1O33A

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o33A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o33A02
1GHBF 1O2SA 2QY0B 3S9CA 1BT7A 5DP5A 1ARBA 4UE7H 4Y10E 1DE7H 1P9SA 1LHDH 3SN8A 1HCGA 4XE4A 1TRYA 1ELFA 4AYYB 1K1OA 4ABHA 1FI8A 3LGYA 1O3NA 3ZVFA 1MD7A 1C5SA 1ZPZA 4MPUA 3LGUA 1ZHRA 1UTKA 1V2JT 3VGCC 2UUKB 2BDHA 3RU4E 1O33A 1EUFA 1QJ1B 4DIIH 4X1RU 3LC5A 4WJG2 3PWBA 1TGCA 4U2WA 2Y6TA 4KTSA 1TPPA 3RC6A 1NFYA 1YPMH 2HNTF 3PWCA 4B73A 1CGIE 1SGRE 1ELAA 1XKAC 2FM2A 4INKA 2YNBA 3ZZBA 1NS3A 2F9OA 3FAOA 4B2AA 2SNWA 5E0JA 1F5LA 1GHAG 1HAOH 1Z8RA 4Q7XA 3RXVA 1CA0C 1O32A 1O2ZA 1QL8A 2FI5E 3Q77A 2STAE 3T5FH 3HATH 3GCTF 2G00A 1ELDE 5PTPA 5BRRE 1QBVH 2VWMA 4QT8C 2ZCLP 3SV7A 4I31A 4X1QU 1X7AC 2UUYA 2AGEX 2A5KA 3PTBA 1BBRH 2ZNKH 4YTAA 1O3HA 4JYVH 1BDAA 2AIQA 3DUXH 3SJIA 5DP9A 1DSTA 2AMPA 4BAOB 1MTVA 3ZVEA 1LMWB 1CT2E 1SPJA 3SV6A 1AUTC 1GMHF 1FZZA 1GDQA 1J16A 2B8OH 1SC8U 1YF4A 2SGEE 2P3TB 3M3TA 3PMJA 4D8NA 2FS9A 1RIWC 3P8GA 1P2IA 1VITF 1EB1H 4IBLH 1O2IA 1PPGE 1IQLA 2BY8X 4UFFH 3P6ZB 2BD2A 1T8OA 2ANMH 2FPZA 1VITH 5E2OA 1WQSA 1QY6A 3SU0A 1O39A 1EZQA 1QBOA 2CMYA 1SGDE 3IWMA 1AE8H 1C5OH 1DXWA 1G3DA 1FQ3A 1V2PT 2PKSB 2Y5FA 1ID5H 1PYTD 2PR3A 4TPYA 2HNTE 3P70B 3AAUA 1O34A 1LTOA 4YOJA 1GHWH 3RLWH 4X1PU 4NIXA 2O8MA 4JCNA 4D7FA 2EI7A 3IITA 5DP4A 1ZZZA 1C1PA 1JXPA 3M5OA 1A7SA 1V2MT 2ZFTA 4K1TA 2XC5A 5JDUB 1TOMH 2ZFQH 3OYPA 4FU7A 1XXFA 5EXMA 5GXPA 5E0HA 1DSUA 5LPRA 1PQ7A 1BBRE 1LDTT 1NRRH 1L1GA 1C2HA 1BTUA 7GCHF 1RTLA 5HGGA 2XWAA 1OWDA 2CF9H 3P95A 1U6QA 3EA7A 1EASA 3VB5A 4X6MA 1ZPCA 4WY3A 3M35A 3CS7A 1MMJN 1KXEA 1VR1H 2ZF0H 4THNH 4O97A 4R0IA 1JBUH 4WMFA 1C5VA 1EP6A 3GDVA 4X1SU 2BDCA 1WQVH 1O3PB 5EOKA 7KMEH 1H8IH 1XUKA 2AMQA 3D23A 3A86A 4I8HA 1ZSKA 2ZPRA 3E8LA 1O5DH 1IHTH 1Q2WA 1IQMA 4ZUHA 4BTIB 4GCHG 1GI4A 1GJDB 1ZR0A 3F9HA 1T31A 1TRMA 1NU7B 1GMDF 1XUGA 1HUTH 2BDYA 3S9BA 1WV7H 1F0UA 4ABAA 2Q6FA 1SGQE 3F9GA 1DUEA 2SFAA 2CXVA 3HGPA 1D3DB 1FAXA 3SUFA 2BX4A 2QV1A 1SGPE 1AY6H 4Y7BA 3DHKH 2Y5GA 3A88A 1C5MD 1O2TA 1AWHB 3ZV8A 2IOTA 1EJNA 1BMMH 1CA8B 3MNCA 3RC5A 1CHOF 1ELGA 2OLGA 2C4FH 2VVVA 2XBWA 6GCHF 2J92A 4NSYA 4CRDA 2R0KA 4CREA 1Y3VA 1GJCB 1Y8TA 1YP9A 1KXAA 1TX6A 1BRAA 4MPXA 4AX9H 2VWNA 1AVGH 5C1UA 3DA9B 1EPTB 1F0SA 3FP6E 3O8RA 3GYLB 2KAIB 2CF8H 1GI9B 2OTVA 2EI6A 1L1JA 1HAPH 1SSXA 2ZDKA 4VGCB 3FZDA 5EXNA 1YKTA 1LQEA 1IQFA 5GJ4B 3CP7A 2C8WB 1C2DA 5HXFA 1S83A 5E2PA 4ESTE 1O2HA 1VJ9U 2H5CA 2STBE 2GCHF 1MTNC 2ZDAH 5DK1A 3ZV9A 2YNAA 1FONA 3SGQE 3PV4A 1UTMA 1T32A 4OS6A 1DITH 3ZZ6A 4ISIH 1GBDA 5AHGH 5DP8A 1HAZB 1M9UA 3MO6A 1QURH 3RXGA 1NRQH 1J9CH 5GDSH 2JH6D 5EPYA 1GBHA 1GBJA 1TNLA 4D76A 2Y81A 1O37A 3NZIA 3JZ2B 4TY7A 2GT7A 1EP5A 2VIQA 1T8MA 5DJ7A 1TABE 1TBZH 4TPIZ 3BTGE 2HWLB 1C5TA 1CVWH 4TWYA 4DGJA 7ESTE 1O2RA 5CE1A 3ATLA 1A5GH 1LKAA 4INHA 1P2JA 4YOGA 2ZEBA 5FBIA 1MU8B 1NROH 2ODPA 1Z8JB 3BTQE 6CHAB 3S7HB 4PROA 3MU5A 1D3TB 2R2MB 1P0SH 1W7XH 5DG6A 1EZSC 2WUBA 1HV7A 1UK3A 1GG6B 1ZSLA 9ESTA 3LGWA 2FWWA 2PLXA 2XWBI 1TNIA 3TNSA 2ZTZA 2A7JA 3A87A 1KXDA 1XUJA 4KP0A 3SJOA 1KY9A 1NFXA 2ZFSA 2A7HA 1C2EA 3Q3XA 3ITIA 4OS7A 1HRTH 1NTPA 4K3JA 1AZZA 1NU9A 4JYTA 1Y5AT 1LPZB 2YOLA 1O2WA 2I6QA 4NIWA 2O8WA 1UVTH 4XBCA 4MNYA 3AW1A 4U30A 4NA7A 3EYDA 4E7RG 4UFDH 1S6HA 3QUMP 1AFEH 1MCVA 1UVPA 1A5HA 3PM3A 1LHEH 3KF2A 3MHWU 2TGPZ 2GTBA 1WU1A 4A1VA 3STIA 1AVWA 2WPIS 3ZVCA 3LC3A 5EPNA 2ILNA 2TGAA 3TH2H 1J8AA 3SUGA 2QIQA 4Q7YA 3F9FA 1W0YH 1ZTKA 3QZQA 2BTCE 3LT3A 3UIRA 5CHAC 1N6YA 3GY4A 2UWOA 2EA3A 1GI2A 2V3HH 1XUHA 2VVUA 2WUCA 1Q31A 2AMDA 1AN1E 4ABIA 2WPLS 1SL3A 1RTFB 3A7XA 1OXGA 3ZYEA 4CRAA 1TNJA 2XBYA 2GP9B 3EA8A 3DFLA 2PKAB 1Y3WA 3UNRA 2VJ1A 3RXOA 2UUJB 1K28D 1HIAA 4OGXA 2VINA 2RG3A 3TJUA 3RXRA 1TE0A 3RXAA 4R8TB 3SU5A 1H9HE 2P8OB 2BD9A 1J15A 4I8KA 1EOLA 1E38B 2FMJA 1GPZA 3M5LA 1GI1A 1FXYA 1QB9A 1OPHB 2G51A 2G81E 4JZIA 1OP8A 2QXIA 2D2DA 1HPGA 1IQNA 1K1IA 2ZU2A 3PTNA 1MU6B 3VXFH 1A46H 1KTSB 1BZXE 4Y0ZE 3RXIA 3SU1A 4FUBA 2AEIH 4Y79A 3VEQB 1PFXC 5ABWA 2H5DA 3MU4A 2XW9A 3NXPA 3QDZB 3U98H 1GI3A 2ODQA 3NKKA 1QJ7B 3QLPH 2PSYA 1UTLM 2FLBH 2ZGHA 1HAGE 2NU3E 3SNAA 3EAJA 4KKDA 2GMTC 1TX7A 5EU8A 1OWEA 1W10U 2QAAA 1VGCC 4IN2A 3U69H 1LKBA 1HIAB 2A4GA 1AB9C 3V0XA 1SVPA 2W26A 1O5EH 2PHBA 3M5NA 3W94A 5JBAS 1D9IA 1G2MA 1GMCF 3UNSA 2JETB 4OS1A 5JYIA 1GBLA 4UFGH 5J4QA 4OS4A 1C2LA 1C5YB 2VIDA 1YBWA 1C5QA 2AIPA 4CHAB 2RA0A 2ZDMA 1UHBB 2R9PA 5AVDA 3RMOH 3GY8A 1ETSH 2OINA 3MWIU 4LOYH 1SGFG 4H42U 1QL7A 1KYNA 4IC5A 1O2NA 2BDAA 1ZRKA 2GD4B 4BAHB 2FESH 1PPHE 4AFUA 4DOQA 2ZQ2A 2OUAA 3KQBA 5JPMH 1O3MA 3TH3H 2RDLA 5EW1H 2BOKA 2Q1JA 3EQ0H 3A82A 2G55A 1G9IE 3KCGH 1QFKH 2BY9X 3LH3A 1S0RA 1V2OT 1GJ6A 3BEFB 4NCYA 3T27A 1VCPA 2VH6A 1E0FD 5FPSA 1G32B 1WUNH 2ZHDA 4AGJA 3VXEH 3E1XB 3ODDA 3TGJE 1ESTA 2F9NA 1P05A 1XVOA 5FBEA 4E7NA 2O8TA 4ZKRU 1QA0A 2R0LA 1BTWA 4ZHAA 2UUFB 3OU0A 1NRSH 1TPOA 3PLPA 2BZAA 2NU0E 2ZQ1A 3VGCB 4MTBA 1YCPH 1OWIA 2PW8H 1QA7A 2OCVB 4CBOA 3MH7A 1DICA 1LPKB 2QYIA 3KNXA 2TGTA 1ELBA 4JMYA 1EAUA 4B74A 1YC0A 4AFZA 2BDBA 1ZMNA 2A31A 2Q6DA 3M3SA 1MKWH 1W14U 4O3UA 3VB4A 2Z9IA 3EA9A 3TJOA 2B7DH 1TLDA 1DX5M 2GV6A 1C1TA 1TQ7B 6ESTA 3LH1A 2OC0A 1CA0B 3VB7A 2OC8A 2QC2A 3QGNB 5F6MA 3LJOA 2BLVA 1C2JA 4H4FA 2G4TA 2XC0A 2FOEA 3T29A 2OD3B 4FUFA 1QRZA 3MNSA 1BTZA 1H9LB 2I6SA 2FI3E 2P93A 3BTDE 2J34A 1UVOA 4DVAU 5H4IB 4BTUB 3SGAE 1S5SA 3BV9B 1BJVA 1OYQA 3SU3A 2GGVB 2K1QA 2J38A 1A4WH 1S85A 3M7TA 1C1MA 3E16B 4FUDA 2FTMA 2ZU5A 1SGYE 1KIGH 1EQ9A 2H2ZA 2SGAA 1Z8IB 1T7CA 1TFXA 4ZKNU 1P8VC 3RXEA 2BDGA 4BAQB 4A1TA 4GAWA 4ABDA 4WF8A 1RIWB 3C27B 1TGNA 2Y80A 1NRPH 3SV9A 1SGCA 3E0PB 5FAHA 2OBQA 5HM2A 1CE5A 1V2TT 1O2OA 3HKIB 3RXPA 2VH0A 4IN1A 5ESBA 1ZTLA 1XX9A 1GBEA 1DS2E 1E37B 2Y7XA 4FUIA 4UFEH 1FAKH 4K8BA 1ZGIA 2SNVA 2ZWLH 2GCTC 2PGBB 3LJJA 3KIDU 1NFWA 1O3KA 1SGIB 1QB1A 1P57B 1S82A 3BTTE 4CBNA 1THPB 3RXDA 2ZG0H 1O30A 1ZHMA 4BAKB 2ZHWH 2BB4A 1RS0A 8GCHG 1K22H 1OWJA 1FUJA 1FY4A 3MNBA 1C5LH 1ZJKA 1O2GH 5A0BA 1YPKH 1ANBA 3M7UA 1SFIA 1TA2A 2F9PA 1V2UT 1E36B 1O3OA 5A0CA 1C1SA 3ZZ5A 1FY5A 1QQUA 4MG3A 1MUEB 1G3BA 1QL9A 2VGCC 1GDUA 3ODFA 2ALVA 4HFPB 2ZA5A 3QWCH 2SGDE 2CHAC 2C8ZB 1FJSA 1JIMA 1DWEH 1YPHE 8KME2 2PTNA 3V13A 3TGIE 1OYTH 2QXHA 4AZ2B 4D9RA 1QRWA 1VZQH 1P02A 1BQYA 1CO7E 1P2MA 4BXWA 5IDKA 1SGEE 3K6ZA 4ZKOU 1YLCA 4RSPA 1P2KA 2V0BA 1ELVA 1O3DA 1SLVB 3NUMA 1HJ9A 1T4UH 4NSVA 2ZTYA 1C5UA 1V2KT 5T6FA 4AB9A 2H9HA 4NFEA 3OY6U 1YCPK 4FXGH 1O2VA 1TA6A 1TPSA 2BD8A 5AFZH 3UY9A 3Q00A 2Q6GA 3S69A 4Z6AH 1ZOMA 1GJ9B 1QCPA 2ZC9H 2D1JA 1EJMA 1MKWK 2BOHB 1PQ5A 2A5IA 1FMGA 1O2UA 5DKMA 3SI4H 1G30B 5GCHG 2PSXA 1N1LA 3PYHA 1A3BH 4CRGA 1MQ6A 2TBSA 2FOAA 1Z6JH 1YGCH 1A3EH 3M7QA 1KXBA 1QGFA 2W7UA 3LDXH 1NO9H 5C3NA 3BG4C 1UVUH 3KGPA 3K2UA 5C5OA 4RKJB 1WCZA 4ZH8A 3UPEA 1GJAB 3RXLA 3TITA 1UK2A 1GJ4H 4NZQA 1C4U2 3RDZA 5I46H 1RXPA 2BD5A 2FX4A 1G36A 1GBBA 3R0FA 1Z1IA 4NGAH 1K21H 1KXCA 7LPRA 2FDAA 4NWLA 1DXPA 3L3TA 3GY6A 2FO9A 5E0GA 4JZFH 5FCRA 3ZZAA 1BTXA 1VCQA 3OX7U 2FYRA 1LQDB 1AMHA 1P3EA 2QA9E 4YO9A 2F9VA 3HGNA 1HAYB 1JIRA 2P16A 5ESTE 1FY8E 3RXCA 4I8JA 4GUXA 4ZMAH 3OY5U 1C2FA 4I33A 4ISOA 3OTJE 3TK5A 3V7TA 3PO1C 3ENSB 3KQEA 4NWKA 1EPTA 1LVMA 4MPVA 2BQ7B 1TMBH 2A45B 2KAIA 3SOSA 1FLEE 5B6OA 1THSH 1MTNB 2FP7B 2OXSA 3A8CA 3KHVA 2ZHQH 4X8VH 3JZ1B 5C5NA 4WH8A 2PKSC 1P12E 1LO6A 1YLDA 4IS5A 1Z71A 2Z9LA 3GY7A 3SU4A 2GZ8A 1JRTA 1O2MA 1HB0B 4Z0KA 1MH0A 3T28A 1L4DA 2ZTXA 4X0WU 1SBWA 3SGBE 5C67A 4O9VA 1BBRK 1ORFA 3LGVA 1MTWA 3PMAB 1OKXA 4F4OC 3KQDA 2QF0A 1AZ8A 1TMTH 3P8FA 1NZQH 3ATKA 3QX5H 1LVYA 1SHHB 5TCCA 1XUFA 2XC4A 4WXVA 1ETRH 3SJ8A 2P59A 5J4SA 2Y5HA 1GVZA 4AN7A 1S0QA 1JMOH 2C93B 4FVBA 4AGKA 1SOZA 3UOUA 1BOQA 1EKBB 4Y6DA 1C5WB 4FU8A 3SW2B 1TAWA 1YPLH 2WINI 2IPHA 3F9EA 4BOHA 3RXBA 1GHVH 2RCEA 2BMGB 1UTJA 3I29A 4RKOB 3ZZ3A 5C2ZA 4FUHA 1YPGH 3RXQA 3RMLH 4BANB 3ESTA 1XXDA 1O2LA 4DT7B 1GJ8B 4FUEA 3ZZ7A 2JH5D 3A7VA 4YLQH 4B2BA 5E8EH 1O3JA 5AF9H 3UQVA 3HK3B 5EODA 1C5XB 4HI3A 3S7KB 4XBBA 3FP8E 3SUDA 3F6UH 1GVLA 1HNEE 6LPRA 4IC6A 1O3LA 2BY7X 4K1SA 5GIBA 2ZGCA 2FXRA 1PPCE 5DO4H 3SNEA 4I8LA 2O8LA 1ZYOA 4WMDA 1OP0A 1GGDB 3AW0A 1OWHA 2F83A 3MFJA 1XVMA 1C1NA 1C1VH 4GVUA 5C1XA 1MKXH 2ZCKP 1PPEE 3GCTG 1HXEH 5G4BA 2ZI2H 4KTCA 2PV9B 1EX3A 4ZROA 1AWFH 2ASUB 4GLYA 3BF6H 4Q2KA 2J2UA 4XFQA 4AYVB 3MOCA 1GCTC 5JBCS 4UONA 4DJZB 1MTSA 2GV7A 1G3CA 5DP3A 1O2JA 1ZGVA 3LU9B 1SQAA 4A7IB 4K5ZA 1UK4A 1C2KA 5HMAA 5CHAB 4FUGA 1GCDA 4DG4A 1KTTB 2A32A 3RUOA 1MD8A 1SR5C 1FN8A 2J4IA 3GY3A 1FV9A 1ABIH 1O38A 2BLWA 3NWUA 4ISNA 3GYMA 3F68H 1GMHG 4CR9A 2Z3DA 1K9OE 1K2I1 1TRNA 1MAYA 3GCHC 1C2IA 4MNWA 4VGCC 1A0LA 1S81A 1O3CA 2CGAA 3LOXA 3U1IB 1OS8A 3H7TA 3GISB 1GBCA 4WXIA 3M37A 3M3VA 2OQ5A 2PUQH 2Z9KA 4MNXA 1MBQA 2GT8A 5FXLA 2PKAA 1O3AA 1DVAH 1IQJA 3URDA 1AO5A 4CH2B 4CH8B 3VPKA 2A5AA 1BB0B 1TMUH 1TNHA 3P8NA 4H6TA 3UTUH 4Y8ZA 2ODYB 2F9UA 3H7OA 4YOIA 4I7YH 5SGAE 2FOGA 2QCYA 2O8UA 2ZPSA 2BVRH 2VIWA 4ZHLU 2XRCA 3S0NA 1H4WA 1QBNA 1SFQB 1LVOA 2FEQH 3NPSA 1T8LA 4TWWA 2GZ7A 1T4VH 3B9FH 3T62A 2IN2A 3KQCA 1EB2A 1EJAA 1TIOA 1G3EA 4ISHH 1GHAF 4CRFA 1F5KU 1N8OC 4KGAA 3TK6A 2ZDLA 4X2XA 3S9AA 3WY8A 1HJAC 2NU4E 1P01A 5EQSA 4Q7ZA 3W95A 2XNIA 2ZFPH 1UMAH 2SGQE 1O2PA 1A0JA 2GDEH 1LHCH 3V12A 1TX8A 3STJA 1S84A 1D3QB 3VFEA 1KLJH 3SV2H 1BHXB 5F8XA 4AFQA 1FY1A 1DDJA 1O5CB 3E90B 3RXTA 1QTFA 1ELTA 3Q3YA 2GZ9A 1GHYH 1QNJA 5IYTA 1UJ1A 1H1BA 2BHGA 1O3GA 4K2YA 2OBOA 1O3IA 1C2MA 1G37A 2HPQH 1UHBA 4RN6A 1GBTA 1P2QA 1L1NA 3ZVAA 4ZHMU 3MNXA 4U32A 1GBAA 2XBVA 4U01A 1O2QA 2ZFRH 4H6SB 3UOPA 3FVFB 4BNRA 2D26C 2C90B 2WV4A 3BG8A 3SJKA 1MTUA 3RXUA 2ZKSA 3IG6B 4NZLA 1AFQC 4J2YB 1EZXC 2F9BH 3D65E 4B76A 1J14A 1ZMLA 1DPOA 1MKXK 3MU1A 2QXJA 4Y7AA 1HDTH 1V2WT 3SNBA 2M5TA 3UWJH 1AIXH 4KTUA 1BTHH 1SB1H 3AVZA 2G8TA 1A5IA 2R3UA 4AOQA 1ELCA 1JRSA 1SMFE 2FI4E 2A1DB 4Y11E 5A8ZA 1YYY1 1TGBA 1TOCB 2THFB 1OWKA 3URCA 1O3EA 3K6YA 6GCHG 2BY6X 2FOMB 1C4Y2 1TGTA 3A7YA 1FIZA 2EEKA 5FPTA 4DURA 1AUJA 3RLYH 4XBDA 4HTCH 4D7GA 4DY7B 5T3HA 1RD3B 4K1EA 1CBWC 1NPMA 1ZRBA 5F8ZA 3O8CA 1UO6A 2ZGXH 2Z9JA 1CT4E 3PLKA 1ZHPA 1BRCE 1IQKA 3E6PH 1NC6A 2UWLA 2F3CE 1P2NA 1OOKB 2P8OC 1GBMA 9LPRA 4A5TS 2WYJA 4FUJA 1BHXF 1C5PA 4X1NU 1ELEE 1DY9A 2G52A 3E91A 3A7WA 2TGDA 3ZZDA 1F2SE 1W2KH 1C2GA 3D62A 3FANA 3ZZ9A 4ABBA 1DLEA 4K60A 3MU8A 1LPGB 1L0ZA 3VB3A 1CT0E 1MBMA 3GOVB 1QRXA 2H6MA 1UTOA 3SU6A 1PPFE 3P17H 1D4PB 4E06H 5DP7A 5GPIB 2BLQA 2FLRH 3ATMA 1XM1A 1A61H 4ZAEA 4YT6H 1UCYH 3SNCA 1BUIA 2A4QA 4GCHF 5JBBS 1WOFA 1F5RA 2ZHEH 3KL6A 3MTYA 1NY22 2FZZA 2VIOA 3T25A 1Y3XA 1LHGH 3BTFE 2FODA 1D6RA 1C9PA 1B0EA 3UWIA 1C1QA 3A85A 4Y8YA 1KDQA 2ANYA 2OC7A 4CHAC 1TQ0B 1DWDH 1ANEA 2A7CA 1Y3UA 1EAWA 3EDXB 3F1SB 5FCKA 1IQEA 1K1LA 1YPEH 1RTKA 2AERH 1B7XB 2Z94A 1QR3E 1C1WH 4ABJA 5T6GA 2BQWB 2ZDVH 1V6DA 3QO6A 2QGRA 2PUXB 3CENA 4A6LA 1E34B 2HLCA 1ABJH 3G01A 2VGCB 4JK6A 2VVCA 2CV3A 4OGYA 1BMLA 2CHAB 2A2QH 1Q3XA 1V2RT 3GCOA 1AVXA 2OP9A 1J17T 2P3UB 1TBQH 2RA3A 3LONA 2NU2E 1W11U 3M36A 2HNTC 2VU8E 2J95A 2O9QA 1XUIA 4Q80A 3TNTA 1O2YA 1THRH 2HALA 2P3FH 3ZVBA 2Z3CA 1HYLA 3LGTA 1SGNE 1KDQB 2G4UA 4NG9H 2B5TB 3BTME 1K1NA 1GI5A 2J94A 1DY8A 1AE5A 2PFEA 1NFUA 4DW2U 1ZTJA 3RXFA 4IGDA 5L2ZH 4JZEH 1GJ7B 1UCYE 2FOCA 3GY5A 4NA8A 1RJXB 3B23B 1C1UH 2CJIA 3UFAA 3HKJB 3M5MA 5DPAA 3BIUH 1V2NT 3SORA 2FTLE 2G5NA 2HRVA 4E05H 3MO9A 3U8OH 1PJPA 1JOUB 5F03A 1EATA 1P06A 1TB6H 3C1KA 1O35A 3K65B 1H9IE 2BLOA 4B75A 1KLTA 1SLWB 3BTWE 4YLUA 3ZZ4A 1PQ8A 1ESAA 3BG4B 4X8SH 1NM6A 3PB1E 1K1MA 1MAXA 3DT0H 1YCPM 3V3MA 1WTGH 2FIRH 1K1PA 2TRMA 2FS8A 1PQAA 2ZO3H 1GWAA 1O0DH 4TY6A 3U8RH 4WMEA 3U8TH 4TYDA 2A2XH 4Y0YE 3GY2A 1BMAA 1XMNB 4B1TA 1BITA 8LPRA 1ETTH 4B2CA 1IAUA 2Z9GA 1O5BB 4X6OA 1BIOA 1F7ZA 1K1JA 2GKVE 1PYTC 3TJVA 1Y3YA 5K7RA 2XTTB 4A92A 3CS0A 2Z7FE 4YT7H 3RU4T 4Y76A 1P9UA 1UCYK 1SGFA 4BTTB 2JKHA 3I78A 3MH6A 3PO1B 4ZXYH 2ALPA 3ZVGA 3RMMH 1Z7KA 2LNCA 4K8YA 1DUAA 4JZ1A 1EAIA 1TALA 2QXGA 2FOFA 1GBFA 5EG4A 3RP2A 1GMCG 3UUZA 1WSSH 1SG8B 3AAVA 1ZMJA 1KLIH 2ZPQA 2GX4A 1O3BA 2AGIX 3GICB 3SU2A 3N7OA 3L33A 1Y59T 2ESTE 1HLTH 2F91A 2FOHA 1EAXA 3PMHB 1L2EA 2NWNA 2Y82A 1W12U 3L6PA 3EGKH 1LVBA 3HK6B 2JH0D 5LGOA 2B9LA 3RMNH 3RM0H 4ISLA 2BZ6H 2D8WA 3H5CB 2FYQA 1GL1A 1PPZA 5DGJA 8ESTE 5K0HA 1GI6A 2BYAX 2XXLA 2C3SA 1GI8B 1EXFA 1Z8GA 4X8TH 1HBTH 5EXLA 1C5NH 1HXFH 1JWTA 1D3PB 1BTYA 2B0FA 1P04A 2GDDA 4DCDA 4HZHA 2DUCA 5A2MH 4OS5A 1V3XA 2TPIZ 3D49H 4CRBA 3RC4A 1Y5UT 1BRBE 2W5EA 3BEUA 1O2KA 2VIPA 5EW2H 1UTNA 5DP6A 3A84A 3AASA 3SQEE 4FVDA 5FPYA 1UTQA 1TYNA 4AFSA 3MI4A 4YM9A 2AFQB 3ATIA 4Y8XA 3EE0B 1GBIA 1LCYA 1ARCA 4WH6A 1W13U 2ZHFH 3TIUA 2ULLA 4X8UH 1IHSH 1C5RA 1DLKB 3RXHA 3MH5A 2BX3A 1E35B 1FIWA 4AG2A 4ABGA 3TVJB 4A1XA 3E0NB 3LGIA 1IQGA 2CN0H 1TWXB 1GCTB 2Y7ZA 3DD2H 2PTCE 5F8TA 1VJAU 2BVSH 5EQQA 1GHBG 3BEIB 1GDNA 5JB9S 1CGHA 1P09A 3GCNA 2EC9H 1P10A 1HAIH 2DE9A 1FDPA 4SGBE 3SHCH 3RXSA 3BIVH 1C4V2 3U1JB 4MPWA 4BXSA 3OSYA 3QGJA 3KEEA 3QZRA 3SZNA 1DANH 5HM9A 3GCHB 3A81A 3PLBA 2H1UA 2ANKH 2BD4A 5JB8S 4ABFA 2VNTA 1TNGA 1FNIA 2V6NA 1AHTH 4ZXXH 4O3TA 2ZCHP 4HGCA 1N6XA 1MZAA 4NIVA 2LPRA 1RRKA 4M7GA 3TU7H 4LZ1H 3MYWA 1LHFH 2VWOA 2ZP0H 4K69A 3SO3A 3A83A 3ZYDA 1O2XA 3TJNA 1D6WA 1P3CA 1QJ6B 3M61U 1GJBB 2GVFA 5L2YH 5LPFA 1QHRB 3MU0A 3BTHE 3FFGA 3PROA 3QN7A 1MZDA 4JK5A 1NRNH 1DWBH 1HAVA 1V2ST 4YZUA 1RGQA 3I77A 1CQQA 3R3GB 4Y71A 2C8YB 5AFYH 2BY5X 3NK8A 4I32A 2HVXA 2H9TH 4CRCA 1AD8H 4MNVA 3T2NA 1QB6A 2ZECA 4NFFA 1HAXB 1FPHH 1N8OB 2ZU4A 3ZZCA 2ZU3A 4I8GA 1PPBH 1EPTC 2TIOA 2VWLA 1HJAB 1SI5H 2NU1E 1BCUH 3BTEE 2DE8A 2V3OH 3UR6A 1EZUC 4UD9H 1VITG 1SLUB 4DIHH 3P92A 1OX1A 1GHZA 4BAMB 1KSNA 3B8JA 3VB6A 1B0FA 3UREA 3TH4H 3RM2H 5C1YA 5A8YA 1HAVB 2AH4X 3O8BA 4KELA 2UWPA 2XCFA 3NCLA 2ZGJA 1NESE 3SI3H 1SHYA 2Z3EA 2ZZUH 3T26A 4LK4A 5HYOA 1YM0A 4MVNA 1B5GH 2XCNA 1BMNH 4LZ4B 1CU1A 3SBKA 3LIWA 1GBKA 1AFQB 1GGDC 1OSSA 2GMTB 3A8DA 1GL0E 4X2VA 1EOJA 1FY3A 5EGMA 3TK9A 1VGCB 1BTPA 2A4OA 2BQ6B 5I25A 1QIXB 4JZDH 3FZZA 1AB9B 1FPCH 1WYKA 1IQHA 1ZLRA 5TJXA 2HGTH 4UDWH 2WPHS 3ELAH 2G5VA 2WPKS 1MCTA 1WAYB 1DOJA 3QK1A 1C1RA 6CHAC 1ANCA 3A7TA 7GCHG 2VB0A 8GCHF 1HFDA 1P2OA 1INCA 2SGPE 4GHQA 4AB8A 1VCWA 4INLA 5FX5A 1AGJA 1MQ5A 1O31A 1GG6C 1WTHD 4FUCA 1P11E 1TGSZ 1CBWB 1O3FA 4X6NA 1V2LT 3LKWA 1P03A 1IQIA 2AYWA 1O5AB 3P8OA 1A0HB 4AORA 1GI7B 1ZJDA 5GWZA 5JBTA 3Q76A 3RXKA 3LPRA 1SGTA 1Z6EA 1O36A 2XYAA 2BXTH 5EQRA 1UVSH 2XBXA 1GMDG 4J1YA 1DM4B 4XOJA 2W7SA 1ESBA 2ZGBH 1OP2A 2WYGA 1V2VT 4IMQA 1L4ZA 4JYUH 4B71A 1WBGB 1C1OA 3SJ9A 5L30H 1ANDA 4D9QA 3ZVDA 1CHGA 2R2WU 5FHTA 1DFPA 5TCAA 4X6PA 1V2QT 1AKSA 4CR5A 2ZU1A 3BTKE 5A09A 1KXFA 4GPGA 3E3TA 4WVPE 3UQOA 1BRUP 5A8XA 2P95A 1GJ5H 3QTVH 1CHOG 1UTPA 2A4RA 3BN9A 1DT2A 3HPTB 3A7ZA 1O5GH 2ANWA 5GCHF 1A2CH 1SQTA 4X2YA 1FN6A 3A8AA 3ATWA 1SLXB 3TLOA 1Y5BT 1O5FH 1AI8H 2ZDNA 4IW4E 4SGAE 5L6NH 2BVXH 2BD3A 1C5ZB 4WWYA 1HJ8A 3RXMA 2H9EH 2BDIA 4F49A 1F0TA 1T8NA 5A0AE 2FOBA 1GHXH 1TPAE 4OS2A 4NA9H 3RXJA 5FX6A 1AU8A 1AKSB 2GCHG 3SQHE 2HPPH 1IOEA 1BJUA 1BA8B 3MO3A 5T6DA 3SV8A 3GDUA 2WPMS 3A8BA 5BPEA 3SUEA 1W0ZU 1G2LA 1Z1JA 2OC1A 2FX6A 3Q3KA 1RFNA 1YPJH 1AQ7A 1TNKA 3PMBB 3UR9A 2A0QB 3A89A 3ZZ8A 4YESB 1HGTH 2W3KA 3TGKE 3RU4D 1ZSJA 5C20A 2Z6BD 4IMZA 2QN5T 4UEHH 1F92A 3UNQA 3SNDA 2AGGX 1C9TA 3DFJA 3KN2A 3QTOH 2J9NA 1DWCH 1H8DH 2EI8A 3GDSA 4FU9A 1F0RA 2IJOB 4O03A 1W7GH 3BSQA 3O8DA 5LH8A 2GCTB 4XDEA 1NT1A 2W3IA 3A80A 1CGJE 1S6FA 4MQAA 2JETC 1W8BH 5CMXH 2BXUH 3K9XB 1W3CA 4LXBH 1NN6A 2P94A 1GVKB 1YPHC 2PWXA 2WV5A 2SGFE 2HOBA 1XKBC 2AS9A 4XSKU 2C8XB 4GSOA 4ABEA 4MDSA 2BM2A 2R3YA 2OQUA 3U9AH 2VIVA 2QF3A 3SHAH 2PGQB 3FP7E 1CSOE 2BD7A 1TONA 1A1RA 2ZIQH 3MMGA 5ETXA 2ZFFH 1SQOA 1TBRH 2V35A 1ACBE 4MLFB 2WPJS 1HAHH 5LPEA 1SOTA 4ZKSU 4NIYA 1ZPBA 4GHTA 4X2WA 4AG1A 3MH4A 3TPIZ 4ASHA 1GI0A 1QQ4A
chains in the Genus database with same CATH superfamily
1GHBF 1O2SA 2QY0B 3S9CA 1BT7A 5DP5A 1ARBA 4UE7H 4Y10E 1DE7H 1P9SA 1LHDH 3SN8A 1HCGA 4XE4A 1TRYA 1ELFA 4OM9A 1K1OA 4AYYB 4ABHA 1FI8A 3LGYA 1O3NA 3ZVFA 1MD7A 2PP6A 1C5SA 1ZPZA 4MPUA 3LGUA 1ZHRA 1UTKA 1V2JT 2KCAA 3VGCC 2UUKB 2BDHA 3RU4E 1O33A 1EUFA 1QJ1B 4DIIH 4X1RU 3LC5A 4WJG2 3PWBA 1TGCA 4U2WA 2Y6TA 4KTSA 4TT3D 1TPPA 3RC6A 1NFYA 1YPMH 2HNTF 3PWCA 4B73A 1CGIE 1SGRE 1ELAA 1XKAC 2FM2A 4INKA 2YNBA 3ZZBA 1NS3A 2F9OA 3FAOA 4B2AA 2SNWA 5E0JA 1F5LA 1GHAG 1HAOH 1Z8RA 4Q7XA 3RXVA 1CA0C 1O32A 1O2ZA 1QL8A 2FI5E 3Q77A 2STAE 3T5FH 3HATH 3GCTF 2G00A 1ELDE 5PTPA 5BRRE 1QBVH 2VWMA 4QT8C 2ZCLP 3SV7A 4I31A 4X1QU 1X7AC 4F55A 2UUYA 2AGEX 2A5KA 3PTBA 4P00A 1BBRH 2ZNKH 4YTAA 1O3HA 4JYVH 1BDAA 2AIQA 3DUXH 3SJIA 5DP9A 1DSTA 2AMPA 4BAOB 1MTVA 3ZVEA 1LMWB 2KM0A 1CT2E 1SPJA 3SV6A 1AUTC 1GMHF 1FZZA 1GDQA 1J16A 2B8OH 1SC8U 1YF4A 2SGEE 2P3TB 3M3TA 3PMJA 4D8NA 2FS9A 1RIWC 3P8GA 1P2IA 1VITF 1EB1H 4IBLH 1O2IA 1PPGE 1IQLA 2BY8X 4UFFH 3P6ZB 2BD2A 1T8OA 2ANMH 2FPZA 1VITH 5E2OA 1WQSA 1QY6A 3SU0A 1O39A 1EZQA 1QBOA 2CMYA 1SGDE 3IWMA 3PV2A 1AE8H 1C5OH 1DXWA 1G3DA 1FQ3A 1V2PT 2PKSB 2Y5FA 1ID5H 1PYTD 2PR3A 4TPYA 2HNTE 3P70B 3AAUA 1O34A 1LTOA 4YOJA 1GHWH 3RLWH 4X1PU 4NIXA 2O8MA 4JCNA 4D7FA 2EI7A 3IITA 5DP4A 1ZZZA 1C1PA 1JXPA 3M5OA 1A7SA 1V2MT 2KX4A 2ZFTA 3FKSD 4K1TA 2XC5A 5JDUB 1TOMH 2ZFQH 3OYPA 2WPDD 4FU7A 1XXFA 5EXMA 5GXPA 5E0HA 1DSUA 5LPRA 1PQ7A 1BBRE 1LDTT 1NRRH 1L1GA 1C2HA 1BTUA 7GCHF 1RTLA 5HGGA 2XWAA 1OWDA 2CF9H 3P95A 1U6QA 3EA7A 1EASA 3VB5A 4X6MA 1ZPCA 4WY3A 3M35A 3CS7A 1MMJN 1KXEA 1VR1H 2ZF0H 4THNH 4O97A 4R0IA 1JBUH 4WMFA 1C5VA 1EP6A 3GDVA 4X1SU 2BDCA 1WQVH 1O3PB 4Q63A 5EOKA 7KMEH 1H8IH 1XUKA 2AMQA 3D23A 3A86A 1SKYE 4I8HA 1ZSKA 2ZPRA 3E8LA 1FX0B 1IHTH 1O5DH 1Q2WA 1IQMA 4ZUHA 4BTIB 4GCHG 5KECA 1GI4A 1GJDB 1ZR0A 3F9HA 1T31A 1TRMA 1NU7B 1GMDF 1XUGA 1HUTH 2BDYA 3S9BA 1WV7H 1F0UA 4ABAA 2Q6FA 1SGQE 3F9GA 1DUEA 2SFAA 2CXVA 3HGPA 3OFND 1D3DB 1FAXA 3SUFA 2BX4A 2QV1A 1SGPE 2J97A 1AY6H 4Y7BA 3DHKH 2Y5GA 3A88A 1C5MD 1O2TA 1AWHB 3ZV8A 2IOTA 1EJNA 1BMMH 1CA8B 3MNCA 3RC5A 1CHOF 1ELGA 2OLGA 2C4FH 2VVVA 2XBWA 6GCHF 2J92A 4NSYA 5EJLA 4CRDA 2R0KA 4CREA 1Y3VA 1GJCB 1Y8TA 1YP9A 1KXAA 1TX6A 1BRAA 4MPXA 4AX9H 2VWNA 1AVGH 5C1UA 3DA9B 1EPTB 1F0SA 3FP6E 3O8RA 3F2FA 3GYLB 2KAIB 2CF8H 1GI9B 2OTVA 2EI6A 1L1JA 1HAPH 1SSXA 2ZDKA 4ACAA 4VGCB 3FZDA 5EXNA 1YKTA 1LQEA 1IQFA 5GJ4B 3CP7A 2C8WB 1C2DA 2L74A 1S83A 5E2PA 4ESTE 1O2HA 1OHHD 1VJ9U 2H5CA 5HXFA 2STBE 2GCHF 3U28C 1MTNC 2ZDAH 5DK1A 3ZV9A 3KYFA 2YNAA 1FONA 3SGQE 3PV4A 1UTMA 1T32A 4OS6A 1DITH 3ZZ6A 4ISIH 1GBDA 5AHGH 5DP8A 1HAZB 1M9UA 3MO6A 3KYGA 1QURH 3RXGA 1NRQH 1J9CH 4RI0A 5GDSH 4XRNA 2JH6D 5EPYA 1GBHA 1GBJA 1TNLA 4D76A 2Y81A 1O37A 3NZIA 3JZ2B 4TY7A 2GT7A 1EP5A 2VIQA 1COWD 1T8MA 5DJ7A 1TABE 1TBZH 4TPIZ 3BTGE 2HWLB 1C5TA 1CVWH 4TWYA 4DGJA 7ESTE 1O2RA 5C94A 3ATLA 5CE1A 1A5GH 1LKAA 4INHA 1P2JA 4YOGA 3PV5A 2ZEBA 5FBIA 4TSFD 1MU8B 1NROH 5KEDA 2ODPA 1Z8JB 3BTQE 6CHAB 3S7HB 4PROA 3MU5A 1D3TB 2R2MB 2KCOA 1P0SH 1W7XH 5DG6A 1EZSC 2WUBA 1HV7A 1UK3A 1GG6B 1ZSLA 9ESTA 3LGWA 2FWWA 2PLXA 2XWBI 1TNIA 3TNSA 2ZTZA 2A7JA 3A87A 1KXDA 1QZ8A 1XUJA 4KP0A 3SJOA 1KY9A 1NFXA 2ZFSA 2A7HA 1C2EA 3Q3XA 3ITIA 4OS7A 1HRTH 1NTPA 4K3JA 1AZZA 1NU9A 4JYTA 1Y5AT 1LPZB 2YOLA 1O2WA 2I6QA 4NIWA 2O8WA 1UVTH 4XBCA 4MNYA 3AW1A 4RT1A 4U30A 4NA7A 3EYDA 4E7RG 4UFDH 1S6HA 3QUMP 1AFEH 1MCVA 1UVPA 1A5HA 3PM3A 1LHEH 3KF2A 3MHWU 2TGPZ 2GTBA 1WU1A 4A1VA 3STIA 1AVWA 2WPIS 3ZVCA 3LC3A 5EPNA 2ILNA 2TGAA 1E79D 3TH2H 1J8AA 3SUGA 4I86A 2QIQA 4Q7YA 3F9FA 1W0YH 1ZTKA 3QZQA 1W0JD 2BTCE 3LT3A 3UIRA 5CHAC 1N6YA 3GY4A 2UWOA 2EA3A 1GI2A 2V3HH 1XUHA 2VVUA 2WUCA 1Q31A 2AMDA 1AN1E 4ABIA 2WPLS 1SL3A 1RTFB 3A7XA 1OXGA 3ZYEA 4CRAA 1TNJA 2XBYA 2GP9B 3EA8A 3DFLA 2PKAB 1Y3WA 3UNRA 2VJ1A 3RXOA 2UUJB 1K28D 1HIAA 4OGXA 2VINA 2RG3A 3FO8D 2IJD1 3RXRA 1TE0A 2GJGA 3RXAA 4R8TB 3SU5A 1H9HE 2P8OB 3TJUA 2BD9A 1J15A 4I8KA 1EOLA 1E38B 2FMJA 1GPZA 3M5LA 1GI1A 1FXYA 1QB9A 1OPHB 2G51A 2G81E 4JZIA 1OP8A 2QXIA 2D2DA 1HPGA 1H8ED 1IQNA 1K1IA 2ZU2A 3PTNA 1MU6B 3VXFH 1A46H 1KTSB 1BZXE 4Y0ZE 3RXIA 3SU1A 4FUBA 2YMSC 2AEIH 4Y79A 3VEQB 1PFXC 5ABWA 2H5DA 3MU4A 2XW9A 3NXPA 3QDZB 3U98H 1GI3A 2ODQA 3NKKA 1QJ7B 3QLPH 2PSYA 1UTLM 2FLBH 2ZGHA 1HAGE 2NU3E 3SNAA 3EAJA 4KKDA 2EQNA 2GMTC 1TX7A 5EU8A 2F43B 1OWEA 1W10U 2QAAA 1VGCC 4IN2A 3U69H 4DT4A 1LKBA 1HIAB 2A4GA 1AB9C 3V0XA 1SVPA 2W26A 1O5EH 2PHBA 3M5NA 3W94A 5JBAS 1D9IA 1G2MA 1GMCF 3UNSA 2JETB 4OS1A 3VG8A 1GBLA 4UFGH 5J4QA 4OS4A 5JYIA 1C2LA 1C5YB 2VIDA 1YBWA 1C5QA 2AIPA 4CHAB 5HKKD 2RA0A 2ZDMA 1UHBB 2R9PA 5AVDA 3RMOH 3GY8A 3KQ5A 1ETSH 2OINA 3MWIU 4LOYH 1SGFG 4H42U 1QL7A 1KYNA 4IC5A 1O2NA 2BDAA 1ZRKA 2GD4B 4BAHB 2FESH 1PPHE 4AFUA 4DOQA 2ZQ2A 2OUAA 3KQBA 5JPMH 1O3MA 3TH3H 2RDLA 3OEED 5EW1H 2BOKA 2Q1JA 3EQ0H 3A82A 2G55A 1G9IE 3KCGH 1QFKH 2BY9X 3LH3A 1S0RA 1V2OT 1GJ6A 3BEFB 4NCYA 3T27A 1VCPA 1E1QD 2VH6A 1E0FD 5FPSA 1G32B 1WUNH 2ZHDA 4AGJA 3VXEH 3E1XB 3ODDA 3TGJE 1NBME 1ESTA 2F9NA 1P05A 1XVOA 5FBEA 4E7NA 2O8TA 4ZKRU 1QA0A 3CNRA 2R0LA 1BTWA 4ZHAA 2UUFB 3OU0A 1NRSH 1TPOA 3PLPA 2BZAA 2NU0E 2ZQ1A 3VGCB 4MTBA 1YCPH 1OWIA 2PW8H 1QA7A 2OCVB 4CBOA 3MH7A 1DICA 1LPKB 2QYIA 3KNXA 2TGTA 1ELBA 4JMYA 1EAUA 4B74A 1YC0A 4AFZA 2BDBA 1ZMNA 2A31A 2Q6DA 3M3SA 1MKWH 1W14U 4O3UA 3VB4A 2Z9IA 3EA9A 4XD7D 3TJOA 4Z1MD 2B7DH 1TLDA 1DX5M 2GV6A 1C1TA 1TQ7B 6ESTA 1W0KD 2OC0A 1CA0B 3LH1A 3VB7A 2OC8A 2QC2A 3QGNB 5F6MA 3LJOA 2BLVA 1C2JA 4H4FA 2G4TA 2XC0A 2FOEA 3T29A 2OD3B 4FUFA 1QRZA 3MNSA 1BTZA 1H9LB 2I6SA 2FI3E 2P93A 3BTDE 2J34A 1UVOA 4DVAU 5H4IB 4BTUB 3SGAE 1S5SA 3BV9B 1BJVA 1OYQA 3SU3A 2GGVB 2K1QA 2J38A 1A4WH 1S85A 3M7TA 1C1MA 3E16B 4FUDA 2FTMA 2ZU5A 1SGYE 1KIGH 1EQ9A 2H2ZA 2SGAA 1Z8IB 1T7CA 1TFXA 4ZKNU 1P8VC 3RXEA 2RFKC 2BDGA 4BAQB 4A1TA 4GAWA 4ABDA 2EY4C 1RIWB 4WF8A 3C27B 1TGNA 2Y80A 1NRPH 3SV9A 1SGCA 3E0PB 5FAHA 2OBQA 5HM2A 1CE5A 1V2TT 1O2OA 3HKIB 3RXPA 2VH0A 4IN1A 5ESBA 1ZTLA 1XX9A 1GBEA 1DS2E 1E37B 2Y7XA 4FUIA 4UFEH 1FAKH 4K8BA 1ZGIA 2SNVA 2ZWLH 2GCTC 2PGBB 3LJJA 3KIDU 1NFWA 1O3KA 1SGIB 1QB1A 1P57B 1S82A 3BTTE 4CBNA 1THPB 3RXDA 2ZG0H 1O30A 1ZHMA 4BAKB 2ZHWH 2BB4A 1RS0A 8GCHG 1K22H 1OWJA 1FUJA 1FY4A 3MNBA 1C5LH 1ZJKA 1O2GH 5A0BA 1YPKH 1ANBA 3M7UA 1SFIA 1TA2A 2F9PA 1V2UT 4B6EA 1E36B 1O3OA 5A0CA 1C1SA 3ZZ5A 1FY5A 1QQUA 4MG3A 1MUEB 1G3BA 1QL9A 2VGCC 1GDUA 3ODFA 2ALVA 4HFPB 2ZA5A 3QWCH 2SGDE 2CHAC 2C8ZB 1FJSA 1JIMA 1DWEH 1YPHE 8KME2 2PTNA 3V13A 3TGIE 1OYTH 2QXHA 3DSOA 4AZ2B 4D9RA 1QRWA 1VZQH 1P02A 1BQYA 1CO7E 1P2MA 4BXWA 5IDKA 1SGEE 3K6ZA 4ZKOU 1YLCA 4RSPA 1P2KA 2V0BA 1ELVA 1O3DA 1SLVB 3NUMA 1HJ9A 1T4UH 4NSVA 2ZTYA 1C5UA 1V2KT 5T6FA 4AB9A 2H9HA 4NFEA 3OY6U 1YCPK 2J98A 4FXGH 1O2VA 1TA6A 1TPSA 2BD8A 5AFZH 3UY9A 3Q00A 2Q6GA 4Q4LA 3S69A 4Z6AH 4YXWD 1ZOMA 1GJ9B 1QCPA 2ZC9H 2D1JA 1EJMA 1MKWK 2BOHB 1PQ5A 2A5IA 1FMGA 2JDID 1O2UA 5DKMA 3SI4H 1G30B 5GCHG 2PSXA 1N1LA 3PYHA 1A3BH 4CRGA 1MQ6A 2TBSA 2FOAA 5B6LA 1Z6JH 1YGCH 1A3EH 3M7QA 1KXBA 1QGFA 2W7UA 3LDXH 1NO9H 5C3NA 3BG4C 1UVUH 3KGPA 3K2UA 3F2HA 5C5OA 3MQKC 4RKJB 1WCZA 4ZH8A 3UPEA 1GJAB 3RXLA 3TITA 1UK2A 1GJ4H 4NZQA 1C4U2 3RDZA 5I46H 1RXPA 2BD5A 2FX4A 5C0UA 1G36A 2J98B 1GBBA 3R0FA 1Z1IA 4NGAH 1K21H 1KXCA 7LPRA 2FDAA 4NWLA 1DXPA 3L3TA 3GY6A 2FO9A 5E0GA 4JZFH 5FCRA 3ZZAA 1BTXA 1VCQA 3OX7U 2FYRA 1LQDB 1AMHA 1P3EA 2QA9E 4YO9A 2F9VA 3HGNA 1HAYB 2KR7A 1JIRA 1UW7A 2P16A 5ESTE 1FY8E 3RXCA 4I8JA 4GUXA 4ZMAH 3OY5U 1C2FA 4I33A 4ISOA 3OTJE 3TK5A 4FETA 3V7TA 3PO1C 3ENSB 3KQEA 4NWKA 1EPTA 1LVMA 4MPVA 2BQ7B 3F0PA 1TMBH 2A45B 2KAIA 3SOSA 1FLEE 5B6OA 1THSH 1MTNB 2FP7B 2OXSA 3A8CA 3KHVA 2ZHQH 4X8VH 3JZ1B 5C5NA 4WH8A 2PKSC 1P12E 1LO6A 1YLDA 4IS5A 1Z71A 2Z9LA 3GY7A 3SU4A 1YWUA 2GZ8A 1JRTA 1O2MA 1HB0B 4Z0KA 1MH0A 2JJ2D 3T28A 1L4DA 2ZTXA 4X0WU 1SBWA 3SGBE 5C67A 4O9VA 1BBRK 1ORFA 3LGVA 1MTWA 3PMAB 1OKXA 4F4OC 3KQDA 2QF0A 1AZ8A 1TMTH 3P8FA 1NZQH 3ATKA 3QX5H 1LVYA 1SHHB 5TCCA 4ZCNA 1XUFA 2XC4A 4WXVA 1ETRH 3SJ8A 2P59A 5J4SA 2Y5HA 1GVZA 4AN7A 1S0QA 3NRLA 1JMOH 4B6FA 2C93B 4FVBA 4AGKA 1SOZA 3UOUA 1BOQA 1EKBB 3DSGA 4Y6DA 1C5WB 4FU8A 3SW2B 1TAWA 1YPLH 2WINI 2IPHA 3F9EA 4BOHA 3RXBA 1E1RD 1GHVH 3F3BA 2RCEA 2BMGB 1UTJA 3I29A 4RKOB 3ZZ3A 5C2ZA 4FUHA 1YPGH 3RXQA 3RMLH 3DCLA 4BANB 3ESTA 1XXDA 1O2LA 4DT7B 2M2AA 1GJ8B 3AK5A 4FUEA 3ZZ7A 2JH5D 3A7VA 4YLQH 4B2BA 5E8EH 1O3JA 5AF9H 3UQVA 3HK3B 5EODA 1C5XB 4HI3A 3S7KB 4XBBA 3FP8E 3SUDA 3F6UH 1GVLA 1HNEE 6LPRA 4IC6A 1O3LA 2BY7X 4K1SA 5GIBA 2ZGCA 2FXRA 1PPCE 5DO4H 3SNEA 4I8LA 2O8LA 1ZYOA 4WMDA 1OP0A 1GGDB 3AW0A 1OWHA 2F83A 3MFJA 1XVMA 1C1NA 1C1VH 4GVUA 5C1XA 1MKXH 2ZCKP 1PPEE 3GCTG 1HXEH 5G4BA 2ZI2H 4KTCA 3UB0A 2PV9B 1EX3A 4ZROA 1AWFH 2ASUB 4GLYA 3BF6H 4Q2KA 2J2UA 4XFQA 4AYVB 3MOCA 1GCTC 5JBCS 5DN6D 4UONA 4DJZB 1MTSA 2GV7A 1G3CA 5DP3A 1O2JA 1ZGVA 3LU9B 1SQAA 4A7IB 4K5ZA 1UK4A 1C2KA 5HMAA 5CHAB 4FUGA 1GCDA 4DG4A 1KTTB 2A32A 3RUOA 1MD8A 1SR5C 1FN8A 2J4IA 3GY3A 1FV9A 1ABIH 1O38A 2BLWA 3NWUA 4ISNA 3GYMA 3F68H 1GMHG 4CR9A 2Z3DA 1K9OE 1K2I1 1TRNA 1MAYA 3GCHC 1C2IA 4MNWA 4VGCC 1A0LA 1S81A 1O3CA 2CGAA 3OAAD 3LOXA 3U1IB 1OS8A 3H7TA 3GISB 1GBCA 4WXIA 3F0OA 3M37A 3M3VA 2F4LA 2OQ5A 2PUQH 2Z9KA 4MNXA 1MBQA 2GT8A 5FXLA 2PKAA 1O3AA 1DVAH 1IQJA 4ACBA 3URDA 1AO5A 4CH2B 4CH8B 3F2GA 3VPKA 2YMSB 2A5AA 1BB0B 1TMUH 1TNHA 3P8NA 4H6TA 3UTUH 3WWFA 4Y8ZA 2ODYB 2QE7D 2F9UA 3H7OA 4YOIA 4I7YH 5SGAE 2FOGA 2QCYA 2O8UA 2ZPSA 2BVRH 2VIWA 4ZHLU 2XRCA 3S0NA 1H4WA 1QBNA 1SFQB 1LVOA 2FEQH 3NPSA 1T8LA 4TWWA 2GZ7A 1T4VH 3B9FH 3T62A 2IN2A 3KQCA 1EB2A 1EJAA 3GS9A 1TIOA 1G3EA 4ISHH 1GHAF 4CRFA 1F5KU 1N8OC 4KGAA 3TK6A 3DSPA 2ZDLA 4X2XA 3S9AA 3WY8A 1HJAC 2NU4E 1P01A 5EQSA 4Q7ZA 3W95A 2XNIA 2ZFPH 1UMAH 2SGQE 1O2PA 1A0JA 2GDEH 1LHCH 3V12A 1TX8A 3STJA 1S84A 3PRDA 1D3QB 3VFEA 1KLJH 3SV2H 1BHXB 5F8XA 4AFQA 1FY1A 1DDJA 1O5CB 3E90B 3RXTA 1QTFA 1ELTA 3Q3YA 2GZ9A 1GHYH 1QNJA 2WHXA 5IYTA 1UJ1A 1H1BA 2BHGA 1O3GA 4K2YA 3N99A 2OBOA 1O3IA 1C2MA 1G37A 2HPQH 1UHBA 4RN6A 1GBTA 1P2QA 1L1NA 3ZVAA 4ZHMU 3MNXA 4U32A 1GBAA 2XBVA 2JIZD 4U01A 1O2QA 1NBMD 2ZFRH 4H6SB 3UOPA 3FVFB 4BNRA 2D26C 2C90B 2WV4A 3BG8A 3SJKA 1MTUA 3RXUA 2ZKSA 3IG6B 4NZLA 1AFQC 4J2YB 1EZXC 2F9BH 3D65E 4B76A 1J14A 1ZMLA 1DPOA 1MKXK 5GNDA 3MU1A 2QXJA 4Y7AA 1HDTH 1V2WT 3SNBA 2M5TA 3UWJH 1AIXH 4KTUA 2YMSD 1BTHH 1SB1H 3AVZA 2G8TA 1A5IA 2R3UA 4AOQA 1ELCA 1JRSA 1SMFE 2FI4E 2A1DB 4Y11E 5A8ZA 1YYY1 1TGBA 1TOCB 2THFB 1OWKA 3URCA 1O3EA 3K6YA 2V7QD 1YLNA 2BY6X 6GCHG 2FOMB 1C4Y2 1TGTA 3A7YA 1FIZA 2V3MA 2EEKA 5FPTA 4DURA 1AUJA 3RLYH 4XBDA 4HTCH 4D7GA 4DY7B 5T3HA 1RD3B 4K1EA 1CBWC 1NPMA 1ZRBA 5F8ZA 3O8CA 1UO6A 2ZGXH 2Z9JA 1CT4E 3PLKA 1ZHPA 1BRCE 5HIYA 1IQKA 3E6PH 1NC6A 2UWLA 2F3CE 1P2NA 1OOKB 2P8OC 1GBMA 9LPRA 4A5TS 2WYJA 1MABB 1BHXF 1C5PA 4FUJA 5C17A 1BMFD 4X1NU 1ELEE 1DY9A 2G52A 3E91A 3A7WA 2TGDA 3ZZDA 1F2SE 1W2KH 1C2GA 3D62A 3FANA 3ZZ9A 4ABBA 1DLEA 4K60A 3MU8A 1LPGB 1L0ZA 3VB3A 1CT0E 1MBMA 3GOVB 1QRXA 2H6MA 1UTOA 3SU6A 1PPFE 3P17H 1D4PB 4E06H 5DP7A 5GPIB 2BLQA 2FLRH 3ATMA 1XM1A 1A61H 3FOAA 4ZAEA 4YT6H 1UCYH 3SNCA 1BUIA 2A4QA 4GCHF 5JBBS 1WOFA 1F5RA 2ZHEH 3KL6A 3MTYA 1NY22 2FZZA 3ZIAD 2VIOA 3T25A 1Y3XA 1LHGH 3BTFE 2FODA 1D6RA 1C9PA 1B0EA 3UWIA 1C1QA 3A85A 4Y8YA 1KDQA 2ANYA 2OC7A 4CHAC 1TQ0B 5C0TA 1DWDH 1ANEA 2A7CA 1Y3UA 1EAWA 3EDXB 3F1SB 5FCKA 1IQEA 1K1LA 1YPEH 1RTKA 2AERH 1B7XB 2Z94A 1QR3E 1C1WH 4ABJA 5T6GA 2BQWB 2ZDVH 1V6DA 2XNDD 3QO6A 2QGRA 1KMHB 2PUXB 3CENA 4A6LA 1E34B 2HLCA 1ABJH 3G01A 2VGCB 4JK6A 2VVCA 2CV3A 4OGYA 1BMLA 2CHAB 2A2QH 1Q3XA 1V2RT 3GCOA 1AVXA 2OP9A 1J17T 2P3UB 1TBQH 2RA3A 3LONA 2NU2E 1W11U 3M36A 2HNTC 2VU8E 2J95A 2O9QA 1XUIA 4Q80A 3TNTA 1O2YA 1THRH 2HALA 2P3FH 3ZVBA 2Z3CA 1HYLA 3LGTA 1SGNE 1KDQB 2OK5A 2G4UA 4NG9H 2B5TB 2K8IA 3BTME 1K1NA 1GI5A 3FN8A 2J94A 1DY8A 1AE5A 2PFEA 1NFUA 4DW2U 1ZTJA 3RXFA 4IGDA 5L2ZH 4JZEH 1GJ7B 1UCYE 2FOCA 3GY5A 4NA8A 1RJXB 3B23B 1C1UH 2CJIA 5DSFA 3UFAA 3HKJB 3M5MA 5DPAA 3BIUH 1V2NT 3SORA 2FTLE 2G5NA 2HRVA 4E05H 3MO9A 3U8OH 4AC9A 1PJPA 1JOUB 5F03A 1EATA 1P06A 1TB6H 3C1KA 1O35A 3K65B 1H9IE 2BLOA 4B75A 1KLTA 1SLWB 3BTWE 4YLUA 2RDEA 3ZZ4A 1PQ8A 1ESAA 3BG4B 3W1EA 4X8SH 3N7EA 1NM6A 3PB1E 1K1MA 1MAXA 3DT0H 1YCPM 3V3MA 1WTGH 4ASUD 1YY3A 2FIRH 1K1PA 2TRMA 2FS8A 1PQAA 2ZO3H 1GWAA 1O0DH 4TY6A 3U8RH 4WMEA 3U8TH 4TYDA 2A2XH 4Y0YE 3GY2A 1BMAA 1XMNB 4B1TA 1BITA 8LPRA 1ETTH 4B2CA 1IAUA 2Z9GA 1O5BB 4X6OA 2L6OA 1BIOA 1F7ZA 1K1JA 2GKVE 1PYTC 3TJVA 1Y3YA 5K7RA 2XTTB 4A92A 3CS0A 2Z7FE 4YT7H 3RU4T 4Y76A 1P9UA 1UCYK 1SGFA 4BTTB 2JKHA 3I78A 3MH6A 1WXRA 3PO1B 5EJZA 4ZXYH 2ALPA 3ZVGA 3RMMH 1Z7KA 2LNCA 4K8YA 1DUAA 3H09A 4JZ1A 1EAIA 1TALA 2QXGA 2FOFA 1GBFA 5EG4A 3RP2A 1GMCG 3UUZA 1WSSH 1SG8B 3AAVA 1ZMJA 1KLIH 2ZPQA 2GX4A 1O3BA 2AGIX 3GICB 3SU2A 3N7OA 3L33A 1Y59T 2ESTE 1HLTH 2F91A 2FOHA 1EAXA 3PMHB 1L2EA 2NWNA 2Y82A 1W12U 3L6PA 3EGKH 1LVBA 3HK6B 2JH0D 5LGOA 1S6LA 2HLDD 2B9LA 3RMNH 3RM0H 4ISLA 2BZ6H 2D8WA 3H5CB 2FYQA 1GL1A 2VBCA 1PPZA 4P02A 5DGJA 8ESTE 5K0HA 1GI6A 2BYAX 2XXLA 2LP6A 2C3SA 1GI8B 1EXFA 1Z8GA 4X8TH 1HBTH 5EXLA 1C5NH 1HXFH 1JWTA 1D3PB 1BTYA 2B0FA 1P04A 2GDDA 4DCDA 4HZHA 2DUCA 5A2MH 4OS5A 1V3XA 2TPIZ 3D49H 4CRBA 3RC4A 1Y5UT 1BRBE 2W5EA 3BEUA 1O2KA 2VIPA 5EW2H 1UTNA 5DP6A 3A84A 3AASA 3SQEE 4FVDA 2LELA 1UTQA 5FPYA 1TYNA 2WZQA 4AFSA 3MI4A 4YM9A 2AFQB 3ATIA 4Y8XA 3EE0B 1GBIA 1LCYA 1ARCA 4WH6A 1W13U 2ZHFH 3TIUA 2ULLA 4X8UH 1IHSH 1C5RA 1DLKB 3RXHA 3MH5A 2BX3A 1E35B 1FIWA 4AG2A 4ABGA 3TVJB 4A1XA 3E0NB 3LGIA 2JJ1D 1IQGA 2XOKD 2CN0H 1TWXB 1GCTB 2Y7ZA 3DD2H 2PTCE 5F8TA 1VJAU 2BVSH 5EQQA 1GHBG 3BEIB 2QF5A 1GDNA 5JB9S 2W6JD 1CGHA 1P09A 2J5UA 3GCNA 3PRBA 2EC9H 1P10A 1HAIH 2DE9A 1FDPA 4SGBE 3SHCH 3RXSA 3BIVH 1C4V2 3U1JB 4MPWA 4BXSA 3OSYA 3QGJA 3KEEA 3QZRA 3SZNA 1DANH 5HM9A 3GCHB 3A81A 3PLBA 2H1UA 3SZEA 2ANKH 2BD4A 5JB8S 4ABFA 2VNTA 1TNGA 1FNIA 2V6NA 1AHTH 4ZXXH 4O3TA 2ZCHP 4HGCA 1N6XA 1MZAA 5IK2D 4NIVA 2LPRA 1RRKA 4M7GA 3TU7H 4LZ1H 3MYWA 1LHFH 2VWOA 2ZP0H 4K69A 3SO3A 3A83A 3ZYDA 1O2XA 3TJNA 1D6WA 1P3CA 1QJ6B 3M61U 1EFRD 1GJBB 2GVFA 5L2YH 5LPFA 1QHRB 3MU0A 3BTHE 3FFGA 3WW7A 3PROA 3QN7A 1MZDA 4JK5A 1NRNH 1DWBH 1HAVA 1V2ST 4YZUA 1RGQA 3I77A 1CQQA 3R3GB 4Y71A 2C8YB 5AFYH 2BY5X 3NK8A 4I32A 2HVXA 2H9TH 4CRCA 1AD8H 4MNVA 3T2NA 1QB6A 2ZECA 4NFFA 1HAXB 1FPHH 1N8OB 2ZU4A 3ZZCA 2ZU3A 4I8GA 1PPBH 1EPTC 2TIOA 2VWLA 1HJAB 1SI5H 2NU1E 1BCUH 3BTEE 2DE8A 2V3OH 3UR6A 1EZUC 4UD9H 1VITG 1SLUB 4DIHH 3P92A 1OX1A 1GHZA 4BAMB 1KSNA 5EJ1A 3B8JA 3VB6A 1B0FA 3UREA 3TH4H 3RM2H 1VKYA 5C1YA 5A8YA 1HAVB 2HVYB 2AH4X 2W6ID 3O8BA 4KELA 1H8HD 2CK3D 2UWPA 2XCFA 3NCLA 2ZGJA 1NESE 3SI3H 1SHYA 1SQRA 2Z3EA 2K0QA 2ZZUH 3T26A 4LK4A 5HYOA 1YM0A 4MVNA 1B5GH 2XCNA 1BMNH 2AHME 4LZ4B 1CU1A 3SBKA 3LIWA 1GBKA 4FOUC 1AFQB 2WSSD 1GGDC 1OSSA 2QF4A 2GMTB 3A8DA 1GL0E 4X2VA 2KZ4A 1EOJA 1FY3A 5EGMA 3TK9A 1VGCB 1BTPA 2A4OA 2BQ6B 5I25A 1QIXB 2KFWA 4JZDH 3FZZA 1AB9B 1FPCH 1WYKA 2WV9A 1IQHA 1ZLRA 5KGOA 5TJXA 2HGTH 4UDWH 2WPHS 3ELAH 2G5VA 2WPKS 1MCTA 1WAYB 1DOJA 3QK1A 1C1RA 6CHAC 1ANCA 3A7TA 7GCHG 2VB0A 8GCHF 1HFDA 1P2OA 1INCA 2SGPE 4GHQA 4AB8A 1VCWA 4INLA 5FX5A 1AGJA 1MQ5A 1O31A 1GG6C 1WTHD 4FUCA 1P11E 1TGSZ 1CBWB 1O3FA 4X6NA 1V2LT 2KCPA 3WWBA 3LKWA 1P03A 1IQIA 2AYWA 1O5AB 3P8OA 1A0HB 4AORA 1WDIA 1GI7B 1ZJDA 5GWZA 5JBTA 3Q76A 4F48B 3RXKA 3LPRA 1SGTA 1Z6EA 1O36A 2XYAA 2BXTH 5EQRA 1UVSH 2XBXA 1GMDG 5CHBA 4J1YA 1DM4B 4XOJA 2W7SA 1ESBA 2ZGBH 1OP2A 2WYGA 1V2VT 3N7DA 4IMQA 1L4ZA 4JYUH 4B71A 1WBGB 1C1OA 3SJ9A 5L30H 1ANDA 5HIZA 4D9QA 3ZVDA 1CHGA 2R2WU 5FHTA 1DFPA 5TCAA 4X6PA 1V2QT 1AKSA 4CR5A 2ZU1A 3BTKE 5A09A 1KXFA 4GPGA 3E3TA 4WVPE 3UQOA 1BRUP 5A8XA 2P95A 5F53A 1GJ5H 3QTVH 1CHOG 1UTPA 5CDFE 2A4RA 3BN9A 5FL7D 1DT2A 3HPTB 1K0HA 3A7ZA 1O5GH 2ANWA 5GCHF 1A2CH 1SQTA 4X2YA 5T1VA 1FN6A 3A8AA 3ATWA 1SLXB 3TLOA 1Y5BT 1O5FH 1AI8H 2ZDNA 4IW4E 4SGAE 5L6NH 2BVXH 2BD3A 1C5ZB 4WWYA 2IPQX 1HJ8A 3RXMA 3UAIC 2H9EH 3OE7D 2BDIA 4F49A 1F0TA 1T8NA 5A0AE 3OEHD 2FOBA 1GHXH 1TPAE 4OS2A 4NA9H 3RXJA 5FX6A 2KCYA 1AU8A 1AKSB 2GCHG 3SQHE 2HPPH 1IOEA 1BJUA 1BA8B 3EE7A 3MO3A 5T6DA 3SV8A 3GDUA 2WPMS 3A8BA 5BPEA 3SUEA 1W0ZU 1G2LA 1Z1JA 2OC1A 2FX6A 3Q3KA 1RFNA 1YPJH 1AQ7A 1TNKA 3PMBB 3UR9A 2A0QB 3A89A 3ZZ8A 4YESB 1HGTH 2W3KA 3TGKE 3RU4D 1ZSJA 5C20A 2Z6BD 4IMZA 2QN5T 4UEHH 1F92A 3UNQA 3SNDA 2AGGX 1C9TA 3DFJA 3KN2A 3QTOH 2J9NA 1DWCH 1H8DH 2EI8A 4HG6A 3GDSA 4FU9A 1F0RA 2IJOB 4O03A 1W7GH 3BSQA 3O8DA 5LH8A 2GCTB 4XDEA 1NT1A 2W3IA 3A80A 1CGJE 1S6FA 4MQAA 2JETC 1W8BH 5CMXH 2BXUH 3K9XB 1W3CA 4LXBH 1NN6A 2P94A 1GVKB 1YPHC 2PWXA 2WV5A 3SYJA 2SGFE 2HOBA 1XKBC 2AS9A 4XSKU 2C8XB 4GSOA 4ABEA 4MDSA 2BM2A 5EIYA 2R3YA 2OQUA 3U9AH 2VIVA 2QF3A 3SHAH 2PGQB 3FP7E 1CSOE 2BD7A 1TONA 1A1RA 2ZIQH 3MMGA 4RT0A 5ETXA 2ZFFH 1SQOA 1TBRH 2V35A 1ACBE 4MLFB 4M9FA 2WPJS 1HAHH 5LPEA 1SOTA 4ZKSU 4NIYA 1ZPBA 4GHTA 4X2WA 4AG1A 3MH4A 3TPIZ 4ASHA 1GI0A 1QQ4A 3OTPA
chains in the Genus database with same CATH topology
1GHBF 1O2SA 2QY0B 3S9CA 1BT7A 5DP5A 1ARBA 4UE7H 4Y10E 1DE7H 1P9SA 1LHDH 3SN8A 1HCGA 4XE4A 1TRYA 1ELFA 4AYYB 1K1OA 4ABHA 1FI8A 3LGYA 1O3NA 3ZVFA 1MD7A 1C5SA 1ZPZA 4MPUA 3LGUA 1ZHRA 1UTKA 1V2JT 3VGCC 2UUKB 2BDHA 3RU4E 1O33A 1EUFA 1QJ1B 4DIIH 4X1RU 3LC5A 4WJG2 3PWBA 1TGCA 4U2WA 2Y6TA 4KTSA 1TPPA 3RC6A 1NFYA 1YPMH 2HNTF 3PWCA 4B73A 1CGIE 1SGRE 1ELAA 1XKAC 2FM2A 4INKA 2YNBA 3ZZBA 1NS3A 2F9OA 3FAOA 4B2AA 2SNWA 5E0JA 1F5LA 1GHAG 1HAOH 1Z8RA 4Q7XA 3RXVA 1CA0C 1O32A 1O2ZA 1QL8A 2FI5E 3Q77A 2STAE 3T5FH 3HATH 3GCTF 2G00A 1ELDE 5PTPA 5BRRE 1QBVH 2VWMA 4QT8C 2ZCLP 3SV7A 4I31A 4X1QU 1X7AC 2UUYA 2AGEX 2A5KA 3PTBA 1BBRH 2ZNKH 4YTAA 1O3HA 4JYVH 1BDAA 2AIQA 3DUXH 3SJIA 5DP9A 1DSTA 2AMPA 4BAOB 1MTVA 3ZVEA 1LMWB 1CT2E 1SPJA 3SV6A 1AUTC 1GMHF 1FZZA 1GDQA 1J16A 2B8OH 1SC8U 1YF4A 2SGEE 2P3TB 3M3TA 3PMJA 4D8NA 2FS9A 1RIWC 3P8GA 1P2IA 1VITF 1EB1H 4IBLH 1O2IA 1PPGE 1IQLA 2BY8X 4UFFH 3P6ZB 2BD2A 1T8OA 2ANMH 2FPZA 1VITH 5E2OA 1WQSA 1QY6A 3SU0A 1O39A 1EZQA 1QBOA 2CMYA 1SGDE 3IWMA 1AE8H 1C5OH 1DXWA 1G3DA 1FQ3A 1V2PT 2PKSB 2Y5FA 1ID5H 1PYTD 2PR3A 4TPYA 2HNTE 3P70B 3AAUA 1O34A 1LTOA 4YOJA 1GHWH 3RLWH 4X1PU 4NIXA 2O8MA 4JCNA 4D7FA 2EI7A 3IITA 5DP4A 1ZZZA 1C1PA 1JXPA 3M5OA 1A7SA 1V2MT 2ZFTA 4K1TA 2XC5A 5JDUB 1TOMH 2ZFQH 3OYPA 4FU7A 1XXFA 5EXMA 5GXPA 5E0HA 1DSUA 5LPRA 1PQ7A 1BBRE 1LDTT 1NRRH 1L1GA 1C2HA 1BTUA 7GCHF 1RTLA 5HGGA 2XWAA 1OWDA 2CF9H 3P95A 1U6QA 3EA7A 1EASA 3VB5A 4X6MA 1ZPCA 4WY3A 3M35A 3CS7A 1MMJN 1KXEA 1VR1H 2ZF0H 4THNH 4O97A 4R0IA 1JBUH 4WMFA 1C5VA 1EP6A 3GDVA 4X1SU 2BDCA 1WQVH 1O3PB 5EOKA 7KMEH 1H8IH 1XUKA 2AMQA 3D23A 3A86A 4I8HA 1ZSKA 2ZPRA 3E8LA 1O5DH 1IHTH 1Q2WA 1IQMA 4ZUHA 4BTIB 4GCHG 1GI4A 1GJDB 1ZR0A 3F9HA 1T31A 1TRMA 1NU7B 1GMDF 1XUGA 1HUTH 2BDYA 3S9BA 1WV7H 1F0UA 4ABAA 2Q6FA 1SGQE 3F9GA 1DUEA 2SFAA 2CXVA 3HGPA 1D3DB 1FAXA 3SUFA 2BX4A 2QV1A 1SGPE 1AY6H 4Y7BA 3DHKH 2Y5GA 3A88A 1C5MD 1O2TA 1AWHB 3ZV8A 2IOTA 1EJNA 1BMMH 1CA8B 3MNCA 3RC5A 1CHOF 1ELGA 2OLGA 2C4FH 2VVVA 2XBWA 6GCHF 2J92A 4NSYA 4CRDA 2R0KA 4CREA 1Y3VA 1GJCB 1Y8TA 1YP9A 1KXAA 1TX6A 1BRAA 4MPXA 4AX9H 2VWNA 1AVGH 5C1UA 3DA9B 1EPTB 1F0SA 3FP6E 3O8RA 3GYLB 2KAIB 2CF8H 1GI9B 2OTVA 2EI6A 1L1JA 1HAPH 1SSXA 2ZDKA 4VGCB 3FZDA 5EXNA 1YKTA 1LQEA 1IQFA 5GJ4B 3CP7A 2C8WB 1C2DA 5HXFA 1S83A 5E2PA 4ESTE 1O2HA 1VJ9U 2H5CA 2STBE 2GCHF 1MTNC 2ZDAH 5DK1A 3ZV9A 2YNAA 1FONA 3SGQE 3PV4A 1UTMA 1T32A 4OS6A 1DITH 3ZZ6A 4ISIH 1GBDA 5AHGH 5DP8A 1HAZB 1M9UA 3MO6A 1QURH 3RXGA 1NRQH 1J9CH 5GDSH 2JH6D 5EPYA 1GBHA 1GBJA 1TNLA 4D76A 2Y81A 1O37A 3NZIA 3JZ2B 4TY7A 2GT7A 1EP5A 2VIQA 1T8MA 5DJ7A 1TABE 1TBZH 4TPIZ 3BTGE 2HWLB 1C5TA 1CVWH 4TWYA 4DGJA 7ESTE 1O2RA 5CE1A 3ATLA 1A5GH 1LKAA 4INHA 1P2JA 4YOGA 2ZEBA 5FBIA 1MU8B 1NROH 2ODPA 1Z8JB 3BTQE 6CHAB 3S7HB 4PROA 3MU5A 1D3TB 2R2MB 1P0SH 1W7XH 5DG6A 1EZSC 2WUBA 1HV7A 1UK3A 1GG6B 1ZSLA 9ESTA 3LGWA 2FWWA 2PLXA 2XWBI 1TNIA 3TNSA 2ZTZA 2A7JA 3A87A 1KXDA 1XUJA 4KP0A 3SJOA 1KY9A 1NFXA 2ZFSA 2A7HA 1C2EA 3Q3XA 3ITIA 4OS7A 1HRTH 1NTPA 4K3JA 1AZZA 1NU9A 4JYTA 1Y5AT 1LPZB 2YOLA 1O2WA 2I6QA 4NIWA 2O8WA 1UVTH 4XBCA 4MNYA 3AW1A 4U30A 4NA7A 3EYDA 4E7RG 4UFDH 1S6HA 3QUMP 1AFEH 1MCVA 1UVPA 1A5HA 3PM3A 1LHEH 3KF2A 3MHWU 2TGPZ 2GTBA 1WU1A 4A1VA 3STIA 1AVWA 2WPIS 3ZVCA 3LC3A 5EPNA 2ILNA 2TGAA 3TH2H 1J8AA 3SUGA 2QIQA 4Q7YA 3F9FA 1W0YH 1ZTKA 3QZQA 2BTCE 3LT3A 3UIRA 5CHAC 1N6YA 3GY4A 2UWOA 2EA3A 1GI2A 2V3HH 1XUHA 2VVUA 2WUCA 1Q31A 2AMDA 1AN1E 4ABIA 2WPLS 1SL3A 1RTFB 3A7XA 1OXGA 3ZYEA 4CRAA 1TNJA 2XBYA 2GP9B 3EA8A 3DFLA 2PKAB 1Y3WA 3UNRA 2VJ1A 3RXOA 2UUJB 1K28D 1HIAA 4OGXA 2VINA 2RG3A 3TJUA 3RXRA 1TE0A 3RXAA 4R8TB 3SU5A 1H9HE 2P8OB 2BD9A 1J15A 4I8KA 1EOLA 1E38B 2FMJA 1GPZA 3M5LA 1GI1A 1FXYA 1QB9A 1OPHB 2G51A 2G81E 4JZIA 1OP8A 2QXIA 2D2DA 1HPGA 1IQNA 1K1IA 2ZU2A 3PTNA 1MU6B 3VXFH 1A46H 1KTSB 1BZXE 4Y0ZE 3RXIA 3SU1A 4FUBA 2AEIH 4Y79A 3VEQB 1PFXC 5ABWA 2H5DA 3MU4A 2XW9A 3NXPA 3QDZB 3U98H 1GI3A 2ODQA 3NKKA 1QJ7B 3QLPH 2PSYA 1UTLM 2FLBH 2ZGHA 1HAGE 2NU3E 3SNAA 3EAJA 4KKDA 2GMTC 1TX7A 5EU8A 1OWEA 1W10U 2QAAA 1VGCC 4IN2A 3U69H 1LKBA 1HIAB 2A4GA 1AB9C 3V0XA 1SVPA 2W26A 1O5EH 2PHBA 3M5NA 3W94A 5JBAS 1D9IA 1G2MA 1GMCF 3UNSA 2JETB 4OS1A 5JYIA 1GBLA 4UFGH 5J4QA 4OS4A 1C2LA 1C5YB 2VIDA 1YBWA 1C5QA 2AIPA 4CHAB 2RA0A 2ZDMA 1UHBB 2R9PA 5AVDA 3RMOH 3GY8A 1ETSH 2OINA 3MWIU 4LOYH 1SGFG 4H42U 1QL7A 1KYNA 4IC5A 1O2NA 2BDAA 1ZRKA 2GD4B 4BAHB 2FESH 1PPHE 4AFUA 4DOQA 2ZQ2A 2OUAA 3KQBA 5JPMH 1O3MA 3TH3H 2RDLA 5EW1H 2BOKA 2Q1JA 3EQ0H 3A82A 2G55A 1G9IE 3KCGH 1QFKH 2BY9X 3LH3A 1S0RA 1V2OT 1GJ6A 3BEFB 4NCYA 3T27A 1VCPA 2VH6A 1E0FD 5FPSA 1G32B 1WUNH 2ZHDA 4AGJA 3VXEH 3E1XB 3ODDA 3TGJE 1ESTA 2F9NA 1P05A 1XVOA 5FBEA 4E7NA 2O8TA 4ZKRU 1QA0A 2R0LA 1BTWA 4ZHAA 2UUFB 3OU0A 1NRSH 1TPOA 3PLPA 2BZAA 2NU0E 2ZQ1A 3VGCB 4MTBA 1YCPH 1OWIA 2PW8H 1QA7A 2OCVB 4CBOA 3MH7A 1DICA 1LPKB 2QYIA 3KNXA 2TGTA 1ELBA 4JMYA 1EAUA 4B74A 1YC0A 4AFZA 2BDBA 1ZMNA 2A31A 2Q6DA 3M3SA 1MKWH 1W14U 4O3UA 3VB4A 2Z9IA 3EA9A 3TJOA 2B7DH 1TLDA 1DX5M 2GV6A 1C1TA 1TQ7B 6ESTA 3LH1A 2OC0A 1CA0B 3VB7A 2OC8A 2QC2A 3QGNB 5F6MA 3LJOA 2BLVA 1C2JA 4H4FA 2G4TA 2XC0A 2FOEA 3T29A 2OD3B 4FUFA 1QRZA 3MNSA 1BTZA 1H9LB 2I6SA 2FI3E 2P93A 3BTDE 2J34A 1UVOA 4DVAU 5H4IB 4BTUB 3SGAE 1S5SA 3BV9B 1BJVA 1OYQA 3SU3A 2GGVB 2K1QA 2J38A 1A4WH 1S85A 3M7TA 1C1MA 3E16B 4FUDA 2FTMA 2ZU5A 1SGYE 1KIGH 1EQ9A 2H2ZA 2SGAA 1Z8IB 1T7CA 1TFXA 4ZKNU 1P8VC 3RXEA 2BDGA 4BAQB 4A1TA 4GAWA 4ABDA 4WF8A 1RIWB 3C27B 1TGNA 2Y80A 1NRPH 3SV9A 1SGCA 3E0PB 5FAHA 2OBQA 5HM2A 1CE5A 1V2TT 1O2OA 3HKIB 3RXPA 2VH0A 4IN1A 5ESBA 1ZTLA 1XX9A 1GBEA 1DS2E 1E37B 2Y7XA 4FUIA 4UFEH 1FAKH 4K8BA 1ZGIA 2SNVA 2ZWLH 2GCTC 2PGBB 3LJJA 3KIDU 1NFWA 1O3KA 1SGIB 1QB1A 1P57B 1S82A 3BTTE 4CBNA 1THPB 3RXDA 2ZG0H 1O30A 1ZHMA 4BAKB 2ZHWH 2BB4A 1RS0A 8GCHG 1K22H 1OWJA 1FUJA 1FY4A 3MNBA 1C5LH 1ZJKA 1O2GH 5A0BA 1YPKH 1ANBA 3M7UA 1SFIA 1TA2A 2F9PA 1V2UT 1E36B 1O3OA 5A0CA 1C1SA 3ZZ5A 1FY5A 1QQUA 4MG3A 1MUEB 1G3BA 1QL9A 2VGCC 1GDUA 3ODFA 2ALVA 4HFPB 2ZA5A 3QWCH 2SGDE 2CHAC 2C8ZB 1FJSA 1JIMA 1DWEH 1YPHE 8KME2 2PTNA 3V13A 3TGIE 1OYTH 2QXHA 4AZ2B 4D9RA 1QRWA 1VZQH 1P02A 1BQYA 1CO7E 1P2MA 4BXWA 5IDKA 1SGEE 3K6ZA 4ZKOU 1YLCA 4RSPA 1P2KA 2V0BA 1ELVA 1O3DA 1SLVB 3NUMA 1HJ9A 1T4UH 4NSVA 2ZTYA 1C5UA 1V2KT 5T6FA 4AB9A 2H9HA 4NFEA 3OY6U 1YCPK 4FXGH 1O2VA 1TA6A 1TPSA 2BD8A 5AFZH 3UY9A 3Q00A 2Q6GA 3S69A 4Z6AH 1ZOMA 1GJ9B 1QCPA 2ZC9H 2D1JA 1EJMA 1MKWK 2BOHB 1PQ5A 2A5IA 1FMGA 1O2UA 5DKMA 3SI4H 1G30B 5GCHG 2PSXA 1N1LA 3PYHA 1A3BH 4CRGA 1MQ6A 2TBSA 2FOAA 1Z6JH 1YGCH 1A3EH 3M7QA 1KXBA 1QGFA 2W7UA 3LDXH 1NO9H 5C3NA 3BG4C 1UVUH 3KGPA 3K2UA 5C5OA 4RKJB 1WCZA 4ZH8A 3UPEA 1GJAB 3RXLA 3TITA 1UK2A 1GJ4H 4NZQA 1C4U2 3RDZA 5I46H 1RXPA 2BD5A 2FX4A 1G36A 1GBBA 3R0FA 1Z1IA 4NGAH 1K21H 1KXCA 7LPRA 2FDAA 4NWLA 1DXPA 3L3TA 3GY6A 2FO9A 5E0GA 4JZFH 5FCRA 3ZZAA 1BTXA 1VCQA 3OX7U 2FYRA 1LQDB 1AMHA 1P3EA 2QA9E 4YO9A 2F9VA 3HGNA 1HAYB 1JIRA 2P16A 5ESTE 1FY8E 3RXCA 4I8JA 4GUXA 4ZMAH 3OY5U 1C2FA 4I33A 4ISOA 3OTJE 3TK5A 3V7TA 3PO1C 3ENSB 3KQEA 4NWKA 1EPTA 1LVMA 4MPVA 2BQ7B 1TMBH 2A45B 2KAIA 3SOSA 1FLEE 5B6OA 1THSH 1MTNB 2FP7B 2OXSA 3A8CA 3KHVA 2ZHQH 4X8VH 3JZ1B 5C5NA 4WH8A 2PKSC 1P12E 1LO6A 1YLDA 4IS5A 1Z71A 2Z9LA 3GY7A 3SU4A 2GZ8A 1JRTA 1O2MA 1HB0B 4Z0KA 1MH0A 3T28A 1L4DA 2ZTXA 4X0WU 1SBWA 3SGBE 5C67A 4O9VA 1BBRK 1ORFA 3LGVA 1MTWA 3PMAB 1OKXA 4F4OC 3KQDA 2QF0A 1AZ8A 1TMTH 3P8FA 1NZQH 3ATKA 3QX5H 1LVYA 1SHHB 5TCCA 1XUFA 2XC4A 4WXVA 1ETRH 3SJ8A 2P59A 5J4SA 2Y5HA 1GVZA 4AN7A 1S0QA 1JMOH 2C93B 4FVBA 4AGKA 1SOZA 3UOUA 1BOQA 1EKBB 4Y6DA 1C5WB 4FU8A 3SW2B 1TAWA 1YPLH 2WINI 2IPHA 3F9EA 4BOHA 3RXBA 1GHVH 2RCEA 2BMGB 1UTJA 3I29A 4RKOB 3ZZ3A 5C2ZA 4FUHA 1YPGH 3RXQA 3RMLH 4BANB 3ESTA 1XXDA 1O2LA 4DT7B 1GJ8B 4FUEA 3ZZ7A 2JH5D 3A7VA 4YLQH 4B2BA 5E8EH 1O3JA 5AF9H 3UQVA 3HK3B 5EODA 1C5XB 4HI3A 3S7KB 4XBBA 3FP8E 3SUDA 3F6UH 1GVLA 1HNEE 6LPRA 4IC6A 1O3LA 2BY7X 4K1SA 5GIBA 2ZGCA 2FXRA 1PPCE 5DO4H 3SNEA 4I8LA 2O8LA 1ZYOA 4WMDA 1OP0A 1GGDB 3AW0A 1OWHA