1O33A

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o33A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o33A02
1OYQA 1CU1A 4Y10E 2PSYA 2VWNA 3LU9B 1NU9A 2PTCE 1FI8A 2WINI 4ZHAA 3M36A 1EP6A 1Y5BT 4WY3A 2YOLA 3TH3H 3E8LA 1YCPH 5JPMH 1MU8B 3QUMP 1FN6A 1NRSH 1SI5H 1PPGE 4NSVA 3GYMA 3PM3A 1Y3VA 1TE0A 1ESBA 1C2IA 1F0UA 2PKSC 3M3TA 1IQEA 3ODDA 4X1QU 1Z71A 2BB4A 5FPYA 1IHSH 1HNEE 1RD3B 5DP6A 5IDKA 1J8AA 3RXMA 5DP7A 1GJ8B 1ETTH 1TONA 2A5AA 3OY5U 1QJ6B 1TWXB 4BANB 4HTCH 1LKAA 3UNSA 1T32A 3UUZA 1V2OT 3QX5H 3SU6A 1VZQH 4CHAC 3NCLA 4OGXA 3S9BA 3M7QA 1PYTC 1AUJA 3E1XB 4B71A 1AKSA 2ALVA 1N8OC 1MTNB 1XKBC 1IQHA 4Z6AH 5GIBA 4JYVH 2ANKH 4X1PU 1IQMA 1GDQA 1NFYA 1GHWH 1NO9H 3PTNA 3URCA 1CHOF 1YCPM 3RM2H 5CE1A 2HRVA 5C5OA 4X8SH 3VGCB 2GV6A 2FS8A 1PPCE 1A5IA 1SBWA 4O3TA 1O3KA 3RXBA 4AYVB 1KXEA 3ZZ8A 2GDDA 4Y6DA 3UTUH 2GZ8A 3UOPA 3TH2H 2ILNA 5AFYH 1O39A 1W7XH 2Z9LA 3E0PB 2ZEBA 1NROH 1DSUA 4MPWA 1JRTA 2KAIB 3A7XA 1ZPCA 2ZFPH 2GP9B 2HNTF 2ZPQA 3LJJA 1GMHF 4VGCB 1O31A 1RS0A 7LPRA 1XVOA 1ZSJA 2Q6FA 2QF0A 1G9IE 3SNCA 4IMQA 3BTTE 2JH0D 2F9VA 2ZCLP 2OINA 1P2KA 1VCQA 4HZHA 1ELGA 1SGDE 1C4U2 4YM9A 3RMLH 2UUKB 2BDYA 1HAVA 2WV4A 1OWEA 3BG4C 1RXPA 5C1XA 4FVDA 1QA0A 2ANWA 4Y8YA 3A86A 1SGCA 3DHKH 1HYLA 3K6YA 3M5MA 3ZZ4A 1WU1A 1AZZA 3SUFA 1J9CH 1ZGIA 4ISLA 3MO3A 3P6ZB 1NPMA 3K6ZA 4KP0A 1W14U 1AFEH 1QBNA 4X6PA 4CH8B 1FNIA 2ODQA 5C1YA 2TPIZ 1VR1H 1GJ9B 2O8WA 3PMBB 5GXPA 2FZZA 1S82A 1GHVH 1L4ZA 1FDPA 2C8WB 3R3GB 3FP8E 3UNRA 3GCHB 3RMMH 1G3CA 2WPKS 1JWTA 2OBOA 1QQ4A 4DGJA 5I46H 2WUCA 1GGDB 2ODYB 3MNCA 1QL7A 1C5SA 2PHBA 2W5EA 1O3HA 3PWBA 1FY4A 1KTTB 5F8TA 1GHZA 4JZFH 3V13A 1HAPH 1ZOMA 2A7CA 3EA9A 4X1RU 2W3KA 2EI8A 2ZTZA 3LPRA 1QHRB 1WTHD 3T27A 1TFXA 2STAE 1ANBA 1QY6A 4FUIA 1KXBA 3SU5A 1DWBH 1MUEB 1FQ3A 3NUMA 2FOCA 1LHEH 5L2YH 1K1NA 3TGIE 1G3EA 2BQ7B 5EGMA 1FJSA 1XUKA 3RXSA 1KTSB 5A0BA 1K9OE 3MMGA 1O3AA 1CA8B 2BDIA 1UTMA 3PB1E 4U01A 6CHAC 1OYTH 1C1WH 3QZRA 1C5UA 2DE8A 2SFAA 3M5LA 2J92A 1SGPE 2XC0A 5BPEA 1S83A 3ITIA 4X6MA 2SGPE 2BD8A 3BV9B 3PMAB 5E2OA 5JB8S 2BDBA 2QXGA 1TA6A 1NFXA 3ZVDA 4ABFA 3K9XB 3MFJA 1M9UA 1SGIB 2BVRH 4NFFA 2FI4E 4HGCA 4D9RA 3QDZB 5L2ZH 3E3TA 4H6SB 1Z1JA 3ATLA 4I32A 1ANDA 3A7ZA 1YPHE 4UFEH 5EW2H 5HM2A 4UFDH 1TBRH 2AMPA 8GCHF 4K3JA 4R0IA 2JETC 1GVKB 1LDTT 4SGBE 5GJ4B 3SJIA 3RXJA 4CR5A 2JH5D 1P03A 4GAWA 4AFUA 3F9FA 3PYHA 1GVZA 1P10A 3GISB 2UUJB 1XUGA 3A89A 2P3UB 1NFUA 2Y5GA 5F8ZA 3RXFA 4R8TB 3VB6A 1PYTD 3HATH 3TJUA 3FAOA 1GBFA 1GI0A 2F9PA 3VB5A 5ABWA 2FOGA 2STBE 4NZLA 1V2UT 2VU8E 3CENA 4IBLH 1ZPBA 2BY6X 1CA0B 2HPPH 1NRRH 3BSQA 1DDJA 1DY8A 1O2GH 2BOKA 2PKAA 4TWYA 1C5NH 4UFFH 3Q3YA 4DOQA 4KELA 3KNXA 1O2VA 1GBAA 3EE0B 1G3BA 3GY3A 4B2AA 3HKJB 1IQGA 2GCTB 1UJ1A 3ODFA 4I8KA 1EAUA 3ZZAA 1GI1A 5TCAA 1BIOA 2CMYA 4YZUA 1YPEH 1EQ9A 1AB9C 1O2TA 1UVPA 2FLRH 2GCHG 2W26A 1YPGH 2ZFFH 1G3DA 2EI7A 5ESBA 1YKTA 1OSSA 2JKHA 1Z6JH 2P16A 3BTQE 1VITH 2ZDAH 5IYTA 5SGAE 1LQDB 1S5SA 1GI9B 3OY6U 3GCNA 3H7OA 1ZHMA 3M35A 1OXGA 1NFWA 5ETXA 3PROA 2OC1A 4AFZA 1S0QA 1SLXB 1BRBE 3SGQE 3QZQA 2ZKSA 2R2WU 2WYGA 3E90B 4YESB 3TGJE 1DE7H 5FPTA 1HPGA 1GMHG 3LGVA 3U8TH 2O8MA 2A4QA 2BD7A 3SGBE 1OPHB 4Q7XA 4BOHA 1XXDA 1AN1E 2FLBH 4FUEA 3TJVA 1AVXA 4FUHA 1QQUA 1SGYE 1W3CA 1LQEA 3V3MA 2VVVA 1ZMJA 4IN1A 3UR9A 3ZV9A 3GYLB 3A8BA 4BAMB 5FPSA 1RIWC 3SHAH 3BN9A 3UOUA 4TY6A 2QXHA 1A3BH 1QB6A 3RXRA 2RG3A 1D9IA 1V2LT 2C93B 3M7UA 1EATA 1MH0A 1HFDA 2HPQH 3DA9B 4BTIB 1MKXH 4INHA 2R0KA 3ZZ9A 3QWCH 3UREA 2SGEE 2BTCE 4D8NA 1YPHC 1TLDA 2AMDA 1VGCB 3EDXB 3RP2A 1LVBA 3ATMA 3SJKA 5EQQA 2A1DB 3LC5A 1GHBF 2P8OC 2OQUA 1OOKB 3L33A 1XM1A 4Y11E 1DLKB 1MCVA 2NWNA 4NIXA 4E7RG 5CHAC 3S7KB 3KCGH 1EJAA 3SUDA 4U30A 2V0BA 7GCHF 3LGWA 2FM2A 2SNVA 8LPRA 1MQ5A 3SBKA 1HDTH 3LGIA 2C8ZB 1SGNE 4JMYA 2UWOA 4FUGA 1O3NA 1HAGE 4GHQA 2ZU1A 2Y7ZA 3UFAA 2CV3A 1P2OA 2J94A 3LT3A 3M7TA 1E35B 1EPTB 1SVPA 5E0GA 2QGRA 4ISIH 3MI4A 1EZXC 4FVBA 1GCTB 2AFQB 4WH8A 1KLIH 1CGJE 1GHAG 3HGPA 2C3SA 2QYIA 3A8AA 1S81A 1K28D 2OXSA 3SJ9A 2EEKA 1QJ7B 1TX7A 2ZHEH 1GI5A 1V2JT 2Y81A 1VCPA 3S9CA 4ZHLU 1W0YH 3LGYA 1MZDA 2CHAB 1RTLA 1Y3YA 4BAHB 3HPTB 3LIWA 4DJZB 3BIUH 1UCYE 1K1OA 2BY9X 5DP8A 4MVNA 1LCYA 3CS7A 1BTYA 1E0FD 1XX9A 2OUAA 1V2NT 2BZAA 2ZCHP 1ARBA 1GJ7B 2VGCC 2H5DA 2VJ1A 2DE9A 3FZZA 4DCDA 3RXTA 2H6MA 1T8OA 1HGTH 4Y76A 1O2SA 1O2QA 3RDZA 1OWHA 4I8LA 4JZIA 4B2CA 1JIMA 1Z8GA 8GCHG 5JBTA 2W7UA 4K1EA 3UPEA 5DP9A 1TNLA 5LPFA 1YYY1 2D1JA 1WOFA 1OP2A 2ZPRA 2AYWA 1YF4A 2PKSB 3KF2A 4FUBA 4XE4A 4MNXA 3GY8A 2FWWA 3VB3A 1HLTH 2J4IA 3A82A 5C20A 2A45B 3ATIA 1O2JA 1B0EA 3TK9A 1UTPA 1A5HA 3KIDU 2XBWA 2VB0A 4GVUA 2AH4X 4ABAA 2O8TA 3H5CB 1C2EA 1C5PA 3F9GA 1BJVA 2ZFQH 4AN7A 4YOJA 3L3TA 1ZSKA 2XBVA 1SGTA 2PSXA 4CHAB 1CBWC 1FLEE 4K5ZA 3ZVAA 1DX5M 1W7GH 5J4QA 1SLVB 3IITA 1C5QA 1V2QT 4ZMAH 1N8OB 1O5EH 2ZU3A 3GDVA 1O35A 1V2RT 3E91A 2XCFA 1KLTA 1PQ8A 4DY7B 4NG9H 4K60A 2VH6A 1LTOA 4ZXXH 4DIHH 4WH6A 1EX3A 3NWUA 4Q80A 1BT7A 2ESTE 4BAOB 2ZP0H 3PLBA 5LPRA 2G4TA 1ZJDA 1UTQA 2TGPZ 2QC2A 2Z3EA 1O3EA 3OYPA 4O9VA 2F9BH 1KXCA 1CSOE 1GBHA 3IG6B 3QN7A 1FIWA 1D6WA 1GCDA 1AKSB 1BBRE 2TGAA 3OTJE 1GL0E 1FPCH 1SR5C 1QBVH 2J95A 3SN8A 3TJOA 1OWIA 2J38A 1QB1A 3T62A 1HAOH 1RTKA 1HB0B 1W11U 2A4RA 2NU3E 3PMJA 3HK6B 1C5OH 3V7TA 2FDAA 1E34B 3Q00A 1ORFA 1Z1IA 3RLWH 1A1RA 4WF8A 5AHGH 1OS8A 5JYIA 2LNCA 2XBXA 1ZTLA 1YPKH 3A7YA 3BG4B 3EA7A 1AI8H 2GT7A 4WWYA 1O2RA 3U98H 1Z7KA 2FX4A 3MU4A 1RJXB 1C1SA 1WYKA 2C8YB 4BAQB 3GDUA 4AG2A 3TVJB 1OKXA 3P92A 3VPKA 1WSSH 2ZDMA 1DWCH 2GGVB 2VH0A 3MU0A 4FU9A 1T4UH 4DT7B 3SJ8A 4DIIH 3ZVBA 2ZU5A 2FX6A 1AU8A 1C2GA 4FUJA 5JDUB 3A7TA 1SB1H 2OCVB 5JBAS 2QY0B 3RXEA 2UWPA 3SU0A 3F9HA 2B0FA 1C9TA 2ZDNA 3IWMA 4X8UH 1B7XB 1HAVB 1TABE 2BX4A 2Y82A 3BEIB 4DURA 2F9NA 3RU4E 3P8GA 1BA8B 1TGNA 2ZTYA 1DUEA 5EPNA 1JOUB 1DSTA 2FEQH 4GUXA 2ZHFH 3MU5A 1Z8RA 3I77A 1TALA 4X6NA 1FY1A 1QJ1B 5L6NH 2ZGHA 4AFQA 2VIVA 3FANA 1SGEE 1CT2E 1NY22 4ABEA 3RXVA 3ZYDA 4XSKU 2BY5X 1E36B 2AEIH 1GMCF 4ZKRU 2ASUB 3BEFB 3RXKA 1W12U 3STJA 1ACBE 1A3EH 2TGTA 1KXAA 1WQVH 1IQNA 1KXFA 1C5WB 3M37A 1P12E 2FOEA 5L30H 1HJ9A 2A32A 3SOSA 1S0RA 3D23A 3UIRA 3FP6E 2QAAA 1HAZB 2VIPA 3VEQB 1HUTH 2ZFTA 1MTUA 3TGKE 4MPXA 1T4VH 3PO1C 1C1OA 1LVOA 2OC0A 1KY9A 1P11E 4M7GA 4X8TH 2R3UA 1AFQC 4AGJA 1DXWA 2JETB 4ABGA 3BTFE 1HXFH 4X2XA 2Y80A 1O2KA 1UHBA 2QIQA 1ESTA 1MZAA 1GVLA 4GLYA 1JXPA 1HAHH 1O2WA 4X0WU 3BTEE 2ULLA 2LPRA 1TBQH 1V2ST 3HKIB 3SGAE 3MHWU 2VINA 1UCYK 4I8HA 3SUEA 5FBEA 1C1NA 2QN5T 5FXLA 1AE5A 1P8VC 1D4PB 1GI2A 2BY7X 2Z3DA 3PLKA 5DJ7A 1O3BA 4YO9A 4CRGA 1K1MA 2CN0H 4B1TA 3QLPH 1TYNA 1O5FH 1SFQB 1HAXB 3U69H 1O2ZA 3KL6A 5C3NA 4KTCA 3S69A 4O3UA 3SV9A 3A8CA 1F2SE 4OS2A 3GICB 1ELVA 3ZZBA 4CR9A 1GBBA 1ZJKA 1AB9B 3LGTA 2FPZA 2NU0E 3ELAH 1EUFA 5GWZA 4OS1A 1O36A 4MQAA 2WPMS 2VWLA 3ZZCA 4ASHA 2BM2A 3ZZDA 2A4GA 4Q2KA 4X1SU 1A61H 5A2MH 1TMTH 5EOKA 6LPRA 3E16B 3BTGE 3TJNA 4MTBA 2Z9GA 3SO3A 1D3TB 1FV9A 4WMEA 2ZG0H 3MYWA 3KQCA 1GI8B 1EB2A 2Q6DA 2PKAB 2BDHA 4X1NU 1C2DA 1FAKH 5T3HA 1V2PT 4I33A 1QL9A 1DOJA 1D3DB 4TPYA 4CH2B 3AASA 2ZQ2A 1ELAA 4WJG2 3Q3XA 1DY9A 3P95A 4PROA 1P09A 1RIWB 2QCYA 3SJOA 2XYAA 3L6PA 5A09A 1S6FA 2FOAA 1AO5A 1TNIA 3T25A 2UUYA 1TIOA 2XWBI 4MNVA 3A87A 3CP7A 1MTVA 1QIXB 4F4OC 4ZAEA 1EP5A 1PPHE 1O0DH 2G00A 5DGJA 5T6GA 5C1UA 1MU6B 1QFKH 1L1GA 4B73A 1O5AB 2RCEA 3VB7A 4NA7A 5TJXA 2K1QA 1O2LA 4Q7ZA 5EW1H 2C8XB 2QA9E 1G30B 1T7CA 1BBRK 1DUAA 3G01A 4CBNA 3LC3A 3QTVH 4Q7YA 4I7YH 3O8DA 3RXOA 5JB9S 1GBDA 2GMTB 1SGFA 1VCWA 3BTKE 1YLCA 1WBGB 4LZ4B 1TBZH 1PQ7A 1UVOA 2VIDA 4NA8A 3TLOA 4DG4A 5EU8A 4K8YA 1ZRBA 1GBJA 1K1JA 2OLGA 4B76A 3TK5A 1GPZA 1CGHA 2ZI2H 2SGDE 2ZHWH 1G36A 1CT0E 2A0QB 3I78A 3PLPA 4GCHF 3GCTF 1ZZZA 1EAIA 1TB6H 1O3MA 2SGFE 1C5MD 2NU1E 1O2UA 3A85A 4VGCC 2A7HA 2UWLA 1GMCG 2XC4A 4NIWA 1EZSC 4X8VH 1BTXA 3VXEH 1NRPH 4H42U 4KKDA 1P3EA 1XUJA 2FYQA 5AVDA 1F5LA 2I6QA 3U1JB 1BRCE 1Q2WA 1CHOG 1ZMLA 2F91A 1OWDA 3AAUA 1YPLH 1GBCA 2VIQA 2FOMB 4B75A 1MAXA 3A83A 4NZQA 1GI6A 1MBMA 1TQ0B 3LGUA 3AW1A 2ZHQH 1PPZA 2H9HA 2AIQA 2VGCB 1IQIA 1BITA 1H8DH 1C1VH 4I31A 4LXBH 2BD5A 2M5TA 4OGYA 2ZGBH 3P8NA 3BTME 5E0JA 3E6PH 1NRNH 1P01A 3SU4A 3DFJA 1O3CA 1V2TT 3JZ2B 2WV5A 4KTSA 1S6HA 4NWKA 2BD3A 2Q1JA 3U8RH 1DLEA 1QCPA 1ZTKA 3AAVA 2OBQA 5A8YA 2BLQA 2ZNKH 1C2JA 3RC6A 3RMNH 1GGDC 1W13U 3MO9A 1DT2A 3K65B 3ZYEA 5HXFA 1F0TA 1ELFA 1GG6C 1L0ZA 3A7WA 4IW4E 2AS9A 2O8LA 1MD8A 4FXGH 1O2MA 3PTBA 1A7SA 2CGAA 1SG8B 4AB9A 2P59A 4O97A 1LHGH 1RGQA 2FESH 1CBWB 5K7RA 2F9OA 3RU4D 4NA9H 1GJ4H 3D65E 5A8ZA 1LHDH 4B74A 4MPVA 1D3PB 3KQEA 5DP4A 1FPHH 1TNGA 4KGAA 1EJMA 2H9TH 5J4SA 1DS2E 3VXFH 1BOQA 4QT8C 2IJOB 1LVYA 3KGPA 3MH5A 2B8OH 2IPHA 1C1QA 1UVUH 1GBKA 1TNJA 5DPAA 2PGBB 2G81E 1TPOA 1FN8A 1K1LA 1BMAA 4ZHMU 1F5RA 3F68H 2GZ7A 1ZR0A 4BTTB 1C9PA 1PQAA 2GKVE 2ZQ1A 3EA8A 1UTNA 4I8JA 5B6OA 2FOHA 3FFGA 1HBTH 2XXLA 1KIGH 4YOIA 5EODA 1FIZA 1A4WH 1NC6A 1THSH 1UMAH 2A5IA 4UD9H 3RU4T 4RKJB 3RXPA 2RA3A 5DK1A 3SNEA 1KDQA 3B9FH 3TH4H 1GBTA 2C90B 5E0HA 1O3DA 3Q3KA 4A6LA 5E8EH 2BQWB 3B8JA 1ZHRA 2YNAA 1IAUA 2XRCA 2ANMH 2Z9KA 3M3SA 3LH3A 1S84A 3T28A 1GWAA 1K21H 1BDAA 4HI3A 1P9SA 4LK4A 1NESE 2ZIQH 1LHCH 1NTPA 4CRBA 1KSNA 1C1PA 4JZDH 1FY5A 1CA0C 1HV7A 4FU8A 2CXVA 3URDA 4BTUB 4JK6A 1GI3A 2BD9A 4E7NA 2ZWLH 2Z6BD 3DT0H 2EI6A 2A2QH 4ZXYH 2A4OA 1G2MA 2NU2E 1GJBB 4E05H 3D49H 1S85A 1C4V2 1O5GH 1HIAA 1XUHA 4Y8ZA 4JZ1A 2CF9H 2ZFSA 1O3LA 1OWKA 5PTPA 6ESTA 4ISNA 3RXCA 3A8DA 1BTPA 1YGCH 4X2YA 3UWJH 4NIVA 1C5ZB 1BHXF 1MKWH 3LKWA 1P02A 1GL1A 1A46H 3S7HB 4JK5A 1ELTA 2J2UA 3MNXA 3KEEA 1U6QA 4U2WA 1O3JA 4WMFA 1FMGA 3KQDA 1LO6A 2AGEX 1TOCB 2ANYA 1A0LA 1SGRE 1W8BH 2PTNA 4XOJA 4RSPA 1J17T 1WAYB 3ENSB 4LOYH 4AORA 5A0AE 1HJ8A 1L4DA 2THFB 1RFNA 1HXEH 3MO6A 1QGFA 1ZYOA 2EC9H 3UY9A 2B5TB 1ETRH 4MNWA 2HGTH 2BQ6B 2FI3E 4NCYA 1MD7A 1YBWA 2WPHS 1TPPA 1VGCC 1DANH 1W10U 3BTDE 5FX5A 4A92A 1QR3E 2ZZUH 2G52A 2P3TB 1AVWA 4A1TA 3QGNB 2FIRH 1QRWA 5H4IB 1O37A 2QXJA 1EJNA 2BLOA 1ZGVA 3ATKA 3SV2H 3MOCA 1EASA 4XFQA 1ANEA 3R0FA 1H1BA 1BTWA 5ESTE 3V0XA 2GZ9A 2VVUA 1MAYA 2CF8H 1H9HE 1V3XA 4DW2U 1DFPA 3SHCH 1AFQB 1C5TA 2ZFRH 1T8MA 4WXIA 1XUFA 1GHXH 1X7AC 3LONA 1GJDB 4Y7AA 4MDSA 3SV8A 1SQOA 4TPIZ 1DPOA 5DP5A 4BXSA 1EZUC 1C2MA 2BVXH 3QK1A 1PPEE 1BZXE 3W95A 2OC8A 4FUFA 1Y8TA 1EPTC 2BMGB 4A1VA 3H7TA 1DITH 4JYUH 3FP7E 1A2CH 1O33A 3SU1A 1ANCA 1SOZA 1KYNA 2TIOA 2BOHB 3NXPA 4JZEH 1ELDE 1GHBG 3TK6A 1EOLA 2P3FH 1YCPK 3M3VA 1C1RA 4TYDA 5EPYA 3RM0H 1UHBB 2ZU2A 4OS4A 7GCHG 3QGJA 2EA3A 3ZVCA 2A31A 1RRKA 2CHAC 1IOEA 3GY2A 3GDSA 2QXIA 2BDAA 3ZV8A 4A5TS 1QL8A 1W2KH 1O34A 4YLUA 2GVFA 4ZKNU 1PPBH 1WV7H 4Y71A 4UFGH 2ZC9H 2PV9B 9ESTA 5G4BA 1O2NA 1TAWA 2O9QA 3RUOA 1ZRKA 1DVAH 3ESTA 1AMHA 4DVAU 1AQ7A 1C1MA 2F83A 1ABJH 1O32A 2ZDLA 2FTMA 1B0FA 4Y79A 5EG4A 2Q6GA 3U1IB 1BTZA 1ESAA 1CE5A 4H4FA 3SU3A 4K69A 4ABJA 3SQHE 3RMOH 2B7DH 3MU8A 1IQKA 2ZO3H 3VB4A 1DXPA 1NT1A 3WY8A 4CRCA 1FY3A 1QBOA 3ZVFA 6CHAB 2AGGX 5C5NA 1TPSA 1AWFH 3E0NB 1SQTA 1BMMH 5FHTA 1WQSA 3SI3H 3RXLA 1UK3A 2H5CA 4INLA 4AYYB 1K1PA 3GY5A 1C5LH 1C2LA 1GBIA 2G5VA 3VFEA 3D62A 4YT7H 5EQSA 1VJAU 1TNHA 1UK2A 2PUXB 4NWLA 3M61U 4AG1A 2BYAX 4XBCA 4Y8XA 4YLQH 1SLUB 3F9EA 2PR3A 4ESTE 1CHGA 2BXUH 1Y3WA 3BTHE 2HWLB 1HJAC 3LJOA 2ZF0H 1OWJA 2GCHF 2GV7A 1C2HA 2ZCKP 4CRDA 3STIA 4MPUA 2GX4A 5JBBS 2HNTC 1O30A 2TGDA 3BIVH 3EYDA 1LVMA 3EGKH 5TCCA 2FOBA 2VIWA 4AOQA 1VJ9U 4YOGA 4ISHH 4U32A 3MU1A 1UTLM 1ELEE 1T8NA 1T31A 1P9UA 3OU0A 2VWOA 5EXNA 1YPJH 1GBMA 2RDLA 5EXMA 2ZPSA 1O5BB 1Z8JB 3SNDA 4NIYA 2ZGCA 1Q3XA 3O8CA 1QURH 1JBUH 1ETSH 2OC7A 3S9AA 1L1JA 1MTWA 3BEUA 2V6NA 2FS9A 2PGQB 2R9PA 1VITF 2Z7FE 1UVSH 2ZU4A 4FU7A 3Q77A 3QTOH 1O2XA 1Q31A 1CGIE 1WCZA 3ZZ6A 1JRSA 1IHTH 1V2VT 1MQ6A 1EKBB 1AHTH 1OP0A 1UCYH 2BHGA 2P93A 2Z9JA 4NSYA 4IC5A 4TWWA 1GI4A 4NFEA 4FUCA 4I8GA 1SC8U 4OS5A 2VIOA 1TGSZ 2IN2A 5DG6A 1H8IH 1NRQH 1BMLA 1BMNH 1O3PB 2CJIA 1ZPZA 2WPLS 2J34A 1K1IA 2OP9A 5T6FA 3AVZA 1LPKB 1XXFA 2QF3A 3TNSA 2WPIS 1YC0A 1YM0A 3T26A 3C1KA 1XKAC 3QO6A 2JH6D 2FTLE 4B2BA 4Y7BA 1AZ8A 1SHYA 1GJ6A 1CT4E 1GG6B 2A7JA 2QV1A 2XC5A 1P2JA 1XMNB 2GTBA 4HFPB 1ELBA 1HCGA 3F1SB 1EXFA 4IS5A 1G2LA 1SLWB 1CO7E 4NGAH 1QTFA 2SGAA 1G37A 1BB0B 1Z6EA 1H4WA 3TNTA 3HK3B 4BXWA 1TMBH 1Z8IB 3PWCA 1DM4B 1H9IE 1GHYH 3EQ0H 3I29A 4YT6H 5E2PA 1P0SH 1CVWH 1O2YA 1C1TA 1C5RA 2D2DA 1ELCA 1YPMH 1P05A 1GHAF 1O2OA 1GBLA 2P8OB 1RTFB 1TX6A 1AE8H 2KAIA 1ZTJA 1MTNC 1A0JA 2GT8A 3KN2A 1AIXH 1YLDA 2WYJA 1TGTA 5CHAB 2I6SA 3UR6A 1GBEA 2OQ5A 1SHHB 1UTJA 1HRTH 1DICA 5I25A 1AVGH 4O03A 2FO9A 3VGCC 5JBCS 1FZZA 1ID5H 2DUCA 4OS6A 2PFEA 3SV7A 5FCRA 1KLJH 1ZLRA 1EAWA 1MTSA 2RA0A 4ABIA 5LH8A 4SGAE 8ESTE 3LOXA 3P70B 2W3IA 1D6RA 3T2NA 4ZKOU 4AGKA 3LDXH 3T5FH 2Y6TA 3MH6A 3K2UA 4A1XA 4RKOB 3UQOA 1BBRH 3GY6A 1IQLA 5BRRE 3UNQA 4FUDA 5LGOA 3A88A 2ZHDA 3MNBA 1F7ZA 4WXVA 4JYTA 1F0RA 2GD4B 5FBIA 3CS0A 1BTUA 1C5VA 1XUIA 3ZZ3A 3NPSA 2WPJS 1QRZA 1SGQE 2BXTH 2R0LA 1LKBA 1TGBA 3AW0A 1WUNH 3BF6H 2ZDKA 3KHVA 3NZIA 4ISOA 3UQVA 5A8XA 1MCTA 3GOVB 3SZNA 2AMQA 1J15A 1KDQB 4K1SA 1INCA 5HGGA 3BTWE 2P94A 3ZZ5A 3SNAA 4UEHH 1P2MA 5HYOA 1G32B 1O3IA 3DD2H 4XBBA 3TU7H 5GPIB 1TRMA 3HGNA 1A5GH 4D7FA 4YTAA 2G8TA 1C1UH 3GCHC 4RN6A 4GSOA 1BHXB 1FONA 1Y5AT 5A0CA 3RXQA 4INKA 1O2IA 2XTTB 2Z9IA 3MH7A 1BJUA 6GCHF 2G55A 3MTYA 3U8OH 2V3OH 2W7SA 1MKXK 1SPJA 4WMDA 1MBQA 1NM6A 3KQBA 1GJCB 5F03A 5C67A 3W94A 2FI5E 4GHTA 4UDWH 4CREA 4GPGA 1P2NA 2XNIA 3UWIA 1O2HA 1O5CB 1FXYA 2AGIX 1GJ5H 4LZ1H 2ZTXA 4D9QA 1C5YB 2BLVA 4H6TA 1ABIH 1P3CA 4ABBA 1BUIA 4K1TA 1HIAB 1LPZB 7KMEH 1BTHH 2BZ6H 3SW2B 3ATWA 1GMDF 1VITG 4BAKB 1ARCA 1ZMNA 3SI4H 4IGDA 9LPRA 1BQYA 2AERH 2GDEH 2HALA 1ZSLA 4IN2A 4E06H 2BVSH 4THNH 1K22H 4ZROA 1TX8A 1D3QB 1Y59T 4AFSA 1PFXC 1TQ7B 5FAHA 1SSXA 2Y7XA 1BCUH 5GCHF 2YNBA 3ZVGA 4ZH8A 3SORA 1J16A 1EOJA 2F9UA 1T8LA 1AUTC 3NK8A 4OS7A 2OD3B 1V2MT 2A5KA 3A7VA 2ODPA 2V3HH 4Z0KA 4MG3A 1SOTA 1PJPA 1QB9A 2VWMA 1GDUA 4ABHA 3SNBA 2BDGA 3LH1A 4ABDA 4BNRA 1L2EA 5HM9A 4JCNA 3S0NA 1SMFE 1O38A 3C27B 3M5OA 2GMTC 4D7GA 3JZ1B 3RXGA 2BD4A 1F5KU 1CQQA 1E37B 4ZUHA 1TA2A 2H2ZA 3O8BA 2V35A 1P04A 2ZECA 2BY8X 1NS3A 4MNYA 3F6UH 1Y3UA 5F8XA 4CRAA 3SU2A 4UONA 2BDCA 2F3CE 3O8RA 1HAIH 2ZGJA 5F6MA 3DUXH 2XWAA 1L1NA 1YP9A 2PWXA 1TMUH 4KTUA 1V2KT 1LMWB 1J14A 4X6OA 1OP8A 2G5NA 1TRNA 2HOBA 4CRFA 1V2WT 2FOFA 2ZA5A 1O2PA 5FX6A 1OX1A 5T6DA 4A7IB 1V6DA 3EAJA 3FVFB 2D8WA 5C2ZA 2FYRA 2GCTC 1E38B 2C4FH 1C2FA 2R2MB 1TGCA 3DFLA 1QNJA 2TBSA 1SQAA 2FP7B 2FXRA 4F49A 1W0ZU 2R3YA 1FY8E 1C5XB 3RLYH 3P8FA 1A0HB 1MKWK 1JMOH 4D76A 2D26C 4J1YA 3PMHB 1F92A 2BX3A 5HMAA 1NN6A 1HAYB 4GCHG 3GCTG 2B9LA 1XVMA 2FMJA 1QA7A 3B23B 4IC6A 1NU7B 3GY7A 5K0HA 3RXDA 2FODA 1THRH 4K2YA 5EQRA 1UVTH 2PUQH 5EXLA 4IMZA 3T29A 1O3OA 1P57B 2VVCA 1F0SA 1UK4A 3RXAA 1NZQH 2H1UA 5FCKA 2XW9A 3A84A 4XBDA 5DP3A 3SV6A 1K2I1 2HLCA 2O8UA 1ZHPA 2IOTA 4J2YB 4XDEA 2HVXA 3M5NA 1SGFG 4X2VA 1EZQA 2BD2A 2Z3CA 1AD8H 2ZGXH 3GCOA 1BRAA 3BG8A 3MH4A 1GJAB 1BRUP 2P95A 2UUFB 1FAXA 2A2XH 1AWHB 1TNKA 2PLXA 5DKMA 1EPTA 3SUGA 5CMXH 5AFZH 1UO6A 1TPAE 1UTKA 3MWIU 4UE7H 1Y3XA 3OX7U 5DO4H 1DWEH 3RXUA 3NKKA 2SGQE 3GY4A 4ZKSU 1TRYA 3PO1B 4Y0YE 3ZZ7A 1LPGB 4WVPE 1LHFH 1HJAB 1MMJN 1WTGH 2VNTA 2ALPA 3V12A 6GCHG 1N1LA 1IQFA 1N6XA 1THPB 1C2KA 3Q76A 1UTOA 4MLFB 2Y5FA 2NU4E 1QRXA 1PQ5A 1P2IA 1TOMH 1GI7B 4AZ2B 3P17H 1GDNA 3U9AH 2BLWA 3RC5A 1H9LB 3TITA 1DWDH 1O3FA 3P8OA 4Y0ZE 1O5DH 1SFIA 3OSYA 4X2WA 3RC4A 3A81A 2OTVA 4TY7A 4K8BA 1JIRA 2Z94A 3N7OA 1FUJA 1P06A 7ESTE 4AX9H 3PV4A 4AB8A 1AGJA 2HNTE 2ZDVH 2WUBA 1O3GA 1AY6H 1GCTC 2SNWA 5LPEA 1N6YA 1GMDG 1SL3A 2TRMA 1EAXA 1P2QA 1KXDA 3MNSA 3A80A 3RXIA 1IQJA 2G4UA 3TPIZ 5AF9H 1PPFE 1EB1H 2AIPA 5GDSH 2Y5HA 3RXHA 2H9EH 2J9NA 1C4Y2 5GCHG 3ZVEA 3TIUA 2G51A 2XBYA 2PW8H 4CBOA 1B5GH 1Y5UT 2XCNA 3FZDA 3SQEE 8KME2
chains in the Genus database with same CATH superfamily
1OYQA 1CU1A 4Y10E 2PSYA 2VWNA 3LU9B 1NU9A 2PTCE 1FI8A 2WINI 4ZHAA 3M36A 1EP6A 1Y5BT 4WY3A 2YOLA 3TH3H 3E8LA 1YCPH 5JPMH 1MU8B 3QUMP 1FN6A 1NRSH 1SI5H 1PPGE 4NSVA 3GYMA 3PM3A 1Y3VA 1TE0A 1ESBA 1C2IA 1F0UA 2PKSC 3M3TA 1IQEA 3ODDA 4X1QU 2EY4C 1Z71A 2BB4A 5FPYA 1IHSH 4P00A 1HNEE 1RD3B 5DP6A 5IDKA 1J8AA 3RXMA 5DP7A 1GJ8B 1ETTH 1TONA 2A5AA 3OY5U 1QJ6B 1TWXB 4BANB 2GJGA 4HTCH 1LKAA 3UNSA 1T32A 3UUZA 1V2OT 3QX5H 3SU6A 1VZQH 4CHAC 3NCLA 4OGXA 3S9BA 3M7QA 1PYTC 1E1RD 1AUJA 3E1XB 4B71A 1AKSA 2ALVA 1N8OC 1MTNB 1XKBC 1IQHA 4Z6AH 3FO8D 4JYVH 5GIBA 2ANKH 4X1PU 1IQMA 1GDQA 1NFYA 1GHWH 2WSSD 1NO9H 3PTNA 2V3MA 3URCA 1CHOF 1YCPM 3RM2H 5CE1A 3OEED 2HRVA 5C5OA 4X8SH 3VGCB 2GV6A 2FS8A 1PPCE 1A5IA 1SBWA 1SKYE 4O3TA 1O3KA 3RXBA 4AYVB 1KXEA 3ZZ8A 2GDDA 4Y6DA 3UTUH 2GZ8A 3UOPA 3TH2H 2ILNA 5AFYH 1O39A 5KECA 4YXWD 1W7XH 2Z9LA 3E0PB 2ZEBA 1NROH 1DSUA 4MPWA 1JRTA 2KAIB 3A7XA 1ZPCA 2ZFPH 2GP9B 2HNTF 2ZPQA 3LJJA 1GMHF 4VGCB 1O31A 1RS0A 7LPRA 1XVOA 1ZSJA 2Q6FA 2QF0A 4AC9A 1G9IE 3SNCA 4HG6A 4IMQA 3BTTE 2JH0D 2F9VA 5HIZA 2ZCLP 2OINA 1P2KA 4F55A 1VCQA 4HZHA 1ELGA 1SGDE 1C4U2 4YM9A 3RMLH 2UUKB 2BDYA 1HAVA 2WV4A 1OWEA 3BG4C 1RXPA 5C1XA 4FVDA 1QA0A 2ANWA 4Y8YA 3A86A 3PRDA 1SGCA 2LP6A 3DHKH 1HYLA 2KCAA 3K6YA 3M5MA 3ZZ4A 5FL7D 1WU1A 1AZZA 3SUFA 1J9CH 1ZGIA 4ISLA 3MO3A 3P6ZB 1NPMA 3K6ZA 4KP0A 1W14U 1AFEH 1QBNA 4X6PA 4CH8B 5C17A 1FNIA 2ODQA 5C1YA 2TPIZ 1VR1H 1GJ9B 2O8WA 3PMBB 5GXPA 2FZZA 1S82A 1GHVH 1L4ZA 1FDPA 2C8WB 3R3GB 3FP8E 3UNRA 3GCHB 3RMMH 1G3CA 2F43B 2KCYA 2WPKS 1JWTA 2OBOA 1QQ4A 4DGJA 5I46H 2WUCA 1GGDB 2ODYB 3F3BA 3MNCA 1QL7A 1C5SA 2PHBA 2W5EA 1O3HA 3PWBA 1FY4A 1KTTB 5F8TA 1GHZA 4JZFH 3V13A 1HAPH 1ZOMA 2A7CA 3EA9A 4X1RU 2W3KA 2EI8A 2ZTZA 3LPRA 1QHRB 1WTHD 3T27A 1TFXA 2STAE 1ANBA 1QY6A 4FUIA 1KXBA 3SU5A 1DWBH 1MUEB 1FQ3A 3NUMA 2FOCA 1LHEH 5L2YH 1K1NA 3TGIE 5KGOA 1G3EA 2BQ7B 5EGMA 1FJSA 1XUKA 3RXSA 1KTSB 5A0BA 1K9OE 3MMGA 1O3AA 1CA8B 2BDIA 2YMSB 3DSOA 1UTMA 3PB1E 4U01A 6CHAC 1OYTH 1C1WH 3QZRA 1C5UA 2DE8A 2SFAA 3M5LA 2J92A 5HKKD 1SGPE 2XC0A 5BPEA 1S83A 3ITIA 4X6MA 2SGPE 2BD8A 3BV9B 3PMAB 5E2OA 5JB8S 2BDBA 2QXGA 1TA6A 1NFXA 3ZVDA 4ABFA 3K9XB 3MFJA 1M9UA 1SGIB 2BVRH 4NFFA 2FI4E 4HGCA 4D9RA 2AHME 3OTPA 3QDZB 5L2ZH 3E3TA 1E1QD 4H6SB 1Z1JA 3ATLA 4I32A 1ANDA 3A7ZA 1YPHE 4UFEH 5EW2H 5HM2A 4UFDH 1TBRH 2AMPA 8GCHF 4K3JA 4ACAA 4R0IA 2JETC 1GVKB 1LDTT 4SGBE 5GJ4B 3SJIA 3RXJA 3DSPA 4CR5A 2JH5D 1P03A 4GAWA 4AFUA 3F9FA 3PYHA 1GVZA 1P10A 3GISB 2UUJB 1XUGA 3A89A 2P3UB 1NFUA 2Y5GA 5F8ZA 3RXFA 4R8TB 3VB6A 1PYTD 3HATH 3TJUA 3FAOA 1GBFA 1GI0A 2F9PA 3VB5A 5ABWA 2FOGA 2STBE 4NZLA 1V2UT 2VU8E 3CENA 4IBLH 1ZPBA 2BY6X 1CA0B 2HPPH 1NRRH 3BSQA 1DDJA 1DY8A 1O2GH 2BOKA 2PKAA 4TWYA 1C5NH 4UFFH 3Q3YA 4DOQA 4KELA 3KNXA 1O2VA 1GBAA 3EE0B 1G3BA 3GY3A 4B2AA 3HKJB 1IQGA 2GCTB 1UJ1A 3ODFA 4I8KA 1EAUA 3ZZAA 1GI1A 5TCAA 1BIOA 2CMYA 4YZUA 1YPEH 1EQ9A 1AB9C 1O2TA 1UVPA 2FLRH 2GCHG 2W26A 1YPGH 2ZFFH 1G3DA 2EI7A 5ESBA 1YKTA 1OSSA 2JKHA 5F53A 1Z6JH 2P16A 3BTQE 1VITH 2ZDAH 5IYTA 5SGAE 4RT1A 1LQDB 1S5SA 1GI9B 3OY6U 2RDEA 3GCNA 3H7OA 1ZHMA 3M35A 1OXGA 1NFWA 5ETXA 3PROA 2OC1A 4AFZA 1S0QA 1SLXB 1BRBE 3SGQE 3QZQA 2ZKSA 2R2WU 2WYGA 3E90B 4YESB 3TGJE 1DE7H 5FPTA 1HPGA 1GMHG 3LGVA 3U8TH 2O8MA 2A4QA 2BD7A 3SGBE 1OPHB 5B6LA 2J98B 4Q7XA 4BOHA 1XXDA 1AN1E 2FLBH 4FUEA 3TJVA 1AVXA 4FUHA 1QQUA 1SGYE 1W3CA 1LQEA 3V3MA 2VVVA 1ZMJA 4IN1A 3UR9A 3ZV9A 3GYLB 3A8BA 4BAMB 5FPSA 1RIWC 3SHAH 3BN9A 3UOUA 4TY6A 2QXHA 1A3BH 1QB6A 3RXRA 2RG3A 1D9IA 1V2LT 2C93B 3M7UA 1EATA 1MH0A 1HFDA 2HPQH 3DA9B 4BTIB 1MKXH 4INHA 2R0KA 3ZZ9A 3QWCH 3UAIC 2SGEE 3UREA 2BTCE 4D8NA 1YPHC 1TLDA 2AMDA 1VGCB 3EDXB 3RP2A 1LVBA 3ATMA 3SJKA 5EQQA 2A1DB 4XRNA 3LC5A 3WWBA 1H8HD 1GHBF 2P8OC 2OQUA 1OOKB 3L33A 1XM1A 4Y11E 1DLKB 1MCVA 2NWNA 4NIXA 5CHBA 4E7RG 5CHAC 3S7KB 3KCGH 1EJAA 3SUDA 4U30A 2V0BA 7GCHF 3LGWA 2FM2A 2SNVA 8LPRA 1MQ5A 3SBKA 1HDTH 3LGIA 2C8ZB 1SGNE 4JMYA 2UWOA 4FUGA 1O3NA 1HAGE 4GHQA 2ZU1A 2Y7ZA 3UFAA 2CV3A 1P2OA 2J94A 3LT3A 3M7TA 1E35B 1EPTB 1SVPA 5E0GA 2QGRA 4ISIH 3MI4A 1EZXC 4FVBA 1GCTB 2AFQB 4WH8A 1KLIH 1CGJE 1GHAG 3HGPA 4ZCNA 2C3SA 2QYIA 3A8AA 1S81A 1K28D 2OXSA 3SZEA 3SJ9A 2EEKA 1QJ7B 1TX7A 2ZHEH 1GI5A 1V2JT 2Y81A 1VCPA 3S9CA 4ZHLU 1W0YH 3LGYA 1MZDA 2CHAB 1RTLA 1Y3YA 4BAHB 3HPTB 3LIWA 4DJZB 3BIUH 1UCYE 1K1OA 2BY9X 5DP8A 4MVNA 1LCYA 3CS7A 1BTYA 1E0FD 1XX9A 2OUAA 1V2NT 2BZAA 2ZCHP 1ARBA 1GJ7B 2VGCC 2H5DA 2VJ1A 2DE9A 3FZZA 4DCDA 3RXTA 3KYGA 4ACBA 2H6MA 1T8OA 1HGTH 4Y76A 1O2SA 1O2QA 3RDZA 1OWHA 4I8LA 4JZIA 4B2CA 1JIMA 1Z8GA 8GCHG 5JBTA 2W7UA 4K1EA 3N7EA 3UPEA 5DP9A 1TNLA 3F2HA 1W0KD 1YYY1 5LPFA 2D1JA 1WOFA 1OP2A 2ZPRA 2HLDD 2AYWA 1YF4A 2PKSB 3KF2A 4FUBA 4XE4A 4MNXA 3GY8A 2FWWA 3VB3A 5C0UA 1HLTH 2J4IA 3A82A 4FOUC 5C20A 2A45B 2JJ1D 1O2JA 3ATIA 1B0EA 3TK9A 1UTPA 1A5HA 3KIDU 2XBWA 2VB0A 4GVUA 2AH4X 3CNRA 4ABAA 2O8TA 3H5CB 1C2EA 1C5PA 3F9GA 1BJVA 2ZFQH 4AN7A 4YOJA 3L3TA 1ZSKA 2XBVA 1SGTA 2PSXA 4CHAB 1CBWC 1FLEE 4K5ZA 3ZVAA 3WWFA 1DX5M 1W7GH 2OK5A 5J4QA 1SLVB 3IITA 1C5QA 1V2QT 4ZMAH 1N8OB 1O5EH 2ZU3A 3GDVA 1O35A 1V2RT 3E91A 2XCFA 1KLTA 1PQ8A 4DY7B 4NG9H 4K60A 2VH6A 1LTOA 4ZXXH 2JJ2D 4DIHH 4WH6A 1EX3A 3NWUA 4Q80A 1BT7A 2ESTE 4BAOB 2ZP0H 3PLBA 5LPRA 2G4TA 1ZJDA 1UTQA 2TGPZ 2QC2A 2Z3EA 1O3EA 3OYPA 4O9VA 2F9BH 1KXCA 1CSOE 1GBHA 3IG6B 3KYFA 3QN7A 1FIWA 1D6WA 1GCDA 1AKSB 1BBRE 2TGAA 3OTJE 1GL0E 1FPCH 1SR5C 1QBVH 2J95A 3SN8A 3TJOA 1OWIA 2J38A 1QB1A 3T62A 1HAOH 1RTKA 1HB0B 1W11U 2A4RA 2NU3E 3PMJA 3HK6B 1C5OH 3V7TA 2FDAA 1E34B 3Q00A 1ORFA 1Z1IA 3RLWH 1A1RA 4WF8A 5AHGH 1OS8A 5JYIA 2LNCA 2XBXA 1ZTLA 1YPKH 3A7YA 3BG4B 3EA7A 1AI8H 2GT7A 4WWYA 1O2RA 3U98H 1Z7KA 2FX4A 3MU4A 1RJXB 1C1SA 1WYKA 2C8YB 4BAQB 3GDUA 4AG2A 3TVJB 1OKXA 2F4LA 3P92A 3VPKA 1WSSH 2ZDMA 1DWCH 2GGVB 2VH0A 3MU0A 4FU9A 1T4UH 4DT7B 3SJ8A 4DIIH 3ZVBA 2ZU5A 2FX6A 1AU8A 1C2GA 4FUJA 5JDUB 3A7TA 1SB1H 2OCVB 5JBAS 2QY0B 3RXEA 2UWPA 3SU0A 3F9HA 2B0FA 1C9TA 2ZDNA 3IWMA 4X8UH 1B7XB 1HAVB 1TABE 2BX4A 2Y82A 3BEIB 4DURA 2F9NA 3RU4E 3P8GA 1BA8B 1MABB 1TGNA 2J97A 2ZTYA 1DUEA 5EPNA 1JOUB 1DSTA 2FEQH 4GUXA 2ZHFH 3MU5A 1Z8RA 3I77A 1TALA 4X6NA 1FY1A 1QJ1B 5L6NH 2ZGHA 4AFQA 2VIVA 3F2GA 3FANA 5IK2D 1SGEE 1CT2E 1NY22 4ABEA 3RXVA 3ZYDA 4XSKU 2BY5X 1E36B 2AEIH 4I86A 1GMCF 4ZKRU 2KZ4A 2ASUB 3BEFB 3RXKA 1W12U 3STJA 1ACBE 1A3EH 2TGTA 1KXAA 1WQVH 1IQNA 1KXFA 1C5WB 3M37A 1P12E 2FOEA 5L30H 1HJ9A 2A32A 3SOSA 1S0RA 3D23A 3UIRA 3FP6E 2QAAA 1HAZB 2VIPA 3VEQB 1HUTH 2ZFTA 1MTUA 3TGKE 4MPXA 1T4VH 3PO1C 1C1OA 1LVOA 2OC0A 1KY9A 1P11E 4M7GA 4X8TH 1E79D 2R3UA 1AFQC 4AGJA 1DXWA 1OHHD 2JETB 4ABGA 3BTFE 1HXFH 4X2XA 2Y80A 1O2KA 1UHBA 2QIQA 1ESTA 1MZAA 1GVLA 4GLYA 1JXPA 1HAHH 1O2WA 4X0WU 3BTEE 1VKYA 3F0OA 2ULLA 2LPRA 4B6FA 1TBQH 1V2ST 3HKIB 3SGAE 3MHWU 2VINA 1UCYK 4I8HA 3SUEA 5FBEA 1C1NA 5EJ1A 2QN5T 5FXLA 1AE5A 1YY3A 1P8VC 1D4PB 1GI2A 2BY7X 2Z3DA 3PLKA 5DJ7A 1O3BA 4YO9A 4CRGA 1K1MA 2CN0H 4B1TA 3QLPH 1TYNA 1O5FH 1SFQB 1HAXB 3U69H 1O2ZA 3KL6A 5C3NA 4KTCA 3S69A 4O3UA 3SV9A 3A8CA 1F2SE 4OS2A 3GICB 1ELVA 3ZZBA 4CR9A 1GBBA 1ZJKA 1AB9B 3LGTA 2FPZA 2NU0E 3ELAH 1EUFA 5GWZA 4OS1A 1O36A 4MQAA 2WPMS 2VWLA 3ZZCA 4ASHA 2BM2A 3ZZDA 2A4GA 4Q2KA 4X1SU 1A61H 5A2MH 1TMTH 5EOKA 5DSFA 6LPRA 3E16B 3BTGE 3TJNA 4MTBA 2Z9GA 3SO3A 1D3TB 1FV9A 4WMEA 2ZG0H 3MYWA 3KQCA 1GI8B 1EB2A 2Q6DA 2PKAB 2BDHA 2KR7A 4X1NU 1C2DA 1FAKH 3MQKC 5T3HA 1V2PT 4I33A 1QL9A 1DOJA 1D3DB 4TPYA 3DSGA 4CH2B 3AASA 2ZQ2A 3NRLA 1ELAA 4WJG2 3Q3XA 1DY9A 3P95A 4PROA 1P09A 1RIWB 2QCYA 3SJOA 2XYAA 3L6PA 5A09A 1S6FA 2FOAA 2JDID 1AO5A 1TNIA 3T25A 2UUYA 1TIOA 5GNDA 2XWBI 4MNVA 3A87A 3CP7A 1MTVA 1QIXB 4F4OC 4ZAEA 1EP5A 1PPHE 1O0DH 2G00A 5DGJA 5T6GA 5C1UA 1MU6B 1QFKH 1L1GA 3N7DA 4B73A 1O5AB 2RCEA 3FKSD 3VB7A 3OE7D 1K0HA 4NA7A 5TJXA 2K1QA 1O2LA 4Q7ZA 5EW1H 2C8XB 2QA9E 1G30B 1T7CA 2KM0A 1BBRK 1DUAA 3G01A 4CBNA 3LC3A 3OAAD 3QTVH 4Q7YA 4I7YH 3O8DA 3RXOA 5JB9S 1GBDA 2GMTB 1SGFA 1VCWA 3BTKE 1YLCA 1WBGB 3H09A 4LZ4B 1TBZH 1PQ7A 1UVOA 2VIDA 4NA8A 3TLOA 4DG4A 5EU8A 4K8YA 2KCOA 1ZRBA 1GBJA 1K1JA 2OLGA 4B76A 3TK5A 1GPZA 1CGHA 2ZI2H 2SGDE 2ZHWH 1G36A 4Q4LA 1CT0E 2A0QB 2LELA 3I78A 3PLPA 4GCHF 3GCTF 1ZZZA 1EAIA 1TB6H 1O3MA 2SGFE 1C5MD 2NU1E 1O2UA 3A85A 4VGCC 2A7HA 2EQNA 2UWLA 1GMCG 2XC4A 4NIWA 1EZSC 4X8VH 1BTXA 3VXEH 1NRPH 4H42U 4KKDA 3U28C 1P3EA 1XUJA 2FYQA 5AVDA 1F5LA 2I6QA 3U1JB 1BRCE 1Q2WA 1CHOG 1ZMLA 2F91A 1OWDA 3AAUA 1YPLH 1GBCA 3OEHD 2VIQA 2FOMB 5CDFE 4B75A 1MAXA 3A83A 4NZQA 1GI6A 1MBMA 1TQ0B 3LGUA 4FETA 3AW1A 2ZHQH 1PPZA 2H9HA 2AIQA 2VGCB 1IQIA 1BITA 1H8DH 1C1VH 4I31A 4LXBH 5DN6D 2BD5A 2M5TA 4OGYA 2ZGBH 3P8NA 3BTME 5E0JA 3E6PH 1NRNH 1P01A 3SU4A 3DFJA 1O3CA 1V2TT 4B6EA 3JZ2B 1WDIA 2WV5A 4KTSA 1S6HA 4NWKA 2BD3A 2Q1JA 3U8RH 1DLEA 1QCPA 1ZTKA 3AAVA 2OBQA 5A8YA 2BLQA 2ZNKH 1C2JA 1FX0B 3RC6A 3RMNH 1GGDC 1W13U 3MO9A 1DT2A 3K65B 3ZYEA 5HXFA 2WV9A 1F0TA 1ELFA 1GG6C 1L0ZA 3A7WA 4IW4E 2PP6A 2AS9A 2L74A 2O8LA 1MD8A 4FXGH 1O2MA 3PTBA 1A7SA 2CGAA 1SG8B 2K8IA 4AB9A 2P59A 4O97A 1LHGH 1RGQA 2FESH 1CBWB 5K7RA 2F9OA 3RU4D 4NA9H 1GJ4H 3SYJA 3D65E 5A8ZA 1LHDH 4B74A 4MPVA 1D3PB 3KQEA 5DP4A 1FPHH 1TNGA 4KGAA 2YMSC 1EJMA 1KMHB 2H9TH 5J4SA 1DS2E 3VXFH 1BOQA 4QT8C 2IJOB 1LVYA 3KGPA 1COWD 3MH5A 2B8OH 2IPHA 1C1QA 1UVUH 1GBKA 1TNJA 5DPAA 2PGBB 2G81E 1TPOA 2IPQX 4RT0A 2KCPA 1FN8A 1K1LA 1BMAA 4ZHMU 1F5RA 3F68H 2GZ7A 1ZR0A 3W1EA 4BTTB 3KQ5A 4RI0A 1C9PA 1PQAA 2GKVE 2ZQ1A 3EA8A 1UTNA 4I8JA 5B6OA 2FOHA 3FFGA 1HBTH 2XXLA 1KIGH 4YOIA 5EODA 1FIZA 1A4WH 1NC6A 1THSH 1UMAH 2A5IA 4UD9H 3RU4T 4RKJB 3RXPA 2RA3A 5DK1A 3SNEA 1KDQA 3B9FH 3TH4H 1GBTA 2C90B 5E0HA 1O3DA 3Q3KA 4A6LA 5E8EH 2BQWB 3B8JA 1ZHRA 2YNAA 1IAUA 1SQRA 2XRCA 2ANMH 2Z9KA 3M3SA 3LH3A 1S84A 3T28A 1GWAA 1K21H 1BDAA 4HI3A 1P9SA 4LK4A 1NESE 2ZIQH 1LHCH 4OM9A 1NTPA 4CRBA 1KSNA 1C1PA 4JZDH 1FY5A 1CA0C 1HV7A 4FU8A 2CXVA 3URDA 4BTUB 4JK6A 1GI3A 2BD9A 4E7NA 2ZWLH 2Z6BD 3DT0H 2EI6A 2A2QH 4ZXYH 4DT4A 4F48B 2VBCA 2A4OA 1G2MA 2J5UA 2NU2E 1GJBB 2WPDD 4E05H 3D49H 1S85A 1C4V2 1O5GH 1HIAA 1XUHA 4Y8ZA 2K0QA 4JZ1A 2CF9H 2ZFSA 1O3LA 1OWKA 5PTPA 6ESTA 4ISNA 3RXCA 3A8DA 1BTPA 1YGCH 4X2YA 3UWJH 4NIVA 1C5ZB 1BHXF 1MKWH 3LKWA 1P02A 1GL1A 1A46H 3S7HB 4JK5A 1ELTA 2J2UA 3MNXA 3KEEA 1U6QA 4U2WA 1O3JA 4WMFA 1FMGA 3KQDA 1LO6A 2AGEX 1TOCB 2ANYA 5EJLA 1A0LA 1SGRE 1W8BH 2PTNA 4XOJA 4RSPA 1J17T 1WAYB 3ENSB 4LOYH 4AORA 5A0AE 1HJ8A 1L4DA 2THFB 1RFNA 1HXEH 3MO6A 1QGFA 1ZYOA 2JIZD 2EC9H 3UY9A 2B5TB 1ETRH 4MNWA 2HGTH 2BQ6B 2FI3E 4NCYA 1MD7A 1YBWA 2WPHS 1TPPA 2QE7D 1VGCC 1DANH 1W10U 3BTDE 5FX5A 4A92A 1QR3E 2ZZUH 2G52A 2P3TB 1AVWA 4A1TA 3QGNB 2FIRH 1QRWA 5H4IB 1O37A 2QXJA 1EJNA 2BLOA 1ZGVA 3ATKA 3SV2H 3MOCA 1EASA 4XFQA 1ANEA 3R0FA 1H1BA 1BTWA 5ESTE 3V0XA 2GZ9A 2VVUA 1MAYA 2CF8H 1H9HE 1V3XA 4DW2U 1DFPA 3SHCH 1AFQB 1C5TA 2ZFRH 1T8MA 1NBMD 4WXIA 1W0JD 1XUFA 1GHXH 1X7AC 3LONA 1GJDB 4Y7AA 4MDSA 3SV8A 1SQOA 4TPIZ 3DCLA 1DPOA 5DP5A 4BXSA 1EZUC 1C2MA 2BVXH 3QK1A 1PPEE 1BZXE 3W95A 2OC8A 4FUFA 1Y8TA 1EPTC 2BMGB 4A1VA 3H7TA 1DITH 4JYUH 3FP7E 1A2CH 1O33A 3SU1A 2YMSD 1ANCA 1SOZA 1KYNA 2TIOA 2BOHB 3NXPA 4JZEH 1ELDE 1GHBG 3TK6A 1EOLA 2P3FH 1YCPK 3M3VA 1C1RA 4TYDA 5EPYA 3RM0H 1UHBB 2ZU2A 4OS4A 7GCHG 3QGJA 2EA3A 3ZVCA 2A31A 1RRKA 2CHAC 1IOEA 3GY2A 3GDSA 2QXIA 2BDAA 3ZV8A 4A5TS 3AK5A 1QL8A 1W2KH 1O34A 4YLUA 2GVFA 4ZKNU 1PPBH 1WV7H 4Y71A 4UFGH 2ZC9H 2PV9B 9ESTA 5G4BA 1O2NA 1TAWA 2O9QA 3RUOA 1ZRKA 1DVAH 3ESTA 1AMHA 4DVAU 1AQ7A 1C1MA 2F83A 1ABJH 1O32A 2ZDLA 2FTMA 1B0FA 4Y79A 5EG4A 2Q6GA 3U1IB 1BTZA 1ESAA 1CE5A 4H4FA 3SU3A 4K69A 4ABJA 3SQHE 3RMOH 2B7DH 3MU8A 1IQKA 2ZO3H 3VB4A 1DXPA 1NT1A 3WY8A 4CRCA 1FY3A 1QBOA 3ZVFA 6CHAB 2AGGX 5C5NA 1TPSA 1AWFH 3E0NB 1SQTA 1BMMH 5FHTA 1WQSA 3SI3H 3RXLA 1UK3A 2H5CA 4INLA 4AYYB 1K1PA 5EJZA 3GY5A 1C5LH 1C2LA 1GBIA 2G5VA 3VFEA 3D62A 4YT7H 1QZ8A 5EQSA 1VJAU 1TNHA 1UK2A 2PUXB 4NWLA 3M61U 4AG1A 2BYAX 4XBCA 4Y8XA 4YLQH 1H8ED 1SLUB 3F9EA 2PR3A 4ESTE 1CHGA 2BXUH 1Y3WA 3BTHE 2HWLB 1HJAC 3LJOA 2ZF0H 1OWJA 2GCHF 2GV7A 1C2HA 4XD7D 2ZCKP 4CRDA 3STIA 4MPUA 2GX4A 5JBBS 2HNTC 5C0TA 1O30A 2TGDA 3BIVH 3EYDA 1LVMA 3EGKH 5TCCA 2FOBA 2VIWA 4AOQA 1VJ9U 4YOGA 4ISHH 4U32A 3MU1A 1UTLM 1ELEE 1BMFD 1T8NA 1T31A 1P9UA 3OU0A 2VWOA 4TSFD 5C94A 4TT3D 5EXNA 1YPJH 1GBMA 2RDLA 5EXMA 2ZPSA 1O5BB 1Z8JB 3SNDA 4NIYA 2ZGCA 1Q3XA 3O8CA 1QURH 1JBUH 1ETSH 2OC7A 3S9AA 1L1JA 1MTWA 3BEUA 2V6NA 2FS9A 2PGQB 2R9PA 1VITF 2Z7FE 1UVSH 2ZU4A 4FU7A 3Q77A 3QTOH 1O2XA 1Q31A 1CGIE 1WCZA 3ZZ6A 1JRSA 1IHTH 1V2VT 1MQ6A 1EKBB 1AHTH 1OP0A 1UCYH 2BHGA 2P93A 2Z9JA 4NSYA 4IC5A 2XNDD 4TWWA 1GI4A 4NFEA 4FUCA 4I8GA 4Z1MD 1SC8U 4OS5A 2VIOA 1TGSZ 3OFND 2IN2A 5DG6A 1H8IH 1NRQH 1BMLA 1BMNH 1O3PB 2CJIA 1ZPZA 2WPLS 2J34A 1K1IA 2OP9A 5T6FA 3AVZA 1LPKB 1XXFA 2QF3A 3TNSA 2WPIS 1YC0A 1YM0A 3T26A 3C1KA 1XKAC 3QO6A 2JH6D 5KEDA 2FTLE 4B2BA 4Y7BA 1AZ8A 1SHYA 3GS9A 1GJ6A 1CT4E 1GG6B 2A7JA 2QV1A 2XC5A 1P2JA 1XMNB 2GTBA 4HFPB 2L6OA 1ELBA 1HCGA 3F1SB 1EXFA 2M2AA 4IS5A 1G2LA 1SLWB 1CO7E 4NGAH 1QTFA 2SGAA 1G37A 1BB0B 1Z6EA 1H4WA 2W6ID 3TNTA 3HK3B 4BXWA 1TMBH 1Z8IB 3PWCA 1DM4B 3F0PA 1H9IE 1GHYH 3EQ0H 3I29A 1EFRD 4YT6H 5E2PA 1NBME 1P0SH 2KX4A 1CVWH 1O2YA 1C1TA 1C5RA 2D2DA 1ELCA 1YPMH 1P05A 3FN8A 1GHAF 1O2OA 1GBLA 1RTFB 1TX6A 2KAIA 1AE8H 2P8OB 2V7QD 1ZTJA 1MTNC 1A0JA 2GT8A 3KN2A 1AIXH 1YLDA 2WYJA 1TGTA 5CHAB 2I6SA 3UR6A 1GBEA 2OQ5A 1SHHB 1UTJA 1HRTH 1DICA 5I25A 1AVGH 4O03A 2FO9A 3VGCC 5JBCS 1FZZA 1ID5H 2DUCA 4OS6A 3UB0A 2PFEA 3FOAA 3SV7A 5FCRA 1KLJH 1ZLRA 1EAWA 1MTSA 2RA0A 4ABIA 5LH8A 4SGAE 8ESTE 3LOXA 3P70B 2W3IA 1D6RA 3T2NA 4ZKOU 4AGKA 3LDXH 3T5FH 2Y6TA 3MH6A 3K2UA 4A1XA 4RKOB 3UQOA 1BBRH 3GY6A 1IQLA 5BRRE 3UNQA 4FUDA 5LGOA 3A88A 2ZHDA 3MNBA 1F7ZA 4WXVA 2HVYB 4JYTA 1F0RA 2XOKD 2GD4B 5FBIA 2QF5A 1BTUA 3CS0A 1C5VA 1XUIA 3ZZ3A 3NPSA 2WPJS 1QRZA 1SGQE 2BXTH 2R0LA 1LKBA 1TGBA 3AW0A 1WUNH 3BF6H 2ZDKA 3KHVA 3NZIA 4ISOA 3UQVA 5A8XA 1MCTA 3GOVB 3VG8A 3SZNA 2AMQA 1J15A 1KDQB 4K1SA 1INCA 5HGGA 5T1VA 3BTWE 2P94A 3ZZ5A 3SNAA 4UEHH 1S6LA 1P2MA 5HYOA 1G32B 1O3IA 3DD2H 4XBBA 3TU7H 5GPIB 1TRMA 3HGNA 1A5GH 4D7FA 4YTAA 2G8TA 1C1UH 3GCHC 4RN6A 4GSOA 1BHXB 1FONA 1Y5AT 2WHXA 5A0CA 3RXQA 4INKA 1O2IA 2XTTB 2Z9IA 3MH7A 1BJUA 6GCHF 2G55A 3MTYA 3U8OH 2V3OH 2W7SA 1MKXK 1SPJA 4WMDA 1MBQA 1NM6A 3KQBA 1GJCB 5F03A 5C67A 3W94A 2FI5E 4GHTA 4UDWH 4CREA 4GPGA 3ZIAD 1P2NA 2XNIA 3UWIA 1O2HA 1O5CB 1FXYA 3WW7A 2AGIX 1GJ5H 4LZ1H 2ZTXA 4Q63A 4D9QA 1C5YB 2BLVA 4H6TA 1ABIH 1P3CA 4ABBA 1BUIA 4K1TA 5HIYA 1HIAB 1LPZB 7KMEH 1BTHH 2IJD1 2BZ6H 3SW2B 3ATWA 1GMDF 2WZQA 1VITG 4BAKB 1ARCA 1ZMNA 3SI4H 4IGDA 9LPRA 1BQYA 2AERH 2GDEH 2HALA 1ZSLA 4IN2A 4E06H 2BVSH 4THNH 1K22H 4ZROA 1TX8A 1D3QB 1Y59T 4AFSA 1PFXC 1TQ7B 5FAHA 1SSXA 2Y7XA 1BCUH 5GCHF 2YNBA 3ZVGA 4ZH8A 3SORA 1J16A 1EOJA 2F9UA 1T8LA 1AUTC 3NK8A 4OS7A 2OD3B 1V2MT 2A5KA 3A7VA 2ODPA 2V3HH 4Z0KA 4MG3A 1SOTA 1PJPA 1QB9A 2VWMA 1GDUA 4ABHA 3SNBA 2BDGA 3LH1A 4ABDA 4BNRA 1L2EA 5HM9A 4JCNA 4ASUD 3S0NA 1SMFE 1O38A 3C27B 3M5OA 2GMTC 4D7GA 3JZ1B 3RXGA 2BD4A 1F5KU 1CQQA 1E37B 3F2FA 4ZUHA 1TA2A 2H2ZA 3O8BA 2V35A 1P04A 2ZECA 2BY8X 2KFWA 1WXRA 1NS3A 4MNYA 3F6UH 1Y3UA 5F8XA 4CRAA 3SU2A 4UONA 2BDCA 2F3CE 3O8RA 1HAIH 2ZGJA 5F6MA 3DUXH 2XWAA 1L1NA 1YP9A 2PWXA 1TMUH 4KTUA 1V2KT 1LMWB 1J14A 4X6OA 1OP8A 2G5NA 1TRNA 2CK3D 2HOBA 4M9FA 4CRFA 1V2WT 2FOFA 2J98A 2ZA5A 1O2PA 5FX6A 1OX1A 5T6DA 4A7IB 1V6DA 3N99A 3EAJA 3FVFB 2D8WA 5C2ZA 2FYRA 2GCTC 1E38B 2C4FH 1C2FA 2R2MB 1TGCA 3DFLA 1QNJA 2TBSA 1SQAA 2FP7B 2FXRA 4F49A 1W0ZU 2R3YA 1FY8E 1C5XB 3RLYH 3P8FA 1A0HB 1MKWK 1JMOH 4D76A 2D26C 4J1YA 3PMHB 1F92A 2BX3A 5HMAA 1NN6A 1HAYB 4GCHG 3GCTG 2B9LA 1XVMA 2FMJA 1QA7A 3PV5A 3B23B 4IC6A 1NU7B 3GY7A 5K0HA 3RXDA 2FODA 1THRH 4K2YA 5EQRA 1UVTH 2QF4A 2PUQH 5EXLA 4IMZA 3T29A 1O3OA 1P57B 1YWUA 3PRBA 2VVCA 1F0SA 1UK4A 3RXAA 1NZQH 2H1UA 3PV2A 5FCKA 2XW9A 3A84A 4XBDA 5DP3A 3SV6A 1K2I1 2HLCA 2O8UA 1ZHPA 2IOTA 4J2YB 4XDEA 2HVXA 3M5NA 1SGFG 4P02A 4X2VA 1EZQA 2BD2A 2Z3CA 1AD8H 2ZGXH 3GCOA 1BRAA 3BG8A 3MH4A 1GJAB 1BRUP 1YLNA 2P95A 2UUFB 1FAXA 2A2XH 1AWHB 1TNKA 2PLXA 5DKMA 1EPTA 3SUGA 5CMXH 5AFZH 1UO6A 1TPAE 1UTKA 3MWIU 4UE7H 1Y3XA 3OX7U 5DO4H 1DWEH 3RXUA 3NKKA 2SGQE 3GY4A 4ZKSU 1TRYA 3PO1B 4Y0YE 3ZZ7A 1LPGB 4WVPE 1LHFH 1HJAB 1MMJN 1WTGH 2VNTA 2ALPA 3V12A 6GCHG 1N1LA 1IQFA 1N6XA 1THPB 1C2KA 3Q76A 1UTOA 4MLFB 2Y5FA 2NU4E 1QRXA 1PQ5A 1P2IA 1TOMH 1GI7B 4AZ2B 3P17H 1GDNA 3U9AH 2BLWA 3RC5A 1H9LB 3TITA 1DWDH 1O3FA 3P8OA 4Y0ZE 3EE7A 1O5DH 1SFIA 3OSYA 4X2WA 3RC4A 3A81A 2OTVA 4TY7A 4K8BA 1JIRA 2Z94A 3N7OA 1FUJA 1P06A 7ESTE 4AX9H 3PV4A 4AB8A 1AGJA 2HNTE 2ZDVH 2WUBA 2RFKC 1O3GA 1AY6H 1GCTC 2SNWA 5LPEA 1N6YA 1GMDG 1SL3A 2TRMA 1EAXA 1P2QA 1KXDA 3MNSA 3A80A 3RXIA 1IQJA 2G4UA 3TPIZ 5AF9H 1PPFE 1EB1H 2AIPA 5GDSH 2Y5HA 3RXHA 1UW7A 2H9EH 2J9NA 2W6JD 1C4Y2 5GCHG 3ZVEA 3TIUA 2G51A 2XBYA 2PW8H 4CBOA 1B5GH 1Y5UT 2XCNA 3FZDA 3SQEE 5EIYA 8KME2
chains in the Genus database with same CATH topology
1OYQA 1CU1A 4Y10E 2PSYA 2VWNA 3LU9B 1NU9A 2PTCE 1FI8A 2WINI 4ZHAA 3M36A 1EP6A 1Y5BT 4WY3A 2YOLA 3TH3H 3E8LA 1YCPH 5JPMH 1MU8B 3QUMP 1FN6A 1NRSH 1SI5H 1PPGE 4NSVA 3GYMA 3PM3A 1Y3VA 1TE0A 1ESBA 1C2IA 1F0UA 2PKSC 3M3TA 1IQEA 3ODDA 4X1QU 1Z71A 2BB4A 5FPYA 1IHSH 1HNEE 1RD3B 5DP6A 5IDKA 1J8AA 3RXMA 5DP7A 1GJ8B 1ETTH 1TONA 2A5AA 3OY5U 1QJ6B 1TWXB 4BANB 4HTCH 1LKAA 3UNSA 1T32A 3UUZA 1V2OT 3QX5H 3SU6A 1VZQH 4CHAC 3NCLA 4OGXA 3S9BA 3M7QA 1PYTC 1AUJA 3E1XB 4B71A 1AKSA 2ALVA 1N8OC 1MTNB 1XKBC 1IQHA 4Z6AH 5GIBA 4JYVH 2ANKH 4X1PU 1IQMA 1GDQA 1NFYA 1GHWH 1NO9H 3PTNA 3URCA 1CHOF 1YCPM 3RM2H 5CE1A 2HRVA 5C5OA 4X8SH 3VGCB 2GV6A 2FS8A 1PPCE 1A5IA 1SBWA 4O3TA 1O3KA 3RXBA 4AYVB 1KXEA 3ZZ8A 2GDDA 4Y6DA 3UTUH 2GZ8A 3UOPA 3TH2H 2ILNA 5AFYH 1O39A 1W7XH 2Z9LA 3E0PB 2ZEBA 1NROH 1DSUA 4MPWA 1JRTA 2KAIB 3A7XA 1ZPCA 2ZFPH 2GP9B 2HNTF 2ZPQA 3LJJA 1GMHF 4VGCB 1O31A 1RS0A 7LPRA 1XVOA 1ZSJA 2Q6FA 2QF0A 1G9IE 3SNCA 4IMQA 3BTTE 2JH0D 2F9VA 2ZCLP 2OINA 1P2KA 1VCQA 4HZHA 1ELGA 1SGDE 1C4U2 4YM9A 3RMLH 2UUKB 2BDYA 1HAVA 2WV4A 1OWEA 3BG4C 1RXPA 5C1XA 4FVDA 1QA0A 2ANWA 4Y8YA 3A86A 1SGCA 3DHKH 1HYLA 3K6YA 3M5MA 3ZZ4A 1WU1A 1AZZA 3SUFA 1J9CH 1ZGIA 4ISLA 3MO3A 3P6ZB 1NPMA 3K6ZA 4KP0A 1W14U 1AFEH 1QBNA 4X6PA 4CH8B 1FNIA 2ODQA 5C1YA 2TPIZ 1VR1H 1GJ9B 2O8WA 3PMBB 5GXPA 2FZZA 1S82A 1GHVH 1L4ZA 1FDPA 2C8WB 3R3GB 3FP8E 3UNRA 3GCHB 3RMMH 1G3CA 2WPKS 1JWTA 2OBOA 1QQ4A 4DGJA 5I46H 2WUCA 1GGDB 2ODYB 3MNCA 1QL7A 1C5SA 2PHBA 2W5EA 1O3HA 3PWBA 1FY4A 1KTTB 5F8TA 1GHZA 4JZFH 3V13A 1HAPH 1ZOMA 2A7CA 3EA9A 4X1RU 2W3KA 2EI8A 2ZTZA 3LPRA 1QHRB 1WTHD 3T27A 1TFXA 2STAE 1ANBA 1QY6A 4FUIA 1KXBA 3SU5A 1DWBH 1MUEB 1FQ3A 3NUMA 2FOCA 1LHEH 5L2YH 1K1NA 3TGIE 1G3EA 2BQ7B 5EGMA 1FJSA 1XUKA 3RXSA 1KTSB 5A0BA 1K9OE 3MMGA 1O3AA 1CA8B 2BDIA 1UTMA 3PB1E 4U01A 6CHAC 1OYTH 1C1WH 3QZRA 1C5UA 2DE8A 2SFAA 3M5LA 2J92A 1SGPE 2XC0A 5BPEA 1S83A 3ITIA 4X6MA 2SGPE 2BD8A 3BV9B 3PMAB 5E2OA 5JB8S 2BDBA 2QXGA 1TA6A 1NFXA 3ZVDA 4ABFA 3K9XB 3MFJA 1M9UA 1SGIB 2BVRH 4NFFA 2FI4E 4HGCA 4D9RA 3QDZB 5L2ZH 3E3TA 4H6SB 1Z1JA 3ATLA 4I32A 1ANDA 3A7ZA 1YPHE 4UFEH 5EW2H 5HM2A 4UFDH 1TBRH 2AMPA 8GCHF 4K3JA 4R0IA 2JETC 1GVKB 1LDTT 4SGBE 5GJ4B 3SJIA 3RXJA 4CR5A 2JH5D 1P03A 4GAWA 4AFUA 3F9FA 3PYHA 1GVZA 1P10A 3GISB 2UUJB 1XUGA 3A89A 2P3UB 1NFUA 2Y5GA 5F8ZA 3RXFA 4R8TB 3VB6A 1PYTD 3HATH 3TJUA 3FAOA 1GBFA 1GI0A 2F9PA 3VB5A 5ABWA 2FOGA 2STBE 4NZLA 1V2UT 2VU8E 3CENA 4IBLH 1ZPBA 2BY6X 1CA0B 2HPPH 1NRRH 3BSQA 1DDJA 1DY8A 1O2GH 2BOKA 2PKAA 4TWYA 1C5NH 4UFFH 3Q3YA 4DOQA 4KELA 3KNXA 1O2VA 1GBAA 3EE0B 1G3BA 3GY3A 4B2AA 3HKJB 1IQGA 2GCTB 1UJ1A 3ODFA 4I8KA 1EAUA 3ZZAA 1GI1A 5TCAA 1BIOA 2CMYA 4YZUA 1YPEH 1EQ9A 1AB9C 1O2TA 1UVPA 2FLRH 2GCHG 2W26A 1YPGH 2ZFFH 1G3DA 2EI7A 5ESBA 1YKTA 1OSSA 2JKHA 1Z6JH 2P16A 3BTQE 1VITH 2ZDAH 5IYTA 5SGAE 1LQDB 1S5SA 1GI9B 3OY6U 3GCNA 3H7OA 1ZHMA 3M35A 1OXGA 1NFWA 5ETXA 3PROA 2OC1A 4AFZA 1S0QA 1SLXB 1BRBE 3SGQE 3QZQA 2ZKSA 2R2WU 2WYGA 3E90B 4YESB 3TGJE 1DE7H 5FPTA 1HPGA 1GMHG 3LGVA 3U8TH 2O8MA 2A4QA 2BD7A 3SGBE 1OPHB 4Q7XA 4BOHA 1XXDA 1AN1E 2FLBH 4FUEA 3TJVA 1AVXA 4FUHA 1QQUA 1SGYE 1W3CA 1LQEA 3V3MA 2VVVA 1ZMJA 4IN1A 3UR9A 3ZV9A 3GYLB 3A8BA 4BAMB 5FPSA 1RIWC 3SHAH 3BN9A 3UOUA 4TY6A 2QXHA 1A3BH 1QB6A 3RXRA 2RG3A 1D9IA 1V2LT 2C93B 3M7UA 1EATA 1MH0A 1HFDA 2HPQH 3DA9B 4BTIB 1MKXH 4INHA 2R0KA 3ZZ9A 3QWCH 3UREA 2SGEE 2BTCE 4D8NA 1YPHC 1TLDA 2AMDA 1VGCB 3EDXB 3RP2A 1LVBA 3ATMA 3SJKA 5EQQA 2A1DB 3LC5A 1GHBF 2P8OC 2OQUA 1OOKB 3L33A 1XM1A 4Y11E 1DLKB 1MCVA 2NWNA 4NIXA 4E7RG 5CHAC 3S7KB 3KCGH 1EJAA 3SUDA 4U30A 2V0BA 7GCHF 3LGWA 2FM2A 2SNVA 8LPRA 1MQ5A 3SBKA 1HDTH 3LGIA 2C8ZB 1SGNE 4JMYA 2UWOA 4FUGA 1O3NA 1HAGE 4GHQA 2ZU1A 2Y7ZA 3UFAA 2CV3A 1P2OA 2J94A 3LT3A 3M7TA 1E35B 1EPTB 1SVPA 5E0GA 2QGRA 4ISIH 3MI4A 1EZXC 4FVBA 1GCTB 2AFQB 4WH8A 1KLIH 1CGJE 1GHAG 3HGPA 2C3SA 2QYIA 3A8AA 1S81A 1K28D 2OXSA 3SJ9A 2EEKA 1QJ7B 1TX7A 2ZHEH 1GI5A 1V2JT 2Y81A 1VCPA 3S9CA 4ZHLU 1W0YH 3LGYA 1MZDA 2CHAB 1RTLA 1Y3YA 4BAHB 3HPTB 3LIWA 4DJZB 3BIUH 1UCYE 1K1OA 2BY9X 5DP8A 4MVNA 1LCYA 3CS7A 1BTYA 1E0FD 1XX9A 2OUAA 1V2NT 2BZAA 2ZCHP 1ARBA 1GJ7B 2VGCC 2H5DA 2VJ1A 2DE9A 3FZZA 4DCDA 3RXTA 2H6MA 1T8OA 1HGTH 4Y76A 1O2SA 1O2QA 3RDZA 1OWHA 4I8LA 4JZIA 4B2CA 1JIMA 1Z8GA 8GCHG 5JBTA 2W7UA 4K1EA 3UPEA 5DP9A 1TNLA 5LPFA 1YYY1 2D1JA 1WOFA 1OP2A 2ZPRA 2AYWA 1YF4A 2PKSB 3KF2A 4FUBA 4XE4A 4MNXA 3GY8A 2FWWA 3VB3A 1HLTH 2J4IA 3A82A 5C20A 2A45B 3ATIA 1O2JA 1B0EA 3TK9A 1UTPA 1A5HA 3KIDU 2XBWA 2VB0A 4GVUA 2AH4X 4ABAA 2O8TA 3H5CB 1C2EA 1C5PA 3F9GA 1BJVA 2ZFQH 4AN7A 4YOJA 3L3TA 1ZSKA 2XBVA 1SGTA 2PSXA 4CHAB 1CBWC 1FLEE 4K5ZA 3ZVAA 1DX5M 1W7GH 5J4QA 1SLVB 3IITA 1C5QA 1V2QT 4ZMAH 1N8OB 1O5EH 2ZU3A 3GDVA 1O35A 1V2RT 3E91A 2XCFA 1KLTA 1PQ8A 4DY7B 4NG9H 4K60A 2VH6A 1LTOA 4ZXXH 4DIHH 4WH6A 1EX3A 3NWUA 4Q80A 1BT7A 2ESTE 4BAOB 2ZP0H 3PLBA 5LPRA 2G4TA 1ZJDA 1UTQA 2TGPZ 2QC2A 2Z3EA 1O3EA 3OYPA 4O9VA 2F9BH 1KXCA 1CSOE 1GBHA 3IG6B 3QN7A 1FIWA 1D6WA 1GCDA 1AKSB 1BBRE 2TGAA 3OTJE 1GL0E 1FPCH 1SR5C 1QBVH 2J95A 3SN8A 3TJOA 1OWIA 2J38A 1QB1A 3T62A 1HAOH 1RTKA 1HB0B 1W11U 2A4RA 2NU3E 3PMJA 3HK6B 1C5OH 3V7TA 2FDAA 1E34B 3Q00A 1ORFA 1Z1IA 3RLWH 1A1RA 4WF8A 5AHGH 1OS8A 5JYIA 2LNCA 2XBXA 1ZTLA 1YPKH 3A7YA 3BG4B 3EA7A 1AI8H 2GT7A 4WWYA 1O2RA 3U98H 1Z7KA 2FX4A 3MU4A 1RJXB 1C1SA 1WYKA 2C8YB 4BAQB 3GDUA 4AG2A 3TVJB 1OKXA 3P92A 3VPKA 1WSSH 2ZDMA 1DWCH 2GGVB 2VH0A 3MU0A 4FU9A 1T4UH 4DT7B 3SJ8A 4DIIH 3ZVBA 2ZU5A 2FX6A 1AU8A 1C2GA 4FUJA 5JDUB 3A7TA 1SB1H 2OCVB 5JBAS 2QY0B 3RXEA 2UWPA 3SU0A 3F9HA 2B0FA 1C9TA 2ZDNA 3IWMA 4X8UH 1B7XB 1HAVB 1TABE 2BX4A 2Y82A 3BEIB 4DURA 2F9NA 3RU4E 3P8GA 1BA8B 1TGNA 2ZTYA 1DUEA 5EPNA 1JOUB 1DSTA 2FEQH 4GUXA 2ZHFH 3MU5A 1Z8RA 3I77A 1TALA 4X6NA 1FY1A 1QJ1B 5L6NH 2ZGHA 4AFQA 2VIVA 3FANA 1SGEE 1CT2E 1NY22 4ABEA 3RXVA 3ZYDA 4XSKU 2BY5X 1E36B 2AEIH 1GMCF 4ZKRU 2ASUB 3BEFB 3RXKA 1W12U 3STJA 1ACBE 1A3EH 2TGTA 1KXAA 1WQVH 1IQNA 1KXFA 1C5WB 3M37A 1P12E 2FOEA 5L30H 1HJ9A 2A32A 3SOSA 1S0RA 3D23A 3UIRA 3FP6E 2QAAA 1HAZB 2VIPA 3VEQB 1HUTH 2ZFTA 1MTUA 3TGKE 4MPXA 1T4VH 3PO1C 1C1OA 1LVOA 2OC0A 1KY9A 1P11E 4M7GA 4X8TH 2R3UA 1AFQC 4AGJA 1DXWA 2JETB 4ABGA 3BTFE 1HXFH 4X2XA 2Y80A 1O2KA 1UHBA 2QIQA 1ESTA 1MZAA 1GVLA 4GLYA 1JXPA 1HAHH 1O2WA 4X0WU 3BTEE 2ULLA 2LPRA 1TBQH 1V2ST 3HKIB 3SGAE 3MHWU 2VINA 1UCYK 4I8HA 3SUEA 5FBEA 1C1NA 2QN5T 5FXLA 1AE5A 1P8VC 1D4PB 1GI2A 2BY7X 2Z3DA 3PLKA 5DJ7A 1O3BA 4YO9A 4CRGA 1K1MA 2CN0H 4B1TA 3QLPH 1TYNA 1O5FH 1SFQB 1HAXB 3U69H 1O2ZA 3KL6A 5C3NA 4KTCA 3S69A 4O3UA 3SV9A 3A8CA 1F2SE 4OS2A 3GICB 1ELVA 3ZZBA 4CR9A 1GBBA 1ZJKA 1AB9B 3LGTA 2FPZA 2NU0E 3ELAH 1EUFA 5GWZA 4OS1A 1O36A 4MQAA 2WPMS 2VWLA 3ZZCA 4ASHA 2BM2A 3ZZDA 2A4GA 4Q2KA 4X1SU 1A61H 5A2MH 1TMTH 5EOKA 6LPRA 3E16B 3BTGE 3TJNA 4MTBA 2Z9GA 3SO3A 1D3TB 1FV9A 4WMEA 2ZG0H 3MYWA 3KQCA 1GI8B 1EB2A 2Q6DA 2PKAB 2BDHA 4X1NU 1C2DA 1FAKH 5T3HA 1V2PT 4I33A 1QL9A 1DOJA 1D3DB 4TPYA 4CH2B 3AASA 2ZQ2A 1ELAA 4WJG2 3Q3XA 1DY9A 3P95A 4PROA 1P09A 1RIWB 2QCYA 3SJOA 2XYAA 3L6PA 5A09A 1S6FA 2FOAA 1AO5A 1TNIA 3T25A 2UUYA 1TIOA 2XWBI 4MNVA 3A87A 3CP7A 1MTVA 1QIXB 4F4OC 4ZAEA 1EP5A 1PPHE 1O0DH 2G00A 5DGJA 5T6GA 5C1UA 1MU6B 1QFKH 1L1GA 4B73A 1O5AB 2RCEA 3VB7A 4NA7A 5TJXA 2K1QA 1O2LA 4Q7ZA 5EW1H 2C8XB 2QA9E 1G30B 1T7CA 1BBRK 1DUAA 3G01A 4CBNA 3LC3A 3QTVH 4Q7YA 4I7YH 3O8DA 3RXOA 5JB9S 1GBDA 2GMTB 1SGFA 1VCWA 3BTKE 1YLCA 1WBGB 4LZ4B 1TBZH 1PQ7A 1UVOA 2VIDA 4NA8A 3TLOA 4DG4A 5EU8A 4K8YA 1ZRBA 1GBJA 1K1JA 2OLGA 4B76A 3TK5A 1GPZA 1CGHA 2ZI2H 2SGDE 2ZHWH 1G36A 1CT0E 2A0QB 3I78A 3PLPA 4GCHF 3GCTF 1ZZZA 1EAIA 1TB6H 1O3MA 2SGFE 1C5MD 2NU1E 1O2UA 3A85A 4VGCC 2A7HA 2UWLA 1GMCG 2XC4A 4NIWA 1EZSC 4X8VH 1BTXA 3VXEH 1NRPH 4H42U 4KKDA 1P3EA 1XUJA 2FYQA 5AVDA 1F5LA 2I6QA 3U1JB 1BRCE 1Q2WA 1CHOG 1ZMLA 2F91A 1OWDA 3AAUA 1YPLH 1GBCA 2VIQA 2FOMB 4B75A 1MAXA 3A83A 4NZQA 1GI6A 1MBMA 1TQ0B 3LGUA 3AW1A 2ZHQH 1PPZA 2H9HA 2AIQA 2VGCB 1IQIA 1BITA 1H8DH 1C1VH 4I31A 4LXBH 2BD5A 2M5TA 4OGYA 2ZGBH 3P8NA 3BTME 5E0JA