1O33A

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o33A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o33A02
1BBRK 3TH2H 1GBMA 1KXFA 1DFPA 2FYRA 5H4IB 2J95A 2NU3E 1DANH 3ITIA 4LK4A 1HAHH 2BDGA 1HXEH 3RXIA 1FJSA 3UWIA 5IDKA 4ABBA 5J4QA 3RP2A 1FY1A 2VIOA 1O5DH 5I46H 4AGKA 1S0QA 4Y6DA 4JZDH 1QRXA 4B75A 4FUIA 1WUNH 3SGBE 5FBEA 1MCTA 2A4RA 3HGPA 2NWNA 1KSNA 1ELCA 1DY8A 2A31A 4E7NA 1CHOG 1ID5H 1BQYA 2A7CA 1Y5AT 2GCTC 2QAAA 3QZQA 1X7AC 5FBIA 3T26A 1EB1H 2ZP0H 1Q3XA 2PKSB 5HMAA 4IN2A 1HAZB 5IYTA 3SGAE 1ZOMA 4ZUHA 1BRBE 1P3EA 4ZHLU 3U69H 2ZFRH 2ZDLA 1IQGA 2KAIB 3SHCH 4DGJA 1NTPA 3P8OA 1W13U 1G9IE 1QA0A 2Z9KA 2ZU4A 1SVPA 2ZQ1A 4YESB 1YPMH 3ODDA 1LMWB 1OP2A 1LKAA 2F9UA 2WPIS 3SO3A 4AB8A 3CP7A 3MO3A 1S5SA 5AFYH 1RTLA 1O3NA 1G32B 1PPFE 2BVRH 2HGTH 5LPRA 1BOQA 3PV4A 8LPRA 5GIBA 1B7XB 1YCPK 5E2OA 2OBQA 1MTWA 5DP6A 1YC0A 4YO9A 3O8RA 2Z9JA 1C5NH 1O2TA 2XC0A 3M5NA 1G37A 4UEHH 3TK5A 4XDEA 1L0ZA 5L2ZH 3ZVGA 1C5SA 3E0PB 2BDCA 3GICB 3EGKH 2P16A 2VIVA 3U8RH 2QXHA 3V0XA 3HKIB 1A3BH 4CRBA 4U32A 3OTJE 1V2KT 1MMJN 1A5HA 2KAIA 1AVWA 3T2NA 4NA9H 3NWUA 5L2YH 3MU1A 1LVOA 2FX6A 2VWNA 1D6WA 1GGDB 1GHWH 2Y5GA 1TX6A 4KGAA 4INKA 2VIDA 3F9GA 1QL8A 1QB9A 4TWYA 2FOCA 1C5UA 2R2WU 3RXMA 2PSXA 3M3TA 1O2KA 3BTME 1C1VH 2VGCB 1C5QA 3Q77A 4D7FA 1QY6A 3UNQA 1B5GH 1O3BA 1TMTH 1YKTA 1DOJA 1NO9H 2Z3DA 2J94A 2C3SA 1QL9A 2PKSC 1O5AB 2ZDVH 4MTBA 2B5TB 1WCZA 1K1IA 1ZZZA 1SMFE 1YPLH 1ZMJA 2P93A 2UUJB 1DWDH 1ORFA 2GDDA 4UE7H 1P05A 4D9QA 1N6YA 1K2I1 4M7GA 3BIUH 1LQEA 3ELAH 2JH5D 5JBCS 1NZQH 2C8ZB 2FDAA 2M5TA 3P95A 3LJOA 2ALVA 3MH5A 1TE0A 2D8WA 2TRMA 2LPRA 4JYTA 1GJBB 3AAVA 2ZPQA 1PYTC 2ZPSA 3ESTA 4O03A 1YPKH 1UTKA 1T31A 5GCHG 2F3CE 1EJAA 3DT0H 1MH0A 5FPTA 1CQQA 4ZAEA 1G3EA 5A09A 2BX3A 2O8UA 4UFGH 4R8TB 1O34A 1L4ZA 1OWJA 1GVLA 1LO6A 1BHXF 2VIQA 4FUFA 1GHBF 1BRCE 1IQHA 2QYIA 1MTVA 4X0WU 1P01A 1V2QT 3L33A 3VPKA 4ZKNU 5PTPA 1E36B 2QXGA 2A5AA 2G5NA 4E7RG 3PB1E 1S81A 4H6SB 3GY4A 2ZDAH 1GGDC 3UREA 1V2JT 3ATLA 1AQ7A 1GHXH 3RUOA 3RXBA 2BY7X 1M9UA 3URCA 2Y80A 3MFJA 2ZGBH 2TBSA 1AKSA 1FV9A 3BTWE 4DVAU 2HVXA 1KLTA 1ELFA 2B9LA 2ZFSA 3GY7A 1FY4A 3QGNB 2GT8A 3OSYA 3E6PH 5EW1H 1S6FA 3SU4A 3ZZ4A 3HGNA 1GJCB 1ZSKA 5TJXA 2VINA 1JRSA 2WUCA 1T32A 2VGCC 4JZIA 3AASA 1P12E 2OQ5A 1SPJA 2Z9GA 1OYQA 1CA8B 3V3MA 5LGOA 1NN6A 1GI0A 3AAUA 3MNBA 2ULLA 2BD3A 2ZZUH 2VB0A 1O3DA 1OWDA 6ESTA 2XNIA 1O5EH 1ZHPA 2RG3A 4BAOB 1O35A 5FX6A 4UFEH 3A7ZA 4CBNA 3SJ8A 2BZ6H 3MOCA 2QN5T 3T29A 1THSH 1V2ST 1ZR0A 4B76A 3MHWU 2FESH 3GISB 2G4TA 4I8LA 2P95A 4WJG2 2BDHA 1W3CA 3ZZ9A 4B2AA 4HGCA 1V2WT 2BD9A 4WXVA 1BTXA 3RU4T 1AD8H 4FVBA 3O8BA 2XBYA 3QGJA 1BDAA 4BTTB 1C2HA 1QJ1B 1O2GH 1TBZH 1DM4B 4AG1A 3AW1A 2A7JA 4X1NU 1EAXA 2FXRA 2FOGA 3D65E 5F6MA 2Z7FE 3FVFB 3SQEE 2GTBA 1LQDB 1C5YB 1IQEA 2FODA 2GV7A 2Q6DA 3E3TA 3RU4E 3RXEA 3LC5A 1ESTA 2PWXA 3SOSA 3U1IB 6LPRA 5C20A 2G4UA 1EJMA 3LPRA 1E35B 1TABE 1MTUA 1S6HA 1A0JA 4K2YA 1FQ3A 4DG4A 5A8YA 2BOKA 2P59A 5JB8S 2GZ9A 3VB6A 2F9VA 2HNTC 3PM3A 2Y5FA 3GCTG 2UWOA 3AVZA 1DVAH 1LPGB 4NZQA 4FUCA 3RM0H 2NU2E 2C8YB 4TY6A 3ZYEA 2P8OB 1BA8B 2Z94A 2V3OH 3LGVA 3B9FH 4X6OA 1C5RA 1GVKB 2FP7B 3UTUH 1A4WH 4X1SU 3ZVCA 2ASUB 1K9OE 1O2NA 1K28D 2O9QA 4XE4A 4CHAB 1BITA 4KP0A 5C1YA 2AIPA 3PLBA 4Q7ZA 3KQDA 2J2UA 2SNWA 2CGAA 4Q7YA 3GDUA 1P8VC 1Y3VA 4DOQA 4OGXA 2XC4A 2ZCLP 3QTOH 4JYVH 1GL1A 4WWYA 4R0IA 2ZDKA 1F5RA 1KXDA 1W11U 1ZJDA 5EGMA 1ZSLA 2ZGJA 1CGJE 1SI5H 1YGCH 2R2MB 1V2TT 3EE0B 3SV9A 2ZU5A 1C2KA 5E2PA 4RN6A 1GBHA 1C1UH 3UR6A 1FONA 1C1TA 1V2UT 1W8BH 2FX4A 3UPEA 1C2EA 1EAWA 2BD8A 2A5KA 1Z8IB 1BZXE 4WF8A 2ZU1A 2PKAB 4UFDH 3M7TA 2A5IA 1SC8U 4OS4A 1TRNA 5E0HA 1WQVH 1C2DA 5HM9A 1L4DA 1ZPCA 3BEUA 2OC7A 1ZTLA 5A0BA 4ZHMU 1CE5A 4KTCA 1LCYA 1PPBH 2PUQH 3JZ2B 4H42U 4K8BA 4D7GA 1P0SH 1ANDA 2ZQ2A 1ANEA 1L2EA 3EYDA 3S7KB 3RLWH 1GHZA 4IMZA 4F4OC 1MZAA 3KQBA 1MBQA 1YBWA 4I8KA 3MNCA 1VITG 4I8HA 4Y7BA 1G30B 1GDUA 4E05H 3BTGE 4WH8A 3ENSB 3MNSA 3MWIU 2BD4A 3PO1B 8KME2 5DP8A 4JK6A 4GPGA 3K9XB 1AO5A 1DY9A 5DKMA 3TK6A 3BIVH 4CH2B 7LPRA 2ODPA 3PTBA 1FAXA 1ZMLA 2XTTB 3E16B 6CHAB 4LXBH 2PKAA 2P8OC 4U01A 2H9EH 3CENA 1OWEA 3S0NA 4J1YA 1KLJH 2H5CA 3CS7A 1JRTA 4AYYB 4GCHF 3UQVA 2Y82A 4CHAC 3QUMP 2H2ZA 3W95A 3RXPA 4E06H 2PW8H 1P02A 3VB7A 1YM0A 2GCHF 1YLCA 1HDTH 1A2CH 2J4IA 1IQKA 1MUEB 2VVUA 3SNCA 1QQUA 3ZVDA 4AOQA 5AVDA 4I7YH 3Q00A 1P10A 2F9BH 3E91A 1SLVB 2OC8A 2TGPZ 1XUKA 3FANA 4HFPB 1HJAB 1AIXH 1CSOE 3FP8E 1JOUB 1SGFG 1ELTA 3TJOA 2VWOA 2ZFFH 1WTGH 4NFFA 2SGDE 1V2OT 1TBQH 2OC1A 1SLXB 8GCHF 1TOCB 4B74A 2OQUA 2G51A 4Y8XA 3SQHE 4DJZB 3TLOA 1SLWB 1DXWA 3A82A 1EUFA 2AFQB 2ZHFH 4MPXA 1HAOH 3MTYA 1QJ6B 3MU4A 1AMHA 2AH4X 1GBIA 3U9AH 1EZXC 1O30A 1C2FA 1WBGB 5JDUB 2PTCE 3KL6A 1C2JA 1J14A 1ZRKA 5C1UA 2HLCA 1GG6B 2FOBA 3P17H 4FUBA 5F8XA 2K1QA 5LPFA 2UUKB 1AE5A 4HI3A 1HLTH 2WPLS 1BB0B 1D6RA 1ELEE 3A8AA 4O9VA 1TGCA 3N7OA 2TGAA 3ZZCA 1O2YA 1RJXB 5EXLA 1MBMA 1DWCH 4KTUA 3PO1C 1OP8A 3UIRA 4Y7AA 2TPIZ 3A87A 4XBCA 4K1SA 2WPMS 3LJJA 3B8JA 1LPKB 3PWCA 3U98H 1RTKA 3ATIA 1WTHD 3P8GA 3F9EA 2O8WA 2OC0A 1KXEA 5FCKA 6CHAC 2ZFQH 1QHRB 1T4UH 4B73A 1QR3E 2XWAA 1Z8JB 1EB2A 3P8NA 1DT2A 1TNKA 1ZSJA 2VNTA 3TITA 5ABWA 4NCYA 1O3OA 1YPHC 1Y8TA 2FM2A 1OKXA 4CR9A 2BYAX 5EODA 1NESE 4K60A 4UONA 2Q6GA 1HCGA 1T8MA 3QX5H 4GHQA 2ZGHA 1ELBA 4X1RU 3MMGA 1Q2WA 2R0KA 1GHAG 4RKOB 1HIAB 3ATKA 1MQ5A 4X2XA 3R0FA 2OBOA 3NUMA 4CH8B 3BTFE 3K65B 4X2YA 4Y11E 3EA8A 4JK5A 1J9CH 1HJAC 1P03A 3RXGA 1NFYA 3LOXA 3K6YA 2UUFB 1C4V2 2ZHEH 1GMHG 1O2SA 5FPSA 4AN7A 2V6NA 2PFEA 3DFJA 2OUAA 3OYPA 1U6QA 1AUTC 3A8CA 1GBDA 5HGGA 1VJ9U 3GCOA 3SUDA 1O3JA 1P09A 1P2JA 2DE9A 1YCPH 5E0GA 2P3TB 1XM1A 3M7UA 4AZ2B 4ZKOU 1GCDA 1GMCF 5A0AE 3NKKA 1NU9A 4NIVA 1ZPBA 3KQEA 4TPIZ 2Z6BD 2P3FH 3PMJA 3STIA 3BN9A 1TPSA 2OP9A 3KIDU 2CF8H 3SHAH 5C1XA 1O3IA 9LPRA 1GG6C 1GBJA 1HIAA 1NY22 2FO9A 4ZROA 1PJPA 4FVDA 3LKWA 2J38A 5AHGH 4ESTE 4MPWA 1O5BB 1W10U 2EC9H 1SGNE 4ISLA 1AZZA 5EQSA 4GAWA 2JH0D 2VWMA 3F68H 1O2OA 1TX8A 3RDZA 3ZV9A 1C2MA 4Q2KA 5T6GA 3UWJH 1UTPA 1O39A 2ZG0H 3B23B 4BXSA 4ZHAA 1UCYE 2AGGX 3EA9A 1ELVA 3LDXH 1G3BA 3M36A 6GCHF 1ZLRA 3S69A 1IHTH 2EEKA 2ODQA 1VCQA 2WUBA 3TGKE 3D49H 4ZXXH 3G01A 3K2UA 5BRRE 1F0TA 1GDQA 2VIPA 3VB4A 1IQFA 1DS2E 1AUJA 1P2KA 2W3KA 2ZPRA 2BXTH 2ZCHP 3QWCH 3IG6B 3GY3A 2XW9A 5T6DA 2GV6A 1ARBA 1TNGA 2FYQA 1DUAA 5EU8A 3SJKA 3TJNA 5F03A 1GWAA 2VVVA 1D9IA 1L1JA 1C5ZB 5DP5A 3QLPH 1O5FH 1EQ9A 2ZCKP 1W14U 2XBVA 3ZZDA 2A4OA 2YNBA 5JBTA 1O3GA 1SHHB 1H9HE 5A0CA 4CRFA 4Q80A 1ZPZA 1TWXB 1FIZA 5ESBA 4MVNA 2F9PA 1MD7A 3V12A 1VR1H 2GDEH 1GBCA 1YF4A 1AY6H 3GYLB 1C1WH 5DP3A 5L6NH 2TGTA 2ZI2H 4CRGA 2VIWA 5EQRA 3U1JB 3KNXA 1UTLM 2G52A 1C5LH 3DFLA 3SORA 1C5TA 4X8UH 3TH3H 1GJ6A 4THNH 1QNJA 1THPB 4CRCA 1ZMNA 2H9HA 1EXFA 2HPQH 5E8EH 3SNDA 3ATWA 3CS0A 3SV2H 1DSUA 1TPPA 1RTFB 1MQ6A 1GI1A 3A89A 3W94A 1LPZB 7GCHF 3BG4B 5GWZA 2VWLA 1TQ7B 1N8OB 2BZAA 1C5MD 1K22H 2V35A 1T8OA 4X6MA 3A7YA 3M37A 4YM9A 1AWFH 1P04A 1WYKA 5EPNA 1UVOA 4DIHH 3UY9A 1SGFA 1BTYA 1IHSH 1L1NA 5HYOA 2SFAA 3O8CA 3RMNH 1K1LA 1PPHE 2TIOA 1GL0E 3BV9B 1SHYA 1HBTH 1F5KU 2RA0A 2ILNA 1T8LA 1CU1A 4NIYA 1FIWA 1SB1H 1J17T 5A8ZA 1FN8A 2A45B 1HJ8A 1NPMA 4AG2A 4YOIA 4GLYA 3KCGH 3E1XB 4NWLA 4ASHA 3RXLA 1O2ZA 1WOFA 1BJUA 3RXDA 1PQ8A 1KTTB 1TMUH 3KN2A 3BTTE 2QXIA 4I31A 4UDWH 1FN6A 1TBRH 1KXCA 5GJ4B 1EOLA 1NRRH 5AFZH 1OWKA 4JMYA 1EATA 2BY5X 1QTFA 3IWMA 2C90B 3I77A 2AIQA 3AW0A 3RU4D 1Z8GA 4X6PA 1OP0A 1FI8A 2BX4A 4WH6A 4YZUA 4WY3A 3PLPA 3MO9A 1DDJA 1LDTT 2FPZA 1OYTH 4YLQH 1SGPE 1D3PB 4A1TA 1O3EA 2A4GA 4B2CA 3SU3A 1KYNA 4NIXA 3T28A 1EZSC 2A7HA 2OCVB 2G8TA 2FS9A 2IPHA 3KHVA 1W12U 2CJIA 4H4FA 1LVYA 4ABGA 3UR9A 3E0NB 1HFDA 3RC4A 3SNBA 1O3KA 3BTKE 1XVOA 1DWBH 2I6SA 1KTSB 4OS6A 3BTQE 1D3TB 1AGJA 2G00A 4JZEH 1HAVB 1Q31A 2BDYA 2IJOB 1AVXA 1FY8E 4XFQA 1SGTA 4O3TA 2Y5HA 2ZEBA 2D26C 3BG4C 2Y81A 5FAHA 1H9LB 5FHTA 1E37B 4MNYA 3JZ1B 1FNIA 1TYNA 4FUHA 1PQAA 1V2RT 3SU0A 1N8OC 2BDIA 1Z71A 4FUDA 2WV4A 1OWIA 5FCRA 3SJ9A 4YT6H 1ZGIA 1BMMH 3TH4H 2CV3A 1VJAU 1F2SE 1MAXA 2OINA 2QV1A 2UUYA 1TRYA 2W26A 3A85A 2RCEA 1DICA 2FTLE 1XUGA 1A5IA 2G55A 3M5LA 1DPOA 1C1PA 1QIXB 3L6PA 5ESTE 3NCLA 1LVBA 1SGCA 4XSKU 3RXTA 1GHVH 2PV9B 1NRNH 1TMBH 1UMAH 1Z6EA 2Z9IA 2THFB 1MKXH 1A7SA 1KY9A 5K0HA 2W3IA 4K5ZA 3SI3H 2FI3E 1MU8B 1BMNH 1SGYE 1HAVA 3P70B 1MTSA 1O2JA 2HNTE 1RD3B 1THRH 1XUJA 3SNAA 3DUXH 4NFEA 1RGQA 4X8SH 2A32A 3SUEA 3Q3YA 1EPTB 1NROH 1W0ZU 1O5CB 2GX4A 2AYWA 2V0BA 5JBBS 2ZU2A 1HAPH 2R3YA 2J9NA 4Q7XA 1Y3XA 5JPMH 1OSSA 1EP5A 3TNSA 2GD4B 7ESTE 1SFIA 1D3DB 1V6DA 4Y8YA 1ELGA 2PLXA 1VITH 2W7UA 2FOHA 2GP9B 2ODYB 3SJOA 1C1RA 4NA8A 2OD3B 4MQAA 4YOJA 4Y10E 1BBRE 1O2UA 3S9BA 1Z8RA 1TFXA 2FS8A 1UJ1A 1P11E 3DA9B 1QJ7B 4U30A 2BB4A 1MKXK 4ZKSU 1G2LA 1S84A 1AVGH 1H1BA 1LKBA 2HRVA 2BD2A 2O8LA 4GUXA 1T8NA 1GHBG 4FU7A 2EI7A 2GZ8A 1XUFA 4D8NA 3V13A 1OWHA 2ZC9H 1C5XB 4AGJA 1SOZA 3D23A 1HRTH 4Y0ZE 1EPTA 3C27B 2ZU3A 5DK1A 1IOEA 3GOVB 2WPJS 3P8FA 3QTVH 1EOJA 4ABAA 1DLKB 3A7WA 2XBXA 2AERH 1IQLA 1JXPA 4BAQB 5JB9S 1C1SA 1UO6A 2AS9A 4I33A 1K1OA 3I78A 1YPJH 5EOKA 5DO4H 1PPEE 1UVPA 2EI6A 2EI8A 1F5LA 1K1MA 1GI6A 1N1LA 1KIGH 3V7TA 1BTPA 3LGUA 2FI5E 1O36A 3RXFA 5LPEA 1EAIA 4DW2U 1QBNA 3SJIA 1O3HA 1TALA 1O2LA 3LONA 2HNTF 4XBBA 1OX1A 4ISHH 1KXAA 2AGEX 1O3FA 1UTMA 1C5OH 1QURH 2WINI 1HYLA 2LNCA 4Y76A 3EA7A 2BXUH 1GJAB 1O31A 4DY7B 2XWBI 2FOAA 3A84A 3GDVA 1XKAC 1W2KH 1YPEH 5C5OA 2ZO3H 1NFXA 2FZZA 3QO6A 2C8WB 1EPTC 1E34B 1ZTKA 1FY3A 4D76A 1Y3YA 2BQWB 5HXFA 1SGIB 1P06A 2ZDMA 2ZHWH 3M61U 1UTJA 4Y0YE 1YCPM 1ARCA 1GJ9B 4LZ4B 2ANMH 4XOJA 1QB6A 1E38B 3GDSA 1P2QA 1TA2A 1O32A 3LU9B 3TVJB 1UK4A 3PROA 1CHOF 2QCYA 4CR5A 3M3VA 1BJVA 1TAWA 1IQIA 1BIOA 1NM6A 1EASA 1AWHB 2ESTE 3A7XA 1JWTA 3RM2H 3ZZ7A 1LHDH 5F8ZA 1GDNA 1ZTJA 1TGTA 4Y71A 1SSXA 3T62A 5K7RA 2F9NA 1XXFA 2D1JA 3BEIB 2STBE 4AFSA 4MPUA 1WV7H 1PQ5A 2H6MA 3LT3A 4NSYA 2PTNA 4FU9A 4TPYA 1TQ0B 2FI4E 5T3HA 1OS8A 1ZHMA 3D62A 4AX9H 2H5DA 1BCUH 5E0JA 1B0EA 1QRZA 1WAYB 1N6XA 1HAXB 4K3JA 3BTDE 5AF9H 2PHBA 2TGDA 3M5MA 1GBTA 1C5PA 2R9PA 3ZVEA 5BPEA 1P3CA 1DITH 1OPHB 4I8GA 4UD9H 4FUJA 9ESTA 1GBKA 1GBBA 5C3NA 2XC5A 1MD8A 1S85A 1WSSH 1Y3WA 4ZXYH 3TK9A 3IITA 1QL7A 4JCNA 2BLOA 3O8DA 5F8TA 5DPAA 3ODFA 1SGQE 1SQTA 2ZFPH 5DP4A 5CMXH 3VB3A 1CT2E 1GJDB 1W7GH 2ALPA 3MNXA 3RXVA 1P2OA 2A4QA 1F0RA 2GVFA 1UTQA 2PGBB 1QBOA 2Y7ZA 4RSPA 3Q76A 3ZVAA 4ZH8A 3SU6A 1CT0E 3RC5A 4OS7A 3GY6A 3UUZA 1FLEE 2FEQH 1VZQH 1AHTH 4X6NA 5G4BA 3F1SB 2FIRH 3TNTA 3QK1A 2GKVE 1J16A 2BDBA 5C67A 2FOEA 4JYUH 3RXHA 3ZZ5A 3BF6H 3HK6B 3SW2B 2PR3A 1O2IA 1P57B 1C1MA 1ABIH 1D3QB 3LH1A 3HK3B 5EPYA 2B0FA 3M7QA 4JZFH 2NU0E 1SQAA 1ZJKA 4Y79A 1CGHA 2O8MA 3E90B 2BDAA 3GY8A 4MG3A 4I32A 1HJ9A 2OXSA 4IGDA 2QA9E 1C9PA 5B6OA 3PMHB 1OOKB 1BHXB 3H7OA 1OXGA 2BTCE 2STAE 3UOPA 4ABEA 3SN8A 2BOHB 3VEQB 2YNAA 1AN1E 4ABHA 4ISIH 1EKBB 2H9TH 2XBWA 1CT4E 1NRPH 2BVSH 2PSYA 2XCFA 2SGFE 1F7ZA 2ZTZA 2QGRA 2WV5A 1VCWA 4YTAA 1DX5M 1H8IH 2BVXH 4CBOA 4GCHG 1TNJA 1SR5C 5GCHF 2A1DB 3UNRA 4X1PU 1O2XA 5DGJA 1TX7A 3ZVFA 1TIOA 2ZF0H 3STJA 3VGCB 1P2IA 1CVWH 1P9UA 3FZDA 1GBEA 1C9TA 2B7DH 2GCHG 1TPOA 5CE1A 3SUFA 3TIUA 1KLIH 1MTNB 4GSOA 4LOYH 1TGSZ 1O33A 2ZDNA 1IAUA 5A2MH 4B71A 1RRKA 1UVTH 3L3TA 4WMFA 4BAKB 2WPHS 5DP9A 4IN1A 4X8VH 2AMQA 3GCNA 3K6ZA 1HAGE 4FUGA 4NIWA 4NZLA 4D9RA 1EZUC 3PTNA 1UK3A 3NZIA 4TWWA 1QRWA 1BRUP 4X2VA 1G2MA 3SU2A 1FXYA 1GBLA 1NT1A 1RXPA 4WMDA 5C5NA 3KF2A 2G81E 1MCVA 1PPGE 4H6TA 1C1NA 3RXJA 8GCHG 1GI7B 2FLBH 4B1TA 3OU0A 1BTHH 5EXMA 2ZHQH 4CRDA 1QBVH 5TCAA 1DXPA 1O2VA 4SGAE 3DHKH 1PFXC 1YYY1 2J92A 1J15A 2G5VA 3SNEA 3GCHB 3ZVBA 2QF0A 3ZZ3A 1BMAA 4YLUA 4BTIB 1O3AA 1O2RA 2VH0A 2VH6A 3EDXB 4CREA 3E8LA 4AORA 1UVSH 1V2PT 1ZYOA 3PWBA 2Z3CA 5EG4A 1C4U2 3T5FH 1ELDE 1PQ7A 4MNVA 1HV7A 1O2MA 2Q1JA 4ZKRU 1PYTD 5T6FA 1TA6A 3M35A 4TY7A 3SGQE 4A1VA 1SOTA 2ZTYA 3VXEH 3NPSA 3A81A 5JYIA 4DT7B 2CF9H 2OTVA 5HM2A 4AFUA 1C1QA 1BT7A 3P6ZB 1FDPA 1W7XH 3A83A 2P94A 1Z1IA 3MU5A 4VGCB 5GPIB 1FZZA 2ANWA 2A2QH 3HPTB 3BTHE 2I6QA 1SGDE 3VGCC 1CHGA 1SFQB 2AGIX 3A88A 5SGAE 3GY2A 4ISNA 1K1NA 2ZHDA 1MTNC 3M5OA 3LGTA 1JIMA 4CRAA 1RFNA 1SBWA 2C93B 4INLA 1ZHRA 3A8DA 4OGYA 3UOUA 1A61H 4U2WA 4PROA 1NU7B 1A46H 3GCTF 4OS1A 1SL3A 3ZZ6A 4ABIA 5CHAB 1FAKH 1P2NA 1NRSH 1PPZA 2BQ6B 4IBLH 4BAMB 3RC6A 3KQCA 4O3UA 2SGEE 1EP6A 1TNHA 1O3PB 4DIIH 1JIRA 3ATMA 3OY6U 7KMEH 1AKSB 2QIQA 1J8AA 1O37A 2P3UB 2ZA5A 3GCHC 3PMAB 2NU4E 5GXPA 3LGYA 4ABDA 1GMCG 4JZ1A 1EAUA 1Z6JH 4ISOA 2Z3EA 3Q3XA 1NRQH 1O2PA 5EW2H 1CBWB 3SI4H 1YPGH 3MH6A 3ZZAA 2YOLA 2SGAA 5DJ7A 1GI4A 3S9AA 1BTUA 4XBDA 3SU1A 4AYVB 2OLGA 3BG8A 3F6UH 1F92A 2HOBA 3RXOA 1KDQB 2A0QB 3GY5A 3SV7A 3ZZ8A 1Y5UT 2C4FH 3MU8A 1O2WA 2SGPE 2ZKSA 4AFZA 2J34A 1C1OA 4DURA 2VU8E 1AFEH 2A2XH 2HWLB 4RKJB 1V2LT 1RIWB 6GCHG 4MPVA 2ZFTA 4BTUB 3PLKA 4NWKA 4IW4E 1CO7E 2FOMB 4AB9A 5FXLA 4MNWA 1ETTH 1FPHH 1AI8H 1C2GA 4INHA 3M3SA 2XRCA 2SGQE 1S82A 4VGCC 1CGIE 3RXSA 4GVUA 2QXJA 1K1PA 2SNVA 4IS5A 1ABJH 2R3UA 1QFKH 1YLDA 1Y3UA 1H8DH 4DCDA 2CXVA 4NSVA 1JBUH 2IN2A 1UCYH 2QY0B 1YP9A 4WMEA 2BLQA 1V2VT 2FLRH 1LHFH 2JKHA 1IQNA 1VITF 4WXIA 1NFUA 1GMDF 2W7SA 1A1RA 3KGPA 3Q3KA 2RA3A 2Y7XA 3MH7A 4Z6AH 4BXWA 1ANCA 3VB5A 1KDQA 2BMGB 1DE7H 3ZYDA 2BD5A 3MH4A 1AFQB 2HALA 5CHAC 4BNRA 1GCTB 3BTEE 1P2MA 1O2QA 1Y5BT 1K1JA 4FU8A 2GZ7A 4YOGA 2BD7A 1SLUB 4MNXA 2JETB 1EX3A 3H5CB 2ZGXH 1MAYA 1XVMA 1AE8H 4ZMAH 3MU0A 4A92A 1A3EH 3RXUA 2O8TA 4AFQA 1O2HA 1ETRH 1FMGA 1SGEE 1UCYK 1LHGH 2ZECA 4A7IB 2XYAA 3FP6E 2Z9LA 1WU1A 2BHGA 4A1XA 5EXNA 1HAIH 5I25A 1CBWC 1C5VA 1NFWA 4K1EA 1A0LA 1HPGA 4IC6A 1GJ8B 1QQ4A 4A5TS 3TGIE 3FP7E 7GCHG 2CMYA 4B2BA 1IQMA 1TONA 2ZNKH 3T25A 2UWLA 3SUGA 4K1TA 1UVUH 2AEIH 1BRAA 3MYWA 1NC6A 3LH3A 1HAYB 3FAOA 1LTOA 3EQ0H 1RIWC 3SU5A 4NGAH 4GHTA 3SV6A 1NS3A 2GMTB 1XMNB 2FTMA 5GDSH 1GBAA 4FXGH 1MZDA 2VJ1A 1Z1JA 1F0SA 2BY6X 2AMDA 2FOFA 4IC5A 1TB6H 3LC3A 4KKDA 1BTWA 3A7TA 5ETXA 1TRMA 2RDLA 1GHYH 5A8XA 4OS2A 3TJUA 1TNLA 5LH8A 1UTNA 5JBAS 1O38A 4ABJA 1C2IA 4FUEA 1O3CA 3RMMH 1H9IE 3BSQA 1PPCE 3HATH 2F83A 3RMOH 3QN7A 1IQJA 1XX9A 1FPCH 3SBKA 2C8XB 1C2LA 1V2MT 1TPAE 2XCNA 4I8JA 3TU7H 3RXQA 3F9HA 1ESBA 1AFQC 2NU1E 3RXCA 1CA0B 4F49A 1GCTC 1VCPA 1EZQA 2XXLA 2CHAB 2Y6TA 1UTOA 4K69A 2JETC 8ESTE 1UK2A 2FWWA 5EQQA 4SGBE 1QCPA 1VGCB 2HPPH 3OY5U 4TYDA 2V3HH 1TNIA 2ANYA 1LHEH 3S7HB 1V3XA 1JMOH 1GHAF 1F0UA 2VVCA 3P92A 3TPIZ 4OS5A 1BUIA 3LGIA 3H7TA 2D2DA 3MI4A 2PGQB 3UFAA 2WYJA 3GYMA 4LZ1H 1HUTH 1ZRBA 1BMLA 1O3LA 4J2YB 4BANB 1ESAA 1S83A 4Z0KA 1GMDG 3UQOA 4KELA 1O5GH 1TLDA 2DE8A 1DUEA 2BLWA 2BQ7B 4Y8ZA 3R3GB 3BEFB 3FZZA 2H1UA 3RXRA 2GT7A 1GMHF 1QB1A 4O97A 5TCCA 1SG8B 1GI5A 1O0DH 2JH6D 3F9FA 3UNSA 4MDSA 1AB9B 1QGFA 1MKWH 1W0YH 4HZHA 1G3CA 4MLFB 1GI9B 1WQSA 2GMTC 1SGRE 2UWPA 1GPZA 1GJ7B 2F91A 1O3MA 3OX7U 1G3DA 4NG9H 1GI3A 3U8OH 3NXPA 3T27A 3TGJE 4BAHB 1HB0B 1GJ4H 3EAJA 2BM2A 3LIWA 1AU8A 1XUIA 4WVPE 1DLEA 2WPKS 1A0HB 3NK8A 1B0FA 1S0RA 1SQOA 3URDA 2EA3A 2QC2A 4HTCH 4KTSA 3SV8A 2AMPA 1MU6B 1A5GH 2ZWLH 2QF3A 4QT8C 2ZGCA 3RMLH 1RS0A 2BY9X 1T4VH 1GBFA 2R0LA 1ETSH 2BY8X 2WYGA 3RXKA 1MKWK 1V2NT 4X8TH 2F9OA 3ZV8A 1CA0C 3PMBB 3RLYH 3PYHA 2CHAC 1XKBC 5C2ZA 1LVMA 3QDZB 1XUHA 2W5EA 3KEEA 1DSTA 1UHBB 5FPYA 3VFEA 3RXAA 3U8TH 1E0FD 1P9SA 1D4PB 2ANKH 2IOTA 3ZZBA 1VGCC 1KXBA 1ELAA 2PUXB 5FX5A 2GCTB 3LGWA 1GI8B 3HKJB 1C5WB 1L1GA 2FMJA 4A6LA 3A8BA 3S9CA 1QA7A 4IMQA 1HXFH 3A80A 1ZGVA 3C1KA 3I29A 3DD2H 1G36A 1GVZA 2DUCA 1BBRH 3VXFH 4X2WA 1DWEH 1C4Y2 2ZIQH 2BLVA 3A86A 3SZNA 1GI2A 1TOMH 1YPHE 1Y59T 3TJVA 1HNEE 3A7VA 3MO6A 4UFFH 5L30H 4X1QU 1EJNA 1XXDA 1TGBA 1K21H 3FFGA 5J4SA 1TGNA 1T7CA 1ANBA 3QZRA 2CN0H 1AB9C 1BTZA 1HGTH 1GJ5H 2B8OH 4BOHA 1UHBA 2Q6FA 4YT7H 1LHCH 3WY8A 2ZTXA 4NA7A 1Z7KA 4ABFA 1INCA 1AZ8A 5DG6A 1FY5A 1ACBE 4K8YA 2GGVB 1H4WA 5DP7A 1FUJA
chains in the Genus database with same CATH superfamily
1BBRK 3TH2H 1GBMA 1KXFA 1DFPA 2FYRA 5H4IB 2J95A 2NU3E 1DANH 3ITIA 4LK4A 1HAHH 2BDGA 1HXEH 3RXIA 1FJSA 3UWIA 5IDKA 4ABBA 3OFND 5J4QA 3RP2A 1FY1A 2VIOA 1O5DH 2QF4A 5I46H 4AGKA 1S0QA 4Y6DA 4JZDH 1QRXA 4B75A 4FUIA 3F2GA 1WUNH 3SGBE 5FBEA 1MCTA 2A4RA 3HGPA 2NWNA 1KSNA 1ELCA 1DY8A 2A31A 2IJD1 4E7NA 1CHOG 1ID5H 1BQYA 2A7CA 1Y5AT 2GCTC 2QAAA 3QZQA 1X7AC 2AHME 5FBIA 3T26A 1EB1H 2ZP0H 1Q3XA 2PKSB 5HMAA 4IN2A 1HAZB 5IYTA 3SGAE 1ZOMA 4ZUHA 1BRBE 1P3EA 4ZHLU 3U69H 2ZFRH 2ZDLA 1IQGA 2KAIB 3SHCH 4DGJA 1NTPA 3P8OA 1W13U 1G9IE 1QA0A 2Z9KA 2ZU4A 1SVPA 2ZQ1A 4YESB 1YPMH 3ODDA 1LMWB 1OP2A 1LKAA 2F9UA 2WPIS 3SO3A 4AB8A 3CP7A 3MO3A 1S5SA 5AFYH 2JJ1D 1RTLA 1O3NA 1G32B 1PPFE 2BVRH 2HGTH 5LPRA 1BOQA 3PV4A 8LPRA 5GIBA 1B7XB 1YCPK 5E2OA 2OBQA 1MTWA 5DP6A 1YC0A 4YO9A 3O8RA 2Z9JA 1C5NH 1O2TA 2XC0A 3M5NA 1G37A 4UEHH 3TK5A 4XDEA 1L0ZA 5L2ZH 3ZVGA 1C5SA 3E0PB 2BDCA 3GICB 3EGKH 2P16A 2VIVA 3U8RH 2QXHA 3V0XA 3HKIB 1A3BH 4CRBA 4U32A 3OTJE 1V2KT 1MMJN 1A5HA 2KAIA 1AVWA 3T2NA 4NA9H 3NWUA 5L2YH 3MU1A 1NBME 1LVOA 2FX6A 2VWNA 1D6WA 1GGDB 1GHWH 2Y5GA 1TX6A 4KGAA 5CHBA 4INKA 2VIDA 3F9GA 1QL8A 1QB9A 4TWYA 2FOCA 2HLDD 1C5UA 2R2WU 3RXMA 2L74A 2PSXA 3M3TA 1O2KA 3BTME 1C1VH 2VGCB 1C5QA 3Q77A 4D7FA 1QY6A 3UNQA 1B5GH 1O3BA 1TMTH 1YKTA 2W6JD 1DOJA 1NO9H 2Z3DA 2J94A 2C3SA 1QL9A 2PKSC 1O5AB 2ZDVH 4MTBA 2B5TB 2OK5A 1WCZA 1K1IA 1ZZZA 1SMFE 1YPLH 1ZMJA 2P93A 2UUJB 1DWDH 1ORFA 2GDDA 4UE7H 3N7EA 1P05A 4D9QA 1YLNA 3KQ5A 1N6YA 1K2I1 4M7GA 3BIUH 1LQEA 3ELAH 2JH5D 5JBCS 1NZQH 2C8ZB 2FDAA 2M5TA 2QF5A 3P95A 3LJOA 5EJZA 2ALVA 3MH5A 1TE0A 2D8WA 2TRMA 2LPRA 4JYTA 1GJBB 3AAVA 2ZPQA 1PYTC 2ZPSA 3ESTA 4O03A 1YPKH 1UTKA 1T31A 5GCHG 2F3CE 1EJAA 3DT0H 1MH0A 5FPTA 1CQQA 4ZAEA 1G3EA 3F2HA 5A09A 2BX3A 2O8UA 4UFGH 4R8TB 3WWFA 1O34A 1L4ZA 1OWJA 1GVLA 1LO6A 1BHXF 2VIQA 4FUFA 1GHBF 1BRCE 4ZCNA 1IQHA 2QYIA 1MTVA 4X0WU 1P01A 1V2QT 3L33A 3VPKA 4ZKNU 5PTPA 1E36B 2QXGA 2A5AA 2G5NA 4E7RG 3PB1E 1S81A 4H6SB 3GY4A 2ZDAH 1GGDC 3UREA 1V2JT 3ATLA 1AQ7A 1GHXH 3RUOA 3RXBA 2BY7X 1M9UA 3URCA 2Y80A 3MFJA 2ZGBH 2TBSA 1AKSA 1FV9A 3BTWE 4DVAU 2HVXA 1KLTA 1ELFA 2B9LA 2ZFSA 3GY7A 1FY4A 2KCPA 3QGNB 2GT8A 3OSYA 3E6PH 5EW1H 1S6FA 3SU4A 3ZZ4A 3HGNA 1GJCB 1ZSKA 5TJXA 2VINA 1JRSA 2WUCA 1T32A 2VGCC 4JZIA 3AASA 1P12E 2OQ5A 1SPJA 2Z9GA 1OYQA 1CA8B 3V3MA 5LGOA 1NN6A 1GI0A 3AAUA 3MNBA 2ULLA 2BD3A 2ZZUH 2VB0A 1O3DA 1OWDA 6ESTA 2XNIA 1O5EH 1ZHPA 2RG3A 4BAOB 1O35A 5FX6A 4UFEH 3A7ZA 4CBNA 3SJ8A 2BZ6H 3MOCA 2QN5T 3T29A 1THSH 1V2ST 1ZR0A 4B76A 3MHWU 2FESH 3GISB 2G4TA 4I8LA 2P95A 4WJG2 2BDHA 1W3CA 3ZZ9A 4B2AA 4HGCA 1V2WT 2BD9A 3PRBA 4WXVA 1BTXA 3RU4T 1AD8H 4FVBA 3O8BA 2XBYA 3QGJA 1BDAA 4BTTB 1C2HA 1QJ1B 1O2GH 1TBZH 1DM4B 4AG1A 3AW1A 2A7JA 4X1NU 1EAXA 2FXRA 2FOGA 3D65E 5F6MA 2Z7FE 3FVFB 3SQEE 2GTBA 1LQDB 1C5YB 1IQEA 2FODA 2GV7A 2Q6DA 3E3TA 3RU4E 3RXEA 3LC5A 1ESTA 2PWXA 3SOSA 3U1IB 6LPRA 5C20A 2G4UA 1EJMA 3LPRA 2KM0A 1E35B 4FETA 1TABE 2KX4A 1MTUA 1S6HA 1A0JA 4K2YA 1FQ3A 4DG4A 5A8YA 2BOKA 2F4LA 2P59A 5JB8S 2GZ9A 3DCLA 3VB6A 2F9VA 2HNTC 3VG8A 3PM3A 2Y5FA 3GCTG 2UWOA 3AVZA 2QE7D 1DVAH 1LPGB 4NZQA 4FUCA 3RM0H 2NU2E 2C8YB 4TY6A 3ZYEA 2P8OB 2JIZD 1BA8B 2Z94A 2V3OH 3LGVA 3B9FH 4X6OA 1C5RA 1GVKB 2FP7B 3UTUH 1A4WH 4X1SU 3ZVCA 2ASUB 1K9OE 1O2NA 1K28D 2O9QA 4XE4A 4CHAB 1BITA 4KP0A 5C1YA 2AIPA 3PLBA 4Q7ZA 3KQDA 2J2UA 2SNWA 2CGAA 4Q7YA 3GDUA 1P8VC 1Y3VA 4DOQA 4OGXA 2XC4A 2ZCLP 3QTOH 4JYVH 1GL1A 4WWYA 4R0IA 2ZDKA 1F5RA 1KXDA 1W11U 1ZJDA 2KCAA 5EGMA 1ZSLA 2ZGJA 1CGJE 1SI5H 1YGCH 2R2MB 1V2TT 3EE0B 2WPDD 3SV9A 2ZU5A 1C2KA 5E2PA 4RN6A 1GBHA 1C1UH 3UR6A 1FONA 1C1TA 1V2UT 1W8BH 2FX4A 3UPEA 1C2EA 1EAWA 2BD8A 2A5KA 1Z8IB 1BZXE 4WF8A 2ZU1A 2PKAB 4UFDH 3M7TA 2A5IA 1SC8U 4OS4A 1TRNA 5E0HA 1WQVH 1C2DA 5HM9A 2WZQA 1L4DA 1ZPCA 3BEUA 2OC7A 1ZTLA 5A0BA 4ZHMU 1CE5A 4KTCA 1LCYA 1PPBH 2LP6A 2M2AA 2PUQH 3JZ2B 4H42U 4K8BA 4D7GA 1P0SH 1ANDA 2ZQ2A 1ANEA 1L2EA 3EYDA 3S7KB 3RLWH 1GHZA 4IMZA 4F4OC 1MZAA 3WW7A 3KQBA 1MBQA 1YBWA 4I8KA 3MNCA 1VITG 4I8HA 4Y7BA 1G30B 1GDUA 4E05H 3BTGE 4WH8A 3ENSB 3MNSA 3MWIU 2BD4A 3PO1B 8KME2 5DP8A 4JK6A 4GPGA 3K9XB 2YMSD 1AO5A 1DY9A 5DKMA 3TK6A 3BIVH 4CH2B 7LPRA 2ODPA 3PTBA 1FAXA 1ZMLA 4M9FA 2XTTB 3E16B 6CHAB 4LXBH 2PKAA 2P8OC 5GNDA 4U01A 2H9EH 3CENA 1OWEA 3S0NA 4J1YA 1KLJH 2H5CA 4P00A 3CS7A 1JRTA 4AYYB 4GCHF 3UQVA 2Y82A 4CHAC 3AK5A 3QUMP 2H2ZA 3W95A 3RXPA 4E06H 5DN6D 2PW8H 1P02A 3VB7A 1VKYA 1YM0A 2GCHF 1YLCA 4P02A 1HDTH 1A2CH 2J4IA 1IQKA 5C0TA 1MUEB 2VVUA 3SNCA 1QQUA 3ZVDA 4AOQA 5AVDA 4I7YH 3Q00A 1P10A 2F9BH 2L6OA 3E91A 1SLVB 2OC8A 2TGPZ 1XUKA 3FANA 4HFPB 1HJAB 1AIXH 1CSOE 3FP8E 1JOUB 1E1RD 1SGFG 1ELTA 3TJOA 2VWOA 2ZFFH 1WTGH 4NFFA 2SGDE 1V2OT 1TBQH 2OC1A 1SLXB 8GCHF 1TOCB 4B74A 2OQUA 2G51A 4Y8XA 3SQHE 4DJZB 3TLOA 1SKYE 1SLWB 1DXWA 3A82A 1EUFA 2AFQB 2ZHFH 4MPXA 3F3BA 1HAOH 3MTYA 1QJ6B 3MU4A 1AMHA 2AH4X 1GBIA 3U9AH 1EZXC 1O30A 1C2FA 1WBGB 5JDUB 2PTCE 3KL6A 1C2JA 1J14A 1ZRKA 5C1UA 2HLCA 1GG6B 2FOBA 3P17H 4FUBA 5F8XA 2K1QA 5LPFA 2UUKB 1AE5A 4HI3A 1HLTH 2WPLS 1BB0B 1D6RA 1ELEE 3A8AA 4O9VA 1TGCA 3N7OA 1E1QD 2TGAA 3ZZCA 1O2YA 1RJXB 5EXLA 1MBMA 1DWCH 4KTUA 3PO1C 1OP8A 3UIRA 4Y7AA 2TPIZ 3A87A 4XBCA 4K1SA 2WPMS 3LJJA 3B8JA 1LPKB 3PWCA 3U98H 1RTKA 3ATIA 1WTHD 3P8GA 3F9EA 2O8WA 2OC0A 1KXEA 5FCKA 6CHAC 2ZFQH 1QHRB 1T4UH 4B73A 1QR3E 2XWAA 1Z8JB 1EB2A 3P8NA 1DT2A 1TNKA 1ZSJA 2VNTA 3NRLA 3TITA 5ABWA 4NCYA 1O3OA 1YPHC 1Y8TA 2FM2A 1OKXA 4CR9A 2BYAX 5T1VA 5EODA 1NESE 4K60A 4UONA 2Q6GA 1HCGA 1T8MA 3QX5H 4GHQA 4Z1MD 2ZGHA 1ELBA 4X1RU 3MMGA 5C0UA 1Q2WA 2R0KA 1GHAG 4RKOB 1HIAB 3ATKA 1MQ5A 4X2XA 3R0FA 2OBOA 3NUMA 5HKKD 4CH8B 3BTFE 3K65B 4X2YA 4Y11E 3EA8A 4JK5A 1J9CH 1HJAC 1P03A 3RXGA 1NFYA 3LOXA 3K6YA 2UUFB 3DSOA 1C4V2 2ZHEH 3SYJA 1GMHG 1O2SA 5FPSA 4AN7A 2V6NA 2PFEA 3DFJA 2OUAA 3OYPA 1U6QA 1AUTC 5B6LA 3A8CA 1GBDA 5HGGA 1VJ9U 3GCOA 2KCYA 3SUDA 1O3JA 1P09A 2J5UA 1P2JA 2DE9A 1YCPH 5E0GA 2P3TB 1XM1A 3M7UA 4AZ2B 4ZKOU 1GCDA 1GMCF 5A0AE 3NKKA 1NU9A 4NIVA 1ZPBA 3KQEA 1NBMD 2Z6BD 4TPIZ 2P3FH 3PMJA 3STIA 3BN9A 1TPSA 2OP9A 3KIDU 2CF8H 3SHAH 5C1XA 1O3IA 9LPRA 1GG6C 1GBJA 1HIAA 4Q63A 1NY22 2FO9A 4ZROA 1PJPA 4FVDA 3LKWA 2J38A 5AHGH 4ESTE 4MPWA 1O5BB 1W10U 2EC9H 1SGNE 4ISLA 1AZZA 5EQSA 3EE7A 4GAWA 2JH0D 2VWMA 3F68H 1O2OA 1TX8A 3F0OA 3RDZA 3ZV9A 1C2MA 4Q2KA 5T6GA 3UWJH 1UTPA 1O39A 2ZG0H 3B23B 4BXSA 4ZHAA 1UCYE 2AGGX 3EA9A 1ELVA 3LDXH 1G3BA 3M36A 6GCHF 1ZLRA 3S69A 1IHTH 1QZ8A 2EEKA 2ODQA 1VCQA 2WUBA 3TGKE 3D49H 4ZXXH 3G01A 3K2UA 5BRRE 1F0TA 1GDQA 2VIPA 3VB4A 1IQFA 1DS2E 1AUJA 1P2KA 2W3KA 3PRDA 2ZPRA 2BXTH 2ZCHP 3QWCH 3IG6B 3GY3A 2XW9A 2KZ4A 5T6DA 2GV6A 1ARBA 1TNGA 2FYQA 1DUAA 5EU8A 3SJKA 3TJNA 5F03A 1GWAA 2VVVA 1D9IA 1L1JA 1C5ZB 5DP5A 3QLPH 1O5FH 1EQ9A 2ZCKP 4B6FA 1W14U 2XBVA 3ZZDA 2A4OA 2YNBA 5JBTA 1O3GA 4RT1A 1SHHB 1COWD 4YXWD 1H9HE 5A0CA 4CRFA 4Q80A 1ZPZA 1TWXB 1FIZA 5ESBA 4MVNA 2F9PA 1MD7A 3V12A 1VR1H 2GDEH 1GBCA 1YF4A 1AY6H 3GYLB 1C1WH 5DP3A 5L6NH 2TGTA 2ZI2H 4CRGA 2VIWA 5EQRA 3U1JB 3KNXA 1UTLM 2G52A 1C5LH 3DFLA 3SORA 1C5TA 4X8UH 3TH3H 1GJ6A 4THNH 1QNJA 1THPB 4CRCA 1ZMNA 2WHXA 2H9HA 1EXFA 2HPQH 5E8EH 3SNDA 1K0HA 3ATWA 3CS0A 3SV2H 1DSUA 1TPPA 1RTFB 1MQ6A 1GI1A 3A89A 3W94A 1LPZB 7GCHF 3BG4B 5GWZA 2VWLA 1TQ7B 1N8OB 2BZAA 1C5MD 1K22H 2V35A 1T8OA 4X6MA 5KECA 3A7YA 3M37A 4YM9A 1AWFH 1P04A 1WYKA 5EPNA 1UVOA 4DIHH 3UY9A 1SGFA 1BTYA 1IHSH 1L1NA 5HYOA 2SFAA 3OAAD 3O8CA 3RMNH 1K1LA 1PPHE 2TIOA 1GL0E 3BV9B 1SHYA 1HBTH 1F5KU 2RA0A 2ILNA 1T8LA 1CU1A 4NIYA 1FIWA 1SB1H 1J17T 5A8ZA 1FN8A 2A45B 1HJ8A 1NPMA 4AG2A 4YOIA 4GLYA 3KCGH 3E1XB 4NWLA 4ASHA 3RXLA 1O2ZA 1WOFA 1BJUA 3RXDA 1PQ8A 1KTTB 1TMUH 3KN2A 3F0PA 3BTTE 2QXIA 4I31A 4UDWH 1FN6A 1TBRH 1KXCA 5GJ4B 1EOLA 1NRRH 5AFZH 2EQNA 1OWKA 4JMYA 4XD7D 1EATA 2BY5X 1QTFA 3IWMA 2C90B 3I77A 2AIQA 3AW0A 3RU4D 1Z8GA 4X6PA 1OP0A 1FI8A 2BX4A 4WH6A 4YZUA 4WY3A 3PLPA 3MO9A 1DDJA 1LDTT 2FPZA 1OYTH 4YLQH 5EJ1A 1SGPE 1D3PB 2EY4C 4A1TA 1O3EA 2A4GA 4B2CA 3SU3A 1KYNA 4NIXA 3T28A 1EZSC 2A7HA 2OCVB 2G8TA 2FS9A 2IPHA 3KHVA 1W12U 2CJIA 4H4FA 1LVYA 5FL7D 4ABGA 2WV9A 3UR9A 3E0NB 1HFDA 3RC4A 3SNBA 1O3KA 3BTKE 1XVOA 1DWBH 2GJGA 2I6SA 1KTSB 4OS6A 3BTQE 1D3TB 1AGJA 2G00A 4JZEH 1HAVB 1Q31A 2BDYA 2IJOB 1AVXA 1FY8E 4XFQA 1SGTA 4O3TA 2Y5HA 2ZEBA 2D26C 3BG4C 2Y81A 2J97A 2W6ID 5FAHA 1H9LB 5FHTA 1E37B 4MNYA 3JZ1B 1FNIA 1TYNA 4FUHA 1PQAA 1V2RT 3SU0A 1N8OC 2BDIA 1Z71A 4FUDA 2WV4A 4XRNA 1OWIA 5FCRA 3SJ9A 4YT6H 1ZGIA 1BMMH 1S6LA 5KEDA 3TH4H 2CV3A 1VJAU 1F2SE 1MAXA 2OINA 2QV1A 2UUYA 1TRYA 2W26A 3A85A 4B6EA 2RCEA 1DICA 2FTLE 1XUGA 1A5IA 2G55A 3M5LA 4RI0A 1DPOA 1C1PA 4TSFD 1QIXB 3L6PA 5ESTE 3NCLA 1LVBA 1SGCA 3UB0A 4XSKU 3RXTA 1GHVH 2PV9B 1NRNH 1TMBH 1UMAH 1Z6EA 2Z9IA 2THFB 1MKXH 1A7SA 3ZIAD 1KY9A 2K0QA 5K0HA 2W3IA 4K5ZA 3SI3H 2FI3E 1MU8B 1BMNH 1SGYE 1OHHD 1HAVA 3P70B 1MTSA 1O2JA 2HNTE 1RD3B 1THRH 1XUJA 3SNAA 3DUXH 4NFEA 1RGQA 4X8SH 2A32A 3SUEA 3Q3YA 1EPTB 1NROH 1W0ZU 1O5CB 2GX4A 2AYWA 2V0BA 5JBBS 2ZU2A 1HAPH 2R3YA 2J9NA 4Q7XA 1Y3XA 5JPMH 1OSSA 1EP5A 3TNSA 2GD4B 7ESTE 1SFIA 1D3DB 1V6DA 4Y8YA 2V7QD 1ELGA 2PLXA 1VITH 2W7UA 2FOHA 2GP9B 2ODYB 3SJOA 1C1RA 4NA8A 2OD3B 4MQAA 4YOJA 4Y10E 1BBRE 1O2UA 3S9BA 1Z8RA 1TFXA 2FS8A 1UJ1A 1P11E 3DA9B 1QJ7B 4U30A 2BB4A 1MKXK 4ZKSU 1G2LA 1S84A 1AVGH 1H1BA 1LKBA 2HRVA 2BD2A 2O8LA 4GUXA 1T8NA 1GHBG 4FU7A 2EI7A 2GZ8A 1XUFA 4D8NA 3V13A 1OWHA 2ZC9H 1C5XB 4AGJA 1SOZA 3D23A 1HRTH 4Y0ZE 1EPTA 3C27B 2ZU3A 5DK1A 1WXRA 1IOEA 3GOVB 2WPJS 3P8FA 3QTVH 1EOJA 4ABAA 1DLKB 3A7WA 2XBXA 2AERH 1IQLA 1JXPA 4BAQB 5JB9S 1C1SA 1UO6A 2AS9A 4I33A 1K1OA 3I78A 1YPJH 5EOKA 5DO4H 1PPEE 1UVPA 2EI6A 2EI8A 1F5LA 1K1MA 3FKSD 1GI6A 1N1LA 2YMSB 1KIGH 3V7TA 1BTPA 3LGUA 2FI5E 2KFWA 1O36A 3RXFA 3DSGA 5LPEA 1EAIA 4DW2U 1QBNA 3SJIA 1O3HA 1TALA 1O2LA 3LONA 2HNTF 4XBBA 1OX1A 3SZEA 4ISHH 1KXAA 2HVYB 2AGEX 1O3FA 1UTMA 1C5OH 1QURH 2WINI 1HYLA 2LNCA 4Y76A 3EA7A 2BXUH 1GJAB 1O31A 4DY7B 2XWBI 2FOAA 3A84A 3GDVA 1XKAC 2JJ2D 1W2KH 1YPEH 5C5OA 2ZO3H 1NFXA 2FZZA 3QO6A 2C8WB 1EPTC 1E34B 1ZTKA 1FY3A 4D76A 1Y3YA 2BQWB 5HXFA 1SGIB 1P06A 2ZDMA 2ZHWH 3M61U 1UTJA 4Y0YE 1YCPM 1H8ED 1ARCA 1GJ9B 4LZ4B 2ANMH 4XOJA 1QB6A 1E38B 3GDSA 1P2QA 1TA2A 1O32A 3LU9B 3TVJB 1UK4A 3PROA 1CHOF 2QCYA 4CR5A 3M3VA 1BJVA 2RFKC 3OE7D 1TAWA 1IQIA 1BIOA 1NM6A 1EASA 1AWHB 2ESTE 3W1EA 3A7XA 1JWTA 3RM2H 3ZZ7A 1LHDH 5F8ZA 1GDNA 1ZTJA 1TGTA 4Y71A 5C94A 1SSXA 3T62A 5K7RA 2F9NA 1XXFA 2D1JA 3BEIB 2STBE 4AFSA 4MPUA 1WV7H 1PQ5A 1SQRA 2H6MA 3LT3A 4NSYA 2PTNA 4FU9A 4TPYA 1TQ0B 2FI4E 5T3HA 1OS8A 1ZHMA 3D62A 4AX9H 2H5DA 1BCUH 5E0JA 1B0EA 1QRZA 1WAYB 1N6XA 1HAXB 4K3JA 3BTDE 5HIZA 5AF9H 2PHBA 2TGDA 3M5MA 1GBTA 1C5PA 2R9PA 3ZVEA 2YMSC 5BPEA 1P3CA 1DITH 4OM9A 1OPHB 4I8GA 4UD9H 4FUJA 9ESTA 1GBKA 1GBBA 5C3NA 2XC5A 5DSFA 1MD8A 1S85A 1WSSH 1Y3WA 4ZXYH 3TK9A 3IITA 1QL7A 4JCNA 3GS9A 2BLOA 3O8DA 5F8TA 5DPAA 3CNRA 3ODFA 1SGQE 1SQTA 2ZFPH 5DP4A 2XOKD 3KYGA 5CMXH 3VB3A 1CT2E 1GJDB 1W7GH 2ALPA 3MNXA 3RXVA 1P2OA 2A4QA 1F0RA 2GVFA 1UTQA 2PGBB 1QBOA 2Y7ZA 4RSPA 3Q76A 3ZVAA 4ZH8A 3SU6A 1CT0E 3RC5A 4OS7A 2CK3D 3GY6A 3UUZA 1FLEE 2FEQH 3PV2A 1VZQH 1AHTH 4X6NA 2KCOA 5G4BA 3F1SB 2FIRH 3TNTA 3QK1A 2GKVE 1J16A 2BDBA 5C67A 2FOEA 4JYUH 3RXHA 3ZZ5A 3BF6H 3HK6B 3SW2B 2PR3A 1O2IA 1P57B 1C1MA 1ABIH 1D3QB 3LH1A 3HK3B 5EPYA 2B0FA 3M7QA 4JZFH 2NU0E 1SQAA 1ZJKA 4Y79A 1CGHA 2O8MA 3E90B 3KYFA 2BDAA 3GY8A 4MG3A 4I32A 1HJ9A 2OXSA 2WSSD 2QA9E 4IGDA 1C9PA 5B6OA 3PMHB 1OOKB 1BHXB 3H7OA 1OXGA 2BTCE 2STAE 3UOPA 4ABEA 5EIYA 3SN8A 2BOHB 3VEQB 2YNAA 1AN1E 4ABHA 4ISIH 1EKBB 2H9TH 2XBWA 1CT4E 1NRPH 2BVSH 2PSYA 2XCFA 2SGFE 1F7ZA 2ZTZA 2QGRA 2VBCA 1VCWA 2WV5A 4YTAA 1DX5M 1H8IH 2BVXH 4CBOA 4GCHG 1TNJA 1SR5C 5GCHF 2A1DB 3UNRA 4X1PU 1O2XA 5DGJA 1TX7A 3ZVFA 1TIOA 2ZF0H 3STJA 3VGCB 1P2IA 1CVWH 1P9UA 3FZDA 1GBEA 1C9TA 2B7DH 2GCHG 1TPOA 5CE1A 3SUFA 3TIUA 1KLIH 1MTNB 4GSOA 4LOYH 1TGSZ 1O33A 2ZDNA 1IAUA 5A2MH 4B71A 1RRKA 1UVTH 3L3TA 4WMFA 4BAKB 2WPHS 5DP9A 4IN1A 2RDEA 4X8VH 2AMQA 3GCNA 3K6ZA 1HAGE 4FUGA 4NIWA 4NZLA 4D9RA 1EZUC 3PTNA 1UK3A 1W0KD 3NZIA 4TWWA 1QRWA 1BRUP 4X2VA 1G2MA 3SU2A 1FXYA 1GBLA 1NT1A 1RXPA 4WMDA 5C5NA 3KF2A 2G81E 1MCVA 1PPGE 4H6TA 1C1NA 3RXJA 8GCHG 1GI7B 2FLBH 4B1TA 3OU0A 1BTHH 5EXMA 2ZHQH 4CRDA 1UW7A 1QBVH 5TCAA 1DXPA 1O2VA 4Q4LA 4SGAE 3DHKH 1PFXC 1YYY1 2J92A 1J15A 2G5VA 3SNEA 3GCHB 3ZVBA 2QF0A 3ZZ3A 1BMAA 4YLUA 4BTIB 1O3AA 5HIYA 1O2RA 2VH0A 2VH6A 3EDXB 4CREA 3E8LA 4AORA 1UVSH 1V2PT 1ZYOA 3PWBA 5C17A 2Z3CA 5EG4A 1C4U2 3T5FH 1ELDE 1PQ7A 4MNVA 1HV7A 1O2MA 2Q1JA 4ZKRU 1PYTD 5T6FA 1WDIA 1TA6A 3M35A 4TY7A 3SGQE 4A1VA 1SOTA 2ZTYA 3VXEH 3NPSA 3A81A 5KGOA 5JYIA 4DT7B 2CF9H 2OTVA 5HM2A 1W0JD 4AFUA 1C1QA 1BT7A 3P6ZB 1FDPA 1W7XH 3A83A 2P94A 1Z1IA 3MU5A 3N7DA 4VGCB 5GPIB 4ASUD 1FZZA 2ANWA 2A2QH 3HPTB 1E79D 4TT3D 3BTHE 2I6QA 1SGDE 3VGCC 1CHGA 1SFQB 2AGIX 3A88A 5SGAE 3GY2A 4ISNA 1K1NA 2ZHDA 1MTNC 3M5OA 3F2FA 1JIMA 3LGTA 1RFNA 1EFRD 4CRAA 1SBWA 2C93B 4INLA 1ZHRA 3A8DA 4OGYA 3UOUA 1A61H 4U2WA 4PROA 4ACBA 1NU7B 1A46H 3GCTF 4OS1A 1SL3A 3ZZ6A 4ABIA 5CHAB 1FAKH 1P2NA 1NRSH 1PPZA 2BQ6B 4FOUC 4IBLH 4BAMB 3RC6A 3KQCA 4O3UA 2SGEE 1EP6A 1TNHA 1O3PB 4DIIH 1JIRA 3ATMA 3OY6U 7KMEH 1AKSB 2QIQA 1J8AA 1O37A 2P3UB 2ZA5A 3GCHC 3PMAB 2NU4E 5GXPA 3LGYA 4ABDA 1GMCG 3FN8A 4JZ1A 1EAUA 3PV5A 1Z6JH 4ISOA 2Z3EA 3Q3XA 1NRQH 1O2PA 5EW2H 1CBWB 3SI4H 1YPGH 3MH6A 3ZZAA 2YOLA 2SGAA 2IPQX 5DJ7A 1GI4A 3S9AA 1BTUA 4XBDA 3SU1A 4AYVB 2OLGA 3BG8A 3F6UH 1F92A 1FX0B 2HOBA 3RXOA 1KDQB 2A0QB 3GY5A 3SV7A 3ZZ8A 1Y5UT 2C4FH 3OEHD 3MU8A 2V3MA 1O2WA 2SGPE 2ZKSA 1BMFD 4AFZA 2J34A 1C1OA 4DURA 2VU8E 1AFEH 2A2XH 2HWLB 4RKJB 1V2LT 1RIWB 6GCHG 4MPVA 2ZFTA 4BTUB 3PLKA 4NWKA 4IW4E 1CO7E 2FOMB 4AB9A 5FXLA 4MNWA 1ETTH 1FPHH 1AI8H 1C2GA 4INHA 3M3SA 2XRCA 2SGQE 1S82A 4VGCC 1CGIE 3RXSA 4GVUA 2QXJA 1K1PA 2SNVA 4IS5A 1ABJH 2R3UA 1QFKH 1YLDA 1Y3UA 1H8DH 4DCDA 2CXVA 4NSVA 1JBUH 2IN2A 1UCYH 2QY0B 1YP9A 4WMEA 2BLQA 1V2VT 2FLRH 1LHFH 2JKHA 1IQNA 3MQKC 1VITF 4WXIA 1NFUA 1GMDF 2W7SA 1A1RA 3KGPA 3Q3KA 2RA3A 2Y7XA 3MH7A 4Z6AH 4BXWA 1ANCA 3VB5A 1KDQA 2BMGB 1DE7H 3ZYDA 2BD5A 3MH4A 1AFQB 2HALA 5CHAC 4BNRA 1GCTB 3BTEE 1P2MA 1O2QA 1Y5BT 1K1JA 4FU8A 2GZ7A 4YOGA 2BD7A 1SLUB 4MNXA 2JETB 1EX3A 3H5CB 3H09A 2ZGXH 1MAYA 1XVMA 1AE8H 3UAIC 4ZMAH 3MU0A 4A92A 1A3EH 3RXUA 2O8TA 4AFQA 1O2HA 1ETRH 1FMGA 1SGEE 3WWBA 2XNDD 4AC9A 1UCYK 1LHGH 2ZECA 4A7IB 2XYAA 3FP6E 2Z9LA 1WU1A 2BHGA 4A1XA 5EXNA 1HAIH 5I25A 3FOAA 1CBWC 1C5VA 1NFWA 4K1EA 2F43B 1A0LA 1HPGA 4IC6A 1GJ8B 1YWUA 1QQ4A 4A5TS 3TGIE 3FP7E 7GCHG 4F55A 2CMYA 4B2BA 1IQMA 1TONA 2ZNKH 3T25A 2UWLA 3SUGA 4K1TA 1UVUH 2AEIH 1BRAA 3MYWA 1NC6A 3LH3A 1HAYB 3FAOA 1LTOA 3EQ0H 1RIWC 3SU5A 4NGAH 4GHTA 3SV6A 2PP6A 1NS3A 2GMTB 3OEED 1XMNB 5CDFE 2FTMA 5GDSH 1GBAA 4FXGH 1MZDA 2VJ1A 1Z1JA 1F0SA 2BY6X 2AMDA 2FOFA 4RT0A 4IC5A 1TB6H 3LC3A 4KKDA 1BTWA 3A7TA 5ETXA 1TRMA 2RDLA 1GHYH 5A8XA 4OS2A 3TJUA 1TNLA 5LH8A 1UTNA 5JBAS 1O38A 1H8HD 4ABJA 1C2IA 4FUEA 1O3CA 2JDID 3RMMH 1H9IE 3BSQA 1YY3A 4HG6A 1PPCE 3HATH 2F83A 3RMOH 3QN7A 1IQJA 3N99A 1XX9A 1FPCH 3SBKA 3OTPA 4ACAA 3FO8D 2C8XB 1C2LA 1V2MT 1TPAE 2XCNA 4I8JA 3TU7H 3RXQA 3DSPA 3F9HA 1ESBA 1AFQC 2NU1E 3RXCA 1CA0B 4F49A 1GCTC 1VCPA 1EZQA 2XXLA 2CHAB 1MABB 2Y6TA 1UTOA 4K69A 2JETC 8ESTE 1UK2A 2FWWA 5EQQA 4SGBE 1QCPA 1VGCB 2HPPH 3OY5U 4TYDA 2V3HH 1TNIA 2ANYA 1LHEH 3S7HB 2J98B 1V3XA 1JMOH 1GHAF 1F0UA 2VVCA 3P92A 3TPIZ 4OS5A 1BUIA 3LGIA 3H7TA 2D2DA 3MI4A 2PGQB 3UFAA 2WYJA 3GYMA 4LZ1H 1HUTH 1ZRBA 1BMLA 1O3LA 4J2YB 4BANB 1ESAA 1S83A 4Z0KA 1GMDG 3UQOA 4KELA 1O5GH 1TLDA 2DE8A 1DUEA 2BLWA 2BQ7B 4Y8ZA 3R3GB 3BEFB 3FZZA 2H1UA 3RXRA 2GT7A 1GMHF 2K8IA 5IK2D 1QB1A 4O97A 5TCCA 1SG8B 1GI5A 1O0DH 2JH6D 3F9FA 3UNSA 4MDSA 1AB9B 1QGFA 1MKWH 1W0YH 4HZHA 1G3CA 4MLFB 1GI9B 1WQSA 2GMTC 1SGRE 2KR7A 2UWPA 1GPZA 1GJ7B 2F91A 1O3MA 3OX7U 1G3DA 4NG9H 1GI3A 3U8OH 3NXPA 3T27A 3TGJE 4BAHB 1HB0B 1GJ4H 3EAJA 2BM2A 3LIWA 2J98A 5F53A 1AU8A 1XUIA 4WVPE 1DLEA 2WPKS 1A0HB 3NK8A 1B0FA 1S0RA 4F48B 1SQOA 3URDA 2EA3A 2QC2A 4HTCH 4KTSA 3SV8A 2AMPA 1MU6B 1A5GH 2ZWLH 2QF3A 4QT8C 2ZGCA 3RMLH 1RS0A 2BY9X 1T4VH 1GBFA 2R0LA 1ETSH 2BY8X 2WYGA 3RXKA 1MKWK 1V2NT 4X8TH 2F9OA 3ZV8A 1CA0C 3PMBB 3RLYH 1KMHB 3PYHA 2CHAC 1XKBC 5C2ZA 1LVMA 3QDZB 1XUHA 2W5EA 3KEEA 1DSTA 1UHBB 4DT4A 5FPYA 3VFEA 3RXAA 3U8TH 1E0FD 1P9SA 1D4PB 2ANKH 2IOTA 3ZZBA 1VGCC 1KXBA 1ELAA 2PUXB 5FX5A 2GCTB 3LGWA 1GI8B 3HKJB 1C5WB 1L1GA 2FMJA 4A6LA 3A8BA 3S9CA 1QA7A 4IMQA 1HXFH 3A80A 1ZGVA 3C1KA 3I29A 3DD2H 1G36A 1GVZA 2DUCA 1BBRH 3VXFH 4X2WA 1DWEH 1C4Y2 2ZIQH 2BLVA 3A86A 3SZNA 1GI2A 1TOMH 1YPHE 1Y59T 3TJVA 1HNEE 3A7VA 3MO6A 4UFFH 5L30H 4X1QU 1EJNA 1XXDA 1TGBA 1K21H 3FFGA 4I86A 5J4SA 1TGNA 1T7CA 1ANBA 3U28C 3QZRA 2CN0H 1AB9C 1BTZA 1HGTH 1GJ5H 2B8OH 4BOHA 1UHBA 2Q6FA 4YT7H 1LHCH 3WY8A 2ZTXA 4NA7A 1Z7KA 4ABFA 1INCA 1AZ8A 5DG6A 1FY5A 1ACBE 2LELA 4K8YA 5EJLA 2GGVB 1H4WA 5DP7A 1FUJA
chains in the Genus database with same CATH topology
1BBRK 3TH2H 1GBMA 1KXFA 1DFPA 2FYRA 5H4IB 2J95A 2NU3E 1DANH 3ITIA 4LK4A 1HAHH 2BDGA 1HXEH 3RXIA 1FJSA 3UWIA 5IDKA 4ABBA 5J4QA 3RP2A 1FY1A 2VIOA 1O5DH 5I46H 4AGKA 1S0QA 4Y6DA 4JZDH 1QRXA 4B75A 4FUIA 1WUNH 3SGBE 5FBEA 1MCTA 2A4RA 3HGPA 2NWNA 1KSNA 1ELCA 1DY8A 2A31A 4E7NA 1CHOG 1ID5H 1BQYA 2A7CA 1Y5AT 2GCTC 2QAAA 3QZQA 1X7AC 5FBIA 3T26A 1EB1H 2ZP0H 1Q3XA 2PKSB 5HMAA 4IN2A 1HAZB 5IYTA 3SGAE 1ZOMA 4ZUHA 1BRBE 1P3EA 4ZHLU 3U69H 2ZFRH 2ZDLA 1IQGA 2KAIB 3SHCH 4DGJA 1NTPA 3P8OA 1W13U 1G9IE 1QA0A 2Z9KA 2ZU4A 1SVPA 2ZQ1A 4YESB 1YPMH 3ODDA 1LMWB 1OP2A 1LKAA 2F9UA 2WPIS 3SO3A 4AB8A 3CP7A 3MO3A 1S5SA 5AFYH 1RTLA 1O3NA 1G32B 1PPFE 2BVRH 2HGTH 5LPRA 1BOQA 3PV4A 8LPRA 5GIBA 1B7XB 1YCPK 5E2OA 2OBQA 1MTWA 5DP6A 1YC0A 4YO9A 3O8RA 2Z9JA 1C5NH 1O2TA 2XC0A 3M5NA 1G37A 4UEHH 3TK5A 4XDEA 1L0ZA 5L2ZH 3ZVGA 1C5SA 3E0PB 2BDCA 3GICB 3EGKH 2P16A 2VIVA 3U8RH 2QXHA 3V0XA 3HKIB 1A3BH 4CRBA 4U32A 3OTJE 1V2KT 1MMJN 1A5HA 2KAIA 1AVWA 3T2NA 4NA9H 3NWUA 5L2YH 3MU1A 1LVOA 2FX6A 2VWNA 1D6WA 1GGDB 1GHWH 2Y5GA 1TX6A 4KGAA 4INKA 2VIDA 3F9GA 1QL8A 1QB9A 4TWYA 2FOCA 1C5UA 2R2WU 3RXMA 2PSXA 3M3TA 1O2KA 3BTME 1C1VH 2VGCB 1C5QA 3Q77A 4D7FA 1QY6A 3UNQA 1B5GH 1O3BA 1TMTH 1YKTA 1DOJA 1NO9H 2Z3DA 2J94A 2C3SA 1QL9A 2PKSC 1O5AB 2ZDVH 4MTBA 2B5TB 1WCZA 1K1IA 1ZZZA 1SMFE 1YPLH 1ZMJA 2P93A 2UUJB 1DWDH 1ORFA 2GDDA 4UE7H 1P05A 4D9QA 1N6YA 1K2I1 4M7GA 3BIUH 1LQEA 3ELAH 2JH5D 5JBCS 1NZQH 2C8ZB 2FDAA 2M5TA 3P95A 3LJOA 2ALVA 3MH5A 1TE0A 2D8WA 2TRMA 2LPRA 4JYTA 1GJBB 3AAVA 2ZPQA 1PYTC 2ZPSA 3ESTA 4O03A 1YPKH 1UTKA 1T31A 5GCHG 2F3CE 1EJAA 3DT0H 1MH0A 5FPTA 1CQQA 4ZAEA 1G3EA 5A09A 2BX3A 2O8UA 4UFGH 4R8TB 1O34A 1L4ZA 1OWJA 1GVLA 1LO6A 1BHXF 2VIQA 4FUFA 1GHBF 1BRCE 1IQHA 2QYIA 1MTVA 4X0WU 1P01A 1V2QT 3L33A 3VPKA 4ZKNU 5PTPA 1E36B 2QXGA 2A5AA 2G5NA 4E7RG 3PB1E 1S81A 4H6SB 3GY4A 2ZDAH 1GGDC 3UREA 1V2JT 3ATLA 1AQ7A 1GHXH 3RUOA 3RXBA 2BY7X 1M9UA 3URCA 2Y80A 3MFJA 2ZGBH 2TBSA 1AKSA 1FV9A 3BTWE 4DVAU 2HVXA 1KLTA 1ELFA 2B9LA 2ZFSA 3GY7A 1FY4A 3QGNB 2GT8A 3OSYA 3E6PH 5EW1H 1S6FA 3SU4A 3ZZ4A 3HGNA 1GJCB 1ZSKA 5TJXA 2VINA 1JRSA 2WUCA 1T32A 2VGCC 4JZIA 3AASA 1P12E 2OQ5A 1SPJA 2Z9GA 1OYQA 1CA8B 3V3MA 5LGOA 1NN6A 1GI0A 3AAUA 3MNBA 2ULLA 2BD3A 2ZZUH 2VB0A 1O3DA 1OWDA 6ESTA 2XNIA 1O5EH 1ZHPA 2RG3A 4BAOB 1O35A 5FX6A 4UFEH 3A7ZA 4CBNA 3SJ8A 2BZ6H 3MOCA 2QN5T 3T29A 1THSH 1V2ST 1ZR0A 4B76A 3MHWU 2FESH 3GISB 2G4TA 4I8LA 2P95A 4WJG2 2BDHA 1W3CA 3ZZ9A 4B2AA 4HGCA 1V2WT 2BD9A 4WXVA 1BTXA 3RU4T 1AD8H 4FVBA 3O8BA 2XBYA 3QGJA 1BDAA 4BTTB 1C2HA 1QJ1B 1O2GH 1TBZH 1DM4B 4AG1A 3AW1A 2A7JA 4X1NU 1EAXA 2FXRA 2FOGA 3D65E 5F6MA 2Z7FE 3FVFB 3SQEE 2GTBA 1LQDB 1C5YB 1IQEA 2FODA 2GV7A 2Q6DA 3E3TA 3RU4E 3RXEA 3LC5A 1ESTA 2PWXA 3SOSA 3U1IB 6LPRA 5C20A 2G4UA 1EJMA 3LPRA 1E35B 1TABE 1MTUA 1S6HA 1A0JA 4K2YA 1FQ3A 4DG4A 5A8YA 2BOKA 2P59A 5JB8S 2GZ9A 3VB6A 2F9VA 2HNTC 3PM3A 2Y5FA 3GCTG 2UWOA 3AVZA 1DVAH 1LPGB 4NZQA 4FUCA 3RM0H 2NU2E 2C8YB 4TY6A 3ZYEA 2P8OB 1BA8B 2Z94A 2V3OH 3LGVA 3B9FH 4X6OA 1C5RA 1GVKB 2FP7B 3UTUH 1A4WH 4X1SU 3ZVCA 2ASUB 1K9OE 1O2NA 1K28D 2O9QA 4XE4A 4CHAB 1BITA 4KP0A 5C1YA 2AIPA 3PLBA 4Q7ZA 3KQDA 2J2UA 2SNWA 2CGAA 4Q7YA 3GDUA 1P8VC 1Y3VA 4DOQA 4OGXA 2XC4A 2ZCLP 3QTOH 4JYVH 1GL1A 4WWYA 4R0IA 2ZDKA 1F5RA 1KXDA 1W11U 1ZJDA 5EGMA 1ZSLA 2ZGJA 1CGJE 1SI5H 1YGCH 2R2MB 1V2TT 3EE0B 3SV9A 2ZU5A 1C2KA 5E2PA 4RN6A 1GBHA 1C1UH 3UR6A 1FONA 1C1TA 1V2UT 1W8BH 2FX4A 3UPEA 1C2EA 1EAWA 2BD8A 2A5KA 1Z8IB 1BZXE 4WF8A 2ZU1A 2PKAB 4UFDH 3M7TA 2A5IA 1SC8U 4OS4A 1TRNA 5E0HA 1WQVH 1C2DA 5HM9A 1L4DA 1ZPCA 3BEUA 2OC7A 1ZTLA 5A0BA 4ZHMU 1CE5A 4KTCA 1LCYA 1PPBH 2PUQH 3JZ2B 4H42U 4K8BA 4D7GA 1P0SH 1ANDA 2ZQ2A 1ANEA 1L2EA 3EYDA 3S7KB 3RLWH 1GHZA 4IMZA 4F4OC 1MZAA 3KQBA 1MBQA 1YBWA 4I8KA 3MNCA 1VITG 4I8HA 4Y7BA 1G30B 1GDUA 4E05H 3BTGE 4WH8A 3ENSB 3MNSA 3MWIU 2BD4A 3PO1B 8KME2 5DP8A 4JK6A 4GPGA 3K9XB 1AO5A 1DY9A 5DKMA 3TK6A 3BIVH 4CH2B 7LPRA 2ODPA 3PTBA 1FAXA 1ZMLA 2XTTB 3E16B 6CHAB 4LXBH 2PKAA 2P8OC 4U01A 2H9EH 3CENA 1OWEA 3S0NA 4J1YA 1KLJH 2H5CA 3CS7A 1JRTA 4AYYB 4GCHF 3UQVA 2Y82A 4CHAC 3QUMP 2H2ZA 3W95A 3RXPA 4E06H 2PW8H 1P02A 3VB7A 1YM0A 2GCHF 1YLCA 1HDTH 1A2CH 2J4IA 1IQKA 1MUEB 2VVUA 3SNCA 1QQUA 3ZVDA 4AOQA 5AVDA 4I7YH 3Q00A 1P10A 2F9BH 3E91A 1SLVB 2OC8A 2TGPZ 1XUKA 3FANA 4HFPB 1HJAB 1AIXH 1CSOE 3FP8E 1JOUB 1SGFG 1ELTA 3TJOA 2VWOA 2ZFFH 1WTGH 4NFFA 2SGDE 1V2OT 1TBQH 2OC1A 1SLXB 8GCHF 1TOCB 4B74A 2OQUA 2G51A 4Y8XA 3SQHE 4DJZB 3TLOA 1SLWB 1DXWA 3A82A 1EUFA 2AFQB 2ZHFH 4MPXA 1HAOH 3MTYA 1QJ6B 3MU4A 1AMHA 2AH4X 1GBIA 3U9AH 1EZXC 1O30A 1C2FA 1WBGB 5JDUB 2PTCE 3KL6A 1C2JA 1J14A 1ZRKA 5C1UA 2HLCA 1GG6B 2FOBA 3P17H 4FUBA 5F8XA 2K1QA 5LPFA 2UUKB 1AE5A 4HI3A 1HLTH 2WPLS 1BB0B 1D6RA 1ELEE 3A8AA 4O9VA 1TGCA 3N7OA 2TGAA 3ZZCA 1O2YA 1RJXB 5EXLA 1MBMA 1DWCH 4KTUA 3PO1C 1OP8A 3UIRA 4Y7AA 2TPIZ 3A87A 4XBCA 4K1SA 2WPMS 3LJJA 3B8JA 1LPKB 3PWCA 3U98H 1RTKA 3ATIA 1WTHD 3P8GA 3F9EA 2O8WA 2OC0A 1KXEA 5FCKA 6CHAC 2ZFQH 1QHRB 1T4UH 4B73A 1QR3E 2XWAA 1Z8JB 1EB2A 3P8NA 1DT2A 1TNKA 1ZSJA 2VNTA 3TITA 5ABWA 4NCYA 1O3OA 1YPHC 1Y8TA 2FM2A 1OKXA 4CR9A 2BYAX 5EODA 1NESE 4K60A 4UONA 2Q6GA 1HCGA 1T8MA 3QX5H 4GHQA 2ZGHA 1ELBA 4X1RU 3MMGA 1Q2WA 2R0KA 1GHAG 4RKOB 1HIAB 3ATKA 1MQ5A 4X2XA 3R0FA 2OBOA 3NUMA 4CH8B 3BTFE 3K65B 4X2YA 4Y11E 3EA8A 4JK5A 1J9CH 1HJAC 1P03A 3RXGA 1NFYA 3LOXA 3K6YA 2UUFB 1C4V2 2ZHEH 1GMHG 1O2SA 5FPSA 4AN7A 2V6NA 2PFEA 3DFJA 2OUAA 3OYPA 1U6QA 1AUTC 3A8CA 1GBDA 5HGGA 1VJ9U 3GCOA 3SUDA 1O3JA 1P09A 1P2JA 2DE9A 1YCPH 5E0GA 2P3TB 1XM1A 3M7UA 4AZ2B 4ZKOU 1GCDA 1GMCF 5A0AE 3NKKA 1NU9A 4NIVA 1ZPBA 3KQEA 4TPIZ 2Z6BD 2P3FH 3PMJA 3STIA 3BN9A 1TPSA 2OP9A 3KIDU 2CF8H 3SHAH 5C1XA 1O3IA 9LPRA 1GG6C 1GBJA 1HIAA 1NY22 2FO9A 4ZROA 1PJPA 4FVDA 3LKWA 2J38A 5AHGH 4ESTE 4MPWA 1O5BB 1W10U 2EC9H 1SGNE 4ISLA 1AZZA 5EQSA 4GAWA 2JH0D 2VWMA 3F68H 1O2OA 1TX8A 3RDZA 3ZV9A 1C2MA 4Q2KA 5T6GA 3UWJH 1UTPA 1O39A 2ZG0H 3B23B 4BXSA 4ZHAA 1UCYE 2AGGX 3EA9A 1ELVA 3LDXH 1G3BA 3M36A 6GCHF 1ZLRA 3S69A 1IHTH 2EEKA 2ODQA 1VCQA 2WUBA 3TGKE 3D49H 4ZXXH 3G01A 3K2UA 5BRRE 1F0TA 1GDQA 2VIPA 3VB4A 1IQFA 1DS2E 1AUJA 1P2KA 2W3KA 2ZPRA 2BXTH 2ZCHP 3QWCH 3IG6B 3GY3A 2XW9A 5T6DA 2GV6A 1ARBA 1TNGA 2FYQA 1DUAA 5EU8A 3SJKA 3TJNA 5F03A 1GWAA 2VVVA 1D9IA 1L1JA 1C5ZB 5DP5A 3QLPH 1O5FH 1EQ9A 2ZCKP 1W14U 2XBVA 3ZZDA 2A4OA 2YNBA 5JBTA 1O3GA 1SHHB 1H9HE 5A0CA 4CRFA 4Q80A 1ZPZA 1TWXB 1FIZA 5ESBA 4MVNA 2F9PA 1MD7A 3V12A 1VR1H 2GDEH 1GBCA 1YF4A 1AY6H 3GYLB 1C1WH 5DP3A 5L6NH 2TGTA 2ZI2H 4CRGA 2VIWA 5EQRA 3U1JB 3KNXA 1UTLM 2G52A 1C5LH 3DFLA 3SORA 1C5TA 4X8UH 3TH3H 1GJ6A 4THNH 1QNJA 1THPB 4CRCA 1ZMNA 2H9HA 1EXFA 2HPQH 5E8EH 3SNDA 3ATWA 3CS0A 3SV2H 1DSUA 1TPPA 1RTFB 1MQ6A 1GI1A 3A89A 3W94A 1LPZB 7GCHF 3BG4B 5GWZA 2VWLA 1TQ7B 1N8OB 2BZAA 1C5MD 1K22H 2V35A 1T8OA 4X6MA 3A7YA 3M37A 4YM9A 1AWFH 1P04A 1WYKA 5EPNA 1UVOA 4DIHH 3UY9A 1SGFA 1BTYA 1IHSH 1L1NA 5HYOA 2SFAA 3O8CA 3RMNH 1K1LA 1PPHE 2TIOA 1GL0E 3BV9B 1SHYA 1HBTH 1F5KU 2RA0A 2ILNA 1T8LA 1CU1A 4NIYA 1FIWA 1SB1H 1J17T 5A8ZA 1FN8A 2A45B 1HJ8A 1NPMA 4AG2A 4YOIA 4GLYA 3KCGH 3E1XB 4NWLA 4ASHA 3RXLA 1O2ZA 1WOFA 1BJUA 3RXDA 1PQ8A 1KTTB 1TMUH 3KN2A 3BTTE 2QXIA 4I31A 4UDWH 1FN6A 1TBRH 1KXCA 5GJ4B 1EOLA 1NRRH 5AFZH 1OWKA 4JMYA 1EATA 2BY5X 1QTFA 3IWMA 2C90B 3I77A 2AIQA 3AW0A 3RU4D 1Z8GA 4X6PA 1OP0A 1FI8A 2BX4A 4WH6A 4YZUA 4WY3A 3PLPA 3MO9A 1DDJA 1LDTT 2FPZA 1OYTH 4YLQH 1SGPE 1D3PB 4A1TA 1O3EA 2A4GA 4B2CA 3SU3A 1KYNA 4NIXA 3T28A 1EZSC 2A7HA 2OCVB 2G8TA 2FS9A 2IPHA 3KHVA 1W12U 2CJIA 4H4FA 1LVYA 4ABGA 3UR9A 3E0NB 1HFDA 3RC4A 3SNBA 1O3KA 3BTKE 1XVOA 1DWBH 2I6SA 1KTSB 4OS6A 3BTQE 1D3TB 1AGJA 2G00A 4JZEH 1HAVB 1Q31A 2BDYA 2IJOB 1AVXA 1FY8E 4XFQA 1SGTA 4O3TA 2Y5HA 2ZEBA 2D26C 3BG4C 2Y81A 5FAHA 1H9LB 5FHTA 1E37B 4MNYA 3JZ1B 1FNIA 1TYNA 4FUHA 1PQAA 1V2RT 3SU0A 1N8OC 2BDIA 1Z71A 4FUDA 2WV4A 1OWIA 5FCRA 3SJ9A 4YT6H 1ZGIA 1BMMH 3TH4H 2CV3A 1VJAU 1F2SE 1MAXA 2OINA 2QV1A 2UUYA 1TRYA 2W26A 3A85A 2RCEA 1DICA 2FTLE 1XUGA 1A5IA 2G55A 3M5LA 1DPOA 1C1PA