2ZDMA

Exploring trypsin s3 pocket
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Congeneric but still distinct: how closely related trypsin ligands exhibit different thermodynamic and structural properties
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2007-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zdmA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zdmA02
1E34B 1QBNA 3M5OA 1Q3XA 1EKBB 3V0XA 1EAXA 2WYGA 1IQFA 1Y3XA 2RDLA 1MD8A 1HAIH 2HLCA 1O3JA 4NFFA 3GY4A 2FO9A 3PYHA 3QZRA 2F9UA 4K8YA 1RXPA 3QO6A 3V3MA 2VINA 1KY9A 2VIPA 2H1UA 1UVPA 3PMJA 3PTBA 3VB6A 1O3HA 1C5YB 1RRKA 3ZZ5A 3SGBE 1GBTA 1LDTT 2V3OH 1K9OE 4X6PA 1A3BH 2J94A 3SOSA 3RU4T 5LPEA 5GCHF 1Y3WA 1V2RT 4DW2U 1GVKB 2F9OA 4NA8A 3BTME 1LVOA 1O3DA 4X1RU 1P2MA 1ZSKA 3M7UA 1ZRBA 4UE7H 2HVXA 1QB9A 1ZTKA 1S84A 1Y3YA 2ILNA 2EC9H 1ANBA 3RXIA 4PROA 3OTJE 3T2NA 4CRCA 2WUCA 2ESTE 5E8EH 1W7XH 1A5HA 1NRSH 3VFEA 1J15A 1NFYA 3B8JA 1DS2E 1Z1JA 4XBBA 1DE7H 1O2PA 1E35B 4IS5A 1C4Y2 3KGPA 1YBWA 1CGHA 2BY6X 5DP9A 4GHTA 2THFB 1QTFA 2ZTXA 2LNCA 5E0GA 2PKSC 4NFEA 1F0RA 1FI8A 4NZQA 4CRDA 4X6NA 1MKWH 4O97A 1ZSJA 2AFQB 8GCHF 1PPEE 2P94A 1Q31A 2JH5D 3Q3XA 1GDNA 2D2DA 3PO1C 3LOXA 4FVDA 4A1XA 2V0BA 6CHAB 2O8MA 1CA0B 1DICA 1EOJA 3AASA 1GL0E 2XC0A 2D8WA 4Y6DA 4I31A 1P2QA 2ZPQA 1C2FA 4K3JA 1NT1A 1MCVA 4JK6A 2ZA5A 1LO6A 4F49A 1YLDA 1HAOH 2QGRA 4J2YB 2OC1A 3MU4A 4MNVA 2IN2A 2BHGA 1LHFH 2VWNA 1Z6JH 1EJMA 3F6UH 1AE5A 2HOBA 4JCNA 1ACBE 3E1XB 4AZ2B 1RTLA 1UVOA 4FUJA 4AX9H 2J95A 5FBEA 5CE1A 3P70B 1C1NA 1GJ9B 4IC5A 5FCKA 4NIYA 1H9HE 4I32A 4I7YH 3QUMP 1O35A 3BTFE 1SGFA 1FXYA 3OYPA 3RMLH 1JMOH 3HK3B 3L3TA 1OS8A 1DDJA 3ZZAA 2EI7A 1F0UA 2NU3E 4IMQA 4OS5A 4LZ4B 1BTUA 2BD9A 3H7OA 4MPXA 2WPLS 4BANB 4X8UH 1GHXH 4Y10E 1FY4A 1B5GH 3BEUA 4ZKRU 2KAIB 1AD8H 3VEQB 1O37A 1KDQB 4B75A 3M5NA 4YT6H 1DSUA 3BTQE 4B73A 1TGTA 4FUBA 4LXBH 1THPB 1O2RA 1DY9A 1XKBC 1IQHA 3OY6U 1CA0C 1ZHPA 5DG6A 1EPTC 3WY8A 3A8DA 3RXJA 1HXEH 1QB1A 4HFPB 4MNXA 2IPHA 3STJA 1TB6H 3ATIA 3TLOA 1MTNB 1F0TA 1ELTA 1MQ6A 4OGYA 2GVFA 5TCCA 3ZVGA 1TMUH 1MBQA 4K60A 5FAHA 1AIXH 5T6DA 2XBXA 3GCTG 1P02A 3ATLA 1LHCH 1AI8H 1PPGE 2V3HH 2FESH 1ETSH 1ZGVA 2OQUA 1MBMA 3TK5A 4GPGA 4CBOA 1GBJA 5DP8A 3ZVAA 1V2TT 2FP7B 3PM3A 2TRMA 9ESTA 1INCA 5HM9A 2ZKSA 2ODYB 4ZKNU 2SGEE 1C5QA 4UFGH 1EB2A 1TMTH 1TBQH 2Z3EA 2VH0A 6LPRA 2VWOA 1QGFA 2Z7FE 4D9RA 2ULLA 3SNCA 1K28D 2XBVA 4FUGA 4GVUA 1VCWA 3QZQA 2XW9A 1LHEH 3GICB 3S9AA 3HATH 2WPJS 1TPAE 1YYY1 1O2VA 2ZDVH 2ZO3H 1N1LA 4YT7H 2Q6DA 4GCHF 3SORA 4GLYA 3HK6B 3N7OA 3SI4H 2PV9B 5A8YA 3P92A 3BSQA 3E8LA 3SUGA 3LC5A 4INLA 3MNXA 3GDVA 4AFUA 1FY8E 2H9EH 1P06A 3SJKA 1Y5UT 3RP2A 4CR9A 1AU8A 1FMGA 2SNWA 3A8BA 3BG8A 1EZUC 3U1JB 2BLVA 1SI5H 1NROH 3A7TA 3A7ZA 1OXGA 5JPMH 2M5TA 1C4U2 1N8OC 1GMHF 2RCEA 3PMHB 2WUBA 4YESB 1ELAA 4ISLA 4NGAH 1MZDA 2JETC 5AFZH 5F8ZA 1O2OA 4JYUH 2IJOB 1CGJE 1UTPA 1Z8RA 1SOZA 2CF8H 2ZGBH 1C1MA 2OD3B 3K9XB 1TQ0B 2Y6TA 1QJ1B 1Z1IA 1C5OH 2UWPA 3VXFH 2FODA 2NU1E 1J8AA 1QBOA 3A8AA 2A0QB 3PV4A 4F4OC 5I25A 2V35A 2H5CA 2Y80A 1NS3A 1SGRE 3RXKA 4K1EA 1SLVB 4OGXA 2A4OA 2STBE 2P59A 4INKA 3VB7A 5C67A 1WQSA 5ETXA 4TWYA 1FAKH 3UNQA 3Q3KA 2AIQA 2Z9JA 2VJ1A 2ZDKA 2ANYA 1NESE 1OP0A 1DFPA 4MPVA 2FWWA 1GMCG 1E0FD 2J2UA 4ZAEA 4X8VH 4NWLA 1OWDA 1FY1A 1TONA 1SHYA 1Y5AT 1GPZA 2XWBI 3TJNA 1O3NA 2ANMH 3A89A 1BTWA 4B71A 1UO6A 4UFDH 4XDEA 2GT8A 1GJ4H 1ZPZA 5A2MH 5B6OA 3U8OH 3GY8A 3EE0B 2GMTB 1TPSA 1XVOA 1UTNA 3CS7A 3UY9A 5T3HA 3SU1A 2UUYA 3Q00A 5JBAS 2BQ7B 3ZVDA 4IGDA 1D4PB 2JETB 2QXJA 1TPOA 1ZHRA 2FOMB 4I8HA 2HPQH 3T29A 4B2CA 1BIOA 1V2LT 3NWUA 1ELFA 1QY6A 1HAZB 4O3UA 3U1IB 1L1JA 3TNSA 2BQ6B 1W7GH 1GWAA 2Z9LA 1OWJA 3RUOA 1CHOG 3SBKA 1KXBA 2ZC9H 3L33A 4KTCA 1ID5H 4LZ1H 1S6HA 1XMNB 5EG4A 5L30H 4DOQA 2XXLA 2QXHA 3A7VA 1MKWK 1GHBF 5JB9S 2WPHS 1NM6A 2I6QA 3PWBA 7GCHF 1O38A 1GI9B 1VJ9U 1GBCA 2O8TA 1P09A 2ZECA 4MLFB 4NSVA 4Q7ZA 4WJG2 1HJAC 1AUJA 3SO3A 1EPTA 2G52A 3V13A 1DANH 4WMEA 1UTQA 3MO6A 1OPHB 4YLUA 2R0KA 4DIIH 1WYKA 3NZIA 1PQAA 1GJ5H 1NU7B 1SLWB 2XRCA 3MTYA 1O39A 1MUEB 4CBNA 1NY22 2GCHG 1W14U 1DVAH 1SFQB 1ZYOA 5EQRA 5T6FA 1TALA 2FTLE 1QIXB 1O0DH 2HALA 2AGEX 3A86A 1KTSB 2ZU5A 4UFFH 4K8BA 3GISB 1O2JA 1BB0B 1GDQA 1KIGH 3ZVBA 3SU2A 3DT0H 3OX7U 1HUTH 3SU4A 1NN6A 1DWBH 1S82A 2FM2A 2ANKH 1V6DA 1LMWB 1P05A 1PPZA 2CGAA 1GCDA 1C5LH 5JYIA 1A4WH 2QN5T 1MH0A 1TBZH 4MNYA 2AGGX 2PR3A 1WOFA 1Z8JB 3QN7A 3GCHB 3I78A 5EXMA 1HIAB 1HJ8A 2DE8A 1XXDA 4IW4E 3T26A 1XUIA 1HV7A 3V12A 2ODPA 1SMFE 1IQKA 3SI3H 2FX6A 4ABBA 4I8GA 3URCA 3GY2A 4OS7A 4X2YA 1C2GA 5FPTA 4Y11E 1DSTA 2ASUB 2PW8H 2VVUA 2BY9X 2G81E 1E36B 4LK4A 3SNAA 1XUHA 4DVAU 1LQDB 2FOGA 4WY3A 5F6MA 1SGQE 3SGQE 4XFQA 3PLKA 3Q76A 5EQSA 3STIA 1QHRB 1VR1H 2OC8A 3BTWE 1OKXA 3LGWA 2GD4B 3TPIZ 2OBOA 3T27A 1YGCH 3RXRA 1O2SA 2VGCC 3QTVH 3ZVFA 4AORA 5JB8S 2GZ8A 1TA6A 4K5ZA 1E37B 1AHTH 4O9VA 1A0LA 1AZZA 1L2EA 1WAYB 1C1PA 1K1PA 1P01A 2ZU2A 2SGDE 1O30A 4YM9A 1O2LA 1XUJA 2G5NA 1GJ8B 3P8FA 4YOIA 1P3CA 2A7CA 2UUJB 6ESTA 1SOTA 2ZNKH 3ZZ9A 1O2QA 2CN0H 2WPIS 3SN8A 3MU8A 2A4RA 3RXVA 5LGOA 1RS0A 5GIBA 4K1SA 2ZDNA 3RLWH 1KSNA 1GJAB 1CO7E 2BOKA 5LPRA 2ZU3A 2C93B 1O3AA 4VGCB 2H9TH 1GHAG 1C1WH 2P8OB 5DKMA 2FPZA 1GI7B 1BHXF 1W8BH 2ZCHP 5JBBS 5LPFA 5DGJA 1SPJA 4THNH 1VGCC 5A0CA 1W0YH 3E0NB 1NU9A 4UDWH 1MKXK 1C5MD 2XCFA 1IHTH 1LPGB 1WTHD 1TGCA 1BHXB 4BTUB 1V2QT 5GWZA 1MKXH 2ZDAH 1ZJKA 4TYDA 2ZGCA 3B9FH 1P9SA 4KP0A 1KTTB 5FX5A 1F5LA 3RMOH 2G8TA 1TRYA 2XBWA 3O8RA 1YPEH 2B0FA 2P16A 1HYLA 1V2WT 1JXPA 5DO4H 1G3BA 4ABEA 4XOJA 3BTDE 4M7GA 2CJIA 4Y0YE 1UCYH 1THSH 1GBBA 1GI4A 1TMBH 2OXSA 2P95A 2ZG0H 4FUIA 2TGDA 4AN7A 2EI6A 1ZOMA 5F03A 2R0LA 4X1NU 2P3FH 1NZQH 3K65B 6GCHG 1A3EH 3FP6E 8ESTE 1GMCF 4B76A 1RIWC 1MD7A 3PB1E 2BXUH 1UMAH 2F9VA 4BAMB 2QIQA 3LDXH 2WINI 1UTMA 2BM2A 3QGNB 2VWLA 3LIWA 3BIVH 2ZHEH 1T8NA 4AG2A 4CRGA 5E2OA 1MAXA 1QNJA 3MFJA 3NPSA 2FI4E 4GUXA 3RXBA 3KQCA 3F9FA 1QQUA 1O5CB 4U01A 1OX1A 4ZKSU 2A7HA 2ZZUH 2W5EA 4TY7A 3BEFB 3MU1A 5FX6A 2ZFTA 1UCYK 1V2KT 4JZ1A 4KGAA 1DUAA 2JKHA 1QRXA 1BBRE 2STAE 3RMNH 2A32A 5L2YH 1PFXC 3MNCA 4DIHH 2ZGXH 4NIWA 4D9QA 1O36A 4JZDH 2NU2E 1HNEE 1SGIB 3PLPA 4WXIA 5EU8A 3HKJB 1YC0A 1C9TA 3U69H 5HYOA 1PPFE 2F9BH 5F8TA 4UFEH 2ZHDA 4ABGA 3NUMA 2AYWA 2B8OH 1QR3E 4NWKA 1T7CA 5AVDA 1AZ8A 3FZDA 4I8JA 1SL3A 3A82A 4NA9H 5DPAA 4Q80A 4AFSA 1IQLA 8GCHG 3ZZCA 1C5VA 1BTYA 1AFQB 3MNBA 3BIUH 1C5PA 1O2NA 3R3GB 1AMHA 5EODA 1XKAC 4WF8A 3S69A 5FCRA 1ABJH 2A1DB 1ZPBA 4TWWA 4MVNA 1SGEE 3M36A 3L6PA 5C5NA 2FOHA 1P2KA 1J16A 3GYLB 2GMTC 3K6ZA 4FU7A 2C4FH 1C2DA 4CREA 1EAIA 4DURA 4IMZA 3DFJA 2D1JA 3LGTA 1CE5A 5EGMA 4KELA 1GVZA 1SB1H 3UOPA 3P8OA 3H7TA 2AMQA 1MMJN 1Z6EA 2J4IA 1QBVH 1HJ9A 2AERH 5H4IB 1BRUP 4IBLH 1P57B 2R2MB 2BD7A 1T31A 2FYRA 1AVGH 4DG4A 1GBKA 2C3SA 3PROA 1FDPA 1F5RA 2EA3A 1DXWA 4FU9A 3E6PH 5GPIB 3QTOH 1JBUH 1OP2A 1Z8IB 3D49H 1BQYA 3SUEA 1K22H 1ORFA 1O2KA 7ESTE 2UWLA 4X0WU 1C5XB 1GI6A 1KLIH 2ZGHA 3D62A 3M3SA 3NXPA 4D7FA 2PKAB 2FMJA 2BY7X 1FN6A 3RXGA 2ZU4A 4U2WA 5HMAA 1GBAA 1A0JA 2ZF0H 1TGBA 2BLOA 1LTOA 3RC6A 4BXWA 3GCTF 1P2NA 1ANDA 2SNVA 2ZTYA 3CENA 4ZKOU 3KIDU 2BZ6H 1H1BA 4NA7A 1TOMH 3SGAE 1V2MT 2JH6D 2G00A 3BG4B 2A5KA 5TJXA 3ZV8A 3P17H 3M5MA 1GGDB 1NRNH 1O5EH 1NTPA 4ISIH 1G2LA 4FUDA 1GHVH 2F83A 3TITA 1SG8B 5E0JA 1UVSH 2Y7ZA 3F68H 4KTSA 1TNKA 4WH6A 1LVYA 2BXTH 2H5DA 4JYTA 3AW1A 1MZAA 2QXGA 3SU0A 1RFNA 1D6WA 2YOLA 1AGJA 1BBRK 3I77A 1EAUA 3ATKA 2YNAA 1Q2WA 3S7HB 1Y3UA 1G3EA 1T8MA 3TGJE 1F92A 2FX4A 5GJ4B 4Q7YA 1GI0A 1P9UA 1MTWA 1EJNA 1V2PT 1N6XA 3BEIB 4HZHA 1GG6B 2BDGA 1ETRH 1ELGA 2OBQA 1ELBA 3FANA 1GBMA 4BXSA 5C5OA 3KEEA 2BZAA 1UVTH 3NK8A 3A7WA 3U98H 2FTMA 1IQMA 2IOTA 4AOQA 2ALPA 5CHAB 1FIWA 3LGYA 4A7IB 2W7UA 1O2ZA 2A4QA 2J92A 3A87A 4B2BA 1DWCH 2BDCA 3MWIU 3VGCB 2O8LA 3UUZA 1HAPH 4R0IA 3URDA 2SGPE 1NPMA 1UTLM 1B0EA 4Y71A 3QWCH 1BTZA 2TBSA 3LC3A 1GDUA 1LHGH 4ZXXH 1AVXA 1AB9B 3P8GA 1GI1A 4X2WA 3F1SB 3AW0A 1AQ7A 1EP6A 4K69A 2HGTH 4HGCA 3IG6B 1O3MA 4CHAB 1O3FA 2AMDA 2ZCLP 1YKTA 2PHBA 1K1MA 1EB1H 1O5AB 2WPMS 2H2ZA 1P2IA 2OP9A 1DLEA 1O5GH 2HNTC 2FOBA 3UOUA 3H5CB 3HGNA 3EA8A 5J4SA 1YCPM 3C1KA 5HM2A 8LPRA 1BUIA 1CVWH 1A46H 3O8BA 1YLCA 3PO1B 3M37A 4H4FA 3MNSA 4SGAE 2Z9IA 1O5BB 1ZGIA 3PMAB 2GTBA 1S83A 2DE9A 2ZWLH 3MHWU 1B7XB 2P3TB 3AAUA 1NFXA 2XWAA 1EX3A 1GBLA 5ESBA 4K2YA 4DCDA 3SNBA 2GCHF 4IN1A 3FVFB 2LPRA 2FLRH 1WQVH 3UNSA 5IDKA 4ASHA 1PYTC 1YPHE 3QGJA 3LGIA 1PPHE 1K2I1 1E38B 4WH8A 3G01A 1YCPK 1CQQA 1C2EA 3MH4A 4UONA 5TCAA 3PLBA 1ELDE 4B1TA 1O2MA 1OWKA 4DGJA 1IQIA 4JZFH 2VU8E 5AHGH 1ZMNA 3UREA 3K2UA 2BX4A 2QA9E 4FUFA 1RIWB 1XM1A 3RC4A 4O03A 2XC4A 4E06H 2A5IA 1QL7A 2EI8A 2QV1A 4CHAC 4AYYB 3RM0H 1ETTH 1GL1A 1ELVA 3UNRA 2PKSB 2QCYA 1SGYE 4D8NA 1AFEH 2GDEH 3TJOA 6CHAC 1ZZZA 3TNTA 3RXFA 2HWLB 1C1OA 1Z8GA 4RKOB 3M7QA 4D7GA 3EAJA 2Y81A 2AGIX 2B7DH 1H9IE 1UJ1A 1GBHA 1SGNE 4CRBA 1K21H 4GAWA 3T5FH 5FXLA 3E16B 1PYTD 1HXFH 1GBDA 3RXTA 1HBTH 4YOGA 2KAIA 3AAVA 3SUFA 3M61U 1QL8A 2ZHWH 4ZROA 3UIRA 3MO3A 1EUFA 1BRAA 1A61H 1DX5M 3SV7A 1G32B 2ZDMA 4UD9H 2P8OC 1SBWA 1VJAU 1D3TB 3MH5A 4I8KA 1OP8A 1SGTA 2C8ZB 4Y7AA 3UWIA 3SJ9A 4ABAA 1O32A 4E7NA 1SHHB 2A2QH 2GZ7A 3LKWA 3BTEE 1SLUB 4Y8ZA 1FUJA 1ZRKA 1ANEA 1QA0A 2HNTE 1B0FA 3GCNA 3LH3A 1NRRH 4MNWA 4MTBA 1K1OA 3O8CA 1T4UH 1P2JA 1SR5C 1J9CH 5L6NH 3LJOA 2HNTF 4ISOA 5K0HA 1C1RA 3BV9B 1C1VH 1O3GA 2FYQA 4ZHMU 3W95A 4BNRA 4A1VA 1TRNA 3KN2A 1CBWC 5HGGA 4B2AA 2B9LA 1XVMA 1M9UA 2PLXA 4ABJA 1GI2A 2W3IA 1W12U 1TX6A 1Y3VA 1BZXE 1VCPA 1O2HA 4H6SB 1HAHH 5ESTE 1O2WA 1YPJH 1O3PB 5CMXH 3SQHE 5G4BA 1SQOA 2A2XH 2PWXA 1S0QA 1ANCA 1WSSH 5EOKA 5HXFA 1ELCA 2GT7A 4H42U 4Y8YA 4XE4A 2Q1JA 3A88A 5PTPA 1AE8H 3W94A 1WBGB 4J1YA 4CRAA 1LVMA 4I8LA 1BTPA 1YPGH 3TJUA 1EATA 1HPGA 1CHOF 1XUFA 3MU5A 1JRTA 3OSYA 1HAGE 2ZQ1A 3TGIE 4A1TA 3ESTA 2HPPH 3OY5U 5CHAC 3ODDA 1OWIA 3ELAH 4O3TA 1C5TA 3KHVA 4I33A 1TLDA 1A1RA 1L4ZA 1LHDH 3ZVCA 1TNIA 5DK1A 1BTXA 2Y5FA 3ODFA 1GGDC 4Q7XA 2C8XB 1L0ZA 3GCHC 2NU0E 4MG3A 2CF9H 1DLKB 1P0SH 1UVUH 4HI3A 3P6ZB 1UTOA 1HGTH 3U8RH 1IOEA 1O33A 1C1TA 1TNGA 5C2ZA 1VCQA 5EXNA 1KDQA 2PUQH 1C2KA 3ZYDA 4RN6A 3ATWA 1GJDB 1QL9A 2GCTC 2AMPA 1GHYH 1G3DA 4CR5A 3KQBA 1Z71A 1XX9A 2JH0D 1WCZA 3R0FA 2VGCB 1MTVA 2WPKS 3V7TA 3A80A 3M5LA 3MH7A 4AG1A 7LPRA 2BDBA 1FNIA 2C90B 1GI5A 1TOCB 2FOEA 1EPTB 3LT3A 1A0HB 4XSKU 4ZH8A 1C5RA 4MPWA 2BOHB 1JWTA 1GJBB 1H4WA 3SW2B 1C2IA 1K1NA 1QQ4A 4ESTE 4AYVB 3T25A 3MYWA 2UUFB 3ZZ4A 4BAHB 1BA8B 1SQAA 1EOLA 1UHBB 3M3TA 1BMAA 2F9NA 1T32A 1ZTJA 3CP7A 1JRSA 1K1JA 2ZHQH 1QJ7B 1H9LB 1AKSB 1P12E 1V2NT 2GDDA 3TK6A 5C3NA 1FPCH 3KQEA 1V2VT 1UTJA 3MO9A 4OS1A 2PFEA 1TWXB 4E7RG 1J14A 1CGIE 3B23B 3RXSA 3UR6A 7KMEH 3ZZ3A 1O3EA 3VXEH 2Y5HA 1EZSC 2ZIQH 3EYDA 1VITH 3RLYH 3O8DA 1C5NH 2GZ9A 1O3BA 3TH2H 2G4UA 2BVXH 3EQ0H 3NCLA 2FLBH 3ZZ7A 2W26A 3ZYEA 3S9CA 4GCHG 1AY6H 3SZNA 1TX7A 2Z6BD 4E05H 1GJ6A 1W13U 3RXCA 1TX8A 4A92A 1GMDG 2C8YB 2SGAA 1A5GH 5FPYA 2FIRH 3UQOA 3SV9A 2Y82A 1HAYB 1GI3A 2FOFA 2ZHFH 1BRBE 4X2VA 1ESTA 1KLJH 1ZHMA 3SNDA 3GYMA 1C2LA 5A09A 1BJVA 1ZR0A 2Y7XA 3SUDA 3VB5A 1KXDA 2NWNA 1GCTB 2QY0B 1HLTH 5LH8A 1C5WB 4YOJA 3MOCA 3LPRA 3UWJH 1WUNH 1IQNA 1Y59T 1LCYA 1CHGA 1P8VC 2RG3A 4Y0ZE 3EA7A 3MH6A 1N8OB 4A5TS 3Q77A 5DP6A 3MMGA 3SU3A 5C20A 4FVBA 4U30A 1SGCA 4BAOB 3U8TH 1TPPA 3KQDA 2QC2A 5A0AE 1BT7A 2CHAC 1DITH 1IQGA 2ZTZA 2GKVE 1QRZA 1W11U 4ZUHA 1BRCE 1V3XA 1HDTH 1HFDA 1D3PB 2O8WA 7GCHG 2ZFSA 2A4GA 3RXEA 2Z9GA 1YPLH 1O2GH 1IHSH 2FI5E 3RDZA 4ZHAA 1DY8A 1SLXB 2BD3A 5I46H 2ZPRA 2J34A 1EZXC 3UPEA 2WV5A 1BITA 2VIVA 2VVVA 3BTTE 2AS9A 1YM0A 1EASA 3EGKH 3RXLA 3RM2H 3QK1A 1OSSA 2FS9A 2BX3A 4GHQA 3ZZBA 4D76A 1GHAF 1TIOA 1ZLRA 1TE0A 1ABIH 1O2TA 5AFYH 1A7SA 1GCTC 3BTGE 1KLTA 4WVPE 1JIMA 2BD8A 1AVWA 3MI4A 1L1NA 5EW2H 1PQ8A 4DY7B 1G30B 3RXUA 1C2MA 1DXPA 1UCYE 3BF6H 3LJJA 1O2XA 5K7RA 2GX4A 1QB6A 4TY6A 2XNIA 1ZTLA 3RXAA 4NSYA 1A2CH 1LQEA 4IN2A 1MAYA 3SQEE 1C5SA 1NRQH 2BTCE 2VNTA 1OWHA 3TIUA 1O2IA 2PUXB 3SJ8A 1O2YA 1YP9A 3FZZA 1O3OA 1HAVA 1GBFA 3S7KB 3M7TA 1S5SA 4ZHLU 2ZFPH 1DUEA 4MDSA 2QAAA 2XTTB 2BDIA 8KME2 1GI8B 3ATMA 1HAXB 3U9AH 4GSOA 2PGQB 3SHAH 4H6TA 4AB8A 2QXIA 2TIOA 4YZUA 4BOHA 2QF0A 1ZPCA 3ZZDA 3DUXH 3HPTB 2OQ5A 1ESBA 1CU1A 2TGPZ 1BTHH 5A8XA 5A0BA 2BB4A 4BTIB 1HJAB 1VITF 1F5KU 2BLWA 3GY5A 2VIOA 1EP5A 1ZMJA 4CH8B 3GY7A 2GV7A 3DFLA 5EPYA 2A45B 4AB9A 3PMBB 4WWYA 1YCPH 4DJZB 1FY3A 1JOUB 1BJUA 2DUCA 4ZMAH 3S9BA 2NU4E 2I6SA 1CSOE 2K1QA 1P04A 3LGUA 4VGCC 4X6OA 1ZJDA 3A8CA 3F9EA 4XBDA 1AUTC 3VB3A 4ISNA 2ZFQH 2O9QA 1VGCB 2PGBB 4HTCH 1K1LA 1C9PA 1TRMA 3BN9A 3I29A 3LGVA 2SFAA 4OS4A 1IQEA 2C8WB 5BRRE 1ARCA 1G37A 1MU8B 1SGPE 5ABWA 1C1SA 3T28A 4K1TA 4MQAA 3KCGH 1IAUA 2XCNA 3EA9A 3T62A 4CRFA 5FHTA 1OWEA 1MQ5A 2Z94A 4NIVA 3Q3YA 1LKBA 2BDYA 5L2ZH 2V6NA 2WV4A 1BOQA 1G9IE 3HKIB 1O5FH 2Q6FA 4Z6AH 5FBIA 1SQTA 2BDAA 1LVBA 1GHBG 3ENSB 3BTHE 4QT8C 1QA7A 1T8OA 1S81A 1ELEE 1P03A 1AFQC 4R8TB 2ZDLA 1XUGA 1G3CA 4Z0KA 1O31A 1BMMH 2FEQH 4TPYA 4XBCA 1D3DB 3P95A 1O3CA 1CT2E 1AB9C 3S0NA 1AWHB 2FOCA 1RTFB 2BVRH 1PJPA 1NO9H 1S6FA 2AH4X 1WU1A 4RKJB 1QJ6B 1SVPA 2ANWA 1TQ7B 2BQWB 5IYTA 1DOJA 1FLEE 1Y8TA 1C2HA 1TAWA 3TU7H 3QX5H 2R3YA 4JK5A 2ZQ2A 3FP8E 5BPEA 1PQ7A 3CS0A 1O34A 1QCPA 4FUCA 5J4QA 2OTVA 4ABHA 4ABDA 2PTNA 5A8ZA 1N6YA 4OS6A 3OU0A 2Z3CA 1QRWA 1X7AC 1P11E 3QLPH 2SGFE 4RSPA 3GDSA 3RXQA 2Y5GA 4X8SH 1QURH 1MU6B 3A83A 3C27B 2F3CE 1NC6A 2VB0A 2AEIH 4DT7B 4JZEH 1PPCE 2CHAB 3EDXB 3UTUH 2P93A 1G36A 1KXFA 2FI3E 1NFUA 1BMLA 1FPHH 1CA8B 2OC0A 5F8XA 1OYTH 4X1QU 3K6YA 4Y8XA 1P3EA 2RA3A 3DA9B 3LH1A 3RC5A 1CT4E 3NKKA 1P2OA 2XBYA 1C4V2 2UUKB 1FQ3A 4BAQB 1GJ7B 3ITIA 1QFKH 1Y5BT 1O3IA 5DJ7A 1NRPH 2XYAA 4JZIA 1GHWH 1XUKA 4KKDA 1BBRH 2OINA 3A7YA 4SGBE 3ZV9A 3SU6A 3TH4H 4TPIZ 3A84A 1OYQA 1T4VH 4Q2KA 2H6MA 4NG9H 2BD5A 5JDUB 5FPSA 1H8IH 3A81A 2GCTB 4INHA 4X6MA 1WTGH 3LONA 1DWDH 1HB0B 2ZEBA 2A31A 4Y76A 5EPNA 1H8DH 2PTCE 1D9IA 4ABFA 2PKAA 4YO9A 1FIZA 1FJSA 1W3CA 1ZSLA 2A7JA 2FOAA 4JYVH 1C1QA 1DPOA 3MU0A 5C1YA 1EAWA 1TABE 2R9PA 1GG6C 2ZFRH 2VIDA 4X8TH 1GMDF 1D6RA 1EJAA 2QF3A 4U32A 3M35A 1FONA 2P3UB 3AVZA 1DT2A 5DP5A 2W3KA 1FN8A 3RXMA 4KTUA 2ODQA 1O3KA 3IWMA 1F0SA 5SGAE 1W2KH 4UEHH 3SHCH 2G5VA 4BAKB 4NIXA 4X1SU 1VZQH 1IQJA 1BCUH 4Y79A 1A5IA 1EZQA 2ALVA 2OLGA 3VGCC 4IC6A 5JBCS 1FY5A 1O5DH 3SJIA 3TGKE 2SGQE 1FAXA 5E2PA 1UK2A 3IITA 3TH3H 2PSXA 2H9HA 2ZFFH 1C2JA 1TBRH 5EQQA 1FZZA 1RGQA 1BMNH 1ZMLA 1HRTH 5C1XA 1PQ5A 3DD2H 3SV8A 1JIRA 1KYNA 3M3VA 3RXPA 2B5TB 1SGFG 5GCHG 1TNHA 3HGPA 1KXAA 3DHKH 1TYNA 1RTKA 5DP3A 2ZI2H 1TA2A 5GXPA 1UHBA 1V2OT 3PTNA 4ZXYH 3SNEA 1YF4A 2TPIZ 4FXGH 1P10A 5E0HA 2ZP0H 1UTKA 2CMYA 3E90B 1GHZA 4WXVA 1TNJA 1AWFH 3FP7E 3SV6A 1MTSA 4X1PU 4AGKA 2CV3A 2TGAA 3GY6A 1F2SE 3JZ1B 4B74A 2G55A 2GV6A 2FDAA 1LKAA 4AFQA 1V2UT 3UR9A 1LPZB 1ESAA 3KL6A 3ZVEA 1TNLA 1KXCA 1T8LA 2BD2A 2F9PA 2GP9B 2RA0A 4BTTB 2GGVB 4MPUA 3RU4E 2J38A 2D26C 5GDSH 3TVJB 3GCOA 1MTNC 1YPHC 4JMYA 2TGTA 3FFGA 4NCYA 3D23A 1C5UA 5AF9H 4WMDA 1U6QA 1K1IA 2FS8A 2YNBA 2ZPSA 1PPBH 1FV9A 2J9NA 1C1UH 3SU5A 1SC8U 1TGSZ 5EXLA 4X2XA 4YTAA 2WYJA 2OCVB 1GBEA 1L1GA 5DP4A 1HAVB 1SSXA 3LU9B 3TJVA 1BDAA 1SFIA 1THRH 4ISHH 1NFWA 2G4TA 2BY5X 2O8UA 3A7XA 4FUEA 1TGNA 5T6GA 2A5AA 2R2WU 4Y7BA 1WV7H 2BY8X 4AGJA 3BG4C 1DWEH 4FU8A 1ARBA 1S0RA 1RD3B 2OUAA 3GY3A 1MTUA 2BDHA 1YPKH 3A85A 2Z3DA 1GMHG 2R3UA 1HIAA 1Z7KA 1F7ZA 4CH2B 3P8NA 1YPMH 2FXRA 3GDUA 1XXFA 1EQ9A 1EXFA 1UK4A 1SGDE 3GOVB 1V2ST 2BMGB 3E91A 2VVCA 1W0ZU 2EEKA 1MCTA 2ZGJA 1HCGA 1KXEA 2OC7A 1GVLA 3PWCA 3RXOA 4WMFA 3SJOA 1LPKB 2AIPA 1TFXA 3SV2H 5DP7A 1S85A 2BLQA 3E0PB 3F9GA 3UQVA 1CT0E 3RMMH 2Q6GA 2ZCKP 1O3LA 4LOYH 1G2MA 4FUHA 5C1UA 2CXVA 3RXHA 1VITG 3VPKA 3E3TA 2W7SA 3KF2A 3RXDA 1DM4B 2G51A 3F9HA 1J17T 2HRVA 3FAOA 2VWMA 3VB4A 3BTKE 2VIQA 1L4DA 2BVSH 3UFAA 4YLQH 3ZZ6A 2VH6A 3TK9A 1W10U 2UWOA 2Z9KA 2ZU1A 1UK3A 1GBIA 1C5ZB 5EW1H 1D3QB 1RJXB 3KNXA 2XC5A 1GJCB 1AKSA 2FZZA 2QYIA 1AN1E 4OS2A 4A6LA 9LPRA 4AFZA 5JBTA 3RU4D 4ABIA 1O2UA 3QDZB 4NZLA 6GCHF 2PSYA 1CBWB 2F91A 2VIWA 2BYAX 3JZ2B 3D65E 3ZZ8A 1AO5A 2BD4A 1OOKB 1V2JT
chains in the Genus database with same CATH superfamily
1E34B 1QBNA 1YWUA 3M5OA 1Q3XA 1EKBB 3V0XA 1EAXA 2WYGA 1IQFA 1Y3XA 2RDLA 5CDFE 1MD8A 1HAIH 2HLCA 1O3JA 4NFFA 3GY4A 2FO9A 3PYHA 3QZRA 2F9UA 4K8YA 1RXPA 3QO6A 3V3MA 5HKKD 2JDID 2VINA 1KY9A 2VIPA 2H1UA 1UVPA 3PMJA 3PTBA 3VB6A 1O3HA 1C5YB 1RRKA 3ZZ5A 3SGBE 1GBTA 1LDTT 2V3OH 1K9OE 4X6PA 1A3BH 2J94A 3SOSA 3RU4T 5LPEA 5GCHF 1Y3WA 1V2RT 4DW2U 1GVKB 2F9OA 4NA8A 3BTME 1LVOA 1O3DA 4X1RU 5EJ1A 2IJD1 1P2MA 1ZSKA 3M7UA 1ZRBA 2KCAA 4UE7H 2HVXA 1QB9A 1ZTKA 1S84A 1Y3YA 2ILNA 2EC9H 1ANBA 3RXIA 4PROA 3OTJE 3T2NA 4CRCA 2WUCA 2ESTE 5E8EH 1W7XH 1A5HA 1NRSH 3VFEA 1J15A 1NFYA 3B8JA 1DS2E 1Z1JA 4XBBA 1DE7H 1O2PA 1E35B 4IS5A 1C4Y2 2RDEA 3KGPA 1YBWA 2J97A 1CGHA 4F48B 1WXRA 2BY6X 5DP9A 4GHTA 2THFB 1QTFA 2ZTXA 2LNCA 5E0GA 2PKSC 4NFEA 1F0RA 1FI8A 4NZQA 4CRDA 4X6NA 1MKWH 4O97A 1ZSJA 2AFQB 8GCHF 1PPEE 2P94A 1Q31A 2JH5D 3Q3XA 1GDNA 2D2DA 3PO1C 3LOXA 4FVDA 4A1XA 2V0BA 3F2HA 6CHAB 5C17A 2O8MA 1CA0B 1DICA 1EOJA 3AASA 1GL0E 2XC0A 2D8WA 4Y6DA 4I31A 1P2QA 2ZPQA 1C2FA 4K3JA 1NT1A 1MCVA 4JK6A 2ZA5A 1LO6A 4F49A 1YLDA 1HAOH 2QGRA 4J2YB 2OC1A 3MU4A 4MNVA 2IN2A 2BHGA 1LHFH 2VWNA 1Z6JH 1EJMA 3F6UH 1AE5A 2HOBA 4JCNA 1ACBE 3E1XB 4AZ2B 1RTLA 1UVOA 4FUJA 4AX9H 2J95A 5FBEA 1COWD 5CE1A 3P70B 1C1NA 2WV9A 1GJ9B 4IC5A 5FCKA 4NIYA 1H9HE 4I32A 4I7YH 3QUMP 1O35A 3BTFE 1SGFA 1FXYA 3OYPA 3RMLH 1JMOH 3HK3B 3L3TA 1OS8A 1DDJA 3ZZAA 2EI7A 1F0UA 2NU3E 4IMQA 4OS5A 4LZ4B 1BTUA 2BD9A 3H7OA 4MPXA 2WPLS 4BANB 4X8UH 1GHXH 3OE7D 4Q4LA 1FY4A 1B5GH 3BEUA 4Y10E 4ZKRU 2KAIB 5T1VA 1AD8H 3VEQB 1O37A 1KDQB 4B75A 3M5NA 4YT6H 1DSUA 3BTQE 4B73A 1TGTA 4FUBA 4LXBH 1THPB 1O2RA 1DY9A 1XKBC 1IQHA 3OY6U 1CA0C 1ZHPA 5DG6A 1EPTC 3WY8A 3A8DA 3RXJA 1HXEH 1QB1A 4HFPB 4MNXA 2IPHA 3STJA 1TB6H 3ATIA 5HIZA 3TLOA 1MTNB 1F0TA 1ELTA 1MQ6A 4OGYA 2GVFA 5TCCA 3ZVGA 1TMUH 1MBQA 4K60A 5FAHA 1AIXH 5T6DA 2XBXA 3GCTG 1P02A 3ATLA 1LHCH 1AI8H 1PPGE 2V3HH 2FESH 1ETSH 1ZGVA 2JJ1D 1YLNA 2OQUA 1MBMA 3TK5A 4GPGA 4CBOA 1GBJA 5DP8A 3ZVAA 1V2TT 2FP7B 3PM3A 2TRMA 9ESTA 1INCA 5HM9A 2ZKSA 2ODYB 4ZKNU 2SGEE 1C5QA 4UFGH 1EB2A 1TMTH 1TBQH 2Z3EA 2VH0A 6LPRA 3OEED 2VWOA 1QGFA 2Z7FE 4D9RA 2ULLA 3SNCA 1K28D 2K8IA 2XBVA 4FUGA 4GVUA 1VCWA 3QZQA 2XW9A 1LHEH 3GICB 3S9AA 3HATH 2WPJS 1TPAE 2M2AA 1YYY1 1O2VA 2ZDVH 2ZO3H 3PRDA 1N1LA 2L6OA 4YT7H 2Q6DA 4GCHF 3SORA 4GLYA 1W0KD 3HK6B 3N7OA 3SI4H 2PV9B 3DSPA 5A8YA 3P92A 4YXWD 3BSQA 3E8LA 3SUGA 3LC5A 4INLA 3MNXA 3GDVA 4AFUA 1FY8E 2H9EH 1P06A 3SJKA 1Y5UT 3RP2A 4CR9A 1EFRD 1AU8A 1FMGA 2SNWA 3A8BA 3BG8A 1EZUC 3U1JB 2BLVA 1SI5H 1NROH 3A7TA 3A7ZA 1OXGA 5JPMH 2M5TA 1C4U2 1N8OC 1GMHF 2RCEA 3PMHB 2V3MA 2WUBA 4YESB 1ELAA 4ISLA 4NGAH 1MZDA 2JETC 1NBMD 5AFZH 5F8ZA 1O2OA 4JYUH 2IJOB 1CGJE 1UTPA 1Z8RA 1SOZA 2CF8H 2ZGBH 1C1MA 2OD3B 3K9XB 1TQ0B 2Y6TA 1QJ1B 1Z1IA 1C5OH 2UWPA 3VXFH 2FODA 2NU1E 2W6JD 1J8AA 1QBOA 3A8AA 2A0QB 3PV4A 2F43B 4F4OC 5I25A 2V35A 2H5CA 2Y80A 1NS3A 1SGRE 3RXKA 4K1EA 1SLVB 4OGXA 2A4OA 2STBE 2P59A 2JJ2D 4INKA 3VB7A 5C67A 1WQSA 5ETXA 4TWYA 1FAKH 3UNQA 3Q3KA 2AIQA 2Z9JA 2VJ1A 2ZDKA 2ANYA 1NESE 1OP0A 1DFPA 4MPVA 2FWWA 1GMCG 1E0FD 2J2UA 4ZAEA 4X8VH 4NWLA 1OWDA 1FY1A 1TONA 1SHYA 1Y5AT 1GPZA 2XWBI 3TJNA 1O3NA 2ANMH 3A89A 1BTWA 4B71A 1UO6A 4UFDH 4XDEA 2GT8A 1GJ4H 1ZPZA 5A2MH 5B6OA 3U8OH 3GY8A 3EE0B 2GMTB 1TPSA 1XVOA 1UTNA 3CS7A 3UY9A 5T3HA 3SU1A 2UUYA 2HLDD 5GNDA 3Q00A 5JBAS 2BQ7B 3ZVDA 4IGDA 1D4PB 2JETB 2QXJA 1TPOA 1ZHRA 2FOMB 4I8HA 2HPQH 3T29A 4B2CA 1BIOA 1V2LT 3NWUA 1ELFA 1QY6A 1HAZB 4O3UA 3U1IB 1L1JA 3TNSA 2BQ6B 1W7GH 1GWAA 2Z9LA 1OWJA 3RUOA 1CHOG 3FOAA 3SBKA 1KXBA 2ZC9H 3L33A 4KTCA 1ID5H 4LZ1H 1S6HA 1XMNB 5EG4A 2JIZD 5L30H 4DOQA 2XXLA 2QXHA 3A7VA 1MKWK 1GHBF 5JB9S 2WPHS 1NM6A 2I6QA 4B6EA 3PWBA 7GCHF 1O38A 1GI9B 1VJ9U 1GBCA 2O8TA 1P09A 2ZECA 4MLFB 4NSVA 4Q7ZA 4WJG2 1HJAC 1AUJA 3SO3A 1EPTA 2G52A 3V13A 1DANH 4WMEA 1UTQA 3MO6A 1OPHB 2KCYA 4YLUA 2R0KA 4DIIH 1WYKA 3NZIA 2LP6A 1PQAA 1GJ5H 1NU7B 1SLWB 2XRCA 3MTYA 1O39A 2J5UA 1MUEB 4CBNA 1NY22 2GCHG 1W14U 1DVAH 1SFQB 1ZYOA 5EQRA 5T6FA 1TALA 2FTLE 1QIXB 1O0DH 2HALA 2AGEX 3A86A 1KTSB 2ZU5A 4UFFH 4K8BA 3GISB 1O2JA 1BB0B 1GDQA 1KIGH 3ZVBA 3SU2A 5KGOA 3DT0H 3OX7U 1HUTH 3SU4A 1NN6A 1DWBH 1S82A 2FM2A 2ANKH 1V6DA 2KZ4A 1LMWB 1P05A 1PPZA 2CGAA 1GCDA 1C5LH 3PV5A 4XRNA 5JYIA 1A4WH 2QN5T 1MH0A 1TBZH 4MNYA 4OM9A 2AGGX 2PR3A 1WOFA 1Z8JB 3QN7A 3GCHB 3I78A 5EXMA 1HIAB 1HJ8A 2DE8A 1XXDA 4IW4E 3T26A 1XUIA 1HV7A 3V12A 2ODPA 1SMFE 1IQKA 3SI3H 2FX6A 4ABBA 4I8GA 3URCA 3GY2A 5DN6D 4OS7A 3F2FA 4X2YA 1C2GA 5FPTA 4Y11E 1DSTA 2ASUB 2PW8H 2VVUA 2BY9X 4Q63A 2G81E 1E36B 4LK4A 3SNAA 1XUHA 4DVAU 1LQDB 2FOGA 4WY3A 5F6MA 1SGQE 3SGQE 4XFQA 3PLKA 3Q76A 5EQSA 3STIA 1QHRB 1VR1H 2OC8A 3BTWE 1OKXA 3LGWA 2GD4B 3TPIZ 2OBOA 3T27A 1YGCH 3RXRA 1O2SA 2VGCC 3QTVH 3ZVFA 4AORA 5JB8S 2GZ8A 1TA6A 4K5ZA 1E37B 2W6ID 1AHTH 4O9VA 1A0LA 1AZZA 1L2EA 1WAYB 1C1PA 1K1PA 1P01A 3PV2A 2ZU2A 2SGDE 1O30A 4YM9A 1O2LA 1XUJA 2G5NA 1GJ8B 3P8FA 4YOIA 1P3CA 2KM0A 2A7CA 2UUJB 6ESTA 1SOTA 2ZNKH 3ZZ9A 1O2QA 2CN0H 2WPIS 3SN8A 3MU8A 2A4RA 3RXVA 5LGOA 1RS0A 5GIBA 4K1SA 2ZDNA 3RLWH 1KSNA 1GJAB 1CO7E 2BOKA 5LPRA 2ZU3A 2C93B 1O3AA 4VGCB 2H9TH 1GHAG 1C1WH 2P8OB 5DKMA 5IK2D 2FPZA 1GI7B 1BHXF 1W8BH 2ZCHP 5JBBS 5LPFA 5DGJA 1SPJA 4THNH 1VGCC 5A0CA 1W0YH 2VBCA 1NU9A 3E0NB 4UDWH 1MKXK 1C5MD 4RI0A 2XCFA 1IHTH 1LPGB 1WTHD 1TGCA 1BHXB 4BTUB 2QF5A 1V2QT 5GWZA 1MKXH 2ZDAH 1ZJKA 4TYDA 2ZGCA 3B9FH 1P9SA 4KP0A 1KTTB 5FX5A 1F5LA 3RMOH 2G8TA 1TRYA 2XBWA 3O8RA 1YPEH 2B0FA 2P16A 1HYLA 1V2WT 1JXPA 5DO4H 1G3BA 4ABEA 4XOJA 3BTDE 4M7GA 2CJIA 4Y0YE 1UCYH 1THSH 3WWFA 1GBBA 1GI4A 1TMBH 2OXSA 2P95A 2ZG0H 4FUIA 2IPQX 2TGDA 4AN7A 2EI6A 1ZOMA 5F03A 2R0LA 4X1NU 2P3FH 1NZQH 3K65B 6GCHG 1A3EH 3FP6E 8ESTE 1GMCF 4B76A 1RIWC 1MD7A 3PB1E 3DSGA 2BXUH 1UMAH 2F9VA 4BAMB 2QIQA 3LDXH 2WINI 1UTMA 4FETA 2BM2A 3QGNB 2VWLA 3LIWA 3BIVH 2ZHEH 1T8NA 4AG2A 4CRGA 5E2OA 1MAXA 1QNJA 3MFJA 3NPSA 2FI4E 4GUXA 3RXBA 3KQCA 3F9FA 1QQUA 1O5CB 4U01A 1OX1A 4ZKSU 2A7HA 2ZZUH 2W5EA 1NBME 4TY7A 3BEFB 3MU1A 5FX6A 2ZFTA 1UCYK 1V2KT 4JZ1A 4KGAA 1DUAA 2JKHA 1QRXA 1BBRE 2STAE 3RMNH 2A32A 5L2YH 1PFXC 3MNCA 4DIHH 2ZGXH 4NIWA 4D9QA 1O36A 1S6LA 2NU2E 1HNEE 1SGIB 4JZDH 3PLPA 4WXIA 5EU8A 3HKJB 1YC0A 5CHBA 1SQRA 1C9TA 3U69H 5HYOA 1PPFE 2F9BH 5F8TA 4UFEH 2ZHDA 4ABGA 3NUMA 2AYWA 2B8OH 1QR3E 4NWKA 1T7CA 5AVDA 1AZ8A 3FZDA 4I8JA 1SL3A 3A82A 4NA9H 5DPAA 4Q80A 4AFSA 1IQLA 8GCHG 3ZZCA 3N7EA 1C5VA 1BTYA 1AFQB 3MNBA 3BIUH 1C5PA 1O2NA 2YMSD 3R3GB 1AMHA 5EODA 1XKAC 4WF8A 3S69A 5FCRA 1ABJH 2A1DB 1ZPBA 4TWWA 4MVNA 1SGEE 3M36A 3L6PA 5C5NA 2FOHA 1P2KA 1J16A 3GYLB 2GMTC 3K6ZA 4FU7A 2C4FH 1C2DA 4CREA 1EAIA 4DURA 4IMZA 3DFJA 2D1JA 3LGTA 1CE5A 5EGMA 4KELA 1GVZA 1SB1H 3UOPA 3P8OA 4ZCNA 3H7TA 2AMQA 1MMJN 1Z6EA 2J4IA 1QBVH 1HJ9A 2AERH 2K0QA 5H4IB 1BRUP 4IBLH 1P57B 2R2MB 2BD7A 1T31A 2FYRA 1AVGH 4DG4A 1E79D 2C3SA 1GBKA 1FX0B 3PROA 1FDPA 1F5RA 2EA3A 1DXWA 4FU9A 3E6PH 5GPIB 3QTOH 1JBUH 1OP2A 1Z8IB 3D49H 1BQYA 3SUEA 1K22H 1ORFA 1O2KA 7ESTE 2UWLA 4X0WU 1C5XB 1GI6A 1KLIH 2ZGHA 3D62A 3M3SA 3NXPA 4D7FA 2PKAB 2FMJA 2BY7X 1FN6A 3RXGA 2ZU4A 4U2WA 5HMAA 1GBAA 1A0JA 2ZF0H 1TGBA 2BLOA 1LTOA 3RC6A 4BXWA 3GCTF 1P2NA 2KCPA 1ANDA 2SNVA 2ZTYA 3CENA 4ZKOU 3KIDU 2BZ6H 1H1BA 4NA7A 1TOMH 3SGAE 1V2MT 2JH6D 2G00A 3BG4B 2A5KA 5TJXA 3ZV8A 3P17H 3M5MA 1GGDB 1NRNH 1O5EH 1NTPA 4ISIH 4ACBA 1G2LA 4FUDA 1GHVH 2F83A 3TITA 1SG8B 5E0JA 1UVSH 2Y7ZA 3F68H 4KTSA 1TNKA 4WH6A 1LVYA 2BXTH 2H5DA 4JYTA 3AW1A 1MZAA 2QXGA 3SU0A 1RFNA 1D6WA 2YOLA 1AGJA 2J98A 1BBRK 3I77A 1EAUA 3ATKA 2YNAA 1Q2WA 3S7HB 1Y3UA 1G3EA 1T8MA 3TGJE 1F92A 2FX4A 5GJ4B 4Q7YA 1GI0A 3WW7A 1P9UA 1QZ8A 1MTWA 1EJNA 1V2PT 1N6XA 3BEIB 4HZHA 1GG6B 2BDGA 1ETRH 1ELGA 2OBQA 1ELBA 3FANA 1GBMA 4BXSA 5C5OA 3KEEA 2BZAA 1UVTH 3NK8A 3A7WA 3U98H 2FTMA 5F53A 1IQMA 2IOTA 4AOQA 2ALPA 5CHAB 1FIWA 2KX4A 3LGYA 4A7IB 2W7UA 1O2ZA 2A4QA 2J92A 3A87A 4B2BA 1DWCH 2BDCA 3MWIU 3VGCB 2O8LA 3UUZA 1HAPH 4R0IA 4TT3D 3URDA 2SGPE 1NPMA 1UTLM 1B0EA 4Y71A 3QWCH 1W0JD 1BTZA 3H09A 2TBSA 3LC3A 1GDUA 1LHGH 4ZXXH 1AVXA 1AB9B 3P8GA 1GI1A 4X2WA 3F1SB 3AW0A 1AQ7A 1EP6A 4K69A 2HGTH 4HGCA 3IG6B 1O3MA 4CHAB 1O3FA 2AMDA 2ZCLP 1YKTA 2PHBA 1MABB 1K1MA 1EB1H 1O5AB 2WPMS 2H2ZA 1P2IA 3DCLA 2OP9A 1DLEA 1O5GH 2HNTC 2FOBA 3UOUA 3H5CB 3HGNA 3EA8A 5J4SA 2EY4C 1YCPM 3C1KA 5HM2A 2AHME 8LPRA 1BUIA 1CVWH 1A46H 3O8BA 1YLCA 3PO1B 3M37A 4H4FA 3MNSA 4SGAE 2Z9IA 1O5BB 1ZGIA 3PMAB 2GTBA 1S83A 2DE9A 2ZWLH 3MHWU 1B7XB 2P3TB 2F4LA 3AAUA 1NFXA 2XWAA 1EX3A 1GBLA 5ESBA 4K2YA 4DCDA 3SNBA 2GCHF 4IN1A 3FVFB 2LPRA 3OAAD 2FLRH 1WQVH 3UNSA 5IDKA 4ASHA 1PYTC 1YPHE 3QGJA 3LGIA 1PPHE 1K2I1 1E38B 4WH8A 3G01A 1YCPK 1CQQA 1C2EA 3MH4A 4UONA 5TCAA 3PLBA 1ELDE 5EIYA 3F3BA 4B1TA 1O2MA 1OWKA 4DGJA 1IQIA 4JZFH 2VU8E 5AHGH 1ZMNA 3UREA 3K2UA 2BX4A 2QA9E 4FUFA 1RIWB 1XM1A 3RC4A 4O03A 2XC4A 4E06H 2A5IA 1QL7A 2EI8A 2QV1A 4CHAC 4AYYB 3RM0H 1ETTH 1GL1A 1ELVA 3UNRA 2PKSB 2QCYA 1SGYE 3WWBA 4D8NA 5FL7D 1AFEH 2GDEH 3TJOA 6CHAC 2WSSD 1ZZZA 3TNTA 3RXFA 2HWLB 1C1OA 1Z8GA 4RKOB 3M7QA 4D7GA 3EAJA 2Y81A 2AGIX 2B7DH 1H9IE 1UJ1A 1GBHA 1SGNE 4CRBA 1K21H 4GAWA 3T5FH 5FXLA 3E16B 1PYTD 1HXFH 1GBDA 3RXTA 1HBTH 4YOGA 2KAIA 3AAVA 3SUFA 3M61U 1QL8A 2ZHWH 4ZROA 3UIRA 3MO3A 1EUFA 4ASUD 1BRAA 1A61H 1DX5M 3SV7A 1G32B 2ZDMA 4UD9H 2P8OC 1SBWA 1VJAU 3SZEA 1D3TB 3KYFA 2CK3D 3MH5A 4I8KA 1OP8A 1SGTA 3OEHD 2C8ZB 4Y7AA 3UWIA 3SJ9A 4ABAA 1O32A 4E7NA 1SHHB 2A2QH 2GZ7A 3LKWA 3BTEE 1SLUB 4Y8ZA 1FUJA 1ZRKA 1ANEA 1QA0A 2HNTE 1B0FA 3GCNA 3LH3A 1NRRH 4MNWA 4MTBA 1K1OA 3O8CA 1T4UH 1P2JA 1SR5C 1J9CH 5L6NH 3LJOA 2HNTF 4ISOA 5K0HA 1C1RA 3BV9B 1C1VH 1O3GA 2FYQA 4ZHMU 3W95A 4BNRA 4A1VA 1TRNA 3KN2A 1CBWC 5B6LA 5HGGA 4B2AA 2B9LA 1XVMA 1M9UA 2PLXA 4ABJA 1GI2A 2W3IA 1W12U 3FKSD 1TX6A 3SYJA 4FOUC 1Y3VA 1BZXE 1VCPA 1O2HA 4H6SB 1HAHH 5ESTE 1O2WA 1YPJH 5KECA 1O3PB 5C94A 5CMXH 3SQHE 5G4BA 1SQOA 2A2XH 2PWXA 1S0QA 2LELA 1ANCA 1WSSH 5EOKA 5HXFA 1ELCA 2GT7A 4H42U 4Y8YA 4XE4A 2Q1JA 3A88A 5PTPA 1AE8H 3W94A 3MQKC 1WBGB 4J1YA 4CRAA 1LVMA 2WHXA 4I8LA 1BTPA 1YPGH 3TJUA 1EATA 1HPGA 1CHOF 1XUFA 3MU5A 1JRTA 3OSYA 1HAGE 2ZQ1A 3TGIE 4A1TA 3ESTA 2HPPH 3OY5U 5CHAC 3ODDA 1OWIA 3ELAH 4O3TA 1C5TA 3KHVA 4I33A 2QF4A 1TLDA 1A1RA 1L4ZA 2OK5A 1LHDH 3ZVCA 1TNIA 5DK1A 1BTXA 2Y5FA 3ODFA 1GGDC 4Q7XA 2C8XB 1L0ZA 3GCHC 2NU0E 4MG3A 2CF9H 1DLKB 1P0SH 1UVUH 4HI3A 3P6ZB 1UTOA 3OTPA 1HGTH 3U8RH 1IOEA 1O33A 1H8HD 1C1TA 1TNGA 5C2ZA 1VCQA 5EXNA 1KDQA 2PUQH 1C2KA 3ZYDA 4RN6A 3ATWA 1GJDB 1QL9A 2GCTC 2AMPA 1GHYH 1G3DA 4CR5A 3KQBA 1Z71A 1XX9A 2JH0D 1WCZA 3R0FA 2VGCB 1MTVA 2WPKS 3CNRA 3V7TA 3A80A 3M5LA 3MH7A 4AG1A 7LPRA 2BDBA 1FNIA 2C90B 1GI5A 1TOCB 2FOEA 1EPTB 3LT3A 1A0HB 4XSKU 4ZH8A 1C5RA 4MPWA 2BOHB 1JWTA 1GJBB 1H4WA 3SW2B 1C2IA 1K1NA 1QQ4A 4ESTE 3F0PA 4AYVB 3T25A 3MYWA 2UUFB 2KCOA 3ZZ4A 4BAHB 1BA8B 1SQAA 1EOLA 1UHBB 3M3TA 2WPDD 4XD7D 1BMAA 2F9NA 1T32A 1ZTJA 2KR7A 3CP7A 1JRSA 1K1JA 2ZHQH 1QJ7B 1H9LB 1AKSB 1P12E 1V2NT 2GDDA 3TK6A 5C3NA 1FPCH 3KQEA 1V2VT 1UTJA 3MO9A 4OS1A 2PFEA 1TWXB 4E7RG 1J14A 1CGIE 3B23B 5C0UA 3RXSA 3UR6A 7KMEH 3ZZ3A 1O3EA 3VXEH 2Y5HA 1EZSC 2ZIQH 3EYDA 1VITH 3RLYH 3O8DA 1C5NH 2GZ9A 1O3BA 3TH2H 2G4UA 2BVXH 3EQ0H 3NCLA 2FLBH 3ZZ7A 2W26A 3ZYEA 3S9CA 4GCHG 1AY6H 3SZNA 1TX7A 2Z6BD 4E05H 1GJ6A 1W13U 3RXCA 1TX8A 4A92A 1GMDG 2C8YB 2SGAA 1A5GH 5FPYA 2FIRH 3UQOA 4DT4A 3SV9A 2Y82A 1HAYB 1GI3A 2FOFA 2ZHFH 1BRBE 1E1QD 4X2VA 1ESTA 1KLJH 1ZHMA 3SNDA 3GYMA 1C2LA 5A09A 1BJVA 1ZR0A 2Y7XA 3N99A 3SUDA 1H8ED 3VB5A 1KXDA 2NWNA 1GCTB 2QY0B 1HLTH 5LH8A 1C5WB 4YOJA 3MOCA 3LPRA 3UWJH 1WUNH 1IQNA 1Y59T 1LCYA 1CHGA 1KMHB 1P8VC 2HVYB 2RG3A 4Y0ZE 3EA7A 3MH6A 1N8OB 4A5TS 3Q77A 3W1EA 5DP6A 3MMGA 3SU3A 5C20A 4FVBA 4TSFD 4U30A 1SGCA 4BAOB 3U8TH 1TPPA 3KQDA 2QC2A 5A0AE 1BT7A 2CHAC 1DITH 1IQGA 2ZTZA 2GKVE 1QRZA 1W11U 4ZUHA 1BRCE 1V3XA 1HDTH 1HFDA 1D3PB 2O8WA 7GCHG 2ZFSA 2A4GA 2YMSB 3RXEA 2Z9GA 1YPLH 1O2GH 2WZQA 5KEDA 1IHSH 2FI5E 3RDZA 4ZHAA 1DY8A 1SLXB 2BD3A 5I46H 2ZPRA 4I86A 2J34A 1EZXC 3U28C 3UPEA 2WV5A 1BITA 2VIVA 2VVVA 3BTTE 2AS9A 1YM0A 1EASA 3EGKH 3RXLA 3RM2H 3QK1A 5HIYA 1OSSA 2FS9A 2BX3A 4GHQA 3ZZBA 4D76A 1GHAF 1TIOA 3OFND 1ZLRA 1BMFD 1TE0A 1ABIH 1O2TA 5AFYH 2GJGA 1A7SA 1GCTC 3BTGE 1KLTA 4WVPE 1JIMA 2BD8A 1AVWA 3MI4A 1L1NA 5EW2H 1PQ8A 4DY7B 1G30B 3RXUA 1UW7A 1C2MA 1DXPA 1UCYE 3BF6H 3LJJA 1O2XA 5K7RA 2GX4A 1QB6A 4TY6A 5EJZA 2XNIA 1ZTLA 3RXAA 4NSYA 1A2CH 1LQEA 4IN2A 1MAYA 3SQEE 1C5SA 1NRQH 2BTCE 2VNTA 1OWHA 3TIUA 1O2IA 2PUXB 3SJ8A 1O2YA 1YP9A 3FZZA 1O3OA 1HAVA 1GBFA 4HG6A 3S7KB 3M7TA 1S5SA 4ZHLU 2ZFPH 1YY3A 1DUEA 4MDSA 2QAAA 2XTTB 2BDIA 8KME2 1GI8B 3ATMA 1HAXB 3U9AH 4GSOA 2PGQB 3SHAH 4H6TA 4AB8A 2QXIA 2TIOA 4YZUA 4BOHA 2QF0A 1ZPCA 3ZZDA 3DUXH 3HPTB 2OQ5A 1ESBA 1CU1A 2TGPZ 1BTHH 5A8XA 5A0BA 2BB4A 4BTIB 1HJAB 1VITF 1F5KU 2BLWA 1E1RD 2L74A 3GY5A 2RFKC 2VIOA 1EP5A 1ZMJA 4CH8B 3KQ5A 3GY7A 2EQNA 2GV7A 3DFLA 3VG8A 5EPYA 2A45B 4AB9A 3PMBB 4WWYA 1YCPH 4DJZB 1FY3A 1JOUB 1BJUA 2DUCA 4ZMAH 3S9BA 2NU4E 2I6SA 1CSOE 2K1QA 1WDIA 1P04A 3LGUA 4VGCC 4X6OA 1ZJDA 3A8CA 3F9EA 4XBDA 1AUTC 3VB3A 4ISNA 3F2GA 2ZFQH 2O9QA 1VGCB 2PGBB 4HTCH 1K1LA 1C9PA 1TRMA 3BN9A 3I29A 3LGVA 2SFAA 4OS4A 1IQEA 2C8WB 5BRRE 1ARCA 1G37A 1MU8B 1SGPE 5ABWA 1C1SA 3T28A 4K1TA 4MQAA 3KCGH 1IAUA 2XCNA 3EA9A 3T62A 4CRFA 5FHTA 1OWEA 1MQ5A 2Z94A 4NIVA 3Q3YA 1LKBA 2BDYA 5L2ZH 2V6NA 2WV4A 1BOQA 1G9IE 3HKIB 1O5FH 2Q6FA 4Z6AH 5FBIA 3AK5A 3N7DA 1SQTA 2BDAA 1LVBA 1GHBG 3ENSB 3BTHE 4QT8C 1QA7A 1T8OA 1S81A 1ELEE 1P03A 1AFQC 4R8TB 2ZDLA 1XUGA 1G3CA 4Z0KA 1O31A 1BMMH 2FEQH 4TPYA 4XBCA 1D3DB 3P95A 1O3CA 1CT2E 1AB9C 3S0NA 1AWHB 2FOCA 1RTFB 2BVRH 1PJPA 1NO9H 1S6FA 2AH4X 4P02A 4ACAA 1WU1A 4RKJB 1QJ6B 1SVPA 2ANWA 1TQ7B 2BQWB 5IYTA 1DOJA 1FLEE 1Y8TA 1C2HA 1TAWA 3TU7H 3QX5H 2R3YA 4JK5A 2ZQ2A 3FP8E 5BPEA 2J98B 1PQ7A 3CS0A 1O34A 1QCPA 4FUCA 5J4QA 2OTVA 4ABHA 4ABDA 2PTNA 5A8ZA 1N6YA 4OS6A 3OU0A 2Z3CA 1QRWA 1X7AC 1P11E 3QLPH 2SGFE 4RSPA 3GDSA 3RXQA 2Y5GA 5EJLA 4X8SH 1QURH 1MU6B 3A83A 3C27B 2F3CE 1NC6A 2VB0A 2AEIH 4DT7B 4JZEH 1PPCE 2CHAB 3EDXB 3UTUH 2P93A 1G36A 1KXFA 2FI3E 1NFUA 1BMLA 1FPHH 1CA8B 2OC0A 5F8XA 1OYTH 4X1QU 3K6YA 4Y8XA 1P3EA 2RA3A 3DA9B 3LH1A 3RC5A 2YMSC 4M9FA 1CT4E 3NKKA 1P2OA 2XBYA 1C4V2 2UUKB 1FQ3A 4BAQB 1GJ7B 3GS9A 3ITIA 1QFKH 2V7QD 1Y5BT 1O3IA 2QE7D 5DJ7A 1NRPH 2XYAA 4JZIA 1GHWH 1XUKA 4KKDA 1BBRH 2OINA 4P00A 3A7YA 4SGBE 3ZV9A 3SU6A 3TH4H 4TPIZ 3A84A 1OYQA 1T4VH 4Q2KA 2H6MA 4NG9H 2BD5A 5JDUB 5FPSA 1H8IH 3A81A 2GCTB 4INHA 4X6MA 1WTGH 3LONA 1DWDH 1HB0B 2ZEBA 2A31A 4Y76A 5EPNA 1H8DH 2PTCE 1D9IA 4ABFA 2PKAA 4YO9A 1FIZA 1FJSA 1W3CA 1ZSLA 2A7JA 2FOAA 4JYVH 1C1QA 1DPOA 3MU0A 5C1YA 4F55A 1EAWA 1TABE 2R9PA 1GG6C 2ZFRH 2VIDA 4X8TH 1GMDF 5DSFA 1D6RA 1EJAA 2QF3A 4U32A 3M35A 1FONA 2P3UB 3AVZA 1DT2A 5DP5A 2W3KA 1FN8A 3RXMA 4KTUA 3KYGA 2ODQA 1O3KA 3IWMA 1F0SA 3NRLA 5SGAE 1W2KH 2XOKD 4UEHH 3SHCH 2G5VA 4BAKB 4NIXA 4X1SU 1VZQH 1IQJA 1BCUH 4Y79A 1A5IA 1EZQA 2ALVA 2OLGA 3VGCC 4IC6A 5JBCS 1FY5A 1O5DH 3SJIA 3TGKE 2SGQE 1FAXA 5E2PA 3FN8A 1UK2A 3IITA 3TH3H 2PSXA 2H9HA 2ZFFH 1C2JA 1TBRH 5EQQA 1FZZA 1RGQA 1BMNH 1ZMLA 1HRTH 5C1XA 1PQ5A 3DD2H 3SV8A 1JIRA 1KYNA 3M3VA 3RXPA 2B5TB 1SGFG 5GCHG 1TNHA 3HGPA 1KXAA 3DHKH 1TYNA 1RTKA 5DP3A 2ZI2H 1TA2A 5GXPA 1UHBA 1V2OT 3PTNA 4ZXYH 3SNEA 1YF4A 2TPIZ 4FXGH 1P10A 5E0HA 2ZP0H 1UTKA 2CMYA 3E90B 1GHZA 4WXVA 1TNJA 1AWFH 3FP7E 3SV6A 1MTSA 4X1PU 4AGKA 2CV3A 2TGAA 3GY6A 1F2SE 3JZ1B 4B74A 2G55A 2GV6A 2FDAA 1LKAA 4AFQA 1V2UT 3UR9A 1LPZB 1ESAA 3KL6A 3ZVEA 1TNLA 1KXCA 4Z1MD 1T8LA 2BD2A 2F9PA 2GP9B 5C0TA 2RA0A 4BTTB 2GGVB 4MPUA 3RU4E 2J38A 4AC9A 2D26C 5GDSH 3TVJB 3GCOA 1MTNC 1YPHC 4JMYA 2TGTA 3FFGA 4NCYA 3D23A 1C5UA 1SKYE 5AF9H 4WMDA 1U6QA 1K1IA 2FS8A 2YNBA 2ZPSA 1OHHD 1PPBH 1FV9A 2J9NA 1C1UH 3SU5A 1SC8U 1TGSZ 5EXLA 4X2XA 4YTAA 2WYJA 2OCVB 1GBEA 1L1GA 5DP4A 1HAVB 1SSXA 3LU9B 3TJVA 1BDAA 1SFIA 1THRH 4ISHH 1NFWA 2G4TA 2BY5X 2O8UA 3A7XA 4FUEA 1TGNA 5T6GA 2A5AA 2R2WU 4Y7BA 1WV7H 2BY8X 4AGJA 3BG4C 1DWEH 4B6FA 4FU8A 1ARBA 1S0RA 1RD3B 2OUAA 2PP6A 3GY3A 1MTUA 3PRBA 2BDHA 1YPKH 3A85A 2Z3DA 1GMHG 2R3UA 1HIAA 1Z7KA 1F7ZA 4CH2B 3P8NA 1YPMH 2FXRA 3GDUA 1XXFA 1EQ9A 1EXFA 1UK4A 1SGDE 3GOVB 1V2ST 2BMGB 3E91A 2KFWA 2VVCA 1W0ZU 2EEKA 1MCTA 2ZGJA 1HCGA 3DSOA 1KXEA 2OC7A 1GVLA 3PWCA 3RXOA 4WMFA 3SJOA 1LPKB 2AIPA 3F0OA 1TFXA 3SV2H 5DP7A 1S85A 2BLQA 3E0PB 2XNDD 3F9GA 3UQVA 1CT0E 3UB0A 3RMMH 2Q6GA 2ZCKP 1O3LA 4LOYH 1G2MA 4FUHA 5C1UA 2CXVA 3RXHA 1VITG 3VPKA 3E3TA 2W7SA 3KF2A 3RXDA 1DM4B 2G51A 3F9HA 1J17T 2HRVA 3FAOA 2VWMA 4RT1A 3VB4A 3BTKE 4RT0A 2VIQA 1L4DA 3ZIAD 2BVSH 1VKYA 4YLQH 3UAIC 3UFAA 3ZZ6A 2VH6A 3TK9A 1W10U 2UWOA 2Z9KA 2ZU1A 1UK3A 1GBIA 1C5ZB 5EW1H 1D3QB 1RJXB 3KNXA 1GJCB 2XC5A 1AKSA 2FZZA 2QYIA 1AN1E 4OS2A 4A6LA 9LPRA 4AFZA 5JBTA 1K0HA 3RU4D 4ABIA 1O2UA 3QDZB 4NZLA 6GCHF 2PSYA 3EE7A 1CBWB 2F91A 2VIWA 2BYAX 3JZ2B 3D65E 3ZZ8A 1AO5A 2BD4A 3FO8D 1OOKB 1V2JT
chains in the Genus database with same CATH topology
1E34B 1QBNA 3M5OA 1Q3XA 1EKBB 3V0XA 1EAXA 2WYGA 1IQFA 1Y3XA 2RDLA 1MD8A 1HAIH 2HLCA 1O3JA 4NFFA 3GY4A 2FO9A 3PYHA 3QZRA 2F9UA 4K8YA 1RXPA 3QO6A 3V3MA 2VINA 1KY9A 2VIPA 2H1UA 1UVPA 3PMJA 3PTBA 3VB6A 1O3HA 1C5YB 1RRKA 3ZZ5A 3SGBE 1GBTA 1LDTT 2V3OH 1K9OE 4X6PA 1A3BH 2J94A 3SOSA 3RU4T 5LPEA 5GCHF 1Y3WA 1V2RT 4DW2U 1GVKB 2F9OA 4NA8A 3BTME 1LVOA 1O3DA 4X1RU 1P2MA 1ZSKA 3M7UA 1ZRBA 4UE7H 2HVXA 1QB9A 1ZTKA 1S84A 1Y3YA 2ILNA 2EC9H 1ANBA 3RXIA 4PROA 3OTJE 3T2NA 4CRCA 2WUCA 2ESTE 5E8EH 1W7XH 1A5HA 1NRSH 3VFEA 1J15A 1NFYA 3B8JA 1DS2E 1Z1JA 4XBBA 1DE7H 1O2PA 1E35B 4IS5A 1C4Y2 3KGPA 1YBWA 1CGHA 2BY6X 5DP9A 4GHTA 2THFB 1QTFA 2ZTXA 2LNCA 5E0GA 2PKSC 4NFEA 1F0RA 1FI8A 4NZQA 4CRDA 4X6NA 1MKWH 4O97A 1ZSJA 2AFQB 8GCHF 1PPEE 2P94A 1Q31A 2JH5D 3Q3XA 1GDNA 2D2DA 3PO1C 3LOXA 4FVDA 4A1XA 2V0BA 6CHAB 2O8MA 1CA0B 1DICA 1EOJA 3AASA 1GL0E 2XC0A 2D8WA 4Y6DA 4I31A 1P2QA 2ZPQA 1C2FA 4K3JA 1NT1A 1MCVA 4JK6A 2ZA5A 1LO6A 4F49A 1YLDA 1HAOH 2QGRA 4J2YB 2OC1A 3MU4A 4MNVA 2IN2A 2BHGA 1LHFH 2VWNA 1Z6JH 1EJMA 3F6UH 1AE5A 2HOBA 4JCNA 1ACBE 3E1XB 4AZ2B 1RTLA 1UVOA 4FUJA 4AX9H 2J95A 5FBEA 5CE1A 3P70B 1C1NA 1GJ9B 4IC5A 5FCKA 4NIYA 1H9HE 4I32A 4I7YH 3QUMP 1O35A 3BTFE 1SGFA 1FXYA 3OYPA 3RMLH 1JMOH 3HK3B 3L3TA 1OS8A 1DDJA 3ZZAA 2EI7A 1F0UA 2NU3E 4IMQA 4OS5A 4LZ4B 1BTUA 2BD9A 3H7OA 4MPXA 2WPLS 4BANB 4X8UH 1GHXH 4Y10E 1FY4A 1B5GH 3BEUA 4ZKRU 2KAIB 1AD8H 3VEQB 1O37A 1KDQB 4B75A 3M5NA 4YT6H 1DSUA 3BTQE 4B73A 1TGTA 4FUBA 4LXBH 1THPB 1O2RA 1DY9A 1XKBC 1IQHA 3OY6U 1CA0C 1ZHPA 5DG6A 1EPTC 3WY8A 3A8DA 3RXJA 1HXEH 1QB1A 4HFPB 4MNXA 2IPHA 3STJA 1TB6H 3ATIA 3TLOA 1MTNB 1F0TA 1ELTA 1MQ6A 4OGYA 2GVFA 5TCCA 3ZVGA 1TMUH 1MBQA 4K60A 5FAHA 1AIXH 5T6DA 2XBXA 3GCTG 1P02A 3ATLA 1LHCH 1AI8H 1PPGE 2V3HH 2FESH 1ETSH 1ZGVA 2OQUA 1MBMA 3TK5A 4GPGA 4CBOA 1GBJA 5DP8A 3ZVAA 1V2TT 2FP7B 3PM3A 2TRMA 9ESTA 1INCA 5HM9A 2ZKSA 2ODYB 4ZKNU 2SGEE 1C5QA 4UFGH 1EB2A 1TMTH 1TBQH 2Z3EA 2VH0A 6LPRA 2VWOA 1QGFA 2Z7FE 4D9RA 2ULLA 3SNCA 1K28D 2XBVA 4FUGA 4GVUA 1VCWA 3QZQA 2XW9A 1LHEH 3GICB 3S9AA 3HATH 2WPJS 1TPAE 1YYY1 1O2VA 2ZDVH 2ZO3H 1N1LA 4YT7H 2Q6DA 4GCHF 3SORA 4GLYA 3HK6B 3N7OA 3SI4H 2PV9B 5A8YA 3P92A 3BSQA 3E8LA 3SUGA 3LC5A 4INLA 3MNXA 3GDVA 4AFUA 1FY8E 2H9EH 1P06A 3SJKA 1Y5UT 3RP2A 4CR9A 1AU8A 1FMGA 2SNWA 3A8BA 3BG8A 1EZUC 3U1JB 2BLVA 1SI5H 1NROH 3A7TA 3A7ZA 1OXGA 5JPMH 2M5TA 1C4U2 1N8OC 1GMHF 2RCEA 3PMHB 2WUBA 4YESB 1ELAA 4ISLA 4NGAH 1MZDA 2JETC 5AFZH 5F8ZA 1O2OA 4JYUH 2IJOB 1CGJE 1UTPA 1Z8RA 1SOZA 2CF8H 2ZGBH 1C1MA 2OD3B 3K9XB 1TQ0B 2Y6TA 1QJ1B 1Z1IA 1C5OH 2UWPA 3VXFH 2FODA 2NU1E 1J8AA 1QBOA 3A8AA 2A0QB 3PV4A 4F4OC 5I25A 2V35A 2H5CA 2Y80A 1NS3A 1SGRE 3RXKA 4K1EA 1SLVB 4OGXA 2A4OA 2STBE 2P59A 4INKA 3VB7A 5C67A 1WQSA 5ETXA 4TWYA 1FAKH 3UNQA 3Q3KA 2AIQA 2Z9JA 2VJ1A 2ZDKA 2ANYA 1NESE 1OP0A 1DFPA 4MPVA 2FWWA 1GMCG 1E0FD 2J2UA 4ZAEA 4X8VH 4NWLA 1OWDA 1FY1A 1TONA 1SHYA 1Y5AT 1GPZA 2XWBI 3TJNA 1O3NA 2ANMH 3A89A 1BTWA 4B71A 1UO6A 4UFDH 4XDEA 2GT8A 1GJ4H 1ZPZA 5A2MH 5B6OA 3U8OH 3GY8A 3EE0B 2GMTB 1TPSA 1XVOA 1UTNA 3CS7A 3UY9A 5T3HA 3SU1A 2UUYA 3Q00A 5JBAS 2BQ7B 3ZVDA 4IGDA 1D4PB 2JETB 2QXJA 1TPOA 1ZHRA 2FOMB 4I8HA 2HPQH 3T29A 4B2CA 1BIOA 1V2LT 3NWUA 1ELFA 1QY6A 1HAZB 4O3UA 3U1IB 1L1JA 3TNSA 2BQ6B 1W7GH 1GWAA 2Z9LA 1OWJA 3RUOA 1CHOG 3SBKA 1KXBA 2ZC9H 3L33A 4KTCA 1ID5H 4LZ1H 1S6HA 1XMNB 5EG4A 5L30H 4DOQA 2XXLA 2QXHA 3A7VA 1MKWK 1GHBF 5JB9S 2WPHS 1NM6A 2I6QA 3PWBA 7GCHF 1O38A 1GI9B 1VJ9U 1GBCA 2O8TA 1P09A 2ZECA 4MLFB 4NSVA 4Q7ZA 4WJG2 1HJAC 1AUJA 3SO3A 1EPTA 2G52A 3V13A 1DANH 4WMEA 1UTQA 3MO6A 1OPHB 4YLUA 2R0KA 4DIIH 1WYKA 3NZIA 1PQAA 1GJ5H 1NU7B 1SLWB 2XRCA 3MTYA 1O39A 1MUEB 4CBNA 1NY22 2GCHG 1W14U 1DVAH 1SFQB 1ZYOA 5EQRA 5T6FA 1TALA 2FTLE 1QIXB 1O0DH 2HALA 2AGEX 3A86A 1KTSB 2ZU5A 4UFFH 4K8BA 3GISB 1O2JA 1BB0B 1GDQA 1KIGH 3ZVBA 3SU2A 3DT0H 3OX7U 1HUTH 3SU4A 1NN6A 1DWBH 1S82A 2FM2A 2ANKH 1V6DA 1LMWB 1P05A 1PPZA 2CGAA 1GCDA 1C5LH 5JYIA 1A4WH 2QN5T 1MH0A 1TBZH 4MNYA 2AGGX 2PR3A 1WOFA 1Z8JB 3QN7A 3GCHB 3I78A 5EXMA 1HIAB 1HJ8A 2DE8A 1XXDA 4IW4E 3T26A 1XUIA 1HV7A 3V12A 2ODPA 1SMFE 1IQKA 3SI3H 2FX6A 4ABBA 4I8GA 3URCA 3GY2A 4OS7A 4X2YA 1C2GA 5FPTA 4Y11E 1DSTA 2ASUB 2PW8H 2VVUA 2BY9X 2G81E 1E36B 4LK4A 3SNAA 1XUHA 4DVAU 1LQDB 2FOGA 4WY3A 5F6MA 1SGQE 3SGQE 4XFQA 3PLKA 3Q76A 5EQSA 3STIA 1QHRB 1VR1H 2OC8A 3BTWE 1OKXA 3LGWA 2GD4B 3TPIZ 2OBOA 3T27A 1YGCH 3RXRA 1O2SA 2VGCC 3QTVH 3ZVFA 4AORA 5JB8S 2GZ8A 1TA6A 4K5ZA 1E37B 1AHTH 4O9VA 1A0LA 1AZZA 1L2EA 1WAYB 1C1PA 1K1PA 1P01A 2ZU2A 2SGDE 1O30A 4YM9A 1O2LA 1XUJA 2G5NA 1GJ8B 3P8FA 4YOIA 1P3CA 2A7CA 2UUJB 6ESTA 1SOTA 2ZNKH 3ZZ9A 1O2QA 2CN0H 2WPIS 3SN8A 3MU8A 2A4RA 3RXVA 5LGOA 1RS0A 5GIBA 4K1SA 2ZDNA 3RLWH 1KSNA 1GJAB 1CO7E 2BOKA 5LPRA 2ZU3A 2C93B 1O3AA 4VGCB 2H9TH 1GHAG 1C1WH 2P8OB 5DKMA 2FPZA 1GI7B 1BHXF 1W8BH 2ZCHP 5JBBS 5LPFA 5DGJA 1SPJA 4THNH 1VGCC 5A0CA 1W0YH 3E0NB 1NU9A 4UDWH 1MKXK 1C5MD 2XCFA 1IHTH 1LPGB 1WTHD 1TGCA 1BHXB 4BTUB 1V2QT 5GWZA 1MKXH 2ZDAH 1ZJKA 4TYDA 2ZGCA 3B9FH 1P9SA 4KP0A 1KTTB 5FX5A 1F5LA 3RMOH 2G8TA 1TRYA 2XBWA 3O8RA 1YPEH 2B0FA 2P16A 1HYLA 1V2WT 1JXPA 5DO4H 1G3BA 4ABEA 4XOJA 3BTDE 4M7GA 2CJIA 4Y0YE 1UCYH 1THSH 1GBBA 1GI4A 1TMBH 2OXSA 2P95A 2ZG0H 4FUIA 2TGDA 4AN7A 2EI6A 1ZOMA 5F03A 2R0LA 4X1NU 2P3FH 1NZQH 3K65B 6GCHG 1A3EH 3FP6E 8ESTE 1GMCF 4B76A 1RIWC 1MD7A 3PB1E 2BXUH 1UMAH 2F9VA 4BAMB 2QIQA 3LDXH 2WINI 1UTMA 2BM2A 3QGNB 2VWLA 3LIWA 3BIVH 2ZHEH 1T8NA 4AG2A 4CRGA 5E2OA 1MAXA 1QNJA 3MFJA 3NPSA 2FI4E 4GUXA 3RXBA 3KQCA 3F9FA 1QQUA 1O5CB 4U01A 1OX1A 4ZKSU 2A7HA 2ZZUH 2W5EA 4TY7A 3BEFB 3MU1A 5FX6A 2ZFTA 1UCYK 1V2KT 4JZ1A 4KGAA 1DUAA 2JKHA 1QRXA 1BBRE 2STAE 3RMNH 2A32A 5L2YH 1PFXC 3MNCA 4DIHH 2ZGXH 4NIWA 4D9QA 1O36A 4JZDH 2NU2E 1HNEE 1SGIB 3PLPA 4WXIA 5EU8A 3HKJB 1YC0A 1C9TA 3U69H 5HYOA 1PPFE 2F9BH 5F8TA 4UFEH 2ZHDA 4ABGA 3NUMA 2AYWA 2B8OH 1QR3E 4NWKA 1T7CA 5AVDA 1AZ8A 3FZDA 4I8JA 1SL3A 3A82A 4NA9H 5DPAA 4Q80A 4AFSA 1IQLA 8GCHG 3ZZCA 1C5VA 1BTYA 1AFQB 3MNBA 3BIUH 1C5PA 1O2NA 3R3GB 1AMHA 5EODA 1XKAC 4WF8A 3S69A 5FCRA 1ABJH 2A1DB 1ZPBA 4TWWA 4MVNA 1SGEE 3M36A 3L6PA 5C5NA 2FOHA 1P2KA 1J16A 3GYLB 2GMTC 3K6ZA 4FU7A 2C4FH 1C2DA 4CREA 1EAIA 4DURA 4IMZA 3DFJA 2D1JA 3LGTA 1CE5A 5EGMA 4KELA 1GVZA 1SB1H 3UOPA 3P8OA 3H7TA 2AMQA 1MMJN 1Z6EA 2J4IA 1QBVH 1HJ9A 2AERH 5H4IB 1BRUP 4IBLH 1P57B 2R2MB 2BD7A 1T31A 2FYRA 1AVGH 4DG4A 1GBKA 2C3SA 3PROA 1FDPA 1F5RA 2EA3A 1DXWA 4FU9A 3E6PH 5GPIB 3QTOH 1JBUH 1OP2A 1Z8IB 3D49H 1BQYA 3SUEA 1K22H 1ORFA 1O2KA 7ESTE 2UWLA 4X0WU 1C5XB 1GI6A 1KLIH 2ZGHA 3D62A 3M3SA 3NXPA 4D7FA 2PKAB 2FMJA 2BY7X 1FN6A 3RXGA 2ZU4A 4U2WA 5HMAA 1GBAA 1A0JA 2ZF0H 1TGBA 2BLOA 1LTOA 3RC6A 4BXWA 3GCTF 1P2NA 1ANDA 2SNVA 2ZTYA 3CENA 4ZKOU 3KIDU 2BZ6H 1H1BA 4NA7A 1TOMH 3SGAE 1V2MT 2JH6D 2G00A 3BG4B 2A5KA 5TJXA 3ZV8A 3P17H 3M5MA 1GGDB 1NRNH 1O5EH 1NTPA 4ISIH 1G2LA 4FUDA 1GHVH 2F83A 3TITA 1SG8B 5E0JA 1UVSH 2Y7ZA 3F68H 4KTSA 1TNKA 4WH6A 1LVYA 2BXTH 2H5DA 4JYTA 3AW1A 1MZAA 2QXGA 3SU0A 1RFNA 1D6WA 2YOLA 1AGJA 1BBRK 3I77A 1EAUA 3ATKA 2YNAA 1Q2WA 3S7HB 1Y3UA 1G3EA 1T8MA 3TGJE 1F92A 2FX4A 5GJ4B 4Q7YA 1GI0A 1P9UA 1MTWA 1EJNA 1V2PT 1N6XA 3BEIB 4HZHA 1GG6B 2BDGA 1ETRH 1ELGA 2OBQA 1ELBA 3FANA 1GBMA 4BXSA 5C5OA 3KEEA 2BZAA 1UVTH 3NK8A 3A7WA 3U98H 2FTMA 1IQMA 2IOTA 4AOQA 2ALPA 5CHAB 1FIWA 3LGYA 4A7IB 2W7UA 1O2ZA 2A4QA 2J92A 3A87A 4B2BA 1DWCH 2BDCA 3MWIU 3VGCB 2O8LA 3UUZA 1HAPH 4R0IA 3URDA 2SGPE 1NPMA 1UTLM 1B0EA 4Y71A 3QWCH 1BTZA 2TBSA 3LC3A 1GDUA 1LHGH 4ZXXH 1AVXA 1AB9B 3P8GA 1GI1A 4X2WA 3F1SB 3AW0A 1AQ7A 1EP6A 4K69A 2HGTH 4HGCA 3IG6B 1O3MA 4CHAB 1O3FA 2AMDA 2ZCLP 1YKTA 2PHBA 1K1MA 1EB1H 1O5AB 2WPMS 2H2ZA 1P2IA 2OP9A 1DLEA 1O5GH 2HNTC 2FOBA 3UOUA 3H5CB 3HGNA 3EA8A 5J4SA 1YCPM 3C1KA 5HM2A 8LPRA 1BUIA 1CVWH 1A46H 3O8BA 1YLCA 3PO1B 3M37A 4H4FA 3MNSA 4SGAE 2Z9IA 1O5BB 1ZGIA 3PMAB 2GTBA 1S83A 2DE9A 2ZWLH 3MHWU 1B7XB 2P3TB 3AAUA 1NFXA 2XWAA 1EX3A 1GBLA 5ESBA 4K2YA 4DCDA 3SNBA 2GCHF 4IN1A 3FVFB 2LPRA 2FLRH 1WQVH 3UNSA 5IDKA 4ASHA 1PYTC 1YPHE