2TA 3P8FA 2JETC 1DITH 3OX7U 1FAXA 1H9LB 4YOJA 1YPJH 1OWDA 2HOBA 2SNWA 2YNAA 3PWBA 2AMPA 3IG6B 1BMNH 5B6LA 2OTVA 3DSOA 1GI9B 1O5GH 5EW2H 2BDHA 2ZF0H 1HAZB 2B7DH 2P94A 1C2IA 1TNGA 4J1YA 1WUNH 2BLOA 5F6MA 2XNIA 1YPLH 3UNSA 4ABIA 2ZFQH 1W10U 2B0FA 2VGCB 3H7TA 3BIUH 3B9FH 1AWHB 1SFQB 2O8TA 2Q6FA 4FETA 4RI0A 1AE8H 2UUKB 2FLBH 1H9HE 1P9UA 3S7KB 1P57B 3A7VA 1P2QA 2D1JA 3P95A 2GJGA 1TNLA 2OINA 4Y0ZE 5DN6D 1F92A 2O9QA 1O39A 1QBOA 2WPDD 1O2UA 1FPHH 1CHOF 1NTPA 3RXEA 1V3XA 7GCHG 1GVLA 4LXBH 1EFRD 2AMQA 5JBBS 2Y7ZA 1SGCA 2FOHA 1IHTH 1S6LA 3VXEH 1PYTD 1Z6EA 1CGIE 2VIVA 1G9IE 4U2WA 3GY3A 4XFQA 5J4SA 1QQUA 1F5LA 3SGAE 4H6SB 1ZPZA 4Z1MD 4K3JA 2P3UB 5E2PA 4UDWH 2ZFRH 3MU8A 2FOBA 3SBKA 5J4QA 2C4FH 3M7UA 5H4IB 2G52A 3F2FA 4X6OA 3VB3A 3FANA 2UWLA 2PKSC 2A4GA 5SGAE 1ESAA 2J5UA 4IW4E 1HAOH 2FS8A 1H8IH 4TWWA 6LPRA 4X2VA 4X6NA 1LVMA 2BVSH 4YXWD 1C2EA 1K1JA 1MQ6A 4WY3A 2EI6A 3M5LA 3PLPA 4X2XA 3SU6A 1O2KA 1SL3A 1ELAA 1H8ED 1DFPA 2FYQA 1ARBA 4B76A 1UJ1A 4ISIH 3TNTA 1D3TB 3L3TA 1MCTA 1HAIH 4AGKA 5K7RA 1T32A 1A5HA 3TIUA 1SLVB 1MKWK 4BTTB 3TJNA 1ELDE 1V2JT 2RFKC 1FXYA 1EXFA 3DHKH 2HNTF 3BTME 1CA0C 4FOUC 2WINI 1ELEE 2ZI2H 1SLWB 4BOHA 3SZNA 1QNJA 4LZ1H 1C5QA 2YOLA 2Z3EA 2HLDD 1FN6A 3PMHB 1GGDB 2WHXA 1C2MA 1EPTA 3VB6A 1WTHD 2BQ6B 2PTNA 1P2OA 3OAAD 4KTCA 1Z8GA 1V2RT 2ASUB 2AMDA 2Y5GA 2BTCE 2BY7X 2VIOA 5L30H 9ESTA 4X1QU 3ZYDA 4ISOA 1K2I1 3TNSA 2V3OH 1Y8TA 1CU1A 1L1NA 1SLUB 1DANH 4B71A 3RXCA 3GCHC 2QF4A 3RMMH 4XD7D 1JIRA 1EKBB 3F9HA 2G8TA 3CENA 1C5ZB 3ATKA 1WSSH 1CE5A 2F9UA 1NU9A 1ABIH 1SQTA 4AG1A 3PV2A 4GHQA 4F49A 4BAMB 3RXAA 3U9AH 2J4IA 3BG4C 1T31A 4HTCH 4AOQA 3E3TA 1W2KH 5JB8S 4XDEA 1VITH 2ZGXH 1GVKB 1OWIA 3SO3A 5JPMH 5JBCS 1VJAU 3M3VA 4GSOA 1TFXA 3VB4A 3NK8A 1V2QT 1EZQA 2WYJA 2JH0D 3OY5U 4ISHH 4JMYA 1GJ9B 1W0JD 2WUCA 4K1SA 2BOHB 2LNCA 1S0RA 3LGWA 5EPYA 2Z9LA 4HFPB 4D76A 2A5IA 1RJXB 3UNQA 4GUXA 1UO6A 3LOXA 1O3FA 1KXDA 1V2KT 2VGCC 1HFDA 5C0UA 3GY8A 2OC0A 1GJ7B 2XNDD 2TRMA 2XBWA 3PMAB 2CN0H 2QIQA 2PW8H 4FVBA 4AYYB 3A8AA 1P2NA 3TGJE 1HJAB 1A0HB 1YGCH 5AVDA 4ISLA 3A7TA 1GJ6A 3T2NA 1UTNA 5E0GA 2ZTYA 1DWCH 4AB9A 2BDBA 1B7XB 2RDEA 2B5TB 3LONA 1RXPA 3SZEA 3EE0B 4KTUA 7ESTE 4ASHA 2I6QA 1ZPBA 2OUAA 4XRNA 1O3LA 2A4OA 2A45B 4O3UA 1K9OE 4Y79A 1MTNB 1L2EA 3UTUH 2YMSB 4TY6A 4FUJA 1RTKA 1FPCH 2G5VA 1PQ8A 2BX4A 3OTPA 4NGAH 1THRH 2VWOA 2W6JD 1AUJA 2BZAA 1A5GH 1O2QA 1ZSKA 4OS2A 4HG6A 5KEDA 2TGAA 2QA9E 2G55A 1EAXA 2BD2A 1KLIH 3LDXH 4FUCA 4H6TA 3VB7A 1ETRH 1K28D 1WBGB 2OD3B 1L1JA 2Y80A 2JIZD 4I32A 1SVPA 1NFXA 3P17H 2TGTA 3SU3A 3VB5A 1OX1A 4YTAA 4BAOB 1EOLA 3P6ZB 4RN6A 4RSPA 1GVZA 4A6LA 3DA9B 3PO1B 4RKOB 1OOKB 2KFWA 3R3GB 4HZHA 4Y71A 2Z94A 5JB9S 2ILNA 4X8VH 1GBHA 2JJ1D 2ALVA 2TIOA 2JH5D 1P3CA 4JZDH 1L0ZA 1W12U 1O2NA 1THSH 1NBMD 2HWLB 3LC3A 1GGDC 2WV4A 1P03A 1DICA 1LVOA 2VU8E 1PJPA 1OPHB 3RLWH 2AS9A 2BDIA 2UUFB 5EPNA 3RXJA 3OEED 4GCHG 3URDA 1NRSH 1ZZZA 4MVNA 5A0BA 1F0RA 3NRLA 5FPTA 1PPCE 4ACAA 1KXEA 4JYVH 3L6PA 1MKWH 4BAKB 1MD8A 4YZUA 1XUKA 3FFGA 3RU4T 4K69A 2V3HH 1C9TA 3B8JA 1AB9B 1BTHH 1E0FD 5HM9A 1TNJA 3KQBA 2GZ8A 8GCHF 3QN7A 3F68H 3Q77A 1QGFA 5EXLA 1YLDA 3F2GA 2KAIB 4IN2A 1QRXA 3ATWA 1AUTC 2P8OB 1P05A 2BLWA 1P2KA 3PM3A 3RXUA 3UPEA 2FZZA 1VKYA 2F9NA 3MNCA 1ACBE 2GDDA 4UFEH 2AGEX 2I6SA 3TJOA 1FIWA 4I31A 2PFEA 4YESB 3GCNA 1DWDH 1UVPA 1D4PB 1QL7A 4WMEA 1TOMH 3SJ8A 2A7CA 3BV9B 3KNXA 2GT8A 2NU1E 4I8KA 1ETSH 2BDCA 1GG6B 2F4LA 1GI8B 5LH8A 1QB1A 1TPSA 2ZU2A 1IOEA 2W3KA 1N8OB 3TH3H 4YO9A 1TRYA 2GT7A 1YYY1 1GDQA 5EXNA 1BQYA 1Z8IB 1W13U 3CS7A 1UK2A 1HJAC 1BTXA 1A3EH 1GHXH 2GCTB 5DG6A 2IPHA 1DOJA 1FQ3A 1MU8B 2QXJA 1Y3XA 1P01A 4ZHAA 3KIDU 2J98B 2W26A 1C1WH 3DFJA 2KCYA 4DG4A 4K5ZA 1HAYB 1TMBH 2EY4C 4TPIZ 3A87A 3MU0A 1HAXB 1GCDA 2ODPA 1T8OA 1MZDA 4KP0A 3N7OA 3GY7A 5DK1A 1G32B 2ZFSA 3W94A 1TB6H 1TWXB 3TK6A 2XC0A 1ELVA 1MU6B 1TBZH 1G37A 3ZZ6A 1W11U 1VCPA 3ENSB 1DVAH 3TJVA 2J9NA 3ZVGA 1GBIA 1TGNA 1Z1JA 3OEHD 5DP4A 2ZNKH 1KXCA 1HYLA 1Y3WA 1S84A 1TQ0B 2Y7XA 1GBAA 1GJBB 2Y82A 3AVZA 1WXRA 1P09A 1GHZA 3PWCA 1PPEE 1TGTA 1NT1A 2BDGA 4YM9A 4GHTA 3SU0A 3MFJA 4AGJA 2D8WA 1SOTA 1AFQC 1DLEA 2ZDAH 1O31A 1JIMA 1MBQA 1C5OH 3BTWE 2VVUA 3M5NA 3S69A 2ZDKA 2F9BH 5C5NA 5EW1H 1YKTA 1FONA 3ODFA 1C2HA 1KXAA 1TRNA 3A8CA 5DP3A 2XRCA 1SC8U 3LH1A 1DXWA 1GBFA 4I8GA 1FZZA 7GCHF 2BQWB 4UFDH 2BY8X 1C1PA 1SQAA 2HPQH 1QA0A 1SGYE 5A8ZA 2H1UA 1FI8A 3ATIA 3QZRA 4B6FA 2QF5A 2FX4A 3DFLA 3LGUA 1NFYA 1NS3A 3A81A 2IOTA 4AC9A 3OSYA 4A92A 1P8VC 3KQEA 1Q3XA 3DD2H 5EG4A 2AH4X 1HPGA 1QL9A 1SGTA 1A1RA 2ZP0H 3MOCA 3V13A 1SGQE 1TALA 1BTWA 4IS5A 1HAVB 1VITG 2ZDNA 1YPHC 1C5XB 2PR3A 2QN5T 1AB9C 3RXRA 1VCWA 1RTLA 1T4UH 4ESTE 1RGQA 2ZPSA 2GCHG 1ZJDA 3V7TA 1E34B 1AO5A 3K9XB 4B75A 1C1SA 5EQQA 2FI3E 3SU2A 1C5RA 1C5PA 5FBIA 1W7XH 1AFEH 5GPIB 2O8UA 1MTUA 2VIDA 2ZTXA 3HPTB 1PQAA 1WDIA 4BTIB 1A3BH 4CH2B 2PKAA 1BRBE 1RFNA 2KR7A 4GPGA 1GJDB 5AHGH 2PV9B 2P3FH 1TABE 1DPOA 4E7RG 5DKMA 1GG6C 5L2ZH 4DT7B 1GBDA 2FWWA 2NU4E 3GCTG 1O3EA 5EU8A 1O3DA 2GX4A 3KHVA 5DO4H 2HVXA 3FOAA 3JZ1B 2EI7A 3GY2A 1G3CA 2ZA5A 3S9CA 5C1YA 2JDID 2R9PA 4NZQA 1UTKA 3K6YA 1TE0A 2XBYA 4DY7B 5CDFE 1QJ6B 1S6HA 2QE7D 1WAYB 3RXVA 1G2MA 1C1TA 2Z9GA 2OC1A 1GI0A 5G4BA 3GCHB 1AZZA 1E38B 3EQ0H 3QUMP 2AERH 3VFEA 3W95A 2BD3A 4WMFA 1OP2A 1F2SE 1L4DA 1IQHA 5HXFA 2Q6GA 1O3MA 3OU0A 4ZKOU 3V0XA 2GTBA 4WF8A 4NCYA 1BMAA 4K8YA 4JK6A 1ANEA 2ULLA 2BD8A 2Z9JA 5EOKA 3GCOA 2HVYB 1ZGVA 1PFXC 1A4WH 2A2XH 6GCHG 1K1IA 1BBRK 3SV2H 1F0UA 1PPHE 4IC5A 2ZZUH 3RXOA 1J16A 1SGPE 1IQNA 3PRDA 3TK5A 5IYTA 5C3NA 2STAE 1BBRE 1HIAA 1OSSA 1W14U 5FBEA 2AHME 4B2AA 1GBLA 4FUIA 4X8TH 1C5NH 3FVFB 4NWLA 1FDPA 1XXFA 2VWNA 1NN6A 3ZZBA 3HK6B 1TA2A 1B0FA 1BIOA 3LC5A 3P70B 3T27A 3NUMA 1A5IA 1GDUA 3RMLH 4F48B 1FMGA 3EGKH 1V2NT 2WSSD 3H5CB 2PHBA 1JWTA 5EIYA 4VGCC 1ELCA 3A8DA 3URCA 1UHBA 2H9HA 3MU1A 2PWXA 1P2IA 2TGPZ 5C17A 2VBCA 3T5FH 1VZQH 2FDAA 1O5FH 3QGJA 3BEFB 4F55A 1B0EA 1V2LT 4D8NA 2P95A 4MNVA 1EPTB 3OYPA 3FN8A 3KL6A 1BTYA 1ELFA 1SHYA 2ZHEH 1J15A 4DURA 1Q2WA 1T7CA 1Z1IA 4Y10E 2VH0A 1P12E 1XVMA 2ZGBH 4Q80A 3FP7E 1NRRH 2FX6A 1O37A 1QJ1B 2M2AA 4ZMAH 1XUJA 2A4RA 3FKSD 9LPRA 3K65B 3ZZAA 4LK4A 1ZYOA 2BOKA 4ZKSU 1T8NA 2A32A 3ZVDA 1C1QA 4X8SH 3RXPA 1UVSH 2SGQE 1IAUA 1XX9A 1XUGA 3U98H 1KLTA 2OCVB 2LELA 5C0TA 2VIWA 5C5OA 3AAVA 3MWIU 2A31A 5DJ7A 1C5SA 1E35B 3M3SA 4XBCA 5EODA 1ZRKA 2A7HA 3MI4A 3MTYA 3BTDE 1K21H 1HBTH 4IMQA 3ZVBA 3HKIB 1O2YA 4OGXA 4OS5A 3W1EA 3SUFA 2WYGA 1D6RA 1NRPH 2CV3A 2G51A 3KGPA 3RXGA 2ZHQH 1HJ8A 5FAHA 1AGJA 2RA0A 4Q7XA 3KQDA 5FPYA 1GI2A 1O3NA 3QO6A 1HAPH 3QDZB 1N1LA 2KCAA 1DLKB 1ABJH 4FUFA 3LJJA 3SJIA 2ZG0H 1XKBC 1T4VH 3PROA 3UOPA 4UFGH 3LGIA 1PYTC 1UCYK 2ZU5A 2WV5A 2F43B 1E37B 1OWJA 1DUAA 2C3SA 3EAJA 4LOYH 4Y8YA 4TY7A 1EAIA 2A2QH 3QK1A 3MO3A 2AIPA 4ZHLU 1IQMA 1JMOH 1UCYE 3SNDA 3UAIC 1BMFD 4XBDA 4BAHB 1GCTC 5HYOA 1BT7A 1CT4E 1O30A 3PRBA 1A2CH 3LGTA 2V35A 1DWEH 1M9UA 2UWPA 3FO8D 2TBSA 4AZ2B 4INHA 1TNHA 2WV9A 4E06H 3UWJH 4JZIA 3ZVCA 3TITA 4B2CA 4AFZA 1RTFB 2XBVA 5FPSA 4K1TA 3JZ2B 3ZZDA 1FV9A 4B6EA 1SGNE 1Z8RA 1MH0A 2WPHS 1O2WA 3BTHE 2XW9A 2BDYA 5F8TA 2SGEE 1P3EA 1KXBA 1SI5H 4ZH8A 1OXGA 3EA9A 1KMHB 3ELAH 3SU1A 4ZROA 1BRUP 1QA7A 1K1OA 4WXVA 4NWKA 4UFFH 2O8LA 2V3MA 4NSYA 2L74A 3SUEA 3UWIA 4D7FA 3OY6U 1KXFA 4AX9H 4JZFH 8LPRA 4GAWA 1CQQA 1IQEA 1TYNA 3KN2A 3LJOA 3RUOA 5FCKA 1C4V2 1BITA 1O2PA 1MTVA 3Q3YA 1MZAA 4WMDA 1O33A 3MO9A 1BBRH 1BMMH 1OP0A 2C90B 4ABJA 1NM6A 3UUZA 1D9IA 3ATLA 4A1VA 1W3CA 1O3PB 3GDUA 1GMDG 4INKA 4NIXA 1ZTLA 4NA7A 2VWMA 1EPTC 1O3GA 3HATH 3Q3XA 1IQKA 2CK3D 1TPPA 1YLNA 1NFUA 4NIYA 4CRGA 4B1TA 1BJUA 2GZ9A 2H9EH 2XXLA 2FEQH 1O3BA 3S9AA 4AYVB 1C1RA 1HB0B 1AQ7A 1YF4A 3MU5A 1U6QA 4YOIA 3WW7A 3UIRA 1O38A 4SGBE 1DT2A 1EQ9A 1AKSA 4P02A 5HKKD 1HAHH 1YWUA 3MNXA 6ESTA 1FNIA 1OWEA 5HGGA 2OBOA 4JZEH 4BXSA 8KME2 5DP6A 1OYTH 3TK9A 2A4QA 4X1PU 5T3HA 4AFQA 1ZJKA 1LHGH 4Q7YA 5JBTA 1PPFE 2SGPE 1HLTH 1GWAA 1ZHRA 5T6FA 3RMNH 1EASA 1AFQB 1AIXH 3M61U 3TH4H 3FP6E 1S85A 2QXGA 5GJ4B 3RXLA 3TPIZ 1LVYA 3A8BA 3RM0H 2XYAA 5T6GA 3E0PB 2H2ZA 4MQAA 2BM2A 1ID5H 1C1UH 1LHEH 3LGVA 3AW1A 1AMHA 5E8EH 2P93A 3RC6A 5EGMA 2ZECA 1YCPH 3KCGH 1OWKA 5EQRA 4WJG2 3A84A 2CJIA 1TPOA 1WQVH 1FY4A 1O2LA 5F8ZA 1K1LA 1ANDA 1F7ZA 1QRWA 3D65E 3GISB 2GMTC 3ZYEA 3TVJB 1HJ9A 2GP9B 2ANWA 4FUEA 4LZ4B 1Y3UA 2AEIH 1TAWA 5DPAA 3KYFA 3LT3A 1E1RD 3UB0A 1G3BA 1V6DA 5BPEA 3Q3KA 1SBWA 2FOGA 5FHTA 5GNDA 2ODYB 3FAOA 2ZIQH 1ESTA 5CHAB 1LPZB 2ZHFH 4U30A 3QGNB 1TQ7B 3GS9A 4CHAB 5LPEA 1E1QD 5F8XA 3SNAA 1QIXB 2CMYA 2F9PA 1AWFH 1Y5BT 3RXKA 1OS8A 3EYDA 1OHHD 3VPKA 2GZ7A 4ZKRU 1SMFE 2GCHF 4FVDA 1NU7B 1V2VT 2C8WB 2OK5A 3FP8E 2CF8H 4I33A 3SNEA 1FY5A 3A7YA 1QB9A 5GIBA 1TRMA 1GJ8B 3MH4A 1O5CB 2W5EA 1UCYH 4ABEA 1INCA 3UY9A 4TT3D 2L6OA 1EB2A 3U8TH 2HNTE 3S7HB 2RG3A 3ZZ4A 2V7QD 2QF0A 4Q4LA 4CRBA 1E36B 3NKKA 1DM4B 1GJ4H 3GCTF 1AI8H 2FO9A 3GYMA 2PSXA 1PPBH 2UWOA 1J17T 1TX8A 3ESTA 1GHAF 2Z3CA 2VNTA 1JRSA 1YLCA 2FOMB 2CHAC 2QY0B 4DIIH 2CF9H 1TMTH 1XUIA 1HXEH 4D9RA 1H9IE 3HGNA 2BD5A 3LKWA 1YCPM 1X7AC 2KX4A 4U32A 4DVAU 3GY4A 4ABAA 3SU4A 4ABHA 3UNRA 1UTOA 1O3JA 1SG8B 5GCHG 1DWBH 1EAWA 3AK5A 3ZZ9A 2HPPH 1P02A 1EZUC 2BD4A 2KZ4A 4FUDA 3SNCA 4D9QA 1SB1H 3TGKE 4ABGA 1WQSA 2W3IA 2P59A 7KMEH 2Z7FE 5C1UA 3RMOH 3V12A 3A7WA 4X2WA 3MNBA 2QV1A 1QZ8A 1V2WT 3CNRA 4I86A 3NCLA 1G3DA 1H8HD 4ZAEA 5BRRE 4X1SU 2VVCA 2ZGCA 3RXHA 3N7DA 1C9PA 1CT2E 2ZC9H 1K22H 2ZTZA 5HMAA 1GI4A 4I8HA 1GL0E 3RC5A 2Q1JA 4NFEA 3TH2H 2BLVA 3SJ9A 6GCHF 2PUXB 1G36A 2PSYA 1IHSH 4ZXYH 3UOUA 4Z0KA 2JH6D 3F9EA 2VH6A 1TLDA 1KTSB 2B8OH 4MPVA 1QBVH 3OTJE 1A0JA 1ORFA 2BD9A 1BZXE 1IQIA 1QQ4A 2EQNA 1V2UT 3RXFA 3DUXH 2AGIX 1SSXA 3GDSA 2OQ5A 1W0KD 2PGBB 1LTOA 2ZGHA 1QURH 5DP9A 1J9CH 1C1VH 2EC9H 2KCPA 1L1GA 1O2XA 1SGDE 4Q63A 4F4OC 4NZLA 4CRCA 2ALPA 1H4WA 1O2JA 3SV6A 2WPLS 4IC6A 3RM2H 4VGCB 5FL7D 3T29A 1FAKH 1UK3A 3SGBE 1UTJA 1XMNB 1UTMA 1FY1A 1IQJA 3GYLB 3H7OA 2PKAB 3S9BA 3O8BA 3T25A 3G01A 2Y81A 4YLQH 1Y3VA 1F5KU 3UQVA 1TMUH 4RT0A 3ITIA 3ZVAA 4ISNA 1DSUA 1O2OA 1ZMNA 3T26A 1RD3B 1KSNA 1ANCA 5FXLA 2SFAA 2D2DA 4WVPE 5A0CA 1TGSZ 3BTGE 3GY6A 2VIQA 2XCFA 2J95A 1NY22 1ZGIA 1KYNA 3BTKE 4OGYA 4Y8ZA 5CHAC 2F91A 5GDSH 1SLXB 2HLCA 2ZWLH 2VB0A 3VEQB 1QL8A 4CHAC 2F83A 3IITA 1GL1A 3ZVFA 1GDNA 3ZV8A 4X0WU 1UVTH 2IJOB 1BDAA 1H1BA 1YPKH 3F3BA 2R0KA 3A83A 2FP7B 1HUTH 2K0QA 3ZZ7A 3UFAA 1IQFA 1C5VA 1GMCG 3RXIA 3E16B 4CBOA 1DDJA 1NFWA 2H5DA 2HRVA 1P2MA 1P04A 1CSOE 3SQHE 5CE1A 1YPEH 1ZPCA 5C20A 3QLPH 4B73A 2QC2A 4D7GA 1GBMA 2DUCA 3MH6A 3ATMA 2ANYA 5ESTE 2J92A 1FLEE 1C4Y2 1CVWH 3C27B 3F2HA 4MLFB 1BHXF 1V2PT 4KTSA 1NO9H 3F0PA 3SUGA 1HIAB 1PPGE 2W6ID 4JCNA 2J2UA 4WH6A 1BTZA 3STIA 5C2ZA 1CA8B 2O8WA 1IQLA 1TOCB 1EZXC 2IN2A 1LHFH 2NU2E 3QWCH 4Y0YE 1GHBG 1WCZA 3RLYH 2TGDA 2OXSA 4ZHMU 2BMGB 2VVVA 4ZCNA 1Y59T 4Y8XA 1AVXA 2AIQA 2NU0E 1P06A 2G81E 3MO6A 5L2YH 5DGJA 1QRZA 5KGOA 1YBWA 3MNSA 1SR5C 1TPAE 1UHBB 2J97A 1DSTA 1GCTB 4NIWA 4Y6DA 2BY6X 1NROH 1J8AA 1MAXA 5EQSA 5L6NH 2FTLE 2EI8A 3TLOA 2BY9X 2SGAA 5DP7A 1C5UA 1YPMH 3F9GA 3LIWA 2FODA 1G3EA 3MQKC 1OKXA 4O9VA 2ZCHP 4DGJA 2ZKSA 3QZQA 4A7IB 2H6MA 3MH5A 1TGCA 4UEHH 5I25A 3FZZA 1YM0A 5EXMA 1QB6A 1K1NA 5CMXH 1QHRB 5HM2A 5TJXA 2G4UA 2XC5A 4Q2KA 1K1MA 1UMAH 2ZHWH 3D49H 4YOGA 1MMJN 2FI4E 1GMHG 1HDTH 2C8YB 2GKVE 3SI3H 4FUGA 3AAUA 3HK3B 1GJAB 1S83A 1SQOA 4WXIA 5A2MH 1O3CA 3DSGA 2UUYA 4J2YB 5K0HA 2ESTE 1NESE 1W0ZU 1MCVA 3VGCB 3ZZ8A 1V2OT 1ZTJA 3N7EA 1S0QA 4IGDA 1O2ZA 3HKJB 4FUHA 3P8OA 3WY8A 2QXHA 1UTQA 5LPRA 4P00A 4QT8C 3TGIE 3U8RH 1FUJA 3PMBB 4WWYA 1P0SH 1BTUA 2FM2A 1A0LA 1O5BB 3BIVH 4M9FA 1AY6H 1ESBA 1MABB 2J38A 3O8CA 4H4FA 1ZMJA 1GMDF 2BDAA 2ZFFH 4BTUB 3RXSA 1UVOA 1C5WB 2FOCA 2HALA 3PMJA 1K0HA 1TBRH 4K1EA 1LO6A 2H5CA 1O2SA 3U69H 4FU8A 1BRAA 1E79D 2FMJA 3PV5A 4MNYA 4RKJB 1S6FA 1NZQH 3SW2B 2B9LA 2VWLA 1W0YH 4R8TB 1VGCB 1YCPK 1YY3A 2XBXA 2STBE 2PUQH 2XC4A 2A5AA 3TJUA 1SGIB 2ANMH 2R3UA 2K8IA 2RCEA 3ZV9A 4M7GA 2ZFTA 3PV4A 1CT0E 1ELTA 1XUFA 1D6WA 3L33A 5TCCA 5FX5A 3VG8A 1UTPA 2G00A 3KQ5A 1A61H 2D26C 2ZQ2A 4HGCA 3NPSA 2FOAA 5TCAA 3SHCH 5C67A 2AFQB 4DW2U 3BTTE 2FPZA 3I77A 2BYAX 1SQRA 2G4TA 3ZZCA 1BRCE 1TIOA 8ESTE 3U1IB 1A46H 4CRAA 4Z6AH 2BD7A 1HCGA 1ZMLA 1N6XA 1F0SA 1SGFG 3ZZ3A 2R2WU 3BSQA 3KYGA 1PQ7A 2ZDMA 2FXRA 2ZDLA 2ZFPH 3SI4H 2YNBA 4A5TS 1BCUH 1EB1H 4DCDA 1P2JA 1LPGB 3BTFE 4ABBA 1MTWA 3A7ZA 1BUIA 2DE8A 2GMTB 2OLGA 1C2GA 1S82A 2WPIS 1LCYA 1LKBA 2WPJS 1Z71A 1A7SA 4GCHF 3RC4A 1GJCB 1HXFH 2GVFA 1V2MT 5E2OA 1GI7B 2QYIA 1DUEA 1DE7H 3RXQA 1MQ5A 2C8ZB 1JRTA 5F03A 1ELBA 1O2GH 1QR3E 3ODDA 1D3QB 1FJSA 3M5OA 1C1NA 5A0AE 4Y76A 1MKXK 2CGAA 4K8BA 3T62A 2ZCKP 4SGAE 2C8XB 2A0QB 1P10A 1G30B 4YT6H 4XSKU 1DXPA 1LKAA 1COWD 2M5TA 3RP2A 4IMZA 3A86A 1O0DH 3RXTA 4INLA 1D3DB 2PLXA 1Y5AT 1DY8A 2AYWA 2BVRH 1KDQB 3OE7D 1AE5A 1C4U2 4OS1A 1GI5A 4O03A 2BHGA 1AKSB 4ACBA 5LGOA 4YT7H 1EP5A 3SU5A 5AF9H 3A89A 1IQGA 4AN7A 2LPRA 4K60A 2ZDVH 3QX5H 3KEEA 4ZXXH 1LDTT 1FIZA 1ZSLA 1BTPA 1YP9A 3U28C 1GBKA 1TX7A 1GBTA 4X1NU 1SFIA 2F9OA 3M37A 1NBME 2Y6TA 4CBNA 2CHAB 1BHXB 3KQCA 2ZQ1A 3SQEE 3BG8A 3VGCC 3MU4A 1MUEB 4XE4A 1O2MA 2ZU3A 1LQEA 1O2VA 1Z8JB 4FU7A 2A7JA 2G5NA 1H8DH 1NRQH 3UQOA 1O34A 2P16A 5GCHF 3A82A 2Z3DA 3PTNA 2ANKH 4UONA 2EEKA 5AFYH 1ZHMA 2QAAA 2GV6A 2C93B 2Z9KA 2SGFE 3PYHA 4ASUD 3E90B 3UREA 2FI5E 3K2UA 1O2HA 1CGHA 1CHOG 5HIZA 2PTCE 1AVWA 3FZDA 1SOZA 2BXUH 3NXPA 1KDQA 1TGBA 1FN8A 3M3TA 3DT0H 1W7GH 1NC6A 3SNBA 4DIHH 2JJ2D 2NU3E 1VGCC 1YC0A 5HIYA 4CRDA 1EP6A 5ABWA 2A5KA 2Y5HA 2FYRA 3H09A 1VJ9U 2H9TH 1YPGH 2F3CE 1NPMA 4MNWA 4MPUA 1O5EH 5JYIA 5A8YA 2QF3A 4JZ1A 4A1XA 1O2RA 1C1OA 4GLYA 1SGFA 1TBQH 3LU9B 2ZEBA 1RIWB 3E91A 1AVGH 2OC8A 3K6ZA 3NZIA 4DOQA 1GBCA 1UTLM 4CRFA 3S0NA 1S81A 1LQDB 4X2YA 4KKDA 1DX5M 1TNIA 1ELGA 1KY9A 3SYJA 3SV9A 2J94A 2Q6DA 1GI1A 1LVBA 1QBNA 1Z6JH 1DS2E 1VCQA 2WPKS 4MPXA 4JYUH 3BN9A 3I29A 3V3MA 3M5MA 5T1VA 1BA8B 4CR9A 4R0IA 5C94A 1QTFA 5C1XA 1O5AB 3RXDA 4AFUA 1O36A 1O3IA 3P8NA 4ABFA 4U01A 2VIPA 5I46H 2GGVB 4OS7A 2ZPRA 2QCYA 2NWNA 1JOUB 1Y3YA 3PLBA 1C2KA 3RXBA 2V6NA 3E8LA 1CBWB 2XCNA 1EZSC 3E0NB 2PP6A 4KELA 2JKHA 1Y5UT 4X8UH 5DP8A 2XOKD 5PTPA 3EE7A 1BB0B 4PROA 1LMWB 4CR5A 3MMGA 4THNH 5DSFA 4YLUA 3SJKA 2CXVA 1N6YA 1WYKA 1QFKH 4BAQB 3AW0A 3D23A 1GHYH 1YPHE 3T28A 5LPFA 1O5DH 4I8JA 2ZGJA 3IWMA 4X1RU 4NIVA 1OWHA 1VITF 2WUBA 5EJZA 1G2LA 2THFB 4WH8A 4DT4A 2BZ6H 2XWBI
chains in the Genus database with same CATH topology
3C1KA 1EOJA 4AFSA 2BLQA 1T8MA 4AB8A 4MDSA 3LPRA 4B74A 1GMCF 2BY5X 1L4ZA 3CP7A 1ZSJA 1XVOA 1MD7A 2QXIA 3GOVB 1FY3A 3A7XA 4O3TA 1LHCH 3A88A 1CO7E 1RRKA 1VR1H 3M7QA 4JK5A 2BVXH 2J34A 4OS6A 1BJVA 2BQ7B 4BANB 1C5YB 2XWAA 4OS4A 3QTVH 2R2MB 1JBUH 5T6DA 2GV7A 2A1DB 3SUDA 1ZHPA 1TX6A 1ZTKA 1TA6A 4UD9H 3R0FA 1F0TA 3PB1E 1ZOMA 1MKXH 3SN8A 1OP8A 1Q31A 2W7UA 4BXWA 3Q76A 3SHAH 1QJ7B 3PTBA 1V2ST 4NA9H 1EX3A 4Q7ZA 1GHBF 3E6PH 1O3AA 3D62A 4ZKNU 1HAGE 6CHAB 1SGRE 1QCPA 4XBBA 1QY6A 3RU4E 1ARCA 1GBBA 3I78A 1C2JA 2WPMS 3F9FA 2ZHDA 2FLRH 3E1XB 2SNVA 1EAUA 1Z7KA 3BTEE 1FY8E 4Y7BA 1ZRBA 2HGTH 1TONA 3O8RA 2ODQA 1WTGH 2ZU4A 3M35A 4X6MA 4MNXA 5E0JA 4K2YA 3EA8A 4IN1A 1LPKB 4Y7AA 4HI3A 3BEUA 3LGYA 4X6PA 2UUJB 2XTTB 2VINA 3F1SB 1AD8H 2KAIA 1UVUH 1O32A 3SJOA 2R3YA 1K1PA 1WU1A 1ZR0A 2FTMA 1MTNC 2JETB 3SORA 1C5TA 1RIWC 1O3HA 1SGEE 1BOQA 1PPZA 3MH7A 2QGRA 1GMHF 5ESBA 1C2DA 2FESH 1NRNH 3SV7A 3MYWA 1C2LA 1ETTH 1MTSA 4TWYA 2VJ1A 1SHHB 4E05H 2O8MA 4I7YH 3VXFH 2V0BA 3SGQE 3P8GA 4TPYA 1CGJE 1GPZA 2OBQA 2K1QA 2SGDE 3A80A 1OYQA 4B2BA 2FS9A 4CH8B 2Z9IA 4E7NA 1AU8A 3PO1C 1CBWC 1EJNA 2BB4A 1F5RA 2BXTH 1EJAA 4ABDA 5AFZH 1MAYA 3M36A 3CS0A 1C1MA 4A1TA 5GXPA 1GJ5H 2ZO3H 2RDLA 1LHDH 5B6OA 3TU7H 1GHVH 1HNEE 1SPJA 2AGGX 3BTQE 1DY9A 5IDKA 2GD4B 4TYDA 4O97A 2ZPQA 1AN1E 2DE9A 3RU4D 2BX3A 1P9SA 5GWZA 1PQ5A 2P3TB 3O8DA 3ZZ5A 4UE7H 1JXPA 4NG9H 2PKSB 3RDZA 4MPWA 5A8XA 3F6UH 3UR9A 3Q00A 3LH3A 2OQUA 2EA3A 1O3OA 2PGQB 5A09A 4H42U 8GCHG 1TNKA 1HGTH 1XM1A 4NFFA 3A85A 1T8LA 1WOFA 1CHGA 1HRTH 4JYTA 1GHWH 3AASA 1HV7A 1O35A 2GDEH 5E0HA 1B5GH 1RS0A 2P8OC 2TPIZ 4GVUA 1BMLA 1THPB 4DJZB 1O2IA 5FX6A 2Y5FA 3GY5A 5JBAS 1MBMA 4IBLH 4NSVA 4FXGH 1CA0B 4Y11E 3P92A 3B23B 3EDXB 3ZVEA 4AORA 1EJMA 3U8OH 2OP9A 1KLJH 1UK4A 1C2FA 1KIGH 1GBJA 3KF2A 1WV7H 4BNRA 2HNTC 3NWUA 1C5MD 2FIRH 1N8OC 2ZCLP 3M7TA 6CHAC 3UR6A 1GHAG 3U1JB 4I8LA 3BEIB 5DP5A 3SV8A 1W8BH 2F9VA 1ANBA 3HGPA 1AHTH 3QTOH 1EUFA 1O3KA 1GBEA 1GI6A 2R0LA 5JDUB 1XUHA 4NA8A 2W7SA 2FOFA 1D3PB 1KTTB 3SOSA 3EA7A 4XOJA 2GCTC 3GICB 1J14A 2ZU1A 3STJA 1HAVA 3PLKA 1P11E 2RA3A 1ZLRA 5ETXA 4FUBA 4MG3A 4AG2A 2Z6BD 4MTBA 1GI3A 1XKAC 1XXDA 4ZUHA 3MHWU 1AZ8A 1S5SA 7LPRA 1EATA 1C5LH 5FCRA 3BG4B 4FU9A 2OC7A 2FOEA 3GDVA 3BF6H 1V2TT 3RXMA 4KGAA 1O2TA 3P8FA 2JETC 1DITH 3OX7U 1FAXA 1H9LB 4YOJA 1YPJH 1OWDA 2HOBA 2SNWA 2YNAA 3PWBA 2AMPA 3IG6B 1BMNH 2OTVA 1GI9B 1O5GH 5EW2H 2BDHA 2ZF0H 1HAZB 2B7DH 2P94A 1C2IA 1TNGA 4J1YA 1WUNH 2BLOA 5F6MA 2XNIA 1YPLH 3UNSA 4ABIA 2ZFQH 1W10U 2B0FA 2VGCB 3H7TA 3BIUH 3B9FH 1AWHB 1SFQB 2O8TA 2Q6FA 1AE8H 2UUKB 2FLBH 1H9HE 1P9UA 3S7KB 1P57B 3A7VA 1P2QA 2D1JA 3P95A 1TNLA 2OINA 4Y0ZE 1F92A 2O9QA 1O39A 1QBOA 1O2UA 1FPHH 1CHOF 1NTPA 3RXEA 1V3XA 7GCHG 1GVLA 4LXBH 2AMQA 5JBBS 2Y7ZA 1SGCA 2FOHA 1IHTH 3VXEH 1PYTD 1Z6EA 1CGIE 2VIVA 1G9IE 4U2WA 3GY3A 4XFQA 5J4SA 1QQUA 1F5LA 3SGAE 4H6SB 1ZPZA 4K3JA 2P3UB 5E2PA 4UDWH 2ZFRH 3MU8A 2FOBA 3SBKA 5J4QA 2C4FH 3M7UA 5H4IB 2G52A 4X6OA 3VB3A 3FANA 2UWLA 2PKSC 2A4GA 5SGAE 1ESAA 4IW4E 1HAOH 2FS8A 1H8IH 4TWWA 6LPRA 4X2VA 4X6NA 1LVMA 2BVSH 1C2EA 1K1JA 1MQ6A 4WY3A 2EI6A 3M5LA 3PLPA 4X2XA 3SU6A 1O2KA 1SL3A 1ELAA 1DFPA 2FYQA 1ARBA 4B76A 1UJ1A 4ISIH 3TNTA 1D3TB 3L3TA 1MCTA 1HAIH 4AGKA 5K7RA 1T32A 1A5HA 3TIUA 1SLVB 1MKWK 4BTTB 3TJNA 1ELDE 1V2JT 1FXYA 1EXFA 3DHKH 2HNTF 3BTME 1CA0C 2WINI 1ELEE 2ZI2H 1SLWB 4BOHA 3SZNA 1QNJA 4LZ1H 1C5QA 2YOLA 2Z3EA 1FN6A 3PMHB 1GGDB 1C2MA 1EPTA 3VB6A 1WTHD 2BQ6B 2PTNA 1P2OA 4KTCA 1Z8GA 1V2RT 2ASUB 2AMDA 2Y5GA 2BTCE 2BY7X 2VIOA 5L30H 9ESTA 4X1QU 3ZYDA 4ISOA 1K2I1 3TNSA 2V3OH 1Y8TA 1CU1A 1L1NA 1SLUB 1DANH 4B71A 3RXCA 3GCHC 3RMMH 1JIRA 1EKBB 3F9HA 2G8TA 3CENA 1C5ZB 3ATKA 1WSSH 1CE5A 2F9UA 1NU9A 1ABIH 1SQTA 4AG1A 4GHQA 4F49A 4BAMB 3RXAA 3U9AH 2J4IA 3BG4C 1T31A 4HTCH 4AOQA 3E3TA 1W2KH 5JB8S 4XDEA 1VITH 2ZGXH 1GVKB 1OWIA 3SO3A 5JPMH 5JBCS 1VJAU 3M3VA 4GSOA 1TFXA 3VB4A 3NK8A 1V2QT 1EZQA 2WYJA 2JH0D 3OY5U 4ISHH 4JMYA 1GJ9B 4K1SA 2WUCA 2BOHB 2LNCA 1S0RA 3LGWA 5EPYA 2Z9LA 4HFPB 4D76A 2A5IA 1RJXB 3UNQA 4GUXA 1UO6A 3LOXA 1O3FA 1KXDA 1V2KT 2VGCC 1HFDA 3GY8A 2OC0A 1GJ7B 2TRMA 2XBWA 3PMAB 2CN0H 2QIQA 2PW8H 4FVBA 4AYYB 3A8AA 1P2NA 3TGJE 1HJAB 1A0HB 1YGCH 5AVDA 4ISLA 3A7TA 1GJ6A 3T2NA 1UTNA 5E0GA 2ZTYA 1DWCH 4AB9A 2BDBA 1B7XB 2B5TB 3LONA 1RXPA 3EE0B 4KTUA 7ESTE 4ASHA 2I6QA 1ZPBA 2OUAA 1O3LA 2A4OA 2A45B 4O3UA 1K9OE 4Y79A 1MTNB 1L2EA 3UTUH 4TY6A 4FUJA 1RTKA 1FPCH 2G5VA 1PQ8A 2BX4A 4NGAH 1THRH 2VWOA 1AUJA 2BZAA 1A5GH 1O2QA 1ZSKA 4OS2A 2TGAA 2QA9E 2G55A 1EAXA 2BD2A 1KLIH 3LDXH 4FUCA 4H6TA 3VB7A 1ETRH 1K28D 1WBGB 2OD3B 1L1JA 2Y80A 4CREA 4I32A 1SVPA 1NFXA 3P17H 2TGTA 3SU3A 3VB5A 1OX1A 4YTAA 4BAOB 1EOLA 3P6ZB 4RN6A 4RSPA 1GVZA 4A6LA 3DA9B 3PO1B 4RKOB 1OOKB 3R3GB 4HZHA 4Y71A 2Z94A 5JB9S 2ILNA 4X8VH 1GBHA 2TIOA 2ALVA 2JH5D 1P3CA 4JZDH 1L0ZA 1W12U 1O2NA 1THSH 2HWLB 3LC3A 1GGDC 2WV4A 1P03A 1DICA 1LVOA 2VU8E 1PJPA 1OPHB 3RLWH 2AS9A 2BDIA 2UUFB 5EPNA 3RXJA 4GCHG 3URDA 1NRSH 1ZZZA 4MVNA 5A0BA 1F0RA 5FPTA 1PPCE 1KXEA 4JYVH 3L6PA 1MKWH 4BAKB 1MD8A 4YZUA 1XUKA 3FFGA 3RU4T 4K69A 2V3HH 1C9TA 3B8JA 1AB9B 1BTHH 1E0FD 5HM9A 1TNJA 3KQBA 2GZ8A 8GCHF 3QN7A 3F68H 3Q77A 1QGFA 5EXLA 1YLDA 4IN2A 2KAIB 1QRXA 3ATWA 1AUTC 2P8OB 1P05A 2BLWA 1P2KA 3PM3A 3RXUA 3UPEA 2FZZA 2F9NA 3MNCA 1ACBE 2GDDA 4UFEH 2AGEX 2I6SA 3TJOA 1FIWA 4I31A 2PFEA 4YESB 3GCNA 1DWDH 1UVPA 1D4PB 1QL7A 4WMEA 1TOMH 3SJ8A 2A7CA 3BV9B 3KNXA 2GT8A 2NU1E 4I8KA 1ETSH 2BDCA 1GG6B 1GI8B 5LH8A 1QB1A 1TPSA 2ZU2A 1IOEA 2W3KA 1N8OB 3TH3H 4YO9A 1TRYA 2GT7A 1YYY1 1GDQA 5EXNA 1BQYA 1Z8IB 1W13U 3CS7A 1UK2A 1HJAC 1BTXA 1A3EH 1GHXH 2GCTB 5DG6A 2IPHA 1DOJA 1FQ3A 1MU8B 2QXJA 1Y3XA 1P01A 4ZHAA 3KIDU 2W26A 1C1WH 3DFJA 4DG4A 4K5ZA 1HAYB 1TMBH 4TPIZ 3A87A 3MU0A 1HAXB 1GCDA 2ODPA 1T8OA 1MZDA 4KP0A 3N7OA 3GY7A 5DK1A 1G32B 2ZFSA 3W94A 1TB6H 1TWXB 3TK6A 2XC0A 1ELVA 1MU6B 1TBZH 1G37A 3ZZ6A 1W11U 1VCPA 3ENSB 1DVAH 3TJVA 2J9NA 3ZVGA 1GBIA 1TGNA 1Z1JA 5DP4A 2ZNKH 1KXCA 1HYLA 1Y3WA 1S84A 1TQ0B 2Y7XA 1GBAA 1GJBB 2Y82A 3AVZA 1P09A 1GHZA 3PWCA 1PPEE 1TGTA 1NT1A 2BDGA 4YM9A 4GHTA 3SU0A 3MFJA 4AGJA 2D8WA 1SOTA 1AFQC 1DLEA 2ZDAH 1O31A 1JIMA 1MBQA 1C5OH 3BTWE 2VVUA 3M5NA 3S69A 2ZDKA 2F9BH 5C5NA 5EW1H 1YKTA 1FONA 3ODFA 1C2HA 1KXAA 1TRNA 3A8CA 5DP3A 2XRCA 1SC8U 3LH1A 1DXWA 1GBFA 4I8GA 1FZZA 7GCHF 2BQWB 4UFDH 2BY8X 1C1PA 1SQAA 2HPQH 1QA0A 1SGYE 5A8ZA 2H1UA 1FI8A 3ATIA 3QZRA 2FX4A 3DFLA 3LGUA 1NFYA 1NS3A 3A81A 2IOTA 3OSYA 4A92A 1P8VC 3KQEA 1Q3XA 3DD2H 5EG4A 2AH4X 1HPGA 1QL9A 1SGTA 1A1RA 2ZP0H 3MOCA 3V13A 1SGQE 1TALA 1BTWA 4IS5A 1HAVB 1VITG 2ZDNA 1YPHC 1C5XB 2PR3A 2QN5T 1AB9C 3RXRA 1VCWA 1RTLA 1T4UH 4ESTE 1RGQA 2ZPSA 2GCHG 1ZJDA 3V7TA 1E34B 1AO5A 3K9XB 4B75A 1C1SA 5EQQA 2FI3E 3SU2A 1C5RA 1C5PA 5FBIA 1W7XH 1AFEH 5GPIB 2O8UA 1MTUA 2VIDA 2ZTXA 3HPTB 1PQAA 4BTIB 1A3BH 4CH2B 2PKAA 1BRBE 1RFNA 4GPGA 1GJDB 5AHGH 2PV9B 2P3FH 1TABE 1DPOA 4E7RG 5DKMA 1GG6C 5L2ZH 4DT7B 1GBDA 2FWWA 2NU4E 3GCTG 1O3EA 5EU8A 1O3DA 2GX4A 3KHVA 5DO4H 2HVXA 3JZ1B 2EI7A 3GY2A 1G3CA 2ZA5A 3S9CA 5C1YA 2R9PA 4NZQA 1UTKA 3K6YA 1TE0A 2XBYA 4DY7B 1QJ6B 1S6HA 1WAYB 3RXVA 1G2MA 1C1TA 2Z9GA 2OC1A 1GI0A 5G4BA 3GCHB 1AZZA 1E38B 3EQ0H 3QUMP 2AERH 3VFEA 3W95A 2BD3A 4WMFA 1OP2A 1F2SE 1L4DA 1IQHA 5HXFA 2Q6GA 1O3MA 3OU0A 4ZKOU 3V0XA 2GTBA 4WF8A 4NCYA 1BMAA 4K8YA 4JK6A 1ANEA 2ULLA 2BD8A 2Z9JA 5EOKA 3GCOA 1ZGVA 1PFXC 1A4WH 2A2XH 6GCHG 1K1IA 1BBRK 3SV2H 1F0UA 1PPHE 4IC5A 2ZZUH 3RXOA 1J16A 1SGPE 1IQNA 3TK5A 5IYTA 5C3NA 2STAE 1BBRE 1HIAA 1OSSA 1W14U 5FBEA 4B2AA 1GBLA 4FUIA 4X8TH 1C5NH 3FVFB 4NWLA 1FDPA 1XXFA 2VWNA 1NN6A 3ZZBA 3HK6B 1TA2A 1B0FA 1BIOA 3LC5A 3P70B 3T27A 3NUMA 1A5IA 1GDUA 3RMLH 1FMGA 3EGKH 1V2NT 3H5CB 2PHBA 1JWTA 4VGCC 1ELCA 3A8DA 3URCA 1UHBA 2H9HA 3MU1A 2PWXA 1P2IA 2TGPZ 3T5FH 1VZQH 2FDAA 1O5FH 3QGJA 3BEFB 1B0EA 1V2LT 4D8NA 2P95A 4MNVA 1EPTB 3OYPA 3KL6A 1BTYA 1ELFA 1SHYA 2ZHEH 1J15A 4DURA 1Q2WA 1T7CA 1Z1IA 4Y10E 2VH0A 1P12E 1XVMA 2ZGBH 4Q80A 3FP7E 1NRRH 2FX6A 1O37A 1QJ1B 4ZMAH 1XUJA 2A4RA 9LPRA 3K65B 3ZZAA