3VB3A

Crystal structure of sars-cov 3c-like protease in apo form
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
301
structure length
301
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Design, synthesis and crystallographic analysis of nitrile-based broad-spectrum peptidomimetic inhibitors for coronavirus 3C-like proteases
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 82
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-12-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3vb3A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3vb3A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3vb3A02
1BRCE 4OS5A 7LPRA 1O3NA 3RXUA 1TBRH 2ULLA 4ABAA 1O2MA 3A7VA 1VGCC 4UFDH 4X8UH 1SSXA 3BEFB 1ZTJA 2O8UA 1GMHF 1CQQA 4DGJA 5A0BA 1QL9A 2BYAX 3RXQA 2OBQA 1C5VA 2ZC9H 1Y3UA 5FBIA 2NU1E 2GMTC 1SOZA 2OTVA 3ZV9A 2ZTXA 2Y5FA 1KSNA 3P70B 4LOYH 4Y0ZE 3P8OA 1BBRH 1TMUH 2CF9H 3KQEA 1EP5A 1O2KA 2RDLA 1GBTA 5TCAA 5C1UA 1SGDE 2QXHA 1IQFA 4UDWH 1FN6A 1K1MA 2FOFA 1GG6B 1O2IA 3VB5A 1CVWH 2FESH 2PTCE 5DKMA 4ZKNU 1QB9A 3Q00A 5C2ZA 5F6MA 3UOUA 1WQSA 3SGQE 4CBOA 1E34B 1BZXE 4ZHMU 2A0QB 4NFFA 4B2AA 1GI3A 3SI4H 1J15A 2H1UA 2ZHFH 5GDSH 3PV4A 1Q2WA 4WMFA 4CH2B 4QT8C 3OU0A 4IN2A 5L30H 9LPRA 2SNWA 5FCKA 4H6SB 4DIHH 1UTOA 3U98H 2XWAA 1K1NA 1YF4A 1ELFA 3SUDA 5C5NA 4JYTA 1C5MD 7ESTE 1KYNA 3UR9A 1VCQA 4Y0YE 3VPKA 2BX3A 2C8YB 1F92A 3V3MA 1S6HA 2FDAA 2Z3DA 2THFB 2QXIA 1UTMA 3P8GA 1SGTA 1SLUB 2NU0E 1C4V2 1GJBB 3T2NA 4BTIB 1C4U2 1EATA 2G55A 1Z8JB 4THNH 1MZDA 3A87A 2WV4A 4TY6A 1DICA 1JWTA 1ZJKA 4RKOB 1GBJA 3TJVA 2GP9B 2HRVA 1DVAH 4D7FA 5GCHG 2ZU4A 2ALVA 4XBCA 3SNDA 1GBCA 2GDDA 3SV8A 1J16A 3ZZ3A 4XFQA 1NFUA 1LDTT 2P93A 1DWDH 1E35B 1OOKB 3EBNA 1KY9A 3BTWE 3A84A 3U8TH 4BAOB 1O2WA 1DE7H 1O2TA 2B8OH 2FI3E 4XDEA 2B0FA 3Q3XA 4X6OA 4LZ4B 2B7DH 1SG8B 1SQTA 5H4IB 3A7YA 2VVUA 1IQLA 1UVTH 3E3TA 1C9TA 5C5OA 2KAIA 1BJUA 1QA0A 1TRMA 3GCTF 5E0HA 1ANDA 4GLYA 3TK9A 1RTKA 1FXYA 2PW8H 3RXAA 2R9PA 1NFXA 3C27B 1SMFE 3MNCA 2OINA 1HRTH 1SQOA 1ABJH 1P2IA 3RC5A 3OTJE 1AQ7A 4GAWA 4Y79A 3TITA 1S0QA 4YOIA 2ZGCA 2ZEBA 3GCHB 5HM9A 3O8DA 1XVOA 3BG4B 4ZAEA 4ABFA 1GI8B 1NU7B 4X1SU 2BXUH 1V2OT 3FANA 4X1PU 1CU1A 1IQEA 1QL8A 3ELAH 1QRZA 3SNBA 5EW2H 2OD3B 3KQCA 1XX9A 2CF8H 1DSTA 3GY5A 2V35A 2BB4A 1AMHA 4IW4E 1UCYK 5J4SA 1C5SA 4Y6DA 3MO3A 5EOKA 3ATKA 4IBLH 3ZZ4A 2BY6X 1OKXA 1VITH 2C3SA 1FV9A 1L1NA 2XC5A 3SORA 1MTVA 1GCTC 6GCHG 1CT2E 4MQAA 3ZVGA 3SW2B 1F0SA 1K1OA 2O8LA 1MTUA 4WH8A 5C20A 2ZGXH 2ZIQH 3UR6A 5GIBA 1LQEA 1QQ4A 1NRPH 2R0LA 8GCHF 2TBSA 3SJIA 3NCLA 4TPYA 1SGCA 4FUJA 4A1TA 1GHAF 2OQUA 3RXOA 5FBEA 1V3XA 2FZZA 1DUAA 2PUQH 5DP4A 1TNLA 1O2QA 1MTNB 2FI4E 3OY5U 1AD8H 1BA8B 4H4FA 2A31A 3RU4E 2K1QA 1AVXA 1HJ9A 4TPIZ 2Q6FA 5EQQA 3BN9A 3EE0B 4AX9H 5HXFA 1P04A 1WUNH 1ACBE 1AE8H 1J17T 2RG3A 2ZQ1A 3MFJA 4YTAA 1CBWC 4IMQA 1KLJH 2R0KA 2SGQE 5GPIB 4IGDA 1UTKA 4LK4A 5HMAA 2B9LA 2H9EH 2OC0A 1LKBA 3D62A 1ESTA 2GKVE 3MH7A 3URDA 1LHFH 4TYDA 4Y7AA 1RJXB 2PV9B 3FP7E 1A0JA 1TMBH 5E0GA 3SV6A 1QA7A 4NG9H 2AGIX 1AVGH 2QGRA 2V6NA 3LH1A 4I8HA 3A8DA 3SV7A 3P92A 1SGEE 4WMEA 1EOLA 3NKKA 2XC0A 3AASA 1K1PA 3B9FH 3ZYDA 2WPJS 3LC3A 1L1JA 2NU2E 3U8RH 3HKIB 4IS5A 1XXDA 1NRQH 4MTBA 3A8CA 4VGCC 2Z7FE 2ASUB 4RKJB 1AKSB 1YPJH 1ZRBA 1WTGH 2HNTF 1RTFB 5F8XA 2EEKA 1SQAA 1RIWC 3ITIA 4ABDA 1Z8GA 3MI4A 1OP8A 1ZPZA 3RXDA 1N1LA 4U01A 4X6MA 3VGCB 1EPTA 1MQ5A 2G4TA 5DP8A 1YPGH 1GL1A 1AHTH 3MNXA 1K28D 3TNSA 1O3AA 3ZVBA 1WQVH 4WF8A 1K9OE 1TIOA 3TPIZ 3H7OA 2ZU2A 2M5TA 5JBTA 1Y5BT 1THPB 1GBEA 2QV1A 1PPHE 4BTUB 3VB3A 5LGOA 1THRH 4MNYA 2ZWLH 1GHYH 1GHXH 2AGGX 2C8ZB 5A8XA 1YCPK 1O2RA 3RLYH 4E7RG 3KCGH 3QWCH 1LHGH 2BDHA 2QF3A 3S9AA 2XYAA 1BRAA 1O37A 2H2ZA 1XUFA 4FU8A 1IQIA 1HJ8A 2WYJA 1EJAA 1MH0A 2PUXB 1DFPA 1AB9B 5FPYA 1NFYA 4DOQA 2GCHF 1HBTH 3SU1A 3I78A 4ABGA 4JMYA 5DK1A 1AY6H 3QTVH 2BD3A 4B71A 3LONA 5A8YA 1VZQH 4MDSA 1XKAC 2ODPA 3A7TA 4B73A 3KHVA 3RMOH 3U8OH 5FCRA 4CRBA 1EZSC 1MUEB 2FOAA 3B8JA 1C5NH 4B2CA 1O35A 3GOVB 5DJ7A 3CS7A 1HPGA 2VIQA 1IQNA 4FVDA 1BT7A 1TABE 4ESTE 1AUJA 4CHAB 4R0IA 2WV5A 3F9FA 1HUTH 1ZGIA 4YT6H 4D9RA 1LQDB 1UCYH 4Y7BA 3RXBA 1O3JA 1ELGA 1Y59T 1UMAH 1MAXA 2VIOA 1TALA 1GI2A 1W7XH 3SGBE 1E38B 1F5LA 1F5KU 1T8OA 1HAGE 2BOKA 2P3UB 1ZHMA 1RS0A 3SQHE 1TRNA 3SOSA 1DUEA 1VGCB 1MU8B 1DY9A 1ZJDA 2W7SA 3STJA 4E05H 1C1WH 1THSH 2TIOA 1KTSB 1SLWB 1K1LA 2GT7A 1EP6A 3OSYA 1ZYOA 2FOGA 1TGNA 4E7NA 2GMTB 2W3KA 4X2XA 4FUCA 1GBDA 1TQ0B 4CBNA 2BQ7B 4AGJA 1N6YA 2D1JA 1HB0B 1S82A 4DW2U 3ZZ9A 2XXLA 3T5FH 5TJXA 1C2LA 1JRSA 3BV9B 2OC1A 1LVBA 4AN7A 1V2RT 1HDTH 1H1BA 1HLTH 1WU1A 2ZU3A 1AZ8A 1A5GH 3HK6B 2WUBA 1GHWH 4WJG2 2YOLA 1HAOH 1Z6EA 4NGAH 1HNEE 4NZQA 2A5IA 2ZF0H 1C1QA 1QGFA 2UUYA 1FY8E 1V2UT 4AFZA 1UTLM 4K3JA 2F91A 3GY6A 3UQVA 1JBUH 2ESTE 2WYGA 1A5HA 3L3TA 3RXTA 1F7ZA 4YM9A 1TNIA 2Y80A 1C5PA 1SGFA 2Z9IA 4UFEH 5AFYH 1O3OA 2IN2A 1SI5H 4D9QA 3S0NA 2ANYA 1ELBA 1FAXA 2SNVA 5FX6A 1C1TA 1UTJA 3UNQA 1P12E 2GCTC 3QDZB 2C8WB 1HAYB 2VB0A 2A5AA 2K7XA 3BTFE 1VCPA 5AVDA 1V2NT 1O2YA 1BITA 4U32A 1V2KT 3H7TA 5HM2A 1GVLA 1TLDA 1QCPA 7GCHF 4FUFA 1SR5C 1C1PA 3HPTB 2A45B 1NY22 3ZV8A 1QR3E 3Q3YA 3QGNB 1W10U 4FUEA 4ZXYH 2UWPA 1F0UA 1FY4A 1NM6A 4CH8B 5ESBA 4X8VH 3SJ9A 4SGBE 1YLCA 1K2I1 2ZFFH 5SGAE 4NWKA 1H9IE 1SHYA 3ZZ5A 5T6FA 3KIDU 1TAWA 3QGJA 2G81E 2SGAA 1V2JT 1YCPM 1O3FA 4O3TA 1MBQA 3MU1A 1ZMNA 3SU5A 2XBYA 1FIZA 4JZFH 4XSKU 4B75A 1XXFA 1TYNA 3K6ZA 1TBQH 2XNIA 4FUDA 2VH6A 1NC6A 5I46H 2H5CA 2GZ8A 1YPKH 2XBXA 4Z6AH 3OYPA 3EA8A 1BHXB 3W94A 1T8LA 1AB9C 1YCPH 1LPZB 3ZVAA 5DP7A 1GVZA 4K5ZA 4NA7A 3UPEA 1OYTH 3MNSA 1IHSH 2VJ1A 3A89A 3GICB 1UO6A 4MVNA 1OWKA 2LNCA 3M61U 1ZRKA 4AOQA 1DWEH 4X6PA 1P10A 1C2MA 1O2ZA 3AW0A 1DT2A 2Y81A 1YPEH 4BNRA 2BY5X 4ABJA 5GCHF 2Y5HA 3BEIB 2O8WA 3M3SA 1UVPA 1RGQA 1MTWA 2ZI2H 4AFQA 2ZZUH 2Q6DA 1LVMA 1TA6A 1TX8A 1XMNB 2V0BA 1IQKA 4IC5A 2ZHQH 1SGQE 1SVPA 3T27A 3BTTE 3LKWA 4A7IB 1TGSZ 4AYYB 1MQ6A 4INLA 1A3EH 1C5RA 3KN2A 5B6OA 1TOMH 5L6NH 3A8AA 1O2XA 1TGTA 3ZZ8A 2F83A 2AS9A 2SFAA 5E0JA 1T8NA 4AB9A 3UFAA 3SHCH 4DURA 1IQGA 1Y3WA 2A7JA 4X8TH 1DOJA 5HYOA 1P02A 3P17H 4BXWA 2ZPQA 3GYLB 2A2QH 2CV3A 3K2UA 2PKAB 1FZZA 1ETRH 3S9BA 4A1VA 2A1DB 4WVPE 1UTPA 3SJOA 3ESTA 1BTHH 2CN0H 2O8MA 2P95A 1K1JA 2J92A 1ZLRA 1ZSJA 1O2PA 4TWYA 1Y3XA 2P3FH 5J4QA 1WBGB 4OGYA 2PKSC 2FOEA 3RXHA 1GCTB 3TH3H 3RLWH 3RXSA 3RP2A 3BEUA 1QHRB 2A4QA 1ETTH 1TX6A 2ZDLA 1D3QB 2F3CE 1C5OH 3MH6A 4HTCH 3TGKE 1EJMA 1KXDA 3PLKA 1AN1E 1OWIA 3OX7U 3W95A 3QN7A 2ANMH 2WPKS 3AAVA 1MMJN 4Q7ZA 3LDXH 4KTSA 1O2HA 1YYY1 1ZPCA 1TWXB 3E6PH 3FFGA 1ARBA 1GMCG 4OS7A 4WMDA 2FLBH 4U2WA 1YPLH 3RXVA 5JBBS 1KIGH 4UONA 1J9CH 2AFQB 3PWCA 1CBWB 1F5RA 3A7XA 4FU9A 1LMWB 2TRMA 3ZZBA 1QIXB 3PTBA 1NROH 1EAUA 4CRGA 1ZMLA 2XC4A 3I77A 6GCHF 3M7QA 2Z9JA 1MTSA 1AFEH 1HIAB 2BOHB 1D6RA 1HXEH 2UUJB 1JMOH 1B0FA 4YO9A 1HAZB 1NS3A 1SL3A 2Z9KA 1ZTLA 4A92A 4ZKRU 3TIUA 1O3PB 1W2KH 3LH3A 3UUZA 2BD9A 1MCVA 1NO9H 2W5EA 3UNRA 3VB6A 1QB1A 2OC8A 2ZFTA 1IAUA 3Q3KA 3MYWA 4CRAA 1ZHRA 2D26C 3LGUA 1AZZA 4VGCB 3M3TA 2FS9A 3DD2H 3RXLA 2Z3CA 4IC6A 2B5TB 5AFZH 1GBFA 1BQYA 3EGKH 4Y71A 1RIWB 1GJ6A 3RXIA 1SGRE 4UEHH 1V2MT 4O03A 1KLIH 1BIOA 2HALA 3PLBA 2EC9H 2ZFRH 2XCFA 2TPIZ 3RXJA 2W3IA 1BHXF 3HGPA 1L4ZA 1LPGB 2P59A 2ZDKA 2VIDA 1T8MA 4UD9H 2ZNKH 5FPTA 5G4BA 3ZZCA 1AIXH 3BTKE 3SJKA 1FY1A 2WINI 4TY7A 5K0HA 3R0FA 1HGTH 2AGEX 5GWZA 1TOCB 1G3EA 1GMHG 2H9HA 1GI4A 5TCCA 2BDGA 4KP0A 1G2LA 2G00A 1KXBA 2FP7B 3BTDE 4HGCA 3SV9A 4JK5A 1ZOMA 4GHTA 4ZROA 2H9TH 2Y82A 2UUKB 1J14A 1P2NA 3V0XA 5BRRE 2BHGA 3U69H 1UVOA 3ATIA 4NFEA 4ZHAA 3UY9A 1S83A 1BMMH 1ELAA 1PQAA 4GCHF 1KXCA 2J94A 5DO4H 2CHAC 2G4UA 5LPRA 4X2VA 1O2SA 3GY8A 3S7KB 4KKDA 1UVUH 2FEQH 2R2WU 1HXFH 3SUFA 1OP0A 1PPEE 3GY7A 2BD7A 3RXEA 3T25A 1B7XB 1EXFA 3PMJA 4J1YA 4YOJA 2Q1JA 3Q77A 4ISNA 1HAIH 3LPRA 4K1TA 4DG4A 1QQUA 2FOBA 4JZIA 3TH4H 5T6DA 1FPHH 2TGTA 2GGVB 1O33A 1DXWA 3UIRA 4KGAA 4KTCA 2YNAA 1UTNA 2PGQB 4I8GA 1LTOA 5JB9S 3AVZA 4OS6A 1WCZA 3QO6A 2QAAA 3ZZAA 1A5IA 1P0SH 1CT0E 3VXEH 1BMLA 2KAIB 3VB4A 1C1UH 1SGNE 3LU9B 1GMDG 1AKSA 3VFEA 4DJZB 4CR9A 1O2LA 3M36A 4X1QU 2GTBA 2GDEH 3RM2H 3WY8A 5DPAA 2F9PA 1A0HB 3MU5A 2Y7ZA 1SHHB 2J38A 2F9UA 4LZ1H 1C2KA 1C2HA 1ELVA 2ZFSA 1Q31A 2Y5GA 3E16B 4B2BA 3BF6H 5ESTE 3PLPA 1PQ5A 1DS2E 3BTEE 1OWJA 1GCDA 2W26A 2BZAA 1NU9A 1P3CA 2F9VA 3HGNA 1GI6A 1GHBF 3ATMA 1H8DH 1P3EA 3DUXH 4WH6A 1IQHA 5ETXA 2AMQA 3DHKH 1UK4A 3M5NA 1EX3A 2BLOA 3SNEA 3VEQB 1N8OC 2A7HA 2VWNA 2BX4A 3MU4A 1F2SE 4H6TA 1O5DH 2PHBA 1AWHB 1Z6JH 2QCYA 1OWDA 3SU4A 2GCTB 3ZVFA 3F9HA 1XUIA 3QUMP 1SGFG 2P3TB 4F4OC 4PROA 4K8BA 2IPHA 4Q7XA 1HAHH 1NN6A 3M5OA 3TJOA 4X2WA 1Y5UT 3KGPA 4LXBH 1O3GA 2A4OA 1PYTD 3GCTG 2PTNA 4UFGH 3O8CA 1Z7KA 1WAYB 2SGFE 1TBZH 2VWOA 2ZECA 4B74A 4ZXXH 1O2NA 1LHDH 2GZ7A 1C5YB 1GJ8B 1G9IE 4NA8A 4Y8ZA 5C67A 1MKXK 3A82A 2PR3A 1OWEA 3EAJA 1O2JA 1K21H 1W8BH 2Q6GA 2AMDA 1A7SA 1CGHA 1E36B 1NT1A 2ZPSA 1LKAA 2ZTZA 4AGKA 1B5GH 1ETSH 2D8WA 1NZQH 1P06A 3RXRA 4AG2A 1O34A 1WYKA 1H9LB 2VVVA 3HK3B 4BAKB 4GPGA 4MPWA 4I32A 1YPHE 4ABBA 2FXRA 5IYTA 1C2JA 3NPSA 2ZPRA 2BD5A 3TNTA 1SPJA 4MPUA 4ABHA 1SFIA 1T4UH 2BDBA 2AEIH 1SGYE 1E37B 2G5VA 3F1SB 3LGIA 3FZDA 1XUKA 2GV7A 1FI8A 2JH0D 1T32A 1ZHPA 3UWJH 1Y5AT 4JZ1A 3STIA 2ZHWH 1DM4B 1ABIH 1C2GA 3SNAA 1DY8A 1TGCA 2JH5D 1BB0B 3A80A 4KELA 3MU8A 2ZKSA 3ZZ7A 1O2UA 2VGCC 2O8TA 1CHOF 5CMXH 4YLUA 3M35A 2FWWA 2C93B 2VINA 2A5KA 1OWHA 2BY9X 4HFPB 1QY6A 1D3DB 3A88A 3SU6A 8GCHG 2JKHA 1GGDC 4XBBA 4OS4A 1GHVH 3M5LA 5GJ4B 1O3IA 1AGJA 2BY7X 1EB2A 1GHAG 3NXPA 2QXGA 1DPOA 3OY6U 2R3UA 2D2DA 4NZLA 3GY2A 3RXCA 1W12U 1P01A 1QURH 3SO3A 1EKBB 1SOTA 1GVKB 2SGPE 3RM0H 5F03A 5JBAS 1CA0C 4ZUHA 2OXSA 3ZVDA 2C4FH 1O0DH 2GZ9A 1EJNA 5EGMA 1XVMA 3TGJE 1P2QA 3FAOA 2Z9GA 1ELEE 1EZXC 2P8OC 1FAKH 3LOXA 3RMNH 1TX7A 4XE4A 1TONA 4B76A 1DANH 2WPLS 4OGXA 1A0LA 3HATH 2HWLB 2O9QA 2ZO3H 1EASA 3NWUA 1QB6A 2PKSB 4AZ2B 1DLEA 3BSQA 1EUFA 2AMPA 1TFXA 1CA8B 3PROA 3RU4T 1EB1H 3LGVA 1VITF 2C8XB 1LHEH 2P16A 2PLXA 4A6LA 3SU0A 5JDUB 1EZQA 1W13U 2R3YA 5LH8A 1W3CA 3TU7H 1G37A 1HCGA 4Z0KA 3SV2H 4XBDA 2Y6TA 3MHWU 2G51A 4ZKOU 1O5EH 4NSVA 3DT0H 3BTHE 1UJ1A 1C5XB 1C2FA 1C1MA 4NIWA 1Z71A 1DXPA 3U1JB 2W7UA 5JPMH 1GBIA 4XOJA 2Y7XA 1Z8IB 1AO5A 3PYHA 3P95A 1FPCH 2Z6BD 3R3GB 3LIWA 4O3UA 1ESAA 2VU8E 2ZU1A 3U9AH 5C3NA 1P9UA 3M7UA 1C5UA 4K1EA 2F9BH 1P9SA 3E91A 1HJAC 1O5CB 3TK5A 2QC2A 4DIIH 1JOUB 3MOCA 6ESTA 1V2LT 1ID5H 1P03A 1D4PB 1DSUA 1T31A 3A7ZA 1HAVB 4X1NU 1T4VH 3KEEA 3PM3A 3NK8A 4JYUH 2GCHG 2BXTH 4FU7A 1QRWA 3DA9B 1MKXH 3AW1A 5LPFA 2A32A 1ELCA 1ZZZA 2BQ6B 2FX6A 1G32B 2VIPA 5FX5A 2Z9LA 1GHZA 4MPXA 6CHAC 1C4Y2 5T6GA 3GISB 2ZG0H 2BD4A 1VCWA 4X8SH 2OQ5A 3PTNA 3RDZA 2PKAA 2NWNA 4K60A 3SNCA 4DY7B 5AHGH 1KTTB 4O97A 2CGAA 4GUXA 3Q76A 5E2OA 3EA7A 1WTHD 2FODA 1RFNA 3PMHB 4ABEA 3RXKA 3D23A 2BMGB 2GV6A 3MH4A 3SGAE 1RXPA 1XKBC 4DVAU 1P2MA 3BIUH 1KXFA 4FXGH 3DFJA 3LC5A 1MCTA 1ZSLA 1GJ5H 3EDXB 2OUAA 1ZGVA 1SGPE 3KQDA 3KF2A 2G8TA 4FUBA 1GI7B 1ZSKA 3GDSA 1LVYA 2V3HH 2ODYB 4UE7H 3V13A 1CO7E 4D8NA 1W0ZU 1IHTH 5LPEA 3TH2H 4D7GA 3SU3A 3O8BA 1A46H 3BTGE 1UHBB 2EA3A 3FZZA 1O5FH 2HGTH 8LPRA 1EPTC 1L1GA 2FOMB 2JETB 1HYLA 2AIPA 2QA9E 2NU3E 2J2UA 5DG6A 5T3HA 3RXGA 4AG1A 2AIQA 1OP2A 3KL6A 1BBRE 1D3TB 2ALPA 3GDVA 1YPHC 1U6QA 2CHAB 3SI3H 2UUFB 3CP7A 1GBBA 3FP6E 3T29A 1S5SA 3UWIA 1HIAA 1O5AB 1WV7H 3T26A 1UVSH 1OX1A 4I31A 1S6FA 1C2IA 2OP9A 4JK6A 1FJSA 1T7CA 1CE5A 2BQWB 2H6MA 2TGAA 2NU4E 1Z1IA 1KDQB 1QRXA 3UREA 1W11U 3RC6A 2GX4A 4WWYA 4AFUA 1C5QA 3KNXA 4B1TA 3RMMH 2XCNA 3A85A 4MLFB 1O3MA 3LGYA 2FI5E 3E0PB 3PMAB 5PTPA 1HAPH 4INKA 1WSSH 2HNTE 3ZVCA 3M37A 4BAHB 2VNTA 2TGDA 7GCHG 1CHGA 2XRCA 5CE1A 1QJ6B 1BRUP 3O8RA 4I8JA 1SBWA 2SGEE 1GBAA 3AAUA 1BRBE 2SGDE 3ATLA 3T28A 3ZVEA 5FHTA 1QTFA 5F8ZA 4CRFA 2HLCA 4INHA 5EXNA 3JZ1B 1BTZA 3E8LA 1O3CA 1FNIA 2ANKH 4NIXA 3BTQE 3E0NB 1GI0A 4GSOA 1BTWA 1LVOA 1YGCH 1FONA 2BD8A 4FUGA 1IOEA 1PPGE 2ODQA 4YLQH 3V12A 1O3LA 1N8OB 9ESTA 1DDJA 1GMDF 2HPPH 1HFDA 1P8VC 2BTCE 2ZFQH 3A7WA 3DFLA 4UFFH 5JBCS 1E0FD 1QBNA 3MMGA 1BMNH 1O30A 1QL7A 1D6WA 1LPKB 1VJAU 2PWXA 2WPIS 2HPQH 2Z94A 1P09A 2RA3A 1DWCH 4Y8XA 2F9OA 5JYIA 2BVSH 4FVBA 2J9NA 2YNBA 3EA9A 1BUIA 1QJ7B 2ILNA 3ZZDA 5EU8A 1L2EA 2VWLA 2ZCLP 1MKWK 5HGGA 3QZQA 4ZKSU 4DT7B 1AFQC 4FUIA 2QXJA 1YP9A 1IQJA 3F9GA 3D65E 1CGIE 3PO1C 2EI8A 4WY3A 3TLOA 1ANBA 1W7GH 3BG8A 1GBMA 1Z1JA 1C9PA 2XTTB 3D49H 1P05A 5EW1H 1TNGA 3LGTA 4Q7YA 2ZDNA 1EQ9A 1A4WH 1NRRH 3F9EA 3I29A 1AU8A 1GDQA 2G5NA 5EPYA 1ESBA 1OS8A 4ISHH 3F6UH 4OS1A 2FOHA 2CJIA 4ISLA 4YOGA 1FY3A 1UK2A 5CHAC 4AB8A 1FY5A 5C1YA 1C5TA 1LCYA 1V6DA 4MG3A 1XUJA 2WUCA 1TGBA 5EG4A 2JETC 1C5WB 1ELTA 4RN6A 4ZH8A 3SUGA 1K1IA 1PPFE 2ZQ2A 2VGCB 5A09A 3BIVH 2FS8A 2FYQA 1FMGA 1AE5A 2FPZA 3LJJA 2HOBA 4F49A 4HZHA 1OSSA 2EI6A 2H5DA 1GGDB 4NWLA 2ANWA 3SHAH 3P6ZB 3GYMA 1ZMJA 1FUJA 1VJ9U 4NIVA 4JYVH 1C1VH 4I8KA 1EAIA 1DITH 1G2MA 1RRKA 3ZYEA 1AI8H 5EODA 1BTUA 1CA0B 3TJUA 3TVJB 1NESE 1TA2A 1H4WA 1Y3YA 1V2PT 4Y11E 3SZNA 1ZTKA 3QLPH 1GBHA 1L4DA 5DP5A 5A0AE 2P8OB 1GG6C 1GWAA 4WXIA 5FXLA 2FMJA 1YLDA 2V3OH 1FDPA 4Y10E 2XW9A 7KMEH 1F0RA 5C1XA 1VR1H 1S81A 2FIRH 5L2YH 3M3VA 1KXAA 1L0ZA 1NFWA 4JZEH 4MPVA 2VH0A 2OCVB 2FO9A 1N6XA 1O5GH 1GBLA 2A4RA 2XBWA 4YESB 4H42U 1V2WT 1BMAA 1YKTA 4ISOA 1TE0A 1P11E 2CXVA 1MD7A 1ANCA 5IDKA 4Q80A 1PFXC 2TGPZ 4NSYA 3K9XB 1V2TT 1PYTC 1LHCH 3EYDA 2ZDMA 3P8FA 1TRYA 1O3HA 1DLKB 3URCA 3F68H 2VWMA 2FLRH 4AORA 5EQRA 1SLXB 1ZR0A 3P8NA 2IJOB 3RXMA 3GCOA 4E06H 5EPNA 4AFSA 5DP3A 2BDIA 2BY8X 5L2ZH 4CR5A 1QNJA 3FP8E 4BANB 4X1RU 3QZRA 1TNKA 2WPMS 3BTME 3ZZ6A 4NIYA 3SQEE 1OYQA 2FOCA 4DCDA 2BDCA 4BAMB 2FTLE 2ZP0H 3JZ2B 4X2YA 1NPMA 1NRSH 2BLWA 4TWWA 3L33A 4K1SA 2HNTC 1OXGA 1JIMA 1HJAB 2QY0B 1GBKA 2AH4X 3MO6A 3LJOA 3PWBA 4K2YA 1O39A 1A3BH 5DGJA 1QBVH 1NTPA 1P57B 1TNJA 1O36A 1MKWH 1AWFH 3MU0A 3GCNA 4RSPA 3NZIA 2R2MB 1AUTC 1FLEE 1XUHA 1C5ZB 2BDAA 1Z8RA 3RUOA 6CHAB 2ZTYA 4GCHG 3TJNA 3U1IB 2BLQA 2HVXA 1PQ8A 1P2KA 3GDUA 2VVCA 5A8ZA 3IG6B 4ISIH 2STAE 4Y8YA 5E8EH 1GPZA 1GI5A 1BJVA 2QIQA 1DX5M 1SLVB 2AYWA 1HV7A 1GJAB 1BOQA 1V2QT 2ZDVH 3MH5A 2P94A 1UCYE 1Y8TA 1ANEA 3GCHC 1AVWA 6LPRA 3S7HB 1NRNH 3BG4C 2DE8A 4I8LA 3SUEA 3QK1A 1GJ9B 3K65B 3MWIU 2LPRA 3SJ8A 4M7GA 1H8IH 1UTQA 4K69A 3RC4A 1O3EA 3UOPA 1MBMA 4BTTB 2A4GA 2PFEA 3IITA 3CENA 5EXLA 1O2GH 3EQ0H 2ZGHA 1SFQB 4HI3A 1TPAE 1D9IA 1MZAA 3E90B 1GJ4H 4I33A 1EPTB 3QTOH 1XM1A 2GVFA 2XBVA 4JCNA 1O32A 1J8AA 3PMBB 3UTUH 5FAHA 8ESTE 1G3CA 3A8BA 2FX4A 1SB1H 1KLTA 1BDAA 1YM0A 2AERH 3B23B 1QFKH 1G36A 1UK3A 2ZU5A 1OPHB 1TPSA 2PSXA 1V2ST 1O2OA 3M7TA 4J2YB 1O31A 2C90B 2DUCA 1GHBG 1O3KA 1EZUC 2EI7A 3SU2A 2WPHS 4BXSA 3TK6A 4MNVA 1GL0E 2BLVA 2QN5T 1ARCA 2OBOA 1WOFA 1C1OA 1G3DA 2QF0A 1FQ3A 1W14U 1S84A 2BD2A 1BBRK 1CGJE 4MNXA 2ZCHP 4O9VA 1H9HE 1HAVA 2BDYA 4WXVA 2OC7A 3M5MA 5E2PA 5EQSA 3MTYA 4A5TS 1MTNC 3MNBA 1EAWA 2UWLA 2XWBI 1EAXA 1P2OA 1PQ7A 1SGIB 1A61H 5DP9A 2ZHDA 2PGBB 4Q2KA 1GJ7B 2VIWA 3RMLH 1EOJA 1GJDB 2CMYA 2I6SA 4FUHA 4MNWA 1C1RA 2G52A 3KQBA 3FVFB 2DE9A 3SBKA 1Q3XA 2ZCKP 3A81A 3L6PA 1C1SA 4CRDA 5DP6A 5A0CA 2VIVA 3ODFA 1PJPA 3A86A 3GY4A 1MU6B 4IN1A 2BVXH 1PPCE 1BTYA 4ABIA 4ZHLU 2ZHEH 3A83A 1JXPA 1RTLA 4YT7H 3HKJB 1O2VA 4OS2A 3VXFH 1TPPA 1IQMA 1ORFA 3CS0A 4ZMAH 5F8TA 2UWOA 4X6NA 4K8YA 4GHQA 3E1XB 3NUMA 2GD4B 1INCA 1YPMH 4A1XA 1TMTH 1A2CH 1TB6H 1V2VT 4BOHA 4R8TB 3GY3A 1XUGA 2ZGJA 2STBE 5BPEA 4AYVB 5A2MH 2ZFPH 1LO6A 3S69A 2J95A 2A7CA 4I7YH 1PPZA 1GMCF 1BCUH 3ODDA 1GI1A 1MD8A 4SGAE 2JH6D 2RA0A 1GDNA 1ELDE 1G30B 1UHBA 1CT4E 3VGCC 3V7TA 4IMZA 1TNHA 3UQOA 1O3BA 2BM2A 3G01A 4BAQB 1JRTA 4X0WU 4GVUA 1ZPBA 1QBOA 1CHOG 1K22H 3MO9A 2GT8A 1FN8A 4CRCA 4NA9H 3QX5H 5ABWA 2FTMA 1C1NA 4NCYA 3LGWA 2LIZA 1YC0A 1AFQB 4JZDH 1C2DA 5AF9H 3PO1B 1A1RA 1CSOE 1GJCB 1JIRA 2RCEA 2ZDAH 1BTXA 4D76A 1G3BA 1KDQA 1TQ7B 3PB1E 1O3DA 3RXFA 3K6YA 3RU4D 1P2JA 1M9UA 2PSYA 4ASHA 3UNSA 8KME2 3RXPA 3IWMA 3ENSB 1HAXB 4U30A 5K7RA 2ZGBH 2IOTA 1S0RA 4Y76A 2BZ6H 2FYRA 1PPBH 3C1KA 2J34A 3TGIE 1O5BB 2BVRH 4CREA 5I25A 5JB8S 2F9NA 1D3PB 2FM2A 1B0EA 2ZA5A 2J4IA 1Y3VA 1W0YH 3LT3A 3SN8A 3N7OA 1RD3B 4CHAC 5FPSA 2A2XH 2OLGA 1TPOA 1FIWA 3T62A 1QJ1B 5CHAB 1MAYA 1KXEA 1SC8U 3ATWA 3VB7A 4KTUA 1O38A 1C5LH 3S9CA 1C2EA 2QYIA 1DWBH 1GI9B 1X7AC 1S85A 1YBWA 1BTPA 3H5CB 2I6QA 1VITG 1F0TA 2Z3EA 5EXMA 5GXPA 1GDUA 4YZUA
chains in the Genus database with same CATH superfamily
1BRCE 4OS5A 4ACBA 7LPRA 1O3NA 3FO8D 3RXUA 1TBRH 2ULLA 4ABAA 1O2MA 3A7VA 1VGCC 4UFDH 4X8UH 1SSXA 3BEFB 1ZTJA 2O8UA 1GMHF 1CQQA 4DGJA 5A0BA 1QL9A 2BYAX 3RXQA 2OBQA 1C5VA 2ZC9H 1Y3UA 5FBIA 2NU1E 2GMTC 1SOZA 2OTVA 3ZV9A 2ZTXA 2Y5FA 1KSNA 3P70B 5GNDA 4LOYH 5KEDA 4Y0ZE 3P8OA 1BBRH 1TMUH 2CF9H 3KQEA 1EP5A 1O2KA 2RDLA 1GBTA 5TCAA 3KQ5A 5C1UA 1SGDE 2QXHA 1IQFA 3CNRA 1FN6A 4P00A 4UDWH 2HLDD 1K1MA 2FOFA 1GG6B 1O2IA 3VB5A 1CVWH 2FESH 2PTCE 5DKMA 4ZKNU 1QB9A 3OEHD 3Q00A 5C2ZA 5F6MA 3UOUA 1WQSA 3SGQE 1YWUA 4CBOA 1E34B 1BZXE 4ZHMU 1QZ8A 2A0QB 4NFFA 1OHHD 4B2AA 1GI3A 3SI4H 1J15A 2H1UA 2ZHFH 5GDSH 3PV4A 3UAIC 1Q2WA 4WMFA 4CH2B 4QT8C 3OU0A 4IN2A 5L30H 9LPRA 2SNWA 5FCKA 4H6SB 4DIHH 1UTOA 3U98H 2XWAA 1K1NA 1YF4A 1ELFA 3SUDA 5C5NA 4JYTA 1C5MD 7ESTE 1KYNA 3UR9A 1VCQA 4Y0YE 3VPKA 2BX3A 2C8YB 1F92A 3V3MA 1S6HA 2FDAA 2Z3DA 2THFB 2QXIA 2J98A 1UTMA 3P8GA 1SGTA 1SLUB 2NU0E 1C4V2 1GJBB 3T2NA 4BTIB 1C4U2 1EATA 2G55A 1Z8JB 4THNH 2W6JD 1MZDA 3A87A 2WV4A 4TY6A 1DICA 1JWTA 1ZJKA 4RKOB 1GBJA 3TJVA 2GP9B 2HRVA 1DVAH 4D7FA 5GCHG 2ZU4A 2ALVA 4XBCA 3SNDA 1GBCA 2GDDA 3SV8A 1J16A 3ZZ3A 4XFQA 1NFUA 2J5UA 1LDTT 2F4LA 2P93A 1DWDH 1E35B 1OOKB 3EBNA 1KY9A 3BTWE 3A84A 3U8TH 4BAOB 1E79D 3H09A 1O2WA 1DE7H 1O2TA 1K0HA 2B8OH 2FI3E 4XDEA 2B0FA 3Q3XA 4X6OA 4LZ4B 2B7DH 1SG8B 1SQTA 5H4IB 3A7YA 2VVUA 1IQLA 3UB0A 1UVTH 3E3TA 1C9TA 5C5OA 2KAIA 2WPDD 1BJUA 1QA0A 1TRMA 3GCTF 5E0HA 1ANDA 2KR7A 4GLYA 3TK9A 1RTKA 4TT3D 1FXYA 2PW8H 3RXAA 2R9PA 1NFXA 3C27B 1SMFE 3MNCA 2OINA 1HRTH 1SQOA 1ABJH 1P2IA 3RC5A 3OTJE 1AQ7A 4GAWA 4Y79A 3TITA 1S0QA 4YOIA 2ZGCA 2ZEBA 3GCHB 5HM9A 3O8DA 1XVOA 3BG4B 4ZAEA 4ABFA 1GI8B 1NU7B 4X1SU 2BXUH 1V2OT 3FANA 4X1PU 1CU1A 1IQEA 1QL8A 3ELAH 1QRZA 3SNBA 2PP6A 5EW2H 2OD3B 3KQCA 4FETA 1XX9A 2CF8H 1DSTA 3GY5A 2V35A 2BB4A 1AMHA 4IW4E 1UCYK 5J4SA 1C5SA 4Y6DA 3MO3A 5EOKA 3ATKA 4IBLH 1FX0B 3F3BA 3ZZ4A 2BY6X 1OKXA 1VITH 3EE7A 2C3SA 1FV9A 1L1NA 2KX4A 2XC5A 3SORA 1MTVA 1GCTC 6GCHG 1CT2E 4MQAA 3ZVGA 3SW2B 1F0SA 1MABB 2KZ4A 1K1OA 2O8LA 1MTUA 4WH8A 5C20A 3PV5A 2ZGXH 2ZIQH 3UR6A 5GIBA 1LQEA 1QQ4A 1NRPH 2R0LA 8GCHF 2TBSA 3SJIA 3NCLA 4TPYA 1SGCA 4FUJA 4A1TA 1GHAF 2OQUA 3RXOA 2W6ID 5FBEA 1V3XA 2FZZA 3WW7A 1DUAA 2PUQH 5DP4A 1TNLA 1O2QA 1MTNB 2FI4E 3OY5U 1AD8H 1BA8B 4H4FA 2A31A 3RU4E 2K1QA 1AVXA 1HJ9A 4TPIZ 2Q6FA 5EQQA 3BN9A 3EE0B 4AX9H 5HXFA 1P04A 1WUNH 1ACBE 1AE8H 1J17T 2RG3A 2ZQ1A 3MFJA 4YTAA 2YMSD 1CBWC 4IMQA 1KLJH 2R0KA 2SGQE 5GPIB 4IGDA 1UTKA 4LK4A 5HMAA 2B9LA 2H9EH 2OC0A 2QF5A 1LKBA 3D62A 1ESTA 2GKVE 3MH7A 3URDA 1LHFH 4TYDA 4Y7AA 1RJXB 2PV9B 3FP7E 1WDIA 1A0JA 1TMBH 5E0GA 3SV6A 1QA7A 1NBMD 4NG9H 2AGIX 1AVGH 2QGRA 2V6NA 3LH1A 4I8HA 3A8DA 5DSFA 3SV7A 3P92A 1SGEE 4WMEA 1EOLA 5EJZA 3NKKA 2XC0A 3AASA 1K1PA 3B9FH 3ZYDA 2WPJS 3LC3A 1L1JA 2NU2E 3U8RH 3HKIB 4IS5A 1XXDA 1NRQH 4MTBA 3A8CA 4VGCC 2Z7FE 2ASUB 4RKJB 1AKSB 1YPJH 1ZRBA 1WTGH 2HNTF 1RTFB 4I86A 5F8XA 2EEKA 1SQAA 1RIWC 3ITIA 4ABDA 1Z8GA 3MI4A 4DT4A 1OP8A 1ZPZA 3RXDA 1N1LA 4U01A 4X6MA 3VGCB 1EPTA 1MQ5A 2G4TA 5DP8A 5EJ1A 1YPGH 1GL1A 1AHTH 3MNXA 1K28D 3TNSA 1O3AA 3ZVBA 1WQVH 4WF8A 1K9OE 1TIOA 3TPIZ 3H7OA 2ZU2A 2M5TA 5JBTA 1Y5BT 1THPB 1GBEA 2QV1A 1PPHE 3F2FA 4BTUB 3VB3A 5LGOA 1THRH 4MNYA 2ZWLH 1GHYH 1GHXH 2AGGX 2C8ZB 5A8XA 1YCPK 1O2RA 3RLYH 4E7RG 3KCGH 3QWCH 1LHGH 2BDHA 2QF3A 3S9AA 2XYAA 1BRAA 1O37A 2H2ZA 1XUFA 4FU8A 1IQIA 1HJ8A 2WYJA 1EJAA 1MH0A 2PUXB 1DFPA 1AB9B 5FPYA 1NFYA 4DOQA 2GCHF 1HBTH 3SU1A 3I78A 4ABGA 4JMYA 5DK1A 1AY6H 3QTVH 2BD3A 4B71A 3LONA 5A8YA 1VZQH 4MDSA 1XKAC 2ODPA 3A7TA 4B73A 3KHVA 3RMOH 3U8OH 5FCRA 4CRBA 1EZSC 1MUEB 2FOAA 3B8JA 1C5NH 4B2CA 1O35A 3GOVB 5DJ7A 3CS7A 1HPGA 2GJGA 2VIQA 1IQNA 4FVDA 1BT7A 1TABE 4ESTE 1AUJA 3F2HA 4R0IA 4CHAB 2WV5A 3F9FA 1HUTH 1ZGIA 4YT6H 4D9RA 1LQDB 1UCYH 4Y7BA 3RXBA 1O3JA 1ELGA 1Y59T 1UMAH 5KGOA 1MAXA 2VIOA 1TALA 1GI2A 1W7XH 3SGBE 2RDEA 1E38B 1F5LA 1F5KU 1T8OA 1HAGE 2BOKA 2P3UB 1ZHMA 1RS0A 3SQHE 1TRNA 3FOAA 3SOSA 1DUEA 1VGCB 1MU8B 1DY9A 2K8IA 1ZJDA 2W7SA 3STJA 4E05H 1C1WH 1THSH 2TIOA 1KTSB 1SLWB 1K1LA 2GT7A 1EP6A 3OSYA 2FOGA 1ZYOA 1TGNA 4E7NA 2GMTB 2W3KA 4X2XA 4FUCA 1GBDA 1TQ0B 4CBNA 2BQ7B 4AGJA 1N6YA 2D1JA 1HB0B 1S82A 4DW2U 3ZZ9A 2XXLA 3T5FH 5TJXA 1C2LA 1JRSA 3BV9B 2OC1A 1LVBA 4AN7A 1V2RT 1HDTH 1H1BA 1HLTH 3F0PA 1WU1A 2ZU3A 1AZ8A 1A5GH 3HK6B 2WUBA 2HVYB 1GHWH 4WJG2 2YOLA 1HAOH 1Z6EA 4NGAH 1HNEE 4NZQA 2A5IA 2ZF0H 1C1QA 1QGFA 2UUYA 1FY8E 1V2UT 4AFZA 1UTLM 4K3JA 2F91A 3GY6A 3UQVA 1JBUH 2ESTE 2WYGA 1A5HA 3L3TA 3RXTA 1F7ZA 4YM9A 1TNIA 2Y80A 1C5PA 1SGFA 2Z9IA 4UFEH 5AFYH 1O3OA 2IN2A 1SI5H 4D9QA 3S0NA 2ANYA 1ELBA 1FAXA 2SNVA 3OE7D 5FX6A 1C1TA 1UTJA 3UNQA 1P12E 2GCTC 3QDZB 2C8WB 1HAYB 2VB0A 2A5AA 2K7XA 3BTFE 1VCPA 5AVDA 1V2NT 1O2YA 1BITA 4U32A 1V2KT 2KCOA 3H7TA 5HM2A 2KCAA 1GVLA 1TLDA 1QCPA 5B6LA 7GCHF 4FUFA 1SR5C 1C1PA 3HPTB 2A45B 1NY22 3ZV8A 1QR3E 3Q3YA 3QGNB 4RT0A 1W10U 4FUEA 4ZXYH 2UWPA 1F0UA 1FY4A 1NM6A 4CH8B 5ESBA 4X8VH 3SJ9A 4SGBE 1YLCA 1K2I1 2ZFFH 5SGAE 4NWKA 1H9IE 1SHYA 3ZZ5A 5T6FA 3KIDU 1TAWA 3QGJA 2G81E 2SGAA 1V2JT 1YCPM 1O3FA 4O3TA 2V7QD 1MBQA 3MU1A 1ZMNA 3SU5A 2XBYA 1FIZA 4JZFH 4XSKU 4B75A 1XXFA 1TYNA 3K6ZA 1TBQH 2XNIA 4FUDA 2VH6A 1NC6A 5I46H 2H5CA 2GZ8A 1YPKH 2XBXA 3PV2A 3OYPA 4Z6AH 3EA8A 1BHXB 3W94A 1T8LA 1AB9C 5C0TA 2L74A 1YCPH 1LPZB 3ZVAA 5DP7A 1GVZA 4K5ZA 4NA7A 3UPEA 1OYTH 3MNSA 1IHSH 2VJ1A 3A89A 3GICB 1UO6A 4MVNA 1OWKA 2LNCA 3M61U 1ZRKA 4AOQA 1DWEH 4X6PA 1P10A 1C2MA 1O2ZA 3AW0A 1DT2A 2Y81A 1YPEH 4BNRA 2BY5X 4ABJA 5GCHF 2Y5HA 3BEIB 2O8WA 3M3SA 1UVPA 1RGQA 1MTWA 2ZI2H 4AFQA 2ZZUH 4Z1MD 2Q6DA 1LVMA 1TA6A 1TX8A 1XMNB 2V0BA 1IQKA 4IC5A 2RFKC 2ZHQH 1SGQE 1SVPA 3T27A 3BTTE 3LKWA 4A7IB 1TGSZ 4AYYB 1MQ6A 1NBME 4INLA 1A3EH 1C5RA 3KN2A 5B6OA 1TOMH 5L6NH 1E1QD 3A8AA 1O2XA 1TGTA 3ZZ8A 2F83A 2AS9A 2SFAA 5E0JA 1T8NA 4AB9A 3UFAA 4TSFD 3SHCH 4DURA 1IQGA 1Y3WA 2A7JA 4X8TH 1DOJA 4B6FA 5HYOA 1P02A 3P17H 4BXWA 2ZPQA 3GYLB 3KYFA 2A2QH 2CV3A 3K2UA 2PKAB 1FZZA 1ETRH 3S9BA 4A1VA 2A1DB 4WVPE 1UTPA 3SJOA 3ESTA 1BTHH 2CN0H 2O8MA 2P95A 1K1JA 2J92A 1ZLRA 1ZSJA 1O2PA 4TWYA 1Y3XA 2P3FH 5J4QA 1WBGB 4OGYA 2PKSC 2FOEA 3RXHA 1GCTB 3TH3H 3RLWH 3RXSA 3RP2A 3BEUA 1QHRB 2A4QA 1ETTH 1WXRA 5F53A 1TX6A 2ZDLA 1D3QB 2F3CE 1C5OH 3MH6A 4HTCH 3TGKE 2JJ2D 1EJMA 3F2GA 1KXDA 3PLKA 1AN1E 1OWIA 3OX7U 3W95A 3QN7A 2ANMH 2WPKS 3AAVA 1MMJN 3DSGA 4Q7ZA 3LDXH 4KTSA 1O2HA 1YYY1 1ZPCA 1TWXB 3E6PH 3FFGA 1ARBA 2CK3D 1GMCG 4OS7A 4WMDA 2FLBH 4U2WA 1YPLH 3RXVA 5JBBS 1KIGH 4UONA 1J9CH 2AFQB 3PWCA 1CBWB 1F5RA 3A7XA 4FU9A 1LMWB 2TRMA 3ZZBA 1QIXB 3PTBA 1NROH 1EAUA 4CRGA 1ZMLA 2XC4A 3I77A 6GCHF 3M7QA 2Z9JA 1MTSA 1AFEH 1HIAB 2BOHB 1D6RA 1HXEH 2UUJB 1JMOH 1B0FA 4YO9A 1HAZB 1NS3A 1SL3A 2Z9KA 1ZTLA 4A92A 4ZKRU 3TIUA 3N7DA 1O3PB 1W2KH 3LH3A 5C0UA 4F48B 3UUZA 2BD9A 1MCVA 1NO9H 2W5EA 3UNRA 3VB6A 1QB1A 2OC8A 2ZFTA 1IAUA 3Q3KA 3MYWA 4CRAA 1ZHRA 2D26C 3LGUA 1AZZA 4VGCB 3M3TA 2FS9A 3DD2H 3RXLA 2Z3CA 4IC6A 2B5TB 5AFZH 1GBFA 1BQYA 3EGKH 4Y71A 1RIWB 1GJ6A 3RXIA 1SGRE 4UEHH 1V2MT 4O03A 1KLIH 1BIOA 2HALA 3PLBA 2EC9H 2ZFRH 2XCFA 2TPIZ 3RXJA 2W3IA 1BHXF 3HGPA 1L4ZA 1LPGB 2P59A 2ZDKA 2VIDA 1T8MA 4UD9H 2ZNKH 5FPTA 5CHBA 5G4BA 3ZZCA 1AIXH 3BTKE 3SJKA 1FY1A 3SYJA 2WINI 4TY7A 5K0HA 3R0FA 1HGTH 2AGEX 5GWZA 1TOCB 1G3EA 1GMHG 2H9HA 1GI4A 5TCCA 5T1VA 2BDGA 4KP0A 1G2LA 2G00A 1KXBA 2FP7B 2IPQX 3BTDE 4HGCA 3SV9A 4JK5A 1ZOMA 4GHTA 4ZROA 2H9TH 2Y82A 2UUKB 1J14A 1P2NA 3V0XA 5BRRE 2BHGA 3U69H 1UVOA 3ATIA 4NFEA 4ZHAA 3UY9A 1S83A 1BMMH 1ELAA 1PQAA 4GCHF 4RT1A 1KXCA 2J94A 5DO4H 3PRBA 2CHAC 2G4UA 5LPRA 4X2VA 1O2SA 3GY8A 2L6OA 3S7KB 4KKDA 1UVUH 2FEQH 2R2WU 1HXFH 3SUFA 1OP0A 2V3MA 1KMHB 1PPEE 3GY7A 2BD7A 3RXEA 3T25A 1B7XB 1EXFA 3PMJA 4J1YA 4YOJA 2Q1JA 2KFWA 3Q77A 4ISNA 1HAIH 3LPRA 4K1TA 4DG4A 1QQUA 2FOBA 4JZIA 3TH4H 5T6DA 1FPHH 2TGTA 2GGVB 1O33A 1YLNA 1DXWA 3UIRA 4KGAA 4KTCA 2YNAA 1UTNA 2PGQB 4I8GA 1LTOA 5JB9S 3AVZA 2YMSC 4OS6A 1WCZA 3QO6A 2QAAA 3ZZAA 1A5IA 1P0SH 1CT0E 3VXEH 1BMLA 2KAIB 3VB4A 1C1UH 1SGNE 3LU9B 1GMDG 1AKSA 3VFEA 4DJZB 4CR9A 1O2LA 3M36A 4X1QU 2GTBA 2GDEH 3RM2H 3WY8A 5DPAA 2F9PA 1A0HB 3MU5A 2Y7ZA 1SHHB 2J38A 2F9UA 4LZ1H 1C2KA 1C2HA 1ELVA 2K0QA 2ZFSA 1Q31A 1S6LA 2Y5GA 3E16B 4B2BA 3BF6H 5ESTE 5EIYA 3PLPA 1PQ5A 1DS2E 3BTEE 1OWJA 1GCDA 2W26A 2BZAA 3WWBA 1NU9A 1P3CA 2F9VA 3HGNA 1GI6A 1GHBF 3ATMA 1H8DH 1P3EA 3DUXH 4WH6A 1IQHA 5ETXA 2AMQA 3DHKH 1UK4A 3M5NA 1EX3A 2BLOA 3SNEA 3VEQB 1N8OC 2A7HA 2VWNA 1UW7A 2BX4A 3U28C 3MU4A 1F2SE 4H6TA 1O5DH 2PHBA 1AWHB 1Z6JH 2QCYA 1OWDA 3SU4A 2GCTB 3ZVFA 3F9HA 1XUIA 3QUMP 1SGFG 2P3TB 5FL7D 4F4OC 4PROA 4K8BA 2IPHA 4Q7XA 3WWFA 1HAHH 1NN6A 3M5OA 3TJOA 5IK2D 4X2WA 1Y5UT 3KGPA 4LXBH 1O3GA 2A4OA 1PYTD 3GCTG 2PTNA 4UFGH 3O8CA 1Z7KA 1WAYB 2SGFE 1TBZH 2VWOA 2ZECA 4B74A 4ZXXH 1O2NA 1LHDH 1W0KD 2GZ7A 1C5YB 1GJ8B 1G9IE 4NA8A 4Y8ZA 5C67A 1MKXK 3A82A 3PRDA 2PR3A 1OWEA 3EAJA 1O2JA 1K21H 1W8BH 2Q6GA 2AMDA 1A7SA 1CGHA 1E36B 1NT1A 2ZPSA 1LKAA 2ZTZA 4AGKA 1B5GH 1ETSH 2D8WA 1NZQH 1P06A 3RXRA 4AG2A 1O34A 1WYKA 1H9LB 2VVVA 3HK3B 4BAKB 4GPGA 4MPWA 4I32A 1YPHE 4ABBA 2FXRA 5IYTA 1C2JA 3NPSA 2ZPRA 2BD5A 3TNTA 1SPJA 4MPUA 4ABHA 1SFIA 1T4UH 2BDBA 2AEIH 1SGYE 1E37B 2G5VA 3F1SB 3LGIA 3FZDA 1XUKA 2GV7A 1FI8A 2JH0D 1T32A 1ZHPA 3UWJH 1Y5AT 4JZ1A 3STIA 1EFRD 2ZHWH 1DM4B 1ABIH 1C2GA 3SNAA 1DY8A 1TGCA 2JH5D 1BB0B 3A80A 4KELA 3MU8A 2ZKSA 3FKSD 3ZZ7A 1O2UA 2VGCC 2O8TA 1CHOF 5CMXH 4YLUA 3M35A 2FWWA 2C93B 2VINA 2A5KA 1OWHA 2BY9X 4HFPB 1QY6A 1D3DB 3A88A 3SU6A 8GCHG 2JKHA 1GGDC 4XBBA 4OS4A 1GHVH 3M5LA 5GJ4B 1O3IA 1AGJA 2BY7X 1EB2A 1GHAG 2OK5A 3NXPA 2QXGA 1DPOA 3OY6U 2R3UA 2XOKD 2D2DA 4NZLA 3GY2A 3RXCA 1W12U 1P01A 1QURH 3SO3A 1EKBB 1SOTA 1GVKB 2SGPE 3RM0H 5F03A 5JBAS 1CA0C 4ZUHA 2OXSA 3N99A 3ZVDA 2C4FH 1O0DH 2GZ9A 1EJNA 5EGMA 1XVMA 3TGJE 1P2QA 3FAOA 3DCLA 2Z9GA 1ELEE 1EZXC 2P8OC 1FAKH 3LOXA 3RMNH 1TX7A 4XE4A 1TONA 4B76A 1DANH 2WPLS 4OGXA 1A0LA 3HATH 2HWLB 2O9QA 2ZO3H 1EASA 3NWUA 1QB6A 2PKSB 4AZ2B 1DLEA 3BSQA 1EUFA 2AMPA 1TFXA 1CA8B 3PROA 3RU4T 2IJD1 1EB1H 3LGVA 1VITF 2C8XB 1LHEH 2P16A 2PLXA 4A6LA 3SU0A 5JDUB 1EZQA 1W13U 2R3YA 5LH8A 1W3CA 3TU7H 1G37A 1HCGA 1BMFD 4Z0KA 3SV2H 4XBDA 2Y6TA 2JDID 3MHWU 2G51A 4ZKOU 1O5EH 4NSVA 3DT0H 3BTHE 1UJ1A 1C5XB 1C2FA 1C1MA 4NIWA 1Z71A 1DXPA 3U1JB 2W7UA 5JPMH 1GBIA 4XOJA 2Y7XA 1Z8IB 1AO5A 3PYHA 3P95A 1FPCH 2Z6BD 3R3GB 3LIWA 4O3UA 1ESAA 2VU8E 2ZU1A 3U9AH 5C3NA 1P9UA 3M7UA 1C5UA 4K1EA 2F9BH 2KM0A 1P9SA 4HG6A 3E91A 1HJAC 1O5CB 3TK5A 2QC2A 4DIIH 1JOUB 3MOCA 6ESTA 1V2LT 1ID5H 1P03A 1D4PB 1DSUA 1T31A 3A7ZA 1HAVB 4X1NU 1T4VH 3KEEA 3PM3A 2M2AA 3NK8A 4JYUH 2GCHG 2BXTH 4FU7A 1QRWA 3DA9B 1MKXH 3AW1A 5LPFA 2A32A 1ELCA 2JJ1D 1ZZZA 2BQ6B 2FX6A 1G32B 2VIPA 5FX5A 2Z9LA 1GHZA 4MPXA 6CHAC 1C4Y2 5T6GA 3GISB 2ZG0H 2BD4A 4M9FA 1VCWA 4X8SH 2OQ5A 3PTNA 3RDZA 2PKAA 4Q63A 2NWNA 4K60A 3SNCA 4DY7B 5AHGH 1KTTB 4O97A 2CGAA 4GUXA 3Q76A 5E2OA 3EA7A 1WTHD 2FODA 1RFNA 3PMHB 4ABEA 3RXKA 3D23A 2BMGB 2GV6A 3MH4A 3SGAE 1RXPA 1XKBC 4DVAU 1P2MA 3BIUH 1KXFA 4FXGH 3DFJA 3N7EA 3LC5A 1MCTA 1ZSLA 1GJ5H 3EDXB 2OUAA 1ZGVA 3OAAD 1SGPE 3KQDA 3KF2A 2G8TA 4FUBA 1GI7B 1ZSKA 2WV9A 3GDSA 1LVYA 2V3HH 2ODYB 4UE7H 3V13A 1CO7E 4D8NA 1W0ZU 1IHTH 5LPEA 3TH2H 2AHME 2LP6A 4D7GA 3SU3A 3O8BA 1A46H 3BTGE 1UHBB 2EA3A 3FZZA 1O5FH 2HGTH 8LPRA 1EPTC 1L1GA 2FOMB 2JETB 1HYLA 2AIPA 2QA9E 2NU3E 2J2UA 5DG6A 5T3HA 3RXGA 3GS9A 4AG1A 2AIQA 1OP2A 3KL6A 1BBRE 1D3TB 2ALPA 3GDVA 1YPHC 1U6QA 2CHAB 3SI3H 2UUFB 3CP7A 1GBBA 3FP6E 3T29A 1S5SA 3UWIA 1HIAA 1O5AB 1WV7H 5C94A 3T26A 1UVSH 1OX1A 4I31A 1S6FA 1C2IA 2OP9A 4JK6A 1FJSA 1T7CA 1CE5A 2BQWB 2H6MA 2TGAA 2NU4E 1Z1IA 1KDQB 1QRXA 3UREA 1W11U 3RC6A 2GX4A 4WWYA 4AFUA 1C5QA 3KNXA 4B1TA 3RMMH 2XCNA 3A85A 4MLFB 1O3MA 3LGYA 2FI5E 3E0PB 3PMAB 5PTPA 1HAPH 2YMSB 4INKA 1WSSH 2HNTE 3ZVCA 3M37A 4BAHB 2VNTA 2TGDA 7GCHG 1CHGA 2XRCA 5CE1A 1QJ6B 1BRUP 3O8RA 4I8JA 1SBWA 2SGEE 1GBAA 3AAUA 1BRBE 2SGDE 3ATLA 3T28A 3ZVEA 5FHTA 1QTFA 5F8ZA 4CRFA 2HLCA 4INHA 5EXNA 3JZ1B 1BTZA 3E8LA 1O3CA 1FNIA 2ANKH 4NIXA 3BTQE 3E0NB 1GI0A 4GSOA 1BTWA 1LVOA 1YGCH 1FONA 2BD8A 4FUGA 1IOEA 1H8HD 4Q4LA 4ZCNA 1PPGE 2ODQA 4YLQH 3V12A 1O3LA 1N8OB 9ESTA 1DDJA 1GMDF 2HPPH 1HFDA 1P8VC 2BTCE 2ZFQH 3A7WA 3DFLA 4UFFH 5JBCS 1E0FD 2LELA 1QBNA 3MMGA 1BMNH 1O30A 1QL7A 1D6WA 1LPKB 1VJAU 2PWXA 2EY4C 2WPIS 2HPQH 2Z94A 1P09A 2RA3A 1DWCH 4Y8XA 2F9OA 5JYIA 2BVSH 4FVBA 2J9NA 2YNBA 3EA9A 1BUIA 1QJ7B 2ILNA 3ZZDA 5EU8A 1L2EA 2VWLA 2ZCLP 3DSOA 1MKWK 5HGGA 3VG8A 3OTPA 3QZQA 4ZKSU 4DT7B 1AFQC 4FUIA 2QXJA 1YP9A 1IQJA 3F9GA 3D65E 1CGIE 3PO1C 2EI8A 4WY3A 3TLOA 1ANBA 1W7GH 3BG8A 1GBMA 1Z1JA 1C9PA 2XTTB 3D49H 1P05A 5EW1H 1TNGA 3LGTA 3SZEA 4Q7YA 2ZDNA 1EQ9A 1A4WH 1NRRH 5HIYA 3F9EA 3I29A 1AU8A 3AK5A 1GDQA 2G5NA 5EPYA 1ESBA 2JIZD 1OS8A 4YXWD 4ISHH 4ACAA 3F6UH 4OS1A 2FOHA 2CJIA 2J98B 4ISLA 3OFND 4YOGA 1FY3A 1UK2A 5CHAC 4AB8A 1FY5A 5C1YA 1C5TA 1LCYA 1V6DA 4MG3A 1XUJA 2WUCA 1TGBA 5EG4A 2JETC 1C5WB 1ELTA 4RN6A 4ZH8A 3SUGA 1K1IA 1PPFE 2ZQ2A 2VGCB 5A09A 3BIVH 2FS8A 2FYQA 1FMGA 1AE5A 2FPZA 3LJJA 2HOBA 4F49A 4HZHA 1OSSA 5C17A 2EI6A 2H5DA 1GGDB 4NWLA 2ANWA 3SHAH 3P6ZB 3GYMA 1ZMJA 1FUJA 1VJ9U 4NIVA 4JYVH 1C1VH 4I8KA 1EAIA 1DITH 1G2MA 1RRKA 1H8ED 3ZYEA 1AI8H 5EODA 1BTUA 1CA0B 3TJUA 3TVJB 1NESE 1TA2A 1H4WA 1Y3YA 1V2PT 4XRNA 4Y11E 3SZNA 1ZTKA 3QLPH 1GBHA 1L4DA 5DP5A 5A0AE 2P8OB 2VBCA 1GG6C 3NRLA 1GWAA 4WXIA 5FXLA 2FMJA 1YLDA 2V3OH 1FDPA 4Y10E 2XW9A 7KMEH 1F0RA 5C1XA 1VR1H 1S81A 2FIRH 5L2YH 3M3VA 4XD7D 1KXAA 1L0ZA 1NFWA 4JZEH 4MPVA 2VH0A 2OCVB 4AC9A 2FO9A 1N6XA 1O5GH 1GBLA 2A4RA 2XBWA 4YESB 4H42U 1V2WT 1BMAA 1YKTA 4ISOA 1TE0A 1P11E 2CXVA 1MD7A 1ANCA 5IDKA 4Q80A 1PFXC 2TGPZ 4NSYA 3K9XB 3KYGA 1V2TT 1PYTC 1LHCH 3EYDA 2ZDMA 3P8FA 1TRYA 1O3HA 1DLKB 3URCA 3F68H 2VWMA 2FLRH 4AORA 5EQRA 1COWD 1SLXB 1ZR0A 3P8NA 2WZQA 2IJOB 3RXMA 3GCOA 4E06H 5HIZA 5EPNA 4AFSA 5DP3A 2BDIA 2BY8X 5L2ZH 4CR5A 1QNJA 3FP8E 4BANB 4X1RU 3QZRA 1TNKA 2WPMS 3BTME 3ZZ6A 4NIYA 3SQEE 1OYQA 2FOCA 4DCDA 2BDCA 4BAMB 2FTLE 2ZP0H 3JZ2B 4X2YA 1NPMA 1NRSH 2BLWA 4TWWA 1SKYE 3L33A 4K1SA 2HNTC 1OXGA 1JIMA 1HJAB 2QY0B 1GBKA 2AH4X 3MO6A 4OM9A 3LJOA 3PWBA 4K2YA 1O39A 1A3BH 5DGJA 1QBVH 5DN6D 1NTPA 1P57B 1TNJA 1O36A 1MKWH 1AWFH 3MU0A 3GCNA 4RSPA 3NZIA 2R2MB 1AUTC 1FLEE 1XUHA 3FN8A 1C5ZB 2BDAA 1Z8RA 3RUOA 6CHAB 2ZTYA 4GCHG 3TJNA 3U1IB 2BLQA 2HVXA 1PQ8A 4FOUC 1P2KA 3GDUA 2VVCA 5A8ZA 3IG6B 4ISIH 2STAE 4Y8YA 5E8EH 1GPZA 1GI5A 1BJVA 5EJLA 2QIQA 1DX5M 1SLVB 2AYWA 1HV7A 1GJAB 1BOQA 1V2QT 2ZDVH 3MH5A 2P94A 1UCYE 1Y8TA 1ANEA 3GCHC 1AVWA 6LPRA 3S7HB 1NRNH 3BG4C 2DE8A 4I8LA 3SUEA 2KCPA 3QK1A 1GJ9B 3K65B 3MWIU 2LPRA 3SJ8A 4M7GA 1H8IH 1UTQA 4K69A 3RC4A 3ZIAD 1O3EA 3UOPA 1MBMA 4BTTB 2A4GA 2PFEA 3IITA 3CENA 5EXLA 1O2GH 3EQ0H 2ZGHA 1SFQB 2XNDD 4HI3A 1TPAE 2QF4A 1VKYA 1D9IA 1MZAA 4ASUD 3E90B 1GJ4H 4I33A 1EPTB 2KCYA 3QTOH 1XM1A 2GVFA 2XBVA 4JCNA 1O32A 1J8AA 3PMBB 3UTUH 5FAHA 8ESTE 1G3CA 3A8BA 2FX4A 1SB1H 1KLTA 1BDAA 1YM0A 2AERH 3B23B 1QFKH 1G36A 1UK3A 2ZU5A 1OPHB 1TPSA 1W0JD 1V2ST 1O2OA 2PSXA 3M7TA 1O31A 4J2YB 2C90B 2DUCA 1GHBG 1O3KA 1EZUC 2EI7A 3W1EA 3SU2A 2WPHS 4BXSA 3TK6A 4MNVA 1GL0E 2BLVA 2QN5T 1ARCA 2OBOA 1WOFA 1C1OA 1G3DA 2QE7D 2QF0A 1FQ3A 1W14U 1S84A 2BD2A 1BBRK 1CGJE 4MNXA 2ZCHP 4O9VA 1H9HE 1HAVA 2BDYA 4WXVA 2OC7A 3M5MA 5E2PA 5EQSA 3MQKC 3MTYA 4A5TS 1MTNC 3MNBA 1EAWA 2UWLA 2XWBI 1EAXA 1P2OA 1PQ7A 1SGIB 1A61H 1SQRA 5DP9A 2ZHDA 2PGBB 4Q2KA 1GJ7B 2VIWA 5HKKD 3RMLH 1EOJA 1GJDB 2EQNA 4B6EA 2CMYA 2I6SA 4FUHA 4MNWA 2WHXA 1C1RA 2G52A 3KQBA 3FVFB 2DE9A 3SBKA 1Q3XA 2ZCKP 3F0OA 3A81A 3L6PA 1C1SA 4CRDA 5DP6A 5A0CA 2VIVA 3ODFA 1PJPA 3A86A 3GY4A 1MU6B 4IN1A 2BVXH 4P02A 1PPCE 1BTYA 4ABIA 4ZHLU 2ZHEH 3A83A 1JXPA 1RTLA 4YT7H 3HKJB 1O2VA 4OS2A 3VXFH 1TPPA 1IQMA 1ORFA 3CS0A 4ZMAH 5F8TA 2UWOA 4X6NA 4K8YA 4GHQA 3E1XB 3NUMA 2GD4B 1INCA 1YPMH 1YY3A 4A1XA 1TMTH 1A2CH 1TB6H 1V2VT 4BOHA 4R8TB 3GY3A 1XUGA 2ZGJA 2STBE 5BPEA 4AYVB 5A2MH 2ZFPH 1LO6A 2F43B 3S69A 2J95A 2A7CA 4I7YH 1PPZA 1GMCF 1BCUH 3ODDA 1GI1A 1MD8A 4SGAE 2JH6D 2RA0A 1GDNA 1ELDE 1G30B 1UHBA 1CT4E 3VGCC 3V7TA 4IMZA 1TNHA 3UQOA 1O3BA 2BM2A 3G01A 4BAQB 1JRTA 4X0WU 4GVUA 1ZPBA 1QBOA 4RI0A 1CHOG 1K22H 2J97A 3MO9A 2GT8A 1FN8A 4CRCA 4NA9H 3QX5H 5ABWA 2FTMA 1C1NA 4NCYA 3LGWA 2LIZA 1YC0A 1AFQB 4JZDH 1C2DA 5AF9H 3PO1B 1A1RA 1CSOE 1GJCB 1JIRA 2RCEA 2ZDAH 1BTXA 4D76A 1G3BA 2WSSD 1KDQA 1TQ7B 3PB1E 1O3DA 3RXFA 3K6YA 3RU4D 1P2JA 1M9UA 2PSYA 4ASHA 3UNSA 8KME2 3RXPA 3IWMA 3ENSB 1HAXB 4U30A 5K7RA 2ZGBH 2IOTA 1S0RA 4Y76A 5KECA 4F55A 2BZ6H 2FYRA 1PPBH 3C1KA 2J34A 3TGIE 1O5BB 2BVRH 4CREA 5I25A 5JB8S 2F9NA 1D3PB 2FM2A 1B0EA 2ZA5A 2J4IA 1Y3VA 1W0YH 3LT3A 3SN8A 3N7OA 1RD3B 4CHAC 5FPSA 2A2XH 2OLGA 1TPOA 1FIWA 3T62A 1QJ1B 5CHAB 1MAYA 1KXEA 1SC8U 3ATWA 3VB7A 4KTUA 1O38A 1C5LH 3S9CA 1C2EA 2QYIA 1DWBH 1GI9B 5CDFE 3OEED 1X7AC 1S85A 1YBWA 1BTPA 3H5CB 2I6QA 1VITG 1F0TA 3DSPA 2Z3EA 1E1RD 5EXMA 5GXPA 1GDUA 4YZUA
chains in the Genus database with same CATH topology
1BRCE 4OS5A 7LPRA 1O3NA 3RXUA 1TBRH 2ULLA 4ABAA 1O2MA 3A7VA 1VGCC 4UFDH 4X8UH 1SSXA 3BEFB 1ZTJA 2O8UA 1GMHF 1CQQA 4DGJA 5A0BA 1QL9A 2BYAX 3RXQA 2OBQA 1C5VA 2ZC9H 1Y3UA 5FBIA 2NU1E 2GMTC 1SOZA 2OTVA 3ZV9A 2ZTXA 2Y5FA 1KSNA 3P70B 4LOYH 4Y0ZE 3P8OA 1BBRH 1TMUH 2CF9H 3KQEA 1EP5A 1O2KA 2RDLA 1GBTA 5TCAA 5C1UA 1SGDE 2QXHA 1IQFA 4UDWH 1FN6A 1K1MA 2FOFA 1GG6B 1O2IA 3VB5A 1CVWH 2FESH 2PTCE 5DKMA 4ZKNU 1QB9A 3Q00A 5C2ZA 5F6MA 3UOUA 1WQSA 3SGQE 4CBOA 1E34B 1BZXE 4ZHMU 2A0QB 4NFFA 4B2AA 1GI3A 3SI4H 1J15A 2H1UA 2ZHFH 5GDSH 3PV4A 1Q2WA 4WMFA 4CH2B 4QT8C 3OU0A 4IN2A 5L30H 9LPRA 2SNWA 5FCKA 4H6SB 4DIHH 1UTOA 3U98H 2XWAA 1K1NA 1YF4A 1ELFA 3SUDA 5C5NA 4JYTA 1C5MD 7ESTE 1KYNA 3UR9A 1VCQA 4Y0YE 3VPKA 2BX3A 2C8YB 1F92A 3V3MA 1S6HA 2FDAA 2Z3DA 2THFB 2QXIA 1UTMA 3P8GA 1SGTA 1SLUB 2NU0E 1C4V2 1GJBB 3T2NA 4BTIB 1C4U2 1EATA 2G55A 1Z8JB 4THNH 1MZDA 3A87A 2WV4A 4TY6A 1DICA 1JWTA 1ZJKA 4RKOB 1GBJA 3TJVA 2GP9B 2HRVA 1DVAH 4D7FA 5GCHG 2ZU4A 2ALVA 4XBCA 3SNDA 1GBCA 2GDDA 3SV8A 1J16A 3ZZ3A 4XFQA 1NFUA 1LDTT 2P93A 1DWDH 1E35B 1OOKB 3EBNA 1KY9A 3BTWE 3A84A 3U8TH 4BAOB 1O2WA 1DE7H 1O2TA 2B8OH 2FI3E 4XDEA 2B0FA 3Q3XA 4X6OA 4LZ4B 2B7DH 1SG8B 1SQTA 5H4IB 3A7YA 2VVUA 1IQLA 1UVTH 3E3TA 1C9TA 5C5OA 2KAIA 1BJUA 1QA0A 1TRMA 3GCTF 5E0HA 1ANDA 4GLYA 3TK9A 1RTKA 1FXYA 2PW8H 3RXAA 2R9PA 1NFXA 3C27B 1SMFE 3MNCA 2OINA 1HRTH 1SQOA 1ABJH 1P2IA 3RC5A 3OTJE 1AQ7A 4GAWA 4Y79A 3TITA 1S0QA 4YOIA 2ZGCA 2ZEBA 3GCHB 5HM9A 3O8DA 1XVOA 3BG4B 4ZAEA 4ABFA 1GI8B 1NU7B 4X1SU 2BXUH 1V2OT 3FANA 4X1PU 1CU1A 1IQEA 1QL8A 3ELAH 1QRZA 3SNBA 5EW2H 2OD3B 3KQCA 1XX9A 2CF8H 1DSTA 3GY5A 2V35A 2BB4A 1AMHA 4IW4E 1UCYK 5J4SA 1C5SA 4Y6DA 3MO3A 5EOKA 3ATKA 4IBLH 3ZZ4A 2BY6X 1OKXA 1VITH 2C3SA 1FV9A 1L1NA 2XC5A 3SORA 1MTVA 1GCTC 6GCHG 1CT2E 4MQAA 3ZVGA 3SW2B 1F0SA 1K1OA 2O8LA 1MTUA 4WH8A 5C20A 2ZGXH 2ZIQH 3UR6A 5GIBA 1LQEA 1QQ4A 1NRPH 2R0LA 8GCHF 2TBSA 3SJIA 3NCLA 4TPYA 1SGCA 4FUJA 4A1TA 1GHAF 2OQUA 3RXOA 5FBEA 1V3XA 2FZZA 1DUAA 2PUQH 5DP4A 1TNLA 1O2QA 1MTNB 2FI4E 3OY5U 1AD8H 1BA8B 4H4FA 2A31A 3RU4E 2K1QA 1AVXA 1HJ9A 4TPIZ 2Q6FA 5EQQA 3BN9A 3EE0B 4AX9H 5HXFA 1P04A 1WUNH 1ACBE 1AE8H 1J17T 2RG3A 2ZQ1A 3MFJA 4YTAA 1CBWC 4IMQA 1KLJH 2R0KA 2SGQE 5GPIB 4IGDA 1UTKA 4LK4A 5HMAA 2B9LA 2H9EH 2OC0A 1LKBA 3D62A 1ESTA 2GKVE 3MH7A 3URDA 1LHFH 4TYDA 4Y7AA 1RJXB 2PV9B 3FP7E 1A0JA 1TMBH 5E0GA 3SV6A 1QA7A 4NG9H 2AGIX 1AVGH 2QGRA 2V6NA 3LH1A 4I8HA 3A8DA 3SV7A 3P92A 1SGEE 4WMEA 1EOLA 3NKKA 2XC0A 3AASA 1K1PA 3B9FH 3ZYDA 2WPJS 3LC3A 1L1JA 2NU2E 3U8RH 3HKIB 4IS5A 1XXDA 1NRQH 4MTBA 3A8CA 4VGCC 2Z7FE 2ASUB 4RKJB 1AKSB 1YPJH 1ZRBA 1WTGH 2HNTF 1RTFB 5F8XA 2EEKA 1SQAA 1RIWC 3ITIA 4ABDA 1Z8GA 3MI4A 1OP8A 1ZPZA 3RXDA 1N1LA 4U01A 4X6MA 3VGCB 1EPTA 1MQ5A 2G4TA 5DP8A 1YPGH 1GL1A 1AHTH 3MNXA 1K28D 3TNSA 1O3AA 3ZVBA 1WQVH 4WF8A 1K9OE 1TIOA 3TPIZ 3H7OA 2ZU2A 2M5TA 5JBTA 1Y5BT 1THPB 1GBEA 2QV1A 1PPHE 4BTUB 3VB3A 5LGOA 1THRH 4MNYA 2ZWLH 1GHYH 1GHXH 2AGGX 2C8ZB 5A8XA 1YCPK 1O2RA 3RLYH 4E7RG 3KCGH 3QWCH 1LHGH 2BDHA 2QF3A 3S9AA 2XYAA 1BRAA 1O37A 2H2ZA 1XUFA 4FU8A 1IQIA 1HJ8A 2WYJA 1EJAA 1MH0A 2PUXB 1DFPA 1AB9B 5FPYA 1NFYA 4DOQA 2GCHF 1HBTH 3SU1A 3I78A 4ABGA 4JMYA 5DK1A 1AY6H 3QTVH 2BD3A 4B71A 3LONA 5A8YA 1VZQH 4MDSA 1XKAC 2ODPA 3A7TA 4B73A 3KHVA 3RMOH 3U8OH 5FCRA 4CRBA 1EZSC 1MUEB 2FOAA 3B8JA 1C5NH 4B2CA 1O35A 3GOVB 5DJ7A 3CS7A 1HPGA 2VIQA 1IQNA 4FVDA 1BT7A 1TABE 4ESTE 1AUJA 4CHAB 4R0IA 2WV5A 3F9FA 1HUTH 1ZGIA 4YT6H 4D9RA 1LQDB 1UCYH 4Y7BA 3RXBA 1O3JA 1ELGA 1Y59T 1UMAH 1MAXA 2VIOA 1TALA 1GI2A 1W7XH 3SGBE 1E38B 1F5LA 1F5KU 1T8OA 1HAGE 2BOKA 2P3UB 1ZHMA 1RS0A 3SQHE 1TRNA 3SOSA 1DUEA 1VGCB 1MU8B 1DY9A 1ZJDA 2W7SA 3STJA 4E05H 1C1WH 1THSH 2TIOA 1KTSB 1SLWB 1K1LA 2GT7A 1EP6A 3OSYA 1ZYOA 2FOGA 1TGNA 4E7NA 2GMTB 2W3KA 4X2XA 4FUCA 1GBDA 1TQ0B 4CBNA 2BQ7B 4AGJA 1N6YA 2D1JA 1HB0B 1S82A 4DW2U 3ZZ9A 2XXLA 3T5FH 5TJXA 1C2LA 1JRSA 3BV9B 2OC1A 1LVBA 4AN7A 1V2RT 1HDTH 1H1BA 1HLTH 1WU1A 2ZU3A 1AZ8A 1A5GH 3HK6B 2WUBA 1GHWH 4WJG2 2YOLA 1HAOH 1Z6EA 4NGAH 1HNEE 4NZQA 2A5IA 2ZF0H 1C1QA 1QGFA 2UUYA 1FY8E 1V2UT 4AFZA 1UTLM 4K3JA 2F91A 3GY6A 3UQVA 1JBUH 2ESTE 2WYGA 1A5HA 3L3TA 3RXTA 1F7ZA 4YM9A 1TNIA 2Y80A 1C5PA 1SGFA 2Z9IA 4UFEH 5AFYH 1O3OA 2IN2A 1SI5H 4D9QA 3S0NA 2ANYA 1ELBA 1FAXA 2SNVA 5FX6A 1C1TA 1UTJA 3UNQA 1P12E 2GCTC 3QDZB 2C8WB 1HAYB 2VB0A 2A5AA 2K7XA 3BTFE 1VCPA 5AVDA 1V2NT 1O2YA 1BITA 4U32A 1V2KT 3H7TA 5HM2A 1GVLA 1TLDA 1QCPA 7GCHF 4FUFA 1SR5C 1C1PA 3HPTB 2A45B 1NY22 3ZV8A 1QR3E 3Q3YA 3QGNB 1W10U 4FUEA 4ZXYH 2UWPA 1F0UA 1FY4A 1NM6A 4CH8B 5ESBA 4X8VH 3SJ9A 4SGBE 1YLCA 1K2I1 2ZFFH 5SGAE 4NWKA 1H9IE 1SHYA 3ZZ5A 5T6FA 3KIDU 1TAWA 3QGJA 2G81E 2SGAA 1V2JT 1YCPM 1O3FA 4O3TA 1MBQA 3MU1A 1ZMNA 3SU5A 2XBYA 1FIZA 4JZFH 4XSKU 4B75A 1XXFA 1TYNA 3K6ZA 1TBQH 2XNIA 4FUDA 2VH6A 1NC6A 5I46H 2H5CA 2GZ8A 1YPKH 2XBXA 4Z6AH 3OYPA 3EA8A 1BHXB 3W94A 1T8LA 1AB9C 1YCPH 1LPZB 3ZVAA 5DP7A 1GVZA 4K5ZA 4NA7A 3UPEA 1OYTH 3MNSA 1IHSH 2VJ1A 3A89A 3GICB 1UO6A 4MVNA 1OWKA 2LNCA 3M61U 1ZRKA 4AOQA 1DWEH 4X6PA 1P10A 1C2MA 1O2ZA 3AW0A 1DT2A 2Y81A 1YPEH 4BNRA 2BY5X 4ABJA 5GCHF 2Y5HA 3BEIB 2O8WA 3M3SA 1UVPA 1RGQA 1MTWA 2ZI2H 4AFQA 2ZZUH 2Q6DA 1LVMA 1TA6A 1TX8A 1XMNB 2V0BA 1IQKA 4IC5A 2ZHQH 1SGQE 1SVPA 3T27A 3BTTE 3LKWA 4A7IB 1TGSZ 4AYYB 1MQ6A 4INLA 1A3EH 1C5RA 3KN2A 5B6OA 1TOMH 5L6NH 3A8AA 1O2XA 1TGTA 3ZZ8A 2F83A 2AS9A 2SFAA 5E0JA 1T8NA 4AB9A 3UFAA 3SHCH 4DURA 1IQGA 1Y3WA 2A7JA 4X8TH 1DOJA 5HYOA 1P02A 3P17H 4BXWA 2ZPQA 3GYLB 2A2QH 2CV3A 3K2UA 2PKAB 1FZZA 1ETRH 3S9BA 4A1VA 2A1DB 4WVPE 1UTPA 3SJOA 3ESTA 1BTHH 2CN0H 2O8MA 2P95A 1K1JA 2J92A 1ZLRA 1ZSJA 1O2PA 4TWYA 1Y3XA 2P3FH 5J4QA 1WBGB 4OGYA 2PKSC 2FOEA 3RXHA 1GCTB 3TH3H 3RLWH 3RXSA 3RP2A 3BEUA 1QHRB 2A4QA 1ETTH 1TX6A 2ZDLA 1D3QB 2F3CE 1C5OH 3MH6A 4HTCH 3TGKE 1EJMA 1KXDA 3PLKA 1AN1E 1OWIA 3OX7U 3W95A 3QN7A 2ANMH 2WPKS 3AAVA 1MMJN 4Q7ZA 3LDXH 4KTSA 1O2HA 1YYY1 1ZPCA 1TWXB 3E6PH 3FFGA 1ARBA 1GMCG 4OS7A 4WMDA 2FLBH 4U2WA 1YPLH 3RXVA 5JBBS 1KIGH 4UONA 1J9CH 2AFQB 3PWCA 1CBWB 1F5RA 3A7XA 4FU9A 1LMWB 2TRMA 3ZZBA 1QIXB 3PTBA 1NROH 1EAUA 4CRGA 1ZMLA 2XC4A 3I77A 6GCHF 3M7QA 2Z9JA 1MTSA 1AFEH 1HIAB 2BOHB 1D6RA 1HXEH 2UUJB 1JMOH 1B0FA 4YO9A 1HAZB 1NS3A 1SL3A 2Z9KA 1ZTLA 4A92A 4ZKRU 3TIUA 1O3PB 1W2KH 3LH3A 3UUZA 2BD9A 1MCVA 1NO9H 2W5EA 3UNRA 3VB6A 1QB1A 2OC8A 2ZFTA 1IAUA 3Q3KA 3MYWA 4CRAA 1ZHRA 2D26C 3LGUA 1AZZA 4VGCB 3M3TA 2FS9A 3DD2H 3RXLA 2Z3CA 4IC6A 2B5TB 5AFZH 1GBFA 1BQYA 3EGKH 4Y71A 1RIWB 1GJ6A 3RXIA 1SGRE 4UEHH 1V2MT 4O03A 1KLIH 1BIOA 2HALA 3PLBA 2EC9H 2ZFRH 2XCFA 2TPIZ 3RXJA 2W3IA 1BHXF 3HGPA 1L4ZA 1LPGB 2P59A 2ZDKA 2VIDA 1T8MA 4UD9H 2ZNKH 5FPTA 5G4BA 3ZZCA 1AIXH 3BTKE 3SJKA 1FY1A 2WINI 4TY7A 5K0HA 3R0FA 1HGTH 2AGEX 5GWZA 1TOCB 1G3EA 1GMHG 2H9HA 1GI4A 5TCCA 2BDGA 4KP0A 1G2LA 2G00A 1KXBA 2FP7B 3BTDE 4HGCA 3SV9A 4JK5A 1ZOMA 4GHTA 4ZROA 2H9TH 2Y82A 2UUKB 1J14A 1P2NA 3V0XA 5BRRE 2BHGA 3U69H 1UVOA 3ATIA 4NFEA 4ZHAA 3UY9A 1S83A 1BMMH 1ELAA 1PQAA 4GCHF 1KXCA 2J94A 5DO4H 2CHAC 2G4UA 5LPRA 4X2VA 1O2SA 3GY8A 3S7KB 4KKDA 1UVUH 2FEQH 2R2WU 1HXFH 3SUFA 1OP0A 1PPEE 3GY7A 2BD7A 3RXEA 3T25A 1B7XB 1EXFA 3PMJA 4J1YA 4YOJA 2Q1JA 3Q77A 4ISNA 1HAIH 3LPRA 4K1TA 4DG4A 1QQUA 2FOBA 4JZIA 3TH4H 5T6DA 1FPHH 2TGTA 2GGVB 1O33A 1DXWA 3UIRA 4KGAA 4KTCA 2YNAA 1UTNA 2PGQB 4I8GA 1LTOA 5JB9S 3AVZA 4OS6A 1WCZA 3QO6A 2QAAA 3ZZAA 1A5IA 1P0SH 1CT0E 3VXEH 1BMLA 2KAIB 3VB4A 1C1UH 1SGNE 3LU9B 1GMDG 1AKSA 3VFEA 4DJZB 4CR9A 1O2LA 3M36A 4X1QU 2GTBA 2GDEH 3RM2H 3WY8A 5DPAA 2F9PA 1A0HB 3MU5A 2Y7ZA 1SHHB 2J38A 2F9UA 4LZ1H 1C2KA 1C2HA 1ELVA 2ZFSA 1Q31A 2Y5GA 3E16B 4B2BA 3BF6H 5ESTE 3PLPA 1PQ5A 1DS2E 3BTEE 1OWJA 1GCDA 2W26A 2BZAA 1NU9A 1P3CA 2F9VA 3HGNA 1GI6A 1GHBF 3ATMA 1H8DH 1P3EA 3DUXH 4WH6A 1IQHA 5ETXA 2AMQA 3DHKH 1UK4A 3M5NA 1EX3A 2BLOA 3SNEA 3VEQB 1N8OC 2A7HA 2VWNA 2BX4A 3MU4A 1F2SE 4H6TA 1O5DH 2PHBA 1AWHB 1Z6JH 2QCYA 1OWDA 3SU4A 2GCTB 3ZVFA 3F9HA 1XUIA 3QUMP 1SGFG 2P3TB 4F4OC