3VB3A

Crystal structure of sars-cov 3c-like protease in apo form
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
301
structure length
301
Chain Sequence
b'SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Design, synthesis and crystallographic analysis of nitrile-based broad-spectrum peptidomimetic inhibitors for coronavirus 3C-like proteases
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 82
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-12-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3vb3A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3vb3A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3vb3A02
2P95A 1IAUA 1O2RA 1AQ7A 5A8YA 4AB9A 1GWAA 4X6OA 1GBHA 4DURA 4BAQB 4KP0A 1S6FA 5C1YA 4E7RG 5ESBA 1O2PA 1JWTA 1ANDA 1RFNA 3MH5A 1TX6A 2LNCA 1VCWA 1A5IA 1MD8A 3KF2A 4NZQA 1C2DA 3OY5U 4B2CA 3EBNA 2CXVA 1AUTC 3I78A 2FEQH 2V3HH 1SGFG 3E0PB 1SQTA 2EI8A 1RJXB 1AKSA 2BVXH 1PPZA 2HLCA 3A7XA 4NG9H 2P3FH 3A7ZA 4B75A 1G32B 1ZSLA 1GVKB 2VIPA 5EPNA 4Q2KA 1FXYA 1QB6A 2UUFB 4NA9H 1ZHRA 1C1QA 1GMHG 1UTJA 3UNSA 4BTTB 1C1OA 4WY3A 3N7OA 3Q3YA 4Y8XA 3V7TA 4B71A 1ACBE 1YCPK 2ZTXA 1ETSH 4AGJA 3CS7A 3TK6A 1O3BA 1J14A 1ETTH 3P8GA 1OXGA 4Y7BA 3RXRA 2ZNKH 1Y5UT 3ZZBA 5GIBA 1IQHA 1IQJA 2VGCC 3DD2H 2BXTH 4MPXA 1P05A 1QQ4A 4NFFA 3B23B 1EAXA 3CS0A 3M3TA 3TPIZ 3BEUA 5GXPA 4DIIH 4O3TA 2UWPA 3HKJB 1BTUA 1XUFA 3NK8A 1K21H 5C5NA 4D7FA 1XXFA 2A1DB 5A0BA 1V2RT 4X1PU 2P59A 2P8OB 3TJNA 1FY8E 3L3TA 2NU3E 2PR3A 8GCHF 1P11E 1SB1H 1GBDA 3SNCA 1AFQC 2ZECA 2GDEH 1EP5A 1GI6A 3NWUA 1KXAA 2NU4E 2WPMS 1TPAE 1ELCA 2OXSA 2CJIA 4UFFH 5DP6A 3UIRA 2LPRA 1DWDH 1FQ3A 3PYHA 2GMTB 3SV2H 3RXLA 2BM2A 2OCVB 3D49H 1DE7H 1ORFA 2PSYA 2PKSB 1BA8B 2CF9H 2XBXA 2Z9JA 2JH0D 4WF8A 1NROH 2ZGHA 4AYYB 1SGRE 1TBRH 3SORA 3E3TA 4OS4A 1HAXB 2OLGA 3TGJE 3RXTA 2IPHA 4X6PA 1JRSA 2BDBA 2R9PA 3EYDA 3MYWA 5J4QA 1MZDA 4FUJA 2ZWLH 1F0RA 1ELTA 4CBNA 3PROA 1WUNH 1TLDA 2FWWA 1C1MA 1C5PA 2G81E 1GBLA 4YM9A 1D6WA 1CVWH 5GJ4B 4DW2U 3GY2A 3SV8A 1ELVA 2V3OH 1JBUH 2VB0A 2C4FH 1O2SA 2F9VA 1D3PB 3I77A 1V2NT 1FI8A 1V2PT 1O32A 1Z1IA 1YPKH 3LH3A 4ABGA 2XXLA 1GBCA 3RMNH 2JETB 1S82A 6LPRA 2VH6A 4FUIA 2Y6TA 3EQ0H 3ZZ4A 1DWEH 1MTVA 1W8BH 5JB9S 1HAZB 1O5CB 1TNJA 3EDXB 4X2WA 1N8OC 1HJAB 3ZZ5A 4I7YH 1AE8H 2P3UB 1O2NA 1T4UH 1THRH 4Y7AA 1VGCB 1ZHMA 5EW1H 1GGDB 2TGAA 2Z3EA 2EI7A 2CN0H 3ZZCA 2O8LA 2BD4A 1BRAA 3RMMH 1FNIA 1FV9A 9LPRA 3U98H 1ZR0A 1PPFE 2NU0E 1NS3A 2QAAA 3LJJA 2ZDNA 1ARBA 1CHOF 2J2UA 1AI8H 2HGTH 5JDUB 1MQ5A 2ZFTA 1F0TA 3UPEA 1MBMA 2TPIZ 1LTOA 1O3PB 2ZHQH 2A4RA 1GBJA 4HFPB 3DA9B 5JPMH 1MKWH 2WPIS 1ELDE 1O2MA 2VVUA 3LKWA 1SLVB 1IQIA 1Z8JB 2VH0A 4I8GA 3Q77A 1Y5BT 4IN2A 3UQOA 1GDUA 2O8UA 3QK1A 3RM0H 1LVYA 1E34B 4M7GA 3ZV8A 3F6UH 3UREA 1ZSJA 2R2WU 1HAOH 1ZMLA 1V2TT 1U6QA 3IITA 3BTME 1NRQH 2BZAA 3AASA 2BYAX 1BTHH 2GD4B 1DFPA 1KY9A 1O3EA 1UTNA 1BBRH 1V2OT 4WMDA 3Q76A 3ZVEA 3IG6B 1BDAA 1LPKB 1EX3A 1NRRH 2K1QA 4AFZA 4X8TH 1V2MT 4DVAU 4ABDA 1P10A 4OS1A 4ZUHA 2B5TB 1GHAF 2EEKA 2ZU1A 2J95A 3BIUH 3LGYA 6CHAC 1NRSH 4XDEA 2XWBI 1GDQA 1TYNA 1UTOA 4XBDA 1MKXK 3LIWA 1HYLA 2AIQA 1T32A 2GVFA 3M35A 4NFEA 1GL1A 2IJOB 4Z0KA 3V3MA 4FUGA 3A7WA 1HJ8A 1VJ9U 4UDWH 1V2JT 2ANMH 1TBQH 2VGCB 3QTOH 1TPSA 5T6GA 3S9BA 1RTFB 1IHTH 4X6MA 3LH1A 4UD9H 3NPSA 1EKBB 2R0KA 1EJMA 3QN7A 1TNHA 4Q80A 1C2GA 4K8YA 3SJKA 5EU8A 3TK9A 1FPCH 3UUZA 7ESTE 3FVFB 4A1VA 4BTIB 3F9FA 1WQSA 2SGPE 3H5CB 4I8JA 4OGXA 4ZKRU 1P2OA 5T6FA 1P01A 1GJCB 4QT8C 1QHRB 1GHWH 2XWAA 4B76A 1GBEA 5C20A 3UWJH 1CO7E 3VGCC 1MD7A 3ZVGA 2CGAA 3QGNB 4LXBH 1WBGB 1EZXC 2ZDMA 1BMMH 2XRCA 4KGAA 1WQVH 4B2BA 1T7CA 2A5KA 2G51A 5SGAE 2A4QA 3V0XA 2B0FA 2TGTA 4KTUA 3ZZ6A 1EJNA 1QJ7B 2OD3B 2PUXB 1PPEE 1ID5H 2GCTC 1ZPBA 1HXEH 1MTUA 1QBOA 2RCEA 1HJ9A 1ZJKA 1O5FH 1SSXA 1B7XB 5PTPA 1ZPCA 1IQLA 3UTUH 3PWBA 1P3EA 3SZNA 1O3HA 3HK3B 2ZGJA 4KTSA 1F0SA 1P12E 2VWMA 2BLQA 2F9BH 2DE8A 2ZGBH 4CH8B 2PKAA 1O2VA 3PWCA 4E7NA 3KIDU 3BF6H 4YOJA 1DM4B 1E0FD 2BY5X 1GJ9B 1OWEA 5I46H 1DXPA 1A2CH 3M36A 1SGIB 1WU1A 2F3CE 1O2HA 1EP6A 3P92A 5A0AE 1N8OB 4XE4A 1KLJH 8GCHG 3ZZAA 1DDJA 5EW2H 5DKMA 4MPUA 1DANH 3E8LA 3T27A 1TE0A 1HB0B 4TY7A 2A45B 2SNWA 1IQKA 4OGYA 4CREA 3LGIA 1A5HA 3A8CA 3RXVA 1TMTH 1W7XH 2BX4A 3SUEA 2PTNA 3RXQA 2FOBA 5HYOA 4ABAA 3S7KB 2QN5T 7GCHF 2GX4A 3Q00A 4MPWA 1Z6EA 4O03A 1L0ZA 3PO1C 5DP3A 3MNXA 3QUMP 1ESAA 3RXSA 1FIWA 5JYIA 3MFJA 5A8ZA 2ZTYA 2TBSA 2XW9A 3GY6A 2ZCKP 2W3IA 4K5ZA 4R0IA 3O8CA 3NZIA 4DCDA 3ZYEA 1PQAA 1LVOA 1BQYA 3P6ZB 4X0WU 4GSOA 5L2ZH 3RUOA 1PQ5A 1EZSC 1WYKA 5ESTE 1EAIA 1EOJA 4AG1A 2PW8H 3Q3XA 1O0DH 1NESE 2PTCE 5AF9H 2W26A 3ATMA 2SGFE 1YF4A 5DK1A 5TCAA 1YP9A 3T62A 3HATH 1NM6A 1QY6A 2A0QB 1GBMA 2OQ5A 2ZFSA 3L6PA 1VITF 1W7GH 4MNXA 1YCPH 1YPHC 1UK2A 2J92A 2H2ZA 2PFEA 6CHAB 3DT0H 2XC4A 2ZU3A 3MOCA 2BY7X 3ODDA 4WMEA 2WYJA 1P03A 4JZEH 5EXLA 1KSNA 1NN6A 1HAIH 2A5AA 3SU0A 3TJVA 1EZQA 3KQEA 4K69A 4XSKU 2ZGCA 4K1SA 2ZKSA 1OWIA 1VITH 1CHOG 1FDPA 2Y80A 3URDA 1C9PA 1WTGH 4BXWA 3SV9A 4FUEA 1IQGA 1RTLA 1QRXA 2FLRH 5AFZH 4ZHMU 4TPIZ 8LPRA 2PV9B 2D8WA 4YLQH 4ABJA 1QBNA 2XBWA 3M7UA 4O9VA 3ATLA 2FOFA 3P8NA 3RXAA 1C5MD 2AH4X 2GZ8A 1EAUA 3MO9A 2WPLS 4YESB 5C1UA 1VCQA 4TWYA 1C9TA 4Y0ZE 2WPHS 2EI6A 3EE0B 2XCFA 3GICB 5EOKA 1C5NH 3M7TA 2VINA 1HAYB 1BT7A 1S85A 4Y76A 1KTSB 1Y8TA 3TH3H 4CR5A 1P9UA 4FVDA 1NFXA 3VXFH 7KMEH 3VGCB 1XX9A 1QNJA 1C1RA 1YKTA 2YOLA 4NWKA 3T5FH 1SGYE 1DWCH 2ZHDA 1ZOMA 1FLEE 2C93B 4WH8A 1FIZA 2VJ1A 1QURH 3GYMA 3TNTA 1C2HA 4YT7H 1A0LA 2WINI 3TIUA 3K9XB 1O2TA 2AGEX 1C2JA 1C5TA 1IQEA 1OOKB 1YC0A 3U1IB 3UR6A 2GCTB 3ZZ3A 1GHAG 4THNH 4NIWA 1CGHA 3RXMA 1ZPZA 3BTWE 3LGUA 3SOSA 1SGEE 4AG2A 1VGCC 6GCHF 1CA0B 1FAXA 1FPHH 2ZGXH 3A8DA 2TRMA 4I8LA 2ILNA 3H7OA 1Q31A 3SGBE 2AS9A 5I25A 2AFQB 2ZQ1A 5FCRA 1AY6H 1BJVA 1KXDA 1DPOA 1P57B 1ZJDA 4WJG2 3BTTE 3QWCH 1DSTA 1OS8A 1GBFA 2WYGA 4Y8YA 3GCOA 3KQCA 1WTHD 2BD9A 2G8TA 2FOCA 4ZKNU 3SHCH 1CHGA 2OUAA 4AX9H 3PMJA 3RU4D 1BTWA 1UVPA 2ZFPH 5DP5A 2ZEBA 3A80A 2Z94A 1YYY1 1S84A 1C5SA 1YPHE 2ZC9H 2FODA 1NFWA 2QXJA 3BTDE 5EQRA 3U69H 3A89A 3QZQA 1A61H 4NA8A 4LZ4B 1XUKA 4IC6A 1MTNC 2BD7A 1KDQB 3T28A 1C5ZB 2KAIB 1RIWC 3MTYA 2BTCE 1CSOE 2O8TA 1KXEA 3PO1B 3RXEA 1YPMH 1OWKA 2V6NA 3NXPA 1O5EH 2XBVA 1TRMA 3KGPA 1QJ6B 1SL3A 1NC6A 1HXFH 4KKDA 1DT2A 1FN8A 3ZZ8A 1W13U 2ZHEH 1S0RA 1TNIA 3W94A 1EAWA 3CP7A 3VB6A 1BHXB 1HLTH 8KME2 1GI7B 1GBKA 1SLWB 1XXDA 2HWLB 2PHBA 3SU6A 2H9HA 5FCKA 1AWHB 1BZXE 3LC3A 3OX7U 3SV6A 5EXMA 2OBOA 1SGTA 1BITA 1DITH 1QFKH 1WV7H 3A7YA 2G5VA 4XOJA 1M9UA 2XNIA 2BVRH 1LHEH 1THSH 1ZRBA 6ESTA 2AIPA 4X1RU 3ESTA 3SU1A 1SBWA 2CV3A 4UFEH 4BNRA 3LGTA 5DJ7A 1MQ6A 3ZZ7A 2BQ6B 1ESTA 4ASHA 2D2DA 1AO5A 3UNQA 1EB2A 1LDTT 2ZHFH 3P95A 1BRCE 3RC6A 1MKXH 2H5CA 4ZROA 1K1LA 1YLCA 2FM2A 1O2GH 4MTBA 1TPOA 3SUFA 3MH4A 1TB6H 4OS7A 1O3LA 2VVCA 3TJUA 1VR1H 4GVUA 4PROA 7GCHG 2UWLA 1AZZA 1GI1A 1O38A 1DUEA 2ASUB 1ELBA 4D76A 1VZQH 2Y5GA 3PLPA 4LK4A 1SG8B 4B73A 4WXIA 1L4DA 1TA2A 1GHXH 3HPTB 5JBBS 1TNKA 4ISHH 3T26A 2FI3E 1B0FA 2WUBA 1GI4A 1MAYA 1RGQA 1C1WH 3QGJA 4LOYH 4UFGH 3SO3A 1TOMH 2EA3A 2I6SA 1PFXC 9ESTA 3HKIB 4HGCA 3PTBA 3QDZB 1Z7KA 4RSPA 5F6MA 1AU8A 4KTCA 3D23A 1FUJA 1BCUH 1JIRA 4YOIA 1FZZA 3A83A 3O8BA 1ZSKA 2BVSH 1UVOA 2VNTA 3RXIA 4JZFH 2GT8A 2RDLA 1PJPA 3KNXA 3UOUA 1O31A 3O8DA 1V2ST 4E06H 1Y3UA 1XM1A 5A0CA 1XMNB 1VITG 2J9NA 3DFLA 1WCZA 4Y79A 4X2YA 1O2LA 2P93A 2ZZUH 5G4BA 1YGCH 4K1TA 1LHGH 5AVDA 1TONA 5CE1A 1QRWA 1A4WH 3M5LA 1T8LA 1T8MA 2ANWA 3ZVFA 2OC1A 1S83A 3S9AA 3GCHC 3ZV9A 2FLBH 4UFDH 4GHTA 1F5RA 1LPGB 5E8EH 3MHWU 2O8MA 1P3CA 1NO9H 4B74A 3PLKA 2D1JA 1T31A 1V6DA 2H1UA 4Y8ZA 5LPEA 3SGAE 5A2MH 1HAPH 1EUFA 1J17T 2H5DA 3SJOA 3BTKE 3ENSB 2TIOA 2CHAC 2ZFQH 1O3OA 8ESTE 2G52A 2AEIH 4CRDA 3DUXH 4B2AA 4U01A 5K0HA 1K1MA 4YZUA 5B6OA 2JH6D 4MNYA 2ZIQH 4ZHLU 3IWMA 3JZ1B 1AIXH 1C2LA 2Q6GA 1MU8B 2BOKA 4NSYA 1W0YH 2PUQH 1HAVB 3FZZA 1BUIA 2Z9LA 2GV7A 2BXUH 1IQFA 2R3UA 4NCYA 1UTKA 2FIRH 1DY9A 1MTNB 1SHYA 1QIXB 1RIWB 1AFEH 3TU7H 3ZVBA 2VIQA 1S0QA 5FHTA 1O2QA 1P04A 3BTHE 4Y11E 1DICA 3C27B 1O5AB 5C1XA 4INHA 4ZKSU 4ABBA 1YLDA 5T6DA 2ODQA 1D3TB 3MH6A 2AGIX 1MBQA 3MH7A 3R0FA 2BDIA 1SVPA 2QA9E 1Y3VA 1Q2WA 2Z9KA 2Z6BD 1NY22 1O30A 4JYVH 3U9AH 3AAVA 1G3DA 1W10U 3D65E 1GI0A 5JBCS 2A2XH 6GCHG 2GCHF 2H9EH 4GLYA 3H7TA 2YNAA 4AFSA 3RM2H 1C1UH 1UCYH 4BANB 2OINA 3SJ8A 1O3IA 4ZAEA 3PMAB 2BD8A 2NWNA 2ZO3H 3VEQB 2EC9H 1P06A 4SGAE 4TWWA 5A8XA 3F9GA 1F7ZA 3MO6A 1O2YA 3LGWA 1H9LB 3SU2A 1PPBH 1SR5C 2ZU5A 2ANKH 3A86A 5DPAA 1Y3YA 2BLOA 1P02A 1DY8A 3MNBA 1V2QT 1HNEE 2VU8E 3A87A 3MU0A 3U8RH 1G3CA 1Z8GA 2J4IA 1G3BA 1C1SA 1ELFA 3GY3A 3MWIU 3RXFA 2A7JA 1EB1H 1A0HB 1LQDB 1TIOA 1V2KT 3LU9B 3DFJA 1GI8B 3GOVB 1CQQA 4AGKA 3UY9A 2GGVB 1H9IE 3E6PH 4FU8A 5GPIB 2H9TH 1NT1A 2BDYA 1BTPA 3ELAH 3ITIA 3SN8A 1OX1A 1O2JA 4IN1A 2C90B 4I33A 5E0JA 1P8VC 2XC5A 1VCPA 5T3HA 3RXHA 3F9EA 1PPGE 2ZDVH 4BAMB 4DY7B 1BRUP 5LGOA 3L33A 3RXBA 3HK6B 1JOUB 1W11U 2Y81A 1LHFH 1UTQA 4JZ1A 5IDKA 1KLTA 5L2YH 2WPJS 3GY7A 4MNWA 1YM0A 1CA0C 5FAHA 1YCPM 2FDAA 4WVPE 2GP9B 4FU9A 2ZDAH 1DX5M 1V3XA 1KYNA 2OP9A 3VB4A 2PGBB 2BMGB 1C4Y2 2VVVA 1XUHA 2G5NA 1LPZB 1K2I1 2CF8H 1BHXF 4WMFA 2OC7A 1WAYB 4O97A 2FX4A 1O39A 3A7TA 1HPGA 3FP6E 1OP0A 3TLOA 1FY3A 4BXSA 1J15A 1TALA 3EA9A 3QLPH 3GCHB 4Y0YE 5FBEA 3KN2A 1B5GH 3V13A 1P09A 1HCGA 2F83A 1KTTB 2ZFRH 4ISLA 2AMDA 1UK4A 3SNEA 4OS2A 3R3GB 1T8OA 2GDDA 3QZRA 4ISIH 5E0GA 1P9SA 1MTSA 1C2IA 4B1TA 4ZMAH 1J9CH 1N6XA 4DJZB 2CHAB 4NIVA 2F9PA 3A84A 1F5LA 4RKOB 1HBTH 1AWFH 3BTQE 3B9FH 2HPPH 1UK3A 1KDQA 4Y10E 2VIVA 3M3SA 3P70B 1J16A 1Z1JA 4K60A 1H4WA 2I6QA 1CGIE 7LPRA 1ZZZA 4MNVA 3SI3H 5A09A 3SUGA 1OYQA 3B8JA 5DP9A 3D62A 1O2XA 2B9LA 4TY6A 4FVBA 4YO9A 1SHHB 1ZTLA 4NWLA 2BY8X 4FUFA 4MDSA 3A7VA 1OWDA 1ZTKA 1BBRE 2FOMB 1OPHB 3ATWA 1V2WT 3U8TH 1ANEA 1GI9B 2FESH 1ZGVA 2IN2A 2Y7ZA 1O35A 2BDAA 4DGJA 1SLXB 1B0EA 1GBBA 2ZPSA 4FUCA 3RXGA 3T2NA 5F8XA 2ZG0H 3Q3KA 1G9IE 1UCYE 1AVXA 1EATA 2R0LA 3M3VA 2XBYA 1G3EA 1MAXA 1AB9C 1E36B 3A8BA 2BOHB 1X7AC 3U8OH 1EASA 2JKHA 3MMGA 3MNCA 1HRTH 5CHAC 1TX8A 1C5LH 1XVOA 1Z8IB 3RC4A 3A82A 2UUJB 1GMDG 3LJOA 2FOGA 5L30H 3KQDA 2BDCA 3SV7A 3GY5A 1TRYA 3ZZ9A 3TGIE 2Y5FA 1QL8A 4UEHH 2ALPA 4MLFB 4NIYA 2Z3DA 1YBWA 3F9HA 2GZ7A 1DS2E 2F91A 5IYTA 1INCA 1TNGA 2W3KA 1EPTC 1NU7B 5E0HA 3STIA 4F49A 2UUKB 2FP7B 2FI5E 2R3YA 2ODYB 2ZDKA 2OC8A 5E2OA 4CRAA 5HMAA 3QTVH 2HOBA 1QA0A 1K1JA 3A81A 4ZHAA 4MVNA 3BTEE 1LCYA 3RXCA 1Z8RA 2Z9GA 1Z71A 4D7GA 4X2VA 1DVAH 2G55A 2HALA 2V0BA 4I8KA 1FJSA 2C8XB 2VIOA 4JCNA 5H4IB 4BAHB 2BD3A 3SQEE 2QIQA 1SGDE 4IW4E 3EA8A 4GUXA 1HV7A 1GJDB 3NCLA 2ZPRA 2STAE 5TCCA 1UTPA 3LT3A 3RLWH 3NUMA 2C8YB 2RG3A 1SGQE 4TYDA 5EODA 1ZTJA 1LVMA 1GBAA 2GCHG 1Z6JH 2Y5HA 1OWHA 3M61U 4ZXXH 3BG8A 2Z9IA 1E37B 1S5SA 4CBOA 1RS0A 1BMLA 3UNRA 3UWIA 1FMGA 5AFYH 5JBTA 1A46H 3PV4A 3PTNA 2SFAA 3SW2B 3RU4T 1CT2E 3AAUA 3KQBA 3RXOA 4XFQA 1UJ1A 3GISB 1ZLRA 4NZLA 2Q6FA 1MMJN 3SUDA 1ZMJA 3FFGA 3GCNA 3GY4A 1AD8H 2UWOA 1S6HA 1ABJH 4Q7XA 4IBLH 1TNLA 1NPMA 2W5EA 1G37A 4CRFA 1Q3XA 2IOTA 1DWBH 4ABHA 2O8WA 4FU7A 4UE7H 1IQMA 4K8BA 3TJOA 2C3SA 1BOQA 3M5MA 3MO3A 3ATKA 3RP2A 2THFB 3FZDA 2XC0A 1Y3WA 3BV9B 1C5YB 1O2UA 2FOHA 2HNTC 2QXHA 1LVBA 4O3UA 4NIXA 4X1SU 2VIWA 2QF0A 4IMQA 4FUBA 2QY0B 4CR9A 5EG4A 5DO4H 1HAVA 4K2YA 1GPZA 1GHZA 2SNVA 2C8WB 4FUHA 2FYQA 3MI4A 1EXFA 1CT4E 3GCTF 1BMAA 3K6ZA 1NFUA 2FTLE 4VGCC 1TPPA 3KHVA 1O3CA 3E0NB 3GDSA 4OS5A 1C2MA 1GJAB 2NU2E 3FAOA 4A1XA 3ODFA 2BDGA 3A88A 3VB5A 2NU1E 4AN7A 5BRRE 1D4PB 1A3BH 1CE5A 1LKBA 1SC8U 1H1BA 2A4OA 3MU8A 1HGTH 3SGQE 1GJ7B 1BIOA 1GMCF 1TFXA 2VWNA 1EZUC 1ETRH 1P0SH 1YPEH 2A7HA 4WWYA 1C1PA 3W95A 5HGGA 1QA7A 5K7RA 1HIAB 1PYTC 2WPKS 5HM2A 2Y7XA 4NSVA 5E2PA 1P2IA 2FOAA 3LOXA 5FX6A 2ZU4A 1TGTA 1UHBB 2AERH 1LO6A 2P94A 1A5GH 4DG4A 3SNAA 4D9QA 1AB9B 2QXIA 4GPGA 2FX6A 2ZPQA 3GYLB 5CHAB 1AN1E 2HVXA 4XBCA 3E91A 1K1PA 2B8OH 3PLBA 4LZ1H 3BG4C 1O2IA 3E90B 1TGNA 2BZ6H 1O3NA 4J1YA 4AYVB 1ELGA 2OBQA 1C5XB 2XTTB 1GI5A 4KELA 4Y71A 5BPEA 3BEIB 2YNBA 1FONA 1TQ0B 2DE9A 2ZHWH 1F2SE 1UVTH 5DGJA 1MUEB 2QCYA 1GHYH 3RDZA 4AOQA 1VJAU 4JZDH 5EXNA 1FAKH 2A7CA 5DP4A 1O3JA 1BTXA 1EPTB 1WSSH 2FYRA 4JYTA 1QB1A 3AW1A 4IC5A 4JZIA 3G01A 3MU4A 1NTPA 1GI3A 1GHBG 3JZ2B 2ZDLA 2SGEE 2WUCA 1V2UT 3BEFB 1DOJA 1PPCE 1GVLA 3M7QA 1G2LA 3ZVAA 1FN6A 1ZYOA 4H42U 1QRZA 2Z7FE 1BTZA 1ANBA 2HNTE 2O9QA 4D8NA 1W12U 4K3JA 4HTCH 3UOPA 2FXRA 4Y6DA 1XUGA 1GI2A 3RMOH 2ZP0H 3LC5A 5FX5A 5C3NA 1CU1A 3SU5A 1GL0E 3LDXH 3RXJA 1GCTB 1TWXB 3M5OA 2RA3A 3OTJE 1YPLH 5JB8S 4IS5A 1K1OA 4RN6A 2GV6A 2GZ9A 3VB3A 1MZAA 1OP2A 3S0NA 1N6YA 4AORA 2Z3CA 1TMBH 1O2KA 2A5IA 4Z6AH 1SOZA 1NZQH 1UMAH 3SJ9A 1C1NA 1CT0E 2ZCHP 4MG3A 1XKAC 1AZ8A 2BX3A 2QC2A 3GDUA 1JMOH 1K1IA 1C2FA 4BAOB 1GMDF 1OKXA 2PSXA 1TABE 3URCA 3K6YA 4DOQA 1C5QA 2A4GA 3PMHB 3PMBB 3T29A 1RXPA 1GJ4H 1PPHE 5TJXA 1ELAA 4X6NA 4CRCA 1SGPE 2TGDA 1RTKA 4A5TS 1GDNA 3A8AA 3SQHE 3KEEA 1QTFA 1ZHPA 5HXFA 3CENA 2STBE 1Y3XA 1ANCA 1SFIA 4AB8A 1LHDH 2ZU2A 3TK5A 5JBAS 4ABEA 5CMXH 2XYAA 1H9HE 1THPB 3UR9A 1GHVH 1GCDA 1O3KA 2ESTE 2BD2A 3K2UA 4GCHF 1A0JA 1L2EA 1O33A 2QF3A 4INLA 4VGCB 5EQSA 2PGQB 1LHCH 1TQ7B 1C4V2 2F9NA 3TH2H 2SGQE 1QR3E 1ELEE 2GKVE 1HDTH 4GAWA 5ABWA 5GWZA 2WV5A 2FTMA 1OP8A 1TRNA 3T25A 2Q6DA 3FP8E 1AKSB 2ANYA 4RKJB 4FXGH 1NRPH 4ZKOU 4AZ2B 1BJUA 3KCGH 1XUJA 1K9OE 1TGCA 1D9IA 2M5TA 1CGJE 1QJ1B 2A31A 3SU4A 2FOEA 3VFEA 2V35A 4WH6A 2FZZA 1GVZA 1DUAA 4JK5A 5FPTA 1FY4A 3RXPA 2AMPA 2SGAA 2ZFFH 1DXWA 4WXVA 5EGMA 5GCHF 1ZGIA 1P2NA 2BLWA 1O2WA 1D6RA 3LPRA 3BIVH 5DP8A 1QBVH 1O3GA 1QB9A 2BY6X 5C67A 5C2ZA 4A7IB 1C1TA 2BQ7B 2G00A 1K1NA 4ZH8A 5LPFA 3TGKE 4AFQA 1BTYA 3BG4B 1O5DH 2Y82A 1FY1A 1SMFE 3F1SB 4X2XA 3HGNA 4E05H 2B7DH 5FXLA 1C2KA 2BDHA 1F92A 1GG6C 3ZVDA 1NRNH 4JK6A 1A3EH 3TVJB 3K65B 1GJBB 3VXEH 3SNDA 1G36A 1YPGH 2Q1JA 1UVUH 2P3TB 3GCTG 1GBIA 1T4VH 3F68H 1A7SA 2AYWA 1DLKB 3ZYDA 2PWXA 1SGNE 4BOHA 3LONA 3STJA 4AFUA 2GTBA 1P2QA 2D26C 1E35B 1LKAA 1V2LT 2J94A 1O5BB 4DT7B 2TGPZ 2BLVA 3EGKH 1AFQB 2W7UA 3SBKA 1ZMNA 4U32A 1C5VA 1DLEA 2ULLA 1O3FA 2R2MB 2A2QH 2SGDE 1Y5AT 3M37A 1GMCG 3FANA 5HM9A 2FO9A 4BAKB 1L1NA 4IMZA 1K22H 3TH4H 5J4SA 5GDSH 1WOFA 3GDVA 1PYTD 4H4FA 3O8RA 4GHQA 1C5WB 3BTFE 1NU9A 2ZF0H 4CRGA 5LPRA 1KIGH 1KXCA 2BD5A 1JIMA 3QX5H 4NA7A 1O37A 2VWLA 1P2KA 2ZA5A 1QQUA 1A1RA 4BTUB 3BSQA 1TBZH 4IGDA 1GJ5H 2OQUA 4YLUA 2DUCA 3SNBA 1ABIH 1BMNH 1H8IH 4CHAC 5F03A 4U2WA 1SQOA 1IHSH 2FS9A 3RMLH 1T8NA 2P16A 1J8AA 1AVGH 1IQNA 2AMQA 1GMHF 3QO6A 1O3DA 2BQWB 1OYTH 3WY8A 2AGGX 2PLXA 5ETXA 2HPQH 2FPZA 4X8SH 2VWOA 3TITA 1XVMA 3SJIA 1F0UA 1HAGE 2XCNA 1GBTA 1L1JA 1C5OH 1F5KU 1SPJA 5FPSA 3U1JB 1O36A 1TOCB 3PB1E 3M5NA 2GT7A 1O34A 3FP7E 1CBWC 3S9CA 2QV1A 4YT6H 1IOEA 4X8VH 1QL9A 2ZTZA 2HRVA 3VB7A 4X1NU 1G2MA 1MKWK 5AHGH 2KAIA 2ALVA 3AVZA 1AMHA 1SOTA 1W3CA 4NGAH 1C5UA 1HAHH 1GJ6A 1W14U 3OYPA 2H6MA 4Q7ZA 1SGFA 3LGVA 5LH8A 3MNSA 3OY6U 1N1LA 4A92A 1PQ8A 1GHBF 3RXDA 3ZZDA 4CH2B 1XKBC 4YOGA 1P2JA 1C4U2 1K28D 3OSYA 4I31A 2C8ZB 2J38A 3ZVCA 4A6LA 1SFQB 4ABIA 2ZI2H 5C5OA 1UVSH 3UFAA 3OU0A 1P2MA 1W0ZU 1AUJA 1BBRK 1MTWA 1TMUH 1RRKA 3HGPA 4FUDA 2K7XA 1S81A 1NFYA 4Q7YA 3P8FA 1W2KH 2F9OA 1HIAA 4X8UH 4HI3A 1MCVA 3RU4E 2ODPA 2QGRA 3RXKA 1DSUA 2RA0A 2F9UA 5EPYA 1UHBA 1UCYK 3S69A 1QCPA 4U30A 1TGBA 2G4TA 3VPKA 4UONA 3S7HB 1BRBE 1ESBA 1GJ8B 1TGSZ 3I29A 4INKA 5EQQA 4XBBA 1TAWA 2FI4E 2J34A 1YPJH 3ATIA 5FBIA 1SGCA 1TA6A 3SU3A 3TNSA 2BHGA 3E16B 1AGJA 4JYUH 3A85A 3V12A 5FPYA 1MCTA 1KXFA 2A32A 2P8OC 4I32A 2CMYA 3UQVA 3BN9A 4K1EA 4ISNA 1ZRKA 1EPTA 5L6NH 4TPYA 3EA7A 4ABFA 4I8HA 1C1VH 1UO6A 5F8ZA 3NKKA 4SGBE 3PM3A 3MU1A 4CRBA 1GG6B 1UTMA 1AHTH 3DHKH 4X1QU 4JMYA 2GMTC 4GCHG 5DG6A 1LMWB 3MU5A 2OC0A 2PKSC 1G30B 1O3MA 1O3AA 1JRTA 4MQAA 2ZCLP 1RD3B 1C2EA 1O5GH 2LIZA 2FMJA 1D3DB 4ZXYH 1GCTC 1AE5A 1ARCA 4J2YB 1EOLA 1FY5A 2HNTF 3RC5A 1D3QB 4MPVA 5F8TA 1E38B 4A1TA 3KL6A 2QXGA 1OWJA 1JXPA 1LQEA 4OS6A 1AVWA 1CA8B 1SQAA 2FS8A 3EAJA 3SI4H 1QGFA 2ZQ2A 3GY8A 1QL7A 4ISOA 1Y59T 1BB0B 1OSSA 1XUIA 4F4OC 4HZHA 2JH5D 1EQ9A 3RXUA 3SHAH 1O2OA 5GCHG 1SI5H 2JETC 1HFDA 1KLIH 2OTVA 4CHAB 1KXBA 2UUYA 1HUTH 4R8TB 1V2VT 1MH0A 3AW0A 1HJAC 1L4ZA 2W7SA 3RLYH 2PKAB 1L1GA 1TX7A 3P17H 1GGDC 3BTGE 3P8OA 1C5RA 4H6TA 2WV4A 1PQ7A 1UTLM 1MU6B 1SLUB 1EJAA 4H6SB 2BY9X 5DP7A 4DIHH 2G4UA 2QYIA 4YTAA 2BB4A 1CBWB 1O2ZA 4ESTE 4D9RA 2VIDA 3E1XB 3C1KA 1H8DH
chains in the Genus database with same CATH superfamily
2P95A 1IAUA 1O2RA 1AQ7A 5A8YA 4AB9A 1GWAA 4X6OA 1GBHA 4DURA 3PV2A 2LELA 4KP0A 1S6FA 4BAQB 5C1YA 4E7RG 5ESBA 1O2PA 1JWTA 1ANDA 1RFNA 3MH5A 1TX6A 2LNCA 1VCWA 4ACAA 1A5IA 1MD8A 3KF2A 4NZQA 1C2DA 3OY5U 4B2CA 3EBNA 2CXVA 1AUTC 4ASUD 3I78A 2FEQH 2V3HH 1SGFG 3E0PB 1SQTA 2EI8A 1RJXB 1AKSA 2WHXA 2BVXH 1PPZA 2HLCA 3A7XA 4NG9H 2P3FH 3A7ZA 4B75A 1G32B 1YLNA 1ZSLA 1GVKB 2VIPA 5EPNA 4Q2KA 1VKYA 2OK5A 1FXYA 1QB6A 2UUFB 4NA9H 1ZHRA 1C1QA 1GMHG 1UTJA 3UNSA 4BTTB 1C1OA 4WY3A 2QF5A 3N7OA 3Q3YA 4Y8XA 3V7TA 4B71A 1ACBE 1YCPK 4DT4A 2ZTXA 1ETSH 4AGJA 3CS7A 3TK6A 1O3BA 1J14A 5EJLA 4F55A 1ETTH 3P8GA 1OXGA 4Y7BA 3RXRA 2ZNKH 1Y5UT 3ZZBA 5GIBA 1IQHA 1IQJA 2VGCC 3DD2H 2BXTH 4MPXA 1P05A 1QQ4A 4NFFA 3B23B 1EAXA 3CS0A 3M3TA 3TPIZ 3BEUA 5GXPA 4DIIH 1SQRA 4O3TA 2UWPA 3HKJB 1BTUA 1XUFA 3NK8A 1K21H 5C5NA 4D7FA 1XXFA 2A1DB 5A0BA 1WDIA 1V2RT 4X1PU 4TSFD 2P59A 2P8OB 3TJNA 1FY8E 3L3TA 2NU3E 2PR3A 8GCHF 1P11E 1SB1H 1GBDA 2CK3D 3SNCA 1AFQC 2ZECA 2GDEH 1EP5A 1GI6A 3NWUA 1KXAA 2NU4E 2WPMS 1TPAE 1ELCA 2OXSA 2CJIA 4UFFH 5DP6A 3UIRA 2LPRA 1DWDH 1FQ3A 2KFWA 2GMTB 3PYHA 3SV2H 3RXLA 2BM2A 2OCVB 3D49H 1DE7H 3DSOA 1ORFA 2PSYA 2PKSB 1BA8B 2CF9H 2XBXA 2Z9JA 2JH0D 4WF8A 1NROH 2ZGHA 3DSGA 4AYYB 1SGRE 1TBRH 3SORA 3E3TA 4OS4A 1HAXB 2OLGA 3TGJE 3RXTA 2IPHA 4X6PA 1JRSA 2BDBA 2R9PA 3EYDA 3MYWA 5J4QA 1MZDA 4FUJA 2ZWLH 4RT0A 1F0RA 1ELTA 4CBNA 3PROA 1WUNH 1TLDA 2FWWA 1C1MA 1C5PA 2G81E 1GBLA 4YM9A 1D6WA 1CVWH 5GJ4B 4DW2U 3GY2A 3SV8A 1ELVA 2V3OH 1JBUH 2PP6A 2VB0A 2C4FH 1O2SA 2F9VA 1D3PB 3I77A 1V2NT 1FI8A 4Q63A 1V2PT 1O32A 1Z1IA 1YPKH 3LH3A 4ABGA 2XXLA 1GBCA 3RMNH 2JETB 1S82A 6LPRA 2VH6A 4FUIA 2Y6TA 3EQ0H 3ZZ4A 1DWEH 5C17A 1MTVA 1W8BH 2J97A 5JB9S 1HAZB 1O5CB 1TNJA 3EDXB 4X2WA 1N8OC 1HJAB 3ZZ5A 4I7YH 1AE8H 2P3UB 1O2NA 1T4UH 1THRH 4Y7AA 1VGCB 1ZHMA 5EW1H 1GGDB 2TGAA 2Z3EA 2EI7A 2CN0H 3ZZCA 2O8LA 2BD4A 1BRAA 3RMMH 1FNIA 1FV9A 9LPRA 3U98H 1ZR0A 1PPFE 2NU0E 1NS3A 2QAAA 3LJJA 2ZDNA 1ARBA 1CHOF 2J2UA 1AI8H 2HGTH 5JDUB 4XRNA 1MQ5A 2ZFTA 1F0TA 3UPEA 1MBMA 2TPIZ 1LTOA 1O3PB 2ZHQH 2A4RA 1GBJA 4HFPB 3DA9B 5JPMH 1MKWH 2WPIS 1ELDE 1O2MA 2VVUA 3LKWA 1SLVB 1IQIA 1Z8JB 2VH0A 4I8GA 3Q77A 1Y5BT 4IN2A 3UQOA 1GDUA 2O8UA 3QK1A 3RM0H 1LVYA 1E34B 4M7GA 3ZV8A 4B6FA 3F6UH 3OFND 3UREA 1ZSJA 2R2WU 1HAOH 1ZMLA 1V2TT 1U6QA 3IITA 3BTME 1NRQH 2BZAA 3AASA 2BYAX 1BTHH 1DFPA 1KY9A 2GD4B 1O3EA 1UTNA 1BBRH 1V2OT 4WMDA 3Q76A 3ZVEA 3IG6B 1BDAA 1LPKB 1EX3A 1NRRH 2K1QA 4AFZA 4X8TH 1V2MT 4DVAU 4ABDA 4TT3D 1P10A 4OS1A 3KYFA 4ZUHA 2B5TB 2HVYB 1GHAF 2EEKA 2ZU1A 2J95A 3BIUH 3LGYA 6CHAC 1NRSH 4XDEA 2XWBI 1GDQA 1TYNA 1UTOA 4XBDA 1MKXK 3LIWA 1HYLA 2AIQA 1T32A 2GVFA 3M35A 4NFEA 1GL1A 2IJOB 4Z0KA 3V3MA 4FUGA 3A7WA 1HJ8A 1VJ9U 4UDWH 1V2JT 2ANMH 1TBQH 2VGCB 3QTOH 1TPSA 5T6GA 3S9BA 1RTFB 1IHTH 4X6MA 3LH1A 4UD9H 3NPSA 1EKBB 2R0KA 2HLDD 1EJMA 3QN7A 1TNHA 4Q80A 1K0HA 1C2GA 4K8YA 3OEED 3SJKA 5EU8A 3TK9A 1FPCH 3UUZA 7ESTE 2GJGA 3FVFB 4A1VA 4BTIB 3F9FA 1WQSA 2SGPE 3H5CB 4I8JA 4OGXA 4ZKRU 1P2OA 5T6FA 1P01A 5HIZA 1GJCB 4QT8C 1QHRB 1GHWH 2XWAA 4B76A 1GBEA 5C20A 3UWJH 1CO7E 3VGCC 1MD7A 3ZVGA 2CGAA 3QGNB 4LXBH 1WBGB 1EZXC 2ZDMA 1BMMH 2XRCA 4KGAA 5HIYA 1WQVH 4B2BA 1T7CA 2A5KA 2G51A 5SGAE 2A4QA 3V0XA 2B0FA 2TGTA 4KTUA 3ZZ6A 1EJNA 1QJ7B 2OD3B 2PUXB 4ZCNA 1PPEE 1ID5H 1ZPBA 1HXEH 1MTUA 2GCTC 1QBOA 2RCEA 1HJ9A 1ZJKA 1O5FH 1SSXA 1B7XB 5PTPA 1ZPCA 1IQLA 3UTUH 3PWBA 1P3EA 3SZNA 3UB0A 1O3HA 3HK3B 2ZGJA 4KTSA 1F0SA 1P12E 2VWMA 2BLQA 2F9BH 2DE8A 2ZGBH 4CH8B 2PKAA 1O2VA 3PWCA 4E7NA 3KIDU 3BF6H 4YOJA 1DM4B 1E0FD 2BY5X 1GJ9B 1OWEA 5I46H 1DXPA 1A2CH 3M36A 1SGIB 1WU1A 2F3CE 1O2HA 1EP6A 3P92A 5A0AE 1N8OB 4XE4A 1KLJH 8GCHG 3ZZAA 1DDJA 5EW2H 5DKMA 4MPUA 1DANH 3E8LA 3T27A 1TE0A 1HB0B 4TY7A 2A45B 2SNWA 1IQKA 4OGYA 4CREA 3LGIA 1A5HA 3A8CA 3RXVA 1TMTH 1W7XH 2BX4A 3SUEA 2PTNA 3RXQA 2FOBA 5HYOA 4ABAA 3S7KB 2QN5T 2V3MA 2GX4A 7GCHF 3PRDA 3Q00A 4MPWA 1BMFD 1Z6EA 4O03A 1L0ZA 3PO1C 5T1VA 5DP3A 3MNXA 3QUMP 1ESAA 3RXSA 1FIWA 5JYIA 1WXRA 3MFJA 5A8ZA 2ZTYA 2TBSA 2XW9A 3GY6A 2ZCKP 2W3IA 4K5ZA 4R0IA 3O8CA 3NZIA 4DCDA 3ZYEA 1PQAA 1LVOA 1BQYA 3P6ZB 4X0WU 4GSOA 5L2ZH 3RUOA 1PQ5A 1EZSC 1WYKA 5ESTE 1EAIA 1EOJA 4AG1A 2PW8H 3Q3XA 1O0DH 1NESE 2PTCE 5AF9H 2W26A 3ATMA 2SGFE 1YF4A 5DK1A 5TCAA 1YP9A 3DCLA 3PRBA 3T62A 3HATH 1NM6A 1QY6A 2A0QB 1GBMA 2OQ5A 2ZFSA 3L6PA 1VITF 1W7GH 4MNXA 1YCPH 1YPHC 1UK2A 2J92A 2H2ZA 2PFEA 6CHAB 3DT0H 2XC4A 2ZU3A 3MOCA 2BY7X 3ODDA 4WMEA 2WYJA 1P03A 4JZEH 5EXLA 1KSNA 1NN6A 1HAIH 2A5AA 3SU0A 3TJVA 1EZQA 3KQEA 4K69A 4XSKU 2ZGCA 4K1SA 2ZKSA 2F4LA 1OWIA 1VITH 2RFKC 1CHOG 1FDPA 2Y80A 3URDA 1C9PA 1WTGH 4BXWA 3SV9A 4FUEA 1IQGA 1RTLA 1QRXA 2FLRH 5AFZH 4ZHMU 3WW7A 4TPIZ 8LPRA 2PV9B 2D8WA 4YLQH 4ABJA 1QBNA 2XBWA 3M7UA 4O9VA 3ATLA 2FOFA 3P8NA 3RXAA 1C5MD 2AH4X 2GZ8A 1EAUA 3MO9A 2WPLS 4YESB 5C1UA 1VCQA 4TWYA 1C9TA 4Y0ZE 2WPHS 2EI6A 3EE0B 2XCFA 3GICB 5EOKA 5C94A 1C5NH 3M7TA 2VINA 1HAYB 1BT7A 1S85A 4Y76A 1KTSB 1Y8TA 3TH3H 3FN8A 4CR5A 1P9UA 4FVDA 1NFXA 3VXFH 7KMEH 3VGCB 1XX9A 1QNJA 1C1RA 1YKTA 2YOLA 4NWKA 3T5FH 2WPDD 1SGYE 1DWCH 2ZHDA 1ZOMA 1FLEE 2C93B 4WH8A 1FIZA 2VJ1A 1QURH 3GYMA 3TNTA 1C2HA 4YT7H 1A0LA 2WINI 3TIUA 3K9XB 1O2TA 2AGEX 1C2JA 1C5TA 1IQEA 1OOKB 1YC0A 3U1IB 3UR6A 2GCTB 3ZZ3A 1GHAG 4THNH 4NIWA 1CGHA 3OEHD 3RXMA 1ZPZA 3BTWE 3LGUA 3SOSA 1SGEE 4AG2A 1VGCC 6GCHF 1CA0B 1FAXA 1FPHH 2ZGXH 3A8DA 2TRMA 4I8LA 2ILNA 3H7OA 1Q31A 3SGBE 2AS9A 5I25A 2AFQB 2ZQ1A 5FCRA 1AY6H 1BJVA 1KXDA 1DPOA 1P57B 1ZJDA 4RI0A 3MQKC 4WJG2 3BTTE 3QWCH 1DSTA 1OS8A 1GBFA 2WYGA 4Y8YA 3GCOA 3KQCA 1WTHD 2BD9A 2G8TA 2FOCA 4ZKNU 3SHCH 1CHGA 2OUAA 4AX9H 3PMJA 3RU4D 1BTWA 1UVPA 1H8HD 2ZFPH 5DP5A 2ZEBA 3A80A 3GS9A 2Z94A 1YYY1 1NBME 1S84A 1C5SA 1YPHE 2ZC9H 2FODA 1NFWA 2QXJA 3BTDE 5EQRA 3U69H 3A89A 3QZQA 1A61H 4NA8A 4LZ4B 1XUKA 4IC6A 4B6EA 1MTNC 2BD7A 1KDQB 3T28A 1C5ZB 2IPQX 2KAIB 3OAAD 1RIWC 4YXWD 3MTYA 2BTCE 1CSOE 2O8TA 3NRLA 1KXEA 3PO1B 4P00A 3RXEA 1YPMH 2JJ1D 1OWKA 2V6NA 3NXPA 1O5EH 2XBVA 5KGOA 1TRMA 3KGPA 1YY3A 1QJ6B 1SL3A 1NC6A 1HXFH 4KKDA 1DT2A 1FN8A 3ZZ8A 1W13U 2ZHEH 1S0RA 1TNIA 3W94A 3SZEA 1EAWA 3CP7A 3VB6A 1BHXB 1HLTH 8KME2 1GI7B 1GBKA 1SLWB 1XXDA 2HWLB 2PHBA 3SU6A 2H9HA 5FCKA 1AWHB 1BZXE 3LC3A 3OX7U 5IK2D 5EXMA 3SV6A 2OBOA 1SGTA 1BITA 5KEDA 1DITH 1QFKH 1WV7H 3OE7D 3A7YA 2G5VA 4XOJA 1M9UA 2XNIA 2BVRH 1LHEH 1THSH 1ZRBA 2IJD1 6ESTA 2AIPA 4X1RU 3ESTA 3SU1A 1SBWA 2CV3A 4UFEH 4BNRA 3LGTA 5DJ7A 1MQ6A 3ZZ7A 2BQ6B 1ESTA 4ASHA 2D2DA 2K0QA 1AO5A 5C0UA 3UNQA 1EB2A 1LDTT 2ZHFH 3P95A 1BRCE 3RC6A 1MKXH 2H5CA 4ZROA 1K1LA 3H09A 1YLCA 2FM2A 1O2GH 4MTBA 1TPOA 3SUFA 3MH4A 1TB6H 4OS7A 1O3LA 2VVCA 3TJUA 1VR1H 4GVUA 4PROA 7GCHG 2UWLA 1AZZA 1GI1A 1O38A 1DUEA 2W6ID 2ASUB 1ELBA 4D76A 1VZQH 2Y5GA 3PLPA 4LK4A 2EY4C 1SG8B 4B73A 4WXIA 1L4DA 1TA2A 1GHXH 3HPTB 5JBBS 1TNKA 4ISHH 3T26A 2FI3E 1B0FA 2WUBA 2KM0A 1GI4A 1MAYA 1RGQA 1C1WH 3QGJA 4LOYH 4UFGH 3SO3A 1TOMH 2EA3A 2I6SA 1PFXC 9ESTA 3HKIB 4HGCA 3PTBA 3QDZB 1Z7KA 4RSPA 5F6MA 1AU8A 4KTCA 3D23A 1FUJA 1BCUH 1JIRA 2V7QD 4YOIA 1FZZA 3A83A 3O8BA 5DN6D 1ZSKA 2BVSH 1UVOA 2VNTA 3RXIA 4JZFH 2GT8A 2RDLA 1PJPA 3KNXA 3UOUA 1O31A 3O8DA 1V2ST 4E06H 1Y3UA 1NBMD 1XM1A 5A0CA 1XMNB 1VITG 2J9NA 3DFLA 1WCZA 4Y79A 4X2YA 1O2LA 2P93A 2ZZUH 5G4BA 1YGCH 4K1TA 1LHGH 5AVDA 1TONA 5CE1A 1QRWA 1A4WH 3M5LA 1T8LA 1T8MA 2ANWA 3ZVFA 2OC1A 1S83A 3S9AA 3GCHC 3ZV9A 2FLBH 4UFDH 4GHTA 1F5RA 1LPGB 5E8EH 3MHWU 2O8MA 1P3CA 1NO9H 4B74A 3PLKA 2D1JA 1T31A 1V6DA 2H1UA 4Y8ZA 5LPEA 3SGAE 5A2MH 1HAPH 1EUFA 1J17T 2H5DA 3SJOA 3BTKE 3ENSB 2TIOA 2CHAC 2ZFQH 1O3OA 8ESTE 2G52A 2AEIH 4CRDA 3DUXH 4B2AA 4U01A 3SYJA 5K0HA 1K1MA 4YZUA 5B6OA 2JH6D 4MNYA 2ZIQH 4ZHLU 3IWMA 1EFRD 5EJ1A 3JZ1B 3CNRA 1AIXH 1C2LA 2Q6GA 1MU8B 2BOKA 4NSYA 1W0YH 2PUQH 1HAVB 3FZZA 1BUIA 3F0PA 2Z9LA 2GV7A 2BXUH 1IQFA 2R3UA 4NCYA 1UTKA 2FIRH 1DY9A 1MTNB 1SHYA 1QIXB 1RIWB 1AFEH 3TU7H 3ZVBA 2VIQA 1S0QA 5FHTA 1O2QA 1P04A 3BTHE 4Y11E 1DICA 3C27B 1O5AB 5C1XA 4INHA 4ZKSU 4ABBA 1YLDA 5T6DA 2ODQA 1D3TB 3MH6A 2AGIX 1MBQA 3MH7A 3R0FA 2BDIA 1SVPA 2QA9E 3F2FA 1Y3VA 1Q2WA 2Z9KA 2Z6BD 1NY22 1S6LA 1O30A 4JYVH 3U9AH 3AAVA 1G3DA 1W10U 3D65E 1GI0A 5JBCS 2A2XH 6GCHG 2GCHF 2H9EH 4GLYA 3H7TA 2YNAA 4AFSA 3RM2H 1C1UH 1UCYH 4BANB 2OINA 3SJ8A 1O3IA 4ZAEA 3PMAB 2BD8A 2NWNA 2ZO3H 3VEQB 2EC9H 1P06A 4SGAE 4TWWA 5A8XA 3F9GA 1F7ZA 3MO6A 1O2YA 4F48B 3LGWA 1H9LB 3SU2A 2LP6A 1PPBH 1SR5C 2ZU5A 2ANKH 3A86A 5DPAA 1Y3YA 2BLOA 1P02A 1DY8A 3MNBA 1V2QT 1HNEE 2VU8E 3A87A 3MU0A 3U8RH 1G3CA 1Z8GA 5HKKD 2J4IA 1G3BA 1C1SA 1ELFA 3GY3A 3MWIU 3RXFA 2A7JA 1EB1H 1A0HB 1LQDB 1TIOA 1W0JD 1V2KT 3LU9B 3DFJA 1GI8B 3GOVB 1CQQA 2L6OA 4AGKA 3UY9A 2GGVB 1H9IE 3E6PH 4FU8A 5GPIB 2H9TH 1NT1A 2BDYA 1BTPA 3ELAH 3ITIA 3SN8A 1OX1A 1O2JA 4IN1A 2C90B 1QZ8A 4I33A 5E0JA 1P8VC 5FL7D 2XC5A 1VCPA 5T3HA 3RXHA 3F9EA 1PPGE 2ZDVH 4BAMB 4DY7B 1BRUP 5LGOA 3L33A 3RXBA 3HK6B 1JOUB 1W11U 2Y81A 1LHFH 1UTQA 4JZ1A 5IDKA 1KLTA 5L2YH 2WPJS 3GY7A 4MNWA 1YM0A 1CA0C 5FAHA 1YCPM 2FDAA 4WVPE 2GP9B 4FU9A 2ZDAH 1DX5M 1V3XA 1KYNA 2OP9A 3VB4A 2PGBB 2BMGB 1C4Y2 2VVVA 1XUHA 2G5NA 1LPZB 1K2I1 2CF8H 1BHXF 4WMFA 2F43B 1WAYB 2OC7A 4O97A 2FX4A 1O39A 3A7TA 1HPGA 3FP6E 1OP0A 3WWFA 3TLOA 1FY3A 4BXSA 1J15A 1TALA 4AC9A 3EA9A 3QLPH 3GCHB 4Y0YE 5FBEA 3KN2A 1B5GH 3V13A 1P09A 2VBCA 1HCGA 2F83A 1KTTB 2ZFRH 4ISLA 2AMDA 1UK4A 3SNEA 4OS2A 3R3GB 1T8OA 2GDDA 3QZRA 4ISIH 5E0GA 1P9SA 1MTSA 1C2IA 4B1TA 4ZMAH 1J9CH 1N6XA 4DJZB 2CHAB 4NIVA 2F9PA 3A84A 1F5LA 4RKOB 1HBTH 1AWFH 3BTQE 4XD7D 1H8ED 3B9FH 2HPPH 1UK3A 1KDQA 4Y10E 2VIVA 3M3SA 3P70B 1J16A 1Z1JA 4K60A 1H4WA 2I6QA 1CGIE 7LPRA 1ZZZA 4MNVA 5C0TA 3N7EA 3SI3H 5A09A 3SUGA 1OYQA 3B8JA 5DP9A 3D62A 1O2XA 2B9LA 4TY6A 4FVBA 4YO9A 3W1EA 1SHHB 1ZTLA 4NWLA 2BY8X 1UW7A 4FUFA 4MDSA 2JJ2D 3A7VA 1OWDA 1ZTKA 1BBRE 2FOMB 2KCAA 3PV5A 1OPHB 5F53A 3ATWA 1V2WT 3U8TH 1ANEA 1GI9B 2FESH 1ZGVA 2IN2A 2Y7ZA 1O35A 2BDAA 4DGJA 1SLXB 1B0EA 1GBBA 2ZPSA 4FUCA 3RXGA 3T2NA 5F8XA 4FETA 2ZG0H 3Q3KA 1G9IE 1UCYE 1AVXA 1EATA 2R0LA 3M3VA 2XBYA 1G3EA 1MAXA 1AB9C 1E36B 3A8BA 2BOHB 1X7AC 3U8OH 1EASA 2JKHA 3MMGA 3MNCA 1HRTH 5CHAC 1TX8A 1C5LH 1XVOA 1Z8IB 3RC4A 3A82A 2UUJB 1GMDG 3LJOA 2FOGA 5L30H 2K8IA 3KQDA 2BDCA 3SV7A 3GY5A 1TRYA 1W0KD 2KZ4A 3ZZ9A 3TGIE 2Y5FA 1QL8A 4UEHH 5DSFA 2ALPA 4MLFB 4NIYA 2Z3DA 1YBWA 3F9HA 2GZ7A 1DS2E 2F91A 5IYTA 1INCA 1TNGA 1YWUA 2W3KA 1EPTC 1NU7B 5E0HA 3STIA 4F49A 2UUKB 2FP7B 2FI5E 2R3YA 2ODYB 2ZDKA 2OC8A 5E2OA 4CRAA 5HMAA 3QTVH 2HOBA 1QA0A 1K1JA 3A81A 4ZHAA 4MVNA 3BTEE 1LCYA 3RXCA 1Z8RA 2Z9GA 1Z71A 4D7GA 4X2VA 1DVAH 2G55A 2HALA 2V0BA 4I8KA 1FJSA 2C8XB 2VIOA 4JCNA 5H4IB 4BAHB 2BD3A 3SQEE 2QIQA 1SGDE 4IW4E 3EA8A 4GUXA 1HV7A 1GJDB 3NCLA 2ZPRA 2STAE 5TCCA 1UTPA 3LT3A 1MABB 3RLWH 3NUMA 2C8YB 2RG3A 1SGQE 4TYDA 5EODA 1ZTJA 1LVMA 1GBAA 2GCHG 1Z6JH 2Y5HA 1OWHA 3M61U 4ZXXH 2KCOA 3BG8A 2Z9IA 1E37B 1S5SA 4CBOA 1RS0A 1BMLA 3UNRA 3UWIA 1FMGA 5AFYH 5JBTA 1A46H 3PV4A 3PTNA 2SFAA 3SW2B 3RU4T 1CT2E 3AAUA 3KQBA 3RXOA 4XFQA 1UJ1A 3GISB 1ZLRA 4NZLA 2Q6FA 1MMJN 3SUDA 1ZMJA 3FFGA 3GCNA 3GY4A 1AD8H 2UWOA 1S6HA 1ABJH 4Q7XA 4IBLH 1TNLA 1NPMA 2W5EA 1G37A 4CRFA 1Q3XA 2IOTA 1DWBH 4ABHA 2O8WA 4FU7A 5EIYA 4UE7H 1IQMA 2J98B 4K8BA 3TJOA 2C3SA 1BOQA 3M5MA 3MO3A 3ATKA 3RP2A 2THFB 3FZDA 2XC0A 1Y3WA 3BV9B 1C5YB 1O2UA 2FOHA 2HNTC 2QXHA 1LVBA 4O3UA 4NIXA 4X1SU 2VIWA 2QF0A 4IMQA 4FUBA 2QY0B 4CR9A 5EG4A 5DO4H 1HAVA 4K2YA 1GPZA 1GHZA 2EQNA 2SNVA 2C8WB 4FUHA 2FYQA 3MI4A 1EXFA 1CT4E 3GCTF 1BMAA 3K6ZA 1NFUA 2FTLE 4VGCC 1TPPA 3KHVA 1O3CA 3E0NB 3GDSA 4OS5A 1C2MA 1GJAB 2NU2E 3FAOA 4A1XA 3ODFA 2BDGA 3A88A 3VB5A 2NU1E 1E79D 3F2GA 4AN7A 5BRRE 1D4PB 1A3BH 1CE5A 1LKBA 1SC8U 1H1BA 2A4OA 3MU8A 1HGTH 3SGQE 1GJ7B 1BIOA 1GMCF 1TFXA 2VWNA 1EZUC 1ETRH 1P0SH 1YPEH 2KR7A 2A7HA 4WWYA 1C1PA 3W95A 5HGGA 1QA7A 5K7RA 1HIAB 1PYTC 2WPKS 5HM2A 2Y7XA 4NSVA 5E2PA 1P2IA 3N7DA 2FOAA 3LOXA 5FX6A 2ZU4A 1TGTA 1UHBB 2AERH 1LO6A 2P94A 1A5GH 4DG4A 3SNAA 4D9QA 1AB9B 2QXIA 4GPGA 2AHME 2FX6A 2ZPQA 3GYLB 5CHAB 1AN1E 2HVXA 4XBCA 3E91A 1K1PA 2B8OH 3PLBA 4LZ1H 3BG4C 1O2IA 3E90B 1TGNA 2RDEA 2BZ6H 1O3NA 4J1YA 4AYVB 1ELGA 2OBQA 1C5XB 2XTTB 1GI5A 4KELA 4Y71A 5BPEA 3BEIB 2YNBA 1FONA 1TQ0B 2DE9A 2ZHWH 1F2SE 1UVTH 5DGJA 1MUEB 2QCYA 5CHBA 1GHYH 3RDZA 4AOQA 1VJAU 4JZDH 5EXNA 1FAKH 2A7CA 5DP4A 1O3JA 1BTXA 1EPTB 1WSSH 2FYRA 4JYTA 1QB1A 1OHHD 3AW1A 4IC5A 4JZIA 2WV9A 3G01A 3MU4A 1NTPA 1GI3A 1GHBG 3JZ2B 2ZDLA 2SGEE 2WUCA 1V2UT 3BEFB 1DOJA 1PPCE 1GVLA 3M7QA 1G2LA 2KX4A 3ZVAA 1FN6A 1ZYOA 4H42U 1QRZA 2Z7FE 1BTZA 1ANBA 2HNTE 2O9QA 4D8NA 1W12U 4K3JA 4HTCH 3UOPA 2FXRA 4Y6DA 1XUGA 1GI2A 3RMOH 2ZP0H 3LC5A 5FX5A 5C3NA 1CU1A 2XNDD 2QF4A 3SU5A 1GL0E 3LDXH 3RXJA 1GCTB 1TWXB 3M5OA 2RA3A 3OTJE 1YPLH 5JB8S 2KCPA 4IS5A 1K1OA 4RN6A 2GV6A 2GZ9A 3VB3A 1MZAA 1OP2A 3S0NA 1N6YA 4AORA 2Z3CA 1TMBH 1O2KA 2A5IA 4Z6AH 1SOZA 3AK5A 1NZQH 1UMAH 3SJ9A 1C1NA 1CT0E 2ZCHP 4MG3A 1XKAC 2J5UA 1AZ8A 2BX3A 2QC2A 3GDUA 1JMOH 1K1IA 1C2FA 4BAOB 1GMDF 1OKXA 2PSXA 1TABE 3URCA 3K6YA 4DOQA 1C5QA 2A4GA 3PMHB 3PMBB 3T29A 1RXPA 1GJ4H 1PPHE 5TJXA 1ELAA 4P02A 4X6NA 4CRCA 1SGPE 1E1QD 2TGDA 2YMSC 1RTKA 4A5TS 1GDNA 3A8AA 3SQHE 3KEEA 3EE7A 1QTFA 1ZHPA 5HXFA 3CENA 2STBE 1Y3XA 1ANCA 1SFIA 4AB8A 1LHDH 2ZU2A 3TK5A 5JBAS 4ABEA 5CMXH 2XYAA 1H9HE 1THPB 3UR9A 1GHVH 1GCDA 1O3KA 2ESTE 2BD2A 3K2UA 3KQ5A 4GCHF 1A0JA 1L2EA 1O33A 2QF3A 4INLA 4VGCB 5EQSA 2PGQB 1LHCH 1TQ7B 1C4V2 2F9NA 3TH2H 2SGQE 1QR3E 3F0OA 1ELEE 2GKVE 1HDTH 4GAWA 5ABWA 5GWZA 2WV5A 2FTMA 3FKSD 3FO8D 1OP8A 1TRNA 3WWBA 3T25A 2Q6DA 3FP8E 1AKSB 2ANYA 3DSPA 4RKJB 4FXGH 2WSSD 1NRPH 4ZKOU 4AZ2B 1BJUA 3KCGH 1XUJA 1K9OE 1TGCA 1D9IA 4M9FA 2M5TA 1CGJE 1QJ1B 2A31A 3SU4A 2FOEA 3VFEA 2V35A 4WH6A 3OTPA 2FZZA 1GVZA 1DUAA 4JK5A 2JDID 5FPTA 1FY4A 3RXPA 2AMPA 2SGAA 2ZFFH 1DXWA 4WXVA 2XOKD 5EGMA 5GCHF 1ZGIA 1P2NA 3F3BA 2BLWA 1O2WA 1D6RA 3LPRA 3BIVH 5DP8A 1QBVH 1O3GA 1QB9A 2BY6X 5C67A 5C2ZA 4A7IB 1C1TA 2BQ7B 2G00A 1K1NA 4ZH8A 5LPFA 3TGKE 4AFQA 1BTYA 3BG4B 1O5DH 2Y82A 1FY1A 1SMFE 3F1SB 4Q4LA 3HGNA 4X2XA 4E05H 2B7DH 5FXLA 1C2KA 2BDHA 1F92A 1GG6C 3ZVDA 1NRNH 4JK6A 1A3EH 3TVJB 3K65B 1GJBB 3VXEH 3SNDA 1G36A 1YPGH 2Q1JA 1UVUH 2P3TB 3GCTG 1GBIA 1T4VH 3F68H 1A7SA 2AYWA 1DLKB 3ZYDA 2PWXA 4I86A 1SGNE 4BOHA 1E1RD 3LONA 3STJA 4AFUA 2GTBA 1P2QA 2D26C 1E35B 1LKAA 1V2LT 2J94A 5CDFE 1O5BB 4DT7B 2TGPZ 2BLVA 3EGKH 1AFQB 2W7UA 3SBKA 1ZMNA 4U32A 1C5VA 1DLEA 2ULLA 1O3FA 2R2MB 2A2QH 2SGDE 1Y5AT 3M37A 1GMCG 3FANA 5HM9A 2FO9A 1FX0B 4BAKB 1L1NA 4IMZA 1K22H 3TH4H 5J4SA 5GDSH 1WOFA 3U28C 3GDVA 1PYTD 4H4FA 3O8RA 4GHQA 1C5WB 3BTFE 1NU9A 2ZF0H 4CRGA 5LPRA 1KIGH 1KXCA 2BD5A 1JIMA 3QX5H 4NA7A 1O37A 2VWLA 1P2KA 2ZA5A 1QQUA 1A1RA 4FOUC 2KCYA 4BTUB 3BSQA 1TBZH 4IGDA 1GJ5H 2OQUA 4YLUA 2DUCA 3SNBA 1ABIH 1BMNH 1H8IH 4CHAC 5F03A 4U2WA 1SQOA 1IHSH 2FS9A 3RMLH 1T8NA 2P16A 1J8AA 1AVGH 1IQNA 2AMQA 1GMHF 3QO6A 1O3DA 2BQWB 1OYTH 3WY8A 3VG8A 2AGGX 2PLXA 4ACBA 5ETXA 2HPQH 2FPZA 4X8SH 2VWOA 3TITA 1XVMA 3SJIA 1F0UA 1HAGE 2XCNA 1GBTA 1L1JA 1C5OH 1F5KU 2L74A 1SPJA 5FPSA 3U1JB 1O36A 1TOCB 2J98A 3M5NA 3PB1E 2GT7A 1O34A 3FP7E 1CBWC 3S9CA 2QV1A 4YT6H 1IOEA 4X8VH 1QL9A 2ZTZA 2HRVA 3VB7A 4X1NU 1G2MA 1MKWK 5AHGH 2KAIA 2ALVA 3AVZA 1AMHA 1SOTA 1W3CA 2YMSB 4NGAH 1C5UA 1HAHH 1GJ6A 1W14U 3OYPA 3UAIC 2H6MA 4Q7ZA 1SGFA 3KYGA 3LGVA 5LH8A 3MNSA 3OY6U 1N1LA 4A92A 1PQ8A 1GHBF 3RXDA 3ZZDA 4CH2B 1XKBC 4YOGA 1P2JA 1C4U2 1K28D 3OSYA 4I31A 2C8ZB 2J38A 3ZVCA 4A6LA 1SKYE 1SFQB 4ABIA 2ZI2H 5C5OA 1UVSH 3UFAA 3OU0A 1P2MA 1W0ZU 1AUJA 1BBRK 1MTWA 1TMUH 4RT1A 1RRKA 3HGPA 4FUDA 2K7XA 1S81A 1NFYA 4Q7YA 5B6LA 3P8FA 1W2KH 2F9OA 1HIAA 4X8UH 4HI3A 1MCVA 3RU4E 2ODPA 2QGRA 1KMHB 2M2AA 3RXKA 1DSUA 2RA0A 2F9UA 5EPYA 1UHBA 1UCYK 3S69A 1QCPA 4U30A 1TGBA 2G4TA 3VPKA 4UONA 3S7HB 1BRBE 1ESBA 1GJ8B 1TGSZ 3I29A 4INKA 5EQQA 4XBBA 2W6JD 2QE7D 1TAWA 2FI4E 2J34A 3ZIAD 1YPJH 3ATIA 5FBIA 1SGCA 1TA6A 3SU3A 3TNSA 2BHGA 3E16B 1AGJA 4JYUH 3A85A 2YMSD 2JIZD 3V12A 5FPYA 1MCTA 1KXFA 2A32A 2P8OC 4I32A 2CMYA 3UQVA 3BN9A 4K1EA 4ISNA 1ZRKA 1EPTA 5L6NH 4TPYA 3EA7A 4ABFA 4I8HA 1C1VH 1UO6A 5F8ZA 3NKKA 4SGBE 3PM3A 3MU1A 4CRBA 1GG6B 5KECA 3FOAA 1UTMA 1AHTH 3DHKH 4X1QU 4JMYA 5EJZA 2GMTC 4GCHG 5DG6A 1LMWB 3MU5A 2OC0A 2PKSC 1G30B 1O3MA 1O3AA 1JRTA 4MQAA 2ZCLP 1RD3B 1C2EA 1O5GH 2LIZA 2FMJA 1D3DB 4ZXYH 1GCTC 1AE5A 1ARCA 4J2YB 1EOLA 1FY5A 2HNTF 3N99A 3RC5A 1D3QB 5GNDA 4MPVA 5F8TA 1E38B 4A1TA 3KL6A 4Z1MD 2QXGA 1OWJA 1JXPA 1LQEA 4OS6A 1AVWA 1CA8B 1SQAA 3F2HA 2FS8A 3EAJA 3SI4H 1QGFA 2ZQ2A 3GY8A 1QL7A 4ISOA 4OM9A 1Y59T 1BB0B 1OSSA 1XUIA 4F4OC 4HZHA 2JH5D 1EQ9A 3RXUA 3SHAH 1O2OA 5GCHG 1SI5H 2JETC 1HFDA 1KLIH 2OTVA 4CHAB 1KXBA 2UUYA 1HUTH 4R8TB 1V2VT 1MH0A 3AW0A 1HJAC 1L4ZA 2W7SA 3RLYH 2PKAB 1L1GA 4HG6A 1TX7A 3P17H 1GGDC 3BTGE 3P8OA 1C5RA 4H6TA 2WZQA 2WV4A 1PQ7A 1UTLM 1COWD 1MU6B 1SLUB 1EJAA 4H6SB 2BY9X 5DP7A 4DIHH 2G4UA 2QYIA 4YTAA 2BB4A 1CBWB 1O2ZA 4ESTE 4D9RA 2VIDA 3E1XB 3C1KA 1H8DH
chains in the Genus database with same CATH topology
2P95A 1IAUA 1O2RA 1AQ7A 5A8YA 4AB9A 1GWAA 4X6OA 1GBHA 4DURA 4BAQB 4KP0A 1S6FA 5C1YA 4E7RG 5ESBA 1O2PA 1JWTA 1ANDA 1RFNA 3MH5A 1TX6A 2LNCA 1VCWA 1A5IA 1MD8A 3KF2A 4NZQA 1C2DA 3OY5U 4B2CA 3EBNA 2CXVA 1AUTC 3I78A 2FEQH 2V3HH 1SGFG 3E0PB 1SQTA 2EI8A 1RJXB 1AKSA 2BVXH 1PPZA 2HLCA 3A7XA 4NG9H 2P3FH 3A7ZA 4B75A 1G32B 1ZSLA 1GVKB 2VIPA 5EPNA 4Q2KA 1FXYA 1QB6A 2UUFB 4NA9H 1ZHRA 1C1QA 1GMHG 1UTJA 3UNSA 4BTTB 1C1OA 4WY3A 3N7OA 3Q3YA 4Y8XA 3V7TA 4B71A 1ACBE 1YCPK 2ZTXA 1ETSH 4AGJA 3CS7A 3TK6A 1O3BA 1J14A 1ETTH 3P8GA 1OXGA 4Y7BA 3RXRA 2ZNKH 1Y5UT 3ZZBA 5GIBA 1IQHA 1IQJA 2VGCC 3DD2H 2BXTH 4MPXA 1P05A 1QQ4A 4NFFA 3B23B 1EAXA 3CS0A 3M3TA 3TPIZ 3BEUA 5GXPA 4DIIH 4O3TA 2UWPA 3HKJB 1BTUA 1XUFA 3NK8A 1K21H 5C5NA 4D7FA 1XXFA 2A1DB 5A0BA 1V2RT 4X1PU 2P59A 2P8OB 3TJNA 1FY8E 3L3TA 2NU3E 2PR3A 8GCHF 1P11E 1SB1H 1GBDA 3SNCA 1AFQC 2ZECA 2GDEH 1EP5A 1GI6A 3NWUA 1KXAA 2NU4E 2WPMS 1TPAE 1ELCA 2OXSA 2CJIA 4UFFH 5DP6A 3UIRA 2LPRA 1DWDH 1FQ3A 3PYHA 2GMTB 3SV2H 3RXLA 2BM2A 2OCVB 3D49H 1DE7H 1ORFA 2PSYA 2PKSB 1BA8B 2CF9H 2XBXA 2Z9JA 2JH0D 4WF8A 1NROH 2ZGHA 4AYYB 1SGRE 1TBRH 3SORA 3E3TA 4OS4A 1HAXB 2OLGA 3TGJE 3RXTA 2IPHA 4X6PA 1JRSA 2BDBA 2R9PA 3EYDA 3MYWA 5J4QA 1MZDA 4FUJA 2ZWLH 1F0RA 1ELTA 4CBNA 3PROA 1WUNH 1TLDA 2FWWA 1C1MA 1C5PA 2G81E 1GBLA 4YM9A 1D6WA 1CVWH 5GJ4B 4DW2U 3GY2A 3SV8A 1ELVA 2V3OH 1JBUH 2VB0A 2C4FH 1O2SA 2F9VA 1D3PB 3I77A 1V2NT 1FI8A 1V2PT 1O32A 1Z1IA 1YPKH 3LH3A 4ABGA 2XXLA 1GBCA 3RMNH 2JETB 1S82A 6LPRA 2VH6A 4FUIA 2Y6TA 3EQ0H 3ZZ4A 1DWEH 1MTVA 1W8BH 5JB9S 1HAZB 1O5CB 1TNJA 3EDXB 4X2WA 1N8OC 1HJAB 3ZZ5A 4I7YH 1AE8H 2P3UB 1O2NA 1T4UH 1THRH 4Y7AA 1VGCB 1ZHMA 5EW1H 1GGDB 2TGAA 2Z3EA 2EI7A 2CN0H 3ZZCA 2O8LA 2BD4A 1BRAA 3RMMH 1FNIA 1FV9A 9LPRA 3U98H 1ZR0A 1PPFE 2NU0E 1NS3A 2QAAA 3LJJA 2ZDNA 1ARBA 1CHOF 2J2UA 1AI8H 2HGTH 5JDUB 1MQ5A 2ZFTA 1F0TA 3UPEA 1MBMA 2TPIZ 1LTOA 1O3PB 2ZHQH 2A4RA 1GBJA 4HFPB 3DA9B 5JPMH 1MKWH 2WPIS 1ELDE 1O2MA 2VVUA 3LKWA 1SLVB 1IQIA 1Z8JB 2VH0A 4I8GA 3Q77A 1Y5BT 4IN2A 3UQOA 1GDUA 2O8UA 3QK1A 3RM0H 1LVYA 1E34B 4M7GA 3ZV8A 3F6UH 3UREA 1ZSJA 2R2WU 1HAOH 1ZMLA 1V2TT 1U6QA 3IITA 3BTME 1NRQH 2BZAA 3AASA 2BYAX 1BTHH 2GD4B 1DFPA 1KY9A 1O3EA 1UTNA 1BBRH 1V2OT 4WMDA 3Q76A 3ZVEA 3IG6B 1BDAA 1LPKB 1EX3A 1NRRH 2K1QA 4AFZA 4X8TH 1V2MT 4DVAU 4ABDA 1P10A 4OS1A 4ZUHA 2B5TB 1GHAF 2EEKA 2ZU1A 2J95A 3BIUH 3LGYA 6CHAC 1NRSH 4XDEA 2XWBI 1GDQA 1TYNA 1UTOA 4XBDA 1MKXK 3LIWA 1HYLA 2AIQA 1T32A 2GVFA 3M35A 4NFEA 1GL1A 2IJOB 4Z0KA 3V3MA 4FUGA 3A7WA 1HJ8A 1VJ9U 4UDWH 1V2JT 2ANMH 1TBQH 2VGCB 3QTOH 1TPSA 5T6GA 3S9BA 1RTFB 1IHTH 4X6MA 3LH1A 4UD9H 3NPSA 1EKBB 2R0KA 1EJMA 3QN7A 1TNHA 4Q80A 1C2GA 4K8YA 3SJKA 5EU8A 3TK9A 1FPCH 3UUZA 7ESTE 3FVFB 4A1VA 4BTIB 3F9FA 1WQSA 2SGPE 3H5CB 4I8JA 4OGXA 4ZKRU 1P2OA 5T6FA 1P01A 1GJCB 4QT8C 1QHRB 1GHWH 2XWAA 4B76A 1GBEA 5C20A 3UWJH 1CO7E 3VGCC 1MD7A 3ZVGA 2CGAA 3QGNB 4LXBH 1WBGB 1EZXC 2ZDMA 1BMMH 2XRCA 4KGAA 1WQVH 4B2BA 1T7CA 2A5KA 2G51A 5SGAE 2A4QA 3V0XA 2B0FA 2TGTA 4KTUA 3ZZ6A 1EJNA 1QJ7B 2OD3B 2PUXB 1PPEE 1ID5H 2GCTC 1ZPBA 1HXEH 1MTUA 1QBOA 2RCEA 1HJ9A 1ZJKA 1O5FH 1SSXA 1B7XB 5PTPA 1ZPCA 1IQLA 3UTUH 3PWBA 1P3EA 3SZNA 1O3HA 3HK3B 2ZGJA 4KTSA 1F0SA 1P12E 2VWMA 2BLQA 2F9BH 2DE8A 2ZGBH 4CH8B 2PKAA 1O2VA 3PWCA 4E7NA 3KIDU 3BF6H 4YOJA 1DM4B 1E0FD 2BY5X 1GJ9B 1OWEA 5I46H 1DXPA 1A2CH 3M36A 1SGIB 1WU1A 2F3CE 1O2HA 1EP6A 3P92A 5A0AE 1N8OB 4XE4A 1KLJH 8GCHG 3ZZAA 1DDJA 5EW2H 5DKMA 4MPUA 1DANH 3E8LA 3T27A 1TE0A 1HB0B 4TY7A 2A45B 2SNWA 1IQKA 4OGYA 4CREA 3LGIA 1A5HA 3A8CA 3RXVA 1TMTH 1W7XH 2BX4A 3SUEA 2PTNA 3RXQA 2FOBA 5HYOA 4ABAA 3S7KB 2QN5T 7GCHF 2GX4A 3Q00A 4MPWA 1Z6EA 4O03A 1L0ZA 3PO1C 5DP3A 3MNXA 3QUMP 1ESAA 3RXSA 1FIWA 5JYIA 3MFJA 5A8ZA 2ZTYA 2TBSA 2XW9A 3GY6A 2ZCKP 2W3IA 4K5ZA 4R0IA 3O8CA 3NZIA 4DCDA 3ZYEA 1PQAA 1LVOA 1BQYA 3P6ZB 4X0WU 4GSOA 5L2ZH 3RUOA 1PQ5A 1EZSC 1WYKA 5ESTE 1EAIA 1EOJA 4AG1A 2PW8H 3Q3XA 1O0DH 1NESE 2PTCE 5AF9H 2W26A 3ATMA 2SGFE 1YF4A 5DK1A 5TCAA 1YP9A 3T62A 3HATH 1NM6A 1QY6A 2A0QB 1GBMA 2OQ5A 2ZFSA 3L6PA 1VITF 1W7GH 4MNXA 1YCPH 1YPHC 1UK2A 2J92A 2H2ZA 2PFEA 6CHAB 3DT0H 2XC4A 2ZU3A 3MOCA 2BY7X 3ODDA 4WMEA 2WYJA 1P03A 4JZEH 5EXLA 1KSNA 1NN6A 1HAIH 2A5AA 3SU0A 3TJVA 1EZQA 3KQEA 4K69A 4XSKU 2ZGCA 4K1SA 2ZKSA 1OWIA 1VITH 1CHOG 1FDPA 2Y80A 3URDA 1C9PA 1WTGH 4BXWA 3SV9A 4FUEA 1IQGA 1RTLA 1QRXA 2FLRH 5AFZH 4ZHMU 4TPIZ 8LPRA 2PV9B 2D8WA 4YLQH 4ABJA 1QBNA 2XBWA 3M7UA 4O9VA 3ATLA 2FOFA 3P8NA 3RXAA 1C5MD 2AH4X 2GZ8A 1EAUA 3MO9A 2WPLS 4YESB 5C1UA 1VCQA 4TWYA 1C9TA 4Y0ZE 2WPHS 2EI6A 3EE0B 2XCFA 3GICB 5EOKA 1C5NH 3M7TA 2VINA 1HAYB 1BT7A 1S85A 4Y76A 1KTSB 1Y8TA 3TH3H 4CR5A 1P9UA 4FVDA 1NFXA 3VXFH 7KMEH 3VGCB 1XX9A 1QNJA 1C1RA 1YKTA 2YOLA 4NWKA 3T5FH 1SGYE 1DWCH 2ZHDA 1ZOMA 1FLEE 2C93B 4WH8A 1FIZA 2VJ1A 1QURH 3GYMA 3TNTA 1C2HA 4YT7H 1A0LA 2WINI 3TIUA 3K9XB 1O2TA 2AGEX 1C2JA 1C5TA 1IQEA 1OOKB 1YC0A 3U1IB 3UR6A 2GCTB 3ZZ3A 1GHAG 4THNH 4NIWA 1CGHA 3RXMA 1ZPZA 3BTWE 3LGUA 3SOSA 1SGEE 4AG2A 1VGCC 6GCHF 1CA0B 1FAXA 1FPHH 2ZGXH 3A8DA 2TRMA 4I8LA 2ILNA 3H7OA 1Q31A 3SGBE 2AS9A 5I25A 2AFQB 2ZQ1A 5FCRA 1AY6H 1BJVA 1KXDA 1DPOA 1P57B 1ZJDA 4WJG2 3BTTE 3QWCH 1DSTA 1OS8A 1GBFA 2WYGA 4Y8YA 3GCOA 3KQCA 1WTHD 2BD9A 2G8TA 2FOCA 4ZKNU 3SHCH 1CHGA 2OUAA 4AX9H 3PMJA 3RU4D 1BTWA 1UVPA 2ZFPH 5DP5A 2ZEBA 3A80A 2Z94A 1YYY1 1S84A 1C5SA 1YPHE 2ZC9H 2FODA 1NFWA 2QXJA 3BTDE 5EQRA 3U69H 3A89A 3QZQA 1A61H 4NA8A 4LZ4B 1XUKA 4IC6A 1MTNC 2BD7A 1KDQB 3T28A 1C5ZB 2KAIB 1RIWC 3MTYA 2BTCE 1CSOE 2O8TA 1KXEA 3PO1B 3RXEA 1YPMH 1OWKA 2V6NA 3NXPA 1O5EH 2XBVA 1TRMA 3KGPA 1QJ6B 1SL3A 1NC6A 1HXFH 4KKDA 1DT2A 1FN8A 3ZZ8A 1W13U 2ZHEH 1S0RA 1TNIA 3W94A 1EAWA 3CP7A 3VB6A 1BHXB 1HLTH 8KME2 1GI7B 1GBKA 1SLWB 1XXDA 2HWLB 2PHBA 3SU6A 2H9HA 5FCKA 1AWHB 1BZXE 3LC3A 3OX7U 3SV6A 5EXMA 2OBOA 1SGTA 1BITA 1DITH 1QFKH 1WV7H 3A7YA 2G5VA 4XOJA 1M9UA 2XNIA 2BVRH 1LHEH 1THSH 1ZRBA 6ESTA 2AIPA 4X1RU 3ESTA 3SU1A 1SBWA 2CV3A 4UFEH 4BNRA 3LGTA 5DJ7A 1MQ6A 3ZZ7A 2BQ6B 1ESTA 4ASHA 2D2DA 1AO5A 3UNQA 1EB2A 1LDTT 2ZHFH 3P95A 1BRCE 3RC6A 1MKXH 2H5CA 4ZROA 1K1LA 1YLCA 2FM2A 1O2GH 4MTBA 1TPOA 3SUFA 3MH4A 1TB6H 4OS7A 1O3LA 2VVCA 3TJUA 1VR1H 4GVUA 4PROA 7GCHG 2UWLA 1AZZA 1GI1A 1O38A 1DUEA 2ASUB 1ELBA 4D76A 1VZQH 2Y5GA 3PLPA 4LK4A 1SG8B 4B73A 4WXIA 1L4DA 1TA2A 1GHXH 3HPTB 5JBBS 1TNKA 4ISHH 3T26A 2FI3E 1B0FA 2WUBA 1GI4A 1MAYA 1RGQA 1C1WH 3QGJA 4LOYH 4UFGH 3SO3A 1TOMH 2EA3A 2I6SA 1PFXC 9ESTA 3HKIB 4HGCA 3PTBA 3QDZB 1Z7KA 4RSPA 5F6MA 1AU8A 4KTCA 3D23A 1FUJA 1BCUH 1JIRA 4YOIA 1FZZA 3A83A 3O8BA 1ZSKA 2BVSH 1UVOA 2VNTA 3RXIA 4JZFH 2GT8A 2RDLA 1PJPA 3KNXA 3UOUA 1O31A 3O8DA 1V2ST 4E06H 1Y3UA 1XM1A 5A0CA 1XMNB 1VITG 2J9NA 3DFLA 1WCZA 4Y79A 4X2YA 1O2LA 2P93A 2ZZUH 5G4BA 1YGCH 4K1TA 1LHGH 5AVDA 1TONA 5CE1A 1QRWA 1A4WH 3M5LA 1T8LA 1T8MA 2ANWA 3ZVFA 2OC1A 1S83A 3S9AA 3GCHC 3ZV9A 2FLBH 4UFDH 4GHTA 1F5RA 1LPGB 5E8EH 3MHWU 2O8MA 1P3CA 1NO9H 4B74A 3PLKA 2D1JA 1T31A 1V6DA 2H1UA 4Y8ZA 5LPEA 3SGAE 5A2MH 1HAPH 1EUFA 1J17T 2H5DA 3SJOA 3BTKE 3ENSB 2TIOA 2CHAC 2ZFQH 1O3OA 8ESTE 2G52A 2AEIH 4CRDA 3DUXH 4B2AA 4U01A 5K0HA 1K1MA 4YZUA 5B6OA 2JH6D 4MNYA 2ZIQH 4ZHLU 3IWMA 3JZ1B 1AIXH 1C2LA 2Q6GA 1MU8B 2BOKA 4NSYA 1W0YH 2PUQH 1HAVB 3FZZA 1BUIA 2Z9LA 2GV7A 2BXUH 1IQFA 2R3UA 4NCYA 1UTKA 2FIRH 1DY9A 1MTNB 1SHYA 1QIXB 1RIWB 1AFEH 3TU7H 3ZVBA 2VIQA 1S0QA 5FHTA 1O2QA 1P04A 3BTHE 4Y11E 1DICA 3C27B 1O5AB 5C1XA 4INHA 4ZKSU 4ABBA 1YLDA 5T6DA 2ODQA 1D3TB 3MH6A 2AGIX 1MBQA 3MH7A 3R0FA 2BDIA 1SVPA 2QA9E 1Y3VA 1Q2WA 2Z9KA 2Z6BD 1NY22 1O30A 4JYVH 3U9AH 3AAVA 1G3DA 1W10U 3D65E 1GI0A 5JBCS 2A2XH 6GCHG 2GCHF 2H9EH 4GLYA 3H7TA 2YNAA 4AFSA 3RM2H 1C1UH 1UCYH 4BANB 2OINA 3SJ8A 1O3IA 4ZAEA 3PMAB 2BD8A 2NWNA 2ZO3H 3VEQB 2EC9H 1P06A 4SGAE 4TWWA 5A8XA 3F9GA 1F7ZA 3MO6A 1O2YA 3LGWA 1H9LB 3SU2A 1PPBH 1SR5C 2ZU5A 2ANKH 3A86A 5DPAA 1Y3YA 2BLOA 1P02A 1DY8A 3MNBA 1V2QT 1HNEE 2VU8E 3A87A 3MU0A 3U8RH 1G3CA 1Z8GA 2J4IA 1G3BA 1C1SA 1ELFA 3GY3A