1GBHA

Alpha-lytic protease with met 190 replaced by ala and gly 216 replaced by leu complex with methoxysuccinyl-ala-ala-pro-leucine boronic acid
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACAGRGDSGGSWITSAGQAQGVMSGLNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Kinetic and structural characterization of mutations of glycine 216 in alpha-lytic protease: a new target for engineering substrate specificity.
pubmed doi rcsb
source organism Lysobacter enzymogenes
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords ALPHA-LYTIC PROTEASE
total genus 53
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1995-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gbhA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gbhA01
3RLWH 1O2SA 1O5FH 2VWMA 3PB1E 1DWBH 2ZA5A 2Z3EA 2ZECA 1RXPA 3MU5A 3M37A 4UFDH 3GCTF 3T5FH 2Y80A 1SOTA 3A85A 1ZRBA 5DP4A 2C4FH 1PPGE 2TGDA 1SR5C 1GJ4H 3MNCA 3RXLA 4ZKOU 1JXPA 1DSUA 2GT8A 2VVVA 5F8TA 2XBYA 1KIGH 1W3CA 2G51A 1O3KA 1O3BA 4VGCB 3SU1A 1WAYB 1ELFA 4K2YA 1CT0E 2R2MB 2C8YB 4A5TS 1C2IA 3Q3KA 3UQOA 2HPQH 1P0SH 4BOHA 5C5NA 5ESBA 4CREA 2VIOA 3P92A 5HXFA 1V2PT 2P3FH 4TWYA 4E05H 5H4IB 2ASUB 2F91A 1GI2A 3QN7A 2Y81A 3MNXA 1AE5A 3GCNA 1GL1A 5FPYA 1FDPA 1HAIH 3VB4A 3HATH 3KQEA 1EASA 5K0HA 2ILNA 3TU7H 2BQWB 2BD3A 2CGAA 1SGFA 4Y6DA 4YO9A 1CA0C 1VCPA 2QCYA 2FOAA 2WV4A 1SGIB 1QB9A 5AVDA 1EOJA 3RXIA 1UTKA 1SG8B 5CE1A 2Y5HA 2BVSH 2OLGA 4XFQA 3RC6A 2G81E 4BAHB 3S9CA 1EZUC 3S9AA 4B1TA 1N8OC 3EA9A 1QA7A 5DK1A 5TCCA 1C5UA 1QRXA 3MFJA 1C5OH 1YKTA 1V2TT 3SORA 3SJOA 3MWIU 1HJAB 2R3YA 2A4QA 2QY0B 2GDEH 5ABWA 1MQ5A 1ANDA 1Z6EA 1TGSZ 1BUIA 2YNBA 4KP0A 1AVXA 1O2NA 2A1DB 2THFB 3OY6U 3GYMA 3ODFA 3PMBB 1FMGA 3JZ1B 4H6TA 1CGIE 1G3DA 1NU7B 1Z1IA 5JBTA 1EPTB 1LMWB 6LPRA 1GHBF 2A4GA 3LKWA 3E8LA 1SFQB 3A89A 1GCTC 1LHDH 1W11U 1BBRH 1AB9C 4MTBA 4Y11E 1O2LA 5A0AE 3BG8A 5FX5A 1OX1A 5C3NA 1Y5AT 3EA8A 2YOLA 1DM4B 2QGRA 2GTBA 4ZAEA 1QIXB 2QF3A 1LVOA 3SHAH 5E0JA 1GJBB 4ABAA 4HZHA 2F9OA 5BRRE 1FAXA 1ETRH 2PKSC 1UCYK 1GI7B 2GMTB 4THNH 1TGCA 5C20A 1XVOA 1QHRB 5AFZH 4D7FA 1O3OA 3PROA 1F5RA 4FUDA 2BD8A 3U98H 4WMFA 3RDZA 1IQFA 2QIQA 2F3CE 1Y5BT 1F0UA 4B71A 1GMHG 1Z7KA 2D2DA 1E0FD 3ZYDA 1C5XB 1T4VH 1GI8B 3TK9A 3LJOA 5C1UA 3SNAA 4MNYA 3F9HA 3SHCH 2RG3A 1EX3A 1DE7H 1C1QA 1MU8B 1C2JA 3SV2H 1MAXA 3SI3H 4K5ZA 3M7TA 3O8RA 5LH8A 3ZZCA 3MU0A 2P8OC 2O8LA 1WU1A 2ZU4A 2RCEA 1W10U 5L6NH 1S6FA 1TIOA 1QJ7B 4FXGH 1GHYH 1QJ1B 1F0TA 1W0YH 1HAZB 3SZNA 1GCTB 5JB9S 4D9RA 2OC7A 1RIWC 4GPGA 4ABEA 1N8OB 2EI7A 1C1TA 1O3EA 2BTCE 3U1JB 1NU9A 3GY8A 1RTFB 3A7ZA 4LOYH 1ZRKA 1FLEE 1GI1A 4NZLA 4HGCA 2BDBA 3EQ0H 2CF9H 1T8OA 3E6PH 4BXWA 1C1OA 2D26C 2UUJB 3KCGH 4D9QA 1G37A 3DA9B 3FAOA 1OYQA 4DIHH 1BRCE 8LPRA 1GBMA 1ESBA 1BHXF 2GT7A 3DFJA 1EB2A 4IN2A 3FP6E 2KAIA 4A7IB 3EYDA 1GHAG 2BQ6B 2CJIA 1AQ7A 4GSOA 3M36A 4ZKRU 3BEIB 1BTWA 2J2UA 4ZHAA 2D8WA 2QXJA 1PPBH 1HLTH 1P8VC 2GX4A 2XBXA 2FDAA 4WF8A 4BTUB 1DWDH 1QY6A 3SBKA 2H5CA 1O33A 4Y71A 6GCHF 3AAUA 4DIIH 2V3HH 3HK6B 2Z9IA 1GGDC 2FEQH 2HALA 4Y7BA 1TPAE 1IQEA 2JKHA 1PPHE 3BTQE 2VVCA 4O9VA 3RXTA 1GBBA 1P9UA 1P09A 1QTFA 3LIWA 2XRCA 4JMYA 1C9TA 1ELBA 2FOEA 4CR9A 1L4DA 2PW8H 3T28A 1GBAA 1MZDA 5FHTA 1F0RA 1ZSJA 3RMMH 2UUFB 2BY6X 1C5TA 3RXUA 1DX5M 2ESTE 1HXFH 3QZRA 2XWBI 2WPHS 2W3KA 4JYUH 5DPAA 3TK5A 2JH5D 2ZTZA 3SJ8A 1K1LA 1LVYA 4D8NA 1SLVB 2CN0H 1SGCA 1C5QA 3A7XA 1X7AC 3I29A 3M61U 5L30H 1QB6A 2P8OB 3MO9A 1FY3A 1Y3WA 1GJ8B 4MPWA 1HNEE 1W13U 2ZU3A 4NSYA 2ZZUH 3SNCA 3FZDA 2ANWA 4X1SU 1FV9A 1QL8A 2OCVB 2ZFTA 4X0WU 1D3DB 1EP6A 4MDSA 1AKSA 3AASA 1TX6A 1ARCA 2O8WA 3E91A 1M9UA 4ISHH 2G55A 1DVAH 4BTTB 2ALPA 1MKXH 3AW1A 2TBSA 1GGDB 3QDZB 4E7RG 2WYJA 1J9CH 2WUBA 1LKAA 2SGAA 3GOVB 1O2IA 1C1RA 1GDQA 1ID5H 2EI8A 3MH7A 1LPZB 4WVPE 3RXRA 5A0BA 3WY8A 1O2HA 3ZVAA 2I6SA 1HJ8A 1YPHE 4IMZA 1K1MA 1PJPA 1GVKB 2W3IA 3I77A 2YNAA 1ZSKA 1DLEA 4X2YA 1CBWB 1O3FA 2ZCHP 2XBWA 3MH5A 2BVXH 4GVUA 5EW2H 4JZFH 2HPPH 1V2KT 4MPVA 1N1LA 2ZU1A 2PSXA 3DFLA 3VEQB 3U8RH 1XUIA 3KF2A 1WQSA 1KTSB 1YF4A 1GHWH 5A8YA 2B7DH 3SGQE 1C4V2 1O34A 1GBLA 1YPEH 1FY1A 1QNJA 2B0FA 2Z94A 1GBKA 1K9OE 3P8NA 2Y6TA 3U69H 2ZQ1A 2AIQA 1SGNE 1DUEA 2GMTC 1Z8IB 4O3TA 4XBDA 2ZFQH 3M5LA 2ZDKA 3B9FH 2OC1A 1NRQH 8ESTE 2BD7A 3A8DA 1LHEH 1UTOA 3VB5A 1D6WA 4XBBA 3U8OH 1UTMA 5DGJA 3ZVFA 1E37B 1FJSA 2G52A 1SPJA 2BDAA 2FTMA 1EPTC 4K8BA 1SGRE 4TY7A 4AYVB 2A5IA 1YPHC 1O2RA 1YM0A 3A80A 7GCHF 3STJA 2FZZA 5J4QA 1TGTA 1O5BB 1RGQA 4UD9H 3TPIZ 1V2ST 1AVWA 3UNSA 2OQ5A 2ZDNA 3LJJA 2VU8E 1TA2A 1LKBA 1KXAA 4IMQA 4K60A 1OXGA 1QGFA 3TGIE 1ELAA 1C5ZB 1MKWH 1JIMA 1O2VA 2Y7ZA 1P01A 3LH1A 1HRTH 4AX9H 4NWKA 1P05A 5GCHF 5I25A 1A5IA 2JETC 2PR3A 2QXHA 1DXWA 1RD3B 8KME2 2IJOB 2XC5A 2ZDLA 1UMAH 1RIWB 2UUKB 2Y5FA 1Y59T 4Q80A 2R0LA 1C2MA 1A5GH 2FP7B 1ORFA 4NWLA 3ZVBA 3RXQA 2AMDA 1SFIA 1JRTA 1KYNA 4Q7XA 1O2XA 1S0RA 3V13A 2OBOA 1QBOA 2ANKH 1C2GA 1SGFG 2QA9E 1UTPA 1JIRA 1SC8U 1EATA 4KELA 3ZVEA 4YLUA 4YOIA 1P2JA 1PQ5A 5EQQA 1OP2A 3QTVH 3M5MA 1ABJH 1O39A 3MHWU 2WPKS 1C1MA 1CHGA 2PFEA 1SLXB 2OTVA 1D3PB 2P3TB 4B74A 2GZ7A 5E2OA 1DFPA 1FY5A 1Z8JB 2SNVA 2ZDAH 3MU4A 1TNIA 3LGUA 1C5SA 4QT8C 1J17T 3BIVH 4NIXA 5DG6A 3O8CA 1UVTH 1GDNA 1CHOF 4ABHA 1QQUA 1MZAA 2PKSB 3NWUA 4F4OC 1XX9A 4WMEA 1GJ5H 1LO6A 1TRYA 1P11E 3MTYA 4LK4A 3D62A 1NY22 2F9BH 1W2KH 5JPMH 5DP6A 1BTXA 5GDSH 6GCHG 4YLQH 1V2JT 1NO9H 1SMFE 2I6QA 3RLYH 2ZFFH 1UK2A 5FCKA 3UREA 1P2QA 2SGPE 2FOBA 1PPEE 2P16A 2H5DA 1F0SA 1G3BA 1GBJA 1MUEB 5GWZA 2BQ7B 1SHHB 7LPRA 4ZXYH 2BX4A 3H7TA 4HTCH 2V6NA 1GBEA 1P2NA 2ZC9H 3QGJA 3BSQA 3TGJE 3RXHA 1ANEA 2H9TH 2WINI 4LZ1H 1V6DA 3S69A 3RXPA 1E34B 1ZR0A 3E0NB 4FUGA 1ESTA 3UWIA 3KHVA 4JCNA 1AUJA 3MYWA 2ANYA 1O3HA 5L2ZH 3Q00A 3KL6A 1FN6A 3HKJB 4X2VA 3O8DA 2EC9H 1HUTH 2ZIQH 4YM9A 1XVMA 1YCPM 2HLCA 4NG9H 2A7JA 2ZU2A 3L6PA 2VVUA 1SQAA 4I8JA 3U8TH 1H8IH 4ISIH 1KLJH 3ESTA 4UEHH 4A92A 1KLTA 3URCA 1V2RT 3T29A 1V2QT 4AORA 1SI5H 3BTFE 1BBRK 2BMGB 1O2MA 1XKBC 3PLPA 4DG4A 1DXPA 3P17H 3N7OA 4DW2U 1WV7H 3MO6A 4CRCA 4OS6A 1ZMLA 2XC0A 3VXEH 1BMNH 5IYTA 4CRAA 4FUEA 4KTSA 1IQGA 3UOUA 2CF8H 2ZCLP 1A2CH 1D4PB 1W7GH 2A0QB 3GYLB 1YGCH 2GV6A 2FM2A 5AF9H 3E1XB 2PLXA 1BRUP 1O3AA 1BTHH 3HGNA 1BMMH 1W12U 3RXJA 1O2ZA 5DKMA 1C2EA 4F49A 2ZCKP 1RTKA 3AVZA 1TLDA 4AFZA 3PMAB 3ZYEA 4NFFA 2GZ8A 1DPOA 1SBWA 1LHGH 1Z8RA 3UR9A 1LPGB 2GCTB 2WPLS 2FESH 5E2PA 5DP9A 2FIRH 3GY7A 2FMJA 4OS7A 1P04A 2VINA 3UNRA 2OP9A 6CHAB 3T25A 4VGCC 2ZDVH 3ZVGA 4CBOA 2GP9B 4ZH8A 3ATMA 2C3SA 3NK8A 4ZROA 2C8XB 4ZKSU 1FY8E 1V2WT 2HGTH 1GMHF 1S84A 3KN2A 2PTNA 1FXYA 5GXPA 2XC4A 1INCA 1VGCB 3TLOA 1JRSA 7GCHG 2PGBB 1BRAA 1EJNA 1JWTA 4IBLH 4JZDH 4A6LA 4INHA 2WPIS 3HPTB 5HYOA 2C93B 4A1VA 1CVWH 1O5DH 1YPLH 1C1SA 4DOQA 3SU3A 4IW4E 2J4IA 1KXBA 1C5NH 2ZWLH 1TNHA 2BX3A 1TMUH 3GCOA 3TJVA 2ZGHA 1K1IA 2BY8X 3QUMP 1UK4A 1F7ZA 1O5CB 2AYWA 4CH8B 5A2MH 2W5EA 5JBAS 1GI5A 1YC0A 1NPMA 1DITH 3NUMA 1C2LA 4I8HA 2Y7XA 1OWDA 1XXFA 1ZGIA 1UTLM 4Y8YA 1TPSA 3DD2H 1BT7A 5A0CA 5C1YA 2ULLA 1VGCC 1P02A 3RC5A 1ETTH 2PUQH 3SU2A 3FP8E 1JMOH 2W26A 1HV7A 1UVOA 1AVGH 1CGHA 2BYAX 3NXPA 1O2PA 3Q3YA 2R3UA 1XM1A 2FI3E 1IHSH 1L4ZA 4INLA 1HAVB 1WQVH 2BVRH 2H6MA 2LNCA 2ALVA 1E35B 1DDJA 1G2LA 1K2I1 4XE4A 2Q6GA 1IQIA 1GHVH 1QL7A 2A4OA 2Y82A 3I78A 1MQ6A 4CRGA 1H4WA 2TGPZ 1OS8A 4FVDA 3QO6A 4JK5A 2VGCC 3FP7E 3QK1A 1JOUB 5EXLA 1THSH 2BY5X 2TRMA 5SGAE 2FOFA 4O03A 1HGTH 1MTWA 3EGKH 1Y3VA 3T2NA 4A1TA 3W95A 1UVPA 4YOJA 2OUAA 1PPCE 2RA0A 1WTGH 2O8MA 1QBNA 3IG6B 1J15A 4OGXA 1W7XH 5F8XA 1P3CA 3SOSA 4BNRA 1MBMA 3RU4T 1QA0A 3ZVCA 4HFPB 2JH6D 1NN6A 1TMTH 3LC3A 1AWFH 2PTCE 1UTJA 5F6MA 2ZFRH 1GMDG 3SGAE 3F9FA 4FUCA 2WPMS 3ZZ7A 1LQEA 1KDQA 4Y8ZA 2J34A 3TNTA 2AERH 2PKAA 2BY9X 4YZUA 1ZOMA 5EQRA 3SV8A 4DVAU 1H8DH 9LPRA 2F9VA 5JBBS 3SQHE 3S0NA 5EOKA 3MNBA 3GY3A 4RKJB 1NRPH 4GAWA 3NPSA 4AFQA 4NA8A 5C67A 1TBRH 1C5PA 1C5YB 1FZZA 4AN7A 3A7VA 1MU6B 2NU2E 3E16B 2G4TA 1MBQA 4BAQB 3GCTG 2BDIA 1O37A 1OKXA 1PQAA 1PQ7A 2ZPRA 4DCDA 4GLYA 1P12E 1IQNA 4ISOA 1T8LA 4NGAH 1GMCF 2CHAB 1O5EH 1NRNH 2QV1A 2J38A 3UWJH 1YLCA 1O38A 1PFXC 1K1PA 1AE8H 2J94A 2XNIA 1P2OA 3CP7A 1S5SA 1C5WB 3E3TA 5EODA 5E0GA 5GPIB 1GMDF 1QL9A 3A8CA 3GDUA 1IOEA 1E38B 3B8JA 1SHYA 2EEKA 1W8BH 3G01A 3MNSA 3V3MA 1ESAA 3SW2B 1THPB 2P3UB 4ABGA 1GHAF 4SGAE 2R9PA 1DWEH 2ZHEH 1ELVA 3VGCB 1IQLA 1GJ9B 1GBCA 4K3JA 1ZYOA 1W0ZU 2P94A 4B76A 3CS7A 2OD3B 2PUXB 1LVMA 1AFEH 2AS9A 4FUIA 5TCAA 1TONA 3PLKA 4NFEA 3TJOA 1AZZA 4A1XA 3SJ9A 3LT3A 2G00A 5EQSA 9ESTA 1BTZA 2STAE 1TFXA 4R0IA 4H6SB 2GV7A 3GDSA 2BZ6H 3M5NA 4RKOB 2HOBA 3GICB 1F92A 3NKKA 1O3NA 4WXVA 4YOGA 1A0LA 1BB0B 1EPTA 1T32A 1UVSH 2PSYA 3ZV9A 1EJMA 1F5LA 4X6MA 3A81A 2VNTA 2XW9A 1OWEA 5LPEA 1V2LT 1EAXA 2A32A 1SGDE 1O32A 1SGPE 1G32B 4XDEA 1Q31A 2XBVA 3IWMA 5DP8A 3VGCC 3ZZDA 1NFWA 4UFGH 3F9GA 1MMJN 1A0HB 1NRRH 1AB9B 1RFNA 2AH4X 3UNQA 5FBEA 4AYYB 1O2UA 1C5LH 3TH2H 4B73A 3R0FA 2TPIZ 3KNXA 4D76A 5C1XA 2FOCA 4NIYA 4U30A 4FU7A 4K1EA 2O9QA 2A7HA 1H9HE 2NU4E 3A7WA 4Q2KA 4O97A 1GBHA 3BG4C 3LGWA 1DS2E 2QXIA 4CR5A 4DURA 2BD4A 3RMNH 4B2CA 1OWIA 3B23B 1THRH 3P70B 3SU0A 4KGAA 2KAIB 3RUOA 2FODA 5T6FA 2OC0A 2NU1E 1GVLA 3RXCA 1AZ8A 4BAMB 3LH3A 3GCHB 1VCQA 2RA3A 3C1KA 4U32A 2Z9JA 3A8AA 1L0ZA 2VWNA 1IQHA 2ZFSA 1GPZA 4TY6A 2ANMH 2R0KA 2AMPA 1K1OA 2UWLA 1UJ1A 2GCHF 4IGDA 4MNXA 2EI6A 4KTUA 2CV3A 1WUNH 3JZ2B 1Y8TA 3E90B 1HAHH 1BTUA 2F9UA 1OWKA 4OS5A 2GZ9A 5EG4A 2AFQB 3A86A 3SU6A 1V2VT 2CHAC 5HM2A 7KMEH 5T6GA 1TPPA 1MTNB 5JYIA 3BTME 3SGBE 1WOFA 3PTBA 1ELCA 1H9IE 2ODQA 1DICA 4DGJA 4WY3A 1TYNA 3SUDA 4UDWH 3U9AH 3K2UA 2RDLA 4X6NA 4X2XA 1DY8A 1XUHA 1GHXH 1HFDA 2BZAA 4ABDA 5F8ZA 3M3TA 1OYTH 1IQMA 4U2WA 1G3EA 1WTHD 4X6PA 2Q6FA 1ZZZA 3SUFA 2Z3DA 1LVBA 3IITA 1ZPZA 3OX7U 1T31A 2G4UA 3DHKH 4CRFA 1ZPCA 1KXFA 2ZDMA 4I8GA 1HJ9A 3EA7A 1SB1H 4NA7A 4DY7B 4LZ4B 1KDQB 1A4WH 4AGJA 3M3VA 1NM6A 1OPHB 2AGGX 3M7QA 1PQ8A 1QR3E 5ESTE 6ESTA 4MPUA 3T26A 3F1SB 4D7GA 1AMHA 4X2WA 1IQJA 1FNIA 1OOKB 2VWLA 1P10A 1GJ6A 1HAYB 2Z6BD 2ZHDA 4FUHA 1O2QA 2B9LA 1RTLA 4YTAA 2XCNA 1YPGH 4WJG2 3UFAA 1FONA 3UQVA 3RU4D 3H7OA 1P2MA 4HI3A 1N6YA 1C4U2 3BV9B 3T62A 1FAKH 1BTYA 1T4UH 4Y0YE 1KXCA 1C2KA 1BJVA 1FQ3A 3LDXH 1N6XA 1F5KU 4FVBA 1BMAA 2SGEE 2FLRH 2ZHWH 3BTGE 1KY9A 1VITG 4MNVA 1FPHH 1KXEA 5A09A 1V2OT 5IDKA 1B5GH 1BDAA 5TJXA 1SGQE 2O8UA 3ZZBA 4U01A 4JYTA 5F03A 2R2WU 2A2QH 1C1VH 2HNTE 1DT2A 1RRKA 2ZFPH 1O3MA 3VFEA 4B2AA 4ZKNU 1O31A 2Q1JA 3SV7A 1TGBA 2XWAA 3A7TA 3TK6A 1O2JA 3FANA 2FI5E 1L2EA 4K1TA 1YYY1 1ARBA 4UFFH 1SGTA 1BIOA 1GBIA 1O3IA 1BTPA 2ZTXA 1DANH 4Q7ZA 2P93A 2O8TA 2VH6A 3A8BA 5K7RA 4I31A 1HIAA 1GWAA 4BAOB 2BOKA 1UO6A 8GCHF 3KIDU 5T6DA 2F9PA 1K28D 1SVPA 3HKIB 1O3JA 2XTTB 3BEFB 1AFQB 1EJAA 2BY7X 3M7UA 4JZ1A 1GJDB 2H9HA 3RXEA 4E06H 5L2YH 2FOGA 3RMOH 3PWCA 1O36A 4TWWA 4Y76A 1QJ6B 4ABBA 1AD8H 1SLUB 4GUXA 2GD4B 1BOQA 1C1UH 1MKXK 1U6QA 1TABE 1FY4A 5LPFA 2AGEX 3F9EA 1O2KA 1GI0A 5I46H 1YCPH 2ZNKH 3UPEA 4J2YB 1EP5A 1ACBE 4Y79A 2A4RA 5DP3A 3UOPA 3EDXB 3QZQA 3UTUH 1CA8B 1O3LA 1QRZA 1TOMH 1BBRE 1P2KA 2QC2A 4I33A 4X8SH 3P6ZB 3UR6A 3MMGA 5E0HA 2ZHFH 3SJIA 2Y5GA 3P8GA 4X8VH 1MTSA 3RXDA 3CS0A 4IC5A 1TGNA 1O5AB 1UTNA 1CGJE 5DJ7A 1CSOE 3DT0H 2BD5A 4AB9A 1A1RA 4ZHMU 3BEUA 3RXKA 1NT1A 2BDHA 1O2OA 1C1WH 1EAWA 1HIAB 1BITA 2ZGXH 1Y3YA 2IOTA 2H1UA 1MTUA 3T27A 1TNKA 2VIPA 4AG1A 2FX4A 1TWXB 3MU8A 3RXGA 4RSPA 1ELGA 1NTPA 2HNTC 2XCFA 1BHXB 2J92A 5G4BA 5T3HA 5CMXH 2A7CA 2A45B 4OS2A 2FPZA 1C5VA 1O30A 4DT7B 1AFQC 2ZHQH 3ZZ3A 1BQYA 3Q3XA 4WXIA 4BTIB 1YPJH 4KTCA 5A8ZA 4IC6A 2GCHG 4Z0KA 1TBZH 1K22H 3SJKA 4I8KA 2PWXA 1B7XB 1SL3A 1DSTA 1LDTT 2OINA 4FUBA 2PGQB 3MH6A 3RXMA 3LPRA 2FYRA 2FI4E 2Z9LA 1SQTA 3R3GB 5AFYH 3ZZ6A 1ZTLA 3H5CB 4INKA 4NZQA 3S7HB 3TJNA 1NZQH 1AUTC 1EOLA 1TBQH 2AMQA 4FUFA 3GY4A 3ATLA 4ABFA 2OC8A 3GY2A 2V0BA 1EZXC 2TGAA 3S7KB 1AIXH 1NESE 2A31A 2HNTF 1HPGA 1CT4E 1DOJA 3A7YA 4X8TH 1ZHPA 4BANB 3SO3A 5EXNA 3VPKA 1O35A 3K6ZA 1O2WA 4H4FA 4FUJA 5LPRA 4WH6A 1E36B 2LPRA 2BD2A 3BTTE 3FFGA 1A3BH 1BJUA 1KTTB 1KXDA 3TH3H 1EZQA 2BDGA 1V3XA 3TJUA 5HMAA 1L1JA 4RN6A 3RXSA 1ZLRA 1C1PA 3OTJE 3ZZ5A 2GVFA 1ZMNA 4GCHF 1EAUA 1SSXA 4GHTA 3TITA 3PO1C 2BDCA 1G9IE 1G36A 2ZPQA 2ZF0H 3F68H 3E0PB 1EXFA 2OBQA 4MNWA 3GISB 1S85A 1CE5A 4B75A 5J4SA 1O2GH 2QF0A 1FPCH 2B8OH 1TAWA 1RJXB 2AIPA 1TNLA 1S0QA 1W14U 4ESTE 5PTPA 2FOMB 2CXVA 1XUGA 1LHFH 1A7SA 3LGTA 1C2HA 1TB6H 4GCHG 3TVJB 1OWJA 3HGPA 3PO1B 4ZHLU 1LQDB 2EA3A 2ODPA 1A3EH 1Q3XA 3NZIA 4ABIA 1TE0A 4Y0ZE 3QWCH 1WYKA 5EPNA 1EUFA 3PYHA 1S83A 4Y8XA 1Y3UA 3Q76A 4UE7H 2FO9A 8GCHG 1YBWA 2VIVA 2FS8A 4NIWA 1ZJKA 2HVXA 2VWOA 3ATWA 2BLWA 3CENA 2HWLB 1FUJA 5JB8S 1K1NA 4CBNA 3VXFH 2DE8A 4OS1A 3ATKA 4Q7YA 1SOZA 1QCPA 3SN8A 4MQAA 4PROA 1FI8A 1YPKH 1P03A 1PPFE 1GI3A 1T8MA 4I32A 1GMCG 1UCYE 1WBGB 3OY5U 1K21H 5FCRA 3BTWE 2SGFE 3VB6A 2PV9B 2Z9GA 1HJAC 2ZGCA 1VZQH 3BG4B 1ANBA 3BIUH 2GKVE 5HM9A 1AHTH 4AFSA 1Z71A 1AKSB 2ZTYA 1XUJA 2V3OH 1BCUH 2C90B 3RM0H 1Z1JA 2UWPA 4CHAC 3KQCA 3OYPA 1HDTH 2NWNA 3MOCA 1BZXE 4YT7H 4TPYA 1F2SE 5FPSA 4ISNA 2DUCA 1HAVA 1P06A 4AB8A 4ISLA 3RU4E 3EAJA 3PMJA 1EZSC 3BTKE 4E7NA 3RXAA 2BLQA 1XUFA 3S9BA 1GBDA 1SGEE 1YCPK 4MPXA 2WV5A 3LONA 1MCTA 2ZQ2A 2FWWA 4KKDA 3SNBA 3RXOA 1WSSH 1GJCB 3F6UH 3RP2A 3STIA 2H9EH 1BA8B 1GI9B 2ZI2H 3ZZ9A 1A0JA 3QLPH 2F83A 1LHCH 2QAAA 1YP9A 4JYVH 3SU5A 4JK6A 4AGKA 1D9IA 1O3PB 1A61H 3ODDA 5A8XA 2BXTH 1O5GH 5DP7A 1DLKB 3C27B 2SGQE 5B6OA 1CHOG 1ELTA 1QFKH 1CQQA 4ZXXH 4CRDA 1Q2WA 1HAPH 2D1JA 2P59A 2VIDA 1K1JA 1TX7A 2B5TB 3PWBA 4MG3A 2F9NA 3MI4A 3PMHB 5DO4H 1P2IA 3BTEE 5FX6A 1B0FA 2STBE 4CHAB 1XMNB 3SQEE 1MTNC 1TNGA 3FVFB 5FAHA 3ZV8A 2XXLA 1GL0E 3ZZ8A 2SFAA 4X1QU 1UCYH 2J95A 3L33A 1DWCH 4O3UA 1Z6JH 3V7TA 1GBTA 1ELDE 3BN9A 1PYTD 1B0EA 2ZP0H 1J14A 2IPHA 2VIQA 2FX6A 1T7CA 2W7UA 1P57B 3P8FA 5JBCS 1C2DA 1HAXB 2J9NA 1XUKA 1O0DH 4NA9H 2AEIH 3A82A 3SNEA 2FYQA 1O3GA 1TQ7B 1L1NA 1OSSA 1TQ0B 1ZMJA 4GHQA 1OP8A 3MH4A 4JZIA 4X1PU 5GIBA 1GG6C 3ZZ4A 1VJAU 3RC4A 2HRVA 2ZEBA 2AGIX 1EKBB 3SUGA 1A46H 1TRNA 2V35A 1TALA 2Z9KA 1D6RA 7ESTE 2DE9A 1GI6A 4B2BA 3ATIA 3A87A 4OS4A 1D3TB 3OSYA 3AW0A 1UHBA 5E8EH 1P9SA 3BTHE 2BOHB 4DJZB 3QGNB 1O2YA 1IQKA 3ZVDA 3V0XA 3UUZA 1KLIH 2FLBH 2BM2A 3K65B 4LXBH 1DY9A 3W94A 1H9LB 1TRMA 1ELEE 1V2UT 4CRBA 1ZHRA 3SV9A 1ZJDA 4Z6AH 4AG2A 1ZGVA 3PLBA 1XXDA 3GY5A 1IHTH 5FPTA 1SQOA 1VITF 4WWYA 6CHAC 1QB1A 2ODYB 2SGDE 1QRWA 3QTOH 3TGKE 3TNSA 4FU9A 3P95A 4WMDA 1CBWC 3AAVA 3KQDA 1GI4A 1SGYE 2G8TA 1CA0B 4UONA 4JZEH 2BLVA 3SNDA 2GDDA 4IS5A 4AZ2B 2BDYA 4NCYA 1S81A 1GJ7B 1NC6A 4MVNA 1Y5UT 4I7YH 4CH2B 1HXEH 3BF6H 2VGCB 1QBVH 5FBIA 1V2NT 2FXRA 2NU0E 5GCHG 1G2MA 2M5TA 1GHBG 1Z8GA 1H1BA 1ZHMA 2G5NA 3RM2H 1VJ9U 3ITIA 2NU3E 4ZMAH 3DUXH 4K1SA 4NSVA 1NS3A 1HAOH 4Y7AA 1C4Y2 3O8BA 5CHAB 3BTDE 1GBFA 1C1NA 3A88A 2ZKSA 2G5VA 5CHAC 1CT2E 1ZTKA 1UHBB 3VB3A 1AY6H 1T8NA 5EGMA 5AHGH 5C2ZA 3SV6A 1A5HA 2C8ZB 2PHBA 2CMYA 2K1QA 4FU8A 2VJ1A 4BAKB 1C9PA 3KEEA 1TX8A 2PKAB 2Q6DA 1GCDA 1EAIA 1C5MD 3OU0A 1DUAA 3LGIA 2ZGJA 1MCVA 1G30B 1MH0A 3V12A 2QXGA 1O3DA 2OQUA 1JBUH 1HB0B 1TOCB 5FXLA 2TGTA 1GG6B 1UVUH 3KGPA 1GVZA 1YPMH 3EE0B 4ASHA 1YLDA 5EW1H 3LC5A 2Z3CA 1MD7A 3NCLA 1NFUA 3K6YA 2QYIA 2FOHA 1O2TA 1FIZA 3D23A 4R8TB 1SLWB 4NIVA 5EU8A 4SGBE 3ZZAA 2VH0A 4MLFB 1CU1A 2BHGA 1RS0A 1BRBE 4TPIZ 5JDUB 1AO5A 1NFXA 4TYDA 5BPEA 2BD9A 5GJ4B 1XKAC 3SU4A 1EB1H 1S82A 1MKWK 3GY6A 1OWHA 1J8AA 1O3CA 4J1YA 1MAYA 3QX5H 1BMLA 2OXSA 1GJAB 4OGYA 3PTNA 5EPYA 1MTVA 1ETSH 2BXUH 1WCZA 4YT6H 1NRSH 2P95A 2ZO3H 3Q77A 5LGOA 1AWHB 1L1GA 3P8OA 1TA6A 3HK3B 3LOXA 1KSNA 1CO7E 3UIRA 4UFEH 4WH8A 2TIOA 3TIUA 1GDUA 5ETXA 2SNWA 2A5AA 1NROH 4BXSA 1VR1H 3A83A 4X8UH 5HGGA 1NFYA 4X1RU 3FZZA 3D65E 3GCHC 5EXMA 3SUEA 3D49H 1EQ9A 4ZUHA 1AI8H 1V2MT 3GDVA 4XBCA 1S6HA 4K8YA 3VB7A 1MD8A 1TMBH 2WUCA 1J16A 4I8LA 2ZU5A 1G3CA 3RXBA 3M35A 1FN8A 1P3EA 2BLOA 3MU1A 1VITH 2FTLE 3UY9A 2BB4A 1HBTH 1GHZA 2H2ZA 1HAGE 1LPKB 2VIWA 1PYTC 1D3QB 2JH0D 1OP0A 1C2FA 3RMLH 2ZPSA 4M7GA 3SI4H 2JETB 2GGVB 4Y10E 1UTQA 3LU9B 4ABJA 2QN5T 3RXVA 1ZTJA 4XSKU 3LGYA 3MO3A 2A2XH 2UUYA 1ANCA 3TH4H 5C5OA 3URDA 3L3TA 2XYAA 3LGVA 1QQ4A 1FIWA 1UK3A 1PPZA 1TNJA 2ZGBH 2GCTC 3M5OA 2WPJS 2FS9A 4X1NU 3KQBA 2IN2A 1HYLA 3K9XB 3A84A 1Y3XA 4X6OA 2ZG0H 4AFUA 1AU8A 2C8WB 1TPOA 3U1IB 4IN1A 1ZSLA 3ENSB 1AN1E 2WYGA 4K69A 4XOJA 1LCYA 3RXFA 2A5KA 2UWOA 1LTOA 1ABIH 3ELAH 3M3SA 4H42U 1C5RA 5DP5A 2VB0A 1QURH 4YESB 1HCGA 1VCWA 3PM3A 1AGJA 2W7SA 4AOQA 1ZPBA 2Z7FE 3PV4A 1IAUA
chains in the Genus database with same CATH superfamily
3RLWH 1O2SA 1O5FH 2VWMA 3PB1E 1DWBH 2ZA5A 2Z3EA 2ZECA 1RXPA 3MU5A 3M37A 4UFDH 3GCTF 3T5FH 2Y80A 1SOTA 3A85A 1ZRBA 5DP4A 2C4FH 1PPGE 2TGDA 1SR5C 1GJ4H 3MNCA 3RXLA 4ZKOU 1JXPA 3FN8A 1DSUA 2GT8A 3DCLA 2VVVA 5F8TA 2XBYA 1KIGH 1W3CA 2G51A 1O3KA 1O3BA 4VGCB 3SU1A 1WAYB 1ELFA 4K2YA 1CT0E 2R2MB 5DN6D 2C8YB 4A5TS 1C2IA 3Q3KA 3UQOA 2HPQH 1P0SH 4BOHA 5C5NA 5ESBA 4CREA 2VIOA 3P92A 5HXFA 1V2PT 2P3FH 4TWYA 4XRNA 4E05H 5H4IB 2ASUB 2F91A 1GI2A 3QN7A 2Y81A 3MNXA 1AE5A 3GCNA 1GL1A 2EY4C 5FPYA 1FDPA 1HAIH 3VB4A 3HATH 3KQEA 1EASA 5K0HA 2ILNA 3TU7H 2BQWB 2BD3A 2CGAA 1SGFA 4Y6DA 4YO9A 1CA0C 1VCPA 2QCYA 2FOAA 2WV4A 1SGIB 1QB9A 5AVDA 1EOJA 3RXIA 1UTKA 1SG8B 5CE1A 2Y5HA 2BVSH 2OLGA 4XFQA 3RC6A 2G81E 4BAHB 3S9CA 1EZUC 1SQRA 3S9AA 4B1TA 1N8OC 3EA9A 1QA7A 5DK1A 5TCCA 1C5UA 1QRXA 3MFJA 1C5OH 1YKTA 1V2TT 3SORA 3SJOA 3MWIU 1HJAB 4TSFD 2R3YA 2A4QA 2IPQX 2QY0B 2GDEH 5ABWA 1MQ5A 1ANDA 1Z6EA 1TGSZ 1BUIA 2YNBA 5B6LA 4KP0A 1AVXA 1O2NA 2A1DB 2THFB 3OY6U 3GYMA 3ODFA 3PMBB 1FMGA 3JZ1B 4H6TA 1CGIE 1G3DA 1NU7B 1Z1IA 5JBTA 1EPTB 1LMWB 6LPRA 1GHBF 2A4GA 3LKWA 3E8LA 1SFQB 3A89A 1GCTC 1LHDH 1W11U 1BBRH 1AB9C 4MTBA 4Y11E 1O2LA 5A0AE 3BG8A 5FX5A 1OX1A 5C3NA 1Y5AT 3EA8A 2YOLA 1DM4B 2QGRA 2GTBA 4ZAEA 1QIXB 2QF3A 1LVOA 3SHAH 5E0JA 1GJBB 4ABAA 4HZHA 2F9OA 5BRRE 1FAXA 1ETRH 2PKSC 3VG8A 1UCYK 1GI7B 2GMTB 4THNH 1TGCA 5C20A 1XVOA 1QHRB 5AFZH 4D7FA 1O3OA 3PROA 1F5RA 4FUDA 2BD8A 3U98H 4WMFA 3RDZA 1IQFA 2QIQA 2F3CE 1Y5BT 1F0UA 4B71A 1GMHG 1Z7KA 2D2DA 1E0FD 3ZYDA 1C5XB 3DSOA 1T4VH 1GI8B 3TK9A 3LJOA 5C1UA 3SNAA 4MNYA 3F9HA 3SHCH 2RG3A 1EX3A 5EJZA 1DE7H 1C1QA 1MU8B 1C2JA 3SV2H 1MAXA 3SI3H 4K5ZA 3M7TA 3O8RA 5LH8A 3ZZCA 5EJLA 3MU0A 2P8OC 2O8LA 1WU1A 2ZU4A 2RCEA 1W10U 5L6NH 1S6FA 1TIOA 3N7DA 1QJ7B 4FXGH 1GHYH 1QJ1B 1F0TA 1W0YH 1HAZB 3SZNA 1GCTB 5JB9S 4D9RA 2OC7A 1RIWC 4GPGA 4ABEA 1N8OB 2EI7A 1C1TA 1O3EA 2BTCE 3U1JB 1NU9A 3KYGA 3GY8A 1RTFB 3A7ZA 4LOYH 1ZRKA 1FLEE 1GI1A 4NZLA 4HGCA 2BDBA 3EQ0H 2WZQA 2CF9H 1T8OA 3E6PH 4BXWA 2UUJB 1C1OA 2D26C 3KCGH 4D9QA 1G37A 3DA9B 3FAOA 2RFKC 1OYQA 4DIHH 1BRCE 8LPRA 1GBMA 1ESBA 1BHXF 2GT7A 3DFJA 1EB2A 4IN2A 3FP6E 2KAIA 4A7IB 3EYDA 2KM0A 1GHAG 2BQ6B 2CJIA 1AQ7A 4GSOA 3M36A 4ZKRU 3BEIB 1BTWA 2J2UA 4ZHAA 3CNRA 2QE7D 1VKYA 2D8WA 2QXJA 1PPBH 1HLTH 1P8VC 2GX4A 2XBXA 2FDAA 4WF8A 4BTUB 1DWDH 1QY6A 3SBKA 2H5CA 1O33A 4Z1MD 4Y71A 6GCHF 1WDIA 3AAUA 4DIIH 2V3HH 3HK6B 2Z9IA 1GGDC 2FEQH 2HALA 4Y7BA 1TPAE 1IQEA 2JKHA 1PPHE 3BTQE 2VVCA 4O9VA 3RXTA 1GBBA 4FETA 3UAIC 3OEED 1P9UA 1P09A 1QTFA 3LIWA 2XRCA 4JMYA 1C9TA 1ELBA 2FOEA 4CR9A 1L4DA 2PW8H 3T28A 1GBAA 1MZDA 5FHTA 1F0RA 3OFND 1ZSJA 2WSSD 3RMMH 3ZIAD 2UUFB 2BY6X 1C5TA 3RXUA 1DX5M 4DT4A 2ESTE 1HXFH 3QZRA 2XWBI 2WPHS 2W3KA 4JYUH 1W0JD 5DPAA 3UB0A 3TK5A 2JH5D 2ZTZA 3SJ8A 1K1LA 1LVYA 4D8NA 1SLVB 2CN0H 1SGCA 1C5QA 3A7XA 1X7AC 3I29A 3M61U 5L30H 1QB6A 2P8OB 3MO9A 1FY3A 1Y3WA 1GJ8B 4MPWA 1HNEE 1W13U 2ZU3A 4NSYA 2ZZUH 3SNCA 3FZDA 2ANWA 4X1SU 1FV9A 1QL8A 2OCVB 2ZFTA 2OK5A 4X0WU 1D3DB 3FKSD 1EP6A 4MDSA 1AKSA 3AASA 1TX6A 1ARCA 2O8WA 3E91A 1M9UA 4ISHH 2G55A 1DVAH 4BTTB 3H09A 2ALPA 1MKXH 3AW1A 2TBSA 1GGDB 3QDZB 4E7RG 4P02A 2WYJA 1J9CH 2WUBA 1LKAA 2SGAA 3GOVB 1O2IA 1C1RA 1GDQA 1ID5H 2EI8A 3MH7A 1LPZB 4WVPE 3RXRA 5A0BA 3WY8A 2KCOA 1O2HA 3ZVAA 2I6SA 1HJ8A 1YPHE 4IMZA 1K1MA 1PJPA 1GVKB 2W3IA 3I77A 2YNAA 1ZSKA 1DLEA 4X2YA 1CBWB 1O3FA 2ZCHP 2XBWA 3MH5A 2BVXH 4GVUA 5EW2H 4JZFH 2HPPH 1V2KT 4MPVA 1N1LA 2ZU1A 2PSXA 3DFLA 3VEQB 3U8RH 1XUIA 3KF2A 1WQSA 1KTSB 1YF4A 1GHWH 5A8YA 2B7DH 3SGQE 1C4V2 1O34A 1GBLA 1YPEH 1FY1A 2KCAA 1QNJA 2B0FA 2Z94A 1GBKA 1K9OE 3P8NA 2Y6TA 3U69H 2ZQ1A 2AIQA 1SGNE 1DUEA 2QF4A 2GMTC 1Z8IB 4O3TA 4XBDA 2ZFQH 3M5LA 2ZDKA 3B9FH 2OC1A 1NRQH 8ESTE 2BD7A 3A8DA 1LHEH 1UTOA 3VB5A 1D6WA 4XBBA 3U8OH 1UTMA 5DGJA 3ZVFA 1E37B 1FJSA 2G52A 1SPJA 2BDAA 3DSGA 2FTMA 1EPTC 1E79D 4K8BA 5CDFE 1SGRE 4TY7A 4AYVB 2A5IA 1YPHC 1O2RA 1YM0A 3A80A 7GCHF 3STJA 2FZZA 5J4QA 1TGTA 1O5BB 1RGQA 4UD9H 3TPIZ 1V2ST 1AVWA 3UNSA 2OQ5A 2ZDNA 3LJJA 2VU8E 1TA2A 1LKBA 1KXAA 4IMQA 4K60A 1OXGA 1QGFA 3TGIE 1ELAA 1C5ZB 1MKWH 1JIMA 1O2VA 4RI0A 2Y7ZA 1P01A 1KMHB 3LH1A 1HRTH 4AX9H 4NWKA 1P05A 5GCHF 5I25A 1A5IA 2JETC 2PR3A 2QXHA 1DXWA 1RD3B 8KME2 2IJOB 2XC5A 2ZDLA 1UMAH 1RIWB 2UUKB 2Y5FA 1Y59T 4Q80A 2R0LA 1C2MA 1A5GH 2FP7B 1ORFA 4NWLA 3ZVBA 3RXQA 2AMDA 1SFIA 1JRTA 1KYNA 4Q7XA 1O2XA 1S0RA 3V13A 2OBOA 1QBOA 2ANKH 1C2GA 1SGFG 2QA9E 1UTPA 1JIRA 1SC8U 1EATA 4KELA 3ZVEA 4YLUA 4YOIA 1P2JA 1PQ5A 5EQQA 1OP2A 3QTVH 3F0OA 3M5MA 1ABJH 1O39A 3MHWU 2WPKS 1C1MA 1CHGA 2PFEA 1SLXB 2OTVA 1D3PB 2P3TB 2J98A 4B74A 2GZ7A 5E2OA 3F2FA 1DFPA 1FY5A 1Z8JB 2SNVA 2ZDAH 3MU4A 1TNIA 3LGUA 1C5SA 4QT8C 1J17T 3BIVH 4NIXA 5DG6A 3O8CA 1UVTH 1GDNA 1CHOF 4ABHA 1QQUA 1MZAA 2PKSB 3NWUA 2GJGA 4F4OC 1XX9A 4WMEA 1GJ5H 1LO6A 1TRYA 1P11E 3MTYA 4LK4A 3D62A 1NY22 2F9BH 1W2KH 5JPMH 5DP6A 1BTXA 5GDSH 6GCHG 4YLQH 1V2JT 1NO9H 5DSFA 1SMFE 2I6QA 2K8IA 3RLYH 1K0HA 2ZFFH 1UK2A 5FCKA 3UREA 1P2QA 2SGPE 2FOBA 1PPEE 2P16A 2H5DA 1F0SA 2JIZD 1G3BA 1GBJA 4AC9A 1MUEB 5GWZA 2BQ7B 1SHHB 7LPRA 4ZXYH 2BX4A 3H7TA 4HTCH 2V6NA 1GBEA 1P2NA 2ZC9H 2VBCA 3QGJA 3BSQA 3TGJE 3RXHA 1ANEA 2H9TH 2WINI 4LZ1H 1V6DA 3S69A 3RXPA 1E34B 1ZR0A 3E0NB 4FUGA 1ESTA 3UWIA 3KHVA 4JCNA 1AUJA 3MYWA 2ANYA 1O3HA 5L2ZH 3Q00A 2LP6A 3KL6A 1FN6A 3HKJB 4X2VA 3O8DA 2EC9H 1HUTH 2ZIQH 4YM9A 1XVMA 1YCPM 2HLCA 4NG9H 2A7JA 2ZU2A 3L6PA 2VVUA 1SQAA 4I8JA 3U8TH 1H8IH 4ISIH 1KLJH 3ESTA 4UEHH 4A92A 1KLTA 3URCA 1V2RT 3T29A 1V2QT 4AORA 1SI5H 3BTFE 1BBRK 2BMGB 1O2MA 1XKBC 1YWUA 3PLPA 4DG4A 1DXPA 3P17H 3N7OA 4P00A 4DW2U 1WV7H 3MO6A 4CRCA 4OS6A 1ZMLA 2XC0A 5HIYA 3VXEH 1BMNH 5IYTA 4CRAA 4FUEA 4KTSA 1IQGA 3UOUA 2CF8H 2ZCLP 1A2CH 1D4PB 1W7GH 2A0QB 2KCPA 3GYLB 1YGCH 2GV6A 2FM2A 5AF9H 3E1XB 2PLXA 1BRUP 1O3AA 1BTHH 3HGNA 1BMMH 1W12U 3RXJA 1O2ZA 5DKMA 1C2EA 3N7EA 4F49A 2ZCKP 1RTKA 3AVZA 1TLDA 4AFZA 3PMAB 3ZYEA 4NFFA 2GZ8A 1DPOA 1SBWA 1LHGH 1Z8RA 3UR9A 1LPGB 2GCTB 2WPLS 2FESH 5E2PA 5DP9A 1W0KD 2FIRH 3GY7A 2FMJA 4OS7A 1P04A 2VINA 3UNRA 2OP9A 6CHAB 3T25A 4VGCC 2ZDVH 3ZVGA 4CBOA 2GP9B 4ZH8A 3ATMA 2C3SA 3NK8A 4ZROA 2C8XB 4ZKSU 1FY8E 1V2WT 2HGTH 1GMHF 1S84A 3KN2A 2PTNA 1FXYA 5GXPA 2XC4A 1INCA 1VGCB 3TLOA 1JRSA 7GCHG 3N99A 2PGBB 1BRAA 1EJNA 1JWTA 4IBLH 4JZDH 4A6LA 4INHA 2WPIS 3HPTB 5HYOA 2C93B 4A1VA 4ACBA 1CVWH 1O5DH 1YPLH 1C1SA 4DOQA 3SU3A 4IW4E 2J4IA 1KXBA 1C5NH 2ZWLH 1TNHA 2BX3A 1TMUH 3GCOA 3TJVA 2ZGHA 1K1IA 2BY8X 1EFRD 1UK4A 3PV2A 3QUMP 1F7ZA 1O5CB 2AYWA 4CH8B 5A2MH 2W5EA 5JBAS 1GI5A 1YC0A 1NPMA 1DITH 3NUMA 1C2LA 4I8HA 2Y7XA 1OWDA 1XXFA 1ZGIA 3U28C 1UTLM 2AHME 1TPSA 2QF5A 4Y8YA 5A0CA 5C1YA 5C0UA 2W6ID 2ULLA 3DD2H 1BT7A 1VGCC 1P02A 3RC5A 1ETTH 2PUQH 3SU2A 3FP8E 1JMOH 2BYAX 1HV7A 1UVOA 1AVGH 1CGHA 2W26A 2WPDD 3NXPA 1O2PA 3Q3YA 4RT1A 2R3UA 3GS9A 1XM1A 2FI3E 1IHSH 1L4ZA 4INLA 1HAVB 1WQVH 2BVRH 2H6MA 2LNCA 2ALVA 1E35B 1DDJA 1G2LA 1K2I1 4XE4A 2Q6GA 1IQIA 1GHVH 1QL7A 2A4OA 2Y82A 3I78A 1MQ6A 4CRGA 1H4WA 2TGPZ 1OS8A 4FVDA 3QO6A 4JK5A 2VGCC 3FP7E 3QK1A 1JOUB 5EXLA 2IJD1 1THSH 2BY5X 2TRMA 5KECA 5SGAE 2FOFA 4O03A 2F43B 1HGTH 1MTWA 3EGKH 1Y3VA 3T2NA 4A1TA 3W95A 1UVPA 4YOJA 2OUAA 1PPCE 2RA0A 1WTGH 2O8MA 1QBNA 3IG6B 1J15A 4OGXA 1W7XH 5F8XA 3SYJA 1P3CA 3SOSA 4BNRA 1MBMA 4RT0A 3RU4T 1QA0A 3ZVCA 4HFPB 2JH6D 1NN6A 1TMTH 3LC3A 1AWFH 2PTCE 1UTJA 1YY3A 2W6JD 5F6MA 2ZFRH 1GMDG 3SGAE 3F9FA 4FUCA 2WPMS 3ZZ7A 1LQEA 3F2HA 1KDQA 4Y8ZA 2J34A 3TNTA 2AERH 2PKAA 2BY9X 4YZUA 1ZOMA 5EQRA 3SV8A 4DVAU 1H8DH 9LPRA 2F9VA 5JBBS 3SQHE 2HVYB 3S0NA 5EOKA 3MNBA 3GY3A 4RKJB 1NRPH 4GAWA 3NPSA 4AFQA 4NA8A 5C67A 1TBRH 1C5PA 1C5YB 1FZZA 4AN7A 3A7VA 1MU6B 2NU2E 3E16B 2G4TA 1MBQA 4BAQB 3GCTG 2BDIA 1O37A 1OKXA 1PQAA 1PQ7A 2ZPRA 4DCDA 4GLYA 1P12E 1IQNA 4ISOA 1T8LA 3KYFA 4NGAH 1GMCF 3F3BA 2CHAB 1O5EH 1NRNH 2QV1A 2J38A 3UWJH 4OM9A 1YLCA 1O38A 1PFXC 1K1PA 1AE8H 2J94A 2XNIA 1P2OA 3CP7A 1S5SA 1C5WB 3E3TA 5EODA 5E0GA 5GPIB 1GMDF 1QL9A 3A8CA 3GDUA 1IOEA 1E38B 3B8JA 1SHYA 2EEKA 1W8BH 3G01A 3MNSA 3V3MA 1ESAA 3SW2B 1THPB 2P3UB 4ABGA 1GHAF 4SGAE 2R9PA 1DWEH 2ZHEH 1ELVA 3VGCB 1IQLA 1GJ9B 3PRDA 1GBCA 4K3JA 1ZYOA 4ZCNA 1W0ZU 2P94A 4B76A 3CS7A 2OD3B 2PUXB 1LVMA 1AFEH 2AS9A 4FUIA 5TCAA 1TONA 3PLKA 4NFEA 3TJOA 1AZZA 4A1XA 3SJ9A 3LT3A 2G00A 5EQSA 9ESTA 5C0TA 1BTZA 2STAE 1TFXA 4R0IA 1FX0B 1NBMD 4H6SB 2GV7A 2WHXA 3GDSA 2YMSB 2BZ6H 3M5NA 4RKOB 2HOBA 3GICB 1F92A 3NKKA 1O3NA 4WXVA 4YOGA 1A0LA 1BB0B 1EPTA 1T32A 1UVSH 2PSYA 3ZV9A 1EJMA 1F5LA 4X6MA 2KR7A 3A81A 2VNTA 3WWFA 2XW9A 1OWEA 5LPEA 1V2LT 1EAXA 2A32A 1SGDE 1O32A 1SGPE 1G32B 4XDEA 1Q31A 2XBVA 3IWMA 5DP8A 3VGCC 3ZZDA 1NFWA 4UFGH 3F9GA 1MMJN 1A0HB 1NRRH 1AB9B 1RFNA 2AH4X 3UNQA 5FBEA 4AYYB 1O2UA 3MQKC 1C5LH 3TH2H 4B73A 3R0FA 2TPIZ 3KNXA 4D76A 5C1XA 2FOCA 4NIYA 4U30A 4FU7A 4K1EA 2O9QA 2A7HA 1H9HE 2NU4E 3A7WA 4Q2KA 4O97A 1GBHA 3BG4C 3FO8D 3LGWA 1DS2E 2QXIA 4CR5A 4DURA 2BD4A 3RMNH 4B2CA 1OWIA 3B23B 1THRH 3P70B 3SU0A 4KGAA 2KAIB 3RUOA 2FODA 1COWD 5T6FA 2OC0A 2NU1E 1GVLA 3RXCA 1AZ8A 4BAMB 3LH3A 3GCHB 1VCQA 2RA3A 3C1KA 4U32A 2Z9JA 3A8AA 1L0ZA 2VWNA 1IQHA 2ZFSA 1GPZA 4TY6A 2ANMH 2R0KA 2AMPA 1K1OA 4B6FA 2UWLA 1UJ1A 2GCHF 4IGDA 4MNXA 2EI6A 4KTUA 2CV3A 1WUNH 3JZ2B 1Y8TA 3E90B 1BMFD 1HAHH 1BTUA 2F9UA 1OWKA 4OS5A 2GZ9A 5EG4A 2AFQB 3A86A 3SU6A 1V2VT 2CHAC 5HM2A 7KMEH 5T6GA 1TPPA 1MTNB 5JYIA 3BTME 3SGBE 1WOFA 3PTBA 1ELCA 1H9IE 2ODQA 1DICA 4DGJA 4WY3A 1TYNA 3SUDA 4UDWH 3U9AH 3K2UA 2RDLA 4X6NA 4X2XA 1DY8A 1XUHA 1GHXH 1HFDA 2BZAA 4ABDA 5F8ZA 3M3TA 1OYTH 5GNDA 1IQMA 4U2WA 1G3EA 1WTHD 4X6PA 3NRLA 2Q6FA 1ZZZA 3SUFA 2Z3DA 1LVBA 2WV9A 3IITA 1ZPZA 3OX7U 1T31A 2G4UA 3DHKH 4CRFA 1ZPCA 1KXFA 2ZDMA 4I8GA 1HJ9A 3EA7A 1SB1H 4NA7A 4DY7B 4LZ4B 3WW7A 1KDQB 1A4WH 1S6LA 4AGJA 3M3VA 1NM6A 1OPHB 2AGGX 3M7QA 1PQ8A 1QR3E 5ESTE 6ESTA 4MPUA 3T26A 3F1SB 4D7GA 1AMHA 2K0QA 4X2WA 1IQJA 1FNIA 1OOKB 2VWLA 1P10A 1GJ6A 1HAYB 2Z6BD 2ZHDA 4FUHA 1O2QA 2B9LA 1RTLA 4YTAA 2XCNA 1YPGH 4WJG2 3UFAA 1FONA 3UQVA 3RU4D 3H7OA 1P2MA 4HI3A 5FL7D 1N6YA 1C4U2 3BV9B 3T62A 1FAKH 1BTYA 1T4UH 4Y0YE 5C94A 1KXCA 1C2KA 1BJVA 1FQ3A 3LDXH 1N6XA 1F5KU 4FVBA 1BMAA 2SGEE 2FLRH 2ZHWH 3BTGE 1E1QD 1KY9A 1VITG 4MNVA 1FPHH 1KXEA 5A09A 1V2OT 5IDKA 1B5GH 1BDAA 5TJXA 1SGQE 2O8UA 3ZZBA 4U01A 4JYTA 5F03A 2R2WU 2A2QH 1C1VH 2HNTE 1DT2A 1RRKA 2ZFPH 1O3MA 3VFEA 4B2AA 4ZKNU 1O31A 2Q1JA 3SV7A 1TGBA 2XWAA 3A7TA 3TK6A 4Q63A 1O2JA 3FANA 2FI5E 1L2EA 4K1TA 1YYY1 1ARBA 4UFFH 1SGTA 1BIOA 1GBIA 1O3IA 1BTPA 2ZTXA 1DANH 4Q7ZA 2P93A 2O8TA 2VH6A 3A8BA 5K7RA 4I31A 1HIAA 1GWAA 4BAOB 2BOKA 1UO6A 8GCHF 1UW7A 3KIDU 5T6DA 2F9PA 1K28D 1SVPA 3HKIB 1O3JA 2XTTB 3BEFB 1AFQB 1EJAA 2BY7X 3M7UA 4JZ1A 1GJDB 2H9HA 3RXEA 4E06H 5L2YH 2FOGA 3RMOH 3PWCA 3W1EA 1O36A 4TWWA 4Y76A 1QJ6B 4ABBA 1AD8H 1SLUB 4GUXA 2GD4B 1BOQA 1C1UH 1MKXK 1U6QA 1TABE 1FY4A 5LPFA 2AGEX 3F9EA 1O2KA 1GI0A 5I46H 1YCPH 2ZNKH 3UPEA 4J2YB 1EP5A 1ACBE 4Y79A 2A4RA 5DP3A 3UOPA 3EDXB 3QZQA 3UTUH 1CA8B 1O3LA 1QRZA 1TOMH 1BBRE 1P2KA 2QC2A 4I33A 4X8SH 3P6ZB 3UR6A 3MMGA 5E0HA 1H8ED 1NBME 2ZHFH 3SJIA 2Y5GA 3P8GA 4X8VH 1MTSA 3RXDA 3CS0A 4IC5A 1TGNA 1O5AB 1UTNA 1CGJE 5DJ7A 1CSOE 3DT0H 2BD5A 4AB9A 1A1RA 4ZHMU 3BEUA 3RXKA 1NT1A 2BDHA 1H8HD 1O2OA 1C1WH 1EAWA 1HIAB 1BITA 2ZGXH 1Y3YA 2IOTA 2H1UA 1MTUA 3T27A 1TNKA 2VIPA 4AG1A 2FX4A 1TWXB 3MU8A 3RXGA 4RSPA 1ELGA 1NTPA 2HNTC 2XCFA 1BHXB 2J92A 2J98B 5G4BA 5T3HA 5CMXH 2A7CA 2A45B 4OS2A 2FPZA 1C5VA 1O30A 4DT7B 1AFQC 2ZHQH 3ZZ3A 1BQYA 3Q3XA 4WXIA 4BTIB 1YPJH 4KTCA 5A8ZA 4IC6A 2GCHG 4Z0KA 1TBZH 2PP6A 1K22H 3SJKA 4I8KA 2PWXA 1B7XB 1SL3A 1DSTA 1LDTT 2OINA 4FUBA 2PGQB 3MH6A 3RXMA 3LPRA 2FYRA 2FI4E 2Z9LA 1SQTA 3R3GB 4Q4LA 5AFYH 3ZZ6A 1ZTLA 3H5CB 4INKA 4NZQA 3S7HB 3TJNA 1NZQH 1AUTC 1EOLA 1TBQH 2AMQA 4FUFA 3GY4A 3ATLA 4ABFA 2OC8A 3GY2A 2V0BA 1EZXC 2TGAA 3S7KB 1AIXH 1NESE 2A31A 2HNTF 1HPGA 1CT4E 1DOJA 3A7YA 4X8TH 1ZHPA 4BANB 3SO3A 5EXNA 3VPKA 1O35A 3K6ZA 1O2WA 4H4FA 4FUJA 5LPRA 4WH6A 1E36B 2LPRA 2BD2A 3BTTE 3FFGA 2XNDD 1A3BH 1BJUA 1KTTB 1KXDA 3TH3H 1EZQA 2BDGA 1V3XA 3TJUA 5HMAA 1L1JA 4RN6A 3RXSA 1ZLRA 1C1PA 3OTJE 3ZZ5A 2GVFA 1ZMNA 3F0PA 2HLDD 4GCHF 1EAUA 1SSXA 4GHTA 3TITA 4YXWD 3PO1C 2BDCA 1G9IE 1G36A 4F48B 2ZPQA 2ZF0H 2KZ4A 3F68H 3E0PB 1EXFA 4I86A 5HKKD 2OBQA 4MNWA 3GISB 1S85A 1CE5A 4B75A 5J4SA 1O2GH 2QF0A 1FPCH 2B8OH 1TAWA 1RJXB 2AIPA 1TNLA 1S0QA 1W14U 2RDEA 4ESTE 3WWBA 5PTPA 2FOMB 2CXVA 1XUGA 1LHFH 1A7SA 3LGTA 1C2HA 1TB6H 4GCHG 3TVJB 1OWJA 2J5UA 3HGPA 3PO1B 4ZHLU 1LQDB 2EA3A 2KX4A 2ODPA 1A3EH 1Q3XA 3NZIA 4ABIA 1TE0A 4Y0ZE 2YMSD 3QWCH 1MABB 1WYKA 5EPNA 1EUFA 3PYHA 1S83A 3OEHD 4Y8XA 1Y3UA 3Q76A 4UE7H 2FO9A 8GCHG 1YBWA 2VIVA 2FS8A 4NIWA 1ZJKA 2HVXA 2VWOA 3ATWA 2BLWA 3CENA 2HWLB 1FUJA 5JB8S 1K1NA 4CBNA 3VXFH 2DE8A 4OS1A 3ATKA 4Q7YA 1SOZA 1QCPA 3OAAD 5CHBA 3SN8A 4MQAA 4PROA 1FI8A 1YPKH 1P03A 1PPFE 1GI3A 1T8MA 4I32A 5C17A 4M9FA 1GMCG 1UCYE 1WBGB 3OY5U 1K21H 5FCRA 3BTWE 2SGFE 4F55A 3VB6A 2PV9B 2Z9GA 1HJAC 2ZGCA 1VZQH 3BG4B 1ANBA 3BIUH 2GKVE 5HM9A 1AHTH 4AFSA 5KGOA 1Z71A 1AKSB 2ZTYA 1XUJA 2V3OH 1BCUH 2C90B 2JJ2D 3RM0H 1Z1JA 2UWPA 4CHAC 3KQCA 3OYPA 1HDTH 2NWNA 3MOCA 1BZXE 4YT7H 4TPYA 5IK2D 1F2SE 5FPSA 4ISNA 4HG6A 2DUCA 1HAVA 1P06A 4AB8A 4ISLA 3RU4E 3EAJA 3PMJA 1EZSC 3BTKE 4E7NA 3RXAA 2BLQA 1XUFA 3SZEA 3S9BA 1GBDA 5HIZA 1SGEE 1YCPK 4MPXA 2WV5A 3LONA 1MCTA 2ZQ2A 2FWWA 4KKDA 3SNBA 3RXOA 1WSSH 1GJCB 3F6UH 3RP2A 3STIA 2H9EH 3KQ5A 1BA8B 1GI9B 2ZI2H 3ZZ9A 1A0JA 3QLPH 2F83A 1LHCH 2QAAA 1YP9A 4JYVH 3PV5A 3SU5A 4JK6A 4AGKA 1D9IA 1O3PB 1A61H 3ODDA 5A8XA 2BXTH 1O5GH 5DP7A 1DLKB 3OE7D 3C27B 2SGQE 5B6OA 1CHOG 1ELTA 1QFKH 1CQQA 4ZXXH 4CRDA 1Q2WA 1HAPH 2D1JA 2P59A 2VIDA 1K1JA 1TX7A 2B5TB 3PWBA 4MG3A 2F9NA 3MI4A 3PMHB 5DO4H 2V7QD 1P2IA 3BTEE 5FX6A 1B0FA 2STBE 4CHAB 1XMNB 3SQEE 1MTNC 1TNGA 3FVFB 5FAHA 3ZV8A 2XXLA 1GL0E 3ZZ8A 2SFAA 4X1QU 1UCYH 2J95A 3L33A 1DWCH 4O3UA 1Z6JH 3V7TA 1GBTA 1ELDE 3BN9A 1PYTD 1B0EA 2ZP0H 1J14A 2IPHA 2VIQA 2FX6A 1T7CA 2W7UA 1P57B 3P8FA 5JBCS 3EE7A 1C2DA 1HAXB 2J9NA 3PRBA 1XUKA 1O0DH 4NA9H 2AEIH 3A82A 3SNEA 2FYQA 1O3GA 1TQ7B 1L1NA 1OSSA 1TQ0B 1ZMJA 4GHQA 1OP8A 3MH4A 4JZIA 4X1PU 5GIBA 1GG6C 3ZZ4A 1VJAU 3RC4A 2HRVA 2ZEBA 2AGIX 1EKBB 3SUGA 1A46H 1TRNA 2V35A 1TALA 2Z9KA 1D6RA 7ESTE 2DE9A 3F2GA 1GI6A 4B2BA 3ATIA 3A87A 4OS4A 1D3TB 3OSYA 3AW0A 1UHBA 5E8EH 1P9SA 1OHHD 3BTHE 2BOHB 4DJZB 2M2AA 3QGNB 1O2YA 1IQKA 3ZVDA 3V0XA 2JJ1D 3UUZA 2KFWA 1KLIH 2FLBH 2BM2A 3K65B 4LXBH 1DY9A 3W94A 1H9LB 1TRMA 1ELEE 1V2UT 4CRBA 1ZHRA 3SV9A 1ZJDA 4Z6AH 4AG2A 1ZGVA 3PLBA 1XXDA 3GY5A 1IHTH 5FPTA 1SQOA 1VITF 4WWYA 6CHAC 1QB1A 2ODYB 2L6OA 2SGDE 1QRWA 3QTOH 3TGKE 3TNSA 4FU9A 3P95A 4WMDA 1CBWC 3AAVA 3KQDA 1GI4A 1SGYE 2G8TA 1CA0B 4UONA 4JZEH 2BLVA 3SNDA 2GDDA 4IS5A 4AZ2B 2BDYA 4NCYA 1S81A 1E1RD 1GJ7B 1NC6A 4MVNA 1Y5UT 1SKYE 3FOAA 4I7YH 4CH2B 1HXEH 3BF6H 2VGCB 1QBVH 5FBIA 1V2NT 2FXRA 2NU0E 2CK3D 5GCHG 5T1VA 1G2MA 2M5TA 1GHBG 1Z8GA 1H1BA 4TT3D 1ZHMA 2G5NA 3RM2H 1VJ9U 3ITIA 2NU3E 4ZMAH 2EQNA 3DUXH 4K1SA 4NSVA 1NS3A 1HAOH 4Y7AA 1C4Y2 3O8BA 2J97A 5CHAB 3BTDE 1GBFA 1C1NA 3A88A 2ZKSA 2G5VA 5CHAC 1CT2E 1ZTKA 1UHBB 3VB3A 1AY6H 1T8NA 5EGMA 5AHGH 5C2ZA 3SV6A 1A5HA 2C8ZB 2PHBA 2CMYA 2K1QA 4FU8A 2VJ1A 4BAKB 1C9PA 3KEEA 1TX8A 2L74A 2PKAB 2Q6DA 1GCDA 1EAIA 1C5MD 3OU0A 1DUAA 3LGIA 2ZGJA 4XD7D 1MCVA 1G30B 1MH0A 4B6EA 3V12A 2QXGA 1O3DA 2OQUA 1JBUH 1HB0B 1TOCB 2XOKD 5FXLA 2TGTA 1GG6B 1UVUH 3KGPA 1GVZA 1YPMH 3EE0B 5KEDA 4ASHA 1YLDA 5EW1H 3LC5A 2Z3CA 1MD7A 3NCLA 1NFUA 3K6YA 2QYIA 2FOHA 1O2TA 1FIZA 3D23A 4R8TB 1SLWB 4NIVA 5EU8A 1YLNA 4SGBE 3ZZAA 2VH0A 4MLFB 1CU1A 2BHGA 1RS0A 1BRBE 4TPIZ 5JDUB 1AO5A 1NFXA 4TYDA 5BPEA 1WXRA 2BD9A 5GJ4B 4ACAA 1XKAC 3SU4A 1EB1H 1S82A 1MKWK 3GY6A 1OWHA 1J8AA 1O3CA 4J1YA 1MAYA 3QX5H 1BMLA 2OXSA 1GJAB 4OGYA 3PTNA 5EPYA 1MTVA 1ETSH 2BXUH 1WCZA 4YT6H 2KCYA 1NRSH 2P95A 2ZO3H 3Q77A 5LGOA 1AWHB 1L1GA 3P8OA 1TA6A 3HK3B 3LOXA 1KSNA 1CO7E 3UIRA 4UFEH 3DSPA 4WH8A 2TIOA 5F53A 3TIUA 1GDUA 5ETXA 2SNWA 2A5AA 1NROH 4BXSA 1VR1H 3A83A 4X8UH 5HGGA 1NFYA 4X1RU 3FZZA 1QZ8A 3D65E 3GCHC 5EXMA 3SUEA 2LELA 3D49H 1EQ9A 4ZUHA 1AI8H 1V2MT 3GDVA 4XBCA 5EJ1A 1S6HA 4K8YA 3VB7A 1MD8A 1TMBH 2V3MA 1J16A 2WUCA 4I8LA 2ZU5A 1G3CA 3RXBA 3M35A 1FN8A 1P3EA 2BLOA 3MU1A 1VITH 2FTLE 3UY9A 2BB4A 1HBTH 1GHZA 2H2ZA 1HAGE 1LPKB 2VIWA 1PYTC 1D3QB 2JH0D 1OP0A 3AK5A 2YMSC 1C2FA 3RMLH 2JDID 2ZPSA 4M7GA 3SI4H 2JETB 2GGVB 4Y10E 1UTQA 3LU9B 4ABJA 2QN5T 3RXVA 1ZTJA 4XSKU 3LGYA 3MO3A 2A2XH 2UUYA 1ANCA 3TH4H 5C5OA 3URDA 3L3TA 2XYAA 3LGVA 1QQ4A 1FIWA 1UK3A 1PPZA 1TNJA 2ZGBH 2GCTC 3M5OA 2WPJS 2FS9A 4X1NU 3KQBA 2IN2A 1HYLA 4ASUD 3K9XB 4FOUC 3A84A 1Y3XA 4X6OA 2ZG0H 3OTPA 4AFUA 1AU8A 2C8WB 1TPOA 3U1IB 4IN1A 1ZSLA 3ENSB 1AN1E 2WYGA 4K69A 4XOJA 1LCYA 3RXFA 2F4LA 2A5KA 2UWOA 1LTOA 1ABIH 3ELAH 3M3SA 4H42U 1C5RA 5DP5A 2VB0A 1QURH 4YESB 1HCGA 1VCWA 3PM3A 1AGJA 2W7SA 4AOQA 1ZPBA 2Z7FE 3PV4A 5EIYA 1IAUA
chains in the Genus database with same CATH topology
3RLWH 1O2SA 1O5FH 2VWMA 3PB1E 1DWBH 2ZA5A 2Z3EA 2ZECA 1RXPA 3MU5A 3M37A 4UFDH 3GCTF 3T5FH 2Y80A 1SOTA 3A85A 1ZRBA 5DP4A 2C4FH 1PPGE 2TGDA 1SR5C 1GJ4H 3MNCA 3RXLA 4ZKOU 1JXPA 1DSUA 2GT8A 2VVVA 5F8TA 2XBYA 1KIGH 1W3CA 2G51A 1O3KA 1O3BA 4VGCB 3SU1A 1WAYB 1ELFA 4K2YA 1CT0E 2R2MB 2C8YB 4A5TS 1C2IA 3Q3KA 3UQOA 2HPQH 1P0SH 4BOHA 5C5NA 5ESBA 4CREA 2VIOA 3P92A 5HXFA 1V2PT 2P3FH 4TWYA 4E05H 5H4IB 2ASUB 2F91A 1GI2A 3QN7A 2Y81A 3MNXA 1AE5A 3GCNA 1GL1A 5FPYA 1FDPA 1HAIH 3VB4A 3HATH 3KQEA 1EASA 5K0HA 2ILNA 3TU7H 2BQWB 2BD3A 2CGAA 1SGFA 4Y6DA 4YO9A 1CA0C 1VCPA 2QCYA 2FOAA 2WV4A 1SGIB 1QB9A 5AVDA 1EOJA 3RXIA 1UTKA 1SG8B 5CE1A 2Y5HA 2BVSH 2OLGA 4XFQA 3RC6A 2G81E 4BAHB 3S9CA 1EZUC 3S9AA 4B1TA 1N8OC 3EA9A 1QA7A 5DK1A 5TCCA 1C5UA 1QRXA 3MFJA 1C5OH 1YKTA 1V2TT 3SORA 3SJOA 3MWIU 1HJAB 2R3YA 2A4QA 2QY0B 2GDEH 5ABWA 1MQ5A 1ANDA 1Z6EA 1TGSZ 1BUIA 2YNBA 4KP0A 1AVXA 1O2NA 2A1DB 2THFB 3OY6U 3GYMA 3ODFA 3PMBB 1FMGA 3JZ1B 4H6TA 1CGIE 1G3DA 1NU7B 1Z1IA 5JBTA 1EPTB 1LMWB 6LPRA 1GHBF 2A4GA 3LKWA 3E8LA 1SFQB 3A89A 1GCTC 1LHDH 1W11U 1BBRH 1AB9C 4MTBA 4Y11E 1O2LA 5A0AE 3BG8A 5FX5A 1OX1A 5C3NA 1Y5AT 3EA8A 2YOLA 1DM4B 2QGRA 2GTBA 4ZAEA 1QIXB 2QF3A 1LVOA 3SHAH 5E0JA 1GJBB 4ABAA 4HZHA 2F9OA 5BRRE 1FAXA 1ETRH 2PKSC 1UCYK 1GI7B 2GMTB 4THNH 1TGCA 5C20A 1XVOA 1QHRB 5AFZH 4D7FA 1O3OA 3PROA 1F5RA 4FUDA 2BD8A 3U98H 4WMFA 3RDZA 1IQFA 2QIQA 2F3CE 1Y5BT 1F0UA 4B71A 1GMHG 1Z7KA 2D2DA 1E0FD 3ZYDA 1C5XB 1T4VH 1GI8B 3TK9A 3LJOA 5C1UA 3SNAA 4MNYA 3F9HA 3SHCH 2RG3A 1EX3A 1DE7H 1C1QA 1MU8B 1C2JA 3SV2H 1MAXA 3SI3H 4K5ZA 3M7TA 3O8RA 5LH8A 3ZZCA 3MU0A 2P8OC 2O8LA 1WU1A 2ZU4A 2RCEA 1W10U 5L6NH 1S6FA 1TIOA 1QJ7B 4FXGH 1GHYH 1QJ1B 1F0TA 1W0YH 1HAZB 3SZNA 1GCTB 5JB9S 4D9RA 2OC7A 1RIWC 4GPGA 4ABEA 1N8OB 2EI7A 1C1TA 1O3EA 2BTCE 3U1JB 1NU9A 3GY8A 1RTFB 3A7ZA 4LOYH 1ZRKA 1FLEE 1GI1A 4NZLA 4HGCA 2BDBA 3EQ0H 2CF9H 1T8OA 3E6PH 4BXWA 1C1OA 2D26C 2UUJB 3KCGH 4D9QA 1G37A 3DA9B 3FAOA 1OYQA 4DIHH 1BRCE 8LPRA 1GBMA 1ESBA 1BHXF 2GT7A 3DFJA 1EB2A 4IN2A 3FP6E 2KAIA 4A7IB 3EYDA 1GHAG 2BQ6B 2CJIA 1AQ7A 4GSOA 3M36A 4ZKRU 3BEIB 1BTWA 2J2UA 4ZHAA 2D8WA 2QXJA 1PPBH 1HLTH 1P8VC 2GX4A 2XBXA 2FDAA 4WF8A 4BTUB 1DWDH 1QY6A 3SBKA 2H5CA 1O33A 4Y71A 6GCHF 3AAUA 4DIIH 2V3HH 3HK6B 2Z9IA 1GGDC 2FEQH 2HALA 4Y7BA 1TPAE 1IQEA 2JKHA 1PPHE 3BTQE 2VVCA 4O9VA 3RXTA 1GBBA 1P9UA 1P09A 1QTFA 3LIWA 2XRCA 4JMYA 1C9TA 1ELBA 2FOEA 4CR9A 1L4DA 2PW8H 3T28A 1GBAA 1MZDA 5FHTA 1F0RA 1ZSJA 3RMMH 2UUFB 2BY6X 1C5TA 3RXUA 1DX5M 2ESTE 1HXFH 3QZRA 2XWBI 2WPHS 2W3KA 4JYUH 5DPAA 3TK5A 2JH5D 2ZTZA 3SJ8A 1K1LA 1LVYA 4D8NA 1SLVB 2CN0H 1SGCA 1C5QA 3A7XA 1X7AC 3I29A 3M61U 5L30H 1QB6A 2P8OB 3MO9A 1FY3A 1Y3WA 1GJ8B 4MPWA 1HNEE 1W13U 2ZU3A 4NSYA 2ZZUH 3SNCA 3FZDA 2ANWA 4X1SU 1FV9A 1QL8A 2OCVB 2ZFTA 4X0WU 1D3DB 1EP6A 4MDSA 1AKSA 3AASA 1TX6A 1ARCA 2O8WA 3E91A 1M9UA 4ISHH 2G55A 1DVAH 4BTTB 2ALPA 1MKXH 3AW1A 2TBSA 1GGDB 3QDZB 4E7RG 2WYJA 1J9CH 2WUBA 1LKAA 2SGAA 3GOVB 1O2IA 1C1RA 1GDQA 1ID5H 2EI8A 3MH7A 1LPZB 4WVPE 3RXRA 5A0BA 3WY8A 1O2HA 3ZVAA 2I6SA 1HJ8A 1YPHE 4IMZA 1K1MA 1PJPA 1GVKB 2W3IA 3I77A 2YNAA 1ZSKA 1DLEA 4X2YA 1CBWB 1O3FA 2ZCHP 2XBWA 3MH5A 2BVXH 4GVUA 5EW2H 4JZFH 2HPPH 1V2KT 4MPVA 1N1LA 2ZU1A 2PSXA 3DFLA 3VEQB 3U8RH 1XUIA 3KF2A 1WQSA 1KTSB 1YF4A 1GHWH 5A8YA 2B7DH 3SGQE 1C4V2 1O34A 1GBLA 1YPEH 1FY1A 1QNJA 2B0FA 2Z94A 1GBKA 1K9OE 3P8NA 2Y6TA 3U69H 2ZQ1A 2AIQA 1SGNE 1DUEA 2GMTC 1Z8IB 4O3TA 4XBDA 2ZFQH 3M5LA 2ZDKA 3B9FH 2OC1A 1NRQH 8ESTE 2BD7A 3A8DA 1LHEH 1UTOA 3VB5A 1D6WA 4XBBA 3U8OH 1UTMA 5DGJA 3ZVFA 1E37B 1FJSA 2G52A 1SPJA 2BDAA 2FTMA 1EPTC 4K8BA 1SGRE 4TY7A 4AYVB 2A5IA 1YPHC 1O2RA 1YM0A 3A80A 7GCHF 3STJA 2FZZA 5J4QA 1TGTA 1O5BB 1RGQA 4UD9H 3TPIZ 1V2ST 1AVWA 3UNSA 2OQ5A 2ZDNA 3LJJA 2VU8E 1TA2A 1LKBA 1KXAA 4IMQA 4K60A 1OXGA 1QGFA 3TGIE 1ELAA 1C5ZB 1MKWH 1JIMA 1O2VA 2Y7ZA 1P01A 3LH1A 1HRTH 4AX9H 4NWKA 1P05A 5GCHF 5I25A 1A5IA 2JETC 2PR3A 2QXHA 1DXWA 1RD3B 8KME2 2IJOB 2XC5A 2ZDLA 1UMAH 1RIWB 2UUKB 2Y5FA 1Y59T 4Q80A 2R0LA 1C2MA 1A5GH 2FP7B 1ORFA 4NWLA 3ZVBA 3RXQA 2AMDA 1SFIA 1JRTA 1KYNA 4Q7XA 1O2XA 1S0RA 3V13A 2OBOA 1QBOA 2ANKH 1C2GA 1SGFG 2QA9E 1UTPA 1JIRA 1SC8U 1EATA 4KELA 3ZVEA 4YLUA 4YOIA 1P2JA 1PQ5A 5EQQA 1OP2A 3QTVH 3M5MA 1ABJH 1O39A 3MHWU 2WPKS 1C1MA 1CHGA 2PFEA 1SLXB 2OTVA 1D3PB 2P3TB 4B74A 2GZ7A 5E2OA 1DFPA 1FY5A 1Z8JB 2SNVA 2ZDAH 3MU4A 1TNIA 3LGUA 1C5SA 4QT8C 1J17T 3BIVH 4NIXA 5DG6A 3O8CA 1UVTH 1GDNA 1CHOF 4ABHA 1QQUA 1MZAA 2PKSB 3NWUA 4F4OC 1XX9A 4WMEA 1GJ5H 1LO6A 1TRYA 1P11E 3MTYA 4LK4A 3D62A 1NY22 2F9BH 1W2KH 5JPMH 5DP6A 1BTXA 5GDSH 6GCHG 4YLQH 1V2JT 1NO9H 1SMFE 2I6QA 3RLYH 2ZFFH 1UK2A 5FCKA 3UREA 1P2QA 2SGPE 2FOBA 1PPEE 2P16A 2H5DA 1F0SA 1G3BA 1GBJA 1MUEB 5GWZA 2BQ7B 1SHHB 7LPRA 4ZXYH 2BX4A 3H7TA 4HTCH 2V6NA 1GBEA 1P2NA 2ZC9H 3QGJA 3BSQA 3TGJE 3RXHA 1ANEA 2H9TH 2WINI 4LZ1H 1V6DA 3S69A 3RXPA 1E34B 1ZR0A 3E0NB 4FUGA 1ESTA 3UWIA 3KHVA 4JCNA 1AUJA 3MYWA 2ANYA 1O3HA 5L2ZH 3Q00A 3KL6A 1FN6A 3HKJB 4X2VA 3O8DA 2EC9H 1HUTH 2ZIQH 4YM9A 1XVMA 1YCPM 2HLCA 4NG9H 2A7JA 2ZU2A 3L6PA 2VVUA 1SQAA 4I8JA 3U8TH 1H8IH 4ISIH 1KLJH 3ESTA 4UEHH 4A92A 1KLTA 3URCA 1V2RT 3T29A 1V2QT 4AORA 1SI5H 3BTFE 1BBRK 2BMGB 1O2MA 1XKBC 3PLPA 4DG4A 1DXPA 3P17H 3N7OA 4DW2U 1WV7H 3MO6A 4CRCA 4OS6A 1ZMLA 2XC0A 3VXEH 1BMNH 5IYTA 4CRAA 4FUEA 4KTSA 1IQGA 3UOUA 2CF8H 2ZCLP 1A2CH 1D4PB 1W7GH 2A0QB 3GYLB 1YGCH 2GV6A 2FM2A 5AF9H 3E1XB 2PLXA 1BRUP 1O3AA 1BTHH 3HGNA 1BMMH 1W12U 3RXJA 1O2ZA 5DKMA 1C2EA 4F49A 2ZCKP 1RTKA 3AVZA 1TLDA 4AFZA 3PMAB 3ZYEA 4NFFA 2GZ8A 1DPOA 1SBWA 1LHGH 1Z8RA 3UR9A 1LPGB 2GCTB 2WPLS 2FESH 5E2PA 5DP9A 2FIRH 3GY7A 2FMJA 4OS7A 1P04A 2VINA 3UNRA 2OP9A 6CHAB 3T25A 4VGCC 2ZDVH 3ZVGA 4CBOA 2GP9B 4ZH8A 3ATMA 2C3SA 3NK8A 4ZROA 2C8XB 4ZKSU 1FY8E 1V2WT 2HGTH 1GMHF 1S84A 3KN2A 2PTNA 1FXYA 5GXPA 2XC4A 1INCA 1VGCB 3TLOA 1JRSA 7GCHG 2PGBB 1BRAA 1EJNA 1JWTA 4IBLH 4JZDH 4A6LA 4INHA 2WPIS 3HPTB 5HYOA 2C93B 4A1VA 1CVWH 1O5DH 1YPLH 1C1SA 4DOQA 3SU3A 4IW4E 2J4IA 1KXBA 1C5NH 2ZWLH 1TNHA 2BX3A 1TMUH 3GCOA 3TJVA 2ZGHA 1K1IA 2BY8X 3QUMP 1UK4A 1F7ZA 1O5CB 2AYWA 4CH8B 5A2MH 2W5EA 5JBAS 1GI5A 1YC0A 1NPMA 1DITH 3NUMA 1C2LA 4I8HA 2Y7XA 1OWDA 1XXFA 1ZGIA 1UTLM 4Y8YA 1TPSA 3DD2H 1BT7A 5A0CA 5C1YA 2ULLA 1VGCC 1P02A 3RC5A 1ETTH 2PUQH 3SU2A 3FP8E 1JMOH 2W26A 1HV7A 1UVOA 1AVGH 1CGHA 2BYAX 3NXPA 1O2PA 3Q3YA 2R3UA 1XM1A 2FI3E 1IHSH 1L4ZA 4INLA 1HAVB 1WQVH 2BVRH 2H6MA 2LNCA 2ALVA 1E35B 1DDJA 1G2LA 1K2I1 4XE4A 2Q6GA 1IQIA 1GHVH 1QL7A 2A4OA 2Y82A 3I78A 1MQ6A 4CRGA 1H4WA 2TGPZ 1OS8A 4FVDA 3QO6A 4JK5A 2VGCC 3FP7E 3QK1A 1JOUB 5EXLA 1THSH 2BY5X 2TRMA 5SGAE 2FOFA 4O03A 1HGTH 1MTWA 3EGKH 1Y3VA 3T2NA 4A1TA 3W95A 1UVPA 4YOJA 2OUAA 1PPCE 2RA0A 1WTGH 2O8MA 1QBNA 3IG6B 1J15A 4OGXA 1W7XH 5F8XA 1P3CA 3SOSA 4BNRA 1MBMA 3RU4T 1QA0A 3ZVCA 4HFPB 2JH6D 1NN6A 1TMTH 3LC3A 1AWFH 2PTCE 1UTJA 5F6MA 2ZFRH 1GMDG 3SGAE 3F9FA 4FUCA 2WPMS 3ZZ7A 1LQEA 1KDQA 4Y8ZA 2J34A 3TNTA 2AERH 2PKAA 2BY9X 4YZUA 1ZOMA 5EQRA 3SV8A 4DVAU 1H8DH 9LPRA 2F9VA 5JBBS 3SQHE 3S0NA 5EOKA 3MNBA 3GY3A 4RKJB 1NRPH 4GAWA 3NPSA 4AFQA 4NA8A 5C67A 1TBRH 1C5PA 1C5YB 1FZZA 4AN7A 3A7VA 1MU6B 2NU2E 3E16B 2G4TA 1MBQA 4BAQB 3GCTG 2BDIA 1O37A 1OKXA 1PQAA 1PQ7A 2ZPRA 4DCDA 4GLYA 1P12E 1IQNA 4ISOA 1T8LA 4NGAH 1GMCF 2CHAB 1O5EH 1NRNH 2QV1A 2J38A 3UWJH 1YLCA 1O38A 1PFXC 1K1PA 1AE8H 2J94A 2XNIA 1P2OA 3CP7A 1S5SA 1C5WB 3E3TA 5EODA 5E0GA 5GPIB 1GMDF 1QL9A 3A8CA 3GDUA 1IOEA 1E38B 3B8JA 1SHYA 2EEKA 1W8BH 3G01A 3MNSA 3V3MA 1ESAA 3SW2B 1THPB 2P3UB 4ABGA 1GHAF 4SGAE 2R9PA 1DWEH 2ZHEH 1ELVA 3VGCB 1IQLA 1GJ9B 1GBCA 4K3JA 1ZYOA 1W0ZU 2P94A 4B76A 3CS7A 2OD3B 2PUXB 1LVMA 1AFEH 2AS9A 4FUIA 5TCAA 1TONA 3PLKA 4NFEA 3TJOA 1AZZA 4A1XA 3SJ9A 3LT3A 2G00A 5EQSA 9ESTA 1BTZA 2STAE 1TFXA 4R0IA 4H6SB 2GV7A 3GDSA 2BZ6H 3M5NA 4RKOB 2HOBA 3GICB 1F92A 3NKKA 1O3NA 4WXVA 4YOGA 1A0LA 1BB0B 1EPTA 1T32A 1UVSH 2PSYA 3ZV9A 1EJMA 1F5LA 4X6MA 3A81A 2VNTA 2XW9A 1OWEA 5LPEA 1V2LT 1EAXA 2A32A 1SGDE 1O32A 1SGPE 1G32B 4XDEA 1Q31A 2XBVA 3IWMA