1O33A

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o33A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o33A02
3SUGA 5C1XA 1T8LA 3SO3A 2P3FH 3E1XB 2ZG0H 1OXGA 1GDNA 1T4VH 1GI8B 4UFFH 1TBRH 1SGYE 1DLKB 3TK6A 1TE0A 2GGVB 3KQEA 2XNIA 4VGCC 4M7GA 6GCHF 2ZPSA 1FN6A 5BPEA 2BQ6B 2UUYA 1OWDA 1SGTA 4WH8A 2ZPRA 3N7OA 4JK6A 4AORA 2J38A 2D26C 1A0LA 1P12E 1W7XH 5DP6A 1JRTA 3PV4A 2A0QB 4CRFA 2ASUB 2JKHA 3QN7A 3M3VA 5FPTA 2FTLE 4Y76A 2AGEX 3TJVA 1G3BA 3CP7A 2O8TA 3LU9B 1GJ5H 1NTPA 1WTGH 1GI1A 4KTUA 1ELGA 2UUJB 4IC5A 1O2OA 2IJOB 1BMLA 2CN0H 3EA7A 2Z3CA 1G3DA 1IHSH 3A82A 3KN2A 2ZECA 1AZ8A 1NN6A 1ZHPA 1ZYOA 2THFB 1PPHE 2H1UA 4ISNA 1UHBB 3QK1A 2ANMH 2FMJA 3BEUA 1O39A 1K9OE 3G01A 4Y8XA 2ODYB 2W5EA 2J34A 3Q77A 3MWIU 3SV2H 4I31A 1KXCA 1MTWA 4NZLA 1SGFA 3DD2H 4RSPA 3TJUA 2FP7B 1SR5C 4I8KA 1P09A 2WUCA 1WCZA 4BTIB 1V2MT 5SGAE 2C90B 4YTAA 1OWEA 2Z6BD 3BTME 2GT8A 4BTUB 1XUHA 3KEEA 2BDGA 2G81E 4NIWA 1GJBB 2ALPA 2P3TB 4WXIA 1GMDG 1HAGE 4O3TA 3ZZ8A 2BDIA 1HAVB 1PPZA 2ZGHA 4HGCA 1WOFA 3S9AA 1OWHA 3A89A 1BJUA 4BOHA 2C8WB 1N8OC 1YKTA 1EZXC 1ARBA 1VGCB 1TB6H 2QXGA 3UNRA 1TQ7B 4NA7A 5AFYH 1P3EA 2PKAB 2HLCA 1DS2E 2BVXH 1Y3WA 3VB3A 1H9IE 1A7SA 2XBWA 4WH6A 3GY3A 1SGDE 2ZHFH 1EP5A 1Y3YA 4BAOB 2CV3A 1F5KU 1C2FA 2ANYA 2WPIS 3MYWA 1TBQH 1LKAA 2ANKH 1LMWB 1UCYK 1V2WT 5A8ZA 2WPLS 3SU5A 1GJ6A 2UUKB 1AD8H 1OX1A 3TIUA 2I6SA 3F9GA 2BD7A 4MDSA 2GP9B 1C4U2 1ELCA 4E05H 1DITH 2VGCB 3KNXA 2XYAA 2OBQA 2GZ7A 4CRDA 2J9NA 1LHEH 2A5IA 4ZMAH 1OP8A 1DPOA 2H6MA 2QIQA 4YLUA 1IHTH 1RFNA 1GI4A 1TRNA 3RC5A 3QX5H 5TJXA 3SHAH 4ABFA 3SNAA 1IQFA 1GI0A 1RRKA 7KMEH 2D2DA 1FDPA 1B7XB 4TPIZ 5GPIB 1ZSKA 3RMOH 2NU0E 3BTHE 5FPSA 4A92A 2V0BA 3TK5A 3MO6A 3STJA 2TPIZ 1C9TA 1OKXA 2ZI2H 1CSOE 4TPYA 3MU8A 4H6SB 3SNBA 1XM1A 1MH0A 5FBIA 1BB0B 4B71A 2Y81A 2Z9JA 1Y3UA 2BLOA 1YPHE 3TVJB 2WPJS 2R3YA 1ELTA 2QCYA 1OYQA 1ETRH 3GY7A 2PGQB 1QBOA 3VB7A 1C5LH 4I33A 1PYTC 3PMHB 1MAXA 1C5TA 5AF9H 1IQMA 1RJXB 1K1MA 2WV4A 2OINA 1HNEE 1L4DA 3L3TA 4ABJA 2HWLB 4GCHF 2ZDKA 5DG6A 5JYIA 4GUXA 3QGJA 3UUZA 3O8RA 1C2EA 3ZV8A 1KXEA 1O30A 3P8OA 1ZMLA 1BIOA 1C4Y2 3PO1B 3Q00A 3S9BA 2VVUA 1YPJH 2ZFSA 4Y11E 3A87A 1BCUH 5C67A 1O2ZA 1TMBH 2P59A 1FY5A 2BDYA 1FY3A 1GBIA 3SHCH 3HGNA 3NPSA 1YLCA 2VIVA 4KTSA 4OS7A 1FXYA 2PV9B 5FCRA 1CBWB 2ZHQH 3L6PA 2VVVA 1SLWB 3V3MA 4ZXXH 2ODQA 4X6OA 1H9LB 1SGNE 3V0XA 2VIOA 1A2CH 4U32A 4DIHH 1BBRK 1TA6A 6CHAC 4K69A 2Y5HA 1J15A 3A8CA 3T29A 2ZDMA 3SN8A 1KDQA 2J95A 3MNXA 2FI3E 1D9IA 4TWYA 4HI3A 3UOUA 2ZDLA 4XBBA 2P3UB 1NC6A 1O3EA 3MNBA 2SGQE 2OD3B 1PQ8A 5CMXH 3RXHA 4JK5A 1ELVA 2EI7A 1FI8A 1FY4A 1P2KA 5PTPA 4Q7YA 1TNHA 1S6HA 1GBJA 3RXCA 1DX5M 1TGBA 1ZTKA 3F9EA 3S0NA 2GCHF 1LDTT 1YM0A 4D9RA 3UR9A 3A7XA 2ZEBA 3RXFA 1SLXB 2XWBI 1DWDH 3OU0A 4I7YH 1IQHA 1OP2A 3NUMA 2VH6A 2UWPA 2GKVE 6CHAB 1TNIA 1MD7A 2FIRH 3EAJA 2G5NA 1BBRH 1C4V2 1XKBC 3MNCA 4JZDH 4H42U 1P06A 2WYGA 3RXQA 2FI4E 1H8DH 1LQDB 1IQKA 2ZTXA 5J4SA 3RXDA 1UVOA 1L0ZA 3B23B 7LPRA 2AGGX 2A4OA 1CQQA 1O3AA 1PPEE 1V2JT 1QGFA 1TOCB 4B1TA 2RDLA 1CT0E 1IOEA 1C5ZB 3U98H 1TQ0B 3IITA 4AGJA 2OC0A 1ESBA 4UFDH 3SUFA 1A5GH 3ZZ9A 4WY3A 1RTKA 5FAHA 1D6WA 1ZMNA 2A7CA 1O3OA 2FS8A 2BDHA 1EPTC 1O5AB 1P11E 1AE8H 1B0EA 1LHDH 2OQ5A 1PJPA 1VCPA 1Q3XA 2BYAX 2SFAA 5DP3A 2A4RA 1Z71A 1CE5A 1VITH 1E0FD 2PTNA 3M3SA 1ESTA 3A7ZA 4FUIA 1P3CA 1UTLM 2BY5X 4MNWA 1VZQH 3MTYA 3LKWA 1YF4A 5H4IB 2VWLA 3BG4B 3A80A 3OY6U 3UQVA 1C5PA 2VB0A 3MU1A 3NCLA 2OC7A 4DIIH 2ZU2A 1AIXH 4IGDA 1RTLA 3LGIA 1AB9C 2ILNA 5EPNA 2YNBA 3TLOA 3GISB 2QAAA 1GMHF 1A1RA 2QA9E 2ZDAH 4PROA 1EOLA 2ZF0H 1PPGE 1VR1H 5GXPA 3A86A 2A31A 1GHBG 2A4GA 2C4FH 3UIRA 4YZUA 2O8WA 1L2EA 1W0YH 1UHBA 4DY7B 2QN5T 1LVBA 3LGTA 1Q31A 1D3PB 1HIAA 1EX3A 2VNTA 1O3DA 1Z6EA 3MH4A 4K8YA 3V13A 1ZLRA 4E7NA 1PPCE 2AYWA 4BAMB 1BQYA 2FOGA 2QY0B 1JMOH 2QF3A 2W3IA 1THRH 4X8UH 1C2DA 2BDAA 3D23A 5EOKA 5TCAA 3MHWU 1LVYA 4LK4A 3FZZA 4K5ZA 3EA8A 5A0AE 5I46H 5GDSH 3A8DA 5GCHG 1C5XB 3SU1A 1BMNH 2QF0A 2XWAA 1L1JA 1LPKB 1BTXA 4YT6H 2F9VA 1VCWA 1ID5H 2JH6D 2A45B 1DSTA 1PQ7A 3BEIB 2V6NA 4NA9H 4KP0A 5E8EH 8GCHG 4E06H 1DXWA 1IQNA 1GHVH 3U8OH 1S81A 4FUFA 5E2OA 5AVDA 2BLVA 3UWIA 2ZA5A 3E90B 4FUDA 1K1JA 4GPGA 1BRBE 2SGDE 3E6PH 3SJIA 1UO6A 5EQRA 1UK4A 2FOFA 4LXBH 4THNH 5EW2H 1GMCG 2XCFA 1C5VA 5E0JA 3IWMA 4OS2A 3SORA 3BTEE 3LGUA 5LPRA 1P2QA 2SNWA 6ESTA 2ZKSA 1S84A 3F6UH 1QL7A 1FMGA 1TLDA 5ETXA 5EXNA 4IMQA 1G36A 2HRVA 1MCTA 1QQUA 4GAWA 3KQCA 4INHA 3RM0H 1O2KA 1NRSH 3ATKA 1GI3A 1PFXC 3LJJA 5C1YA 2VU8E 1HIAB 1AN1E 2P8OC 1C5OH 2PFEA 1O3JA 3VB6A 5L30H 3GCOA 3O8CA 3A7YA 1BTUA 5EGMA 1IQJA 4A7IB 4A1TA 1SQTA 1W0ZU 1DY9A 3M7TA 1OP0A 1A5HA 4Q80A 2FXRA 1HJAB 1NY22 5E0GA 1UJ1A 1TRMA 3M7UA 4K8BA 5JB9S 4SGBE 4DGJA 5FCKA 1OWJA 1ZRBA 1EUFA 4NIVA 3LGVA 5C20A 2GV7A 3T62A 1D4PB 5HXFA 3PTBA 3TH3H 1AKSB 4MPUA 8KME2 1O31A 2LPRA 5EXLA 2QYIA 1AU8A 1LHGH 1TNJA 1A3BH 3PLKA 2ZFRH 5TCCA 1N8OB 1SLUB 4HTCH 4IS5A 1UVTH 4YM9A 3VGCC 4J2YB 4UDWH 2VWNA 1Y5AT 3T28A 3SU0A 1UVSH 3ATWA 1DT2A 1RIWB 1VJ9U 1KY9A 1BUIA 3SQEE 1FY1A 2J94A 1O36A 1O2UA 5L2ZH 1SMFE 2Z94A 2PLXA 1P2JA 3RXAA 1NU9A 1NU7B 3DUXH 1DXPA 1UTMA 2GCHG 1SSXA 3NKKA 3BTTE 4XBDA 2GD4B 5IDKA 1GGDB 1GJCB 5DP4A 1MUEB 1YYY1 1SG8B 5T6GA 3TGIE 2W26A 1O5DH 3RLWH 3SBKA 3M36A 2KAIB 3QWCH 2GCTB 1AZZA 4AFUA 3ITIA 1AVWA 8GCHF 1N1LA 1NROH 3FP8E 1TFXA 4A6LA 1O3NA 1UK3A 4Y71A 6GCHG 1TX7A 1G2MA 1HCGA 4X8SH 1DFPA 1CHOG 1ZJDA 1TPOA 1AQ7A 1GG6B 1O5GH 2TIOA 1C2JA 4R0IA 1ZGVA 2OBOA 1TABE 1Y59T 3GICB 1O3GA 4BAKB 1ETSH 2NU2E 4CRGA 1AUJA 2Z9KA 1DUAA 3H7OA 2H5CA 1O2RA 2BXUH 1O2LA 4JZEH 5DP5A 1ANDA 1DWEH 3UQOA 3T5FH 1HXFH 1YPGH 4UE7H 4D7FA 1GBAA 1WYKA 1IQIA 2F9OA 3SV7A 5HM9A 4A1XA 3GY6A 2AS9A 2B5TB 2JETB 3GCHC 1LQEA 2BQ7B 4AZ2B 5EODA 1EQ9A 1P2NA 2XRCA 5DK1A 1F0SA 1Y3VA 2XBVA 1YPMH 2CJIA 1FAKH 2FOHA 4MPWA 2Q6GA 1QB6A 3SU6A 1T32A 1O2SA 1GCTC 3SGAE 2F9NA 1QB9A 1GCTB 3M7QA 4UD9H 3PO1C 4K1EA 1XUIA 3EYDA 3STIA 2PR3A 3BTQE 1C5UA 3K65B 4F49A 3RXLA 1V2ST 3FFGA 1P0SH 3A81A 1ZJKA 1GMDF 5IYTA 4X1RU 1XKAC 1BITA 5EG4A 1ZTLA 2ZHWH 2JH0D 1C5QA 1O2MA 1HFDA 2JETC 1GJ8B 3GCHB 2GT7A 3BTWE 1KYNA 2FOAA 5C3NA 3A7TA 2P94A 3EQ0H 3A88A 1O3MA 1GI6A 1GVKB 3F9HA 1ARCA 1LO6A 3AW1A 3TH4H 3S7KB 3ENSB 5DP9A 5JBTA 4DURA 1T8NA 4AN7A 4NSYA 1LHCH 1MKWK 4ZHLU 1P05A 3OY5U 1K21H 1AO5A 1BHXB 2F83A 1QL8A 4D9QA 5AHGH 3BTGE 1V2PT 3E16B 1RS0A 2EC9H 3CS0A 3LC5A 2VIWA 3BIVH 2ZNKH 1ZSJA 4IC6A 5EQQA 1GBHA 1EPTB 1TNLA 3SU3A 3TJOA 2ZGXH 1N6XA 4U01A 3VPKA 1O5FH 2ZWLH 2Q1JA 3MFJA 4INLA 2FOCA 1MD8A 1Z8IB 3RC6A 1K1PA 1FJSA 1EAUA 2ZTZA 1NFYA 4YOIA 1SFIA 4ASHA 1NRRH 1NFXA 4GVUA 5B6OA 1YCPM 2GMTB 4TWWA 3SI3H 5JBBS 5T6FA 1C1UH 1FLEE 1GMCF 4B2AA 2TGAA 4AFZA 2F9PA 1TPAE 2B8OH 2FOMB 1WAYB 1TIOA 2DE8A 1GWAA 5K0HA 2A7HA 1WV7H 4ISLA 1GJAB 2Y7XA 1HPGA 1SHYA 1Z1JA 3HK6B 4FXGH 4K3JA 7GCHF 2HNTE 7ESTE 4FU8A 1P04A 1KXBA 3ZZBA 5DO4H 3ZYDA 4BTTB 3GYMA 5FXLA 4MPXA 1SGRE 2OQUA 1ZTJA 2ZIQH 1TPPA 4ZKRU 3RXOA 3D65E 2WYJA 1ESAA 3F1SB 4X6PA 3SV8A 4VGCB 2W3KA 1DUEA 1ACBE 3V7TA 4AYYB 1SFQB 2HNTF 3R3GB 1J9CH 1TPSA 1OS8A 3E0NB 1D3QB 3K2UA 4YESB 4AFQA 4H4FA 1C5RA 2ZU1A 4AG2A 3I29A 1J14A 1O3HA 3A7WA 3GCTG 4QT8C 4E7RG 1ZRKA 3ZZDA 4A5TS 1V2LT 1K1LA 1A5IA 1O38A 1MQ6A 1FIWA 1AFQC 4ZXYH 4K2YA 3FVFB 1CHGA 2Y80A 1RGQA 3ZZAA 2VWMA 2G00A 3BTKE 4GLYA 1PPBH 2VWOA 4NA8A 1HB0B 4U30A 1QURH 1QHRB 3KCGH 1GCDA 2C8YB 2OC8A 1CA0B 1CA8B 2HPPH 3NXPA 4ISOA 1O35A 1K1NA 3HATH 2SNVA 4FUJA 3EE0B 1SOZA 1EKBB 2UWLA 5EQSA 3LH1A 3SW2B 4IN2A 5T6DA 3RMMH 1C2MA 1HXEH 3ZVBA 4CBOA 3RXBA 1QJ1B 2HPQH 2Z9GA 1FUJA 1QA7A 1F92A 1A0HB 2B0FA 2W7UA 3TPIZ 3M5MA 2BMGB 1SL3A 4ZUHA 2VIPA 2EEKA 2H9TH 1OWKA 3HK3B 1V2QT 1CA0C 4X1QU 4Y79A 2HOBA 1KDQB 1MAYA 4AFSA 4NWKA 3S9CA 1Z8RA 4ZHMU 1LVOA 1QB1A 3V12A 1XUKA 1UTNA 3BF6H 2ZZUH 3P17H 3TJNA 1AY6H 2DE9A 4Y10E 1MU8B 3GCNA 4ZHAA 2ZU4A 2XCNA 1C5NH 2O8MA 5A2MH 2NU4E 1AHTH 2ZCLP 3SNDA 4XOJA 4AGKA 1G3EA 1IQGA 5EXMA 3RUOA 1HV7A 1HLTH 4DT7B 1DICA 4AX9H 1O33A 4NZQA 3M5NA 3BTDE 3MNSA 3RXVA 4AOQA 2VH0A 3VXFH 4B74A 1MTUA 1THSH 5EU8A 4O03A 2ZGBH 1LCYA 3Q3YA 3SJ9A 2PKSC 3AAUA 1J16A 1AI8H 2GZ8A 3TGJE 1G9IE 1FZZA 2G5VA 3HKIB 1GJDB 1C1VH 2NWNA 1O2YA 1XUFA 2VVCA 1TGSZ 2AEIH 2TGTA 3T25A 3SJOA 1JIRA 1HAIH 5LPFA 1UTJA 4LZ4B 4Y8YA 4Y8ZA 3ATLA 3GDVA 1O2JA 1IQEA 1GBFA 2YNAA 2IOTA 1P8VC 4OGYA 4UFEH 2BD9A 3RXPA 4Z6AH 4JZFH 2C8ZB 4TY6A 1KLTA 3RDZA 1H1BA 4ISHH 3SGQE 2UUFB 3KHVA 1QBVH 5F8XA 4YOJA 3CS7A 1EZQA 2A1DB 2BXTH 3MH6A 4CH2B 1WQVH 4UEHH 3S69A 3ZZ5A 1A61H 5ESTE 4CHAB 1O5BB 2ZC9H 3GOVB 3ZVCA 1FPCH 3UFAA 1HYLA 2A5KA 4YO9A 2FEQH 1HJ9A 1EPTA 1K1OA 4RKOB 3F9FA 1XX9A 2BD5A 1GG6C 1V2KT 3VFEA 1EJNA 1O3IA 1T31A 1Z1IA 5C5NA 1QRXA 2VIQA 5L6NH 2OLGA 1LVMA 5HYOA 1MCVA 3M37A 1K28D 4XE4A 2H2ZA 1C1SA 1GHZA 4K1SA 4J1YA 1SGPE 2SGAA 1QNJA 4DCDA 5HMAA 1SGEE 1SC8U 3BTFE 2SGFE 5E2PA 1EATA 4WWYA 1EJMA 1O3PB 2BLQA 4OS1A 1P9UA 2Z7FE 2GCTC 2A7JA 1GJ9B 1ABIH 1L4ZA 1UTQA 2IN2A 3TITA 3ZZ6A 3ZVEA 2ZGJA 4XBCA 2VJ1A 3GDSA 1S6FA 3K9XB 2AMDA 1V3XA 2XTTB 2BDCA 2EI6A 1O2GH 3UTUH 5A8YA 1QJ7B 4X2VA 3D49H 4X2XA 3UREA 1RTFB 3UNSA 4LZ1H 3E8LA 1ZPZA 3M5LA 3KL6A 3H5CB 2BD8A 3LIWA 1TALA 3ZZ7A 4WVPE 1Z6JH 4R8TB 4OGXA 2Z3EA 1D3DB 3M35A 3T2NA 1BTZA 3Q76A 2B7DH 3VEQB 3LC3A 4B73A 3PLPA 1VJAU 1C5SA 4NFEA 1YP9A 1O2VA 2QGRA 4XFQA 3QDZB 1TAWA 2CMYA 1NT1A 2AGIX 3SI4H 3ZZ4A 5JPMH 2R0KA 1W8BH 3LGYA 2QXJA 4BAQB 5DP7A 2BZ6H 1AE5A 1JIMA 5DJ7A 4JZIA 4NWLA 5LPEA 1MTSA 4JYTA 3ZVAA 4ESTE 2TGPZ 2BD2A 1CGHA 2BD4A 1ORFA 1GI5A 1YLDA 3ZVGA 2A4QA 4JYUH 2G51A 2BX4A 3LH3A 1AUTC 2ZFFH 1DE7H 4NCYA 3TNSA 3LJOA 4MQAA 3RXGA 3FP6E 3EGKH 3A8AA 2VGCC 2FOEA 2BOHB 4IBLH 1FAXA 4X8VH 1W13U 4AB8A 1QBNA 2VIDA 1H8IH 3K6ZA 2Q6FA 5A8XA 3L33A 3ESTA 5T3HA 1Y5UT 3P8FA 1IQLA 4BXWA 1EXFA 4JZ1A 1ZSLA 2FX6A 3SUEA 4BNRA 1RIWC 5CHAB 1W11U 3E3TA 1BRUP 4NIYA 2AH4X 2A2QH 2BM2A 4DOQA 1S0RA 1TGTA 3BIUH 3SUDA 1EJAA 3WY8A 3LPRA 2OXSA 4X6NA 2FX4A 2J4IA 1XXFA 4IN1A 4Q2KA 3QZRA 3HKJB 1PQ5A 4CRCA 4ABDA 4Y0ZE 3I78A 3QUMP 1YPLH 3QTOH 1S5SA 2ZU3A 3EA9A 3OX7U 1P03A 2SGPE 2HVXA 3T26A 2FS9A 2OUAA 1BHXF 1N6YA 3BG4C 1C1PA 1WUNH 4Y7BA 3DA9B 1C1QA 1SBWA 5LGOA 1OPHB 5EW1H 1NRQH 1DM4B 2GX4A 1GI2A 1LKBA 1TGNA 4X2YA 1EASA 1KXAA 1MTNC 5CHAC 4DJZB 1NO9H 3URCA 3RXEA 1TA2A 4X1SU 2BY9X 2CHAB 2ZCKP 4OS4A 1MZAA 3RM2H 3SJKA 4ZKOU 1ELDE 1XXDA 2CHAC 2D1JA 1O3KA 3FAOA 1GVZA 5GJ4B 1GBMA 3LGWA 1L1NA 2GV6A 3IG6B 1OWIA 2BOKA 2WV5A 4ISIH 4ABEA 1WSSH 2RG3A 2FO9A 4CR5A 1QRZA 1O2WA 1CHOF 5JBAS 1ZPBA 1C9PA 1ZZZA 3RXIA 3Q3XA 1SGIB 3SOSA 5A09A 3VB5A 2BY6X 3ATMA 1GHYH 3CENA 4UFGH 1O3CA 3RXMA 3SGBE 1MQ5A 3NWUA 1TOMH 5L2YH 1KIGH 1M9UA 1P2OA 2STAE 1L1GA 1ANBA 2AERH 2FDAA 1GBCA 3SQHE 1AFQB 2J92A 1H9HE 3NK8A 3UR6A 2QXHA 6LPRA 1ZPCA 3RXUA 2LNCA 2BVSH 2XBYA 3I77A 4K60A 4KTCA 2DUCA 2ZGCA 5FPYA 1BA8B 2FYRA 2PKAA 1D6RA 3RC4A 3MMGA 2ZQ2A 5DKMA 1O2NA 4DVAU 2H5DA 1ELAA 1SQOA 2F91A 1O3LA 1FPHH 1C1NA 1O2QA 3QO6A 3MH5A 3MI4A 1Y5BT 3PMJA 1O0DH 2NU3E 1C1OA 3P92A 5DP8A 1GL1A 1NFWA 1SB1H 1B5GH 3U1IB 4I8LA 1NPMA 2BTCE 3OTJE 4GHTA 3B9FH 1HAVA 4HFPB 3ZYEA 1GJ4H 2P8OB 1ABJH 1GBDA 4Y6DA 4MNYA 4ZKSU 2ZQ1A 1H4WA 5C2ZA 4FU9A 1LPZB 1UK2A 4Z0KA 4B2BA 2V35A 1MTVA 1FIZA 3GYLB 1GBTA 3UOPA 2FOBA 2PSXA 3FP7E 3M5OA 1GVLA 2FTMA 1GBLA 3SJ8A 4IW4E 1Q2WA 1YPEH 1CO7E 3MO9A 3M61U 1UTKA 4MNVA 1C5WB 2VINA 2G4TA 2H9HA 1AMHA 2H9EH 1BT7A 1BZXE 1C1MA 2BDBA 3RMNH 2RA3A 1AGJA 2BD3A 2WPKS 1W14U 3SV6A 2BVRH 5AFZH 3UNQA 4I8GA 4MPVA 2FODA 1GHXH 3MO3A 3A84A 4UONA 3DFLA 3RXRA 1BMAA 1HAYB 1Y3XA 3RXKA 1XUGA 4JMYA 1QFKH 3C27B 1UVUH 3ZZ3A 1O3FA 2FI5E 4AG1A 1CVWH 3U8RH 5BRRE 1TGCA 3AAVA 4XSKU 3GY8A 2ANWA 1CGIE 1S82A 4KGAA 4INKA 1G32B 4H6TA 4NIXA 4WMEA 4FUBA 4ZH8A 1V2UT 4FUGA 3M3TA 4GHQA 1AKSA 3MH7A 3LDXH 2QC2A 1XVMA 2XC0A 1NESE 1KTTB 3U8TH 1LPGB 1GBKA 3UY9A 3P70B 2P93A 2Y82A 2AMPA 2HGTH 4YLQH 3O8DA 5LH8A 2GZ9A 1NZQH 2YOLA 1F5LA 1S85A 1Z8JB 4ZROA 2FLBH 3PTNA 2V3HH 4FUHA 4X8TH 4ABGA 3BSQA 4D76A 2AMQA 5I25A 1V2NT 2PUQH 2GDEH 4OS6A 1FV9A 3HPTB 2TBSA 1SGCA 1F0UA 1HGTH 2BZAA 1AWHB 1QJ6B 1EOJA 3Q3KA 5DPAA 1NRNH 1O2HA 1K2I1 2F9UA 2HALA 4RN6A 2OP9A 1DLEA 1C2GA 1PQAA 4Y7AA 1TNKA 1MZDA 4FVBA 1UTPA 3TGKE 1W7GH 1BOQA 1G30B 1BTWA 1TMTH 1XMNB 2R0LA 2Y7ZA 4ABIA 1QY6A 7GCHG 1DANH 3FZDA 1KXDA 2KAIA 3KQBA 1T7CA 4Q7XA 1TX8A 3TNTA 1HAZB 1SGFG 4CRBA 1UCYE 2TGDA 1E38B 2P16A 2Z9IA 3QZQA 2Q6DA 1QR3E 3AASA 4GCHG 1ZR0A 1W12U 1SOTA 1KLJH 1YC0A 4FVDA 5C1UA 1HDTH 1EAIA 1P2IA 1YCPK 5JDUB 4KELA 4ZAEA 3RP2A 1GDQA 1EAXA 1MBQA 1O2IA 1B0FA 3LOXA 3ZVFA 1ZHMA 1GBEA 5A0CA 1WU1A 1U6QA 1JOUB 5HGGA 1GHAF 3JZ1B 1GI9B 1W3CA 3RU4E 4LOYH 4ZKNU 1TX6A 2UWOA 1LHFH 1FNIA 1SHHB 2Z9LA 1ANCA 1W10U 2STBE 4I32A 3K6YA 2FPZA 3SNCA 3C1KA 1JWTA 2ODPA 3ELAH 5ESBA 5F8ZA 4F4OC 3MU4A 1GMHG 3KF2A 1F0TA 1C5MD 4B76A 1MU6B 5GWZA 1GL0E 4WJG2 2Y5GA 1BBRE 1Y8TA 3PB1E 1C2KA 3HGPA 2R3UA 3KIDU 1G37A 1THPB 2WINI 4TYDA 1ELBA 1GHBF 3RU4D 1ETTH 1C2LA 1TWXB 5G4BA 3D62A 3MOCA 1CBWC 4NSVA 1SVPA 1MBMA 4CHAC 1EP6A 1WBGB 4O97A 2FM2A 3MU5A 1C5YB 4TY7A 1CT4E 3PM3A 3DFJA 4D7GA 1UVPA 2OCVB 3QLPH 2XC5A 1W2KH 1SPJA 4YOGA 4WXVA 2BX3A 2TRMA 2G8TA 2ZDNA 1TBZH 4X1NU 4NG9H 4XDEA 3RXSA 5F6MA 3DHKH 1Z8GA 2O8UA 4ABBA 9LPRA 1SI5H 2CF8H 5GCHF 1D3TB 1BRCE 4DG4A 4K1TA 2PHBA 1EB1H 1ZGIA 3TK9A 2AIPA 1P57B 1VGCC 1V2RT 3P6ZB 1DOJA 5EPYA 1MKWH 2I6QA 3PROA 1ANEA 4MNXA 1V6DA 1HAXB 4Y0YE 3U9AH 4CREA 1J8AA 1EZSC 2GVFA 1JBUH 1E34B 1O37A 3EDXB 4ABHA 1HJAC 2BQWB 4WMFA 2PWXA 3ZZCA 5GIBA 3FANA 2FYQA 1A46H 3UPEA 1CGJE 5FX6A 1JXPA 2XW9A 2A2XH 1O2TA 3U69H 2C8XB 2PW8H 4X2WA 2ZHDA 2ZDVH 1G2LA 1VITF 4HZHA 2PGBB 5F8TA 3PMBB 3A8BA 1OSSA 2OC1A 1K22H 1XUJA 3VB4A 5JB8S 1KSNA 4O3UA 2ZPQA 3LONA 1GPZA 2EA3A 5FHTA 1GHWH 1GJ7B 2Y6TA 1FONA 1PYTD 1QQ4A 3R0FA 5FBEA 5HM2A 2ZTYA 2F9BH 2AIQA 4RKJB 8LPRA 2O9QA 2M5TA 4CR9A 1AVXA 1YBWA 3SNEA 1O2PA 3SV9A 2XBXA 1MTNB 1O5CB 1DVAH 2XXLA 1RXPA 2RA0A 2BLWA 1S0QA 4YT7H 2FESH 3AVZA 1HAPH 5DGJA 3A7VA 3BN9A 1BTYA 3NZIA 3LT3A 1SQAA 1BMMH 1NRPH 1X7AC 3O8BA 3SZNA 1O3BA 4FU7A 1V2VT 3W94A 3GCTF 1BDAA 3S7HB 2C3SA 1GGDC 1YCPH 2ZO3H 2HNTC 2FWWA 4ABAA 1QRWA 1DWBH 1GHAG 4A1VA 4FUEA 2FZZA 1C1RA 1CT2E 3MU0A 2P95A 3RMLH 4BAHB 4BXSA 2G55A 4KKDA 1A4WH 1SGQE 1AB9B 1WQSA 1AFEH 2ULLA 1DDJA 1AVGH 1LTOA 3ODDA 4X0WU 5CE1A 1P01A 4DW2U 1RD3B 2ZHEH 1FN8A 1KXFA 3OSYA 3ZVDA 1F5RA 1HUTH 4I8HA 1HAHH 1E35B 2G4UA 3PWCA 2PTCE 3U1JB 1P2MA 2A32A 1YPHC 1GDUA 1EZUC 1IAUA 3KQDA 3UWJH 1K1IA 2ESTE 1OYTH 1T4UH 3A83A 1C1TA 3RXTA 4NGAH 5JBCS 1ZMJA 2BHGA 4D8NA 2B9LA 1NM6A 3RXJA 2R2MB 3SU2A 1BTHH 4X6MA 2BY7X 1BJVA 4GSOA 4CRAA 2ZFTA 1O2XA 1F0RA 1T8OA 1TNGA 3H7TA 3VXEH 3ZV9A 2RCEA 1G3CA 4JCNA 1NS3A 1QA0A 2CF9H 2ZP0H 2AFQB 1UCYH 4I8JA 5E0HA 5C5OA 3GY5A 2WPHS 1E36B 2WPMS 1QCPA 4U2WA 3DT0H 3ODFA 1DWCH 1WTHD 3QTVH 1QL9A 4NFFA 3BG8A 1P10A 1MKXK 2EI8A 1PPFE 1TMUH 2K1QA 1HJ8A 2A5AA 1TRYA 1DSUA 3A85A 1J17T 2CGAA 4WF8A 1YGCH 2IPHA 3PYHA 4OS5A 1VITG 4B2CA 3KGPA 1O5EH 4Q7ZA 2GTBA 1ZOMA 3TU7H 2XC4A 1EAWA 1ELEE 3PLBA 2QV1A 5ABWA 2BB4A 3BV9B 2J2UA 1T8MA 2ALVA 1CU1A 2W7SA 1QTFA 1MMJN 2FLRH 2ZU5A 3W95A 1QIXB 1F2SE 4WMDA 4MTBA 1P9SA 5FX5A 3JZ2B 4JYVH 3RU4T 2ZFQH 1BRAA 2WUBA 1A0JA 2ZFPH 3P95A 1XVOA 1KTSB 1S83A 3AW0A 4AYVB 3E91A 1OOKB 4O9VA 3OYPA 1C2IA 1AWFH 5J4QA 1NFUA 2PKSB 1SLVB 1Z7KA 2R2WU 4AB9A 1DY8A 4BANB 1O34A 3GY4A 4IMZA 2JH5D 1HAOH 4X1PU 1HRTH 1VCQA 2BY8X 2PUXB 2PSYA 3SU4A 1BTPA 1O32A 1UMAH 3QGNB 2OTVA 4CH8B 1KLIH 2Z3DA 1FQ3A 8ESTE 3E0PB 1P02A 2QXIA 3B8JA 3GY2A 9ESTA 4CBNA 1FY8E 2R9PA 1EB2A 1INCA 2Y5FA 4MVNA 1V2OT 1C1WH 3RLYH 2F3CE 3ATIA 2V3OH 3P8NA 5A0BA 4FUCA 2NU1E 1GBBA 1C2HA 1E37B 1JRSA 1ZHRA 3T27A 2G52A 4B75A 2ZCHP 3GDUA 3P8GA 2GMTC 3TH2H 5F03A 1F7ZA 5K7RA 3F68H 1MKXH 3URDA 1TONA 2D8WA 3BEFB 4MLFB 1HBTH 1GI7B 1UTOA 3VGCB 4MG3A 2C93B 2SGEE 1ELFA 3PWBA 2CXVA 4SGAE 3PMAB 2GDDA 1A3EH 1TYNA 1YPKH 1V2TT 2O8LA
chains in the Genus database with same CATH superfamily
3SUGA 5C1XA 1T8LA 3SO3A 2P3FH 3E1XB 2ZG0H 1OXGA 1GDNA 1T4VH 1GI8B 4UFFH 1TBRH 1SGYE 1DLKB 3TK6A 1TE0A 2GGVB 3KQEA 2XNIA 4VGCC 4M7GA 6GCHF 2ZPSA 1FN6A 5BPEA 2BQ6B 2UUYA 1OWDA 1SGTA 4WH8A 2ZPRA 3N7OA 4JK6A 4AORA 2J38A 2D26C 1A0LA 1P12E 1W7XH 5DP6A 1JRTA 3PV4A 2A0QB 4CRFA 2ASUB 2JKHA 3W1EA 3QN7A 3M3VA 5FPTA 2FTLE 4Y76A 2AGEX 3TJVA 1G3BA 3CP7A 2O8TA 2EQNA 1GJ5H 3LU9B 1NTPA 1WTGH 1GI1A 4KTUA 1ELGA 2UUJB 4IC5A 1O2OA 2IJOB 1BMLA 2CN0H 3EA7A 2Z3CA 1G3DA 1IHSH 3A82A 4RT0A 3KN2A 2ZECA 1AZ8A 1NN6A 1ZHPA 1ZYOA 2THFB 1PPHE 2H1UA 2YMSB 4ISNA 1UHBB 3QK1A 2ANMH 2FMJA 3BEUA 1O39A 1K9OE 2YMSC 3G01A 4Y8XA 2ODYB 2W5EA 2J34A 3Q77A 3MWIU 3SV2H 4I31A 1KXCA 1MTWA 4NZLA 1SGFA 3DD2H 4RSPA 4FETA 3TJUA 2FP7B 1SR5C 4I8KA 1P09A 2WUCA 1WCZA 4BTIB 1V2MT 5SGAE 2C90B 4YTAA 1OWEA 2Z6BD 3BTME 2GT8A 4BTUB 1XUHA 3KEEA 5FL7D 2BDGA 2G81E 4NIWA 1GJBB 2ALPA 2P3TB 4WXIA 1GMDG 1HAGE 4O3TA 3ZZ8A 2BDIA 1HAVB 1PPZA 2WPDD 2ZGHA 4HGCA 1WOFA 3S9AA 1OWHA 3A89A 1BJUA 4BOHA 5KECA 2C8WB 1N8OC 1YKTA 1EZXC 1ARBA 1VGCB 1TB6H 2QXGA 2L74A 3UNRA 1TQ7B 4NA7A 5AFYH 1P3EA 2PKAB 2HLCA 1DS2E 2BVXH 1Y3WA 3VB3A 1H9IE 1A7SA 2KFWA 2XBWA 4WH6A 3GY3A 1SGDE 2ZHFH 1EP5A 1Y3YA 4BAOB 2CV3A 1F5KU 2IJD1 1C2FA 2ANYA 2WPIS 3MYWA 1TBQH 1LKAA 2ANKH 1LMWB 1UCYK 1V2WT 5A8ZA 2WPLS 3SU5A 1GJ6A 2UUKB 1AD8H 1OX1A 3TIUA 3UAIC 2I6SA 3F9GA 2BD7A 4MDSA 2GP9B 1C4U2 1ELCA 3DCLA 4E05H 1DITH 2VGCB 3KNXA 2XYAA 2OBQA 4DT4A 2GZ7A 4CRDA 2J9NA 1LHEH 2A5IA 4ZMAH 1OP8A 1DPOA 1MABB 2H6MA 2QIQA 4YLUA 1IHTH 1RFNA 1GI4A 1TRNA 3RC5A 3QX5H 5TJXA 3SHAH 4ABFA 3SNAA 1IQFA 1GI0A 1RRKA 7KMEH 2D2DA 1FDPA 1B7XB 4TPIZ 5GPIB 1ZSKA 3RMOH 2NU0E 3BTHE 3KQ5A 5FPSA 4A92A 2V0BA 3UB0A 3TK5A 3MO6A 3STJA 2TPIZ 1C9TA 1OKXA 2ZI2H 5HKKD 1CSOE 4TPYA 3MU8A 4H6SB 3SNBA 1XM1A 1MH0A 5FBIA 1BB0B 5F53A 4B71A 2Y81A 2Z9JA 1Y3UA 2BLOA 1YPHE 3TVJB 2WPJS 2R3YA 1ELTA 2QCYA 1OYQA 1ETRH 3GY7A 2PGQB 1QBOA 1E1RD 3VB7A 1C5LH 4I33A 1PYTC 3PMHB 2AHME 1MAXA 1C5TA 5AF9H 1IQMA 1RJXB 1K1MA 2OINA 2WV4A 1HNEE 1L4DA 3L3TA 4ABJA 2HWLB 4GCHF 2ZDKA 5DG6A 5JYIA 4GUXA 3QGJA 3UUZA 3O8RA 1C2EA 3ZV8A 1KXEA 1O30A 3P8OA 1ZMLA 1BIOA 1C4Y2 3PO1B 3Q00A 3S9BA 2VVUA 1YPJH 2ZFSA 4Y11E 2PP6A 1BCUH 3A87A 5C67A 1O2ZA 1TMBH 2P59A 1FY5A 2BDYA 1FY3A 1GBIA 3SHCH 3HGNA 3NPSA 1YLCA 2VIVA 4KTSA 4OS7A 1FXYA 2PV9B 5FCRA 1CBWB 2ZHQH 2F4LA 3L6PA 2VVVA 1SLWB 3V3MA 4ZXXH 2ODQA 4X6OA 1H9LB 1SGNE 3V0XA 2VIOA 1A2CH 4U32A 4DIHH 1BBRK 1TA6A 3SYJA 1YLNA 6CHAC 4K69A 2Y5HA 1J15A 3A8CA 3T29A 2ZDMA 3SN8A 1KDQA 2J95A 3MNXA 2FI3E 1D9IA 4TWYA 4HI3A 3UOUA 4Q4LA 2ZDLA 4XBBA 2P3UB 1NC6A 1O3EA 3MNBA 2SGQE 2OD3B 1PQ8A 5CMXH 3RXHA 4JK5A 1ELVA 2EI7A 1FI8A 1FY4A 1P2KA 5PTPA 4Q7YA 1TNHA 1S6HA 1GBJA 3RXCA 1DX5M 1TGBA 1ZTKA 3F9EA 3S0NA 2GCHF 1LDTT 1YM0A 4D9RA 3UR9A 3A7XA 2ZEBA 3RXFA 1SLXB 2XWBI 1DWDH 3OU0A 4I7YH 1IQHA 1OP2A 3NUMA 2VH6A 2UWPA 2GKVE 6CHAB 1TNIA 1MD7A 2FIRH 3EAJA 2G5NA 1BBRH 1C4V2 1XKBC 3MNCA 4JZDH 4H42U 1P06A 2QE7D 2WYGA 3RXQA 2FI4E 1H8DH 1LQDB 3NRLA 1IQKA 2ZTXA 5J4SA 3RXDA 1UVOA 1L0ZA 3B23B 7LPRA 2AGGX 2A4OA 1CQQA 1O3AA 1PPEE 1V2JT 1QGFA 1TOCB 4B1TA 2RDLA 1CT0E 1IOEA 1C5ZB 3U98H 1TQ0B 3IITA 4AGJA 2J98A 2OC0A 1ESBA 4UFDH 4F55A 3SUFA 1A5GH 3ZZ9A 4WY3A 1RTKA 5FAHA 1D6WA 1ZMNA 2A7CA 1O3OA 2FS8A 2BDHA 1EPTC 1O5AB 1P11E 1AE8H 1B0EA 1LHDH 2OQ5A 1PJPA 2KR7A 1VCPA 1Q3XA 2BYAX 2SFAA 5DP3A 2A4RA 2KX4A 1Z71A 1CE5A 1VITH 1E0FD 2PTNA 3M3SA 1ESTA 3A7ZA 1E1QD 4FUIA 1P3CA 1UTLM 2BY5X 4MNWA 1VZQH 3MTYA 3LKWA 1YF4A 5KGOA 5H4IB 2VWLA 3BG4B 3A80A 3OY6U 3UQVA 4FOUC 1C5PA 2VB0A 3MU1A 3NCLA 2OC7A 4DIIH 2ZU2A 1AIXH 4IGDA 1RTLA 3LGIA 1AB9C 2ILNA 5EPNA 2YNBA 3WWFA 3TLOA 3GISB 2QAAA 1GMHF 1A1RA 2QA9E 2ZDAH 4PROA 1EOLA 2ZF0H 1WXRA 1PPGE 1VR1H 5GXPA 3A86A 2A31A 1GHBG 2A4GA 2C4FH 3UIRA 4YZUA 2O8WA 1L2EA 1W0YH 1UHBA 4DY7B 2QN5T 1LVBA 3LGTA 1Q31A 1D3PB 2HLDD 1HIAA 1EX3A 2VNTA 1O3DA 1Z6EA 3MH4A 4K8YA 3V13A 1ZLRA 4E7NA 1YY3A 1PPCE 2AYWA 4BAMB 1BQYA 2FOGA 2QY0B 1JMOH 2QF3A 2W3IA 1THRH 4X8UH 1C2DA 2BDAA 3D23A 5EOKA 5TCAA 3MHWU 1LVYA 4LK4A 3FZZA 2KZ4A 4K5ZA 3EA8A 5A0AE 5I46H 5GDSH 3A8DA 5GCHG 1C5XB 3SU1A 1BMNH 2QF0A 2XWAA 1L1JA 1LPKB 1BTXA 4YT6H 2F9VA 1VCWA 1ID5H 2JH6D 2A45B 2IPQX 1DSTA 1PQ7A 3BEIB 2V6NA 4NA9H 4KP0A 5E8EH 8GCHG 4E06H 1DXWA 1IQNA 1GHVH 3U8OH 1S81A 4FUFA 5E2OA 5AVDA 2BLVA 3UWIA 2ZA5A 3E90B 4FUDA 1K1JA 4GPGA 1BRBE 2SGDE 3E6PH 3SZEA 3SJIA 1UO6A 5EQRA 1UK4A 2FOFA 4LXBH 4THNH 3DSPA 5EW2H 1GMCG 2XCFA 1C5VA 2V3MA 5E0JA 3IWMA 4OS2A 3SORA 3BTEE 3LGUA 5LPRA 1P2QA 2SNWA 6ESTA 2ZKSA 1S84A 3F6UH 1QL7A 1FMGA 1TLDA 5ETXA 5EXNA 4IMQA 1G36A 2HRVA 1MCTA 1QQUA 4GAWA 3KQCA 4INHA 3RM0H 1O2KA 1H8ED 1NRSH 3ATKA 1GI3A 1PFXC 3LJJA 5C1YA 1HIAB 1AN1E 2P8OC 2VU8E 1C5OH 2PFEA 1O3JA 3VB6A 5L30H 3GCOA 3O8CA 3A7YA 1BTUA 5EGMA 1IQJA 5DSFA 4A7IB 4A1TA 1SQTA 1W0ZU 1DY9A 3M7TA 1OP0A 1A5HA 4Q80A 2FXRA 1HJAB 1NY22 5E0GA 1UJ1A 1TRMA 3M7UA 4K8BA 5JB9S 4SGBE 4DGJA 5FCKA 1OWJA 1ZRBA 1EUFA 4NIVA 3LGVA 5C20A 3F3BA 2GV7A 3T62A 1D4PB 5HXFA 3PTBA 3TH3H 1AKSB 4MPUA 2LELA 2WZQA 8KME2 1O31A 2LPRA 5EXLA 2QYIA 1AU8A 1LHGH 1TNJA 1A3BH 3PLKA 2ZFRH 5TCCA 1N8OB 1SLUB 4HTCH 2OK5A 4IS5A 1UVTH 4YM9A 3VGCC 4J2YB 4UDWH 2VWNA 1Y5AT 3T28A 3SU0A 1UVSH 3ATWA 1DT2A 5T1VA 1RIWB 3OTPA 1VJ9U 1KY9A 3F2HA 1BUIA 3SQEE 1FY1A 2J94A 1O36A 1O2UA 5L2ZH 1SMFE 2Z94A 2PLXA 1P2JA 3RXAA 1NU9A 1NU7B 3DUXH 1DXPA 1UTMA 2GCHG 1SSXA 3NKKA 3BTTE 4XBDA 2GD4B 2LP6A 4TSFD 1GGDB 5IDKA 1GJCB 5DP4A 1MUEB 1YYY1 1SG8B 5T6GA 3TGIE 5KEDA 2W26A 1O5DH 3RLWH 3SBKA 3M36A 2KAIB 3QWCH 2GCTB 1AZZA 4AFUA 3ITIA 1AVWA 8GCHF 1N1LA 1NROH 3FP8E 5C0UA 1TFXA 4A6LA 1O3NA 1UK3A 4Y71A 6GCHG 1TX7A 2K8IA 1G2MA 1HCGA 1QZ8A 4X8SH 1DFPA 1CHOG 1ZJDA 1TPOA 1AQ7A 1GG6B 1O5GH 2TIOA 1C2JA 4R0IA 1ZGVA 2OBOA 1TABE 1Y59T 3GICB 1O3GA 4BAKB 1ETSH 2NU2E 4CRGA 1AUJA 2Z9KA 1DUAA 3H7OA 2QF5A 2H5CA 1O2RA 2BXUH 1O2LA 4JZEH 5DP5A 1ANDA 1DWEH 3UQOA 3T5FH 1HXFH 1YPGH 4UE7H 4D7FA 1GBAA 1WYKA 1IQIA 1S6LA 2F9OA 3SV7A 5HM9A 4A1XA 3GY6A 1EFRD 2AS9A 2B5TB 2JETB 3GCHC 1LQEA 2BQ7B 4AZ2B 5EODA 1EQ9A 1P2NA 2XRCA 5DK1A 1F0SA 1Y3VA 2FOHA 1YPMH 2CJIA 1FAKH 2XBVA 4MPWA 2Q6GA 1QB6A 3SU6A 1T32A 1O2SA 1GCTC 3SGAE 2F9NA 1QB9A 1GCTB 3M7QA 4UD9H 3PO1C 4K1EA 1XUIA 3EYDA 3STIA 2PR3A 3BTQE 1C5UA 3K65B 4F49A 3RXLA 1V2ST 2KCPA 3FFGA 3N99A 1P0SH 5IK2D 3A81A 1ZJKA 1GMDF 5IYTA 4X1RU 1XKAC 3H09A 1BITA 5EG4A 1ZTLA 2ZHWH 2JH0D 1C5QA 1O2MA 1HFDA 2JETC 1GJ8B 3GCHB 2GT7A 3BTWE 1KYNA 2FOAA 5C3NA 3A7TA 2VBCA 2P94A 3EQ0H 3A88A 1O3MA 1GI6A 1GVKB 3F9HA 1ARCA 1LO6A 3AW1A 3TH4H 5EIYA 3S7KB 3ENSB 5DP9A 5JBTA 4DURA 1T8NA 4AN7A 4NSYA 1LHCH 1MKWK 4ZHLU 1P05A 3OY5U 1K21H 1AO5A 1BHXB 2F83A 1QL8A 4D9QA 5AHGH 3BTGE 1V2PT 3E16B 1RS0A 2EC9H 3CS0A 3LC5A 2VIWA 3BIVH 2ZNKH 1ZSJA 4IC6A 5EQQA 1GBHA 1EPTB 1TNLA 3SU3A 3TJOA 2ZGXH 1N6XA 4U01A 3VPKA 1O5FH 4TT3D 2ZWLH 2Q1JA 3MFJA 4INLA 2FOCA 1MD8A 1Z8IB 3RC6A 1K1PA 1FJSA 1EAUA 2ZTZA 1NFYA 4YOIA 1SFIA 4ASHA 1NRRH 1NFXA 2K0QA 4GVUA 5B6OA 1YCPM 2GMTB 4TWWA 3SI3H 5JBBS 5T6FA 1C1UH 1FLEE 1GMCF 4B2AA 2TGAA 4AFZA 2F9PA 1TPAE 2B8OH 2FOMB 1WAYB 1TIOA 2DE8A 2EY4C 1GWAA 5K0HA 2A7HA 1WV7H 2KCAA 3OEHD 1SQRA 4ISLA 1GJAB 2Y7XA 1HPGA 1SHYA 1Z1JA 3HK6B 4FXGH 4K3JA 7GCHF 2HNTE 7ESTE 4FU8A 1P04A 2HVYB 1KXBA 3ZZBA 5DO4H 3ZYDA 4BTTB 3GYMA 5FXLA 4MPXA 1NBMD 1SGRE 2OQUA 1ZTJA 2ZIQH 1TPPA 4ZKRU 3RXOA 3D65E 2WYJA 1ESAA 3F1SB 4X6PA 3SV8A 4VGCB 2W3KA 1DUEA 1ACBE 3V7TA 4AYYB 1SFQB 2HNTF 3R3GB 1J9CH 1TPSA 1OS8A 3E0NB 1D3QB 3K2UA 2J5UA 4YESB 4AFQA 4H4FA 1C5RA 2ZU1A 4AG2A 3I29A 1J14A 2CK3D 1O3HA 3A7WA 3GCTG 4QT8C 4E7RG 1ZRKA 3ZZDA 4A5TS 1V2LT 1K1LA 1A5IA 2JJ2D 1O38A 1MQ6A 1FIWA 1AFQC 4ZXYH 4K2YA 3FVFB 1CHGA 2Y80A 1RGQA 3ZZAA 2VWMA 2G00A 3BTKE 4GLYA 1PPBH 5HIZA 2VWOA 4NA8A 3AK5A 1HB0B 4U30A 1QURH 1QHRB 3KCGH 2KM0A 1GCDA 2C8YB 2OC8A 1CA0B 1CA8B 2HPPH 3NXPA 4ISOA 1O35A 1K1NA 3HATH 2SNVA 4FUJA 3EE0B 1SOZA 1EKBB 2UWLA 5EQSA 3LH1A 3SW2B 4IN2A 3MQKC 5T6DA 3RMMH 5C0TA 3DSGA 3WW7A 5B6LA 1C2MA 1HXEH 3ZVBA 4CBOA 3RXBA 1QJ1B 2HPQH 2Z9GA 1WDIA 1FUJA 1QA7A 3ZIAD 1F92A 1A0HB 2B0FA 2W7UA 3TPIZ 3M5MA 2BMGB 1SL3A 4ZUHA 2VIPA 2EEKA 2H9TH 3EE7A 1OWKA 3HK3B 1V2QT 1CA0C 4X1QU 4Y79A 4Q63A 2HOBA 1KDQB 1MAYA 4AFSA 4NWKA 3S9CA 1Z8RA 4ZHMU 1LVOA 1QB1A 3V12A 1XUKA 1UTNA 3BF6H 2ZZUH 3P17H 4HG6A 3TJNA 1AY6H 2DE9A 4Y10E 1MU8B 3GCNA 4ZHAA 2WSSD 2ZU4A 2XCNA 1C5NH 2O8MA 5A2MH 2NU4E 1AHTH 2ZCLP 3SNDA 4XOJA 4AGKA 1G3EA 1IQGA 5EXMA 3F2GA 3RUOA 1HV7A 1HLTH 4DT7B 1DICA 4AX9H 1O33A 4NZQA 3M5NA 3BTDE 3MNSA 3RXVA 4AOQA 2VH0A 3VXFH 4B74A 1MTUA 1THSH 5EU8A 4O03A 3PV5A 2ZGBH 1LCYA 3Q3YA 3SJ9A 2PKSC 3AAUA 1J16A 1AI8H 2GZ8A 3TGJE 1G9IE 1FZZA 2G5VA 3HKIB 1GJDB 1C1VH 2NWNA 1O2YA 1XUFA 2VVCA 1TGSZ 2AEIH 2TGTA 3T25A 3SJOA 1JIRA 1HAIH 5LPFA 1UTJA 4LZ4B 4Y8YA 4Y8ZA 3ATLA 3GDVA 1O2JA 2XNDD 1IQEA 1GBFA 2YNAA 2IOTA 1P8VC 2J97A 4OGYA 4UFEH 2BD9A 4RI0A 2M2AA 3RXPA 4Z6AH 4JZFH 2J98B 2C8ZB 4TY6A 4B6FA 1KLTA 3RDZA 1H1BA 5DN6D 4ISHH 3SGQE 2UUFB 3KHVA 2YMSD 1QBVH 5F8XA 4YOJA 3CS7A 1EZQA 2A1DB 2BXTH 3MH6A 4CH2B 1WQVH 2F43B 4UEHH 3S69A 3ZZ5A 1A61H 5ESTE 4CHAB 1O5BB 2ZC9H 3GOVB 3KYFA 3ZVCA 1FPCH 3UFAA 1HYLA 1H8HD 2A5KA 4YO9A 2FEQH 1HJ9A 1EPTA 1K1OA 4RKOB 3F9FA 1XX9A 4YXWD 2BD5A 1GG6C 1V2KT 3VFEA 1EJNA 1O3IA 1T31A 1Z1IA 5C5NA 1QRXA 2VIQA 5L6NH 2OLGA 1LVMA 5HYOA 1MCVA 3M37A 1K28D 4XE4A 2H2ZA 1C1SA 1GHZA 4K1SA 4J1YA 1SGPE 2SGAA 1QNJA 4DCDA 5HMAA 1SGEE 1SC8U 4ACBA 3BTFE 2SGFE 5E2PA 1EATA 4F48B 4WWYA 2KCOA 1EJMA 1O3PB 2BLQA 4OS1A 1P9UA 2Z7FE 2GCTC 2A7JA 1GJ9B 1ABIH 1L4ZA 1UTQA 2IN2A 3TITA 3ZZ6A 3ZVEA 2ZGJA 5C17A 4XBCA 2VJ1A 3GDSA 1S6FA 3K9XB 2AMDA 1V3XA 2XTTB 2BDCA 2EI6A 1O2GH 3UTUH 5A8YA 1QJ7B 4X2VA 3D49H 4X2XA 3UREA 1RTFB 3UNSA 4LZ1H 3E8LA 1ZPZA 3M5LA 3KL6A 3H5CB 2BD8A 3LIWA 1TALA 3ZZ7A 4WVPE 1Z6JH 4R8TB 4OGXA 2Z3EA 1D3DB 3M35A 3T2NA 1BTZA 3Q76A 2B7DH 3VEQB 3LC3A 4B73A 3PLPA 1VJAU 1C5SA 4NFEA 1YP9A 1O2VA 2QGRA 4XFQA 3QDZB 1TAWA 2CMYA 1NT1A 2AGIX 3SI4H 3ZZ4A 5JPMH 2R0KA 1W8BH 3LGYA 2QXJA 4BAQB 5DP7A 2BZ6H 1AE5A 1JIMA 5DJ7A 4JZIA 4NWLA 1BMFD 5LPEA 1MTSA 4JYTA 3ZVAA 4ESTE 2TGPZ 2BD2A 1CGHA 2BD4A 1ORFA 1K0HA 1GI5A 1YLDA 3ZVGA 2A4QA 4JYUH 2G51A 2BX4A 3LH3A 1AUTC 2ZFFH 1DE7H 4NCYA 3TNSA 3LJOA 4MQAA 3RXGA 1UW7A 3FP6E 3EGKH 3A8AA 2VGCC 2FOEA 2BOHB 4IBLH 1FAXA 4X8VH 1W13U 4AB8A 1QBNA 3OE7D 2VIDA 1H8IH 3K6ZA 2Q6FA 5A8XA 3L33A 3ESTA 5T3HA 1Y5UT 3P8FA 1IQLA 4BXWA 1EXFA 4JZ1A 1ZSLA 2FX6A 3PRDA 3SUEA 4BNRA 1RIWC 2V7QD 5CHAB 1W11U 3E3TA 1BRUP 3FN8A 2AH4X 4NIYA 2A2QH 2BM2A 4DOQA 1S0RA 1TGTA 3BIUH 2QF4A 3SUDA 1EJAA 4M9FA 3WY8A 3LPRA 2OXSA 5CHBA 2GJGA 4X6NA 2FX4A 5EJZA 2J4IA 1XXFA 4IN1A 4Q2KA 3QZRA 3HKJB 1PQ5A 4I86A 4CRCA 4ABDA 4Y0ZE 3I78A 3QUMP 1YPLH 3QTOH 1S5SA 2ZU3A 3EA9A 3OX7U 4RT1A 1P03A 2SGPE 2HVXA 3T26A 2FS9A 2OUAA 1BHXF 1N6YA 3BG4C 1C1PA 1WUNH 4Y7BA 3DA9B 1C1QA 1SBWA 5LGOA 1OPHB 5EW1H 1NRQH 1DM4B 2GX4A 1GI2A 1LKBA 1TGNA 2W6JD 4X2YA 1EASA 1KXAA 1MTNC 5CHAC 4DJZB 5CDFE 1NO9H 3URCA 3RXEA 1TA2A 4X1SU 2BY9X 2CHAB 4ACAA 2ZCKP 4OS4A 1MZAA 4XD7D 3RM2H 3SJKA 4ZKOU 1ELDE 1XXDA 2CHAC 2D1JA 1O3KA 3FAOA 1GVZA 5GJ4B 1GBMA 3LGWA 1L1NA 2GV6A 3IG6B 1OWIA 2BOKA 2WV5A 4ISIH 3FOAA 1VKYA 1WSSH 4ABEA 2RG3A 2FO9A 4CR5A 1QRZA 1O2WA 1CHOF 5JBAS 1ZPBA 1C9PA 1ZZZA 3RXIA 3Q3XA 1SGIB 3SOSA 5A09A 5HIYA 3VB5A 2BY6X 5GNDA 1SKYE 3ATMA 1GHYH 3CENA 4UFGH 1O3CA 3RXMA 3SGBE 1MQ5A 3OAAD 3NWUA 1TOMH 5L2YH 1KIGH 1M9UA 1P2OA 2STAE 1L1GA 1ANBA 2AERH 2FDAA 1GBCA 3SQHE 1AFQB 2J92A 1H9HE 3NK8A 3UR6A 2QXHA 6LPRA 1ZPCA 3RXUA 2LNCA 2BVSH 2XBYA 3I77A 4K60A 4KTCA 1YWUA 2DUCA 2ZGCA 5FPYA 1BA8B 2FYRA 2PKAA 1D6RA 3RC4A 3MMGA 2ZQ2A 5DKMA 1O2NA 4DVAU 2H5DA 1ELAA 1SQOA 2F91A 1O3LA 1FPHH 1C1NA 1O2QA 3QO6A 3MH5A 3MI4A 1Y5BT 3PMJA 1O0DH 2NU3E 1C1OA 3P92A 5DP8A 1GL1A 1NFWA 1SB1H 1W0JD 1B5GH 3U1IB 4I8LA 1NPMA 2BTCE 2JDID 3OTJE 4GHTA 3B9FH 1HAVA 4HFPB 3ZYEA 1GJ4H 2P8OB 1ABJH 1GBDA 1COWD 4Y6DA 4MNYA 4ZKSU 2ZQ1A 1H4WA 5C2ZA 4FU9A 1LPZB 1UK2A 4Z0KA 4B2BA 2V35A 1MTVA 1FIZA 3GYLB 1GBTA 3UOPA 2FOBA 2PSXA 3FP7E 3M5OA 1GVLA 2FTMA 1GBLA 3SJ8A 4IW4E 1Q2WA 1YPEH 1CO7E 3MO9A 3M61U 1UTKA 4MNVA 1C5WB 2VINA 2G4TA 2H9HA 1AMHA 2H9EH 1BT7A 1BZXE 1C1MA 2BDBA 3RMNH 2RA3A 3KYGA 1AGJA 2BD3A 2WPKS 1W14U 3SV6A 2BVRH 5AFZH 3UNQA 4I8GA 4MPVA 2FODA 4ASUD 1GHXH 3MO3A 3A84A 4UONA 3DFLA 3RXRA 1BMAA 1HAYB 1Y3XA 3RXKA 1XUGA 4JMYA 1QFKH 3C27B 1UVUH 3ZZ3A 1O3FA 2FI5E 4AG1A 1CVWH 3U8RH 5BRRE 1TGCA 3AAVA 5EJLA 4XSKU 3GY8A 2ANWA 1CGIE 1S82A 2WV9A 4KGAA 4INKA 1G32B 4H6TA 4NIXA 4WMEA 4FUBA 4ZH8A 1V2UT 4FUGA 3WWBA 3M3TA 4GHQA 1AKSA 3MH7A 3LDXH 2QC2A 1XVMA 2XC0A 1NESE 1KTTB 3U8TH 1LPGB 1GBKA 3UY9A 3P70B 2P93A 2Y82A 2AMPA 2HGTH 4YLQH 4ZCNA 3O8DA 5LH8A 2GZ9A 1NZQH 2YOLA 1F5LA 1S85A 1Z8JB 4ZROA 2FLBH 3PTNA 2V3HH 4FUHA 4X8TH 4ABGA 3BSQA 4D76A 2AMQA 5I25A 4XRNA 1V2NT 2PUQH 2GDEH 4OS6A 1FV9A 3HPTB 2TBSA 3N7EA 1SGCA 1F0UA 1HGTH 2BZAA 1AWHB 1QJ6B 1EOJA 3Q3KA 5DPAA 1NRNH 1O2HA 1K2I1 2F9UA 2HALA 4RN6A 2OP9A 1DLEA 1C2GA 1PQAA 4Y7AA 4OM9A 1TNKA 1MZDA 4FVBA 1UTPA 3TGKE 1W7GH 1BOQA 1G30B 1BTWA 1TMTH 1XMNB 2R0LA 2Y7ZA 4ABIA 1QY6A 7GCHG 1DANH 3FZDA 1KXDA 2KAIA 3KQBA 1T7CA 4Q7XA 1TX8A 3TNTA 1HAZB 1SGFG 4CRBA 1UCYE 2TGDA 1E38B 2P16A 2Z9IA 3QZQA 2Q6DA 1QR3E 3AASA 4GCHG 1ZR0A 1W12U 1SOTA 1KLJH 1YC0A 4FVDA 1KMHB 5C1UA 1HDTH 1EAIA 1P2IA 1YCPK 5JDUB 4KELA 4ZAEA 3F2FA 3RP2A 1GDQA 1EAXA 1MBQA 1O2IA 1B0FA 3LOXA 3ZVFA 1ZHMA 1GBEA 5A0CA 1WU1A 1U6QA 1JOUB 3N7DA 5HGGA 1GHAF 3JZ1B 1GI9B 1W3CA 3RU4E 4LOYH 4ZKNU 1TX6A 2UWOA 1LHFH 1FNIA 1SHHB 2Z9LA 1ANCA 1W10U 2STBE 4I32A 3K6YA 2FPZA 3SNCA 3C1KA 1JWTA 2ODPA 3ELAH 5ESBA 5F8ZA 4F4OC 3MU4A 1GMHG 3KF2A 1F0TA 1C5MD 4B76A 1MU6B 5GWZA 1GL0E 4WJG2 2Y5GA 1BBRE 1Y8TA 4AC9A 3PB1E 1C2KA 3HGPA 2R3UA 3KIDU 1G37A 1THPB 2WINI 4TYDA 1ELBA 1GHBF 3RU4D 1ETTH 1C2LA 1TWXB 5G4BA 3D62A 3MOCA 1CBWC 4NSVA 1SVPA 1MBMA 4CHAC 1EP6A 1WBGB 4O97A 2FM2A 3MU5A 1C5YB 4TY7A 1CT4E 3PM3A 3DFJA 4D7GA 1UVPA 2OCVB 3QLPH 2XC5A 5EJ1A 1W2KH 1SPJA 4YOGA 4WXVA 2BX3A 2TRMA 2G8TA 2ZDNA 1TBZH 4X1NU 4NG9H 4XDEA 3RXSA 5F6MA 3DHKH 1Z8GA 3FO8D 2O8UA 4ABBA 4Z1MD 1SI5H 2CF8H 5GCHF 9LPRA 1D3TB 1BRCE 4DG4A 4K1TA 2PHBA 1EB1H 1ZGIA 3TK9A 2AIPA 1P57B 1VGCC 1V2RT 3P6ZB 1DOJA 5EPYA 1MKWH 2I6QA 3PROA 1ANEA 4MNXA 1V6DA 1HAXB 4Y0YE 3U9AH 4CREA 1J8AA 1EZSC 2GVFA 1JBUH 1E34B 1O37A 3EDXB 4ABHA 1NBME 1HJAC 2BQWB 4WMFA 2PWXA 3ZZCA 5GIBA 3FANA 2XOKD 2FYQA 1A46H 3UPEA 1CGJE 5FX6A 1JXPA 2XW9A 2A2XH 1O2TA 3U69H 2C8XB 2PW8H 4X2WA 2ZHDA 2ZDVH 1G2LA 1VITF 4HZHA 2PGBB 5F8TA 3PMBB 3A8BA 1OSSA 2OC1A 1K22H 1XUJA 3VB4A 5JB8S 1KSNA 4O3UA 2ZPQA 3LONA 1GPZA 2EA3A 5FHTA 1GHWH 1GJ7B 2Y6TA 1FONA 1PYTD 1QQ4A 3R0FA 5FBEA 5HM2A 2ZTYA 2F9BH 2AIQA 3F0PA 4RKJB 8LPRA 2O9QA 2M5TA 4CR9A 1AVXA 1YBWA 3SNEA 3OFND 1O2PA 3SV9A 2XBXA 1MTNB 1O5CB 1DVAH 2XXLA 1RXPA 2RA0A 2BLWA 1S0QA 4YT7H 2FESH 3AVZA 1HAPH 5DGJA 3A7VA 3BN9A 1BTYA 3NZIA 3LT3A 1SQAA 1BMMH 1NRPH 1X7AC 3O8BA 3SZNA 1O3BA 4FU7A 1V2VT 3W94A 3GCTF 1BDAA 3S7HB 2C3SA 1GGDC 1YCPH 2ZO3H 2HNTC 2FWWA 4ABAA 1QRWA 1DWBH 3GS9A 1GHAG 4A1VA 4FUEA 2FZZA 1C1RA 1CT2E 3MU0A 2P95A 3RMLH 4BAHB 4BXSA 2G55A 4KKDA 1A4WH 1SGQE 1AB9B 1WQSA 1AFEH 2RDEA 3VG8A 2ULLA 1DDJA 1AVGH 1LTOA 3ODDA 4X0WU 5CE1A 2W6ID 1P01A 4DW2U 1RD3B 2ZHEH 1FN8A 2JJ1D 1W0KD 1KXFA 3OSYA 3ZVDA 1F5RA 1HUTH 4I8HA 1HAHH 3CNRA 1E35B 2G4UA 3PWCA 2PTCE 2JIZD 3U1JB 1P2MA 2A32A 1YPHC 1GDUA 1EZUC 1IAUA 3KQDA 3UWJH 1K1IA 2ESTE 1OYTH 1T4UH 3A83A 1C1TA 3RXTA 4NGAH 5JBCS 1ZMJA 2BHGA 4D8NA 2B9LA 1NM6A 3RXJA 2R2MB 3SU2A 1BTHH 4X6MA 2BY7X 1BJVA 4GSOA 4CRAA 2ZFTA 1O2XA 1F0RA 1T8OA 1TNGA 3H7TA 1OHHD 3VXEH 3ZV9A 2RCEA 1G3CA 4JCNA 1NS3A 1QA0A 2CF9H 2ZP0H 2AFQB 1UCYH 4I8JA 5E0HA 5C5OA 3GY5A 2WPHS 1E36B 2WPMS 1QCPA 4U2WA 3DT0H 3ODFA 1DWCH 1WTHD 4B6EA 3QTVH 1QL9A 4NFFA 3BG8A 1P10A 1MKXK 2EI8A 1PPFE 1TMUH 2K1QA 1HJ8A 2A5AA 1TRYA 1DSUA 3A85A 1J17T 2CGAA 4WF8A 1YGCH 2WHXA 2IPHA 3PYHA 4OS5A 1VITG 4B2CA 3KGPA 3PV2A 1O5EH 4Q7ZA 2GTBA 3DSOA 1ZOMA 3TU7H 2XC4A 3PRBA 1EAWA 1ELEE 3PLBA 2QV1A 3U28C 5ABWA 2BB4A 3BV9B 2J2UA 1T8MA 2ALVA 1CU1A 2W7SA 1E79D 1QTFA 1MMJN 2FLRH 2RFKC 2ZU5A 3W95A 1QIXB 1F2SE 4WMDA 4MTBA 1P9SA 5FX5A 3JZ2B 4JYVH 3RU4T 2ZFQH 1BRAA 2WUBA 1A0JA 2ZFPH 3P95A 1XVOA 1KTSB 1S83A 3AW0A 4AYVB 3E91A 1OOKB 4O9VA 3OYPA 1C2IA 1AWFH 5J4QA 2PKSB 1NFUA 3FKSD 1SLVB 1Z7KA 2R2WU 4AB9A 1DY8A 4BANB 1O34A 3GY4A 4IMZA 2JH5D 1HAOH 4X1PU 1HRTH 2KCYA 1VCQA 2BY8X 2PUXB 2PSYA 3SU4A 1BTPA 1O32A 1UMAH 3QGNB 2OTVA 4CH8B 1KLIH 2Z3DA 1FQ3A 8ESTE 3E0PB 1P02A 2QXIA 3B8JA 3OEED 3GY2A 9ESTA 4CBNA 1FY8E 2R9PA 1EB2A 1INCA 2Y5FA 1FX0B 3F0OA 4MVNA 1V2OT 1C1WH 2L6OA 2F3CE 3ATIA 3RLYH 2V3OH 3P8NA 5A0BA 4FUCA 2NU1E 1GBBA 4P00A 1C2HA 1E37B 1JRSA 1ZHRA 3T27A 2G52A 4B75A 2ZCHP 3GDUA 3P8GA 2GMTC 3TH2H 5F03A 1F7ZA 5K7RA 3F68H 1MKXH 3URDA 1TONA 2D8WA 3BEFB 4MLFB 5C94A 1HBTH 1GI7B 1UTOA 3VGCB 4MG3A 2C93B 4P02A 2SGEE 1ELFA 3PWBA 2CXVA 4SGAE 3PMAB 2GDDA 1A3EH 1TYNA 1YPKH 1V2TT 2O8LA
chains in the Genus database with same CATH topology
3SUGA 5C1XA 1T8LA 3SO3A 2P3FH 3E1XB 2ZG0H 1OXGA 1GDNA 1T4VH 1GI8B 4UFFH 1TBRH 1SGYE 1DLKB 3TK6A 1TE0A 2GGVB 3KQEA 2XNIA 4VGCC 4M7GA 6GCHF 2ZPSA 1FN6A 5BPEA 2BQ6B 2UUYA 1OWDA 1SGTA 4WH8A 2ZPRA 3N7OA 4JK6A 4AORA 2J38A 2D26C 1A0LA 1P12E 1W7XH 5DP6A 1JRTA 3PV4A 2A0QB 4CRFA 2ASUB 2JKHA 3QN7A 3M3VA 5FPTA 2FTLE 4Y76A 2AGEX 3TJVA 1G3BA 3CP7A 2O8TA 3LU9B 1GJ5H 1NTPA 1WTGH 1GI1A 4KTUA 1ELGA 2UUJB 4IC5A 1O2OA 2IJOB 1BMLA 2CN0H 3EA7A 2Z3CA 1G3DA 1IHSH 3A82A 3KN2A 2ZECA 1AZ8A 1NN6A 1ZHPA 1ZYOA 2THFB 1PPHE 2H1UA 4ISNA 1UHBB 3QK1A 2ANMH 2FMJA 3BEUA 1O39A 1K9OE 3G01A 4Y8XA 2ODYB 2W5EA 2J34A 3Q77A 3MWIU 3SV2H 4I31A 1KXCA 1MTWA 4NZLA 1SGFA 3DD2H 4RSPA 3TJUA 2FP7B 1SR5C 4I8KA 1P09A 2WUCA 1WCZA 4BTIB 1V2MT 5SGAE 2C90B 4YTAA 1OWEA 2Z6BD 3BTME 2GT8A 4BTUB 1XUHA 3KEEA 2BDGA 2G81E 4NIWA 1GJBB 2ALPA 2P3TB 4WXIA 1GMDG 1HAGE 4O3TA 3ZZ8A 2BDIA 1HAVB 1PPZA 2ZGHA 4HGCA 1WOFA 3S9AA 1OWHA 3A89A 1BJUA 4BOHA 2C8WB 1N8OC 1YKTA 1EZXC 1ARBA 1VGCB 1TB6H 2QXGA 3UNRA 1TQ7B 4NA7A 5AFYH 1P3EA 2PKAB 2HLCA 1DS2E 2BVXH 1Y3WA 3VB3A 1H9IE 1A7SA 2XBWA 4WH6A 3GY3A 1SGDE 2ZHFH 1EP5A 1Y3YA 4BAOB 2CV3A 1F5KU 1C2FA 2ANYA 2WPIS 3MYWA 1TBQH 1LKAA 2ANKH 1LMWB 1UCYK 1V2WT 5A8ZA 2WPLS 3SU5A 1GJ6A 2UUKB 1AD8H 1OX1A 3TIUA 2I6SA 3F9GA 2BD7A 4MDSA 2GP9B 1C4U2 1ELCA 4E05H 1DITH 2VGCB 3KNXA 2XYAA 2OBQA 2GZ7A 4CRDA 2J9NA 1LHEH 2A5IA 4ZMAH 1OP8A 1DPOA 2H6MA 2QIQA 4YLUA 1IHTH 1RFNA 1GI4A 1TRNA 3RC5A 3QX5H 5TJXA 3SHAH 4ABFA 3SNAA 1IQFA 1GI0A 1RRKA 7KMEH 2D2DA 1FDPA 1B7XB 4TPIZ 5GPIB 1ZSKA 3RMOH 2NU0E 3BTHE 5FPSA 4A92A 2V0BA 3TK5A 3MO6A 3STJA 2TPIZ 1C9TA 1OKXA 2ZI2H 1CSOE 4TPYA 3MU8A 4H6SB 3SNBA 1XM1A 1MH0A 5FBIA 1BB0B 4B71A 2Y81A 2Z9JA 1Y3UA 2BLOA 1YPHE 3TVJB 2WPJS 2R3YA 1ELTA 2QCYA 1OYQA 1ETRH 3GY7A 2PGQB 1QBOA 3VB7A 1C5LH 4I33A 1PYTC 3PMHB 1MAXA 1C5TA 5AF9H 1IQMA 1RJXB 1K1MA 2WV4A 2OINA 1HNEE 1L4DA 3L3TA 4ABJA 2HWLB 4GCHF 2ZDKA 5DG6A 5JYIA 4GUXA 3QGJA 3UUZA 3O8RA 1C2EA 3ZV8A 1KXEA 1O30A 3P8OA 1ZMLA 1BIOA 1C4Y2 3PO1B 3Q00A 3S9BA 2VVUA 1YPJH 2ZFSA 4Y11E 3A87A 1BCUH 5C67A 1O2ZA 1TMBH 2P59A 1FY5A 2BDYA 1FY3A 1GBIA 3SHCH 3HGNA 3NPSA 1YLCA 2VIVA 4KTSA 4OS7A 1FXYA 2PV9B 5FCRA 1CBWB 2ZHQH 3L6PA 2VVVA 1SLWB 3V3MA 4ZXXH 2ODQA 4X6OA 1H9LB 1SGNE 3V0XA 2VIOA 1A2CH 4U32A 4DIHH 1BBRK 1TA6A 6CHAC 4K69A 2Y5HA 1J15A 3A8CA 3T29A 2ZDMA 3SN8A 1KDQA 2J95A 3MNXA 2FI3E 1D9IA 4TWYA 4HI3A 3UOUA 2ZDLA 4XBBA 2P3UB 1NC6A 1O3EA 3MNBA 2SGQE 2OD3B 1PQ8A 5CMXH 3RXHA 4JK5A 1ELVA 2EI7A 1FI8A 1FY4A 1P2KA 5PTPA 4Q7YA 1TNHA 1S6HA 1GBJA 3RXCA 1DX5M 1TGBA 1ZTKA 3F9EA 3S0NA 2GCHF 1LDTT 1YM0A 4D9RA 3UR9A 3A7XA 2ZEBA 3RXFA 1SLXB 2XWBI 1DWDH 3OU0A 4I7YH 1IQHA 1OP2A 3NUMA 2VH6A 2UWPA 2GKVE 6CHAB 1TNIA 1MD7A 2FIRH 3EAJA 2G5NA 1BBRH 1C4V2 1XKBC 3MNCA 4JZDH 4H42U 1P06A 2WYGA 3RXQA 2FI4E 1H8DH 1LQDB 1IQKA 2ZTXA 5J4SA 3RXDA 1UVOA 1L0ZA 3B23B 7LPRA 2AGGX 2A4OA 1CQQA 1O3AA 1PPEE 1V2JT 1QGFA 1TOCB 4B1TA 2RDLA 1CT0E 1IOEA 1C5ZB 3U98H 1TQ0B 3IITA 4AGJA 2OC0A 1ESBA 4UFDH 3SUFA 1A5GH 3ZZ9A 4WY3A 1RTKA 5FAHA 1D6WA 1ZMNA 2A7CA 1O3OA 2FS8A 2BDHA 1EPTC 1O5AB 1P11E 1AE8H 1B0EA 1LHDH 2OQ5A 1PJPA 1VCPA 1Q3XA 2BYAX 2SFAA 5DP3A 2A4RA 1Z71A 1CE5A 1VITH 1E0FD 2PTNA 3M3SA 1ESTA 3A7ZA 4FUIA 1P3CA 1UTLM 2BY5X 4MNWA 1VZQH 3MTYA 3LKWA 1YF4A 5H4IB 2VWLA 3BG4B 3A80A 3OY6U 3UQVA 1C5PA 2VB0A 3MU1A 3NCLA 2OC7A 4DIIH 2ZU2A 1AIXH 4IGDA 1RTLA 3LGIA 1AB9C 2ILNA 5EPNA 2YNBA 3TLOA 3GISB 2QAAA 1GMHF 1A1RA 2QA9E 2ZDAH 4PROA 1EOLA 2ZF0H 1PPGE 1VR1H 5GXPA 3A86A 2A31A 1GHBG 2A4GA 2C4FH 3UIRA 4YZUA 2O8WA 1L2EA 1W0YH 1UHBA 4DY7B 2QN5T 1LVBA 3LGTA 1Q31A 1D3PB 1HIAA 1EX3A 2VNTA 1O3DA 1Z6EA 3MH4A 4K8YA 3V13A 1ZLRA 4E7NA 1PPCE 2AYWA 4BAMB 1BQYA 2FOGA 2QY0B 1JMOH 2QF3A 2W3IA 1THRH 4X8UH 1C2DA 2BDAA 3D23A 5EOKA 5TCAA 3MHWU 1LVYA 4LK4A 3FZZA 4K5ZA 3EA8A 5A0AE 5I46H 5GDSH 3A8DA 5GCHG 1C5XB 3SU1A 1BMNH 2QF0A 2XWAA 1L1JA 1LPKB 1BTXA 4YT6H 2F9VA 1VCWA 1ID5H 2JH6D 2A45B 1DSTA 1PQ7A 3BEIB 2V6NA 4NA9H 4KP0A 5E8EH 8GCHG 4E06H 1DXWA 1IQNA 1GHVH 3U8OH 1S81A 4FUFA 5E2OA 5AVDA 2BLVA 3UWIA 2ZA5A 3E90B 4FUDA 1K1JA 4GPGA 1BRBE 2SGDE 3E6PH 3SJIA 1UO6A 5EQRA 1UK4A 2FOFA 4LXBH 4THNH 5EW2H 1GMCG 2XCFA 1C5VA 5E0JA 3IWMA 4OS2A 3SORA 3BTEE 3LGUA 5LPRA 1P2QA 2SNWA 6ESTA 2ZKSA 1S84A 3F6UH 1QL7A 1FMGA 1TLDA 5ETXA 5EXNA 4IMQA 1G36A 2HRVA 1MCTA 1QQUA 4GAWA 3KQCA 4INHA 3RM0H 1O2KA 1NRSH 3ATKA 1GI3A 1PFXC 3LJJA 5C1YA 2VU8E 1HIAB 1AN1E 2P8OC 1C5OH 2PFEA 1O3JA 3VB6A 5L30H 3GCOA 3O8CA 3A7YA 1BTUA 5EGMA 1IQJA 4A7IB 4A1TA 1SQTA 1W0ZU 1DY9A 3M7TA 1OP0A 1A5HA 4Q80A 2FXRA 1HJAB 1NY22 5E0GA 1UJ1A 1TRMA 3M7UA 4K8BA 5JB9S 4SGBE 4DGJA 5FCKA 1OWJA 1ZRBA 1EUFA 4NIVA 3LGVA 5C20A 2GV7A 3T62A 1D4PB 5HXFA 3PTBA 3TH3H 1AKSB 4MPUA 8KME2 1O31A 2LPRA 5EXLA 2QYIA 1AU8A 1LHGH 1TNJA 1A3BH 3PLKA 2ZFRH 5TCCA 1N8OB 1SLUB 4HTCH 4IS5A 1UVTH 4YM9A 3VGCC 4J2YB 4UDWH 2VWNA 1Y5AT 3T28A 3SU0A 1UVSH 3ATWA 1DT2A 1RIWB 1VJ9U 1KY9A 1BUIA 3SQEE 1FY1A 2J94A 1O36A 1O2UA 5L2ZH 1SMFE 2Z94A 2PLXA 1P2JA 3RXAA 1NU9A 1NU7B 3DUXH 1DXPA 1UTMA 2GCHG 1SSXA 3NKKA 3BTTE 4XBDA 2GD4B 5IDKA 1GGDB 1GJCB 5DP4A 1MUEB 1YYY1 1SG8B 5T6GA 3TGIE 2W26A 1O5DH 3RLWH 3SBKA 3M36A 2KAIB 3QWCH 2GCTB 1AZZA 4AFUA 3ITIA 1AVWA 8GCHF 1N1LA 1NROH 3FP8E 1TFXA 4A6LA 1O3NA 1UK3A 4Y71A 6GCHG 1TX7A 1G2MA 1HCGA 4X8SH 1DFPA 1CHOG 1ZJDA 1TPOA 1AQ7A 1GG6B 1O5GH 2TIOA 1C2JA 4R0IA 1ZGVA 2OBOA 1TABE 1Y59T 3GICB 1O3GA 4BAKB 1ETSH 2NU2E 4CRGA 1AUJA 2Z9KA 1DUAA 3H7OA 2H5CA 1O2RA 2BXUH 1O2LA 4JZEH 5DP5A 1ANDA 1DWEH 3UQOA 3T5FH 1HXFH 1YPGH 4UE7H 4D7FA 1GBAA 1WYKA 1IQIA 2F9OA 3SV7A 5HM9A 4A1XA 3GY6A 2AS9A 2B5TB 2JETB 3GCHC 1LQEA 2BQ7B 4AZ2B 5EODA 1EQ9A 1P2NA 2XRCA 5DK1A 1F0SA 1Y3VA 2XBVA 1YPMH 2CJIA 1FAKH 2FOHA 4MPWA 2Q6GA 1QB6A 3SU6A 1T32A 1O2SA 1GCTC 3SGAE 2F9NA 1QB9A 1GCTB 3M7QA 4UD9H 3PO1C 4K1EA 1XUIA 3EYDA 3STIA 2PR3A 3BTQE 1C5UA 3K65B 4F49A 3RXLA 1V2ST 3FFGA 1P0SH 3A81A 1ZJKA 1GMDF 5IYTA 4X1RU 1XKAC 1BITA 5EG4A 1ZTLA 2ZHWH 2JH0D 1C5QA 1O2MA 1HFDA 2JETC 1GJ8B 3GCHB 2GT7A 3BTWE 1KYNA 2FOAA 5C3NA 3A7TA 2P94A 3EQ0H 3A88A 1O3MA 1GI6A 1GVKB 3F9HA 1ARCA 1LO6A 3AW1A 3TH4H 3S7KB 3ENSB 5DP9A 5JBTA 4DURA 1T8NA 4AN7A 4NSYA 1LHCH 1MKWK 4ZHLU 1P05A 3OY5U 1K21H 1AO5A 1BHXB 2F83A 1QL8A 4D9QA 5AHGH 3BTGE 1V2PT 3E16B 1RS0A 2EC9H 3CS0A 3LC5A 2VIWA 3BIVH 2ZNKH 1ZSJA 4IC6A 5EQQA 1GBHA 1EPTB 1TNLA 3SU3A 3TJOA 2ZGXH 1N6XA 4U01A 3VPKA 1O5FH 2ZWLH 2Q1JA 3MFJA 4INLA 2FOCA 1MD8A 1Z8IB 3RC6A 1K1PA 1FJSA 1EAUA 2ZTZA 1NFYA 4YOIA 1SFIA 4ASHA 1NRRH 1NFXA 4GVUA 5B6OA 1YCPM 2GMTB 4TWWA 3SI3H 5JBBS 5T6FA 1C1UH 1FLEE 1GMCF 4B2AA 2TGAA 4AFZA 2F9PA 1TPAE 2B8OH 2FOMB 1WAYB 1TIOA 2DE8A 1GWAA 5K0HA 2A7HA 1WV7H 4ISLA 1GJAB 2Y7XA 1HPGA 1SHYA 1Z1JA 3HK6B 4FXGH 4K3JA 7GCHF 2HNTE 7ESTE 4FU8A 1P04A 1KXBA 3ZZBA 5DO4H 3ZYDA 4BTTB 3GYMA 5FXLA 4MPXA 1SGRE 2OQUA 1ZTJA 2ZIQH 1TPPA 4ZKRU 3RXOA 3D65E 2WYJA 1ESAA 3F1SB 4X6PA 3SV8A 4VGCB 2W3KA 1DUEA 1ACBE 3V7TA 4AYYB 1SFQB 2HNTF 3R3GB 1J9CH 1TPSA 1OS8A 3E0NB 1D3QB 3K2UA 4YESB 4AFQA 4H4FA 1C5RA 2ZU1A 4AG2A 3I29A 1J14A 1O3HA 3A7WA 3GCTG 4QT8C 4E7RG 1ZRKA 3ZZDA 4A5TS 1V2LT 1K1LA 1A5IA 1O38A 1MQ6A 1FIWA 1AFQC 4ZXYH 4K2YA 3FVFB 1CHGA 2Y80A 1RGQA 3ZZAA 2VWMA 2G00A 3BTKE 4GLYA 1PPBH 2VWOA 4NA8A 1HB0B 4U30A 1QURH 1QHRB 3KCGH 1GCDA 2C8YB 2OC8A 1CA0B 1CA8B 2HPPH 3NXPA 4ISOA 1O35A 1K1NA 3HATH 2SNVA 4FUJA 3EE0B 1SOZA 1EKBB 2UWLA 5EQSA 3LH1A 3SW2B 4IN2A 5T6DA 3RMMH 1C2MA 1HXEH 3ZVBA 4CBOA 3RXBA 1QJ1B 2HPQH 2Z9GA 1FUJA 1QA7A 1F92A 1A0HB 2B0FA 2W7UA 3TPIZ 3M5MA 2BMGB 1SL3A 4ZUHA 2VIPA 2EEKA 2H9TH 1OWKA 3HK3B 1V2QT 1CA0C 4X1QU 4Y79A 2HOBA 1KDQB 1MAYA 4AFSA 4NWKA 3S9CA 1Z8RA 4ZHMU 1LVOA 1QB1A 3V12A 1XUKA 1UTNA 3BF6H 2ZZUH 3P17H 3TJNA 1AY6H 2DE9A 4Y10E 1MU8B 3GCNA 4ZHAA 2ZU4A 2XCNA 1C5NH 2O8MA 5A2MH 2NU4E 1AHTH 2ZCLP 3SNDA 4XOJA 4AGKA 1G3EA 1IQGA 5EXMA 3RUOA 1HV7A 1HLTH 4DT7B 1DICA 4AX9H 1O33A 4NZQA 3M5NA 3BTDE 3MNSA 3RXVA 4AOQA 2VH0A 3VXFH 4B74A 1MTUA 1THSH 5EU8A 4O03A 2ZGBH 1LCYA 3Q3YA 3SJ9A 2PKSC 3AAUA 1J16A 1AI8H 2GZ8A 3TGJE 1G9IE 1FZZA 2G5VA 3HKIB 1GJDB 1C1VH