2ZDMA

Exploring trypsin s3 pocket
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
publication title Congeneric but still distinct: how closely related trypsin ligands exhibit different thermodynamic and structural properties
pubmed doi rcsb
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2007-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zdmA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zdmA02
1O3PB 1LKBA 2BD5A 1UTNA 4TPYA 4IC6A 1WAYB 1GI6A 1MTUA 4OS5A 1TRMA 3FFGA 3TIUA 1W12U 3QK1A 1RXPA 1V2NT 3PMBB 2BDIA 3K6ZA 5A8ZA 3QZQA 3FVFB 5DP9A 1C5NH 2HOBA 1KSNA 3BTFE 1DWCH 2C8YB 4YESB 3QN7A 1OSSA 3EE0B 2GV7A 3PMJA 1TNKA 2AYWA 4ABAA 2BX3A 1P2OA 1O2KA 1VCPA 3SU5A 1FDPA 4WVPE 2PTNA 3KGPA 1TGBA 3LT3A 4BANB 1L2EA 1MBMA 3MO6A 5LPFA 4FUFA 2AMDA 1G3DA 3M5MA 4OS7A 2EC9H 4HGCA 1QFKH 1CU1A 3ATKA 1AVWA 4O03A 2GD4B 4FU7A 3SHAH 1V2VT 1GJDB 3AAUA 1EKBB 2K1QA 2VWOA 3RXSA 2GP9B 4ZAEA 1UK3A 4K8BA 4NZLA 3TJUA 1E36B 2FOBA 5AVDA 2UUFB 1TRYA 1J14A 3BIVH 3F68H 1HAYB 3ZYEA 1ABJH 1LKAA 3ZV8A 3OX7U 1EX3A 2OINA 3GYLB 1GGDC 4FUDA 1DXWA 4AG1A 5EG4A 2ZTXA 1FN6A 1QBVH 2WPKS 3W95A 2O9QA 1FY8E 4X2WA 1KXCA 4NCYA 1VJ9U 1GMHG 1NRSH 1PQ5A 3Q76A 3OYPA 1ZR0A 1P8VC 1O5BB 1UVPA 1RRKA 4WMEA 1LPKB 2D26C 1HAZB 1HXEH 2Y5HA 1DS2E 1A3EH 1TNGA 3SV7A 1O32A 1EUFA 4XBDA 4ABHA 3MU4A 3BTDE 1C1VH 1C1QA 5H4IB 1P3EA 3M3SA 2F9UA 3ATMA 3VFEA 1BRAA 2IOTA 3T27A 4DY7B 1C2HA 1UTOA 1DVAH 1O5DH 1O5EH 2BY7X 1F0RA 1GHVH 1GJ4H 2QXHA 5JBAS 1LHDH 2VIVA 3MU1A 3P8OA 4NFEA 3D49H 2ZU1A 5JYIA 1C1SA 5E2PA 4JYVH 2PSYA 1SGIB 1QCPA 3RMOH 2ZGJA 1BDAA 5I25A 4ISHH 1VGCB 4CRDA 5LPRA 1BBRH 4INLA 1ZTLA 2CN0H 4TY7A 3VB7A 1T4VH 2GX4A 3B23B 3M5OA 4BNRA 1W2KH 2P3FH 1KXFA 3DFJA 1GBKA 5EPYA 1J17T 2OC1A 4BOHA 2QF3A 2BD2A 5E2OA 3LGUA 2PW8H 3SW2B 4MNVA 4U30A 2KAIA 2ALVA 1C1UH 1O38A 2Z94A 3M7QA 5EPNA 3QZRA 4IW4E 1VCQA 2ZDAH 3OU0A 1UMAH 8LPRA 1C5QA 3VB5A 1TOMH 4X8SH 2BTCE 5L2YH 1QA7A 1C5OH 1S6HA 1RD3B 1ZLRA 3EAJA 3K6YA 3RXGA 4MPVA 2R3YA 3QO6A 4QT8C 3ZZ8A 4YM9A 1V2MT 2A31A 2R0LA 1OYQA 5C5OA 3MH5A 1TA2A 1Z1JA 1VZQH 1DITH 1EJNA 3M7TA 1Z6EA 1TONA 1D3DB 1IAUA 1RTKA 3K9XB 3HKIB 3RXLA 1UCYK 2NU1E 2A2QH 1HAIH 3LC5A 2A4GA 2NU4E 4X2YA 4K1SA 1G37A 1KXDA 1KDQB 1P06A 2BD9A 1OP0A 1BQYA 1TPPA 3FP6E 1OS8A 5FHTA 1CVWH 4X2VA 1GJAB 2IJOB 2W26A 1H4WA 2GT8A 1PPFE 1T8MA 1F92A 3GDUA 5A8YA 1FQ3A 2BOHB 3RU4D 4Y79A 5BRRE 3MO3A 1UCYE 3A8CA 1G9IE 2EI8A 1FNIA 2G5VA 1PQ8A 1J15A 3ZZ3A 3BG4B 1SGFG 3EQ0H 3TJOA 1CHOF 2RA0A 1D3PB 4CRAA 1Y3XA 4Y8YA 3SI4H 2ZFQH 1P2JA 3BEFB 5AFZH 1A3BH 4I8KA 5EGMA 4AOQA 1YP9A 1V6DA 4I31A 3JZ1B 3LC3A 5FBIA 1NFYA 3BEIB 2PHBA 4DW2U 1QB1A 3GY3A 1EZUC 1XXDA 4JK5A 1PPGE 3NCLA 4TWWA 3BTTE 4Q7XA 1O3GA 1P9SA 1OOKB 1W14U 2VU8E 1FY3A 2FX4A 1UTPA 4CBNA 2FMJA 1VR1H 2XCFA 1MD7A 2QYIA 2H1UA 3L6PA 1IOEA 1ZRKA 5F6MA 3P95A 4KTSA 4X8TH 1MKWK 1CE5A 3SV9A 2FTMA 2AIQA 1C5TA 1Q31A 1O0DH 5FCKA 3BEUA 4FVDA 4D9RA 1S81A 3D23A 4GAWA 8KME2 3GCTG 2ZDNA 4OGXA 1ELTA 3QUMP 2GCHF 4NSVA 1MCTA 2BVRH 1DLEA 1ANEA 1EJMA 1GHAF 4UFDH 1OP2A 3SNEA 1MCVA 1XVOA 3NWUA 5ETXA 3I77A 1AO5A 1VITF 3FZDA 1ZHRA 1C5SA 1T7CA 5JBCS 1DLKB 2ZDKA 2OQ5A 1ELGA 2P59A 1HBTH 2ZQ2A 3VB6A 5GPIB 4FUJA 4K60A 4JZEH 5IDKA 2QV1A 4AYVB 2BY9X 3RXQA 3SGAE 3HPTB 1ANCA 2BX4A 3P92A 1G36A 1LCYA 1WTHD 1O2JA 2AFQB 3RXDA 1LVYA 1ZZZA 2ZQ1A 2FLBH 4B2AA 5F8TA 1DOJA 3U8OH 1GCDA 1BMMH 2AS9A 1CBWB 3ZVBA 3DUXH 2GMTC 1A61H 3SNBA 5HM2A 4Y7AA 4CHAC 2V3HH 2OTVA 3KQBA 3ZVFA 1W11U 3RXJA 1UCYH 5CHAC 1UHBB 1BTHH 1UVOA 4UFEH 4X1SU 3URCA 2AMQA 3MU8A 1TOCB 4NSYA 4JZ1A 4BAKB 1GDQA 1O3JA 4GLYA 4JK6A 2OCVB 3BTGE 3ZVCA 4NA8A 1O2IA 1QQ4A 1LQEA 1W0ZU 4AZ2B 4XE4A 2GCTB 3SJ9A 2FS8A 1T4UH 4YLQH 4OS1A 1O2GH 1ELAA 7LPRA 4X1NU 1CA8B 2FOEA 4WF8A 2ZC9H 3NZIA 3C27B 3GY5A 3ZZ7A 4VGCC 1NPMA 1MKXK 1BTUA 1ZHMA 1KDQA 2ASUB 2D1JA 2GZ7A 3SZNA 4A1VA 4B73A 1TBZH 5T6GA 4X6NA 2VIWA 4ZH8A 1CA0B 2OC7A 3RC4A 1ID5H 1YGCH 7ESTE 4B76A 3RU4T 4NA7A 3RXCA 1NT1A 1IQIA 1BZXE 1C5VA 4K3JA 1VITH 2FESH 1HLTH 2Q6GA 3MNBA 3QGJA 3RP2A 2BQWB 2Z3EA 1CHGA 1GI2A 3OY5U 1BTYA 4KTUA 2A4QA 3KN2A 3U1JB 3SU3A 4R0IA 4TY6A 5DG6A 2ZU5A 1QRWA 2FEQH 4NWKA 1O2PA 1GJ5H 1MKWH 3H5CB 3RXVA 3RMMH 4DT7B 3T29A 5L2ZH 3TGJE 2Z9LA 2FP7B 2ODPA 1Z8GA 1KYNA 1Y3VA 1UVSH 2AGIX 3ZYDA 1CBWC 1DUAA 2ZP0H 3SGQE 2ZPSA 3ZVEA 1O31A 2HLCA 2ZA5A 4WY3A 1CT4E 2FODA 5LPEA 5DGJA 2VWLA 4E05H 1P02A 2QA9E 1K9OE 4WJG2 1NRQH 2D8WA 3MYWA 2ULLA 3UFAA 1SVPA 4HI3A 3SJKA 3QTVH 1TRNA 4NZQA 2R3UA 3KHVA 2FOFA 2OBQA 3SU6A 8GCHF 1IQEA 2P3UB 2PGQB 1GBFA 2R9PA 1UTKA 5JDUB 5K7RA 1O3CA 1NFXA 2UUYA 1QA0A 1C5ZB 3L33A 2VB0A 1FIWA 3DT0H 4SGAE 1LDTT 3V7TA 1AWFH 2G5NA 4D9QA 8GCHG 3LH1A 1BUIA 1IQGA 1S83A 2TGPZ 1AD8H 4K1EA 3Q00A 1CSOE 4IS5A 1EB2A 3MMGA 5FPSA 2BD4A 1GI5A 5A0AE 1LHFH 1FJSA 1YPJH 2VWMA 4JZFH 2A45B 4YO9A 3EYDA 8ESTE 1BA8B 5E0HA 3FP7E 1CA0C 2BY6X 1C1NA 2RG3A 3EA8A 2XC4A 2Y5GA 4DGJA 4GCHF 4Y0ZE 2CF8H 3MFJA 2QC2A 3A88A 4Y76A 2QF0A 3HGNA 1MZAA 2ZI2H 3TU7H 1C2KA 1XX9A 2WUBA 1FV9A 1RGQA 2QIQA 2XTTB 1O3BA 2D2DA 3BSQA 1K22H 1AU8A 1TGSZ 2ANYA 3A8DA 1NZQH 4GUXA 2GZ9A 4FUEA 2BDYA 3JZ2B 2EEKA 1ZPBA 1UHBA 2J2UA 4A5TS 3SORA 1TX7A 3TNSA 1XUKA 1T32A 1TX6A 2HWLB 1C2FA 2ZF0H 4SGBE 4UDWH 1DDJA 2AIPA 4R8TB 4MVNA 1HAOH 3BTME 1EAWA 1YPMH 1C5XB 3RXFA 5DPAA 3SU0A 3L3TA 3SJ8A 1UTJA 2VINA 3UY9A 2G52A 2IN2A 2BDBA 3HK3B 1EAXA 1P10A 5A0BA 1BRUP 4AFUA 1WQVH 2FOAA 6CHAB 3VEQB 1SOZA 4RKJB 1O2TA 1ZJKA 5DK1A 1XMNB 4WMFA 5EXMA 3FP8E 1SGNE 5JB9S 3AW0A 1CGHA 4X0WU 4GVUA 4ISIH 4BAQB 1YKTA 1GBCA 3M35A 3F9GA 1Y3UA 1SR5C 1SLXB 1UTLM 2XYAA 5DP6A 1YPGH 2BDHA 2VH0A 1O5GH 1F7ZA 1EAUA 4BTUB 1O30A 2VIDA 2THFB 1FI8A 3STIA 1HFDA 1MUEB 1GJCB 4ABDA 2BXTH 1P2IA 1LQDB 4B71A 2XWBI 1GBIA 3PLPA 3TH4H 4AN7A 2HPPH 3VGCC 4XBCA 5FXLA 2HNTC 1GI9B 3A81A 3SV8A 1P57B 5C20A 1DSUA 1C5LH 3VB4A 4B2BA 1QRZA 1O2HA 1QHRB 1FAKH 1ZGVA 4Y7BA 1E35B 2ZGHA 4U32A 2BD7A 4WH8A 1EJAA 2ZIQH 1LHEH 2JH6D 1D9IA 4CRBA 4MPUA 3TK6A 1DANH 3E0NB 1A5HA 1GMHF 3SUFA 1GBDA 1K2I1 1L4ZA 1HJ8A 2VIQA 3SUGA 1HPGA 4Y10E 5DP3A 4A92A 5EU8A 1XM1A 1BCUH 1BMLA 6ESTA 1ELCA 1KTTB 2H5CA 3CP7A 3U69H 4AFZA 1DT2A 4I32A 3U98H 1BJVA 3RLWH 2C4FH 2FXRA 1ZPZA 1EXFA 3SHCH 2XC5A 1KLIH 1NS3A 1SGDE 2DE9A 5C5NA 1HXFH 4IBLH 1MQ5A 1FZZA 1T8OA 2OLGA 2GT7A 1DPOA 4JZDH 1WUNH 2A32A 1TGNA 3LIWA 3V3MA 1C1MA 4WXVA 2W7SA 1D3TB 2CHAB 1XUHA 2Y7XA 1QL7A 3NK8A 1PPZA 3FANA 2ZCKP 1O2YA 3Q3YA 3M37A 3D62A 3RXEA 2BLWA 1ZTKA 1P05A 4CR9A 1UVUH 4WXIA 1Z7KA 1P9UA 3MWIU 6CHAC 2Y6TA 2H9TH 1C2IA 2ZGBH 1SBWA 1L1GA 3GDVA 1PYTD 5C2ZA 4DURA 5DP8A 1FN8A 3ATIA 3ZZ9A 2QXIA 1QNJA 2PUXB 4ZXYH 3LGYA 2CMYA 1MQ6A 1PQAA 1G2LA 1O2LA 2VGCB 2FPZA 1JBUH 3MU0A 2J34A 4X6MA 3ENSB 2BD3A 1QJ1B 3EA9A 1EPTB 2PGBB 2BXUH 1K1IA 4ZXXH 1C5WB 1OXGA 1V2LT 1SHHB 1QB9A 2Z9IA 1QJ6B 5GWZA 2LNCA 1V2OT 2PV9B 2ZGXH 1HV7A 3RU4E 1CT0E 3PROA 3GY8A 2OXSA 4PROA 2ZHEH 4LXBH 3SJIA 3GY7A 4LK4A 2XW9A 2VVCA 1K1MA 4KTCA 3MU5A 1GMDG 3KL6A 2JH5D 4HZHA 2Z3CA 5GJ4B 1FPHH 1THRH 2H9HA 3ZZBA 1W7GH 2F9PA 1YCPK 1K1PA 4H6SB 1SB1H 1O2OA 1EAIA 1O3KA 1TB6H 1BTXA 2FOHA 2HGTH 1BITA 1O33A 4AORA 1GI3A 2VVUA 3ZZ6A 5T6FA 2P8OB 1RTLA 2SGDE 2Y82A 3H7OA 3UUZA 3DD2H 3MHWU 3UQVA 2A5IA 3PLBA 5GIBA 1TWXB 1AI8H 1GHYH 1V2TT 4RSPA 1F0SA 1TLDA 1C1OA 1ABIH 1W7XH 1ZSLA 4AX9H 1SLUB 1K28D 3MH4A 4NG9H 3LKWA 1GVKB 1O3DA 1P01A 3M5NA 3CENA 1GI1A 3GICB 2ZZUH 4OGYA 1EATA 2CHAC 1ZGIA 2O8TA 1O3IA 1H9LB 1AIXH 1ZSKA 2HNTE 4ESTE 1S5SA 2EI6A 2ANWA 3A7ZA 2AH4X 1UK4A 1UK2A 5CE1A 1LVBA 4OS4A 3C1KA 4XFQA 3ZZCA 1GHWH 3T26A 1HAGE 5T3HA 4BXWA 3RLYH 1V2WT 1G32B 2PKSB 2H5DA 1G3CA 1CQQA 1VGCC 3LGWA 1N6YA 1GHBF 1JRSA 4CH2B 2ANMH 1U6QA 2WUCA 2VGCC 1ARCA 1RIWB 4JYUH 1M9UA 1EPTC 1ZPCA 3MNCA 3RXOA 4ABFA 3Q3KA 3GY2A 5ESTE 1XVMA 1G30B 4K2YA 1GHBG 1QTFA 4D7FA 2Y80A 2A4RA 4MNYA 3TK5A 2H9EH 1AE5A 1S84A 3PO1B 3TK9A 3Q3XA 2PKAB 1FUJA 5JB8S 1C9TA 4OS6A 1HJAB 1O2WA 4AYYB 1SLWB 3LDXH 3GCTF 3UWIA 5FBEA 1K1JA 1GBJA 2HVXA 4A7IB 1GHXH 2FZZA 3SGBE 3O8RA 1O3NA 1JIMA 1YBWA 4Y6DA 4ZKSU 1AZZA 2V0BA 1L1NA 2TRMA 1CGIE 2GDEH 3MNXA 4NFFA 4ABBA 1NU7B 1T8NA 3RMLH 4E06H 3Q77A 1TE0A 1ELFA 3AASA 4F4OC 2ZU3A 3SNDA 1DWBH 5A09A 3RC5A 2VIOA 1E34B 4XOJA 1AQ7A 2JETB 3A7YA 3UREA 4GHTA 1EB1H 1ZMLA 3BIUH 3V13A 1MTSA 1HIAB 4DIIH 1E0FD 3P8GA 2J95A 2FLRH 2O8MA 2W3IA 4BXSA 2G8TA 2ZFPH 3B8JA 2SFAA 2AMPA 3A87A 2XBWA 1PQ7A 2HPQH 2VH6A 1L1JA 3QGNB 2FWWA 1EPTA 1FY4A 1IQNA 1EZSC 4UFFH 1AMHA 5HYOA 2UWOA 1SGRE 1YLCA 4ABGA 4THNH 1GBAA 5G4BA 3BG4C 3GDSA 4JYTA 2P95A 1YCPH 4NIYA 5HXFA 1ZOMA 2PKSC 2TPIZ 2QGRA 3ATWA 2ZECA 3M36A 3SBKA 1QURH 2XNIA 3ZVGA 1LO6A 3A86A 1O34A 1QBOA 2PR3A 2QCYA 4MLFB 4AB9A 3UNRA 2GVFA 2XCNA 1A5GH 1NTPA 2TIOA 2F9OA 2BDCA 2XBVA 1XUIA 1QY6A 1AUJA 1RJXB 4UEHH 4AGJA 1NFUA 1HYLA 3SN8A 2QXJA 3UR6A 1C5YB 2FX6A 1ORFA 4B75A 3PO1C 1DXPA 1P2QA 2TGTA 4H42U 1HJAC 1O2QA 1Y5BT 1PPEE 1O3MA 4IGDA 1NRRH 3ZZ5A 3KQEA 1A0LA 1C5UA 2M5TA 1LHGH 2JKHA 1SMFE 4YOJA 3CS0A 4UD9H 1RTFB 2FYQA 3F6UH 1INCA 1CO7E 2C8WB 2SGPE 3BTQE 1X7AC 4MTBA 3BTKE 2W7UA 1LPZB 1ANBA 1C1TA 1DE7H 2GTBA 3QWCH 3KEEA 2WPIS 5DJ7A 3UWJH 1EZQA 2QAAA 5E8EH 2I6SA 4D8NA 4JMYA 3GCOA 4ABJA 1DX5M 1FXYA 2ZEBA 5GCHF 2JETC 1O2SA 1D6RA 2R2WU 2WPJS 3DFLA 4CRFA 2Z3DA 2G4UA 4O3UA 3W94A 1S85A 2BM2A 2A5AA 2BLOA 3M61U 1AUTC 1MAXA 5DP5A 1GDNA 1SOTA 1A2CH 1B0EA 2TBSA 5GCHG 1D6WA 1JRTA 1O2NA 4IN1A 2ODQA 2ZDVH 1KLTA 2FIRH 1IQHA 3B9FH 3M3VA 3UNQA 5TCAA 1HAHH 4K8YA 2F3CE 3E91A 4FUGA 4A1TA 1QRXA 4YZUA 1OP8A 1MD8A 1C5MD 5F8ZA 2FOCA 1DICA 2AGGX 2P94A 2WPHS 1SGYE 1T31A 1PYTC 3E90B 2I6QA 2DUCA 3DHKH 1BMNH 5E0GA 2PKAA 4M7GA 4YOIA 3F9EA 2P16A 3QLPH 3O8BA 4X8VH 5EXLA 2XXLA 1ESAA 2NU0E 3AVZA 4GPGA 1E38B 1GBBA 1RS0A 3WY8A 2STBE 4Q2KA 3U9AH 3BN9A 3E1XB 1BRBE 2ZHQH 1NN6A 2CXVA 4BAOB 1GJ9B 1TIOA 1EQ9A 1TPSA 3LONA 2SNWA 3UIRA 2ZKSA 4ISLA 2YNAA 4CRGA 1C2LA 3S9AA 1WYKA 3UR9A 1G3EA 2GCTC 2VJ1A 3U8TH 5FX6A 1WSSH 1V2PT 3MOCA 3GY4A 1TMUH 2ZU2A 4ZKRU 2GKVE 1FY5A 3AAVA 1K21H 3RUOA 1P04A 3A84A 1OWEA 2UUJB 2GDDA 1YPHC 1XUJA 4TPIZ 1DWEH 3NUMA 1GWAA 2ZFFH 1HJ9A 1MU6B 2OC8A 2BYAX 1PPCE 3TH2H 3SV2H 1AB9B 1GJBB 2FYRA 4A1XA 2AGEX 1YYY1 4B1TA 3KIDU 1HCGA 1HIAA 1XUGA 3V12A 3IITA 1NFWA 1XKAC 1BIOA 1KXBA 4Y0YE 1RFNA 1Z8JB 5C1XA 4CBOA 1MTWA 3T62A 4DCDA 3M5LA 2G00A 1IHTH 2WYGA 5FPTA 3T2NA 1V3XA 2Y7ZA 5FAHA 4IN2A 6GCHF 3PMAB 2HALA 4K5ZA 3SV6A 3AW1A 5DKMA 2B0FA 1A0JA 1JIRA 1V2RT 2G55A 1GDUA 3E6PH 4I8JA 1TA6A 3ZZDA 4BTTB 3K65B 1YPKH 1IHSH 3KF2A 1GBEA 3F9FA 4AFSA 2SGEE 6GCHG 1G2MA 1N1LA 1NU9A 4LZ4B 3TJNA 1L0ZA 1BRCE 3N7OA 1MKXH 1C5RA 3SU4A 2ZCLP 1MH0A 4XSKU 3SUDA 1DSTA 2A2XH 1B7XB 3S7HB 3G01A 3P8NA 3U8RH 4Z0KA 3HATH 2BDAA 1GHZA 1HAVB 1Z8RA 1P0SH 3OTJE 1HAPH 3RM2H 1PFXC 3UPEA 5L6NH 1HB0B 3RXHA 1S6FA 1KY9A 3I78A 5EQQA 1EOLA 1ESTA 1OWDA 1THSH 4IMQA 2ILNA 3SU1A 5EXNA 1FLEE 2ZFTA 1BBRE 4YT6H 1C2EA 3LJOA 1H9HE 5TCCA 1FMGA 4H4FA 4MQAA 5TJXA 1P11E 2J9NA 2PSXA 1LPGB 3ODFA 3SI3H 3A7VA 1BMAA 3MNSA 2EA3A 1C4V2 1AZ8A 2QXGA 4E7RG 3GOVB 1S0RA 4BTIB 1ZTJA 3H7TA 1AB9C 4Y8XA 4I33A 1MTNB 1DY9A 1TGTA 2Q6FA 1Y59T 2IPHA 3F1SB 4ASHA 3RXBA 1O3HA 9LPRA 4F49A 2RDLA 4ABEA 1V2KT 4ZHAA 1ELVA 1FAXA 2PFEA 1HRTH 1P2MA 5EQSA 4NIVA 3KNXA 1IQMA 1C4U2 1GVZA 1FIZA 1P03A 1YC0A 1SGCA 1WQSA 2OUAA 5EW1H 5A0CA 3MI4A 1P3CA 1SSXA 2C8ZB 4ZROA 1O2VA 2AEIH 1TPAE 4RN6A 4E7NA 3RC6A 5FPYA 1SHYA 1ANDA 3MTYA 4Y8ZA 1Y8TA 1AVXA 4YLUA 1OYTH 3D65E 1BHXF 2VVVA 4KGAA 6LPRA 2TGAA 3RXPA 1DM4B 1EZXC 1SFIA 2ZU4A 3A8BA 1IQLA 1A46H 5BPEA 3LGIA 2ANKH 3P17H 2VWNA 3RDZA 1V2QT 2QY0B 4INHA 4DIHH 1ZMJA 3TITA 1YCPM 3TJVA 2ZFSA 2BB4A 1YPHE 3ZZ4A 1CT2E 5LH8A 1SQAA 4X6OA 5B6OA 3S7KB 2Z7FE 3R3GB 3LJJA 1Q3XA 2BMGB 4AB8A 2P3TB 1AFEH 5J4SA 1TNIA 3DA9B 1GJ7B 2PWXA 2R2MB 3ODDA 1Z1IA 1SGFA 2Z9KA 2YOLA 5A2MH 5FCRA 1KLJH 1QJ7B 1AGJA 1WTGH 3FZZA 2BQ7B 4HTCH 1ZJDA 3EA7A 3KQCA 1QIXB 1Y3YA 2XBYA 3SNAA 4NA9H 1P2NA 1UTMA 1TAWA 2UUKB 1XKBC 2NU2E 1SC8U 1C2GA 3HGPA 4KKDA 3KQDA 3S69A 3A8AA 4U2WA 1SI5H 5C1UA 4LOYH 3A80A 1WBGB 1TALA 2A7CA 1H9IE 2B7DH 4GHQA 1TMBH 2BZAA 1F2SE 1MTNC 1Z71A 2OP9A 1PJPA 1UTQA 3BG8A 1GMDF 2FI3E 4IC5A 4NIXA 1AFQB 1O2RA 1LHCH 4DVAU 5GXPA 1C1WH 3TGIE 2BD8A 2P93A 1O35A 2GV6A 1GJ8B 1GPZA 1W10U 2W5EA 4MNXA 3UNSA 3HK6B 3TNTA 1GI7B 1JXPA 1SGPE 1AE8H 1GBHA 4NWLA 3UOPA 2FTLE 3RXMA 1L4DA 3I29A 2WPMS 3T5FH 3A85A 4I8HA 1DUEA 2XC0A 1KXAA 4FUHA 4UFGH 3CS7A 1YM0A 3S9BA 3GCNA 1C1RA 5EODA 5ABWA 1LTOA 1B0FA 1GBTA 1HAVA 3NXPA 3LPRA 3ZZAA 3SQEE 1O5FH 1HDTH 4ZUHA 1AHTH 3BF6H 1QL9A 2Z6BD 1WV7H 3LU9B 1AWHB 4KELA 3VXFH 4ZKOU 4IMZA 1A0HB 2XWAA 3SUEA 2ZPQA 3E16B 1C2JA 2Q1JA 1GG6B 4MDSA 4U01A 4K1TA 1GCTB 5F03A 2UWLA 4ABIA 1NC6A 4MPXA 3TLOA 1SPJA 1TX8A 2PUQH 2ZDMA 1TBQH 5ESBA 2H6MA 3BV9B 1TPOA 7KMEH 3UQOA 4H6TA 1N8OB 1QR3E 2GZ8A 1ELBA 1O36A 1TQ7B 1GL1A 1NY22 2ZTZA 5DP4A 2AERH 2SGFE 3F9HA 2HNTF 3IG6B 4CRCA 2F9VA 3M7UA 1IQFA 1P12E 1NO9H 2F9NA 4O3TA 7GCHF 3ITIA 4D7GA 4D76A 4UONA 3E3TA 1BOQA 1ZRBA 3RXUA 2GMTB 1QL8A 1OWHA 2QN5T 2W3KA 1V2JT 1EP6A 2ZWLH 1K1NA 4CHAB 2C93B 4AGKA 2C90B 2H2ZA 2YNBA 4ZHMU 2A1DB 7GCHG 2WV5A 5CHAB 1SGEE 4Z6AH 1O3OA 3A82A 1CHOG 1SQOA 1OKXA 1AFQC 2OBOA 3PMHB 2XBXA 3A89A 1NRNH 2SGQE 2J38A 3SO3A 4O97A 1A5IA 1GBLA 1MAYA 3LOXA 9ESTA 2G81E 1EP5A 1SL3A 2O8WA 2A7JA 3QX5H 5HMAA 1P2KA 2ODYB 2UWPA 1ARBA 4X8UH 2BQ6B 2BVXH 3O8CA 1K1LA 4X6PA 1QB6A 5GDSH 3RXIA 2V35A 1XUFA 1TNJA 4JCNA 4FXGH 1MMJN 1BTPA 1Y3WA 3IWMA 2OQUA 1G3BA 5FX5A 5JBTA 2NWNA 2FI5E 2OC0A 2A4OA 1QGFA 2P8OC 2WYJA 4ZMAH 2CGAA 2ZHDA 4VGCB 1O3FA 1FY1A 3GY6A 1PPBH 3PTNA 1DY8A 3ZV9A 1MTVA 5CMXH 3A7TA 4B2CA 2Q6DA 3VXEH 1O3LA 4ZKNU 3A7WA 3PWCA 4I7YH 1D3QB 1AVGH 1AKSB 4Q7ZA 4J2YB 3PYHA 3P6ZB 2ZG0H 1GG6C 3RXRA 4WMDA 4YTAA 4FU9A 4K69A 3UTUH 2Y5FA 1GCTC 3LH3A 1V2ST 3K2UA 2A5KA 3TPIZ 4B74A 2A0QB 1FPCH 4O9VA 3URDA 1F0UA 5C1YA 1O5AB 3VPKA 1A4WH 2GCHG 1GI4A 1LMWB 2FS9A 3MH7A 2C8XB 2WINI 1W8BH 1YLDA 1GHAG 1N8OC 1S0QA 3PTBA 5HM9A 1GI0A 1SQTA 2ZTYA 2SNVA 4WWYA 1SGTA 1O5CB 1Q2WA 3R0FA 1FONA 4X1PU 2ZDLA 1GL0E 1O2UA 1VITG 3MH6A 1HAXB 4DJZB 2B8OH 3BTHE 3RXAA 1TYNA 1H8IH 4XDEA 5JPMH 2FM2A 1NM6A 1ETRH 1RIWC 3TVJB 2EI7A 1J16A 2CF9H 1THPB 1BHXB 1F5LA 2PLXA 5L30H 1YPLH 1ESBA 2Y81A 5JBBS 2BVSH 1DWDH 2STAE 4MG3A 3TGKE 1MZDA 4LZ1H 1OPHB 3LGTA 1F5RA 3ESTA 3PWBA 1BJUA 2O8UA 5E0JA 1K1OA 2FOGA 5C67A 1EOJA 1WOFA 1EASA 4TYDA 2F83A 1PPHE 5I46H 4KP0A 4CH8B 3VB3A 2ZNKH 3M3TA 1ETSH 4FUIA 2BY5X 3QTOH 1O3EA 3U1IB 1Z8IB 1ETTH 1ZSJA 1V2UT 2OD3B 4DG4A 1IQJA 2J92A 1AN1E 1MBQA 1IQKA 2C3SA 2DE8A 3FAOA 2HRVA 1O3AA 4BAMB 4Q7YA 1SFQB 4TWYA 3SOSA 3STJA 1C4Y2 2PTCE 3UOUA 4Q80A 4DOQA 1W0YH 1KTSB 1W3CA 4XBBA 2ALPA 1MU8B 4ZHLU 1KIGH 1KXEA 2BZ6H 1WU1A 1C5PA 4CREA 3E0PB 1LVOA 1GI8B 1TBRH 2ESTE 2RA3A 5HGGA 3A7XA 2VNTA 1D4PB 1F5KU 1VCWA 4Y11E 5F8XA 1HGTH 3BTWE 1ZHPA 3BTEE 1W13U 4ISOA 2NU3E 1A7SA 2V6NA 3RXKA 4CR5A 2BY8X 5C3NA 2CJIA 5J4QA 3SU2A 1TNHA 2VIPA 5EW2H 1AY6H 3GCHB 2BHGA 5LGOA 5A8XA 3E8LA 1TMTH 4X2XA 2B5TB 1XXFA 4OS2A 4YT7H 1T8LA 3LGVA 3ZVDA 2ZCHP 3O8DA 2ZHWH 5DO4H 1UJ1A 1QBNA 3OY6U 2G4TA 2ZGCA 2FOMB 3P8FA 2J94A 4FU8A 1Z6JH 3EDXB 4WH6A 2R0KA 1C2DA 1UVTH 2BDGA 4MPWA 1OWJA 1O2XA 4AG2A 3ZVAA 1ELEE 4UE7H 1A1RA 1C1PA 1ZMNA 2LPRA 2ZPRA 2BOKA 3SNCA 1JOUB 4RKOB 3RMNH 1P09A 5T6DA 1TNLA 1GMCF 2F9BH 3HKJB 4NGAH 5EQRA 2FI4E 4A6LA 1NRPH 1TFXA 5PTPA 1N6XA 4YOGA 1O2MA 2XRCA 1VJAU 1ELDE 3GISB 2O8LA 1AKSA 1E37B 1GMCG 2SGAA 4FUCA 1OWIA 1O39A 3QDZB 3S9CA 1SG8B 2A7HA 1GVLA 4NIWA 1UO6A 4AFQA 2JH0D 4HFPB 1NESE 1YF4A 5K0HA 1O2ZA 3PLKA 1J9CH 4I8LA 5SGAE 3NKKA 2B9LA 4GSOA 2TGDA 4ISNA 3T25A 2GGVB 1BTWA 1TQ0B 2CV3A 5DP7A 3VGCB 3RM0H 1JWTA 1ACBE 2V3OH 3ELAH 2FDAA 5AFYH 1BB0B 2ZHFH 5EOKA 1GJ6A 2FO9A 1LVMA 1C9PA 3GYMA 3PB1E 1WCZA 4INKA 5AHGH 3RXTA 1DFPA 3ATLA 1NROH 4JZIA 1OX1A 1OWKA 1B5GH 1QQUA 1CGJE 1Y5UT 3TH3H 1SLVB 3SJOA 3V0XA 2ZFRH 1J8AA 1S82A 1H1BA 4X1QU 2BLVA 2KAIB 1F0TA 4J1YA 1GGDB 2Z9GA 2WPLS 3MO9A 3A83A 3S0NA 3PV4A 4GCHG 3GCHC 1ZYOA 2J4IA 2ZO3H 4MNWA 1BBRK 3T28A 4FVBA 1BTZA 4BAHB 1GBMA 1HNEE 3OSYA 2RCEA 4FUBA 2WV4A 1Y5AT 1TGCA 1JMOH 1BT7A 2G51A 3NPSA 1HUTH 3P70B 1H8DH 3KCGH 2F91A 3PM3A 2Z9JA 3EGKH 1TABE 4X1RU 1YPEH 2BLQA 1O37A 1SGQE 1C2MA 4Y71A 5IYTA 3SQHE 5AF9H 4I8GA
chains in the Genus database with same CATH superfamily
1O3PB 1LKBA 3N7DA 2BD5A 2EQNA 1UTNA 4TPYA 4ZCNA 4IC6A 1WAYB 1GI6A 1MTUA 4OS5A 1TRMA 3FFGA 3TIUA 3VG8A 1W12U 3QK1A 1RXPA 1V2NT 3PMBB 2BDIA 2YMSB 3K6ZA 5A8ZA 3QZQA 3FVFB 5DP9A 1C5NH 2HOBA 1KSNA 3BTFE 1SQRA 1DWCH 2C8YB 4YESB 3QN7A 1OSSA 3EE0B 2GV7A 3PMJA 1TNKA 2AYWA 4ABAA 2BX3A 1P2OA 1O2KA 1VCPA 3SU5A 1FDPA 4WVPE 2PTNA 3KGPA 1TGBA 3GS9A 3LT3A 4BANB 1L2EA 1MBMA 3MO6A 5LPFA 4FUFA 2AMDA 1G3DA 3M5MA 4OS7A 2EC9H 4HGCA 1QFKH 1CU1A 3ATKA 1AVWA 4O03A 3KYGA 2GD4B 4FU7A 3SHAH 1V2VT 1GJDB 3AAUA 4HG6A 1EKBB 2K1QA 2VWOA 3RXSA 2GP9B 4ZAEA 2F4LA 1UK3A 4K8BA 4NZLA 3TJUA 1E36B 2FOBA 5AVDA 2UUFB 1TRYA 1J14A 3BIVH 3F68H 1HAYB 3ZYEA 1ABJH 1LKAA 5CHBA 3ZV8A 3OX7U 1EX3A 2OINA 3GYLB 1GGDC 4FUDA 1DXWA 4AG1A 5EG4A 2ZTXA 1FN6A 1QBVH 2WPKS 3W95A 2O9QA 1FY8E 4X2WA 1KXCA 4NCYA 1VJ9U 1GMHG 1NRSH 1PQ5A 2KX4A 3Q76A 4ACAA 3OYPA 1ZR0A 1P8VC 1O5BB 1UVPA 1RRKA 4WMEA 1LPKB 5EJ1A 2D26C 1HAZB 1HXEH 2Y5HA 1DS2E 1A3EH 1TNGA 3SV7A 1O32A 1EUFA 4XBDA 4ABHA 3MU4A 3BTDE 1C1VH 1C1QA 5H4IB 1P3EA 5C0UA 3M3SA 2F9UA 3ATMA 3VFEA 1BRAA 2IOTA 3T27A 3SYJA 4DY7B 1C2HA 1UTOA 1DVAH 1O5DH 1O5EH 2BY7X 1F0RA 1GHVH 1GJ4H 2QXHA 3F3BA 5JBAS 1LHDH 2VIVA 3MU1A 3P8OA 4NFEA 3D49H 2ZU1A 5JYIA 2YMSC 1C1SA 5E2PA 4JYVH 2KM0A 2PSYA 5F53A 1SGIB 1QCPA 3RMOH 2ZGJA 1BDAA 5I25A 4ISHH 1VGCB 4CRDA 5LPRA 1BBRH 4INLA 1ZTLA 2CN0H 4TY7A 3VB7A 1T4VH 2GX4A 3B23B 3M5OA 4Z1MD 4BNRA 1W2KH 2P3FH 1KXFA 3DFJA 1GBKA 5EPYA 1J17T 4F48B 2OC1A 4BOHA 4B6EA 2QF3A 3N99A 2BD2A 5E2OA 3LGUA 2PW8H 3SW2B 4MNVA 4U30A 2KAIA 2ALVA 1C1UH 4FOUC 1O38A 2Z94A 3M7QA 5EPNA 3QZRA 4IW4E 1VCQA 2ZDAH 1WXRA 3OU0A 1UMAH 8LPRA 1C5QA 3VB5A 5KEDA 1TOMH 4X8SH 2BTCE 5L2YH 1QA7A 1C5OH 1S6HA 1RD3B 1ZLRA 2CK3D 3EAJA 3K6YA 2HLDD 3RXGA 4MPVA 2R3YA 3QO6A 4QT8C 3ZZ8A 4YM9A 1V2MT 2A31A 2R0LA 2KR7A 1OYQA 2KCOA 1SKYE 5C5OA 3MH5A 1TA2A 1Z1JA 1VZQH 1DITH 5IK2D 1EJNA 3M7TA 1Z6EA 1TONA 1D3DB 1IAUA 1RTKA 3K9XB 3HKIB 3RXLA 4ASUD 1UCYK 2NU1E 2A2QH 1HAIH 3LC5A 2A4GA 2NU4E 4X2YA 4K1SA 1G37A 1KXDA 1KDQB 1P06A 2BD9A 1OP0A 1BQYA 1TPPA 3FP6E 1OS8A 5FHTA 1CVWH 4X2VA 1GJAB 2IJOB 2W26A 1H4WA 2GT8A 1PPFE 3DSPA 1T8MA 1F92A 3GDUA 5A8YA 1FQ3A 2BOHB 3RU4D 4Y79A 5BRRE 3MO3A 1UCYE 3A8CA 3PV5A 1G9IE 2EI8A 1FNIA 2G5VA 1PQ8A 1J15A 3ZZ3A 3BG4B 1SGFG 4P00A 3EQ0H 3TJOA 1CHOF 2RA0A 1D3PB 3FKSD 4CRAA 1Y3XA 4Y8YA 3SI4H 2ZFQH 1P2JA 3BEFB 5AFZH 1A3BH 2KCAA 4I8KA 5EGMA 4AOQA 1YP9A 1V6DA 4I31A 3JZ1B 3LC3A 5FBIA 1NFYA 3BEIB 2PHBA 4DW2U 1QB1A 3GY3A 1EZUC 1XXDA 4JK5A 1PPGE 3NCLA 4TWWA 3BTTE 4Q7XA 1O3GA 1P9SA 1OOKB 1W14U 2VU8E 1FY3A 2FX4A 1UTPA 1W0KD 4CBNA 2FMJA 1VR1H 2XCFA 1MD7A 2QYIA 2H1UA 3L6PA 1IOEA 1ZRKA 5F6MA 3P95A 4KTSA 4X8TH 1MKWK 1CE5A 3SV9A 2FTMA 1COWD 2AIQA 1C5TA 1Q31A 1O0DH 5FCKA 3BEUA 4FVDA 4D9RA 1S81A 3D23A 5HIYA 4GAWA 8KME2 3OEED 3GCTG 2ZDNA 4OGXA 1ELTA 3QUMP 2GCHF 4NSVA 1MCTA 2BVRH 1DLEA 1ANEA 1EJMA 1GHAF 4UFDH 1OP2A 3SNEA 1MCVA 1XVOA 3NWUA 5ETXA 3I77A 1AO5A 1VITF 3FZDA 1ZHRA 1C5SA 1T7CA 5JBCS 1DLKB 2ZDKA 2OQ5A 1ELGA 2P59A 5B6LA 1HBTH 2ZQ2A 3VB6A 5GPIB 4FUJA 4K60A 4JZEH 5IDKA 2QV1A 4AYVB 2BY9X 3RXQA 3SGAE 3HPTB 1ANCA 2BX4A 3P92A 1G36A 1LCYA 1WTHD 1O2JA 2AFQB 3RXDA 1LVYA 1ZZZA 2ZQ1A 2FLBH 4B2AA 5F8TA 1DOJA 3U8OH 4RI0A 1GCDA 1BMMH 2AS9A 1CBWB 3ZVBA 3DUXH 2GMTC 1A61H 1FX0B 3SNBA 5HM2A 4Y7AA 4CHAC 2V3HH 2OTVA 3KQBA 3ZVFA 1W11U 3RXJA 1UCYH 5CHAC 1UHBB 1BTHH 1UVOA 4UFEH 5C94A 4X1SU 4P02A 5HIZA 3URCA 2AMQA 3MU8A 1TOCB 4NSYA 4JZ1A 4BAKB 1GDQA 1O3JA 4GLYA 4JK6A 2OCVB 3BTGE 3ZVCA 4NA8A 1O2IA 1QQ4A 1LQEA 1W0ZU 4AZ2B 4XE4A 2GCTB 3SJ9A 2FS8A 1T4UH 4YLQH 4OS1A 1O2GH 1ELAA 7LPRA 4X1NU 1CA8B 2FOEA 4WF8A 2ZC9H 3NZIA 3C27B 3GY5A 3ZZ7A 4VGCC 1NPMA 1MKXK 1BTUA 1ZHMA 1KDQA 2ASUB 2D1JA 2GZ7A 3SZNA 4A1VA 4B73A 1TBZH 5T6GA 5KGOA 4X6NA 2VIWA 4ZH8A 1CA0B 2OC7A 3RC4A 1ID5H 1YGCH 7ESTE 4B76A 3RU4T 4NA7A 3RXCA 1NT1A 1IQIA 1BZXE 1C5VA 2K0QA 4K3JA 1VITH 2FESH 2KCYA 1HLTH 3OFND 2Q6GA 3MNBA 3QGJA 3RP2A 2BQWB 2Z3EA 1CHGA 4FETA 1GI2A 3OY5U 1BTYA 4KTUA 2A4QA 3KN2A 3U1JB 3SU3A 4R0IA 4TY6A 5DG6A 2ZU5A 1QRWA 2FEQH 4NWKA 1O2PA 1GJ5H 1MKWH 3OEHD 2LP6A 3H5CB 3RXVA 3RMMH 4DT7B 3T29A 5L2ZH 3TGJE 2Z9LA 2FP7B 2ODPA 1Z8GA 1KYNA 1Y3VA 1UVSH 2AGIX 3ZYDA 1CBWC 1DUAA 2ZP0H 3SGQE 2ZPSA 3ZVEA 1O31A 2HLCA 2ZA5A 4WY3A 1CT4E 4DT4A 2FODA 5CDFE 5LPEA 5DGJA 2VWLA 4E05H 1P02A 2QA9E 1K9OE 4WJG2 1NRQH 2D8WA 3MYWA 2ULLA 3UFAA 1SVPA 4HI3A 3SJKA 3QTVH 1TRNA 4NZQA 2R3UA 3KHVA 2FOFA 2OBQA 3SU6A 2IPQX 8GCHF 1IQEA 2L6OA 2P3UB 2PGQB 1GBFA 2R9PA 1UTKA 4TSFD 5JDUB 5K7RA 1O3CA 1NFXA 2UUYA 1QA0A 1C5ZB 3L33A 3F2HA 2VB0A 1FIWA 3DT0H 4SGAE 1LDTT 2QF4A 1AWFH 2G5NA 3V7TA 4D9QA 3LH1A 8GCHG 1BUIA 1IQGA 1S83A 2TGPZ 1AD8H 4K1EA 3Q00A 1CSOE 4IS5A 1EB2A 3MMGA 5FPSA 2BD4A 1GI5A 5A0AE 1LHFH 1FJSA 1YPJH 2VWMA 4JZFH 2A45B 4YO9A 3EYDA 8ESTE 1BA8B 5E0HA 2RFKC 3FP7E 1CA0C 2BY6X 1C1NA 2RG3A 2WSSD 3EA8A 2XC4A 2Y5GA 4DGJA 4GCHF 4Y0ZE 2CF8H 3MFJA 2QC2A 3A88A 4Y76A 2QF0A 3HGNA 1MZAA 2ZI2H 3TU7H 1C2KA 1XX9A 3H09A 2WUBA 1FV9A 1RGQA 2QIQA 2XTTB 1O3BA 2D2DA 2KCPA 3BSQA 1K22H 1AU8A 1TGSZ 2ANYA 3A8DA 1NZQH 4GUXA 2GZ9A 4FUEA 2BDYA 3JZ2B 2EEKA 2V7QD 1ZPBA 1UHBA 2J2UA 4A5TS 3SORA 1TX7A 3TNSA 1XUKA 2XNDD 1T32A 1TX6A 2HWLB 1C2FA 2ZF0H 4SGBE 4UDWH 1DDJA 2AIPA 4R8TB 4MVNA 1HAOH 3BTME 1EAWA 1YPMH 1C5XB 3RXFA 5DPAA 3SU0A 3L3TA 3SJ8A 1UTJA 2VINA 3UY9A 2G52A 2IN2A 2BDBA 3HK3B 1EAXA 1P10A 5A0BA 1BRUP 4AFUA 1WQVH 2FOAA 6CHAB 3VEQB 1SOZA 4RKJB 1O2TA 1ZJKA 5DK1A 1XMNB 4WMFA 5EXMA 3FP8E 1SGNE 3OAAD 5JB9S 3AW0A 1CGHA 4X0WU 5EJZA 4GVUA 4ISIH 4BAQB 1YKTA 1GBCA 3M35A 3F9GA 1Y3UA 1SR5C 1SLXB 1UTLM 2XYAA 3F2FA 5DP6A 1YPGH 2BDHA 2VH0A 1O5GH 1F7ZA 1EAUA 4BTUB 1O30A 2VIDA 2THFB 1FI8A 3STIA 1HFDA 1MUEB 1GJCB 5DSFA 4ABDA 2BXTH 1P2IA 1LQDB 4B71A 2XWBI 1GBIA 3PLPA 3TH4H 4AN7A 2HPPH 3VGCC 4XBCA 5FXLA 2HNTC 1GI9B 3A81A 3SV8A 1P57B 3KQ5A 5C20A 1DSUA 1C5LH 3VB4A 4B2BA 1QRZA 3AK5A 1O2HA 1QHRB 1FAKH 1ZGVA 2JJ2D 4Y7BA 3FOAA 1E35B 2ZGHA 4U32A 2BD7A 4WH8A 1EJAA 2ZIQH 1LHEH 2JH6D 1D9IA 4CRBA 4MPUA 3TK6A 1DANH 3E0NB 1A5HA 1GMHF 3SUFA 1GBDA 1K2I1 1L4ZA 1HJ8A 2VIQA 3SUGA 1HPGA 4Y10E 5DP3A 4A92A 5EU8A 1UW7A 1XM1A 1BCUH 1BMLA 6ESTA 1ELCA 1KTTB 2H5CA 3CP7A 3U28C 3U69H 4AFZA 1DT2A 4I32A 3U98H 1BJVA 3RLWH 3MQKC 1E1QD 2C4FH 2FXRA 1ZPZA 1EXFA 3SHCH 2XC5A 1KLIH 1NS3A 1SGDE 2DE9A 5C5NA 1HXFH 4IBLH 1MQ5A 1FZZA 1T8OA 2OLGA 2GT7A 1DPOA 4JZDH 1WUNH 2A32A 1TGNA 3LIWA 3V3MA 1C1MA 3UAIC 4WXVA 2W7SA 1D3TB 2CHAB 1XUHA 2Y7XA 3FO8D 1QL7A 3NK8A 1PPZA 3FANA 2ZCKP 1O2YA 3Q3YA 3M37A 3D62A 3RXEA 2BLWA 1ZTKA 1P05A 4CR9A 1UVUH 4WXIA 1Z7KA 1P9UA 3MWIU 6CHAC 2Y6TA 2H9TH 1C2IA 2ZGBH 1SBWA 1L1GA 3GDVA 1PYTD 5C2ZA 4DURA 5DP8A 1FN8A 3ATIA 3ZZ9A 2QXIA 1QNJA 2PUXB 4ZXYH 3LGYA 2CMYA 1MQ6A 1PQAA 1G2LA 1O2LA 2VGCB 2FPZA 1JBUH 3MU0A 2J34A 4X6MA 3ENSB 2BD3A 1QJ1B 3EA9A 1EPTB 2PGBB 2BXUH 1K1IA 4ZXXH 1V2LT 1C5WB 1OXGA 1SHHB 1QB9A 2Z9IA 1QJ6B 5GWZA 2LNCA 2WV9A 1V2OT 2PV9B 2ZGXH 1HV7A 3RU4E 1CT0E 3PROA 3GY8A 2OXSA 4PROA 2ZHEH 3F0PA 4LXBH 3SJIA 3GY7A 4LK4A 2XW9A 2VVCA 1K1MA 4KTCA 3MU5A 1GMDG 3KL6A 2JH5D 4HZHA 2Z3CA 5GJ4B 1FPHH 1THRH 2H9HA 3ZZBA 1W0JD 1W7GH 2F9PA 1YCPK 1K1PA 4H6SB 1SB1H 1O2OA 1EAIA 1O3KA 1TB6H 1BTXA 2FOHA 2HGTH 3OE7D 1BITA 1O33A 4AORA 1GI3A 2VVUA 3SZEA 5T6FA 3ZZ6A 2P8OB 1RTLA 2SGDE 1OHHD 2Y82A 3H7OA 3UUZA 3UB0A 3DD2H 3MHWU 3UQVA 2A5IA 3PLBA 5GIBA 1TWXB 1AI8H 1GHYH 1V2TT 4RSPA 1F0SA 3W1EA 1TLDA 1C1OA 1ABIH 1W7XH 1ZSLA 1YWUA 5HKKD 4AX9H 1SLUB 1K28D 3MH4A 4NG9H 3LKWA 1GVKB 1O3DA 1P01A 3M5NA 3CENA 1GI1A 3GICB 2ZZUH 4OGYA 1EATA 2CHAC 1ZGIA 2O8TA 1O3IA 1H9LB 1AIXH 1ZSKA 2HNTE 4ESTE 1S5SA 2EI6A 2ANWA 3A7ZA 2AH4X 1UK4A 1UK2A 5CE1A 1LVBA 4OS4A 3C1KA 4XFQA 3ZZCA 1GHWH 3T26A 1HAGE 5T3HA 4BXWA 3RLYH 1V2WT 1G32B 2PKSB 2H5DA 1G3CA 1CQQA 1VGCC 3LGWA 1N6YA 1GHBF 1JRSA 4CH2B 2ANMH 1U6QA 2WUCA 2VGCC 1ARCA 2RDEA 1RIWB 4JYUH 1M9UA 1EPTC 1ZPCA 3MNCA 3RXOA 4ABFA 3Q3KA 3GY2A 4F55A 5ESTE 1XVMA 1G30B 4K2YA 1GHBG 1QTFA 4D7FA 2Y80A 2A4RA 4MNYA 3TK5A 2H9EH 1AE5A 5C0TA 1S84A 3PO1B 3TK9A 3Q3XA 1VKYA 2PKAB 1FUJA 5JB8S 1C9TA 4OS6A 5EIYA 1HJAB 1O2WA 4AYYB 1SLWB 3LDXH 3GCTF 3UWIA 5FBEA 1K1JA 1GBJA 2HVXA 4A7IB 1GHXH 2FZZA 3SGBE 3O8RA 1O3NA 1JIMA 1YBWA 4Y6DA 4ZKSU 1AZZA 2V0BA 1L1NA 2TRMA 1CGIE 2GDEH 3MNXA 4NFFA 4ABBA 1NU7B 1T8NA 3RMLH 4E06H 1NBMD 3Q77A 1TE0A 1ELFA 3AASA 4F4OC 4XRNA 2ZU3A 3SNDA 1DWBH 5A09A 3RC5A 2VIOA 1E34B 4XOJA 1AQ7A 2JETB 3A7YA 3UREA 4GHTA 1EB1H 1ZMLA 3BIUH 3V13A 1MTSA 1HIAB 4DIIH 1E0FD 3P8GA 2J95A 2FLRH 4OM9A 1K0HA 2O8MA 2W3IA 4BXSA 2G8TA 2ZFPH 3B8JA 2SFAA 2AMPA 3A87A 3OTPA 2XBWA 1PQ7A 2HPQH 2VH6A 4XD7D 3PRBA 1L1JA 2K8IA 3QGNB 2FWWA 1EPTA 1FY4A 1IQNA 1EZSC 4UFFH 1AMHA 5HYOA 2UWOA 1SGRE 1YLCA 4ABGA 4THNH 1GBAA 5G4BA 3BG4C 3GDSA 4JYTA 2P95A 1YCPH 4NIYA 5HXFA 1ZOMA 2PKSC 2TPIZ 2QGRA 3ATWA 2ZECA 3M36A 3SBKA 1QURH 2XNIA 3ZVGA 1LO6A 3A86A 1O34A 1QBOA 2PR3A 2QCYA 4MLFB 4AB9A 3UNRA 2GVFA 2XCNA 1A5GH 1NTPA 2TIOA 2F9OA 2BDCA 2XBVA 1XUIA 1QY6A 1AUJA 1RJXB 4UEHH 4AGJA 1NFUA 1HYLA 3SN8A 2QXJA 3UR6A 1C5YB 2AHME 2FX6A 1ORFA 1S6LA 4B75A 3PO1C 1DXPA 1P2QA 2TGTA 4H42U 1HJAC 1O2QA 1Y5BT 1PPEE 1O3MA 4IGDA 1NRRH 3ZZ5A 3KQEA 1A0LA 1C5UA 2M5TA 1LHGH 2JKHA 1SMFE 4YOJA 3CS0A 4UD9H 1RTFB 2FYQA 3F6UH 1INCA 1CO7E 2C8WB 2SGPE 4RT1A 3BTQE 1X7AC 4MTBA 3BTKE 2W7UA 1LPZB 1ANBA 1C1TA 1DE7H 2GTBA 2M2AA 3KEEA 2WPIS 3QWCH 5DJ7A 3UWJH 1EZQA 2QAAA 5E8EH 2I6SA 4D8NA 4JMYA 3GCOA 4ABJA 1DX5M 1FXYA 2ZEBA 5GCHF 2JETC 1O2SA 1D6RA 2R2WU 2WPJS 3DFLA 1YLNA 4CRFA 2Z3DA 2G4UA 4O3UA 3W94A 1S85A 5KECA 2BM2A 1E1RD 2A5AA 2BLOA 3M61U 1AUTC 1MAXA 5DP5A 1GDNA 1SOTA 1A2CH 1B0EA 2TBSA 5GCHG 1D6WA 1JRTA 1O2NA 4IN1A 2ODQA 2ZDVH 1KLTA 2FIRH 1IQHA 3B9FH 3M3VA 3UNQA 5TCAA 1HAHH 4K8YA 2F3CE 3E91A 4FUGA 5FL7D 4A1TA 1QRXA 4YZUA 1OP8A 2WPDD 1MD8A 1C5MD 5F8ZA 2FOCA 1DICA 2AGGX 2P94A 2WPHS 1SGYE 1T31A 1PYTC 3E90B 2I6QA 2DUCA 3DHKH 1BMNH 5E0GA 2PKAA 2W6ID 4M7GA 4YOIA 3F9EA 2P16A 3F0OA 3QLPH 3O8BA 4X8VH 5EXLA 2XXLA 1ESAA 2NU0E 4AC9A 3AVZA 4GPGA 1E38B 1GBBA 1RS0A 3WY8A 2STBE 4Q2KA 3U9AH 3BN9A 3E1XB 1BRBE 2ZHQH 1NN6A 2CXVA 4BAOB 1GJ9B 1TIOA 1EQ9A 1TPSA 3LONA 2SNWA 3UIRA 2ZKSA 4ISLA 2YNAA 4CRGA 1C2LA 3S9AA 1WYKA 3UR9A 1G3EA 2GCTC 2VJ1A 3U8TH 5FX6A 1WSSH 1V2PT 3MOCA 3GY4A 1TMUH 2ZU2A 4ZKRU 2GKVE 1FY5A 3AAVA 1K21H 3RUOA 1P04A 3A84A 1OWEA 2UUJB 2GDDA 1YPHC 1XUJA 4TPIZ 1DWEH 3NUMA 1GWAA 2ZFFH 1HJ9A 1MU6B 2OC8A 2BYAX 1PPCE 3TH2H 3SV2H 1AB9B 1GJBB 2FYRA 4A1XA 2AGEX 1YYY1 4B1TA 2IJD1 3KIDU 1HCGA 1HIAA 1XUGA 3V12A 3IITA 1NFWA 1XKAC 1BIOA 3WWFA 1KXBA 4Y0YE 1RFNA 1Z8JB 5C1XA 4CBOA 1MTWA 3T62A 4DCDA 3M5LA 2G00A 1IHTH 2WYGA 5FPTA 3T2NA 1V3XA 2Y7ZA 5FAHA 4IN2A 6GCHF 3PMAB 2HALA 4K5ZA 3SV6A 3AW1A 5DKMA 2B0FA 1A0JA 1JIRA 1V2RT 2G55A 1GDUA 3E6PH 4I8JA 1TA6A 3ZZDA 4BTTB 3K65B 1YPKH 1IHSH 3KF2A 1GBEA 3F9FA 4AFSA 2SGEE 6GCHG 1G2MA 1N1LA 1NU9A 4LZ4B 3TJNA 1L0ZA 1BRCE 3N7OA 1MKXH 1C5RA 3SU4A 2ZCLP 1MH0A 4XSKU 3SUDA 1DSTA 2A2XH 1B7XB 3S7HB 3G01A 3P8NA 3U8RH 4Z0KA 3HATH 2BDAA 1GHZA 2HVYB 1HAVB 1Z8RA 1P0SH 2XOKD 3OTJE 1HAPH 2OK5A 3RM2H 1PFXC 3UPEA 5L6NH 1HB0B 3RXHA 1S6FA 1KY9A 1WDIA 3I78A 5EQQA 1EOLA 1ESTA 1OWDA 1THSH 4IMQA 2ILNA 3SU1A 5EXNA 3KYFA 3PRDA 1FLEE 2ZFTA 1BBRE 4YT6H 1C2EA 3LJOA 1H9HE 5TCCA 1FMGA 4H4FA 4MQAA 5TJXA 1P11E 2J9NA 2PSXA 1LPGB 3ODFA 4Q4LA 3SI3H 3A7VA 1BMAA 3MNSA 2EA3A 1C4V2 3N7EA 1AZ8A 2QXGA 2WHXA 4E7RG 3GOVB 1S0RA 4BTIB 1ZTJA 3H7TA 1AB9C 4Y8XA 4I33A 1MTNB 1DY9A 1TGTA 2Q6FA 1Y59T 2IPHA 3F1SB 4ASHA 3RXBA 1O3HA 9LPRA 4F49A 2RDLA 4ABEA 1V2KT 4ZHAA 1ELVA 5DN6D 1FAXA 2PFEA 1HRTH 1P2MA 5EQSA 5C17A 4NIVA 3KNXA 1IQMA 1C4U2 1GVZA 1FIZA 1P03A 1YC0A 1SGCA 1WQSA 2OUAA 5EW1H 5A0CA 3MI4A 1P3CA 1SSXA 2C8ZB 4ZROA 1O2VA 2AEIH 1TPAE 4RN6A 4E7NA 3RC6A 5FPYA 1SHYA 1ANDA 3MTYA 4Y8ZA 1Y8TA 1AVXA 1BMFD 4YLUA 1OYTH 3D65E 2PP6A 1BHXF 2VVVA 4KGAA 6LPRA 2QE7D 2TGAA 3RXPA 1DM4B 1EZXC 1SFIA 2ZU4A 3A8BA 1IQLA 5EJLA 3NRLA 1A46H 5BPEA 3LGIA 2ANKH 3P17H 2VWNA 3RDZA 1V2QT 2QY0B 4INHA 4DIHH 1ZMJA 3TITA 1YCPM 3TJVA 2ZFSA 2BB4A 1YPHE 3ZZ4A 1CT2E 5LH8A 1SQAA 4X6OA 5B6OA 3S7KB 5T1VA 2Z7FE 3R3GB 2L74A 3LJJA 1Q3XA 2BMGB 4AB8A 2P3TB 1AFEH 5J4SA 1TNIA 3DA9B 1GJ7B 2PWXA 2R2MB 3ODDA 1Z1IA 1SGFA 2Z9KA 2YOLA 5A2MH 5FCRA 1KLJH 1QJ7B 1AGJA 1WTGH 3FZZA 2BQ7B 4HTCH 1ZJDA 3EA7A 3KQCA 1QIXB 1KMHB 1Y3YA 2XBYA 3SNAA 4NA9H 1P2NA 1UTMA 1TAWA 2UUKB 1XKBC 2NU2E 1SC8U 1C2GA 3HGPA 4KKDA 3KQDA 3S69A 3A8AA 4U2WA 1SI5H 5C1UA 4LOYH 3A80A 1WBGB 1TALA 2A7CA 1H9IE 2B7DH 4GHQA 1TMBH 2BZAA 1F2SE 1E79D 1MTNC 1Z71A 2OP9A 1PJPA 1UTQA 3BG8A 1GMDF 2FI3E 4IC5A 4NIXA 1AFQB 1O2RA 1LHCH 4DVAU 5GXPA 1C1WH 3TGIE 2BD8A 2P93A 1O35A 2GV6A 1GJ8B 1GPZA 1W10U 2W5EA 4MNXA 3UNSA 3HK6B 3TNTA 1GI7B 1JXPA 1SGPE 1AE8H 3DSOA 1GBHA 4NWLA 3UOPA 2FTLE 2J98B 3RXMA 1L4DA 3I29A 2WPMS 3T5FH 3A85A 4I8HA 1DUEA 2XC0A 1KXAA 4FUHA 4UFGH 3CS7A 1YM0A 3S9BA 3GCNA 1C1RA 5EODA 5ABWA 1LTOA 1B0FA 1GBTA 1HAVA 3NXPA 3LPRA 3ZZAA 3SQEE 1O5FH 1HDTH 2VBCA 4ZUHA 1AHTH 3BF6H 1QL9A 2Z6BD 1WV7H 3LU9B 1AWHB 4KELA 2LELA 3VXFH 4ZKOU 4IMZA 1A0HB 2XWAA 3SUEA 2ZPQA 3E16B 1C2JA 2Q1JA 1GG6B 4MDSA 4U01A 4K1TA 1GCTB 5F03A 2UWLA 4ABIA 1NC6A 4MPXA 4TT3D 3TLOA 4YXWD 1SPJA 1TX8A 2PUQH 2ZDMA 1TBQH 5ESBA 2H6MA 3BV9B 1TPOA 7KMEH 3UQOA 2KFWA 4H6TA 1N8OB 1NBME 4Q63A 1QR3E 2GZ8A 1ELBA 1O36A 1TQ7B 1GL1A 1NY22 2ZTZA 5DP4A 2AERH 2SGFE 3F9HA 3F2GA 2HNTF 3IG6B 4CRCA 2QF5A 2F9VA 3M7UA 1IQFA 1P12E 1NO9H 2F9NA 4O3TA 2WZQA 7GCHF 3ITIA 4D7GA 4D76A 4UONA 3E3TA 1BOQA 1ZRBA 3RXUA 2GMTB 1QL8A 1OWHA 2QN5T 2W3KA 1V2JT 1EP6A 2ZWLH 1K1NA 4CHAB 2C93B 4AGKA 2C90B 2H2ZA 2YNBA 4ZHMU 2A1DB 7GCHG 2WV5A 5CHAB 1SGEE 4Z6AH 1O3OA 1YY3A 3A82A 1CHOG 1SQOA 1OKXA 1AFQC 2OBOA 3PMHB 2XBXA 3A89A 1NRNH 2V3MA 2SGQE 4ACBA 2J38A 3SO3A 4O97A 1A5IA 1GBLA 1MAYA 3LOXA 9ESTA 2G81E 1EP5A 1SL3A 3PV2A 2O8WA 2A7JA 3QX5H 5HMAA 1P2KA 2ODYB 2UWPA 1ARBA 3CNRA 2BQ6B 2BVXH 4X8UH 3O8CA 1K1LA 4X6PA 1QB6A 5GDSH 3RXIA 2V35A 1XUFA 1TNJA 4JCNA 4FXGH 4M9FA 1MMJN 1BTPA 1Y3WA 3IWMA 2OQUA 1G3BA 5FX5A 5JBTA 2NWNA 2FI5E 2OC0A 2A4OA 1QGFA 2P8OC 2WYJA 4ZMAH 2CGAA 2ZHDA 4VGCB 1O3FA 1FY1A 3GY6A 1PPBH 3PTNA 1DY8A 3ZV9A 1MTVA 5CMXH 3A7TA 4B2CA 4I86A 2Q6DA 3VXEH 1O3LA 4ZKNU 3A7WA 3PWCA 4I7YH 1D3QB 1EFRD 1AVGH 1AKSB 4Q7ZA 4J2YB 3PYHA 3P6ZB 2ZG0H 1GG6C 3RXRA 4WMDA 4YTAA 4FU9A 4K69A 3UTUH 2Y5FA 1GCTC 3LH3A 3WW7A 1V2ST 3K2UA 2A5KA 3TPIZ 4B74A 2A0QB 1FPCH 4O9VA 3URDA 1F0UA 5C1YA 1O5AB 3VPKA 1A4WH 2GCHG 1GI4A 1LMWB 2FS9A 3MH7A 2C8XB 2WINI 1W8BH 1YLDA 1GHAG 1N8OC 1S0QA 3PTBA 5HM9A 1GI0A 1SQTA 2ZTYA 2SNVA 4WWYA 1SGTA 1O5CB 1Q2WA 3R0FA 1FONA 4X1PU 2ZDLA 1GL0E 2J97A 1O2UA 1VITG 3MH6A 1HAXB 4DJZB 2B8OH 3BTHE 3RXAA 1TYNA 1H8IH 4XDEA 5JPMH 2FM2A 1NM6A 2J5UA 1ETRH 1RIWC 1H8HD 3TVJB 2EI7A 1J16A 2CF9H 1THPB 1BHXB 1F5LA 2PLXA 5L30H 1YPLH 1ESBA 2Y81A 5JBBS 2BVSH 2J98A 1DWDH 2STAE 4MG3A 3TGKE 1MZDA 4LZ1H 1OPHB 3LGTA 1F5RA 3ESTA 2JDID 3PWBA 1BJUA 2YMSD 2O8UA 5E0JA 1K1OA 5GNDA 2FOGA 2JJ1D 5C67A 1EOJA 1WOFA 1EASA 4TYDA 2F83A 1PPHE 5I46H 4KP0A 4CH8B 3VB3A 2ZNKH 3M3TA 1ETSH 4FUIA 2BY5X 3QTOH 1O3EA 3U1IB 1Z8IB 1ETTH 1ZSJA 1V2UT 2OD3B 4DG4A 1IQJA 2J92A 1AN1E 1MBQA 1IQKA 1QZ8A 2C3SA 2DE8A 2HRVA 3FAOA 1O3AA 4BAMB 4Q7YA 1SFQB 4TWYA 3SOSA 3STJA 1C4Y2 2PTCE 3UOUA 4Q80A 4DOQA 1W0YH 1KTSB 1W3CA 4XBBA 1H8ED 2ALPA 1MU8B 4ZHLU 2BZ6H 1KIGH 1KXEA 1WU1A 1C5PA 4CREA 3E0PB 1LVOA 1GI8B 1TBRH 2ESTE 2RA3A 5HGGA 3A7XA 2VNTA 1D4PB 1F5KU 3ZIAD 1VCWA 4Y11E 5F8XA 1HGTH 3BTWE 1ZHPA 3BTEE 1W13U 4ISOA 2NU3E 1A7SA 2V6NA 3RXKA 4CR5A 2BY8X 5C3NA 2CJIA 5J4QA 3SU2A 1TNHA 2VIPA 5EW2H 1AY6H 3GCHB 2BHGA 5LGOA 5A8XA 3DSGA 2GJGA 2KZ4A 3E8LA 1TMTH 4X2XA 2B5TB 1XXFA 4OS2A 4YT7H 1T8LA 3LGVA 3ZVDA 2ZCHP 2W6JD 3O8DA 3WWBA 2ZHWH 5DO4H 1UJ1A 1QBNA 3OY6U 2G4TA 2ZGCA 2FOMB 3P8FA 2J94A 4FU8A 1Z6JH 3EDXB 4WH6A 2R0KA 1C2DA 1UVTH 2BDGA 4MPWA 1OWJA 1O2XA 4AG2A 3ZVAA 1ELEE 4UE7H 1A1RA 1C1PA 1ZMNA 2LPRA 2ZPRA 2BOKA 3SNCA 1JOUB 4RKOB 3RMNH 1P09A 3EE7A 1MABB 5T6DA 1TNLA 1GMCF 2F9BH 3HKJB 4NGAH 5EQRA 2FI4E 4A6LA 1NRPH 1TFXA 5PTPA 1N6XA 4YOGA 1O2MA 2XRCA 1VJAU 1ELDE 3GISB 2O8LA 1AKSA 1E37B 1GMCG 2SGAA 4FUCA 1OWIA 1O39A 3QDZB 3S9CA 1SG8B 2A7HA 1GVLA 4NIWA 1UO6A 4AFQA 3FN8A 2JH0D 4HFPB 1NESE 1YF4A 5K0HA 1O2ZA 3PLKA 1J9CH 4I8LA 5SGAE 3NKKA 2B9LA 4GSOA 2TGDA 4ISNA 3T25A 2JIZD 2GGVB 1BTWA 1TQ0B 2CV3A 5DP7A 3VGCB 3RM0H 1JWTA 1ACBE 2V3OH 3ELAH 2FDAA 5AFYH 1BB0B 2ZHFH 5EOKA 1GJ6A 2FO9A 1LVMA 1C9PA 3GYMA 3PB1E 1WCZA 4INKA 5AHGH 3RXTA 1DFPA 3ATLA 1NROH 4JZIA 1OX1A 1OWKA 1B5GH 1QQUA 1CGJE 1Y5UT 2EY4C 3TH3H 1SLVB 3SJOA 3V0XA 2ZFRH 1J8AA 4B6FA 1S82A 1H1BA 4X1QU 2BLVA 2KAIB 1F0TA 4J1YA 1GGDB 2Z9GA 2WPLS 3MO9A 3A83A 3S0NA 3PV4A 4GCHG 3GCHC 1ZYOA 2J4IA 2F43B 2ZO3H 4MNWA 4RT0A 1BBRK 3T28A 4FVBA 1BTZA 4BAHB 1GBMA 1HNEE 3OSYA 2RCEA 4FUBA 2WV4A 1Y5AT 1TGCA 1JMOH 1BT7A 2G51A 3NPSA 1HUTH 3P70B 1H8DH 3DCLA 3KCGH 2F91A 3PM3A 2Z9JA 3EGKH 1TABE 4X1RU 1YPEH 2BLQA 1O37A 1SGQE 1C2MA 4Y71A 5IYTA 3SQHE 5AF9H 4I8GA
chains in the Genus database with same CATH topology
1O3PB 1LKBA 2BD5A 1UTNA 4TPYA 4IC6A 1WAYB 1GI6A 1MTUA 4OS5A 1TRMA 3FFGA 3TIUA 1W12U 3QK1A 1RXPA 1V2NT 3PMBB 2BDIA 3K6ZA 5A8ZA 3QZQA 3FVFB 5DP9A 1C5NH 2HOBA 1KSNA 3BTFE 1DWCH 2C8YB 4YESB 3QN7A 1OSSA 3EE0B 2GV7A 3PMJA 1TNKA 2AYWA 4ABAA 2BX3A 1P2OA 1O2KA 1VCPA 3SU5A 1FDPA 4WVPE 2PTNA 3KGPA 1TGBA 3LT3A 4BANB 1L2EA 1MBMA 3MO6A 5LPFA 4FUFA 2AMDA 1G3DA 3M5MA 4OS7A 2EC9H 4HGCA 1QFKH 1CU1A 3ATKA 1AVWA 4O03A 2GD4B 4FU7A 3SHAH 1V2VT 1GJDB 3AAUA 1EKBB 2K1QA 2VWOA 3RXSA 2GP9B 4ZAEA 1UK3A 4K8BA 4NZLA 3TJUA 1E36B 2FOBA 5AVDA 2UUFB 1TRYA 1J14A 3BIVH 3F68H 1HAYB 3ZYEA 1ABJH 1LKAA 3ZV8A 3OX7U 1EX3A 2OINA 3GYLB 1GGDC 4FUDA 1DXWA 4AG1A 5EG4A 2ZTXA 1FN6A 1QBVH 2WPKS 3W95A 2O9QA 1FY8E 4X2WA 1KXCA 4NCYA 1VJ9U 1GMHG 1NRSH 1PQ5A 3Q76A 3OYPA 1ZR0A 1P8VC 1O5BB 1UVPA 1RRKA 4WMEA 1LPKB 2D26C 1HAZB 1HXEH 2Y5HA 1DS2E 1A3EH 1TNGA 3SV7A 1O32A 1EUFA 4XBDA 4ABHA 3MU4A 3BTDE 1C1VH 1C1QA 5H4IB 1P3EA 3M3SA 2F9UA 3ATMA 3VFEA 1BRAA 2IOTA 3T27A 4DY7B 1C2HA 1UTOA 1DVAH 1O5DH 1O5EH 2BY7X 1F0RA 1GHVH 1GJ4H 2QXHA 5JBAS 1LHDH 2VIVA 3MU1A 3P8OA 4NFEA 3D49H 2ZU1A 5JYIA 1C1SA 5E2PA 4JYVH 2PSYA 1SGIB 1QCPA 3RMOH 2ZGJA 1BDAA 5I25A 4ISHH 1VGCB 4CRDA 5LPRA 1BBRH 4INLA 1ZTLA 2CN0H 4TY7A 3VB7A 1T4VH 2GX4A 3B23B 3M5OA 4BNRA 1W2KH 2P3FH 1KXFA 3DFJA 1GBKA 5EPYA 1J17T 2OC1A 4BOHA 2QF3A 2BD2A 5E2OA 3LGUA 2PW8H 3SW2B 4MNVA 4U30A 2KAIA 2ALVA 1C1UH 1O38A 2Z94A 3M7QA 5EPNA 3QZRA 4IW4E 1VCQA 2ZDAH 3OU0A 1UMAH 8LPRA 1C5QA 3VB5A 1TOMH 4X8SH 2BTCE 5L2YH 1QA7A 1C5OH 1S6HA 1RD3B 1ZLRA 3EAJA 3K6YA 3RXGA 4MPVA 2R3YA 3QO6A 4QT8C 3ZZ8A 4YM9A 1V2MT 2A31A 2R0LA 1OYQA 5C5OA 3MH5A 1TA2A 1Z1JA 1VZQH 1DITH 1EJNA 3M7TA 1Z6EA 1TONA 1D3DB 1IAUA 1RTKA 3K9XB 3HKIB 3RXLA 1UCYK 2NU1E 2A2QH 1HAIH 3LC5A 2A4GA 2NU4E 4X2YA 4K1SA 1G37A 1KXDA 1KDQB 1P06A 2BD9A 1OP0A 1BQYA 1TPPA 3FP6E 1OS8A 5FHTA 1CVWH 4X2VA 1GJAB 2IJOB 2W26A 1H4WA 2GT8A 1PPFE 1T8MA 1F92A 3GDUA 5A8YA 1FQ3A 2BOHB 3RU4D 4Y79A 5BRRE 3MO3A 1UCYE 3A8CA 1G9IE 2EI8A 1FNIA 2G5VA 1PQ8A 1J15A 3ZZ3A 3BG4B 1SGFG 3EQ0H 3TJOA 1CHOF 2RA0A 1D3PB 4CRAA 1Y3XA 4Y8YA 3SI4H 2ZFQH 1P2JA 3BEFB 5AFZH 1A3BH 4I8KA 5EGMA 4AOQA 1YP9A 1V6DA 4I31A 3JZ1B 3LC3A 5FBIA 1NFYA 3BEIB 2PHBA 4DW2U 1QB1A 3GY3A 1EZUC 1XXDA 4JK5A 1PPGE 3NCLA 4TWWA 3BTTE 4Q7XA 1O3GA 1P9SA 1OOKB 1W14U 2VU8E 1FY3A 2FX4A 1UTPA 4CBNA 2FMJA 1VR1H 2XCFA 1MD7A 2QYIA 2H1UA 3L6PA 1IOEA 1ZRKA 5F6MA 3P95A 4KTSA 4X8TH 1MKWK 1CE5A 3SV9A 2FTMA 2AIQA 1C5TA 1Q31A 1O0DH 5FCKA 3BEUA 4FVDA 4D9RA 1S81A 3D23A 4GAWA 8KME2 3GCTG 2ZDNA 4OGXA 1ELTA 3QUMP 2GCHF 4NSVA 1MCTA 2BVRH 1DLEA 1ANEA 1EJMA 1GHAF 4UFDH 1OP2A 3SNEA 1MCVA 1XVOA 3NWUA 5ETXA 3I77A 1AO5A 1VITF 3FZDA 1ZHRA 1C5SA 1T7CA 5JBCS 1DLKB 2ZDKA 2OQ5A 1ELGA 2P59A 1HBTH 2ZQ2A 3VB6A 5GPIB 4FUJA 4K60A 4JZEH 5IDKA 2QV1A 4AYVB 2BY9X 3RXQA 3SGAE 3HPTB 1ANCA 2BX4A 3P92A 1G36A 1LCYA 1WTHD 1O2JA 2AFQB 3RXDA 1LVYA 1ZZZA 2ZQ1A 2FLBH 4B2AA 5F8TA 1DOJA 3U8OH 1GCDA 1BMMH 2AS9A 1CBWB 3ZVBA 3DUXH 2GMTC 1A61H 3SNBA 5HM2A 4Y7AA 4CHAC 2V3HH 2OTVA 3KQBA 3ZVFA 1W11U 3RXJA 1UCYH 5CHAC 1UHBB 1BTHH 1UVOA 4UFEH 4X1SU 3URCA 2AMQA 3MU8A 1TOCB 4NSYA 4JZ1A 4BAKB 1GDQA 1O3JA 4GLYA 4JK6A 2OCVB 3BTGE 3ZVCA 4NA8A 1O2IA 1QQ4A 1LQEA 1W0ZU 4AZ2B 4XE4A 2GCTB 3SJ9A 2FS8A 1T4UH 4YLQH 4OS1A 1O2GH 1ELAA 7LPRA 4X1NU 1CA8B 2FOEA 4WF8A 2ZC9H 3NZIA 3C27B 3GY5A 3ZZ7A 4VGCC 1NPMA 1MKXK 1BTUA 1ZHMA 1KDQA 2ASUB 2D1JA 2GZ7A 3SZNA 4A1VA 4B73A 1TBZH 5T6GA 4X6NA 2VIWA 4ZH8A 1CA0B 2OC7A 3RC4A 1ID5H 1YGCH 7ESTE 4B76A 3RU4T 4NA7A 3RXCA 1NT1A 1IQIA 1BZXE 1C5VA 4K3JA 1VITH 2FESH 1HLTH 2Q6GA 3MNBA 3QGJA 3RP2A 2BQWB 2Z3EA 1CHGA 1GI2A 3OY5U 1BTYA 4KTUA 2A4QA 3KN2A 3U1JB 3SU3A 4R0IA 4TY6A 5DG6A 2ZU5A 1QRWA 2FEQH 4NWKA 1O2PA 1GJ5H 1MKWH 3H5CB 3RXVA 3RMMH 4DT7B 3T29A 5L2ZH 3TGJE 2Z9LA 2FP7B 2ODPA 1Z8GA 1KYNA 1Y3VA 1UVSH 2AGIX 3ZYDA 1CBWC 1DUAA 2ZP0H 3SGQE 2ZPSA 3ZVEA 1O31A 2HLCA 2ZA5A 4WY3A 1CT4E 2FODA 5LPEA 5DGJA 2VWLA 4E05H 1P02A 2QA9E 1K9OE 4WJG2 1NRQH 2D8WA 3MYWA 2ULLA 3UFAA 1SVPA 4HI3A 3SJKA 3QTVH 1TRNA 4NZQA 2R3UA 3KHVA 2FOFA 2OBQA 3SU6A 8GCHF 1IQEA 2P3UB 2PGQB 1GBFA 2R9PA 1UTKA 5JDUB 5K7RA 1O3CA 1NFXA 2UUYA 1QA0A 1C5ZB 3L33A 2VB0A 1FIWA 3DT0H 4SGAE 1LDTT 3V7TA 1AWFH 2G5NA 4D9QA 8GCHG 3LH1A 1BUIA 1IQGA 1S83A 2TGPZ 1AD8H 4K1EA 3Q00A 1CSOE 4IS5A 1EB2A 3MMGA 5FPSA 2BD4A 1GI5A 5A0AE 1LHFH 1FJSA 1YPJH 2VWMA 4JZFH 2A45B 4YO9A 3EYDA 8ESTE 1BA8B 5E0HA 3FP7E 1CA0C 2BY6X 1C1NA 2RG3A 3EA8A 2XC4A 2Y5GA 4DGJA 4GCHF 4Y0ZE 2CF8H 3MFJA 2QC2A 3A88A 4Y76A 2QF0A 3HGNA 1MZAA 2ZI2H 3TU7H 1C2KA 1XX9A 2WUBA 1FV9A 1RGQA 2QIQA 2XTTB 1O3BA 2D2DA 3BSQA 1K22H 1AU8A 1TGSZ 2ANYA 3A8DA 1NZQH 4GUXA 2GZ9A 4FUEA 2BDYA 3JZ2B 2EEKA 1ZPBA 1UHBA 2J2UA 4A5TS 3SORA 1TX7A 3TNSA 1XUKA 1T32A 1TX6A 2HWLB 1C2FA 2ZF0H 4SGBE 4UDWH 1DDJA 2AIPA 4R8TB 4MVNA 1HAOH 3BTME 1EAWA 1YPMH 1C5XB 3RXFA 5DPAA 3SU0A 3L3TA 3SJ8A 1UTJA 2VINA 3UY9A 2G52A 2IN2A 2BDBA 3HK3B 1EAXA 1P10A 5A0BA 1BRUP 4AFUA 1WQVH 2FOAA 6CHAB 3VEQB 1SOZA 4RKJB 1O2TA 1ZJKA 5DK1A 1XMNB 4WMFA 5EXMA 3FP8E 1SGNE 5JB9S 3AW0A 1CGHA 4X0WU 4GVUA 4ISIH 4BAQB 1YKTA 1GBCA 3M35A 3F9GA 1Y3UA 1SR5C 1SLXB 1UTLM 2XYAA 5DP6A 1YPGH 2BDHA 2VH0A 1O5GH 1F7ZA 1EAUA 4BTUB 1O30A 2VIDA 2THFB 1FI8A 3STIA 1HFDA 1MUEB 1GJCB 4ABDA 2BXTH 1P2IA 1LQDB 4B71A 2XWBI 1GBIA 3PLPA 3TH4H 4AN7A 2HPPH 3VGCC 4XBCA 5FXLA 2HNTC 1GI9B 3A81A 3SV8A 1P57B 5C20A 1DSUA 1C5LH 3VB4A 4B2BA 1QRZA 1O2HA 1QHRB 1FAKH 1ZGVA 4Y7BA 1E35B 2ZGHA 4U32A 2BD7A 4WH8A 1EJAA 2ZIQH 1LHEH 2JH6D 1D9IA 4CRBA 4MPUA 3TK6A 1DANH 3E0NB 1A5HA 1GMHF 3SUFA 1GBDA 1K2I1 1L4ZA 1HJ8A 2VIQA 3SUGA 1HPGA 4Y10E 5DP3A 4A92A 5EU8A 1XM1A 1BCUH 1BMLA 6ESTA 1ELCA 1KTTB 2H5CA 3CP7A 3U69H 4AFZA 1DT2A 4I32A 3U98H 1BJVA 3RLWH 2C4FH 2FXRA 1ZPZA 1EXFA 3SHCH 2XC5A 1KLIH 1NS3A 1SGDE 2DE9A 5C5NA 1HXFH 4IBLH 1MQ5A 1FZZA 1T8OA 2OLGA 2GT7A 1DPOA 4JZDH 1WUNH 2A32A 1TGNA 3LIWA 3V3MA 1C1MA 4WXVA 2W7SA 1D3TB 2CHAB 1XUHA 2Y7XA 1QL7A 3NK8A 1PPZA 3FANA 2ZCKP 1O2YA 3Q3YA 3M37A 3D62A 3RXEA 2BLWA 1ZTKA 1P05A 4CR9A 1UVUH 4WXIA 1Z7KA 1P9UA 3MWIU 6CHAC 2Y6TA 2H9TH 1C2IA 2ZGBH 1SBWA 1L1GA 3GDVA 1PYTD 5C2ZA 4DURA 5DP8A 1FN8A 3ATIA 3ZZ9A 2QXIA 1QNJA 2PUXB 4ZXYH 3LGYA 2CMYA 1MQ6A 1PQAA 1G2LA 1O2LA 2VGCB 2FPZA 1JBUH 3MU0A 2J34A 4X6MA 3ENSB 2BD3A 1QJ1B 3EA9A 1EPTB 2PGBB 2BXUH 1K1IA 4ZXXH 1C5WB 1OXGA 1V2LT 1SHHB 1QB9A 2Z9IA 1QJ6B 5GWZA 2LNCA 1V2OT 2PV9B 2ZGXH 1HV7A 3RU4E 1CT0E 3PROA 3GY8A 2OXSA 4PROA 2ZHEH 4LXBH 3SJIA 3GY7A 4LK4A 2XW9A 2VVCA 1K1MA 4KTCA 3MU5A 1GMDG 3KL6A 2JH5D 4HZHA 2Z3CA 5GJ4B 1FPHH 1THRH 2H9HA 3ZZBA 1W7GH 2F9PA 1YCPK 1K1PA 4H6SB 1SB1H 1O2OA 1EAIA 1O3KA 1TB6H 1BTXA 2FOHA 2HGTH 1BITA 1O33A 4AORA 1GI3A 2VVUA 3ZZ6A 5T6FA 2P8OB 1RTLA 2SGDE 2Y82A 3H7OA 3UUZA 3DD2H 3MHWU 3UQVA 2A5IA 3PLBA 5GIBA 1TWXB 1AI8H 1GHYH 1V2TT 4RSPA 1F0SA 1TLDA 1C1OA 1ABIH 1W7XH 1ZSLA 4AX9H 1SLUB 1K28D 3MH4A 4NG9H 3LKWA 1GVKB 1O3DA 1P01A 3M5NA 3CENA 1GI1A 3GICB 2ZZUH 4OGYA 1EATA 2CHAC 1ZGIA 2O8TA 1O3IA 1H9LB 1AIXH 1ZSKA 2HNTE 4ESTE 1S5SA 2EI6A 2ANWA 3A7ZA 2AH4X 1UK4A 1UK2A 5CE1A 1LVBA 4OS4A 3C1KA 4XFQA 3ZZCA 1GHWH 3T26A 1HAGE 5T3HA 4BXWA 3RLYH 1V2WT 1G32B 2PKSB 2H5DA 1G3CA 1CQQA 1VGCC 3LGWA 1N6YA 1GHBF 1JRSA 4CH2B 2ANMH 1U6QA 2WUCA 2VGCC 1ARCA 1RIWB 4JYUH 1M9UA 1EPTC 1ZPCA 3MNCA 3RXOA 4ABFA 3Q3KA 3GY2A 5ESTE 1XVMA 1G30B 4K2YA 1GHBG 1QTFA 4D7FA 2Y80A 2A4RA 4MNYA 3TK5A 2H9EH 1AE5A 1S84A 3PO1B 3TK9A 3Q3XA 2PKAB 1FUJA 5JB8S 1C9TA 4OS6A 1HJAB 1O2WA 4AYYB 1SLWB 3LDXH 3GCTF 3UWIA 5FBEA 1K1JA 1GBJA 2HVXA 4A7IB 1GHXH 2FZZA 3SGBE 3O8RA 1O3NA 1JIMA 1YBWA 4Y6DA 4ZKSU 1AZZA 2V0BA 1L1NA 2TRMA 1CGIE 2GDEH 3MNXA 4NFFA 4ABBA 1NU7B 1T8NA 3RMLH 4E06H 3Q77A 1TE0A 1ELFA 3AASA 4F4OC 2ZU3A 3SNDA 1DWBH 5A09A 3RC5A 2VIOA 1E34B 4XOJA 1AQ7A 2JETB 3A7YA 3UREA 4GHTA 1EB1H 1ZMLA 3BIUH 3V13A 1MTSA 1HIAB 4DIIH 1E0FD 3P8GA 2J95A 2FLRH 2O8MA 2W3IA 4BXSA 2G8TA 2ZFPH 3B8JA 2SFAA 2AMPA 3A87A 2XBWA 1PQ7A 2HPQH 2VH6A 1L1JA 3QGNB 2FWWA 1EPTA 1FY4A 1IQNA 1EZSC 4UFFH 1AMHA 5HYOA 2UWOA 1SGRE 1YLCA 4ABGA 4THNH 1GBAA 5G4BA 3BG4C 3GDSA 4JYTA