1GBHA

Alpha-lytic protease with met 190 replaced by ala and gly 216 replaced by leu complex with methoxysuccinyl-ala-ala-pro-leucine boronic acid
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACAGRGDSGGSWITSAGQAQGVMSGLNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-LYTIC PROTEASE
publication title Kinetic and structural characterization of mutations of glycine 216 in alpha-lytic protease: a new target for engineering substrate specificity.
pubmed doi rcsb
source organism Lysobacter enzymogenes
molecule tags Hydrolase/hydrolase inhibitor
total genus 53
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1995-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gbhA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gbhA01
1A61H 1UTPA 3PO1B 4K5ZA 4UFEH 1UK3A 1DPOA 1CT2E 1T32A 2ZGCA 3PLPA 2THFB 4XOJA 4AFQA 3UPEA 3ZZ9A 1G32B 1O3IA 1TABE 4ABIA 2XTTB 2ZFRH 1MQ5A 1C5QA 3PB1E 5C5OA 2GT8A 3V0XA 4TY6A 4IS5A 2WV5A 3UQVA 1SOZA 3RXHA 2HRVA 5IDKA 2JKHA 1M9UA 3A7VA 2WPKS 4YOGA 2BX4A 4GVUA 1ELCA 2Q1JA 5E0JA 2GCTB 1MBQA 3QZQA 4ISHH 4KELA 2FX4A 1WU1A 3M5MA 3BTTE 3CS7A 1O3CA 2VH0A 1EAWA 2ZU1A 1KXEA 1MUEB 3TK6A 1HAXB 1L4ZA 1O2HA 3M7QA 4JZEH 2Y6TA 1UTMA 4NIYA 1LVYA 1YF4A 1LVMA 1ZGVA 4X2WA 2FODA 3F1SB 1OYQA 2QYIA 1N6YA 1C1PA 1YPKH 4K8YA 1ABJH 1L1GA 2Q6FA 1PPBH 3P92A 1W11U 2AERH 4H6TA 5C67A 1B0EA 1GDNA 1YCPM 4CRFA 2G4UA 3A7YA 5SGAE 1BRAA 1O2QA 4VGCB 1ELGA 4YM9A 1GJBB 1LKAA 3SOSA 1YPMH 1NS3A 2XXLA 1TRYA 3AAUA 1DY9A 3LGYA 1P04A 3RXAA 2ZCKP 4DT7B 1DANH 1QL9A 1WUNH 3HK3B 3V12A 1C2FA 3Q3YA 1ZRBA 3SI4H 2A2XH 4GLYA 1GVZA 6CHAC 1AFQC 1G2LA 5JBBS 2CN0H 2OC1A 1BTHH 1O30A 2PFEA 1E37B 2DE8A 3SUGA 1EB2A 3MO9A 1SR5C 1SC8U 3L3TA 4IMZA 5DK1A 1ELAA 3SNCA 1GI0A 2W3KA 2GV6A 2Y82A 4GAWA 3S7KB 1GBAA 1TFXA 1IQJA 3F9FA 5F6MA 3ZYDA 5EW2H 4ZAEA 1OYTH 2R9PA 1EZSC 4XDEA 3ITIA 4YTAA 2B8OH 1EATA 1TBZH 4JZFH 4INLA 5LPRA 4AYVB 3E6PH 1C5RA 5C1XA 1FXYA 1OWHA 1P2JA 1N8OC 5LH8A 3FP6E 4YT6H 2GMTB 3LC3A 2GVFA 1ZSJA 4MVNA 4GPGA 1C9PA 2R0LA 2ZDVH 1NPMA 3PMBB 3T5FH 1TMBH 1K2I1 2FTLE 5HMAA 1BJVA 5EG4A 3TJOA 2DE9A 4IN2A 1AU8A 3VXEH 3P70B 1YCPK 3MO3A 3ZZAA 2F9OA 3A89A 2C8YB 1GHAF 1ELDE 3A8DA 3EYDA 1W13U 2Y81A 1P02A 1BMAA 2XNIA 3KNXA 4B1TA 1FY4A 1C2LA 2Y5GA 2A4RA 1O5EH 4DJZB 5F8XA 2ZPQA 3A84A 1GMCF 2HNTC 1N1LA 3SHAH 1GVKB 2ZGXH 2RCEA 2BVSH 4RKOB 2ZF0H 3ZVGA 2PGQB 4A7IB 2EI7A 3NXPA 1TLDA 1QURH 1SSXA 3ATIA 9ESTA 4FUFA 4BAKB 1WSSH 1PPCE 2OBQA 2STAE 1HLTH 3E8LA 4Q80A 2P16A 1YP9A 2H6MA 3UOUA 1AE5A 5C1YA 1TMUH 3VGCB 4CH2B 2PKAB 1C2GA 3SUFA 1TE0A 3CS0A 1NU7B 3N7OA 2RDLA 2ILNA 1MTNC 2PUQH 2F9NA 3RU4E 1RIWB 3V3MA 1A2CH 4WXIA 4UD9H 4Y71A 2VIPA 1DLEA 4I8KA 3ATWA 1Q2WA 1AHTH 3QDZB 1CHOG 3TH4H 5CHAB 1GMDG 1IQLA 1OSSA 2ZDMA 4X1NU 1HPGA 3Q3XA 1XUFA 1O5CB 3A81A 1EQ9A 1SMFE 3LH1A 4K60A 4D8NA 4QT8C 3TH3H 1K28D 1F7ZA 1GHXH 1ESAA 2V0BA 3FANA 2SGEE 3LU9B 4KTUA 1WTHD 3NK8A 1TWXB 1YCPH 1JOUB 3TLOA 5AHGH 1TGBA 3EQ0H 1BUIA 3MYWA 1BMMH 4CHAB 1JIMA 3KN2A 1P8VC 2VVUA 3BTKE 1FJSA 1OWDA 3Q00A 1GBMA 2OC7A 1BOQA 1HBTH 4YT7H 1F2SE 3NWUA 3RC5A 7LPRA 4PROA 4A5TS 1TYNA 4I33A 3DA9B 1EUFA 1OS8A 3RC6A 1VJ9U 3RXCA 1BTPA 1OWIA 1PPEE 3RU4T 1QCPA 3F68H 4K2YA 3DFJA 1FY3A 1C5UA 1BBRK 1GMHF 3BG4C 1HAZB 3ZZCA 4AORA 3F9EA 3S9CA 1C1VH 2OUAA 3ATLA 4FUJA 1QA0A 1O3NA 2VU8E 2F9BH 4X8SH 5TJXA 1C2HA 1TNIA 2ZFTA 3TGKE 1P2NA 2P94A 2WPJS 4UFGH 3E91A 2ZU5A 1D3PB 1A3EH 1DFPA 3RXDA 2QV1A 2XBWA 4BANB 3EE0B 1HJ8A 1QL7A 2BVRH 3HKJB 4Z0KA 4X8VH 3TNSA 1HXEH 1GJDB 1Y59T 1HAIH 3GYMA 1THPB 3RM0H 4INHA 1NU9A 2ZECA 1XUKA 1O3AA 3GY5A 3P8GA 4BAOB 1B7XB 3O8CA 2Y7XA 2VWLA 3QK1A 1C1NA 1QB6A 3O8RA 4NWKA 1PPFE 4JZIA 2O8WA 4JZ1A 1O2SA 1P03A 3LJOA 5ABWA 1GJ5H 1LDTT 1DWCH 1AIXH 5JYIA 4UE7H 2HALA 3GY4A 2LPRA 1LTOA 1C5LH 2A2QH 1O5AB 1BBRH 2VGCC 3W94A 4BOHA 4XSKU 1EPTC 2QN5T 2UWLA 1FDPA 2AGIX 2Q6DA 1MZAA 4BTUB 1Z7KA 4NA8A 2BLVA 5GWZA 1YPEH 1LVBA 2XCFA 2A1DB 3A8AA 3KQBA 1G3DA 1EJNA 1SGFG 3ZZ4A 5GXPA 2NU4E 3D49H 1IQNA 1IHTH 1C2KA 1NESE 4X1RU 1Y3UA 1SGPE 3RXOA 1EP6A 3DHKH 1ZYOA 5EODA 5T3HA 2ZHDA 1C2JA 3LC5A 4AB8A 2FLRH 1DDJA 1FIWA 5ESBA 1C5OH 1GGDC 6CHAB 1NFYA 1AFQB 3PWCA 3ZZ8A 1LPZB 2Y5FA 1O5GH 4AFSA 5LGOA 1QR3E 5CE1A 5C20A 4LOYH 3MWIU 5A0AE 1MBMA 1ZRKA 2QXGA 1RTKA 3BTDE 1BHXB 4BAMB 2A7JA 2XC4A 2FS8A 1BRBE 1GHYH 4NIVA 3RDZA 1XKAC 2A5KA 2GKVE 1MKXK 1EAXA 3KEEA 1FUJA 1AVWA 4MLFB 4NSVA 2BY9X 1V2JT 4ABAA 1N8OB 1GI7B 1XX9A 2QXIA 4MPXA 2VIQA 4MG3A 2D2DA 4GHQA 1A5IA 3BTFE 1OWEA 2BM2A 1TPSA 1EPTA 3BIUH 4SGAE 1CGHA 4IC6A 2BD3A 1GDUA 2G8TA 3ZZ5A 1VJAU 3RXQA 2PHBA 1CO7E 4XFQA 4ZKRU 2KAIA 1CHOF 1HB0B 4FUIA 1ELBA 4RKJB 1ANBA 1GMDF 1THRH 3UOPA 1W8BH 1KLIH 1DOJA 2PKSC 2F3CE 4U2WA 5FBEA 1NZQH 3ZVBA 2ANKH 1BT7A 4R0IA 1L4DA 2GX4A 5FX6A 1B5GH 1FAXA 7GCHG 3SU4A 1GBIA 1C2EA 3GY6A 1O38A 1UK4A 3ZZBA 1GBBA 2XC0A 1A5GH 2EA3A 1L1NA 1TNLA 1ETSH 2FOHA 1UVPA 3ZVDA 4CBNA 1C5PA 4JZDH 3E16B 4JYVH 1WCZA 5A0CA 5A2MH 1A0HB 2WYJA 2ZDAH 4OS4A 1A5HA 1TONA 4ZMAH 1K1NA 5T6DA 1AE8H 1NRPH 1D6WA 3A85A 1ZPZA 1GPZA 2ZHQH 3FFGA 4GSOA 2PLXA 2BD7A 2ZGBH 2J2UA 2JH6D 5EXNA 1NRQH 1O2OA 2WUBA 2STBE 1BA8B 1KLTA 2BZ6H 3CP7A 2B9LA 1QBVH 1ZJDA 1XM1A 1CBWC 1O2RA 3EA7A 4OS6A 1MKXH 1RFNA 2OBOA 5A8YA 3RLWH 3SV6A 5E2OA 1SFIA 2QF3A 2BD4A 3SUDA 6ESTA 1MTNB 2C4FH 3P8FA 1C1WH 5DP7A 2ODPA 3SV9A 1Y5UT 1LPGB 2G00A 1OPHB 3LGIA 4FUCA 1MMJN 2ASUB 2H1UA 3NUMA 2W5EA 3PMHB 3MOCA 6GCHG 5GJ4B 4WY3A 5JDUB 1KTTB 5DP3A 2I6SA 5A8ZA 5EW1H 2FOGA 2EEKA 3A87A 2VWOA 3UY9A 2BDGA 4MNWA 1CSOE 1TPAE 1O35A 2ANWA 1KXAA 4TWWA 3FP8E 3A7XA 3HGPA 3AASA 2WYGA 1GI8B 4DVAU 5DG6A 3VEQB 2BX3A 1FV9A 2FX6A 2ZTYA 3QGNB 1JIRA 1YLCA 3I29A 1HYLA 1QJ6B 5T6FA 4X8TH 1UTOA 4DG4A 1K1OA 1RS0A 2VB0A 3LPRA 3HGNA 4E05H 1FPHH 2OXSA 2TIOA 2B5TB 3SV2H 1FONA 1AZ8A 1DLKB 1BZXE 1HRTH 1TBRH 2NU0E 1HAYB 1HUTH 3E1XB 1DXPA 4O3TA 3SJKA 3BTHE 3PMJA 1BMNH 1SLUB 4KKDA 4ZH8A 3RXTA 3ZYEA 4DY7B 1GI6A 4BAHB 4IN1A 3A8CA 3BG4B 1ETRH 4ABFA 5DO4H 2OINA 3MU4A 3PROA 1KTSB 2J95A 1Z8GA 3AW1A 1PJPA 4FUGA 1D3DB 1QBOA 3RXEA 3SJIA 5HM2A 1SQTA 2ZFFH 1FN8A 2F91A 1MAYA 4AYYB 1H8IH 2HVXA 2J92A 1TNJA 2OC8A 4H6SB 3OTJE 3SNEA 3EDXB 1QB1A 1O2ZA 1TGNA 2H5CA 5JB8S 2J4IA 3ESTA 4X6NA 1HJ9A 1GBTA 1FY8E 1IQIA 2QC2A 1C5TA 3STJA 4Q7YA 3S9BA 1JMOH 1LKBA 1W14U 4DW2U 1AKSA 4HFPB 1A3BH 1O32A 1SFQB 3PTNA 4D7FA 2TGPZ 1T8NA 5L2YH 3ODFA 1C1UH 3RXKA 2FS9A 7ESTE 1A0LA 1FNIA 2QXHA 3I78A 3DFLA 2R0KA 1O39A 1BDAA 3BEFB 1NM6A 3A83A 2O9QA 3KGPA 2CMYA 2AH4X 3SU2A 1KXBA 2ODYB 2WV4A 1O3GA 1S0RA 1F0TA 4AFZA 4XBDA 3M37A 1ZSKA 1OKXA 4HI3A 3HATH 2P59A 1IQEA 1WTGH 4A1XA 1O0DH 4MPUA 3GICB 1OP2A 2BDYA 3M7TA 1IQGA 1T8LA 1TOMH 1VGCC 5ETXA 1UK2A 2VGCB 2BY7X 2ANYA 2D26C 2BDIA 1O36A 2BHGA 1MTWA 1O33A 2BZAA 2G5NA 1EPTB 3TJVA 1TGTA 1C1MA 2OC0A 1GJ6A 1XKBC 5EPYA 1UVTH 1PYTC 5AFYH 1X7AC 2BTCE 3NZIA 2M5TA 3FZDA 3FAOA 2AIPA 1CA8B 2UUFB 2RG3A 1ELVA 1MCTA 4ZKSU 4BTTB 1C1RA 2BD8A 3ENSB 3DT0H 4A92A 2NU3E 5FPYA 2ZCHP 3RXRA 4ZUHA 2WUCA 3RXPA 2XBXA 2PW8H 3KF2A 1E38B 3M3SA 1QQUA 4BXWA 1PPZA 2OLGA 2CJIA 3M35A 4Y6DA 3QX5H 1GGDB 2ZDKA 7GCHF 2QXJA 2F9PA 3MNBA 1O2UA 1G3CA 1T8MA 5HGGA 3S9AA 2BMGB 1V2UT 2ZPSA 5TCAA 2H9EH 1DVAH 5C1UA 2QY0B 5A09A 4F4OC 1TGCA 5FHTA 4K69A 4H42U 4Y10E 2BDHA 1SLXB 3U98H 2D8WA 1EASA 1GHVH 1G3EA 1T4UH 1Z71A 3SO3A 1KDQA 4GHTA 4ZKOU 4WMEA 4ABDA 1V6DA 4GCHG 4JYUH 1IQHA 3RU4D 3ZVEA 4GUXA 5E2PA 1C9TA 1F92A 2F83A 4FVBA 4K1EA 5FPSA 2HOBA 1P2OA 1FAKH 1DE7H 1ZHRA 4B71A 1UHBA 4IC5A 1ANCA 3SNBA 2SGDE 4NSYA 4Y8ZA 5JB9S 1YC0A 4CREA 1PQAA 6GCHF 1ZGIA 3VPKA 2C93B 5TCCA 1O3PB 2VVCA 2PKSB 4X2VA 4MNVA 1TA6A 4O9VA 1LO6A 1GBEA 2FPZA 2ZG0H 4DGJA 2BYAX 3OSYA 3TITA 4Y8XA 3SGAE 1DSTA 3MNSA 4CRDA 3MU0A 1GDQA 2G55A 2JH0D 1J9CH 2VIDA 3E3TA 4SGBE 1TRNA 4UFFH 1YPJH 1KYNA 1O3LA 1GBKA 4FUDA 1Z6JH 1W3CA 2V3HH 5FCRA 3K6YA 4IW4E 1C1TA 1SPJA 4NFEA 2QCYA 2JH5D 1YKTA 3TIUA 3UNRA 5DP4A 1EZUC 3BTWE 2CF9H 2AMQA 3RXSA 1HGTH 1ZPBA 1AVXA 1H9IE 1CBWB 3A7ZA 3GY8A 1SLVB 1GJ4H 1YPHC 4MNXA 3UWJH 1E35B 2FOBA 4B2CA 1P2MA 5HM9A 3Q77A 1TX7A 2HPPH 3OY5U 3AAVA 4OS2A 4ZKNU 1BRCE 1AVGH 4DIHH 1O3OA 5ESTE 1Y8TA 1TPOA 2QA9E 5EOKA 2Z94A 1C2MA 1AKSB 2VVVA 1OOKB 1TX8A 1LHGH 2GT7A 1GI3A 2VNTA 1EB1H 5PTPA 2BDAA 2TBSA 2BDCA 1WQSA 4B75A 3M5LA 1V2MT 2ZU2A 1GHBG 1MZDA 3QLPH 3VB3A 1C5MD 3UFAA 1O2MA 3LH3A 3C27B 1F0SA 1TALA 3GCHC 4B73A 1H9LB 4KTSA 1LVOA 1O2TA 1XUGA 3LONA 2A4OA 1GBFA 1GI1A 3L6PA 1T7CA 5FX5A 5JBAS 1QA7A 1JXPA 4NA9H 3BTME 1ZTJA 1Z6EA 1RJXB 4A1TA 3SW2B 2IN2A 4AOQA 2AIQA 1SQOA 2BQ6B 2H9HA 5E8EH 1HDTH 1Y3WA 4U01A 4NIWA 5G4BA 2Y7ZA 4YOIA 1S85A 1TB6H 4TY7A 4WWYA 1EJAA 1V3XA 2OP9A 5F8TA 3V7TA 3ELAH 3ZVFA 1VITG 2FDAA 3ZVCA 4LXBH 2HNTE 1ANDA 1H9HE 1A7SA 2GDDA 3KL6A 3A88A 1CQQA 3SV7A 3H5CB 4AZ2B 4AB9A 1YM0A 1P0SH 1RD3B 5DPAA 3SUEA 4O3UA 4XE4A 2NWNA 2R3UA 2VH6A 1P2QA 1K21H 1QHRB 2ZGJA 1B0FA 1P11E 3TGIE 4ISNA 1TNKA 2UWPA 3ATKA 4CH8B 2C90B 1RTFB 7KMEH 1Y5AT 3U8TH 1T8OA 2ZQ2A 2FI3E 5C2ZA 3MH5A 4NA7A 1MD8A 1XVOA 1O2WA 1CGIE 2ZCLP 2BD5A 1TGSZ 1ID5H 4OS1A 1V2PT 1CE5A 1G36A 1SLWB 3UQOA 5K7RA 1J8AA 1UTKA 3QTVH 1O5DH 4ABGA 4ISOA 3MFJA 1GVLA 5JPMH 2AMPA 4K1SA 1GG6C 1AY6H 1OP0A 1NFWA 4U32A 2FOFA 1O3KA 1WQVH 5I25A 1VGCB 1NFXA 2B7DH 3GDSA 3K65B 1L0ZA 1O2IA 2AYWA 1UHBB 1G9IE 3UNQA 1H1BA 3BEIB 4GCHF 2A32A 3HK6B 1W0YH 1GWAA 5E0HA 3PM3A 1QRXA 1CGJE 3U1IB 3G01A 1LHFH 1NTPA 4WH8A 1BRUP 3ZV9A 1AWHB 1GI2A 2FIRH 1AB9C 1FIZA 3KQDA 2ULLA 1QTFA 2J38A 1K1JA 4YZUA 1P3CA 2BXUH 2ZHWH 1MTVA 3URCA 2G4TA 3A80A 8LPRA 1KXFA 3EA8A 5BPEA 3STIA 1KXCA 1QJ1B 1Z8IB 3BEUA 4TPIZ 2W3IA 4NG9H 5EU8A 3M5NA 4JMYA 5B6OA 1S5SA 3OU0A 1HNEE 1ACBE 1UTJA 3Q76A 1ZZZA 3RP2A 3K6ZA 1BTWA 4AG1A 1WBGB 3RXVA 4M7GA 5L30H 3KHVA 2WPHS 1BIOA 1C5ZB 1ZPCA 1BBRE 4FXGH 1W10U 4DOQA 3L33A 2W26A 3RMNH 1UVSH 1GBJA 2ZTXA 2G5VA 4KGAA 1FLEE 2TGAA 1J17T 2G52A 3VFEA 2FOCA 1RXPA 1G30B 5EQSA 1AUTC 3U69H 4AN7A 5T6GA 1MD7A 1CA0C 1TNHA 2XBYA 1O34A 3OYPA 5FXLA 2ALVA 3EAJA 2A31A 1JRSA 6LPRA 3A82A 2WPLS 2P3FH 4JYTA 1Y3VA 2ZHEH 2OCVB 2ZDLA 2ZKSA 2P3TB 4HZHA 1MTSA 4XBBA 1MKWK 4Q7XA 3BN9A 1GHBF 1CT4E 3OY6U 3SV8A 1DITH 2ZFSA 3KQCA 1NRRH 2XWBI 1AI8H 3H7OA 1DY8A 3SJ8A 1LPKB 3ATMA 1NY22 4X8UH 1Y3XA 2Z3CA 3MTYA 1O2KA 4X1SU 3GISB 2ZC9H 2Z9KA 4K1TA 1UCYE 2HGTH 3UWIA 1HV7A 1QGFA 2BDBA 3E0PB 1HJAC 3PYHA 4OGYA 3SI3H 3U8RH 4DURA 3GYLB 1J16A 3UREA 1RTLA 1S82A 4WMFA 2HWLB 1Y3YA 3RXLA 1O2XA 1FZZA 1SGQE 1EZQA 3GDVA 4ISIH 2XW9A 4AGJA 1AD8H 4FU8A 2HPQH 1EXFA 1GHZA 1BHXF 1TAWA 4X2XA 3SJOA 4K3JA 3ZZDA 5DKMA 2FOMB 1ZR0A 2QGRA 1KIGH 3MH4A 3VB5A 1J14A 1SGIB 1A0JA 2ZP0H 1GI5A 2AMDA 4A1VA 1VITF 3PWBA 1EX3A 2YNAA 1P12E 4IBLH 2ZIQH 2BD9A 5H4IB 4NCYA 4Y79A 1TA2A 4Y8YA 3TJUA 1UTQA 3P8OA 2FXRA 2ZTZA 3RC4A 3BTEE 5DGJA 2ZGHA 1YBWA 3T29A 3I77A 1XXDA 2VIOA 4UDWH 4LZ4B 3TK5A 1O5FH 2A4QA 1O3MA 5J4QA 2SNWA 3GY3A 1E34B 1MKWH 5LPEA 2AS9A 1RIWC 2TGTA 1YGCH 3GCHB 2FI4E 3T62A 5CHAC 4O97A 1EKBB 2Z3DA 1C4U2 3EA9A 1C5NH 1G37A 4KP0A 1KSNA 1V2WT 1BTZA 3ZZ7A 4ZXYH 2ALPA 3P95A 5C3NA 1UMAH 1SGRE 1GL1A 3P6ZB 3SGBE 3DD2H 4KTCA 2HNTF 4WJG2 2ZFPH 2FLBH 1P3EA 3ODDA 2WPIS 3A86A 1AUJA 1OWKA 2FOAA 2GTBA 4THNH 1NT1A 3TU7H 3C1KA 3M7UA 2H9TH 5DP8A 3RXUA 2CF8H 3VB4A 3FP7E 3URDA 2G81E 2Y80A 3SQEE 2ZU4A 1TPPA 1OXGA 3RUOA 5IYTA 3F6UH 5EXMA 1XUJA 5K0HA 5GCHG 4X1QU 2VIVA 3AW0A 1SGTA 5AFZH 1INCA 3PLBA 3PV4A 3T25A 2ZHFH 2UUKB 1GJ9B 1TBQH 3F9GA 2A7CA 2CGAA 4CR5A 1SHHB 3S7HB 1LHDH 2Q6GA 1QL8A 2PKAA 1DICA 1MU6B 1O2YA 2BVXH 4BNRA 1BJUA 2A4GA 2GZ9A 1ZTLA 4MNYA 1YPGH 1ZHMA 1EOLA 3RXFA 3RMMH 5GIBA 3TK9A 1GG6B 3MI4A 2JETC 4YESB 5CMXH 2QIQA 2UUYA 1FMGA 4I8GA 1D6RA 5DP6A 3GCTG 2VWNA 1V2OT 1ZOMA 1ZMLA 1F0RA 1PQ5A 4Y76A 1AQ7A 2Z9JA 2GZ7A 1O5BB 1NO9H 3RXJA 1QQ4A 2W7UA 3RXGA 2BOHB 1AB9B 4MPVA 1P57B 4WH6A 3BIVH 1HXFH 2KAIB 2H2ZA 2EI8A 2R3YA 1BTXA 2P8OC 2ZU3A 3A7WA 4WMDA 2PWXA 1GL0E 1G3BA 1V2TT 3QTOH 1Y5BT 4BXSA 4I32A 3MU1A 3E0NB 1Z1IA 1GMHG 5DP5A 1F0UA 1PYTD 4WXVA 1AMHA 1PPGE 2GCHG 3K9XB 4TWYA 4NGAH 1D3QB 2FZZA 1O3DA 1LHCH 2BLQA 2FTMA 2ANMH 1SQAA 1ZMJA 2FM2A 1HFDA 2SGQE 5EXLA 1GJAB 4CRCA 4J2YB 1GI9B 1ZTKA 2R2MB 1KLJH 2BOKA 1QRZA 2A5IA 5GDSH 3LGWA 5E0GA 4ZXXH 2F9UA 2GP9B 4R8TB 3F9HA 1MCVA 1MH0A 4NZQA 5GPIB 3A7TA 3JZ2B 1IQFA 1O37A 1V2NT 1XXFA 1IHSH 3T27A 4HTCH 1IQMA 1FN6A 2BY8X 1P2IA 3SNAA 2P95A 1D4PB 2PTNA 1CA0B 1DWDH 2XRCA 1ZLRA 1UJ1A 1HCGA 2BY5X 2VIWA 2V35A 3BG8A 5L6NH 1GCTC 1QFKH 1H8DH 3KIDU 5FAHA 1TQ7B 3NCLA 5FPTA 1O3FA 4B2BA 3FZZA 1N6XA 1SOTA 5FCKA 2FP7B 2Z6BD 1SGNE 2LNCA 2SGPE 3P8NA 4LZ1H 2BD2A 2OTVA 5EQRA 1GJCB 4E7RG 1TRMA 2GGVB 1HAHH 1TNGA 2O8UA 1P9SA 2ZZUH 2FWWA 5DJ7A 2EI6A 2A0QB 2O8TA 2TPIZ 2XC5A 1DUEA 4MQAA 2BQWB 5A0BA 3CENA 1QRWA 1Q3XA 3RMOH 3D23A 1HJAB 5HYOA 5F03A 1PQ7A 1O2GH 3SBKA 3GDUA 1Q31A 1V2ST 3M36A 1TIOA 2CHAC 2W7SA 2Y5HA 4RN6A 2BLWA 2FYQA 1VCPA 1VR1H 3QWCH 1VITH 4D9RA 3RXMA 4X1PU 5BRRE 4WVPE 3BSQA 1KY9A 2YNBA 2FEQH 1SG8B 1UTLM 4JK6A 4YLUA 4OGXA 1TQ0B 2GZ8A 4I8LA 1PPHE 3SZNA 1S81A 4Y7BA 1O3BA 2ZNKH 3QZRA 1P09A 2A7HA 3TGJE 3RM2H 1QBNA 1HAVA 4F49A 1IQKA 1BITA 3LDXH 2V3OH 4IGDA 4TYDA 1C1OA 2ODQA 3UIRA 2O8MA 3PLKA 3UTUH 4YLQH 5GCHF 1Z1JA 3QUMP 4NIXA 2PSYA 1UO6A 1EJMA 1BCUH 4LK4A 8GCHG 3TNTA 2PGBB 3B23B 4HGCA 2ESTE 4BTIB 1U6QA 2BXTH 2FESH 1OX1A 2ZI2H 1MU8B 4D9QA 3PMAB 3K2UA 1GBLA 3SORA 1AFEH 2BLOA 2J34A 3MU5A 1F5RA 4AG2A 2PSXA 1QIXB 1WV7H 2FOEA 1O3HA 1VZQH 2IPHA 1C1QA 1DT2A 1ETTH 1GHWH 3SGQE 1ELFA 1FI8A 3A8BA 4RSPA 5FBIA 1C2IA 1HAGE 2IOTA 2XCNA 1O3JA 2VWMA 3KQEA 4B74A 1W7GH 1UVOA 3H7TA 3ZVAA 1CT0E 3TVJB 4CRBA 1AZZA 2SFAA 1P9UA 3O8BA 1P01A 3GCTF 2FI5E 1ARBA 1THSH 2SGFE 3IWMA 4TPYA 1Z8RA 1OP8A 4FUHA 3T2NA 2SNVA 4ZHAA 2F9VA 2R2WU 4I8JA 4ABEA 1S6FA 4B76A 1CVWH 1SBWA 1XVMA 4FU9A 4YO9A 1MAXA 4U30A 1FPCH 4O03A 5L2ZH 3MH7A 1FQ3A 4WF8A 1W7XH 4CBOA 1NFUA 2VJ1A 1O2JA 2UUJB 3D65E 1C5WB 3MMGA 3UUZA 1BMLA 1BQYA 3QGJA 1YPHE 3BTGE 2GCHF 4ESTE 4Y11E 2GV7A 2OQUA 3U9AH 1Z8JB 2C3SA 4K8BA 3IG6B 1BB0B 1SGFA 1C5XB 1LQEA 3UNSA 4E7NA 1P06A 5EGMA 4B2AA 4UONA 1SGDE 1V2VT 3TH2H 3GCNA 1JRTA 5HXFA 3PO1C 4ISLA 3JZ1B 3U1JB 1KDQB 2AGEX 1ZHPA 2JETB 3Q3KA 3LGUA 3M3TA 3QO6A 3OX7U 8KME2 1CU1A 1W12U 4ASHA 1EOJA 1CHGA 4FUBA 3O8DA 1NN6A 4X6MA 1DM4B 1C1SA 5EPNA 2ZDNA 1O2NA 2Z3EA 4UEHH 1EP5A 3SHCH 4MTBA 1SI5H 3UR6A 4I7YH 3B9FH 4X0WU 2EC9H 2P8OB 3TPIZ 4Q2KA 1HAPH 2GCTC 1O2VA 1GBCA 3ZZ6A 2ZA5A 2QAAA 1DS2E 1L2EA 1V2QT 4Y0YE 1UCYK 1FY5A 1HIAA 1UTNA 1D3TB 3ZZ3A 2C8WB 3E90B 3GY2A 2YOLA 2O8LA 1D9IA 1FY1A 8ESTE 1ZSLA 3VB6A 1S84A 2Z9IA 2ZQ1A 4X6OA 4XBCA 4Q7ZA 4CRGA 5F8ZA 2ZEBA 4ABJA 2D1JA 3DUXH 3SU1A 3SU3A 1YPLH 3GY7A 3PTBA 1ELEE 1JWTA 4CR9A 1IAUA 2PTCE 3HKIB 3M5OA 4VGCC 1QJ7B 1LCYA 2XYAA 1VCWA 2CXVA 4FU7A 4A6LA 3LJJA 2G51A 4MPWA 1ANEA 1ARCA 2H5DA 3IITA 1ORFA 1O2PA 3HPTB 5LPFA 1ZMNA 1RGQA 1EZXC 1JBUH 1P10A 3T28A 3RXBA 1DWBH 1XUIA 2TRMA 1HAVB 4Z6AH 2I6QA 3LKWA 1GCTB 2VINA 4D76A 2SGAA 1K9OE 3S69A 3GOVB 5C5NA 1T4VH 2P93A 2ZWLH 4NWLA 3W95A 1DX5M 1ESBA 1K1LA 1UCYH 1V2RT 4BAQB 4DCDA 2A45B 4CRAA 3LGTA 3SU5A 3RXIA 1AN1E 3EGKH 1SGYE 4AFUA 2XBVA 8GCHF 2XWAA 1BTYA 3LOXA 3R3GB 3MNXA 1S0QA 5AVDA 4INKA 2WINI 1EAIA 4DIIH 1DUAA 1SB1H 4I31A 1K1PA 1NC6A 3MO6A 2NU1E 2AEIH 1O2LA 4E06H 4FVDA 1GBDA 2GMTC 5AF9H 2FO9A 3M61U 4ABHA 4ZROA 1DWEH 1QNJA 2ZPRA 3BV9B 4OS7A 3D62A 1K1MA 3P17H 2RA0A 1W0ZU 3AVZA 2UWOA 4UFDH 1GBHA 1TX6A 2CHAB 3T26A 1L1JA 1OWJA 4ABBA 1E0FD 2P3UB 1WYKA 1AGJA 4D7GA 4JCNA 1QY6A 1H4WA 3SJ9A 4AX9H 1T31A 3GCOA 2OD3B 1XUHA 2HLCA 4IMQA 3LIWA 1NRNH 1O31A 1GJ8B 2ZFQH 1LQDB 1DSUA 1RRKA 5JBCS 3MU8A 1KXDA 5JBTA 4NZLA 1J15A 1HAOH 1NROH 1C5SA 2CV3A 1A1RA 1S6HA 3SU0A 3NKKA 4Y7AA 2NU2E 3UR9A 2AFQB 1WAYB 2V6NA 1GI4A 1K1IA 3U8OH 1ELTA 1ABIH 3MNCA 1S83A 2J9NA 3SU6A 2ZO3H 1TOCB 2TGDA 2GD4B 3SN8A 1WOFA 1SGCA 2QF0A 3SQHE 2A5AA 1BTUA 1A46H 3R0FA 5I46H 2BY6X 4NFFA 2Z7FE 4FUEA 3MH6A 3VGCC 5A8XA 4X6PA 1W2KH 2RA3A 1XMNB 1NRSH 1GJ7B 3BTQE 4OS5A 3VB7A 1SGEE 1E36B 1EAUA 2IJOB 2B0FA 2Z9LA 2J94A 3ZV8A 4X2YA 1YLDA 4JK5A 1MQ6A 1TMTH 1LMWB 3FVFB 1C4V2 2BQ7B 1G2MA 1MTUA 1C4Y2 1GHAG 1LHEH 2AGGX 1AWFH 2Z9GA 4Y0ZE 3VXFH 4ZHLU 3SNDA 1C5YB 2WPMS 1F5KU 4AGKA 3BF6H 1P2KA 2FMJA 1C5VA 1PQ8A 2C8ZB 1SHYA 3RLYH 3S0NA 1ZJKA 3M3VA 4CHAC 1GMCG 2BB4A 4H4FA 3TJNA 1SVPA 3QN7A 3LGVA 1HIAB 9LPRA 5J4SA 1F5LA 1AO5A 1ESTA 1DXWA 1YYY1 1QB9A 3RMLH 3MHWU 4I8HA 2PV9B 1SL3A 3V13A 1VCQA 4MDSA 1V2KT 2FYRA 3KCGH 1K22H 3B8JA 1V2LT 1PFXC 2OQ5A 1A4WH 1O3EA 1IOEA 1UVUH 3WY8A 4J1YA 2PUXB 1GCDA 2K1QA 4YOJA 2C8XB 2DUCA 5DP9A 4ZHMU 1P05A 3NPSA 5EQQA 3LT3A 2PR3A 2GDEH 1C2DA
chains in the Genus database with same CATH superfamily
1A61H 1UTPA 3PO1B 4K5ZA 4UFEH 1UK3A 1DPOA 1CT2E 1FX0B 1T32A 2ZGCA 3PLPA 2THFB 4XOJA 4AFQA 3UPEA 3ZZ9A 1G32B 1O3IA 1TABE 4ABIA 2XTTB 2ZFRH 2VBCA 1MQ5A 1C5QA 3PB1E 5C5OA 2GT8A 3V0XA 4TY6A 4IS5A 2KFWA 2WV5A 3UQVA 1SOZA 3RXHA 2HRVA 5IDKA 2JKHA 1M9UA 3A7VA 2WPKS 4YOGA 2BX4A 3H09A 4GVUA 1ELCA 2Q1JA 5E0JA 2GCTB 1MBQA 3QZQA 4ISHH 4KELA 2FX4A 1WU1A 3M5MA 3BTTE 3CS7A 1O3CA 2VH0A 1EAWA 2ZU1A 1KXEA 1MUEB 3TK6A 5KECA 1HAXB 1L4ZA 1O2HA 3M7QA 4JZEH 2Y6TA 1UTMA 4NIYA 1LVYA 1YF4A 1LVMA 1ZGVA 4X2WA 2FODA 3F1SB 1OYQA 2QYIA 1N6YA 1C1PA 1YPKH 4K8YA 1ABJH 1L1GA 2Q6FA 1PPBH 3P92A 3FO8D 1W11U 2AERH 4H6TA 4ZCNA 5C67A 1B0EA 1GDNA 1YCPM 4CRFA 2G4UA 3A7YA 2JDID 5SGAE 1BRAA 1O2QA 4VGCB 1ELGA 4YM9A 1GJBB 1LKAA 3SOSA 1YPMH 1NS3A 2XXLA 1TRYA 3AAUA 1DY9A 3LGYA 1P04A 3RXAA 2ZCKP 4DT7B 1DANH 1QL9A 1WUNH 3HK3B 3V12A 1C2FA 4FOUC 3Q3YA 1ZRBA 3SI4H 2A2XH 4GLYA 1GVZA 6CHAC 1AFQC 1G2LA 1SQRA 5JBBS 2CN0H 2OC1A 1BTHH 1O30A 2PFEA 1E37B 2DE8A 3SUGA 1EB2A 3MO9A 1SR5C 1SC8U 3L3TA 4IMZA 5DK1A 1ELAA 3SNCA 1GI0A 2W3KA 2GV6A 2Y82A 4GAWA 3S7KB 1GBAA 1TFXA 1IQJA 3F9FA 5F6MA 3ZYDA 5EW2H 4ZAEA 1OYTH 2R9PA 1EZSC 4XDEA 3ITIA 4YTAA 1MABB 2B8OH 1EATA 1TBZH 4JZFH 4INLA 5LPRA 4AYVB 3E6PH 1C5RA 5C1XA 1FXYA 1OWHA 1P2JA 1N8OC 4Z1MD 3FP6E 4YT6H 5LH8A 5HKKD 2GMTB 3LC3A 2GVFA 1ZSJA 4MVNA 4GPGA 1C9PA 2R0LA 2ZDVH 2K8IA 1NPMA 1COWD 3PMBB 3T5FH 1TMBH 1K2I1 2FTLE 5HMAA 1BJVA 1W0JD 5EG4A 3TJOA 2DE9A 4IN2A 1AU8A 3VXEH 3P70B 1YCPK 3MO3A 3ZZAA 2F9OA 3A89A 4F48B 2C8YB 1GHAF 1ELDE 3A8DA 3EYDA 1W13U 2Y81A 1P02A 1BMAA 2XNIA 3KNXA 4B1TA 1FY4A 1C2LA 2Y5GA 2A4RA 1O5EH 4DJZB 5F8XA 2ZPQA 3A84A 1GMCF 2HNTC 1N1LA 3SHAH 1GVKB 2ZGXH 2RCEA 2BVSH 1E1RD 2ZF0H 4RKOB 3ZVGA 2PGQB 4A7IB 2EI7A 3NXPA 1TLDA 1QURH 1SSXA 3ATIA 9ESTA 4FUFA 4BAKB 1WSSH 1PPCE 2OBQA 2STAE 1HLTH 3E8LA 4Q80A 2P16A 1YP9A 2H6MA 3UOUA 1AE5A 5C1YA 1TMUH 3VGCB 4CH2B 2PKAB 1C2GA 3SUFA 1TE0A 3CS0A 1NU7B 3N7OA 2RDLA 2ILNA 1MTNC 2PUQH 2F9NA 3RU4E 1RIWB 2L6OA 3V3MA 1A2CH 4WXIA 4UD9H 4Y71A 2VIPA 1DLEA 4I8KA 3ATWA 1Q2WA 1AHTH 3QDZB 1CHOG 3TH4H 5CHAB 1GMDG 1IQLA 1OSSA 2ZDMA 4X1NU 1HPGA 3Q3XA 1XUFA 1O5CB 3A81A 1EQ9A 1SMFE 3LH1A 4K60A 4D8NA 4QT8C 3TH3H 1K28D 1F7ZA 1GHXH 1ESAA 2V0BA 3FANA 2QF5A 2SGEE 3LU9B 4KTUA 1WTHD 3NK8A 1TWXB 1YCPH 1JOUB 3TLOA 5AHGH 1TGBA 3EQ0H 1BUIA 3MYWA 1BMMH 4CHAB 1JIMA 3KN2A 1P8VC 2VVUA 3BTKE 1FJSA 1OWDA 3Q00A 1GBMA 2OC7A 1BOQA 1HBTH 4YT7H 1F2SE 3DSGA 3NWUA 3RC5A 7LPRA 4PROA 4A5TS 1TYNA 4I33A 3DA9B 3DSOA 1EUFA 1OS8A 3RC6A 1VJ9U 3RXCA 1BTPA 1OWIA 1PPEE 3RU4T 1QCPA 3F68H 4K2YA 3DFJA 1FY3A 1C5UA 1BBRK 1GMHF 3BG4C 1HAZB 3ZZCA 4AORA 3VG8A 3F9EA 3S9CA 1C1VH 2OUAA 3ATLA 4FUJA 1QA0A 1O3NA 2VU8E 2F9BH 4X8SH 5TJXA 1C2HA 1TNIA 2ZFTA 3OAAD 3TGKE 1P2NA 2P94A 2WPJS 3EE7A 4UFGH 3E91A 2ZU5A 1D3PB 1A3EH 1DFPA 3RXDA 2QV1A 2XBWA 4BANB 3EE0B 1HJ8A 1QL7A 2BVRH 3HKJB 4Z0KA 4X8VH 3TNSA 1HXEH 1GJDB 1Y59T 1HAIH 3GYMA 1THPB 3RM0H 4INHA 1NU9A 2ZECA 1XUKA 1O3AA 3GY5A 3P8GA 4TSFD 4BAOB 1B7XB 3O8CA 2Y7XA 2VWLA 3CNRA 3QK1A 1C1NA 1QB6A 3O8RA 4NWKA 2WZQA 1PPFE 4JZIA 2O8WA 4JZ1A 4XD7D 1O2SA 1P03A 2CK3D 3LJOA 5ABWA 1GJ5H 1LDTT 1DWCH 1AIXH 5JYIA 5KGOA 4UE7H 2HALA 3GY4A 2LPRA 3WW7A 1LTOA 1C5LH 2A2QH 1O5AB 1BBRH 2VGCC 3W94A 4BOHA 4XSKU 1EPTC 2V3MA 2QN5T 3WWBA 2UWLA 1FDPA 2AGIX 2Q6DA 2JIZD 1MZAA 4BTUB 1Z7KA 1SKYE 2BLVA 4NA8A 5GWZA 1YPEH 1LVBA 2XCFA 2A1DB 3A8AA 3KQBA 1G3DA 1EJNA 1SGFG 3ZZ4A 5GXPA 2NU4E 3D49H 1K0HA 1IQNA 1IHTH 1C2KA 1NESE 4X1RU 1Y3UA 1SGPE 3RXOA 1EP6A 3DHKH 1ZYOA 5EODA 5T3HA 2ZHDA 1C2JA 3LC5A 4AB8A 2FLRH 1DDJA 1FIWA 5ESBA 1C5OH 1GGDC 2M2AA 6CHAB 1NFYA 1AFQB 3PWCA 3ZZ8A 1LPZB 2Y5FA 1O5GH 4AFSA 5LGOA 1QR3E 5CE1A 5C20A 4LOYH 3MWIU 5A0AE 1MBMA 1ZRKA 2QXGA 1RTKA 3BTDE 1BHXB 4BAMB 2A7JA 2XC4A 2FS8A 1BRBE 1GHYH 4NIVA 3F2GA 3RDZA 1XKAC 3U28C 2A5KA 2GKVE 1MKXK 1EAXA 3KEEA 1FUJA 1AVWA 4MLFB 4NSVA 2BY9X 1V2JT 4ABAA 1N8OB 1GI7B 1XX9A 2QXIA 4MPXA 2VIQA 4MG3A 2D2DA 4GHQA 1A5IA 3BTFE 1OWEA 2BM2A 1TPSA 1EPTA 3BIUH 4SGAE 1CGHA 4IC6A 2BD3A 1GDUA 2G8TA 3ZZ5A 1VJAU 3RXQA 2PHBA 1CO7E 4XFQA 4ZKRU 2KAIA 1CHOF 1HB0B 4FUIA 1ELBA 4RKJB 1ANBA 1GMDF 1THRH 3UOPA 1W8BH 1KLIH 1DOJA 2F3CE 2PKSC 4U2WA 5FBEA 1NZQH 3ZVBA 2ANKH 1BT7A 4R0IA 1L4DA 2GX4A 5HIZA 5FX6A 1B5GH 1FAXA 3F2HA 7GCHG 3SU4A 1GBIA 3FN8A 1C2EA 3GY6A 1O38A 1UK4A 3ZZBA 1GBBA 2XC0A 1A5GH 2EA3A 1L1NA 1TNLA 1ETSH 2FOHA 1UVPA 3ZVDA 3KYFA 1C5PA 4CBNA 4JZDH 3E16B 4JYVH 1WCZA 3F0OA 5A0CA 1A0HB 2WYJA 2ZDAH 4OS4A 5A2MH 1A5HA 1TONA 4ZMAH 1K1NA 5T6DA 1AE8H 1NRPH 1D6WA 3A85A 1ZPZA 1GPZA 2ZHQH 3FFGA 4GSOA 2PLXA 2BD7A 2IJD1 2ZGBH 4FETA 2J2UA 2JH6D 5EXNA 1NRQH 1O2OA 2WUBA 2STBE 1BA8B 1KLTA 2BZ6H 3CP7A 2B9LA 1QBVH 1ZJDA 1XM1A 1CBWC 1O2RA 3EA7A 4OS6A 1MKXH 1RFNA 2OBOA 5A8YA 3RLWH 3SV6A 5E2OA 1SFIA 2HVYB 2QF3A 2BD4A 3SUDA 6ESTA 1MTNB 2C4FH 3P8FA 1C1WH 5DP7A 2ODPA 3SV9A 1Y5UT 2QF4A 1LPGB 2G00A 1OPHB 3LGIA 4FUCA 1MMJN 2ASUB 4DT4A 2H1UA 3NUMA 2W5EA 3PMHB 3DSPA 3MOCA 6GCHG 5GJ4B 4WY3A 5JDUB 1KTTB 5DP3A 2I6SA 3KQ5A 5A8ZA 5EW1H 2FOGA 2OK5A 2EEKA 3A87A 2VWOA 3UY9A 2BDGA 4MNWA 1CSOE 2YMSC 1TPAE 1O35A 2ANWA 1KXAA 4TWWA 3FP8E 3A7XA 3HGPA 3AASA 2WYGA 1GI8B 4DVAU 5DG6A 3VEQB 2BX3A 1FV9A 2FX6A 2ZTYA 3QGNB 1JIRA 1YLCA 3I29A 1HYLA 1QJ6B 3OTPA 5T6FA 3GS9A 4X8TH 1UTOA 4DG4A 1K1OA 1RS0A 2K0QA 2VB0A 3LPRA 3HGNA 5DSFA 1FPHH 4E05H 2OXSA 2TIOA 2B5TB 3SV2H 1FONA 1AZ8A 1DLKB 1BZXE 1HRTH 5EJLA 1TBRH 2NU0E 1HAYB 1HUTH 3E1XB 1DXPA 4O3TA 3SJKA 3BTHE 3PMJA 1BMNH 1SLUB 3N7EA 4KKDA 4ZH8A 3RXTA 3ZYEA 4DY7B 1GI6A 4BAHB 4IN1A 3A8CA 3BG4B 1ETRH 4ABFA 5DO4H 2OINA 3MU4A 3PROA 1KTSB 2J95A 1Z8GA 3AW1A 3NRLA 1PJPA 4FUGA 1D3DB 1QBOA 3RXEA 3SJIA 5HM2A 1SQTA 2ZFFH 1FN8A 2F91A 1MAYA 4AYYB 1H8IH 2HVXA 2J92A 1TNJA 4HG6A 2OC8A 4H6SB 3OTJE 3SNEA 3EDXB 1QB1A 1O2ZA 1TGNA 2H5CA 5JB8S 2J4IA 3ESTA 4X6NA 1HJ9A 1GBTA 3F0PA 1FY8E 1IQIA 2QC2A 1C5TA 3STJA 4Q7YA 3S9BA 1JMOH 1LKBA 1W14U 4DW2U 1AKSA 4HFPB 1A3BH 1O32A 1SFQB 3PTNA 4D7FA 2TGPZ 1T8NA 5L2YH 3OEED 3ODFA 1C1UH 3UAIC 3RXKA 5C94A 2FS9A 7ESTE 1A0LA 1FNIA 2QXHA 3I78A 3DFLA 2R0KA 1O39A 1BDAA 3BEFB 1NM6A 3A83A 2O9QA 3KGPA 2CMYA 1QZ8A 2AH4X 3SU2A 1KXBA 2ODYB 2WV4A 1O3GA 1S0RA 1F0TA 4AFZA 4XBDA 3M37A 1ZSKA 1OKXA 4HI3A 3HATH 2P59A 1IQEA 1WTGH 4A1XA 1O0DH 4MPUA 3GICB 1OP2A 2BDYA 3M7TA 1IQGA 1T8LA 1TOMH 1VGCC 5ETXA 1UK2A 2VGCB 2D26C 2ANYA 2BY7X 2BDIA 1O36A 2BHGA 1MTWA 1O33A 2BZAA 2G5NA 1YWUA 1EPTB 3TJVA 1TGTA 1C1MA 2OC0A 1GJ6A 1XKBC 5EPYA 1UVTH 1PYTC 5AFYH 1X7AC 2BTCE 3NZIA 2M5TA 3FZDA 3FAOA 2QE7D 2AIPA 1CA8B 2UUFB 2RG3A 1ELVA 1S6LA 1MCTA 4ZKSU 4BTTB 1C1RA 2BD8A 3ENSB 3DT0H 4A92A 2NU3E 5FPYA 2ZCHP 3RXRA 4ZUHA 2WUCA 3RXPA 2XBXA 2PW8H 3KF2A 1E38B 3M3SA 1QQUA 4BXWA 1PPZA 2OLGA 2CJIA 3M35A 4Y6DA 3QX5H 1GGDB 2ZDKA 7GCHF 2QXJA 2F9PA 3MNBA 1O2UA 1G3CA 1T8MA 5HGGA 3S9AA 5B6LA 2BMGB 1V2UT 2ZPSA 5TCAA 3OE7D 2H9EH 1DVAH 5F53A 3OEHD 5C1UA 2QY0B 5A09A 4F4OC 1TGCA 5FHTA 4K69A 4H42U 4Y10E 2BDHA 1SLXB 3U98H 2D8WA 1EASA 1GHVH 1G3EA 1T4UH 1Z71A 3SO3A 1KDQA 4GHTA 4ZKOU 4WMEA 4ABDA 1V6DA 4GCHG 4JYUH 1IQHA 3RU4D 3ZVEA 4GUXA 5E2PA 1C9TA 1F92A 2F83A 4FVBA 4K1EA 5FPSA 2HOBA 1P2OA 1FAKH 1DE7H 1ZHRA 4B71A 1UHBA 4IC5A 2J98A 1ANCA 3SNBA 2SGDE 4NSYA 4Y8ZA 5JB9S 1YC0A 4CREA 1PQAA 6GCHF 1ZGIA 3VPKA 2C93B 5TCCA 1O3PB 2VVCA 2PKSB 4X2VA 4MNVA 1TA6A 4O9VA 1LO6A 1GBEA 2FPZA 2ZG0H 4DGJA 2BYAX 3OSYA 3TITA 4Y8XA 3SGAE 1DSTA 3MNSA 4CRDA 3MU0A 1GDQA 2G55A 2JH0D 1J9CH 2VIDA 3E3TA 4SGBE 1TRNA 4UFFH 1YPJH 1KYNA 1O3LA 1GBKA 4FUDA 1Z6JH 1W3CA 2HLDD 2V3HH 5FCRA 3K6YA 4IW4E 1C1TA 1SPJA 4NFEA 2QCYA 2JH5D 1YKTA 3TIUA 3UNRA 5DP4A 1EZUC 3BTWE 2CF9H 2AMQA 3RXSA 1HGTH 2XNDD 1ZPBA 1AVXA 1H9IE 1CBWB 2J97A 3A7ZA 3GY8A 1SLVB 1GJ4H 1YPHC 4MNXA 3UWJH 1E35B 2FOBA 4B2CA 1P2MA 5HM9A 3Q77A 1TX7A 2HPPH 3FOAA 3OY5U 3AAVA 5EJ1A 3MQKC 4OS2A 4ZKNU 1BRCE 1E79D 1AVGH 4DIHH 1O3OA 5ESTE 1Y8TA 1TPOA 2QA9E 5EOKA 2Z94A 5C17A 1C2MA 1AKSB 2VVVA 1OOKB 1TX8A 1LHGH 2GT7A 1GI3A 1UW7A 2YMSB 3DCLA 2VNTA 1EB1H 5PTPA 2BDAA 2TBSA 2BDCA 1WQSA 4B75A 3M5LA 1V2MT 2ZU2A 1GHBG 5GNDA 1MZDA 3QLPH 3VB3A 1C5MD 3UFAA 1O2MA 3LH3A 3C27B 1F0SA 1TALA 2W6JD 3GCHC 4B73A 1H9LB 4KTSA 2IPQX 1LVOA 1O2TA 1XUGA 2KCPA 3LONA 2A4OA 1GBFA 1GI1A 3L6PA 1T7CA 5FX5A 5JBAS 1QA7A 1JXPA 4NA9H 3BTME 1ZTJA 1Z6EA 1RJXB 4A1TA 3SW2B 2IN2A 4AOQA 2AIQA 1SQOA 2BQ6B 2H9HA 5E8EH 1HDTH 1Y3WA 4U01A 4NIWA 5G4BA 2Y7ZA 4YOIA 1S85A 3F3BA 4ASUD 1TB6H 5C0TA 4TY7A 4WWYA 1EJAA 1V3XA 2OP9A 5F8TA 3V7TA 3ELAH 3ZVFA 1VITG 2FDAA 3ZVCA 4LXBH 2PP6A 2HNTE 1ANDA 1H9HE 1A7SA 2AHME 2GDDA 3KL6A 3A88A 1CQQA 3SV7A 3H5CB 4AZ2B 4AB9A 1YM0A 1P0SH 1RD3B 5DPAA 3SUEA 4O3UA 4XE4A 2NWNA 2R3UA 2VH6A 1P2QA 1K21H 1QHRB 2ZGJA 1B0FA 1P11E 3TGIE 4ISNA 1TNKA 2UWPA 3ATKA 4CH8B 2C90B 2F43B 1RTFB 7KMEH 1Y5AT 3U8TH 1T8OA 2ZQ2A 2FI3E 5C2ZA 3MH5A 4NA7A 1MD8A 1XVOA 3FKSD 1O2WA 1CGIE 2ZCLP 2BD5A 1TGSZ 1ID5H 4OS1A 1V2PT 1CE5A 1G36A 1SLWB 3UQOA 5K7RA 1J8AA 1UTKA 3QTVH 1O5DH 4ABGA 4ISOA 3MFJA 1GVLA 5JPMH 2AMPA 4K1SA 1GG6C 1AY6H 1OP0A 1NFWA 4U32A 2FOFA 1O3KA 1WQVH 5I25A 1VGCB 1NFXA 2B7DH 3GDSA 3K65B 1L0ZA 1O2IA 2AYWA 1UHBB 1G9IE 3UNQA 1H1BA 2J98B 3BEIB 3F2FA 4GCHF 2A32A 3HK6B 1W0YH 1GWAA 5E0HA 3PM3A 1QRXA 1CGJE 3U1IB 4P02A 3G01A 1LHFH 2WV9A 1NTPA 4WH8A 1BRUP 3ZV9A 1AWHB 1GI2A 5T1VA 2FIRH 1AB9C 1FIZA 3KQDA 2ULLA 1QTFA 2J38A 1K1JA 4YZUA 1P3CA 2BXUH 2ZHWH 1MTVA 3URCA 2G4TA 3A80A 1OHHD 8LPRA 1KXFA 3EA8A 5BPEA 3STIA 1KXCA 1QJ1B 1Z8IB 3BEUA 4TPIZ 2W3IA 4NG9H 5EU8A 3M5NA 4JMYA 5B6OA 1YY3A 1S5SA 3OU0A 1HNEE 1ACBE 1UTJA 3Q76A 1ZZZA 3RP2A 5EJZA 3K6ZA 1BTWA 4AG1A 1WBGB 3RXVA 4M7GA 5L30H 3KHVA 2WPHS 2WSSD 1BIOA 1C5ZB 1ZPCA 1BBRE 4FXGH 1W10U 4DOQA 3L33A 2W26A 3RMNH 1UVSH 1GBJA 2ZTXA 2G5VA 4KGAA 1FLEE 2TGAA 1J17T 2G52A 3VFEA 2FOCA 1RXPA 1G30B 5EQSA 1AUTC 3U69H 4AN7A 5T6GA 1MD7A 1WDIA 1CA0C 1TNHA 2XBYA 1O34A 3OYPA 2RDEA 5FXLA 2ALVA 3EAJA 2A31A 5CHBA 1JRSA 6LPRA 3A82A 2WPLS 2P3FH 4JYTA 1Y3VA 2ZHEH 2OCVB 2ZDLA 2ZKSA 2P3TB 4HZHA 4ACBA 1MTSA 4XBBA 1MKWK 4Q7XA 3BN9A 1GHBF 1CT4E 3OY6U 3SV8A 1DITH 2ZFSA 3KQCA 1NRRH 2XWBI 1AI8H 3H7OA 2LP6A 1DY8A 3SJ8A 1LPKB 2EY4C 3ATMA 1NY22 4X8UH 1Y3XA 2Z3CA 3MTYA 1O2KA 4X1SU 3GISB 2ZC9H 2Z9KA 4K1TA 1UCYE 2HGTH 3UWIA 1HV7A 1QGFA 2BDBA 3E0PB 1HJAC 3PYHA 4OGYA 3SI3H 3U8RH 4DURA 3GYLB 1J16A 3UREA 1RTLA 1S82A 4WMFA 2HWLB 1Y3YA 3RXLA 1O2XA 1FZZA 1SGQE 3SYJA 1EZQA 3GDVA 4ISIH 2XW9A 4AGJA 1AD8H 4FU8A 2HPQH 1EXFA 1GHZA 1BHXF 1TAWA 4X2XA 3SJOA 4K3JA 3ZZDA 5DKMA 2FOMB 1ZR0A 2QGRA 1KIGH 3MH4A 3VB5A 1J14A 1SGIB 1A0JA 2ZP0H 1GI5A 2AMDA 4A1VA 1VITF 5HIYA 3PWBA 1EX3A 2YNAA 1P12E 4IBLH 2ZIQH 2BD9A 5H4IB 4NCYA 3SZEA 4Y79A 1TA2A 4Y8YA 3TJUA 1UTQA 3P8OA 2FXRA 2ZTZA 3RC4A 3BTEE 5DGJA 2ZGHA 1YBWA 3T29A 3I77A 1XXDA 2VIOA 4UDWH 4LZ4B 3TK5A 1O5FH 2A4QA 1O3MA 5J4QA 2SNWA 3GY3A 1E34B 1MKWH 5LPEA 2AS9A 1RIWC 2TGTA 1YGCH 3GCHB 2FI4E 3T62A 5CHAC 4O97A 1EKBB 2Z3DA 1C4U2 3EA9A 1C5NH 1G37A 4KP0A 1KSNA 5EIYA 1V2WT 1BTZA 3ZZ7A 4ZXYH 2ALPA 3P95A 5C3NA 1UMAH 1SGRE 1GL1A 3P6ZB 3SGBE 3DD2H 4KTCA 2HNTF 4WJG2 4B6EA 2ZFPH 2FLBH 1P3EA 2RFKC 3ODDA 2WPIS 3A86A 1AUJA 1OWKA 2FOAA 2GTBA 4THNH 1NT1A 3TU7H 3C1KA 3M7UA 2H9TH 5DP8A 3RXUA 2CF8H 3VB4A 3FP7E 3URDA 2G81E 2Y80A 3SQEE 2ZU4A 1TPPA 1OXGA 3RUOA 4RT0A 5IYTA 3F6UH 5EXMA 1XUJA 5K0HA 5GCHG 4X1QU 2VIVA 3AW0A 3AK5A 1SGTA 5AFZH 1INCA 3PLBA 4B6FA 3PV4A 3T25A 2ZHFH 2UUKB 1GJ9B 4YXWD 1TBQH 2KX4A 3F9GA 2A7CA 2CGAA 4CR5A 1SHHB 3S7HB 2KM0A 1LHDH 2Q6GA 1QL8A 2PKAA 1DICA 1MU6B 1O2YA 2BVXH 4BNRA 1BJUA 2A4GA 2GZ9A 1ZTLA 4MNYA 1YPGH 1ZHMA 1EOLA 3PRDA 3RXFA 3RMMH 5GIBA 3TK9A 1GG6B 3MI4A 2JETC 4YESB 5CMXH 2QIQA 2UUYA 1FMGA 4I8GA 1D6RA 5DP6A 3GCTG 2VWNA 1V2OT 1ZOMA 1ZMLA 1F0RA 1PQ5A 4Y76A 1AQ7A 2Z9JA 2GZ7A 1O5BB 1NO9H 3RXJA 1QQ4A 2W7UA 3RXGA 2BOHB 1AB9B 4MPVA 1P57B 4WH6A 3BIVH 1HXFH 2KAIB 2H2ZA 2EI8A 2R3YA 1BTXA 2P8OC 2ZU3A 3A7WA 4WMDA 2PWXA 1GL0E 1G3BA 1V2TT 3QTOH 1Y5BT 4BXSA 4I32A 3MU1A 3E0NB 1Z1IA 1GMHG 5DP5A 1F0UA 1PYTD 4WXVA 1AMHA 1PPGE 2GCHG 2L74A 3K9XB 4TWYA 2WHXA 2KZ4A 4NGAH 1D3QB 2FZZA 1O3DA 1LHCH 2BLQA 2FTMA 2ANMH 3UB0A 1NBMD 1SQAA 1ZMJA 2FM2A 1HFDA 2SGQE 5EXLA 1GJAB 4CRCA 3KYGA 4J2YB 1GI9B 1ZTKA 2R2MB 1KLJH 2BOKA 1QRZA 2A5IA 5GDSH 3LGWA 5E0GA 4ZXXH 2F9UA 2GP9B 4R8TB 3F9HA 1MCVA 1MH0A 4NZQA 5GPIB 3A7TA 3JZ2B 1IQFA 1O37A 1V2NT 4TT3D 1XXFA 1IHSH 3T27A 4HTCH 1IQMA 1FN6A 2BY8X 1P2IA 3SNAA 2P95A 1D4PB 2PTNA 1CA0B 1DWDH 2J5UA 2XRCA 1ZLRA 1UJ1A 1HCGA 2BY5X 2VIWA 2V35A 2XOKD 3BG8A 5L6NH 1GCTC 1QFKH 1H8DH 3N7DA 3KIDU 5FAHA 1TQ7B 3NCLA 5FPTA 2KCOA 1O3FA 4B2BA 3FZZA 1N6XA 1SOTA 5FCKA 2FP7B 2Z6BD 1SGNE 2LNCA 2SGPE 3P8NA 4LZ1H 2BD2A 2OTVA 4AC9A 5EQRA 1GJCB 4E7RG 1TRMA 2GGVB 1HAHH 1TNGA 2O8UA 1P9SA 2ZZUH 2FWWA 3PRBA 5DJ7A 2EI6A 2A0QB 2O8TA 2TPIZ 3W1EA 2XC5A 1DUEA 4MQAA 2BQWB 5A0BA 3CENA 1NBME 1Q3XA 1QRWA 3RMOH 3D23A 1HJAB 5HYOA 5F03A 1PQ7A 1O2GH 3SBKA 3GDUA 1Q31A 1V2ST 3M36A 1TIOA 2CHAC 2W7SA 2Y5HA 4RN6A 1KMHB 2BLWA 2FYQA 1VCPA 1VR1H 3QWCH 1VITH 4D9RA 3RXMA 4X1PU 5BRRE 4WVPE 3BSQA 1KY9A 2YNBA 2FEQH 1SG8B 1UTLM 4JK6A 4I86A 4YLUA 4OGXA 1TQ0B 2GZ8A 2JJ2D 1PPHE 4I8LA 3SZNA 1S81A 4Y7BA 1O3BA 2ZNKH 3QZRA 2WPDD 1P09A 2A7HA 3TGJE 3RM2H 1QBNA 1HAVA 4F49A 1IQKA 1BITA 3LDXH 2V3OH 4IGDA 4TYDA 1C1OA 2ODQA 3UIRA 2O8MA 3PLKA 3UTUH 4YLQH 5GCHF 1Z1JA 3QUMP 4NIXA 2PSYA 1UO6A 1EJMA 1BCUH 4LK4A 8GCHG 3TNTA 2PGBB 3B23B 4HGCA 2ESTE 4BTIB 4XRNA 1U6QA 2BXTH 2FESH 1OX1A 2ZI2H 1MU8B 4D9QA 3PMAB 3K2UA 1GBLA 3SORA 1AFEH 2BLOA 2J34A 3MU5A 1F5RA 4AG2A 2PSXA 1QIXB 1WV7H 2FOEA 1O3HA 1VZQH 2IPHA 1C1QA 1DT2A 1ETTH 1GHWH 3SGQE 1ELFA 1FI8A 3A8BA 4RSPA 5FBIA 1C2IA 1HAGE 1H8ED 2IOTA 2XCNA 1O3JA 2F4LA 2VWMA 3KQEA 4P00A 4B74A 1W7GH 1UVOA 3H7TA 3ZVAA 1CT0E 3TVJB 4CRBA 1AZZA 2SFAA 1P9UA 3O8BA 1P01A 3GCTF 2FI5E 1ARBA 1THSH 2SGFE 1WXRA 3IWMA 4TPYA 1Z8RA 1OP8A 4FUHA 3T2NA 2SNVA 4ZHAA 2F9VA 2R2WU 4I8JA 1H8HD 1S6FA 4ABEA 1CVWH 4B76A 1SBWA 1XVMA 2LELA 2JJ1D 1MAXA 4FU9A 4U30A 4YO9A 1W0KD 1FPCH 4O03A 5L2ZH 3MH7A 1FQ3A 4WF8A 1W7XH 4CBOA 1NFUA 2VJ1A 1O2JA 2UUJB 1YLNA 3D65E 1C5WB 3MMGA 3UUZA 1BMLA 1BQYA 3QGJA 1YPHE 3BTGE 2GCHF 4ESTE 4Y11E 2GV7A 2OQUA 3U9AH 1Z8JB 2C3SA 4K8BA 3IG6B 1BB0B 1SGFA 1C5XB 1LQEA 3UNSA 4E7NA 1P06A 5EGMA 4B2AA 4UONA 1SGDE 1V2VT 3TH2H 3GCNA 1JRTA 5HXFA 3PO1C 4ISLA 3JZ1B 3U1JB 1KDQB 2AGEX 1ZHPA 2JETB 3Q3KA 3LGUA 3M3TA 3QO6A 3OX7U 8KME2 1CU1A 5DN6D 1W12U 4ASHA 1EOJA 1CHGA 4FUBA 3O8DA 1NN6A 4X6MA 1DM4B 1C1SA 5EPNA 2ZDNA 1O2NA 2Z3EA 4UEHH 4RI0A 1EP5A 1E1QD 3SHCH 4MTBA 1SI5H 3UR6A 4I7YH 3B9FH 4X0WU 2EC9H 2P8OB 3TPIZ 4Q2KA 1HAPH 2GCTC 1O2VA 1GBCA 1EFRD 3ZZ6A 2ZA5A 2QAAA 1DS2E 1L2EA 1V2QT 4Y0YE 1UCYK 1FY5A 1HIAA 1UTNA 1D3TB 3ZZ3A 2C8WB 3E90B 3GY2A 2YOLA 2O8LA 1D9IA 1FY1A 8ESTE 3WWFA 1ZSLA 3VB6A 1S84A 2Z9IA 2ZQ1A 4X6OA 4XBCA 4Q7ZA 4CRGA 5F8ZA 2ZEBA 4ABJA 2D1JA 3DUXH 3SU1A 3SU3A 1YPLH 4F55A 2W6ID 3GY7A 3PTBA 1ELEE 1JWTA 4CR9A 1IAUA 2PTCE 3HKIB 3M5OA 4VGCC 1QJ7B 1LCYA 2XYAA 1VCWA 2CXVA 4FU7A 4A6LA 1VKYA 3LJJA 2G51A 4MPWA 1ANEA 1ARCA 2H5DA 3IITA 1ORFA 1O2PA 3HPTB 5LPFA 1ZMNA 1RGQA 1EZXC 1JBUH 1P10A 3T28A 3RXBA 1DWBH 1XUIA 2TRMA 5C0UA 1HAVB 4Z6AH 2I6QA 3LKWA 1GCTB 2VINA 4D76A 2SGAA 1K9OE 3S69A 3GOVB 5C5NA 1T4VH 2P93A 2ZWLH 4NWLA 4OM9A 3W95A 1DX5M 1ESBA 1K1LA 1UCYH 1V2RT 4BAQB 4DCDA 2A45B 4CRAA 3LGTA 3SU5A 3RXIA 1AN1E 3EGKH 1SGYE 4AFUA 2XBVA 8GCHF 2XWAA 1BTYA 3LOXA 3R3GB 3MNXA 1S0QA 5AVDA 4INKA 2WINI 1EAIA 4DIIH 1DUAA 1SB1H 4I31A 1K1PA 1NC6A 3MO6A 2NU1E 2AEIH 1O2LA 4E06H 4FVDA 1GBDA 2GMTC 5AF9H 2FO9A 3M61U 4ABHA 4ZROA 1DWEH 1QNJA 2ZPRA 3BV9B 4OS7A 3D62A 1K1MA 3P17H 2RA0A 1W0ZU 3AVZA 2UWOA 4UFDH 1GBHA 1TX6A 2CHAB 3T26A 1L1JA 1OWJA 2KCAA 4ABBA 1E0FD 2P3UB 1WYKA 1AGJA 3N99A 4D7GA 4JCNA 1QY6A 1H4WA 3SJ9A 4AX9H 1T31A 3GCOA 2OD3B 1XUHA 2HLCA 4IMQA 3LIWA 1NRNH 1O31A 1GJ8B 2ZFQH 1LQDB 1DSUA 1RRKA 5JBCS 3MU8A 1KXDA 5JBTA 4NZLA 1J15A 1HAOH 1NROH 1C5SA 2CV3A 1A1RA 1S6HA 3SU0A 3NKKA 4Y7AA 2NU2E 3UR9A 2AFQB 1WAYB 2V6NA 1GI4A 1K1IA 3U8OH 1ELTA 1ABIH 3MNCA 1S83A 2J9NA 4Q63A 3SU6A 2ZO3H 1TOCB 2TGDA 2GD4B 3SN8A 1WOFA 1SGCA 2QF0A 3SQHE 2A5AA 1BTUA 1A46H 3PV5A 3R0FA 5I46H 2BY6X 4NFFA 2Z7FE 4FUEA 3MH6A 3VGCC 5A8XA 4X6PA 1W2KH 2RA3A 1XMNB 1NRSH 3ZIAD 1GJ7B 3BTQE 4OS5A 3VB7A 1SGEE 1E36B 1EAUA 2IJOB 2B0FA 2Z9LA 2J94A 3ZV8A 4X2YA 1YLDA 2YMSD 4JK5A 3PV2A 1MQ6A 1TMTH 2KCYA 5CDFE 1LMWB 3FVFB 1C4V2 2BQ7B 1G2MA 1MTUA 1C4Y2 1GHAG 1LHEH 2AGGX 1AWFH 2Z9GA 4Y0ZE 3VXFH 4ZHLU 3SNDA 1C5YB 2WPMS 1F5KU 4AGKA 2V7QD 5KEDA 3BF6H 1P2KA 2FMJA 1C5VA 1PQ8A 2C8ZB 1SHYA 5FL7D 3RLYH 3S0NA 4Q4LA 1ZJKA 3M3VA 4CHAC 1GMCG 4M9FA 2BB4A 4H4FA 3TJNA 1SVPA 3QN7A 1BMFD 3LGVA 4ACAA 1HIAB 9LPRA 5J4SA 1F5LA 1AO5A 1ESTA 1DXWA 1YYY1 1QB9A 3RMLH 3MHWU 4I8HA 2PV9B 1SL3A 3V13A 5IK2D 4RT1A 1VCQA 4MDSA 1V2KT 2FYRA 2KR7A 3KCGH 1K22H 3OFND 3B8JA 1V2LT 1PFXC 2OQ5A 1A4WH 1O3EA 1IOEA 1UVUH 3WY8A 4J1YA 2PUXB 1GCDA 2K1QA 4YOJA 2C8XB 2DUCA 5DP9A 4ZHMU 1P05A 3NPSA 5EQQA 3LT3A 2EQNA 2GDEH 2PR3A 2GJGA 1C2DA
chains in the Genus database with same CATH topology
1A61H 1UTPA 3PO1B 4K5ZA 4UFEH 1UK3A 1DPOA 1CT2E 1T32A 2ZGCA 3PLPA 2THFB 4XOJA 4AFQA 3UPEA 3ZZ9A 1G32B 1O3IA 1TABE 4ABIA 2XTTB 2ZFRH 1MQ5A 1C5QA 3PB1E 5C5OA 2GT8A 3V0XA 4TY6A 4IS5A 2WV5A 3UQVA 1SOZA 3RXHA 2HRVA 5IDKA 2JKHA 1M9UA 3A7VA 2WPKS 4YOGA 2BX4A 4GVUA 1ELCA 2Q1JA 5E0JA 2GCTB 1MBQA 3QZQA 4ISHH 4KELA 2FX4A 1WU1A 3M5MA 3BTTE 3CS7A 1O3CA 2VH0A 1EAWA 2ZU1A 1KXEA 1MUEB 3TK6A 1HAXB 1L4ZA 1O2HA 3M7QA 4JZEH 2Y6TA 1UTMA 4NIYA 1LVYA 1YF4A 1LVMA 1ZGVA 4X2WA 2FODA 3F1SB 1OYQA 2QYIA 1N6YA 1C1PA 1YPKH 4K8YA 1ABJH 1L1GA 2Q6FA 1PPBH 3P92A 1W11U 2AERH 4H6TA 5C67A 1B0EA 1GDNA 1YCPM 4CRFA 2G4UA 3A7YA 5SGAE 1BRAA 1O2QA 4VGCB 1ELGA 4YM9A 1GJBB 1LKAA 3SOSA 1YPMH 1NS3A 2XXLA 1TRYA 3AAUA 1DY9A 3LGYA 1P04A 3RXAA 2ZCKP 4DT7B 1DANH 1QL9A 1WUNH 3HK3B 3V12A 1C2FA 3Q3YA 1ZRBA 3SI4H 2A2XH 4GLYA 1GVZA 6CHAC 1AFQC 1G2LA 5JBBS 2CN0H 2OC1A 1BTHH 1O30A 2PFEA 1E37B 2DE8A 3SUGA 1EB2A 3MO9A 1SR5C 1SC8U 3L3TA 4IMZA 5DK1A 1ELAA 3SNCA 1GI0A 2W3KA 2GV6A 2Y82A 4GAWA 3S7KB 1GBAA 1TFXA 1IQJA 3F9FA 5F6MA 3ZYDA 5EW2H 4ZAEA 1OYTH 2R9PA 1EZSC 4XDEA 3ITIA 4YTAA 2B8OH 1EATA 1TBZH 4JZFH 4INLA 5LPRA 4AYVB 3E6PH 1C5RA 5C1XA 1FXYA 1OWHA 1P2JA 1N8OC 5LH8A 3FP6E 4YT6H 2GMTB 3LC3A 2GVFA 1ZSJA 4MVNA 4GPGA 1C9PA 2R0LA 2ZDVH 1NPMA 3PMBB 3T5FH 1TMBH 1K2I1 2FTLE 5HMAA 1BJVA 5EG4A 3TJOA 2DE9A 4IN2A 1AU8A 3VXEH 3P70B 1YCPK 3MO3A 3ZZAA 2F9OA 3A89A 2C8YB 1GHAF 1ELDE 3A8DA 3EYDA 1W13U 2Y81A 1P02A 1BMAA 2XNIA 3KNXA 4B1TA 1FY4A 1C2LA 2Y5GA 2A4RA 1O5EH 4DJZB 5F8XA 2ZPQA 3A84A 1GMCF 2HNTC 1N1LA 3SHAH 1GVKB 2ZGXH 2RCEA 2BVSH 4RKOB 2ZF0H 3ZVGA 2PGQB 4A7IB 2EI7A 3NXPA 1TLDA 1QURH 1SSXA 3ATIA 9ESTA 4FUFA 4BAKB 1WSSH 1PPCE 2OBQA 2STAE 1HLTH 3E8LA 4Q80A 2P16A 1YP9A 2H6MA 3UOUA 1AE5A 5C1YA 1TMUH 3VGCB 4CH2B 2PKAB 1C2GA 3SUFA 1TE0A 3CS0A 1NU7B 3N7OA 2RDLA 2ILNA 1MTNC 2PUQH 2F9NA 3RU4E 1RIWB 3V3MA 1A2CH 4WXIA 4UD9H 4Y71A 2VIPA 1DLEA 4I8KA 3ATWA 1Q2WA 1AHTH 3QDZB 1CHOG 3TH4H 5CHAB 1GMDG 1IQLA 1OSSA 2ZDMA 4X1NU 1HPGA 3Q3XA 1XUFA 1O5CB 3A81A 1EQ9A 1SMFE 3LH1A 4K60A 4D8NA 4QT8C 3TH3H 1K28D 1F7ZA 1GHXH 1ESAA 2V0BA 3FANA 2SGEE 3LU9B 4KTUA 1WTHD 3NK8A 1TWXB 1YCPH 1JOUB 3TLOA 5AHGH 1TGBA 3EQ0H 1BUIA 3MYWA 1BMMH 4CHAB 1JIMA 3KN2A 1P8VC 2VVUA 3BTKE 1FJSA 1OWDA 3Q00A 1GBMA 2OC7A 1BOQA 1HBTH 4YT7H 1F2SE 3NWUA 3RC5A 7LPRA 4PROA 4A5TS 1TYNA 4I33A 3DA9B 1EUFA 1OS8A 3RC6A 1VJ9U 3RXCA 1BTPA 1OWIA 1PPEE 3RU4T 1QCPA 3F68H 4K2YA 3DFJA 1FY3A 1C5UA 1BBRK 1GMHF 3BG4C 1HAZB 3ZZCA 4AORA 3F9EA 3S9CA 1C1VH 2OUAA 3ATLA 4FUJA 1QA0A 1O3NA 2VU8E 2F9BH 4X8SH 5TJXA 1C2HA 1TNIA 2ZFTA 3TGKE 1P2NA 2P94A 2WPJS 4UFGH 3E91A 2ZU5A 1D3PB 1A3EH 1DFPA 3RXDA 2QV1A 2XBWA 4BANB 3EE0B 1HJ8A 1QL7A 2BVRH 3HKJB 4Z0KA 4X8VH 3TNSA 1HXEH 1GJDB 1Y59T 1HAIH 3GYMA 1THPB 3RM0H 4INHA 1NU9A 2ZECA 1XUKA 1O3AA 3GY5A 3P8GA 4BAOB 1B7XB 3O8CA 2Y7XA 2VWLA 3QK1A 1C1NA 1QB6A 3O8RA 4NWKA 1PPFE 4JZIA 2O8WA 4JZ1A 1O2SA 1P03A 3LJOA 5ABWA 1GJ5H 1LDTT 1DWCH 1AIXH 5JYIA 4UE7H 2HALA 3GY4A 2LPRA 1LTOA 1C5LH 2A2QH 1O5AB 1BBRH 2VGCC 3W94A 4BOHA 4XSKU 1EPTC 2QN5T 2UWLA 1FDPA 2AGIX 2Q6DA 1MZAA 4BTUB 1Z7KA 4NA8A 2BLVA 5GWZA 1YPEH 1LVBA 2XCFA 2A1DB 3A8AA 3KQBA 1G3DA 1EJNA 1SGFG 3ZZ4A 5GXPA 2NU4E 3D49H 1IQNA 1IHTH 1C2KA 1NESE 4X1RU 1Y3UA 1SGPE 3RXOA 1EP6A 3DHKH 1ZYOA 5EODA 5T3HA 2ZHDA 1C2JA 3LC5A 4AB8A 2FLRH 1DDJA 1FIWA 5ESBA 1C5OH 1GGDC 6CHAB 1NFYA 1AFQB 3PWCA 3ZZ8A 1LPZB 2Y5FA 1O5GH 4AFSA 5LGOA 1QR3E 5CE1A 5C20A 4LOYH 3MWIU 5A0AE 1MBMA 1ZRKA 2QXGA 1RTKA 3BTDE 1BHXB 4BAMB 2A7JA 2XC4A 2FS8A 1BRBE 1GHYH 4NIVA 3RDZA 1XKAC 2A5KA 2GKVE 1MKXK 1EAXA 3KEEA 1FUJA 1AVWA 4MLFB 4NSVA 2BY9X 1V2JT 4ABAA 1N8OB 1GI7B 1XX9A 2QXIA 4MPXA 2VIQA 4MG3A 2D2DA 4GHQA 1A5IA 3BTFE 1OWEA 2BM2A 1TPSA 1EPTA 3BIUH 4SGAE 1CGHA 4IC6A 2BD3A 1GDUA 2G8TA 3ZZ5A 1VJAU 3RXQA 2PHBA 1CO7E 4XFQA 4ZKRU 2KAIA 1CHOF 1HB0B 4FUIA 1ELBA 4RKJB 1ANBA 1GMDF 1THRH 3UOPA 1W8BH 1KLIH 1DOJA 2PKSC 2F3CE 4U2WA 5FBEA 1NZQH 3ZVBA 2ANKH 1BT7A 4R0IA 1L4DA 2GX4A 5FX6A 1B5GH 1FAXA 7GCHG 3SU4A 1GBIA 1C2EA 3GY6A 1O38A 1UK4A 3ZZBA 1GBBA 2XC0A 1A5GH 2EA3A 1L1NA 1TNLA 1ETSH 2FOHA 1UVPA 3ZVDA 4CBNA 1C5PA 4JZDH 3E16B 4JYVH 1WCZA 5A0CA 5A2MH 1A0HB 2WYJA 2ZDAH 4OS4A 1A5HA 1TONA 4ZMAH 1K1NA 5T6DA 1AE8H 1NRPH 1D6WA 3A85A 1ZPZA 1GPZA 2ZHQH 3FFGA 4GSOA 2PLXA 2BD7A 2ZGBH 2J2UA 2JH6D 5EXNA 1NRQH 1O2OA 2WUBA 2STBE 1BA8B 1KLTA 2BZ6H 3CP7A 2B9LA 1QBVH 1ZJDA 1XM1A 1CBWC 1O2RA 3EA7A 4OS6A 1MKXH 1RFNA 2OBOA 5A8YA 3RLWH 3SV6A 5E2OA 1SFIA 2QF3A 2BD4A 3SUDA 6ESTA 1MTNB 2C4FH 3P8FA 1C1WH 5DP7A 2ODPA 3SV9A 1Y5UT 1LPGB 2G00A 1OPHB 3LGIA 4FUCA 1MMJN 2ASUB 2H1UA 3NUMA 2W5EA 3PMHB 3MOCA 6GCHG 5GJ4B 4WY3A 5JDUB 1KTTB 5DP3A 2I6SA 5A8ZA 5EW1H 2FOGA 2EEKA 3A87A 2VWOA 3UY9A 2BDGA 4MNWA 1CSOE 1TPAE 1O35A 2ANWA 1KXAA 4TWWA 3FP8E 3A7XA 3HGPA 3AASA 2WYGA 1GI8B 4DVAU 5DG6A 3VEQB 2BX3A 1FV9A 2FX6A 2ZTYA 3QGNB 1JIRA 1YLCA 3I29A 1HYLA 1QJ6B 5T6FA 4X8TH 1UTOA 4DG4A 1K1OA 1RS0A 2VB0A 3LPRA 3HGNA 4E05H 1FPHH 2OXSA 2TIOA 2B5TB 3SV2H 1FONA 1AZ8A 1DLKB 1BZXE 1HRTH 1TBRH 2NU0E 1HAYB 1HUTH 3E1XB 1DXPA 4O3TA 3SJKA 3BTHE 3PMJA 1BMNH 1SLUB 4KKDA 4ZH8A 3RXTA 3ZYEA 4DY7B 1GI6A 4BAHB 4IN1A 3A8CA 3BG4B 1ETRH 4ABFA 5DO4H 2OINA 3MU4A 3PROA 1KTSB 2J95A 1Z8GA 3AW1A 1PJPA 4FUGA 1D3DB 1QBOA 3RXEA 3SJIA 5HM2A 1SQTA 2ZFFH 1FN8A 2F91A 1MAYA 4AYYB 1H8IH 2HVXA 2J92A 1TNJA 2OC8A 4H6SB 3OTJE 3SNEA 3EDXB 1QB1A 1O2ZA 1TGNA 2H5CA 5JB8S 2J4IA 3ESTA 4X6NA 1HJ9A 1GBTA 1FY8E 1IQIA 2QC2A 1C5TA 3STJA 4Q7YA 3S9BA 1JMOH 1LKBA 1W14U 4DW2U 1AKSA 4HFPB 1A3BH 1O32A 1SFQB 3PTNA 4D7FA 2TGPZ 1T8NA 5L2YH 3ODFA 1C1UH 3RXKA 2FS9A 7ESTE 1A0LA 1FNIA 2QXHA 3I78A 3DFLA 2R0KA 1O39A 1BDAA 3BEFB 1NM6A 3A83A 2O9QA 3KGPA 2CMYA 2AH4X 3SU2A 1KXBA 2ODYB 2WV4A 1O3GA 1S0RA 1F0TA 4AFZA 4XBDA 3M37A 1ZSKA 1OKXA 4HI3A 3HATH 2P59A 1IQEA 1WTGH 4A1XA 1O0DH 4MPUA 3GICB 1OP2A 2BDYA 3M7TA 1IQGA 1T8LA 1TOMH 1VGCC 5ETXA 1UK2A 2VGCB 2BY7X 2ANYA 2D26C 2BDIA 1O36A 2BHGA 1MTWA 1O33A 2BZAA 2G5NA 1EPTB 3TJVA 1TGTA 1C1MA 2OC0A 1GJ6A 1XKBC 5EPYA 1UVTH 1PYTC 5AFYH 1X7AC 2BTCE 3NZIA 2M5TA 3FZDA 3FAOA 2AIPA 1CA8B 2UUFB 2RG3A 1ELVA 1MCTA 4ZKSU 4BTTB 1C1RA 2BD8A 3ENSB 3DT0H 4A92A 2NU3E 5FPYA 2ZCHP 3RXRA 4ZUHA 2WUCA 3RXPA 2XBXA 2PW8H 3KF2A 1E38B 3M3SA 1QQUA 4BXWA 1PPZA 2OLGA 2CJIA 3M35A 4Y6DA 3QX5H 1GGDB 2ZDKA 7GCHF 2QXJA 2F9PA 3MNBA 1O2UA 1G3CA 1T8MA 5HGGA 3S9AA 2BMGB 1V2UT 2ZPSA 5TCAA 2H9EH 1DVAH 5C1UA 2QY0B 5A09A 4F4OC 1TGCA 5FHTA 4K69A 4H42U 4Y10E 2BDHA 1SLXB 3U98H 2D8WA 1EASA 1GHVH 1G3EA 1T4UH 1Z71A 3SO3A 1KDQA 4GHTA 4ZKOU 4WMEA 4ABDA 1V6DA 4GCHG 4JYUH 1IQHA 3RU4D 3ZVEA 4GUXA 5E2PA 1C9TA 1F92A 2F83A 4FVBA 4K1EA 5FPSA 2HOBA 1P2OA 1FAKH 1DE7H 1ZHRA 4B71A 1UHBA 4IC5A 1ANCA 3SNBA 2SGDE 4NSYA 4Y8ZA 5JB9S 1YC0A 4CREA 1PQAA 6GCHF 1ZGIA 3VPKA 2C93B 5TCCA 1O3PB 2VVCA 2PKSB 4X2VA 4MNVA 1TA6A 4O9VA 1LO6A 1GBEA 2FPZA 2ZG0H 4DGJA 2BYAX 3OSYA 3TITA 4Y8XA 3SGAE 1DSTA 3MNSA 4CRDA 3MU0A 1GDQA 2G55A 2JH0D 1J9CH 2VIDA 3E3TA 4SGBE 1TRNA 4UFFH 1YPJH 1KYNA 1O3LA 1GBKA 4FUDA 1Z6JH 1W3CA 2V3HH 5FCRA 3K6YA 4IW4E 1C1TA 1SPJA 4NFEA 2QCYA 2JH5D 1YKTA 3TIUA 3UNRA 5DP4A 1EZUC 3BTWE 2CF9H 2AMQA 3RXSA 1HGTH 1ZPBA 1AVXA 1H9IE 1CBWB 3A7ZA 3GY8A 1SLVB 1GJ4H 1YPHC 4MNXA 3UWJH 1E35B 2FOBA 4B2CA 1P2MA 5HM9A 3Q77A 1TX7A 2HPPH 3OY5U 3AAVA 4OS2A 4ZKNU 1BRCE 1AVGH 4DIHH 1O3OA 5ESTE 1Y8TA 1TPOA 2QA9E 5EOKA 2Z94A 1C2MA 1AKSB 2VVVA 1OOKB 1TX8A 1LHGH 2GT7A 1GI3A 2VNTA 1EB1H 5PTPA 2BDAA 2TBSA 2BDCA 1WQSA 4B75A 3M5LA 1V2MT 2ZU2A 1GHBG 1MZDA 3QLPH 3VB3A 1C5MD 3UFAA 1O2MA 3LH3A 3C27B 1F0SA 1TALA 3GCHC 4B73A 1H9LB 4KTSA 1LVOA 1O2TA 1XUGA 3LONA 2A4OA 1GBFA 1GI1A 3L6PA 1T7CA 5FX5A 5JBAS 1QA7A 1JXPA 4NA9H 3BTME 1ZTJA 1Z6EA 1RJXB 4A1TA 3SW2B 2IN2A 4AOQA 2AIQA 1SQOA 2BQ6B 2H9HA 5E8EH 1HDTH 1Y3WA 4U01A 4NIWA 5G4BA 2Y7ZA 4YOIA 1S85A 1TB6H 4TY7A 4WWYA 1EJAA 1V3XA 2OP9A 5F8TA 3V7TA 3ELAH 3ZVFA 1VITG 2FDAA 3ZVCA 4LXBH 2HNTE 1ANDA 1H9HE 1A7SA 2GDDA 3KL6A 3A88A 1CQQA 3SV7A 3H5CB 4AZ2B 4AB9A 1YM0A 1P0SH 1RD3B 5DPAA 3SUEA 4O3UA 4XE4A 2NWNA 2R3UA 2VH6A </