2ZDMA

Exploring trypsin s3 pocket
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Congeneric but still distinct: how closely related trypsin ligands exhibit different thermodynamic and structural properties
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2007-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zdmA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zdmA02
4OS4A 1CHGA 1SFQB 5EU8A 1F5KU 1GL0E 2BD8A 2AMQA 1BTWA 2VWLA 2KAIA 4E06H 1DICA 1UVOA 4F4OC 3MTYA 4XSKU 3NKKA 4BAMB 5JB8S 3ZVCA 3RUOA 2P3UB 2DE8A 4X8UH 2BLOA 2O8UA 4BTTB 4IN2A 3KQCA 1D3TB 1ZGVA 2ZKSA 4TWWA 1WU1A 1GHXH 2FZZA 2F9NA 4B2AA 2GT7A 2NU3E 1C9PA 1ZHRA 1HYLA 2XC4A 2ZF0H 1LHDH 2XBYA 1UO6A 1O5BB 1Z1IA 3TK5A 4ISHH 5HYOA 1ZSJA 2BD7A 1C2FA 1XUIA 1NRNH 2XWAA 5CE1A 1J9CH 1B5GH 1EZXC 1O2MA 5FX6A 3FANA 4TPIZ 3BTWE 3A7VA 3JZ2B 4LK4A 1NU9A 2XXLA 1O2GH 5E2OA 2VH0A 4IMZA 1AY6H 1K2I1 3KGPA 1AE5A 1MQ6A 1NT1A 1HCGA 3QTVH 4E7NA 5L2ZH 1CT0E 1GI6A 4U2WA 2GV7A 3MU0A 1B7XB 3TIUA 4AG2A 1Z6EA 3NZIA 3BTQE 2WPKS 1XXFA 2G00A 2JKHA 1E34B 4FUFA 2ZNKH 1HBTH 1O2OA 4FUEA 2HPPH 1QB6A 1P10A 4I7YH 3RU4D 3P17H 3L3TA 2FOHA 3QX5H 2ZGJA 1G3BA 5GXPA 4DG4A 1AN1E 1QHRB 2ZC9H 3M61U 2STBE 2PKAA 5ESBA 1GCDA 1TONA 2PTNA 1J15A 2FYQA 3JZ1B 2VINA 1TB6H 3MU8A 4MLFB 3SNBA 5EW1H 1AQ7A 3AAVA 1HAVB 2CXVA 3RMOH 3LGVA 1NZQH 5IYTA 3S9AA 5HMAA 3F9HA 5FPSA 2ZU4A 1TQ0B 4WXIA 4GUXA 1Q3XA 3QLPH 3EDXB 3QGNB 4CR9A 1O2TA 1DSTA 4WH8A 2BD2A 4NIWA 2ALVA 1SQAA 3S9BA 2G5NA 1L4DA 2GCHG 2H9EH 3LGTA 2I6QA 2O8LA 5F8ZA 4Q80A 3M5NA 1FPCH 1H9IE 2W3KA 3SJIA 3MOCA 3U69H 4JZEH 4Y0YE 2NU4E 4WWYA 1FAKH 1Z6JH 1Z8IB 1BBRE 4VGCC 1AMHA 1G32B 1GHAG 4AGKA 2SGDE 3SU5A 1GHBF 1A3EH 1O30A 3PTBA 1GPZA 1L1GA 4ISIH 3QO6A 3I29A 1BOQA 3EE0B 3UR6A 3BTME 3UQOA 2Y5HA 4ASHA 1HAOH 4KKDA 1LVOA 3LJJA 1C2HA 4A5TS 1CGHA 3EA8A 3TPIZ 4CBNA 1UTMA 1T4UH 4X0WU 1ZMJA 1HJAC 1T8MA 1YPHC 2D26C 2PUXB 3VB3A 3Q77A 5H4IB 4AFUA 5JBAS 3ZZDA 1UK2A 3VB4A 1Y3XA 4Q7YA 3VXEH 1O34A 5DP9A 1P05A 1VITH 1QRWA 1PPFE 1AFQB 3O8RA 2DUCA 4WH6A 4I8GA 4CRGA 3LONA 1ELTA 4E7RG 1P9UA 4YESB 1AI8H 5DP4A 3HPTB 1AVGH 1NFUA 1NM6A 3BG4B 1UTJA 4ABHA 4NIYA 1V2VT 3A8AA 3TNSA 1K1MA 4GLYA 3TITA 2PSXA 2O8MA 4AN7A 4BAKB 3SV6A 2RDLA 1SGFA 2G81E 4U30A 1QA7A 1T31A 1BHXF 2BXTH 1V2PT 1QFKH 1YGCH 3A8CA 1Q31A 3TGKE 4Y10E 5E2PA 2VJ1A 1FJSA 3AAUA 5AF9H 5EW2H 1A0LA 1GBHA 4ABFA 3QUMP 4MQAA 1UCYH 1DY9A 2H9HA 2H5CA 5DGJA 1LKAA 2A0QB 4NIVA 1GWAA 1BT7A 2WPMS 4OGXA 2Z9JA 3KF2A 1JIMA 1L4ZA 3BSQA 3KQBA 3RXLA 3F68H 1LPKB 2GCHF 5AFZH 2O8WA 4CRDA 1GI4A 3ZZ6A 1WTGH 5T6GA 1C2IA 5EPYA 3KL6A 2CF9H 1T4VH 3LIWA 1C1NA 1S82A 3UNQA 4KELA 5FAHA 3GY3A 4MTBA 4LOYH 1OOKB 2UUKB 4ZHAA 1IQMA 1JBUH 2QN5T 1J8AA 1XUGA 1TX8A 1Y3WA 1A5IA 4I31A 2O8TA 6LPRA 1FIZA 1QA0A 3EYDA 1TYNA 3RXGA 3P8OA 5HM9A 1GVLA 4BAQB 3BV9B 3OY5U 1NRQH 4FUCA 1NFWA 1AIXH 2ZWLH 1KIGH 5F03A 1BTZA 5FX5A 2BX3A 1AFEH 1PYTC 1PPCE 3ZZ3A 3HK3B 3P92A 1FY8E 2P95A 1O38A 2A31A 2QXIA 4O3TA 4PROA 2BTCE 5EG4A 2J2UA 4M7GA 1GVZA 3G01A 3SJOA 1DT2A 1G3DA 2BDYA 1N8OB 1DITH 1XKAC 2ZDMA 4MNXA 3L33A 4YOIA 1HIAB 4JK6A 3GCTF 3PMAB 1AZ8A 2F3CE 4JK5A 2GDDA 2P59A 5DP6A 1S0QA 4CRFA 2VVUA 2YNAA 1MD7A 3FZZA 2FOFA 3PLKA 3ZZ7A 3A8BA 2VWNA 3GOVB 3C27B 1GBKA 2VWMA 2Z3CA 4MDSA 4Y11E 2UWOA 2BY5X 1O3HA 1GDQA 5FBEA 1GG6B 1LPGB 1XUFA 3LC5A 1AUTC 2PKSC 1JMOH 2A4GA 3GCHB 4FU7A 4FUHA 2V3HH 3DA9B 1D3PB 3GYMA 3LGWA 4IBLH 3RXSA 3TLOA 4BANB 1ANDA 3R3GB 1ZJDA 1C5UA 1HPGA 2AH4X 3GCHC 3B9FH 1FN6A 1LHEH 1AB9B 5LPRA 1UTNA 1FI8A 3QTOH 2ZCKP 1C5YB 2ALPA 2J94A 1D4PB 1P2MA 1TRMA 4J2YB 2CGAA 4X2YA 2A7CA 2ZHDA 2FO9A 1OXGA 3ELAH 2B5TB 1S85A 3SU3A 3BTKE 5DO4H 2F9UA 2GCTB 1SLWB 3OX7U 4Y6DA 1FZZA 3A89A 1MKWH 4FXGH 1FV9A 1O2VA 1J17T 6GCHF 1G36A 1O31A 1UVSH 1C4U2 2BVSH 4K69A 4OS1A 3QZRA 4YO9A 7GCHF 1Z8RA 4JYTA 2GZ8A 3RMNH 1LVYA 2AGGX 1IHSH 1SHHB 1KXEA 1BMAA 4CRCA 2GZ7A 1TA6A 2SFAA 4QT8C 1A2CH 1C1PA 4SGAE 2PGBB 4D9QA 4X2VA 1MAXA 1IAUA 1OP2A 4CHAB 1Y5BT 3GICB 2ZPQA 1FN8A 3GDUA 1W10U 1HAIH 1DX5M 2FODA 2FI4E 1EPTB 1K28D 4ZXXH 1QURH 2OC0A 1QQ4A 1A46H 1MU8B 1Y8TA 1V3XA 3ATKA 4ZUHA 1YPJH 1C1MA 1GHYH 1YYY1 4I8HA 1HLTH 3E91A 1VJ9U 1LQDB 1DOJA 3V12A 1B0EA 2ZHFH 4I8KA 1IHTH 2B9LA 3GCOA 5C5NA 4K2YA 2CHAC 1FMGA 1QCPA 2WPHS 2Z3EA 2BZ6H 4Z0KA 1C5NH 1EX3A 2G4TA 2QIQA 3PLPA 4UD9H 4UFEH 1H1BA 1P3CA 2BDHA 3M35A 1A0JA 3UY9A 9ESTA 5LGOA 4CH8B 4AFQA 2BLVA 1LHGH 5T3HA 4XOJA 2WUCA 2YNBA 4RSPA 2BY6X 2J4IA 1XVMA 5ABWA 1KDQA 1C4Y2 1C5SA 3UIRA 5C1XA 1GMDF 1CQQA 1V2TT 2GDEH 2NU2E 2VWOA 1KXCA 1SGYE 5JBTA 1O2NA 2TPIZ 1UVUH 3BTHE 1T8NA 2EI6A 5C67A 4BTIB 1N1LA 2ZPRA 3RXQA 1O5CB 3M5MA 2H2ZA 1C5XB 1C1SA 2VVCA 3MNXA 5GCHG 3RXDA 3BTGE 3UR9A 1EKBB 2R0LA 3BTDE 2ZFSA 2ZHWH 3ATMA 3SN8A 1YPLH 2WPLS 2WYGA 3ZZ4A 3SU2A 1TBQH 3ATWA 3PWCA 4D7GA 4AB8A 5JBBS 3ODDA 1SHYA 3IITA 2R9PA 2W7SA 1F7ZA 4RN6A 2FIRH 3GDSA 1P2IA 1O3CA 2V6NA 1OYQA 1EASA 1GGDC 1ZR0A 1DE7H 1P2OA 4FVDA 4WY3A 4DJZB 1MKXK 1O2IA 2FM2A 2ZGBH 4Y71A 3SU6A 1O2LA 3N7OA 4NFFA 1O3KA 1WQSA 4K5ZA 3NPSA 1S0RA 1QIXB 3UOPA 1ZOMA 1OWHA 2AMPA 1GMCF 1BMNH 2Z6BD 3RXHA 5FCKA 2Q6DA 3RXBA 1HNEE 4ABAA 1J14A 1C1TA 2P8OC 3SOSA 1IOEA 3O8BA 3FVFB 3VEQB 3PLBA 3AASA 5CHAB 1HAVA 1P04A 1O2QA 2TIOA 4A1XA 4DOQA 1HAGE 4KTUA 5JPMH 1LTOA 2NWNA 1C1RA 5CHAC 1CE5A 4UFFH 1E37B 2FEQH 3RU4T 1QR3E 1SLUB 2P3FH 1TGCA 1Y3VA 1TMBH 1HAPH 1SQOA 1G2MA 1G3EA 1UTLM 1P01A 2UUJB 2ODQA 3QDZB 1FONA 4AB9A 4YT6H 1C1WH 4HTCH 1MD8A 2FOCA 5DK1A 3T27A 3SBKA 1GBDA 1B0FA 4UDWH 3RP2A 1CBWC 1QBVH 1C5ZB 3KQEA 3UQVA 1P06A 3VB7A 1UJ1A 3TJVA 2OLGA 2RCEA 1J16A 1RJXB 3O8CA 1ELBA 3F1SB 1BUIA 3SW2B 3RXEA 3ESTA 2BOKA 1UTQA 2BLQA 2XC5A 3WY8A 3FP8E 4E05H 3URDA 1H8DH 3HKIB 2P93A 4A92A 2WYJA 4O97A 2FESH 1RRKA 2ZP0H 8GCHF 1XKBC 1EZQA 2BY7X 1YCPH 1S6HA 2PW8H 3VGCC 1FY1A 1DSUA 2HGTH 3V0XA 5PTPA 1VITF 2WINI 1RIWC 1E38B 2OD3B 3UNSA 3ODFA 1V2WT 2ILNA 4U32A 2SGAA 1KDQB 1HV7A 3BEFB 3U8OH 3LC3A 1NTPA 3MH5A 1E36B 1BBRK 3SUFA 1TIOA 5JYIA 3SUGA 1K1NA 3NWUA 3P8FA 1MTUA 3SO3A 4IGDA 4MPVA 1BCUH 3RC5A 3ZVEA 5C5OA 3HGNA 3H7OA 1MBQA 2ZU5A 2C8WB 4FUJA 1EJAA 1K1LA 2C3SA 3KIDU 3T5FH 2AIPA 1THRH 3MWIU 3P70B 5GDSH 4GCHG 3SGQE 1V6DA 1JOUB 3STJA 1BDAA 1HB0B 3I77A 1Z1JA 3MH6A 3U98H 1ELFA 4HI3A 3O8DA 3HATH 4NGAH 1AVWA 1K1PA 1SGTA 1TOCB 1XUKA 2G55A 1ANEA 3A80A 2ZTXA 1O5FH 2ANKH 5ESTE 1G37A 4K8YA 1BTXA 1S81A 3Q3YA 1CSOE 2PFEA 1F92A 4HFPB 3U8RH 1F0RA 5HM2A 2ZTYA 5GPIB 1O2ZA 3RXMA 4JZDH 5A0BA 1GJ4H 2FPZA 5LPFA 3LGYA 4IN1A 1LQEA 3M3TA 4XBDA 4FUGA 1P2JA 4Y76A 1HFDA 4YOGA 5HXFA 3A84A 1UK3A 4X8TH 2BMGB 1V2NT 1EOJA 3OSYA 3V13A 4ZAEA 1GCTC 2XTTB 4Q7ZA 1ZPBA 5TCAA 3FZDA 2W5EA 1NESE 1GBCA 2PLXA 4NZLA 1AKSB 4XBBA 2DE9A 3PV4A 1OWKA 3GY5A 1ESBA 2BVXH 1GL1A 3F6UH 1CT2E 3PWBA 4VGCB 1G9IE 1GMHG 1UCYE 1WQVH 6CHAC 1SBWA 1YBWA 5FPYA 3MU1A 4OS5A 5FPTA 3M5LA 4DIIH 2A2QH 4ISNA 5A0AE 7KMEH 4INLA 1TABE 4Y79A 1SGIB 3A87A 2K1QA 1C5LH 1TWXB 2NU1E 3ITIA 3E6PH 1M9UA 1LO6A 1MKXH 1EB2A 1DPOA 3A7WA 1ZRBA 3SHCH 4WXVA 1GBMA 1TNIA 1CA0C 1HJAB 2Y6TA 3MO6A 1HRTH 1HIAA 2BY8X 2FTMA 1Y5AT 3CS7A 1CHOG 2A32A 2Q6FA 1UHBB 2ANWA 2QY0B 2SGPE 3P8GA 1SOZA 2BY9X 4GCHF 1AE8H 1RS0A 1P9SA 2Y81A 1FY3A 1PPEE 1T32A 1ZJKA 2A5AA 4O3UA 1Y5UT 3RXTA 3OTJE 1UMAH 3AW1A 3HK6B 2XCFA 1VCQA 4D9RA 3PMBB 1OWIA 3TK9A 3GY7A 3LH3A 1SFIA 2XBWA 1GI1A 3RXRA 1DDJA 4OGYA 2Q1JA 2J38A 3DHKH 1BTPA 2WUBA 4OS6A 5SGAE 1D3DB 1K1IA 5F8TA 1TGNA 1W11U 3SJKA 3SU1A 4ZHLU 3LU9B 3A8DA 1QL9A 1O3DA 3VXFH 8LPRA 1AGJA 4I33A 5ETXA 4K3JA 2UWPA 4I32A 4H42U 2W26A 4B73A 1SQTA 2FXRA 1SR5C 1OX1A 1JRTA 3RM0H 2GKVE 3SUDA 2M5TA 1OP8A 1ZHMA 2V3OH 2VGCC 1HJ8A 1NO9H 5EXMA 4B75A 1AVXA 1O2RA 1G3CA 4AFZA 3SV8A 2ZHQH 1O3PB 4X6NA 2AFQB 3SV9A 2TGTA 4X8VH 1PQAA 3T29A 2ZIQH 3MNBA 4ABBA 4AOQA 3T25A 1DS2E 1GJ7B 1ANCA 1P0SH 4X1PU 4IS5A 1AZZA 4UEHH 1P09A 2ZA5A 1ZPCA 1ZSKA 2NU0E 4GHQA 2A7JA 1N6YA 4WVPE 1GMHF 1A1RA 4FUDA 2ZCHP 1BBRH 1F0UA 2H5DA 3U8TH 3QK1A 1WSSH 3D23A 5LH8A 1W3CA 3TU7H 1BJUA 4RKJB 8ESTE 3SZNA 1GHAF 2Z3DA 4YLUA 1S5SA 2F9PA 2ESTE 2FTLE 1FAXA 5EOKA 2VIOA 3S69A 3SJ8A 1EPTA 6ESTA 3M7TA 2RG3A 3EQ0H 4MG3A 3HGPA 1OWDA 1W13U 1QJ1B 2A2XH 1EAIA 3A85A 1MAYA 1NRRH 1GHZA 1FXYA 3SGAE 3MO3A 4FU8A 3UPEA 1QB1A 1WAYB 3SV2H 3F9EA 1O33A 4O9VA 3A83A 1TBZH 2GMTC 2ASUB 2G4UA 1TPAE 1U6QA 1C1QA 2D8WA 3MU5A 1LHCH 2D1JA 1MBMA 2ZG0H 1YP9A 1GBAA 4R8TB 2CMYA 4ZROA 1DLEA 5JBCS 4DURA 1F5LA 1H9LB 1TPSA 2AERH 2OCVB 1C2LA 4ABEA 1E0FD 3M3VA 2QAAA 4ABGA 4NA8A 5E0GA 1LVBA 1DXPA 4YLQH 2QF0A 1V2RT 2XW9A 3SORA 2HNTC 2R2MB 2PKSB 4HGCA 3A88A 2Y5GA 3A82A 1ELAA 3KN2A 1HUTH 3BEIB 1O5EH 2STAE 1LHFH 1YLDA 2SNWA 1RGQA 4INKA 2ZEBA 4BXSA 1S84A 4Y0ZE 1O35A 3SHAH 5LPEA 1N6XA 2FYRA 3M7UA 3Q76A 1YM0A 1MMJN 1THPB 1NY22 3A7YA 1QY6A 8KME2 1O2KA 3AVZA 1C5TA 4BOHA 3TK6A 2BQWB 4LXBH 4KP0A 1ABIH 2TGDA 5A8YA 3M3SA 1C1VH 4X6OA 5FBIA 2FI5E 2ODYB 1O3BA 4RKOB 1GJCB 1EB1H 2BX4A 1NS3A 4LZ1H 5DKMA 2G51A 1EAUA 1RTFB 2ZDNA 1S83A 1BTUA 5C20A 1IQFA 3UTUH 2C90B 5L2YH 4DT7B 3K9XB 1TBRH 2C4FH 1O2XA 1V2QT 3SQEE 1O3FA 2J95A 3B23B 1GBTA 2FX6A 1ZYOA 1ZMLA 4B76A 1DLKB 2G52A 2AGIX 2CJIA 5C3NA 3F9FA 4A7IB 1P3EA 1SSXA 2FOBA 2AGEX 1C5OH 4X1SU 2O9QA 2ANYA 3RXCA 1QTFA 2ZCLP 1TMTH 1GHWH 1TX6A 2XYAA 3BG8A 4ESTE 3QZQA 4ISLA 1LDTT 1S6FA 1SB1H 4UFDH 3S7KB 2ZZUH 4NFEA 2BD9A 1LCYA 4D76A 2AYWA 4X1NU 1GJ8B 4ABDA 3MNSA 1ELDE 4FUIA 1GBLA 3BTFE 2PV9B 1NRPH 2A5KA 1AHTH 1UVTH 1CGJE 1PQ5A 1TMUH 3GCNA 1WUNH 2QF3A 4IC5A 2GP9B 4NSYA 1DFPA 2CHAB 4CBOA 1DWEH 4NA9H 2J92A 2R3YA 1YF4A 2UUFB 1FPHH 1L2EA 2C8YB 1TPPA 1Z71A 1HGTH 1TQ7B 3BEUA 1K21H 2OC7A 5J4QA 1A5HA 2FOAA 1NC6A 5EXLA 1X7AC 1IQNA 3Q00A 2TRMA 2A4QA 2G8TA 1C2GA 4CRAA 5T6DA 1W7XH 3ZZ5A 1SGFG 1W14U 2Z7FE 2BLWA 2ZECA 4X1RU 4X2WA 1KXAA 1O37A 1HAXB 2P16A 1BMMH 1O5GH 4HZHA 3LKWA 5HGGA 1NPMA 1O2YA 1OYTH 4DW2U 1F5RA 1A4WH 1O2HA 3ATLA 4DGJA 1ZZZA 1A0HB 4OS2A 3T26A 1JRSA 1ZLRA 5JB9S 1OWJA 4R0IA 3LDXH 2AEIH 2HALA 3A7XA 1ARBA 2QYIA 2GTBA 1W7GH 1KLTA 1G30B 1DUAA 1SGDE 2PTCE 2ZFPH 4JMYA 3W94A 1K1JA 1YLCA 5G4BA 1FNIA 2ZFQH 1MUEB 5C1YA 3RXAA 2GV6A 1VCPA 4GVUA 1ABJH 3MH7A 3RXFA 1GGDB 2Z9KA 5A8ZA 3ZZCA 2LNCA 2F9VA 1VR1H 1MQ5A 2OUAA 1MTNB 4TY7A 3RXIA 1KY9A 3STIA 2HNTF 4GHTA 3RXPA 1C2EA 2W7UA 1O3AA 1TNLA 1C1UH 3IWMA 1MTNC 1MCVA 2BDBA 3H5CB 1BRAA 2P8OB 1HJ9A 1BITA 4LZ4B 4DCDA 1NFYA 4NWLA 4WMDA 1NU7B 3E3TA 4MPUA 1O3IA 3DUXH 3QWCH 1OSSA 1UVPA 3E1XB 5A0CA 2V0BA 2AMDA 3ZV9A 2RA0A 1P11E 1CA8B 1F0TA 2A7HA 3MNCA 2VVVA 2OBOA 2UUYA 3PROA 2QXHA 1PPGE 2XBXA 2OXSA 2EC9H 1C2JA 1YPMH 3E0NB 3ENSB 5F8XA 3TJOA 1P2QA 1V2JT 5L6NH 5AHGH 2ZI2H 5DPAA 3ZYEA 4A1VA 1AKSA 4AFSA 3E16B 1CBWB 2FWWA 1W0YH 2GX4A 4YT7H 1GVKB 1GDUA 1PQ8A 1SGCA 1AUJA 3E8LA 3TJNA 2V35A 1SMFE 3TH2H 4D8NA 2H6MA 3VB5A 3ZZ9A 3BIVH 1C5QA 2PSYA 3RLYH 3GY4A 4NIXA 4D7FA 1DWBH 1HXFH 3DFJA 3KNXA 4ZXYH 1ZPZA 1YKTA 2BYAX 3BF6H 1KTTB 1TLDA 3UREA 4ZKOU 3FAOA 3VGCB 5L30H 4AGJA 3NK8A 1KTSB 1TAWA 2IPHA 4I8LA 1RIWB 2PR3A 1XUHA 1ORFA 1EQ9A 1P03A 2HRVA 3U1JB 4K1EA 5GCHF 2WPJS 2OC1A 4UONA 2ZGCA 4GSOA 4ZH8A 4BNRA 2ZPSA 3GISB 2CN0H 4Y7AA 1SL3A 1ANBA 1UHBA 1UCYK 1XMNB 2BQ6B 1FLEE 2P3TB 1GI7B 2HPQH 1QRXA 3EAJA 1L1JA 1CT4E 2H9TH 5DP5A 1O3JA 2BXUH 4AX9H 3TGJE 1BB0B 1KLJH 1QL8A 2A1DB 1NRSH 3TGIE 4CH2B 5GIBA 5K0HA 3U9AH 4Y7BA 1C5VA 2Y5FA 3ZZ8A 3MYWA 2VIPA 1YPGH 1WBGB 2BM2A 2QGRA 1AWHB 1C1OA 1ZTJA 4JCNA 3SNAA 1GHBG 1W0ZU 1TALA 3TJUA 4WJG2 1LPZB 3R0FA 2EA3A 2YOLA 1YC0A 3BIUH 1D9IA 1SOTA 3ATIA 4A6LA 1IQHA 1VZQH 3H7TA 4DY7B 1LMWB 1XUJA 1CGIE 2ZQ2A 1ESAA 4B1TA 1EJNA 2Z9LA 5A8XA 2ZGHA 5EODA 3LJOA 1BTHH 4NZQA 1ZTKA 2WV5A 3ZVBA 4ABIA 1RXPA 1KSNA 5AVDA 2CF8H 4YOJA 1GJ6A 1TNGA 3GY8A 5FHTA 4JZFH 2JH0D 1DM4B 2ZFTA 3S9CA 4ZKSU 1H4WA 1BIOA 4AYYB 1O3EA 2ZU2A 3RXUA 2D2DA 1HXEH 4TYDA 4Y8ZA 1GCTB 3LH1A 1TX7A 4MPXA 1A5GH 1MTVA 1O3NA 1IQEA 1W2KH 3TH4H 1VCWA 2IN2A 3DD2H 2XWBI 1OPHB 1OWEA 4O03A 1CVWH 1MH0A 2PGQB 1TRYA 3SI3H 4TPYA 1O2PA 3RXVA 1FY5A 1SGRE 1CO7E 2GVFA 4XFQA 2PWXA 1EZSC 2J34A 3SGBE 4I8JA 7ESTE 2ULLA 2PUQH 4CREA 1NROH 2FI3E 1XVOA 2A5IA 6CHAB 2BD4A 4UFGH 1RTLA 5T6FA 3SQHE 2XBVA 2A4RA 5DP8A 5C2ZA 3ZVAA 1O3LA 2F91A 1O39A 2ZTZA 1GBIA 2C8XB 2SGEE 4AG1A 3V7TA 3UUZA 2FS8A 2OQUA 1IQLA 2A4OA 1OP0A 1GJ9B 4X6MA 1C4V2 1MTSA 1ESTA 1CA0B 1GJBB 2GGVB 4X8SH 1ELCA 1SLXB 4ABJA 1TGBA 3FP6E 1TGSZ 1DXWA 2RA3A 1C5MD 2Q6GA 2I6SA 1YPKH 1DUEA 1VJAU 3CP7A 1ID5H 2BD3A 2KAIB 3B8JA 1D6RA 3T28A 1MKWK 2JH6D 1GBFA 2W3IA 4GAWA 4NG9H 1ZGIA 2SNVA 4FU9A 1P8VC 1E35B 1T7CA 3T2NA 1ACBE 3KHVA 1UTKA 2HOBA 1GBJA 3VFEA 4BXWA 3M5OA 4A1TA 1JXPA 3ZV8A 4K1SA 4JZ1A 5IDKA 2ZDKA 1GI5A 3UNRA 1Z7KA 2BHGA 1G2LA 4MNWA 3D49H 2J9NA 5C1UA 1GBEA 3PYHA 3OY6U 1DVAH 1O2WA 1V2ST 1BTYA 4NA7A 2VGCB 1MCTA 4MNVA 1AFQC 1BA8B 2R3UA 1BJVA 3MMGA 3GCTG 4B71A 2ZFFH 2HWLB 1K1OA 1UTPA 1K22H 2VIWA 2AIQA 3MU4A 1O0DH 1FQ3A 2BDAA 1BQYA 1NN6A 1FUJA 2UWLA 3UOUA 3BG4C 1ELGA 2BD5A 2H1UA 2Z94A 3CENA 3QGJA 1KLIH 2ZQ1A 4DVAU 1EUFA 2GT8A 2QV1A 5B6OA 5GWZA 3A7ZA 2ZDAH 4B2BA 2EEKA 4XDEA 4AZ2B 5EGMA 4CRBA 2FMJA 3ZYDA 1WTHD 2C8ZB 1QJ6B 1P02A 4B74A 3UWJH 3RMMH 1GI2A 4BTUB 1EZUC 2PHBA 1GJ5H 3DFLA 3RC4A 1DANH 1EATA 1C5PA 3ZVFA 4GPGA 3A7TA 2LPRA 5TCCA 3CS0A 1A3BH 1CU1A 3MO9A 1MZAA 2PKAB 2VIQA 2F83A 4Q2KA 1D3QB 3P95A 2ZO3H 5DP3A 3VB6A 1H9HE 1GHVH 2BDGA 2EI7A 2OQ5A 1KXDA 1IQIA 3DT0H 2QXGA 3ZZBA 2BVRH 1GI3A 2HLCA 3PTNA 1AWFH 1LVMA 1WOFA 1CHOF 1SGEE 2JH5D 2GMTB 3EA9A 3RLWH 2TBSA 6GCHG 2BOHB 2IJOB 3RXOA 7GCHG 3RU4E 1Y3YA 3RXKA 3VPKA 1C2KA 1EAWA 4KTCA 1XXDA 3SU0A 1NFXA 1QBOA 1V2LT 1YCPM 1WYKA 3A86A 1MTWA 1DY8A 4WMFA 4IC6A 1HAYB 2VIVA 2Y80A 7LPRA 3ZVGA 3A81A 1YPEH 1PFXC 3S0NA 4BAOB 1V2UT 1SG8B 1V2OT 1FIWA 2FDAA 1TNHA 2AS9A 2QCYA 1ETRH 1FDPA 2FP7B 4SGBE 3RC6A 1HAHH 3RMLH 5FCRA 4MPWA 2ZFRH 1QBNA 2OBQA 1SC8U 3BN9A 3GY6A 2R0KA 2OTVA 1SVPA 2ZU3A 1DWDH 3NCLA 3U1IB 1PQ7A 1AD8H 4Y8YA 2BQ7B 4H6TA 5E0HA 1XM1A 1O3OA 1ZHPA 5I25A 1N8OC 1L1NA 1IQJA 4U01A 1LKBA 1QGFA 1GI9B 1TGTA 4K8BA 4ZKRU 3K6ZA 3FFGA 4X6PA 1T8OA 1JWTA 4JYUH 3M36A 4UE7H 4X2XA 5BPEA 1T8LA 3MH4A 4K60A 4NSVA 4X1QU 3SV7A 4ZMAH 1HDTH 1TNKA 3OU0A 1QRZA 1F2SE 3LOXA 3TNTA 2FOEA 1TNJA 5DP7A 3BTEE 1ELEE 5EPNA 5A2MH 1GG6C 3QN7A 5BRRE 1Q2WA 3PMHB 2VB0A 2B0FA 2VH6A 2QA9E 4TWYA 1PYTD 1F0SA 1GJDB 3T62A 1QJ7B 3ZZAA 2Y82A 4NCYA 1P12E 2GD4B 2ZDVH 4ZHMU 1P2NA 1AB9C 2HVXA 1GMDG 2FOMB 3EA7A 3RXJA 4YTAA 1KXFA 1EP5A 1QQUA 5AFYH 3SNDA 4AORA 4H4FA 2F9OA 3I78A 1SGNE 4THNH 3SJ9A 1XX9A 1ZTLA 5A09A 4ISOA 3BTTE 2BDIA 4J1YA 2GCTC 3RM2H 5CMXH 3MHWU 1JIRA 3PO1B 1MU6B 4WMEA 3D65E 3HKJB 4Z6AH 2ZU1A 3Q3KA 1O2JA 3KQDA 1GDNA 1YCPK 4TY6A 4MVNA 3PO1C 1SLVB 1ZSLA 3P6ZB 3LPRA 2WPIS 2QXJA 5EQQA 1RFNA 3FP7E 1PPBH 1UK4A 1Y59T 1HAZB 5F6MA 2FLRH 1ETSH 3NUMA 2XRCA 4CR5A 5FXLA 1TPOA 2G5VA 4FVBA 4IMQA 3UFAA 4CHAC 1C9TA 9LPRA 1BZXE 1SGPE 1YPHE 1ELVA 2ANMH 1L0ZA 3D62A 3KCGH 5DJ7A 4KTSA 1GMCG 1QL7A 1OKXA 3EGKH 3SNEA 1EPTC 2ZDLA 3TVJB 1AO5A 5I46H 4AYVB 1QB9A 2CV3A 2C93B 2BDCA 1TFXA 1ZRKA 1SPJA 3GYLB 1FY4A 2IOTA 2GZ9A 1EJMA 2THFB 5JDUB 3MFJA 1TOMH 3MI4A 1KYNA 2B7DH 2XC0A 1GBBA 3C1KA 1IQKA 5K7RA 1MZDA 1TA2A 3RDZA 1PPHE 1V2KT 1O36A 2P94A 3M37A 1SGQE 2OC8A 2FOGA 3PM3A 1C2DA 1DWCH 1D6WA 4KGAA 2FS9A 3LGUA 1Z8JB 1WCZA 3NXPA 1BRBE 3K6YA 1KXBA 5J4SA 4OS7A 4BAHB 1O2SA 1O3GA 2TGPZ 2XNIA 3AW0A 2EI8A 2VIDA 2Z9GA 4F49A 1EXFA 3SNCA 4ZKNU 3F9GA 1THSH 2VNTA 1ARCA 5EXNA 8GCHG 1EP6A 3OYPA 2R2WU 1WV7H 5TJXA 2SGFE 2FLBH 2XCNA 4YZUA 2Y7ZA 1TE0A 5GJ4B 2JETB 1VITG 1ETTH 1GI0A 3LGIA 1RTKA 1EAXA 1K9OE 5EQSA 2JETC 3W95A 2SGQE 1BRCE 3URCA 2Z9IA 2WV4A 1V2MT 1C5RA 1Y3UA 2B8OH 3LT3A 5EQRA 3E90B 1RD3B 3PB1E 4NWKA 3S7HB 2F9BH 1PPZA 2ZGXH 3UWIA 1P2KA 1AU8A 4JZIA 1W12U 3SU4A 2ODPA 3IG6B 4IW4E 5DG6A 3ZVDA 1IQGA 2QC2A 4FUBA 1O2UA 2OINA 4WF8A 1VGCB 1H8IH 3PMJA 1EOLA 1W8BH 1UTOA 4MNYA 4H6SB 4K1TA 1VGCC 5E8EH 2BB4A 1GI8B 3M7QA 2VU8E 3GDVA 1QNJA 4XE4A 1O32A 3SI4H 2ZHEH 1TRNA 4B2CA 1ZMNA 1C5WB 2OP9A 4INHA 1O5DH 1PJPA 2FX4A 3SUEA 4JYVH 4XBCA 3Q3XA 4Q7XA 1Z8GA 4YM9A 2TGAA 1P57B 3K2UA 2A45B 3P8NA 2HNTE 1A7SA 3GY2A 2Y7XA 3L6PA 3E0PB 1O3MA 1C2MA 1SI5H 3V3MA 4Y8XA 1INCA 1BMLA 1OS8A 5E0JA 1GJAB 2BZAA 3K65B 4DIHH 3KEEA 1A61H 1BHXB 1O5AB 1BRUP 3TH3H
chains in the Genus database with same CATH superfamily
4OS4A 1CHGA 1SFQB 5EU8A 1F5KU 1GL0E 2BD8A 2AMQA 1BTWA 2VWLA 2KAIA 4E06H 1DICA 5FL7D 1UVOA 4F4OC 3MTYA 4XSKU 3NKKA 4BAMB 5JB8S 3ZVCA 3RUOA 2P3UB 2DE8A 4X8UH 2BLOA 2O8UA 4BTTB 4IN2A 3KQCA 1D3TB 1W0KD 1ZGVA 2ZKSA 4TWWA 1WU1A 1GHXH 2FZZA 2F9NA 4B2AA 2GT7A 2WHXA 2NU3E 1C9PA 1ZHRA 1HYLA 2XC4A 2ZF0H 1LHDH 2XBYA 1UO6A 1O5BB 1Z1IA 3TK5A 4ISHH 5HYOA 1ZSJA 2BD7A 1C2FA 1XUIA 1NRNH 2XWAA 5CE1A 1J9CH 1B5GH 1EZXC 1O2MA 5FX6A 3FANA 4TPIZ 3BTWE 3A7VA 3JZ2B 4LK4A 1NU9A 2XXLA 2LP6A 1O2GH 5E2OA 2VH0A 4IMZA 1AY6H 1K2I1 3KGPA 1AE5A 1MQ6A 1NT1A 1HCGA 3QTVH 4E7NA 5L2ZH 1CT0E 1GI6A 4U2WA 2GV7A 3MU0A 1B7XB 3TIUA 4AG2A 1Z6EA 3NZIA 3BTQE 2WPKS 1XXFA 2G00A 2JKHA 1E34B 4FUFA 2ZNKH 1HBTH 1O2OA 4FUEA 3WWBA 2HPPH 1QB6A 1P10A 4I7YH 4ASUD 3RU4D 3P17H 3L3TA 2FOHA 3QX5H 2ZGJA 1G3BA 5GXPA 4DG4A 1AN1E 1QHRB 2ZC9H 3M61U 2STBE 2PKAA 5ESBA 1GCDA 1TONA 2AHME 2PTNA 1J15A 2FYQA 3JZ1B 2VINA 1TB6H 3MU8A 4MLFB 3SNBA 5EW1H 1AQ7A 3AAVA 1HAVB 2CXVA 3RMOH 3LGVA 1NZQH 5IYTA 3S9AA 5HMAA 3F9HA 5FPSA 2ZU4A 1TQ0B 4WXIA 4GUXA 1Q3XA 3QLPH 3EDXB 3QGNB 3PV5A 4CR9A 1O2TA 1DSTA 4WH8A 2BD2A 4NIWA 2ALVA 1SQAA 3S9BA 1H8ED 2G5NA 1L4DA 2GCHG 2H9EH 3LGTA 1BMFD 2J98A 2I6QA 2O8LA 5F8ZA 4Q80A 3M5NA 1FPCH 1H9IE 2W3KA 3SJIA 3MOCA 3U69H 4JZEH 4Y0YE 2NU4E 4WWYA 1FAKH 1Z6JH 1Z8IB 1BBRE 4VGCC 1NBMD 1AMHA 1G32B 1GHAG 4AGKA 2SGDE 3SU5A 1GHBF 1A3EH 1O30A 3PTBA 1GPZA 1L1GA 4ISIH 3QO6A 3I29A 1BOQA 3EE0B 3UR6A 3BTME 3UQOA 2Y5HA 4ASHA 1HAOH 4KKDA 1LVOA 3LJJA 1C2HA 4A5TS 1CGHA 3EA8A 3TPIZ 1UW7A 4CBNA 1UTMA 1T4UH 4X0WU 5C0TA 1ZMJA 1HJAC 1T8MA 1YPHC 2D26C 2PUXB 3VB3A 3Q77A 4RT1A 5H4IB 4AFUA 5JBAS 3ZZDA 1UK2A 3VB4A 1Y3XA 4Q7YA 3VXEH 1O34A 5DP9A 1P05A 1VITH 1QRWA 1PPFE 1AFQB 3O8RA 2DUCA 4WH6A 4I8GA 4CRGA 3LONA 1ELTA 4E7RG 1P9UA 4YESB 1KMHB 1AI8H 5DP4A 3HPTB 1AVGH 1NFUA 1NM6A 3BG4B 1UTJA 4ABHA 4NIYA 1V2VT 3A8AA 3TNSA 1K1MA 4GLYA 3TITA 2PSXA 2O8MA 4AN7A 4BAKB 3SV6A 2RDLA 1SGFA 2G81E 4U30A 1QA7A 1T31A 1BHXF 2BXTH 1V2PT 1QFKH 1YGCH 3A8CA 2WZQA 1Q31A 3TGKE 4Y10E 5E2PA 2VJ1A 1FJSA 1WXRA 3AAUA 5AF9H 5EW2H 1A0LA 1GBHA 4ABFA 3QUMP 4MQAA 1UCYH 1DY9A 2H9HA 2H5CA 5DGJA 1LKAA 2A0QB 4NIVA 1GWAA 3PRBA 1BT7A 2WPMS 4OGXA 2Z9JA 3KF2A 1JIMA 1L4ZA 2W6JD 3BSQA 2K0QA 3KQBA 3RXLA 3F68H 2PP6A 3F0OA 1LPKB 2GCHF 5AFZH 2O8WA 4CRDA 1GI4A 3ZZ6A 1WTGH 5T6GA 1C2IA 5EPYA 3KL6A 2CF9H 1T4VH 3LIWA 1C1NA 1S82A 3W1EA 2L6OA 3UNQA 4KELA 5FAHA 3GY3A 4MTBA 4LOYH 1OOKB 2UUKB 4ZHAA 1IQMA 1JBUH 2QN5T 1J8AA 1XUGA 1TX8A 1Y3WA 3VG8A 1A5IA 4B6FA 4I31A 2O8TA 6LPRA 1FIZA 3UAIC 1QA0A 3EYDA 1TYNA 3RXGA 3P8OA 5HM9A 1GVLA 4BAQB 3BV9B 3OY5U 1NRQH 4FUCA 1NFWA 1AIXH 2ZWLH 1KIGH 5F03A 1BTZA 5FX5A 2BX3A 1AFEH 1PYTC 1PPCE 3ZZ3A 3HK3B 3P92A 1FY8E 2P95A 2J5UA 1O38A 2A31A 2QXIA 4O3TA 4PROA 2BTCE 5EG4A 2J2UA 4M7GA 1GVZA 3G01A 3SJOA 1DT2A 1G3DA 2BDYA 1N8OB 1DITH 1XKAC 2ZDMA 4MNXA 3L33A 5EJLA 4YOIA 1HIAB 4JK6A 3GCTF 3PMAB 1AZ8A 2F3CE 4JK5A 2GDDA 2P59A 5DP6A 1S0QA 4CRFA 2VVUA 2YNAA 1MD7A 3FZZA 2FOFA 3PLKA 3ZZ7A 5CDFE 3A8BA 3DSOA 2VWNA 3GOVB 3C27B 1GBKA 2VWMA 2Z3CA 4MDSA 4Y11E 2UWOA 2BY5X 1O3HA 1GDQA 5FBEA 1GG6B 1LPGB 1XUFA 3LC5A 1AUTC 1NBME 1JMOH 2A4GA 2PKSC 3GCHB 3PRDA 4FU7A 4FUHA 2V3HH 3DA9B 1D3PB 3GYMA 3LGWA 4IBLH 3RXSA 3TLOA 4BANB 1ANDA 3R3GB 1ZJDA 1C5UA 1HPGA 2AH4X 3GCHC 3B9FH 1FN6A 1LHEH 1AB9B 5LPRA 1UTNA 1FI8A 3QTOH 2ZCKP 1C5YB 2ALPA 2J94A 1D4PB 1P2MA 1TRMA 4J2YB 2CGAA 4X2YA 2A7CA 2ZHDA 2FO9A 1OXGA 3ELAH 2B5TB 1S85A 3SU3A 3BTKE 5DO4H 2F9UA 2GCTB 1SLWB 3OX7U 4Y6DA 1FZZA 2EY4C 3A89A 1MKWH 4FXGH 1FV9A 1O2VA 1J17T 6GCHF 1G36A 1O31A 1UVSH 1C4U2 2BVSH 4K69A 4OS1A 3QZRA 4YO9A 2WPDD 3F0PA 7GCHF 1Z8RA 4JYTA 2GZ8A 3RMNH 1E1QD 1LVYA 2AGGX 1IHSH 1SHHB 1KXEA 1BMAA 4CRCA 2GZ7A 1TA6A 2SFAA 3FOAA 4QT8C 1A2CH 1C1PA 4SGAE 2PGBB 5HIZA 4D9QA 4X2VA 1MAXA 1IAUA 4F48B 1OP2A 4CHAB 1Y5BT 3GICB 2ZPQA 1FN8A 3GDUA 1W10U 2JJ2D 4HG6A 1HAIH 1DX5M 2FODA 2FI4E 1EPTB 1K28D 4ZXXH 1QURH 2OC0A 1QQ4A 1A46H 4DT4A 1MU8B 1Y8TA 3UB0A 1V3XA 3ATKA 4ZUHA 1YPJH 1C1MA 1GHYH 1YYY1 4I8HA 1HLTH 3E91A 1VJ9U 1LQDB 1DOJA 2JDID 3V12A 1B0EA 2ZHFH 4I8KA 1IHTH 2B9LA 3GCOA 5C5NA 4K2YA 2CHAC 1FMGA 1QCPA 2WPHS 2Z3EA 2BZ6H 4Z0KA 1C5NH 1EX3A 2G4TA 2QIQA 3PLPA 4UD9H 4UFEH 1H1BA 1P3CA 4FETA 2BDHA 3M35A 1A0JA 3UY9A 9ESTA 5LGOA 4CH8B 4AFQA 3N7EA 2BLVA 1LHGH 5T3HA 4XOJA 2WUCA 2YNBA 4RSPA 2BY6X 2J4IA 2YMSD 1XVMA 5ABWA 1KDQA 1C4Y2 1C5SA 3OTPA 3UIRA 5C1XA 1GMDF 1CQQA 1V2TT 2GDEH 2NU2E 2VWOA 2V3MA 1KXCA 1SGYE 5JBTA 1O2NA 2TPIZ 1UVUH 3BTHE 1T8NA 2EI6A 5C67A 4BTIB 1N1LA 3KYGA 2ZPRA 3RXQA 1O5CB 3M5MA 2H2ZA 1C5XB 1C1SA 2VVCA 3MNXA 5GCHG 3RXDA 3BTGE 3UR9A 1EKBB 2R0LA 3BTDE 2ZFSA 2ZHWH 3ATMA 3SN8A 1YPLH 2WPLS 2WYGA 3ZZ4A 3SU2A 1TBQH 3ATWA 3PWCA 4D7GA 4AB8A 5JBBS 3ODDA 1SHYA 3IITA 2R9PA 2W7SA 1F7ZA 4RN6A 2FIRH 3GDSA 1P2IA 1O3CA 2V6NA 1OYQA 1EASA 1GGDC 1ZR0A 1DE7H 1P2OA 4FVDA 4WY3A 4DJZB 1MKXK 1O2IA 2FM2A 2ZGBH 4Y71A 3SU6A 1O2LA 3N7OA 4NFFA 1O3KA 1WQSA 4K5ZA 3NPSA 1S0RA 1QIXB 3UOPA 5C0UA 1ZOMA 1OWHA 2AMPA 1GMCF 1BMNH 2Z6BD 3RXHA 5FCKA 2Q6DA 3RXBA 1HNEE 3OFND 1J14A 1C1TA 2P8OC 4ABAA 3SOSA 1IOEA 3O8BA 3FVFB 3VEQB 3PLBA 3AASA 5CHAB 1HAVA 1P04A 1O2QA 2TIOA 4A1XA 4DOQA 1HAGE 4KTUA 5JPMH 1LTOA 3OEHD 2NWNA 1C1RA 5CHAC 1CE5A 4RI0A 4UFFH 1E37B 2FEQH 3RU4T 1QR3E 1SLUB 2P3FH 1TGCA 1Y3VA 1TMBH 1HAPH 1SQOA 1G2MA 1G3EA 1UTLM 1P01A 2UUJB 2ODQA 3QDZB 1FONA 4AB9A 4YT6H 1C1WH 2QF5A 4HTCH 1MD8A 2FOCA 5DK1A 4I86A 3T27A 3SBKA 1GBDA 2HVYB 1B0FA 4UDWH 3RP2A 1CBWC 1QBVH 1C5ZB 3KQEA 3UQVA 1P06A 3VB7A 2KCOA 1UJ1A 3TJVA 2OLGA 2RCEA 1J16A 1RJXB 3O8CA 1ELBA 3F1SB 1BUIA 5KGOA 3SW2B 3RXEA 3ESTA 2BOKA 1UTQA 2BLQA 2XC5A 4XRNA 3WY8A 2KCYA 3FP8E 4E05H 3URDA 1H8DH 3HKIB 2P93A 4A92A 2WYJA 2WSSD 4O97A 2FESH 1RRKA 2ZP0H 8GCHF 1XKBC 1EZQA 2BY7X 1YCPH 1S6HA 2PW8H 3VGCC 1FY1A 1DSUA 2HGTH 3V0XA 5PTPA 1VITF 2WINI 1RIWC 1E38B 2OD3B 3UNSA 3ODFA 1V2WT 2ILNA 4P02A 2SGAA 4U32A 1KDQB 1HV7A 3BEFB 3U8OH 5C17A 3LC3A 1NTPA 3MH5A 4TT3D 1E36B 1BBRK 3SUFA 1TIOA 5JYIA 3SUGA 2VBCA 1K1NA 3NWUA 3P8FA 1MTUA 2K8IA 3SO3A 4IGDA 4MPVA 1BCUH 3RC5A 3ZVEA 5C5OA 3HGNA 3H7OA 4TSFD 1MBQA 2ZU5A 2C8WB 4FUJA 1EJAA 1K1LA 2C3SA 3KIDU 3T5FH 2AIPA 1THRH 3MWIU 3P70B 5GDSH 4GCHG 3SGQE 1V6DA 1JOUB 3STJA 1BDAA 1HB0B 3I77A 1Z1JA 3MH6A 3U98H 1ELFA 4HI3A 3O8DA 3HATH 2M2AA 4NGAH 3FN8A 1AVWA 1K1PA 1SGTA 1TOCB 1XUKA 2G55A 1ANEA 3A80A 2ZTXA 1O5FH 2ANKH 5C94A 3ZIAD 5ESTE 1G37A 4K8YA 1BTXA 1S81A 3Q3YA 1CSOE 2PFEA 3GS9A 1F92A 4HFPB 3U8RH 1F0RA 5HM2A 2ZTYA 5GPIB 1O2ZA 3RXMA 4JZDH 5A0BA 1GJ4H 2FPZA 5LPFA 3LGYA 4IN1A 1LQEA 3DSPA 3M3TA 4XBDA 4FUGA 1P2JA 4Y76A 1HFDA 4YOGA 5HXFA 3A84A 1UK3A 4X8TH 2BMGB 2F4LA 1V2NT 1EOJA 3OSYA 3V13A 4ZAEA 1GCTC 2XTTB 4Q7ZA 4Q4LA 1ZPBA 5TCAA 3FZDA 2W5EA 1NESE 1GBCA 2PLXA 4NZLA 1AKSB 4XBBA 2DE9A 3PV4A 1OWKA 3GY5A 1ESBA 2BVXH 1GL1A 3F6UH 1CT2E 3PWBA 4VGCB 1G9IE 1GMHG 1UCYE 1WQVH 6CHAC 1SBWA 1YBWA 5FPYA 3MU1A 4OS5A 5FPTA 2L74A 3M5LA 4DIIH 2A2QH 4ISNA 5A0AE 7KMEH 4INLA 1TABE 4Y79A 3FKSD 1YLNA 1SGIB 1SKYE 3A87A 2K1QA 1C5LH 1TWXB 2NU1E 3ITIA 3E6PH 1M9UA 1LO6A 1MKXH 1EB2A 1DPOA 3A7WA 1ZRBA 3SHCH 4WXVA 1GBMA 1TNIA 1CA0C 1HJAB 3MQKC 2Y6TA 3MO6A 1HRTH 1HIAA 2BY8X 2FTMA 1Y5AT 3CS7A 1CHOG 2A32A 2Q6FA 1UHBB 4M9FA 1W0JD 2ANWA 2QY0B 2SGPE 3P8GA 1SOZA 2BY9X 4GCHF 1AE8H 1RS0A 1P9SA 2Y81A 1FY3A 1PPEE 1T32A 1ZJKA 2A5AA 4O3UA 1Y5UT 3RXTA 3OTJE 1UMAH 3AW1A 3HK6B 2XCFA 4ACBA 3WW7A 1VCQA 4D9RA 3PMBB 3KQ5A 1OWIA 3TK9A 3GY7A 3LH3A 1SFIA 2XBWA 1GI1A 3RXRA 1DDJA 4OGYA 2Q1JA 2J38A 3DHKH 1BTPA 2WUBA 4OS6A 5SGAE 1D3DB 1K1IA 5F8TA 1TGNA 1W11U 3SJKA 3SU1A 4ZHLU 3LU9B 3A8DA 1QL9A 1O3DA 3VXFH 8LPRA 1AGJA 4I33A 5ETXA 4K3JA 2UWPA 4I32A 4H42U 2W26A 4B73A 1SQTA 2FXRA 1SR5C 1OX1A 1JRTA 3RM0H 2GKVE 5HKKD 3SUDA 3KYFA 2M5TA 1OP8A 1ZHMA 2V3OH 2VGCC 1HJ8A 1NO9H 5EXMA 4B75A 1AVXA 1O2RA 1G3CA 1MABB 4AFZA 3SV8A 2ZHQH 2QE7D 1O3PB 4X6NA 2AFQB 3SV9A 2TGTA 4X8VH 1PQAA 3T29A 2ZIQH 3MNBA 4ABBA 4AOQA 3T25A 1DS2E 1GJ7B 1ANCA 5EJZA 1P0SH 4X1PU 4IS5A 1AZZA 4UEHH 1P09A 2ZA5A 1ZPCA 1ZSKA 2NU0E 3NRLA 4GHQA 5CHBA 2A7JA 1N6YA 4WVPE 1GMHF 3F2FA 1A1RA 4FUDA 2ZCHP 1BBRH 1F0UA 2H5DA 3U8TH 3QK1A 1WSSH 3D23A 5LH8A 1W3CA 3TU7H 1BJUA 4RKJB 8ESTE 3SZNA 1GHAF 2Z3DA 4YLUA 1S5SA 2F9PA 2ESTE 2FTLE 1FAXA 5EOKA 2VIOA 3S69A 3SJ8A 1EPTA 6ESTA 3M7TA 2RG3A 3EQ0H 4MG3A 3HGPA 1OWDA 1W13U 1QJ1B 2A2XH 1EAIA 3A85A 1MAYA 1NRRH 1GHZA 1FXYA 3SGAE 3MO3A 4FU8A 3UPEA 1QB1A 1WAYB 2EQNA 3SV2H 3F9EA 1O33A 4O9VA 3A83A 2XOKD 1TBZH 2GMTC 4ACAA 2ASUB 2G4UA 1TPAE 1U6QA 1C1QA 2D8WA 3MU5A 1LHCH 2D1JA 1MBMA 2ZG0H 1YP9A 1GBAA 4Z1MD 4R8TB 2CMYA 4ZROA 1DLEA 5JBCS 4DURA 1F5LA 1H9LB 1TPSA 2AERH 2OCVB 1C2LA 4ABEA 1E0FD 3M3VA 2QAAA 4ABGA 4NA8A 5E0GA 1LVBA 1DXPA 4YLQH 2QF0A 1V2RT 2XW9A 3SORA 2HNTC 2R2MB 2PKSB 4HGCA 3A88A 2Y5GA 3A82A 1ELAA 3KN2A 1HUTH 3BEIB 1O5EH 2STAE 1LHFH 1YLDA 2SNWA 1RGQA 4INKA 2ZEBA 4BXSA 1S84A 4Y0ZE 1O35A 3SHAH 5LPEA 1N6XA 2FYRA 3M7UA 3Q76A 1H8HD 1YM0A 1MMJN 1THPB 1NY22 3A7YA 1QY6A 8KME2 1O2KA 3AVZA 1C5TA 4BOHA 3TK6A 2BQWB 4LXBH 4KP0A 1ABIH 2TGDA 5A8YA 4B6EA 3M3SA 1C1VH 4X6OA 5FBIA 2FI5E 2ODYB 1O3BA 4RKOB 1GJCB 1EB1H 2BX4A 1NS3A 4LZ1H 5DKMA 4OM9A 2G51A 1EAUA 3FO8D 1RTFB 2ZDNA 1OHHD 1S83A 1BTUA 5C20A 1IQFA 3UTUH 2C90B 5L2YH 4DT7B 3K9XB 1TBRH 2KCPA 2C4FH 1O2XA 3DCLA 1V2QT 3SQEE 1O3FA 2J95A 3B23B 1K0HA 1GBTA 2FX6A 2LELA 1ZYOA 1ZMLA 4B76A 1DLKB 4P00A 2G52A 2AGIX 2CJIA 5C3NA 4XD7D 3F9FA 4A7IB 1P3EA 1SSXA 2FOBA 2AGEX 1C5OH 4X1SU 2O9QA 2ANYA 3RXCA 1QTFA 2ZCLP 1TMTH 1GHWH 1TX6A 2XYAA 3BG8A 4ESTE 3QZQA 4ISLA 1LDTT 1S6FA 1SB1H 4UFDH 3S7KB 2ZZUH 4NFEA 2BD9A 1LCYA 4D76A 2AYWA 4X1NU 2RDEA 1GJ8B 4ABDA 3MNSA 1ELDE 4FUIA 1GBLA 3BTFE 2PV9B 1NRPH 2A5KA 1AHTH 1UVTH 1CGJE 1PQ5A 1TMUH 3GCNA 1WUNH 2QF3A 4IC5A 2GP9B 4NSYA 1DFPA 2CHAB 3N7DA 4CBOA 1DWEH 4NA9H 2J92A 2R3YA 1YF4A 2UUFB 1FPHH 1L2EA 2C8YB 1TPPA 1Z71A 1HGTH 1TQ7B 3BEUA 1K21H 2OC7A 5J4QA 1A5HA 2FOAA 1NC6A 5EXLA 1X7AC 1IQNA 3Q00A 2TRMA 3SYJA 2A4QA 2G8TA 1C2GA 4CRAA 5T6DA 1W7XH 3ZZ5A 1SGFG 1W14U 2Z7FE 2BLWA 2ZECA 4X1RU 4X2WA 1KXAA 1O37A 1HAXB 2P16A 1BMMH 1O5GH 3CNRA 4HZHA 3LKWA 5HGGA 3OE7D 1NPMA 1O2YA 1OYTH 4DW2U 1F5RA 1A4WH 1O2HA 3ATLA 4DGJA 1ZZZA 1A0HB 4OS2A 3T26A 1JRSA 1ZLRA 5JB9S 1OWJA 4R0IA 3LDXH 2AEIH 2HALA 3SZEA 2KX4A 3A7XA 1ARBA 2QYIA 2GTBA 1W7GH 1KLTA 1G30B 1DUAA 1SGDE 2PTCE 2ZFPH 4JMYA 3W94A 1K1JA 1YLCA 5G4BA 1FNIA 2ZFQH 1MUEB 5C1YA 3RXAA 3AK5A 1QZ8A 2GV6A 1VCPA 4GVUA 1ABJH 3MH7A 3RXFA 4YXWD 1GGDB 2Z9KA 5A8ZA 3ZZCA 2LNCA 2F9VA 1VR1H 1MQ5A 2OUAA 1MTNB 4TY7A 3RXIA 1KY9A 3STIA 2HNTF 4GHTA 3RXPA 1C2EA 2W7UA 1O3AA 1TNLA 1C1UH 3IWMA 1MTNC 1MCVA 2BDBA 3H5CB 1BRAA 2P8OB 1HJ9A 1BITA 4LZ4B 4DCDA 1NFYA 4NWLA 4WMDA 1NU7B 3E3TA 4MPUA 1O3IA 3DUXH 3QWCH 1OSSA 1UVPA 3E1XB 5A0CA 1SQRA 2V0BA 2OK5A 2AMDA 3ZV9A 2RA0A 1P11E 1CA8B 1F0TA 2A7HA 3MNCA 2VVVA 2OBOA 2UUYA 3PROA 2QXHA 1PPGE 2XBXA 1YWUA 2OXSA 2EC9H 1C2JA 1YPMH 3E0NB 3ENSB 5F8XA 3TJOA 1P2QA 1V2JT 5L6NH 5AHGH 2ZI2H 5DPAA 3ZYEA 4A1VA 1AKSA 4AFSA 3E16B 1CBWB 2FWWA 1W0YH 2GX4A 4YT7H 1GVKB 1GDUA 1PQ8A 1SGCA 1AUJA 3E8LA 3TJNA 2V35A 1SMFE 3TH2H 4D8NA 2H6MA 3VB5A 3ZZ9A 4RT0A 3BIVH 1C5QA 2PSYA 4FOUC 3RLYH 3GY4A 4NIXA 4D7FA 1DWBH 1HXFH 3DFJA 3KNXA 4ZXYH 1ZPZA 1YKTA 2BYAX 3BF6H 1KTTB 1TLDA 3UREA 4ZKOU 3FAOA 3VGCB 5L30H 4AGJA 3NK8A 1KTSB 1TAWA 2IPHA 4I8LA 1RIWB 2PR3A 1XUHA 2IPQX 1ORFA 1EQ9A 1P03A 2HRVA 3U1JB 4K1EA 5GCHF 2WPJS 2OC1A 4UONA 2ZGCA 4GSOA 4ZH8A 4BNRA 2ZPSA 3GISB 2CN0H 4Y7AA 1SL3A 1ANBA 1UHBA 2XNDD 1UCYK 1XMNB 2BQ6B 1FLEE 2P3TB 1GI7B 2HPQH 1QRXA 3EAJA 1L1JA 1CT4E 2H9TH 5DP5A 1O3JA 2BXUH 4AX9H 3TGJE 1BB0B 1KLJH 1QL8A 2A1DB 1NRSH 3TGIE 4CH2B 5GIBA 5K0HA 3U9AH 4Y7BA 3F2GA 1C5VA 2Y5FA 3ZZ8A 3MYWA 2VIPA 1YPGH 2KR7A 1WBGB 2BM2A 2QGRA 3F3BA 1AWHB 1C1OA 1ZTJA 4JCNA 3SNAA 1GHBG 1W0ZU 1TALA 3TJUA 2KZ4A 4WJG2 1LPZB 3R0FA 2EA3A 2YOLA 1YC0A 3BIUH 1D9IA 1SOTA 3ATIA 4A6LA 1IQHA 1VZQH 3H7TA 4DY7B 1LMWB 1XUJA 1CGIE 2ZQ2A 1ESAA 4B1TA 1E79D 1EJNA 2Z9LA 4Q63A 5A8XA 2ZGHA 5EODA 3LJOA 1BTHH 1E1RD 4NZQA 1ZTKA 2WV5A 3ZVBA 4ABIA 1RXPA 1KSNA 5AVDA 2CF8H 4YOJA 1GJ6A 1TNGA 3GY8A 5FHTA 4JZFH 5EJ1A 2JH0D 1DM4B 5HIYA 2ZFTA 3S9CA 4ZKSU 1H4WA 1BIOA 4AYYB 1O3EA 2ZU2A 3RXUA 2D2DA 1HXEH 4TYDA 4Y8ZA 1GCTB 3LH1A 1TX7A 4MPXA 1A5GH 1MTVA 1O3NA 1IQEA 1W2KH 3TH4H 1VCWA 2CK3D 2IN2A 3DD2H 2V7QD 2XWBI 1OPHB 1OWEA 4O03A 1CVWH 1MH0A 2PGQB 1TRYA 3SI3H 4TPYA 1O2PA 3RXVA 1FY5A 1SGRE 1CO7E 2GVFA 4XFQA 2PWXA 1EZSC 2J34A 3SGBE 4I8JA 7ESTE 2ULLA 2PUQH 4CREA 5DN6D 1NROH 2FI3E 1XVOA 2A5IA 6CHAB 2BD4A 4UFGH 1RTLA 5T6FA 3SQHE 2XBVA 2A4RA 5DP8A 5C2ZA 3ZVAA 1O3LA 2F91A 1O39A 2ZTZA 1GBIA 2C8XB 2SGEE 4AG1A 3V7TA 3UUZA 2FS8A 2OQUA 1IQLA 2A4OA 1OP0A 1GJ9B 4X6MA 1C4V2 1MTSA 1ESTA 1CA0B 1GJBB 2GGVB 4F55A 4X8SH 1ELCA 1SLXB 4ABJA 1TGBA 3FP6E 1TGSZ 1DXWA 2RA3A 1C5MD 1EFRD 2Q6GA 2I6SA 1YPKH 1DUEA 1VJAU 3CP7A 1ID5H 2BD3A 2KAIB 3B8JA 1D6RA 3T28A 1MKWK 2JH6D 1GBFA 2W3IA 4GAWA 4NG9H 1ZGIA 2SNVA 2KCAA 4FU9A 1P8VC 1E35B 1T7CA 3T2NA 1ACBE 3KHVA 1UTKA 2HOBA 2F43B 1GBJA 3VFEA 4BXWA 3M5OA 2J97A 5F53A 4A1TA 1JXPA 3ZV8A 4K1SA 4JZ1A 5IDKA 2ZDKA 1GI5A 3UNRA 1Z7KA 2BHGA 1G2LA 4MNWA 3D49H 2J9NA 5C1UA 1GBEA 3PYHA 3OY6U 1DVAH 1O2WA 1V2ST 1BTYA 2RFKC 4NA7A 2VGCB 1MCTA 4MNVA 1AFQC 1BA8B 2R3UA 1BJVA 3MMGA 3GCTG 4B71A 2ZFFH 2HWLB 1K1OA 1UTPA 1K22H 2VIWA 2AIQA 1VKYA 3MU4A 1O0DH 1FQ3A 2BDAA 1BQYA 1NN6A 1FUJA 2UWLA 3UOUA 3BG4C 1ELGA 2BD5A 2H1UA 2Z94A 3CENA 3QGJA 1KLIH 2HLDD 2ZQ1A 4DVAU 3DSGA 1EUFA 2GT8A 2QV1A 5B6OA 5GWZA 3A7ZA 2ZDAH 4B2BA 2EEKA 4XDEA 4AZ2B 5EGMA 4CRBA 2FMJA 3ZYDA 1WTHD 2C8ZB 1QJ6B 2WV9A 1P02A 4B74A 3UWJH 3RMMH 1GI2A 4BTUB 1EZUC 2PHBA 1GJ5H 3DFLA 3RC4A 1DANH 1EATA 1C5PA 3ZVFA 4GPGA 3A7TA 2LPRA 5TCCA 3CS0A 1A3BH 1CU1A 3MO9A 3PV2A 1MZAA 2PKAB 2VIQA 2F83A 4Q2KA 1D3QB 3P95A 2ZO3H 5DP3A 3VB6A 1H9HE 1GHVH 2BDGA 2EI7A 2OQ5A 1KXDA 1IQIA 3DT0H 2QXGA 3ZZBA 2BVRH 1GI3A 2HLCA 3PTNA 1AWFH 1LVMA 1WOFA 1CHOF 1SGEE 2JH5D 2GMTB 3EA9A 3RLWH 2TBSA 6GCHG 2BOHB 2IJOB 4ZCNA 3RXOA 7GCHG 3RU4E 2KM0A 1Y3YA 3RXKA 3VPKA 1C2KA 1EAWA 4KTCA 1XXDA 3SU0A 2J98B 1NFXA 1QBOA 1V2LT 1YY3A 1YCPM 1WYKA 3A86A 1MTWA 1DY8A 4WMFA 4IC6A 1HAYB 2VIVA 2Y80A 7LPRA 3ZVGA 3A81A 1YPEH 1PFXC 3S0NA 4BAOB 1V2UT 1SG8B 1COWD 1V2OT 1FIWA 2FDAA 1TNHA 2AS9A 2QCYA 2W6ID 1ETRH 1FDPA 2FP7B 4SGBE 3RC6A 1HAHH 3RMLH 5FCRA 4MPWA 2ZFRH 1QBNA 2OBQA 1SC8U 3BN9A 3GY6A 2R0KA 2OTVA 1SVPA 2ZU3A 1DWDH 3NCLA 3U1IB 1PQ7A 1AD8H 4Y8YA 2BQ7B 4H6TA 5E0HA 1XM1A 1O3OA 1ZHPA 5I25A 1N8OC 1L1NA 1IQJA 4U01A 1LKBA 1QGFA 1GI9B 1TGTA 4K8BA 4ZKRU 3K6ZA 3FFGA 4X6PA 1T8OA 1JWTA 4JYUH 3M36A 4UE7H 4X2XA 5BPEA 1T8LA 3OEED 3MH4A 4K60A 4NSVA 4X1QU 3SV7A 4ZMAH 1HDTH 1TNKA 3OU0A 1QRZA 1F2SE 3LOXA 3TNTA 2FOEA 1TNJA 5DP7A 3BTEE 1ELEE 5KEDA 5EPNA 5A2MH 1GG6C 3QN7A 5BRRE 1Q2WA 2JIZD 3PMHB 2VB0A 2B0FA 2VH6A 2QA9E 4TWYA 1PYTD 1F0SA 1GJDB 3OAAD 3T62A 1QJ7B 3ZZAA 2Y82A 4NCYA 1P12E 2GD4B 2ZDVH 4ZHMU 1P2NA 1AB9C 2HVXA 1GMDG 5IK2D 2FOMB 3EA7A 3RXJA 4YTAA 1KXFA 1EP5A 1QQUA 5AFYH 3SNDA 4AORA 4H4FA 2F9OA 3I78A 1SGNE 4THNH 3SJ9A 1XX9A 1ZTLA 5A09A 4ISOA 2YMSB 2BDIA 3BTTE 2GCTC 4J1YA 3RM2H 5CMXH 3MHWU 1JIRA 3PO1B 1MU6B 4WMEA 3D65E 3HKJB 4Z6AH 2ZU1A 3Q3KA 1O2JA 2YMSC 3KQDA 1GDNA 1YCPK 4TY6A 4MVNA 3PO1C 1SLVB 1ZSLA 3P6ZB 3LPRA 2WPIS 2IJD1 2QXJA 5EQQA 1RFNA 3FP7E 1PPBH 5T1VA 1UK4A 1Y59T 1HAZB 5F6MA 2FLRH 1ETSH 5KECA 3NUMA 2XRCA 4CR5A 5FXLA 1TPOA 2G5VA 1S6LA 4FVBA 4IMQA 3UFAA 5DSFA 4CHAC 5GNDA 1C9TA 9LPRA 1BZXE 1SGPE 1YPHE 1ELVA 2ANMH 2QF4A 1L0ZA 3D62A 3KCGH 5DJ7A 4KTSA 1GMCG 1QL7A 1OKXA 3EGKH 3SNEA 1EPTC 2ZDLA 3TVJB 1AO5A 5I46H 4AYVB 1QB9A 2CV3A 2C93B 2BDCA 1TFXA 1ZRKA 1SPJA 3GYLB 1FY4A 2IOTA 2GZ9A 1EJMA 2THFB 5JDUB 5B6LA 3MFJA 1TOMH 3MI4A 1KYNA 2B7DH 2XC0A 1GBBA 3C1KA 1IQKA 5K7RA 1MZDA 1TA2A 3RDZA 1PPHE 1V2KT 1O36A 2P94A 3M37A 1SGQE 2OC8A 2FOGA 3PM3A 1C2DA 1DWCH 1D6WA 4KGAA 2FS9A 3LGUA 1Z8JB 1WCZA 3NXPA 1BRBE 3K6YA 1KXBA 5J4SA 4OS7A 4BAHB 1O2SA 1O3GA 2TGPZ 2XNIA 3AW0A 2EI8A 2VIDA 2Z9GA 4F49A 1EXFA 3SNCA 4ZKNU 4AC9A 3F9GA 1THSH 2VNTA 1ARCA 5EXNA 8GCHG 1EP6A 3OYPA 2R2WU 1WV7H 5TJXA 2SGFE 2FLBH 2XCNA 4YZUA 2Y7ZA 1TE0A 5GJ4B 2JETB 1VITG 1ETTH 1GI0A 3LGIA 1RTKA 1EAXA 1K9OE 5EQSA 1WDIA 2JETC 3W95A 2SGQE 1BRCE 3U28C 3URCA 2Z9IA 2WV4A 1V2MT 1C5RA 1Y3UA 2B8OH 3LT3A 5EQRA 3E90B 1RD3B 3PB1E 4NWKA 3S7HB 2F9BH 1PPZA 2ZGXH 3UWIA 1P2KA 1AU8A 4JZIA 1W12U 3SU4A 2ODPA 3IG6B 4IW4E 5DG6A 3ZVDA 1IQGA 2QC2A 4FUBA 1O2UA 2OINA 3N99A 4WF8A 1VGCB 1H8IH 3PMJA 1EOLA 1W8BH 1UTOA 4MNYA 4H6SB 4K1TA 1VGCC 5E8EH 2BB4A 1GI8B 3M7QA 2VU8E 3GDVA 1QNJA 4XE4A 1O32A 3SI4H 2ZHEH 1TRNA 3H09A 1ZMNA 4B2CA 1C5WB 2OP9A 4INHA 3F2HA 1FX0B 3EE7A 1O5DH 1PJPA 2FX4A 3SUEA 5EIYA 4JYVH 4XBCA 3Q3XA 4Q7XA 1Z8GA 4YM9A 2TGAA 2GJGA 1P57B 3K2UA 2A45B 3P8NA 3WWFA 2HNTE 1A7SA 3GY2A 2Y7XA 3L6PA 3E0PB 1O3MA 1C2MA 1SI5H 3V3MA 4Y8XA 1INCA 1BMLA 1OS8A 2JJ1D 5E0JA 1GJAB 2BZAA 3K65B 4DIHH 3KEEA 1A61H 1BHXB 2KFWA 1O5AB 1BRUP 3TH3H
chains in the Genus database with same CATH topology
4OS4A 1CHGA 1SFQB 5EU8A 1F5KU 1GL0E 2BD8A 2AMQA 1BTWA 2VWLA 2KAIA 4E06H 1DICA 1UVOA 4F4OC 3MTYA 4XSKU 3NKKA 4BAMB 5JB8S 3ZVCA 3RUOA 2P3UB 2DE8A 4X8UH 2BLOA 2O8UA 4BTTB 4IN2A 3KQCA 1D3TB 1ZGVA 2ZKSA 4TWWA 1WU1A 1GHXH 2FZZA 2F9NA 4B2AA 2GT7A 2NU3E 1C9PA 1ZHRA 1HYLA 2XC4A 2ZF0H 1LHDH 2XBYA 1UO6A 1O5BB 1Z1IA 3TK5A 4ISHH 5HYOA 1ZSJA 2BD7A 1C2FA 1XUIA 1NRNH 2XWAA 5CE1A 1J9CH 1B5GH 1EZXC 1O2MA 5FX6A 3FANA 4TPIZ 3BTWE 3A7VA 3JZ2B 4LK4A 1NU9A 2XXLA 1O2GH 5E2OA 2VH0A 4IMZA 1AY6H 1K2I1 3KGPA 1AE5A 1MQ6A 1NT1A 1HCGA 3QTVH 4E7NA 5L2ZH 1CT0E 1GI6A 4U2WA 2GV7A 3MU0A 1B7XB 3TIUA 4AG2A 1Z6EA 3NZIA 3BTQE 2WPKS 1XXFA 2G00A 2JKHA 1E34B 4FUFA 2ZNKH 1HBTH 1O2OA 4FUEA 2HPPH 1QB6A 1P10A 4I7YH 3RU4D 3P17H 3L3TA 2FOHA 3QX5H 2ZGJA 1G3BA 5GXPA 4DG4A 1AN1E 1QHRB 2ZC9H 3M61U 2STBE 2PKAA 5ESBA 1GCDA 1TONA 2PTNA 1J15A 2FYQA 3JZ1B 2VINA 1TB6H 3MU8A 4MLFB 3SNBA 5EW1H 1AQ7A 3AAVA 1HAVB 2CXVA 3RMOH 3LGVA 1NZQH 5IYTA 3S9AA 5HMAA 3F9HA 5FPSA 2ZU4A 1TQ0B 4WXIA 4GUXA 1Q3XA 3QLPH 3EDXB 3QGNB 4CR9A 1O2TA 1DSTA 4WH8A 2BD2A 4NIWA 2ALVA 1SQAA 3S9BA 2G5NA 1L4DA 2GCHG 2H9EH 3LGTA 2I6QA 2O8LA 5F8ZA 4Q80A 3M5NA 1FPCH 1H9IE 2W3KA 3SJIA 3MOCA 3U69H 4JZEH 4Y0YE 2NU4E 4WWYA 1FAKH 1Z6JH 1Z8IB 1BBRE 4VGCC 1AMHA 1G32B 1GHAG 4AGKA 2SGDE 3SU5A 1GHBF 1A3EH 1O30A 3PTBA 1GPZA 1L1GA 4ISIH 3QO6A 3I29A 1BOQA 3EE0B 3UR6A 3BTME 3UQOA 2Y5HA 4ASHA 1HAOH 4KKDA 1LVOA 3LJJA 1C2HA 4A5TS 1CGHA 3EA8A 3TPIZ 4CBNA 1UTMA 1T4UH 4X0WU 1ZMJA 1HJAC 1T8MA 1YPHC 2D26C 2PUXB 3VB3A 3Q77A 5H4IB 4AFUA 5JBAS 3ZZDA 1UK2A 3VB4A 1Y3XA 4Q7YA 3VXEH 1O34A 5DP9A 1P05A 1VITH 1QRWA 1PPFE 1AFQB 3O8RA 2DUCA 4WH6A 4I8GA 4CRGA 3LONA 1ELTA 4E7RG 1P9UA 4YESB 1AI8H 5DP4A 3HPTB 1AVGH 1NFUA 1NM6A 3BG4B 1UTJA 4ABHA 4NIYA 1V2VT 3A8AA 3TNSA 1K1MA 4GLYA 3TITA 2PSXA 2O8MA 4AN7A 4BAKB 3SV6A 2RDLA 1SGFA 2G81E 4U30A 1QA7A 1T31A 1BHXF 2BXTH 1V2PT 1QFKH 1YGCH 3A8CA 1Q31A 3TGKE 4Y10E 5E2PA 2VJ1A 1FJSA 3AAUA 5AF9H 5EW2H 1A0LA 1GBHA 4ABFA 3QUMP 4MQAA 1UCYH 1DY9A 2H9HA 2H5CA 5DGJA 1LKAA 2A0QB 4NIVA 1GWAA 1BT7A 2WPMS 4OGXA 2Z9JA 3KF2A 1JIMA 1L4ZA 3BSQA 3KQBA 3RXLA 3F68H 1LPKB 2GCHF 5AFZH 2O8WA 4CRDA 1GI4A 3ZZ6A 1WTGH 5T6GA 1C2IA 5EPYA 3KL6A 2CF9H 1T4VH 3LIWA 1C1NA 1S82A 3UNQA 4KELA 5FAHA 3GY3A 4MTBA 4LOYH 1OOKB 2UUKB 4ZHAA 1IQMA 1JBUH 2QN5T 1J8AA 1XUGA 1TX8A 1Y3WA 1A5IA 4I31A 2O8TA 6LPRA 1FIZA 1QA0A 3EYDA 1TYNA 3RXGA 3P8OA 5HM9A 1GVLA 4BAQB 3BV9B 3OY5U 1NRQH 4FUCA 1NFWA 1AIXH 2ZWLH 1KIGH 5F03A 1BTZA 5FX5A 2BX3A 1AFEH 1PYTC 1PPCE 3ZZ3A 3HK3B 3P92A 1FY8E 2P95A 1O38A 2A31A 2QXIA 4O3TA 4PROA 2BTCE 5EG4A 2J2UA 4M7GA 1GVZA 3G01A 3SJOA 1DT2A 1G3DA 2BDYA 1N8OB 1DITH 1XKAC 2ZDMA 4MNXA 3L33A 4YOIA 1HIAB 4JK6A 3GCTF 3PMAB 1AZ8A 2F3CE 4JK5A 2GDDA 2P59A 5DP6A 1S0QA 4CRFA 2VVUA 2YNAA 1MD7A 3FZZA 2FOFA 3PLKA 3ZZ7A 3A8BA 2VWNA 3GOVB 3C27B 1GBKA 2VWMA 2Z3CA 4MDSA 4Y11E 2UWOA 2BY5X 1O3HA 1GDQA 5FBEA 1GG6B 1LPGB 1XUFA 3LC5A 1AUTC 2PKSC 1JMOH 2A4GA 3GCHB 4FU7A 4FUHA 2V3HH 3DA9B 1D3PB 3GYMA 3LGWA 4IBLH 3RXSA 3TLOA 4BANB 1ANDA 3R3GB 1ZJDA 1C5UA 1HPGA 2AH4X 3GCHC 3B9FH 1FN6A 1LHEH 1AB9B 5LPRA 1UTNA 1FI8A 3QTOH 2ZCKP 1C5YB 2ALPA 2J94A 1D4PB 1P2MA 1TRMA 4J2YB 2CGAA 4X2YA 2A7CA 2ZHDA 2FO9A 1OXGA 3ELAH 2B5TB 1S85A 3SU3A 3BTKE 5DO4H 2F9UA 2GCTB 1SLWB 3OX7U 4Y6DA 1FZZA 3A89A 1MKWH 4FXGH 1FV9A 1O2VA 1J17T 6GCHF 1G36A 1O31A 1UVSH 1C4U2 2BVSH 4K69A 4OS1A 3QZRA 4YO9A 7GCHF 1Z8RA 4JYTA 2GZ8A 3RMNH 1LVYA 2AGGX 1IHSH 1SHHB 1KXEA 1BMAA 4CRCA 2GZ7A 1TA6A 2SFAA 4QT8C 1A2CH 1C1PA 4SGAE 2PGBB 4D9QA 4X2VA 1MAXA 1IAUA 1OP2A 4CHAB 1Y5BT 3GICB 2ZPQA 1FN8A 3GDUA 1W10U 1HAIH 1DX5M 2FODA 2FI4E 1EPTB 1K28D 4ZXXH 1QURH 2OC0A 1QQ4A 1A46H 1MU8B 1Y8TA 1V3XA 3ATKA 4ZUHA 1YPJH 1C1MA 1GHYH 1YYY1 4I8HA 1HLTH 3E91A 1VJ9U 1LQDB 1DOJA 3V12A 1B0EA 2ZHFH 4I8KA 1IHTH 2B9LA 3GCOA 5C5NA 4K2YA 2CHAC 1FMGA 1QCPA 2WPHS 2Z3EA 2BZ6H 4Z0KA 1C5NH 1EX3A 2G4TA 2QIQA 3PLPA 4UD9H 4UFEH 1H1BA 1P3CA 2BDHA 3M35A 1A0JA 3UY9A 9ESTA 5LGOA 4CH8B 4AFQA 2BLVA 1LHGH 5T3HA 4XOJA 2WUCA 2YNBA 4RSPA 2BY6X 2J4IA 1XVMA 5ABWA 1KDQA 1C4Y2 1C5SA 3UIRA 5C1XA 1GMDF 1CQQA 1V2TT 2GDEH 2NU2E 2VWOA 1KXCA 1SGYE 5JBTA 1O2NA 2TPIZ 1UVUH 3BTHE 1T8NA 2EI6A 5C67A 4BTIB 1N1LA 2ZPRA 3RXQA 1O5CB 3M5MA 2H2ZA 1C5XB 1C1SA 2VVCA 3MNXA 5GCHG 3RXDA 3BTGE 3UR9A 1EKBB 2R0LA 3BTDE 2ZFSA 2ZHWH 3ATMA 3SN8A 1YPLH 2WPLS 2WYGA 3ZZ4A 3SU2A 1TBQH 3ATWA 3PWCA 4D7GA 4AB8A 5JBBS 3ODDA 1SHYA 3IITA 2R9PA 2W7SA 1F7ZA 4RN6A 2FIRH 3GDSA 1P2IA 1O3CA 2V6NA 1OYQA 1EASA 1GGDC 1ZR0A 1DE7H 1P2OA 4FVDA 4WY3A 4DJZB 1MKXK 1O2IA 2FM2A 2ZGBH 4Y71A 3SU6A 1O2LA 3N7OA 4NFFA 1O3KA 1WQSA 4K5ZA 3NPSA 1S0RA 1QIXB 3UOPA 1ZOMA 1OWHA 2AMPA 1GMCF 1BMNH 2Z6BD 3RXHA 5FCKA 2Q6DA 3RXBA 1HNEE 4ABAA 1J14A 1C1TA 2P8OC 3SOSA 1IOEA 3O8BA 3FVFB 3VEQB 3PLBA 3AASA 5CHAB 1HAVA 1P04A 1O2QA 2TIOA 4A1XA 4DOQA 1HAGE 4KTUA 5JPMH 1LTOA 2NWNA 1C1RA 5CHAC 1CE5A 4UFFH 1E37B 2FEQH 3RU4T 1QR3E 1SLUB 2P3FH 1TGCA 1Y3VA 1TMBH 1HAPH 1SQOA 1G2MA 1G3EA 1UTLM 1P01A 2UUJB 2ODQA 3QDZB 1FONA 4AB9A 4YT6H 1C1WH 4HTCH 1MD8A 2FOCA 5DK1A 3T27A 3SBKA 1GBDA 1B0FA 4UDWH 3RP2A 1CBWC 1QBVH 1C5ZB 3KQEA 3UQVA 1P06A 3VB7A 1UJ1A 3TJVA 2OLGA 2RCEA 1J16A 1RJXB 3O8CA 1ELBA 3F1SB 1BUIA 3SW2B 3RXEA 3ESTA 2BOKA 1UTQA 2BLQA 2XC5A 3WY8A 3FP8E 4E05H 3URDA 1H8DH 3HKIB 2P93A 4A92A 2WYJA 4O97A 2FESH 1RRKA 2ZP0H 8GCHF 1XKBC 1EZQA 2BY7X 1YCPH 1S6HA 2PW8H 3VGCC 1FY1A 1DSUA 2HGTH 3V0XA 5PTPA 1VITF 2WINI 1RIWC 1E38B 2OD3B 3UNSA 3ODFA 1V2WT 2ILNA 4U32A 2SGAA 1KDQB 1HV7A 3BEFB 3U8OH 3LC3A 1NTPA 3MH5A 1E36B 1BBRK 3SUFA 1TIOA 5JYIA 3SUGA 1K1NA 3NWUA 3P8FA 1MTUA 3SO3A 4IGDA 4MPVA 1BCUH 3RC5A 3ZVEA 5C5OA 3HGNA 3H7OA 1MBQA 2ZU5A 2C8WB 4FUJA 1EJAA 1K1LA 2C3SA 3KIDU 3T5FH 2AIPA 1THRH 3MWIU 3P70B 5GDSH 4GCHG 3SGQE 1V6DA 1JOUB 3STJA 1BDAA 1HB0B 3I77A 1Z1JA 3MH6A 3U98H 1ELFA 4HI3A 3O8DA 3HATH 4NGAH 1AVWA 1K1PA 1SGTA 1TOCB 1XUKA 2G55A 1ANEA 3A80A 2ZTXA 1O5FH 2ANKH 5ESTE 1G37A 4K8YA 1BTXA 1S81A 3Q3YA 1CSOE 2PFEA 1F92A 4HFPB 3U8RH 1F0RA 5HM2A 2ZTYA 5GPIB 1O2ZA 3RXMA 4JZDH 5A0BA 1GJ4H 2FPZA 5LPFA 3LGYA 4IN1A 1LQEA 3M3TA 4XBDA 4FUGA 1P2JA 4Y76A 1HFDA 4YOGA 5HXFA 3A84A 1UK3A 4X8TH 2BMGB 1V2NT 1EOJA 3OSYA 3V13A 4ZAEA 1GCTC 2XTTB 4Q7ZA 1ZPBA 5TCAA 3FZDA 2W5EA 1NESE 1GBCA 2PLXA 4NZLA 1AKSB 4XBBA 2DE9A 3PV4A 1OWKA 3GY5A 1ESBA 2BVXH 1GL1A 3F6UH 1CT2E 3PWBA 4VGCB 1G9IE 1GMHG 1UCYE 1WQVH 6CHAC 1SBWA 1YBWA 5FPYA 3MU1A 4OS5A 5FPTA 3M5LA 4DIIH 2A2QH 4ISNA 5A0AE 7KMEH 4INLA 1TABE 4Y79A 1SGIB 3A87A 2K1QA 1C5LH 1TWXB 2NU1E 3ITIA 3E6PH 1M9UA 1LO6A 1MKXH 1EB2A 1DPOA 3A7WA 1ZRBA 3SHCH 4WXVA 1GBMA 1TNIA 1CA0C 1HJAB 2Y6TA 3MO6A 1HRTH 1HIAA 2BY8X 2FTMA 1Y5AT 3CS7A 1CHOG 2A32A 2Q6FA 1UHBB 2ANWA 2QY0B 2SGPE 3P8GA 1SOZA 2BY9X 4GCHF 1AE8H 1RS0A 1P9SA 2Y81A 1FY3A 1PPEE 1T32A 1ZJKA 2A5AA 4O3UA 1Y5UT 3RXTA 3OTJE 1UMAH 3AW1A 3HK6B 2XCFA 1VCQA 4D9RA 3PMBB 1OWIA 3TK9A 3GY7A 3LH3A 1SFIA 2XBWA 1GI1A 3RXRA 1DDJA 4OGYA 2Q1JA 2J38A 3DHKH 1BTPA 2WUBA 4OS6A 5SGAE 1D3DB 1K1IA 5F8TA 1TGNA 1W11U 3SJKA 3SU1A 4ZHLU 3LU9B 3A8DA 1QL9A 1O3DA 3VXFH 8LPRA 1AGJA 4I33A 5ETXA 4K3JA 2UWPA 4I32A 4H42U 2W26A 4B73A 1SQTA 2FXRA 1SR5C 1OX1A 1JRTA 3RM0H 2GKVE 3SUDA 2M5TA 1OP8A 1ZHMA 2V3OH 2VGCC 1HJ8A 1NO9H 5EXMA 4B75A 1AVXA 1O2RA 1G3CA 4AFZA 3SV8A 2ZHQH 1O3PB 4X6NA 2AFQB 3SV9A 2TGTA 4X8VH 1PQAA 3T29A 2ZIQH 3MNBA 4ABBA 4AOQA 3T25A 1DS2E 1GJ7B 1ANCA 1P0SH 4X1PU 4IS5A 1AZZA 4UEHH 1P09A 2ZA5A 1ZPCA 1ZSKA 2NU0E 4GHQA 2A7JA 1N6YA 4WVPE 1GMHF 1A1RA 4FUDA 2ZCHP 1BBRH 1F0UA 2H5DA 3U8TH 3QK1A 1WSSH 3D23A 5LH8A 1W3CA 3TU7H 1BJUA 4RKJB 8ESTE 3SZNA 1GHAF 2Z3DA 4YLUA 1S5SA 2F9PA 2ESTE 2FTLE 1FAXA 5EOKA 2VIOA 3S69A 3SJ8A 1EPTA 6ESTA 3M7TA 2RG3A 3EQ0H 4MG3A 3HGPA 1OWDA 1W13U 1QJ1B 2A2XH 1EAIA 3A85A 1MAYA 1NRRH 1GHZA 1FXYA 3SGAE 3MO3A 4FU8A 3UPEA 1QB1A 1WAYB 3SV2H 3F9EA 1O33A 4O9VA 3A83A 1TBZH 2GMTC 2ASUB 2G4UA 1TPAE 1U6QA 1C1QA 2D8WA 3MU5A 1LHCH 2D1JA 1MBMA 2ZG0H 1YP9A 1GBAA 4R8TB 2CMYA 4ZROA 1DLEA 5JBCS 4DURA 1F5LA 1H9LB 1TPSA 2AERH 2OCVB 1C2LA 4ABEA 1E0FD 3M3VA 2QAAA 4ABGA 4NA8A 5E0GA