3VB3A

Crystal structure of sars-cov 3c-like protease in apo form
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
301
structure length
301
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 3C-like proteinase
publication title Design, synthesis and crystallographic analysis of nitrile-based broad-spectrum peptidomimetic inhibitors for coronavirus 3C-like proteases
pubmed doi rcsb
source organism Sars coronavirus
total genus 82
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-12-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3vb3A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3vb3A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3vb3A02
1ANCA 1ANBA 3ITIA 3P70B 1RXPA 5LPEA 5GWZA 3BEUA 4BNRA 3SORA 1BTZA 1G3EA 3STJA 1HCGA 3CP7A 4NFEA 1O3PB 2H6MA 2W7SA 4UEHH 2FOHA 2ZDNA 3GCTF 3S7HB 3AAUA 5FXLA 1TWXB 1GBFA 4BAHB 1JOUB 2ZPSA 1NO9H 1DPOA 1AB9C 3QGNB 3UTUH 1IQGA 1DWEH 1C4U2 2XCFA 4YTAA 1TPOA 1H9LB 2PFEA 1C2LA 3GY6A 1ABIH 1QJ6B 1ZJDA 1S0QA 1KTTB 1CT4E 3RU4T 1W2KH 3MOCA 1GHBF 5TJXA 2VB0A 2VGCB 1O3MA 1AVWA 1D9IA 1T4VH 2BHGA 1YGCH 4X8SH 2A4GA 3FFGA 1GJ4H 2WPMS 3RXIA 1ZOMA 1W7XH 4E06H 3LPRA 1C5WB 1O2NA 6ESTA 2BDGA 1QL7A 4WWYA 3BTGE 2V0BA 1N1LA 4HI3A 1MZAA 4YO9A 1G32B 2J9NA 2FOCA 4IS5A 1J9CH 2BLQA 3K2UA 1NS3A 4CRCA 4B71A 3LC5A 4MNXA 2PKAA 4YLQH 1D3PB 1AUJA 3M3SA 2ZQ2A 1FQ3A 1PQ5A 3RXVA 2ZDVH 4E05H 4B1TA 3SV6A 1D3QB 1TPPA 2F3CE 1YPLH 1HXFH 1THPB 1XUKA 3BF6H 1TPSA 1JWTA 1GHYH 1QBVH 3UR9A 3LGYA 1EB2A 3T29A 4HZHA 1XX9A 1FIWA 2HRVA 2ANWA 1DVAH 2XBVA 2QF0A 4CRFA 1A4WH 1UCYH 2LPRA 1GWAA 4FUFA 1AZ8A 1YKTA 3UFAA 2WPJS 3NXPA 3I78A 1ZPBA 1HJAC 1O2YA 1LHEH 3Q00A 4LK4A 1SQAA 1W7GH 1GDQA 8ESTE 1BT7A 3ZZ6A 1GGDC 3PO1C 1V6DA 3FVFB 1GJ5H 5C67A 3Q3XA 4A6LA 1KXAA 2ZA5A 3MI4A 2BX3A 4FUBA 1C5ZB 1C2JA 3ATLA 1ETSH 1L4DA 1SFIA 3M5LA 2G52A 2GCHG 2J34A 1VCPA 3GY3A 1AVGH 5EXMA 1T31A 1GBTA 1P10A 1EPTA 3NKKA 4FUGA 1GBEA 1CHOF 1RFNA 4ISLA 1RRKA 1O3IA 3H7TA 3PLBA 3ZVEA 1BA8B 1BJVA 2Q6GA 1EP6A 1WAYB 3N7OA 5DK1A 1F5KU 3PWCA 1NESE 4YESB 2TIOA 1QRZA 1TMTH 2GTBA 1XVOA 7GCHG 2AMQA 3VFEA 1LVOA 1OYQA 3LONA 2A5AA 1KXEA 2H9TH 4E7NA 5EPNA 3T2NA 4RKJB 4X6OA 4B2BA 1GMDF 2OUAA 4AN7A 2R9PA 2KAIB 4K1TA 4OGXA 2J38A 3SU5A 1P8VC 1O3BA 1XVMA 3SJOA 3UQVA 2A5KA 2FOAA 4GUXA 3URCA 3W94A 3O8RA 1W12U 3SJ8A 2J92A 2PTNA 1G9IE 3VB3A 4ZHLU 2BLOA 1MQ5A 3KN2A 2GMTB 1TRYA 3EA8A 4CR9A 4DGJA 1XXFA 4R8TB 1GL1A 4JK5A 1Y5AT 1MAXA 1AQ7A 4OS4A 4ABAA 5DP4A 4Q7YA 1QBNA 1AE5A 4ZUHA 1TGSZ 2GVFA 5BPEA 2VWMA 1GG6B 4CRAA 3SJ9A 3LT3A 4XDEA 1XKAC 5DKMA 3RLYH 1MTWA 3BG4B 4FU8A 1SB1H 1JRSA 3ZVGA 2PTCE 2ZCHP 3T25A 3C1KA 3S7KB 2C8YB 2XC0A 4JZDH 1DM4B 1HXEH 4AORA 4CBNA 2JH6D 3SNDA 3NZIA 4BTUB 1SLVB 2ZO3H 1HJ9A 1TQ0B 2W3KA 1C5SA 1EOJA 1Z8JB 2ZFFH 1BBRE 2ZPRA 1GBHA 1A5HA 4AFQA 3RU4D 4AZ2B 1A46H 2HALA 3RU4E 2XC5A 1GJBB 1MUEB 3CENA 2F9UA 3M5MA 2V3HH 3LKWA 1FJSA 1IQLA 1ZJKA 2Y6TA 1B0EA 3P8OA 5CHAC 1XUHA 1O39A 3ATIA 3OX7U 2ZKSA 1EXFA 4JMYA 2M5TA 1ELBA 1PYTD 1S84A 1O36A 4NSVA 1H4WA 1O3CA 2B0FA 1KSNA 2BVXH 1BTPA 1YC0A 4UONA 1SGTA 2ZCKP 1FUJA 3JZ2B 2YNBA 1SBWA 1U6QA 2CHAC 1ANDA 4JYVH 4FXGH 4AB9A 1TBZH 2G5NA 1MQ6A 3TJNA 1LHDH 3ODDA 1S85A 2OBOA 1V2UT 3DHKH 2VIWA 2K1QA 5FCRA 2QC2A 4OS2A 2QXGA 3RM2H 2IPHA 3KQCA 3OSYA 5E8EH 2RCEA 3LGWA 1C5MD 4IC5A 1GCDA 2O9QA 2FYQA 1FDPA 1SC8U 1W14U 2BOHB 4DVAU 2EEKA 1SQTA 2BM2A 1UK4A 1O2WA 3VEQB 3VXEH 1AMHA 3SI4H 1ZGIA 3NK8A 4BOHA 3VB7A 1BMLA 4X2XA 2ZP0H 3P92A 5DP9A 3BTEE 5JDUB 3L33A 3E1XB 3PM3A 2C90B 1F5RA 1K1MA 4OS1A 4I7YH 3ZZ7A 1XKBC 1BUIA 1TGCA 1UVTH 4BAKB 1SLWB 1PPCE 1ZRBA 4ZH8A 3EA9A 5DP3A 1Y5BT 3QX5H 1ZSJA 4ZXYH 2SGEE 3T62A 5GPIB 1O3OA 1AIXH 5EU8A 2TRMA 1O5EH 4YOGA 2VGCC 4RN6A 3BIUH 3M7UA 1ZMJA 3C27B 2SNVA 1RD3B 1Z7KA 1L1GA 1PJPA 7ESTE 4JZIA 2ANMH 1O2TA 1SGEE 3SU0A 4ESTE 3IG6B 4NZLA 3RXJA 1GJDB 2OQ5A 1V2KT 2STBE 3KF2A 2QCYA 1TOMH 3RXOA 5L30H 2HLCA 1SGDE 2CV3A 1EATA 8LPRA 1TMBH 1EB1H 4UD9H 1LPZB 2Z94A 2BDAA 3M37A 1GI0A 4IGDA 4JK6A 1WCZA 1QQ4A 5LH8A 2YOLA 2H9HA 2Y81A 1CQQA 1DS2E 2VWOA 1A61H 1O38A 5A0AE 1C5OH 2FX4A 2UUYA 1FI8A 1AO5A 2OBQA 1TMUH 5JBTA 1S82A 2BQWB 2A7CA 5J4QA 2A1DB 2PR3A 3QGJA 3SUGA 1P02A 1K1LA 3SU1A 1GHAF 2FTLE 2I6SA 2ZEBA 4UE7H 4A1XA 3A7YA 2O8TA 4Y79A 1AI8H 2Z7FE 5EG4A 4ZAEA 4H6TA 4K60A 4DT7B 2WV4A 2F83A 2C93B 3BTFE 1TB6H 4GLYA 1GI3A 1P04A 5IDKA 3RM0H 1A0HB 3AASA 1BRAA 1HV7A 3RXDA 5EXLA 2XTTB 1QB1A 1G3DA 1NU9A 1P2IA 2GZ9A 1QRXA 3LU9B 4Q80A 1D4PB 3U1IB 2ZDAH 2AGEX 3QO6A 1F2SE 2TGTA 1O2KA 5E0GA 1C4Y2 3KNXA 3Q76A 1FY5A 1TA6A 1EPTB 2VIQA 1OKXA 1UO6A 2EI6A 4IMQA 2JKHA 3P8GA 1O31A 1RTKA 2WYJA 4K3JA 4IN2A 1HAPH 5E0HA 4MVNA 2BD9A 4X1RU 1HLTH 1SHHB 2HPPH 3MU5A 1W13U 1N6XA 3RC6A 2Q1JA 1DSUA 1SPJA 2ZZUH 1P12E 3A8CA 2B5TB 3V7TA 5C20A 1IQIA 2AERH 3A8DA 1V2JT 2PSYA 1P2JA 1ZTKA 2BLWA 1SOTA 4OS7A 2A2XH 1ETRH 4X8VH 1SGIB 1FAKH 1C5LH 3TJUA 3ZZBA 1KXCA 4IC6A 4BAOB 5JBCS 2BDBA 3A80A 3L6PA 1O2HA 1YPMH 1MD8A 2GMTC 2Y7XA 3DT0H 4A5TS 2ZFRH 5GIBA 1F0UA 1TFXA 1FY4A 5ETXA 3HKIB 3M3VA 4D9RA 3BTWE 4WMDA 3MH4A 2FS8A 1O2SA 2G4UA 4F4OC 4F49A 3HK6B 1GBBA 4ZHAA 2Z9JA 3E0NB 3M5OA 3S9BA 1GG6C 1ZTJA 1TGTA 1YBWA 1IHTH 4INHA 1UCYE 3E91A 3F9FA 2ANYA 1C9TA 2AS9A 2UUFB 5K0HA 1C2GA 3BG4C 1GBKA 4Y10E 1W3CA 2R2WU 1TNGA 1UVPA 1QHRB 4IMZA 4Y8ZA 1O2QA 4HFPB 1IQNA 2WPKS 9ESTA 4DIHH 1E34B 2F9BH 5A0CA 1P11E 1XUGA 2Q6DA 3Q3YA 7KMEH 3TITA 1YCPK 1LKAA 4ZMAH 2ZPQA 2OC1A 2BY6X 3D23A 1GDUA 4ZKSU 1EJNA 2GT8A 2A4OA 2H5DA 3HPTB 4FUDA 1SGNE 4FUJA 3RXAA 3GICB 5GCHG 1QB6A 1HDTH 1S6FA 1KTSB 2J4IA 4ABEA 3PYHA 4ZXXH 2AIPA 1NFXA 1P03A 4HGCA 1P2OA 3DFJA 4AG2A 3V13A 3RMOH 1BRCE 2A31A 4MPUA 3QLPH 3QZRA 4NIYA 4ISNA 1QJ1B 4JZEH 5J4SA 2G8TA 2VWNA 5C5NA 1OS8A 5E0JA 1NZQH 1CGIE 4O03A 3ZZ9A 1C1MA 4H6SB 2P94A 1FN8A 1HAOH 2FESH 1A2CH 3A81A 1VR1H 2QV1A 2FS9A 4Y0YE 1UJ1A 1BTWA 1OYTH 5GJ4B 1Y59T 1V2WT 3E6PH 3FANA 2QXJA 2FI5E 3QWCH 2D1JA 1YPGH 3NCLA 2P3TB 2H9EH 4TPYA 2F9OA 1P06A 1WYKA 1NU7B 4FVDA 1DWBH 3SJIA 3U9AH 2F9NA 1V2ST 2G51A 1GJ9B 3LOXA 3TGKE 4YZUA 3RMNH 4H42U 1HAZB 2VIOA 1MTUA 1ZSKA 4X1PU 4ZKNU 2BXUH 4K2YA 1C2KA 1JRTA 4YLUA 1PPFE 2QN5T 3GYMA 1BOQA 5JB9S 3BN9A 2Z3CA 1PQAA 1WU1A 4XBCA 6GCHF 2HPQH 3A7VA 2BDYA 1A0LA 1C1RA 1HPGA 1QTFA 1SSXA 1UK2A 1YYY1 1EKBB 3ATMA 4B2CA 3MU0A 3SU3A 1G37A 1TX7A 2JH0D 1DE7H 3DUXH 1ELDE 1HAIH 3SN8A 1C2HA 2FWWA 2TPIZ 1CGJE 1SQOA 2LNCA 1T8MA 3TPIZ 3Q3KA 1PPBH 1LMWB 1ELAA 1MKXH 3TK5A 2XBXA 1GMCG 1GVKB 5AHGH 4AFSA 1ZHRA 2CN0H 1S83A 3GCHB 2BD8A 3AVZA 1TBQH 3GY2A 1DT2A 2WUBA 3ZVCA 1IQHA 1O3NA 3ESTA 4MLFB 1C5QA 4YT6H 3K6ZA 1LQDB 5G4BA 4LXBH 4TWYA 4ZKOU 2SGDE 5L2YH 1O2GH 1G30B 1XXDA 2ZG0H 1E35B 2BQ6B 2SGAA 1O35A 4NIVA 3ZV9A 3SZNA 1IOEA 3ZVBA 4UFGH 4D7GA 4MG3A 3ATWA 3SV8A 3PMHB 4WH8A 3T26A 1IAUA 1VJ9U 2FDAA 5IYTA 3SW2B 3V12A 5AVDA 5EPYA 4IBLH 4I8GA 3RXBA 1AU8A 1HAVA 5T6FA 1BBRK 1HAXB 3S9AA 3BEFB 2ALVA 4DIIH 5DPAA 2HVXA 3RXEA 2ILNA 3HATH 1GBCA 2OC8A 5JB8S 2HGTH 4FU9A 5ESBA 5FPYA 1MTSA 5EW1H 2EC9H 3U8TH 1C5TA 2B7DH 1S81A 3RMMH 4YOIA 4ABDA 1C1WH 1EZXC 1ARCA 1TBRH 2ZTYA 4Y11E 2O8WA 3BTDE 5EOKA 3TJVA 1BTYA 3TLOA 1O2IA 1C1QA 2FOMB 1V2TT 2D8WA 3IITA 2AEIH 3VPKA 4ABHA 1GCTB 4MPXA 3GCOA 1HFDA 1T8OA 1O2XA 4YT7H 1YPJH 1ZGVA 3M7TA 1GL0E 1BITA 1E37B 3SNAA 2AGIX 1GHXH 1ARBA 2BOKA 5L6NH 1CVWH 1AFEH 2C8XB 1NT1A 4A92A 1YPKH 1ZPCA 5T6GA 2GZ8A 2VVCA 1EPTC 2ZGCA 1GJCB 3GY4A 4K8BA 4XBDA 1V2OT 1NFWA 5HM9A 4FUCA 2AMPA 1ELGA 4KP0A 3I77A 3ODFA 3TK9A 2H1UA 3DA9B 1H8DH 1A1RA 3LIWA 1C2DA 3LH3A 1DXPA 5HGGA 2GV6A 5DG6A 5C5OA 3K9XB 3MU1A 1L1JA 3SO3A 3ZZ5A 2OQUA 1O2MA 4IW4E 3SUDA 1UTNA 1EQ9A 2WYGA 3U1JB 3NPSA 1A3BH 2BDIA 3A84A 4Q7ZA 4X6NA 1C5UA 1UTOA 1Y3XA 1QBOA 1K21H 3ZVAA 5FHTA 1O3GA 3PV4A 1V2MT 1L1NA 2QXHA 1QIXB 1EJMA 4MTBA 4TYDA 1E36B 4UFDH 3LGTA 3AW1A 5PTPA 3D49H 2P59A 3OU0A 1EX3A 4DCDA 1EP5A 2R0LA 1DUAA 3QZQA 3UR6A 1T32A 1YCPH 1TNKA 1HAYB 2ZU3A 5C1YA 2FODA 4Z6AH 2FOEA 2ESTE 1ESAA 1Y5UT 2VVVA 3MH6A 3GYLB 2JETB 1TE0A 2F9VA 1GMHF 1F7ZA 1IQMA 5L2ZH 3P6ZB 1MD7A 3QK1A 1TQ7B 4NZQA 3E90B 2EI8A 1OXGA 3PMBB 2IJOB 3SBKA 4U32A 2PHBA 2VH6A 2CJIA 1ZYOA 2GP9B 1AKSA 3U98H 5DO4H 1MCVA 4CR5A 1KDQA 2OTVA 3BG8A 5FX5A 1SGRE 1L2EA 3IWMA 4TY6A 2ALPA 1NFYA 1ANEA 1UVUH 2VIPA 4X2YA 5T6DA 2GCTB 2PUXB 5DP6A 3SI3H 2FOFA 3M35A 1IQJA 1T8LA 2FPZA 2A7JA 1JIRA 1IQKA 2TBSA 1LVBA 1O3JA 1FONA 3SU4A 1TNLA 4NIXA 2ZNKH 1GI5A 2FM2A 3A7XA 1V2RT 2ZGXH 1VCWA 5EW2H 5HXFA 1GBJA 3UY9A 1K2I1 2NWNA 1OOKB 2XWAA 1OWKA 1L0ZA 1LVMA 2R3UA 4ISIH 3ZZ4A 7LPRA 1GPZA 3F6UH 3H5CB 4AGJA 3CS0A 3EBNA 3SUEA 1EZUC 1BJUA 3VB5A 1WQSA 1SI5H 2HNTF 1JBUH 4X6MA 1VITG 2ZU5A 1QQUA 2GX4A 1NFUA 1H8IH 3A7ZA 3SHCH 4CH2B 2FP7B 1GI9B 3BTME 1HAHH 3W95A 1C5NH 1BMMH 2VIDA 3NWUA 3GCNA 3RLWH 1LDTT 1LCYA 2OC7A 1LHFH 3P8NA 1O2OA 2OXSA 3A7TA 4UFFH 3TNTA 1UK3A 3K65B 4U01A 2ZIQH 3B9FH 1DANH 2G55A 4VGCB 1CE5A 1OSSA 1TX8A 2PW8H 1WV7H 1HJ8A 3E16B 1DDJA 1QA0A 2OC0A 1D6WA 1VGCB 1K1OA 4X2VA 1CA8B 5HYOA 1SOZA 1THRH 2Y5HA 1N8OB 1VITH 5CMXH 2ULLA 4BXWA 2FMJA 3HK3B 2JH5D 1BZXE 3SUFA 3QTOH 4YOJA 2THFB 4CHAB 2XBYA 1FXYA 3KQBA 2VU8E 2UUKB 4CRGA 4DG4A 2W26A 3O8CA 3CS7A 1SGYE 5JPMH 4K1SA 5DP5A 1UVOA 1YLDA 2BX4A 2A32A 2C3SA 4JYUH 3LC3A 2FLBH 3GCHC 3SQHE 3RXFA 1YF4A 4FVBA 3STIA 4DY7B 3LJJA 4Y7BA 1CSOE 1PPGE 3ZZ8A 1J8AA 1P3EA 2F9PA 2ZECA 4AYVB 4D8NA 3PB1E 1BQYA 3VXFH 1TRMA 3SU2A 3KQDA 1TNIA 1TNJA 2I6QA 1BBRH 3I29A 1O3DA 1BMAA 1YPHE 4DW2U 2WUCA 1ID5H 2TGDA 3GDSA 1TABE 1C9PA 2A4QA 2W3IA 3HKJB 3KCGH 4ZHMU 3BTQE 1UMAH 3FZZA 4FU7A 3A7WA 1XMNB 3QUMP 1KXFA 2AGGX 2A7HA 1TLDA 5FCKA 1O3HA 3RXCA 1WQVH 3D65E 1ORFA 3UPEA 1TALA 1OWDA 3A86A 5JYIA 1QRWA 2STAE 5E2PA 4WH6A 4BAQB 3ZZ3A 1SVPA 4Y6DA 1O5AB 3T5FH 1HBTH 3O8DA 2VVUA 4X1SU 1RTFB 1HAVB 4NGAH 1SLUB 1V2LT 2H2ZA 3LGVA 6LPRA 1WTGH 1SGPE 1Y3UA 3G01A 2BVSH 5JBAS 3UWJH 2BD2A 1YCPM 4ABJA 5FX6A 3S69A 3LH1A 1P2NA 1AD8H 4X1NU 2OINA 4Y8XA 1ZMLA 3PLPA 1GCTC 5DJ7A 4Y76A 3A89A 1SR5C 5BRRE 2P8OB 2BXTH 4MQAA 4R0IA 1T4UH 3T27A 4LZ4B 4TWWA 4X2WA 1O33A 3A87A 3EQ0H 1TGBA 3GISB 5GXPA 5JBBS 2J95A 2BY8X 2OCVB 1QA7A 1P9UA 4X1QU 4BTTB 2ZU1A 2G4TA 1NROH 1FIZA 1DWDH 1T8NA 1P2QA 1B0FA 4O97A 4ABGA 3RXPA 1DY9A 1UTMA 6CHAB 1DWCH 2DE8A 3ZV8A 2XXLA 3ATKA 3V3MA 3NUMA 2ZDLA 4UDWH 1AUTC 3PMAB 4K5ZA 5E2OA 4ASHA 2ODYB 1GBIA 2HNTC 2A45B 2FX6A 1RIWB 4LOYH 1DY8A 1J17T 1OWJA 3S0NA 1XUFA 3E3TA 1JIMA 4Y8YA 4O9VA 2HWLB 3MYWA 4ABBA 1SG8B 1SL3A 4Y71A 3BIVH 2UWLA 4MDSA 4BAMB 2XC4A 3F1SB 4X8UH 3KL6A 2VINA 3GDUA 3SNBA 1QR3E 3RXLA 3ZVFA 8KME2 1TOCB 2O8UA 1O2PA 2D2DA 3LJOA 1BB0B 4GPGA 1L4ZA 4DJZB 1V2PT 2QAAA 2G00A 3SGBE 3MNBA 3A85A 2Y80A 1ELVA 1P0SH 2PWXA 1HIAA 1K1JA 5FPTA 1C1NA 4BTIB 2FTMA 2BVRH 4WVPE 2R3YA 3F68H 2GCHF 3UNSA 1ZSLA 3MNXA 2JETC 1BMNH 1OWHA 2FZZA 1P57B 1O5GH 3EGKH 4ZROA 1Y3VA 3AW0A 4Y0ZE 4AFUA 1QB9A 1ELTA 2FYRA 1UVSH 2PSXA 1P3CA 5C1XA 1OP8A 1OWIA 4DURA 1D3TB 3M61U 3TGIE 7GCHF 4GSOA 1YLCA 2XNIA 1FY3A 4M7GA 1PPZA 3UUZA 1K1NA 3KEEA 4INLA 4Y7AA 1HB0B 1AWFH 1HUTH 1GHAG 1DLEA 4GCHG 1FNIA 2GCTC 1O2LA 2BMGB 3A83A 5F8ZA 1ZHPA 1BRBE 1AKSB 2GKVE 2A4RA 2TGPZ 1DITH 4Q7XA 1TYNA 3QDZB 1GI1A 4GHQA 4OGYA 3TGJE 2PKSB 1EAUA 2HOBA 1KDQB 1KLJH 2BD7A 2GGVB 4MNVA 3WY8A 2PGBB 1T7CA 4O3UA 5C3NA 4K1EA 1HAGE 1AN1E 1FMGA 2FOBA 4OS5A 2NU3E 1AFQB 3M36A 2VNTA 2WV5A 2ZTZA 1MH0A 2QIQA 1GHZA 2FIRH 2GDDA 2WINI 2FO9A 2LIZA 1V3XA 4RKOB 1O2UA 3RXKA 1MCTA 1ABJH 1K9OE 1QY6A 3B23B 1C1UH 1KIGH 4GHTA 1BHXB 2QGRA 2QF3A 1C5VA 1HGTH 4X0WU 5B6OA 1MTVA 1AHTH 3LGIA 1LO6A 1RTLA 3OY6U 3EYDA 4LZ1H 2ZI2H 3BV9B 3FP7E 5EXNA 3EE0B 3K6YA 2BY5X 4Z0KA 5FPSA 5F8TA 3TIUA 4E7RG 2R2MB 3VGCB 4CH8B 1KXDA 2ZU2A 1NRRH 5ABWA 4BANB 4J2YB 3RXQA 1GDNA 3RC5A 4RSPA 3H7OA 4BXSA 1RJXB 1Y8TA 2Z9LA 5TCCA 1K1IA 1CU1A 4I32A 2O8LA 2GZ7A 2RA3A 4VGCC 1RGQA 2J94A 1O2JA 1JXPA 3S9CA 1F5LA 3A8AA 3M7QA 1O2VA 3O8BA 1SGFA 2BD4A 5I25A 2DE9A 1VGCC 3U69H 1B7XB 2UWOA 4DOQA 2A0QB 3TU7H 1N8OC 8GCHG 2V6NA 4XE4A 4WMFA 3FP6E 3RXSA 5A8XA 4CHAC 1SGFG 5F8XA 3EDXB 9LPRA 2ZHQH 1DSTA 4XFQA 4I8HA 1QJ7B 2ASUB 5A09A 3KQEA 1PQ7A 1FZZA 1QL8A 1C1VH 1S0RA 2ODPA 3BTKE 5EQSA 1BTUA 1GI6A 1LHGH 1Z8RA 4OS6A 5K7RA 1EJAA 3P17H 4XBBA 1P2KA 2SGPE 3RUOA 1O5DH 1DFPA 1AVXA 1MBQA 1FY8E 1TONA 4X6PA 1LQEA 3E0PB 3T28A 1UTPA 1C5PA 3SOSA 3MO3A 3PTNA 4XSKU 1INCA 2CGAA 1O5FH 3TH3H 2ZHDA 1GJ6A 5C1UA 1C2MA 1Z1JA 2ZFPH 1UTKA 3LGUA 1UHBA 1CA0B 1X7AC 3OY5U 1MZDA 4THNH 4A7IB 1A5GH 3SGQE 4WMEA 2AH4X 2XBWA 3R3GB 1F92A 1S5SA 5EQQA 3VB4A 5AFYH 1EASA 2Z9GA 2XW9A 1LPKB 1VJAU 2ZF0H 1YPEH 1Z8IB 3SNEA 2F91A 3UNQA 2UWPA 5EODA 3MO9A 1CHGA 2BDCA 2VH0A 4I8KA 3EAJA 3MH7A 1P2MA 1DUEA 5AFZH 1BHXF 3MMGA 4A1VA 1MBMA 3KHVA 2AYWA 1Q3XA 1G2MA 3FAOA 1QCPA 5DP7A 1CBWB 1ELFA 3KGPA 1O30A 1VITF 2ZFSA 3LDXH 3QTVH 4AG1A 4JYTA 4MPWA 1GBAA 1NRPH 3RMLH 3SHAH 1G3CA 1MKWK 2BY9X 2CF8H 2PV9B 3BTHE 4CRDA 1UTLM 2C4FH 5LPRA 2FLRH 3UREA 1GJAB 3RXUA 1KXBA 3GCTG 3ZZAA 1GI8B 1G2LA 4U30A 1J16A 2Y5GA 1MU6B 1EZQA 3SV2H 2P8OC 1LTOA 2Q6FA 1UTJA 1NPMA 4MNYA 1O3AA 2ZC9H 4FUHA 4AYYB 5LPFA 1A7SA 1TX6A 1SGQE 2Z6BD 2ZU4A 2ZHEH 4NWKA 1IQFA 5A0BA 3RXMA 1GHBG 4ABFA 1KLTA 1ZZZA 2AFQB 3SQEE 2QXIA 4KTUA 3Q77A 1C1SA 1NRSH 1V2NT 2GV7A 2SNWA 3MH5A 4WY3A 4AFZA 6GCHG 5FAHA 6CHAC 4SGBE 1LPGB 4QT8C 4NA9H 1ZPZA 1GVZA 3TVJB 5GDSH 1QL9A 1RIWC 2K7XA 2W7UA 2GD4B 4CBOA 1FAXA 2WPIS 2OLGA 3ELAH 2C8WB 4UFEH 3UOPA 1AGJA 2ZHFH 1ESBA 4O3TA 1G3BA 2FI3E 3SV7A 2D26C 3RXHA 3D62A 2ODQA 3TNSA 2ZQ1A 1W0YH 3A82A 3OTJE 2H5CA 1XUIA 1NC6A 2RG3A 4I8JA 1MTNB 5FBIA 2P16A 3M3TA 1O2ZA 4JZ1A 3MHWU 1SHYA 4A1TA 1OX1A 1WTHD 3UQOA 1NRNH 2NU2E 2W5EA 2V3OH 2WPHS 4GAWA 3PROA 4AOQA 1O3EA 2RDLA 1FPCH 2BDHA 1SMFE 1WUNH 1UTQA 1O3LA 1PFXC 2ZCLP 3UIRA 2PUQH 1XUJA 4JZFH 1HIAB 1NTPA 4WF8A 3U8OH 3GY5A 1DICA 4B76A 3ENSB 3RDZA 3MU8A 1ZR0A 2BY7X 1PPHE 2NU1E 2ZTXA 3V0XA 3SU6A 2Z9KA 4X8TH 5A2MH 2BZ6H 1ZLRA 4KGAA 3TH2H 2ZGHA 4YM9A 1HNEE 2PLXA 1CHOG 3RXTA 1P01A 5F03A 4ABIA 1LHCH 1BIOA 1V2QT 4B73A 1K28D 3SV9A 1QFKH 1ETTH 2O8MA 2VJ1A 2B8OH 2BTCE 2PGQB 4HTCH 1W0ZU 3P8FA 2P3FH 2ZGJA 3BSQA 2G5VA 1A0JA 1AB9B 1SGCA 2SGFE 1Y3YA 2PKSC 4ISHH 1WSSH 1OPHB 1GJ7B 1GI4A 2VIVA 1C2IA 2J2UA 5HMAA 1Z1IA 1DOJA 3FP8E 2Z3EA 1AFQC 1E0FD 4JCNA 3A88A 1FPHH 1KLIH 1NM6A 1TGNA 1GMDG 5A8YA 3UNRA 1P09A 3OYPA 5DGJA 1GBDA 4NG9H 1C5YB 2IOTA 3GY7A 1GJ8B 3MNCA 4ZKRU 4KELA 2XWBI 3ZZCA 4U2WA 2HNTE 1BRUP 1ELEE 1C5RA 3GOVB 1TRNA 2Z3DA 1O0DH 1QGFA 5LGOA 3RXRA 2BLVA 2BD3A 1GI2A 2FOGA 3VGCC 5F6MA 1OP0A 1VCQA 2WPLS 4NIWA 1TA2A 3ZYDA 2BQ7B 2BD5A 4KTCA 4B2AA 1Z71A 3UWIA 4Q2KA 4PROA 1NY22 1B5GH 1BTXA 1EZSC 1W8BH 2YNAA 1IQEA 5SGAE 2ZHWH 1IHSH 2P93A 1RS0A 1FY1A 1O3KA 3MFJA 1HYLA 1MKXK 3F9HA 1HJAB 1ACBE 1YM0A 5GCHF 5CE1A 1M9UA 2VWLA 3HGPA 1WOFA 2AIQA 4SGAE 4J1YA 1GGDB 1SLXB 3PO1B 1D6RA 1UCYK 2FXRA 2V35A 3TH4H 4D76A 2QA9E 1Z6EA 1HRTH 3ZZDA 1H9HE 1LKBA 4KTSA 3RXGA 2PKAB 1LVYA 3ZYEA 1TNHA 1ZTLA 3BTTE 1KYNA 3SGAE 1N6YA 2Y5FA 2GDEH 1WBGB 1Q2WA 5EQRA 3AAVA 1W10U 3MO6A 1JMOH 1C2EA 1P05A 1SFQB 1TIOA 4TPIZ 1KY9A 3L3TA 1GMHG 1TAWA 4K69A 1PYTC 2EA3A 2ZDKA 1O37A 1O32A 4NFFA 3GY8A 5T3HA 5H4IB 1THSH 4GCHF 1F0RA 1GHWH 4XOJA 3RC4A 2P3UB 1H1BA 3MTYA 3PMJA 1K22H 2BYAX 2CXVA 1J15A 1MU8B 1FN6A 2C8ZB 2BB4A 2P95A 1MAYA 2KAIA 4I8LA 1CA0C 1DXWA 5ESTE 2GT7A 1GI7B 1P9SA 5DP8A 2XYAA 1DLKB 2ZFTA 2OD3B 1EAIA 3QN7A 4GVUA 5AF9H 3MNSA 1EAWA 2QY0B 3UOUA 1GVLA 1MKWH 1UHBB 3PWBA 2BZAA 3URDA 1AE8H 3PLKA 1G36A 1FV9A 1O5BB 2NU0E 2SFAA 2ZDMA 4CREA 3TJOA 1CBWC 2ZGBH 1EOLA 4WXVA 5FBEA 4NWLA 2XRCA 3TK6A 3P95A 1C4V2 4I31A 3FZDA 3VB6A 1TPAE 4TY7A 2Y82A 3RP2A 1XM1A 2ZWLH 1C1PA 3SNCA 1BCUH 5TCAA 2EI7A 1MMJN 1PPEE 5A8ZA 2R0KA 1V2VT 1J14A 1A5IA 2OP9A 1O3FA 1DX5M 2B9LA 5I46H 1A3EH 4ISOA 1C1TA 1W11U 4H4FA 1C1OA 1GMCF 1QNJA 3HGNA 2CF9H 1VZQH 3R0FA 2NU4E 1O5CB 1PQ8A 1Z6JH 3A8BA 1AWHB 1EUFA 1FLEE 3ZVDA 3BEIB 8GCHF 4NCYA 1ZMNA 1CT2E 3U8RH 2AMDA 4AGKA 1O2RA 2XCNA 4AB8A 1AY6H 2A2QH 2Y7ZA 2Z9IA 1GBMA 4AX9H 3JZ1B 5C2ZA 5EGMA 1AZZA 1O34A 2SGQE 3MU4A 3DD2H 5HM2A 1E38B 1ZHMA 1NRQH 1NN6A 4NSYA 5CHAB 1BTHH 4MPVA 3M5NA 1QURH 3F9GA 1CGHA 4B74A 4NA8A 1D3DB 4NA7A 4FUIA 4INKA 3MWIU 1CT0E 1Q31A 2G81E 1F0TA 4D9QA 2UUJB 4I33A 2TGAA 3EA7A 1ESTA 2CHAB 2A5IA 1YP9A 1EAXA 1MTNC 1GHVH 1C2FA 1ELCA 3KIDU 4FUEA 4K8YA 2FI4E 1H9IE 4MNWA 1BDAA 1OP2A 4KKDA 4IN1A 3SJKA 2FEQH 3B8JA 1ZRKA 2ZFQH 1C5XB 2IN2A 2CMYA 1F0SA 1Y3WA 1YPHC 2RA0A 1Z8GA 1CO7E 3DFLA 4WJG2 4B75A 1K1PA 2DUCA 2QYIA 1GBLA 4D7FA 3F9EA 3GDVA 2ANKH 3E8LA 4WXIA 1OWEA 3PTBA 1S6HA 4CRBA
chains in the Genus database with same CATH superfamily
1ANCA 1ANBA 3ITIA 3P70B 1RXPA 5LPEA 5GWZA 3BEUA 4BNRA 3SORA 1BTZA 1G3EA 2KFWA 3STJA 1HCGA 5EJZA 3CP7A 4NFEA 1O3PB 2H6MA 2W7SA 4UEHH 5C17A 2FOHA 2ZDNA 3GCTF 3S7HB 3AAUA 5FXLA 1TWXB 2EY4C 1GBFA 4BAHB 3ZIAD 1JOUB 2ZPSA 1NO9H 1DPOA 1AB9C 3QGNB 3UTUH 1IQGA 1DWEH 1C4U2 2XCFA 4YTAA 1TPOA 1H9LB 2PFEA 1C2LA 3GY6A 1ABIH 1QJ6B 1ZJDA 1S0QA 1KTTB 1CT4E 3RU4T 1W2KH 3MOCA 1GHBF 5TJXA 2VB0A 2VGCB 1O3MA 1AVWA 1D9IA 1T4VH 2BHGA 1YGCH 4X8SH 4AC9A 2A4GA 3FFGA 1GJ4H 2WPMS 3RXIA 1ZOMA 1W7XH 4E06H 2YMSC 3LPRA 1C5WB 1O2NA 6ESTA 2BDGA 1QL7A 4WWYA 3BTGE 2V0BA 1VKYA 3OE7D 1N1LA 4HI3A 1MZAA 4YO9A 1G32B 2J9NA 2FOCA 4IS5A 1J9CH 2BLQA 3K2UA 1NS3A 4CRCA 4B71A 3LC5A 4MNXA 2PKAA 4YLQH 1D3PB 1AUJA 3M3SA 2ZQ2A 1FQ3A 1PQ5A 3RXVA 2ZDVH 4E05H 4B1TA 3SV6A 1D3QB 1TPPA 2F3CE 1YPLH 1HXFH 1THPB 1XUKA 3BF6H 1TPSA 1JWTA 1GHYH 1QBVH 3UR9A 3LGYA 1EB2A 3T29A 4HZHA 1XX9A 1FIWA 2HRVA 2ANWA 1DVAH 2XBVA 2QF0A 4CRFA 1A4WH 1UCYH 2LPRA 1GWAA 4FUFA 1AZ8A 1YKTA 3UFAA 2WPJS 3NXPA 3I78A 1ZPBA 1HJAC 1O2YA 1LHEH 4YXWD 3Q00A 4LK4A 1SQAA 3PV2A 1W7GH 1GDQA 2J97A 8ESTE 1BT7A 3ZZ6A 1GGDC 3PO1C 1V6DA 3FVFB 1GJ5H 5C67A 2KCAA 3Q3XA 4A6LA 1KXAA 2ZA5A 3MI4A 2BX3A 4FUBA 1C5ZB 1C2JA 3ATLA 1ETSH 1L4DA 1SFIA 3M5LA 2G52A 2GCHG 2J34A 1VCPA 3GY3A 1AVGH 5EXMA 1T31A 1GBTA 1P10A 1EPTA 3NKKA 4FUGA 1GBEA 1SKYE 1CHOF 1RFNA 4ISLA 1RRKA 1O3IA 3H7TA 3PLBA 3ZVEA 1BA8B 1BJVA 2Q6GA 1EP6A 1WAYB 3N7OA 5DK1A 1F5KU 3PWCA 5C0TA 1NESE 4YESB 2TIOA 1QRZA 1TMTH 2GTBA 1XVOA 7GCHG 2AMQA 3VFEA 1LVOA 1OYQA 1KMHB 3LONA 2A5AA 1KXEA 2H9TH 4E7NA 5EPNA 3T2NA 4RKJB 1YLNA 4X6OA 4B2BA 1GMDF 2OUAA 4AN7A 2R9PA 2KAIB 4K1TA 4OGXA 2J38A 3SU5A 1P8VC 1O3BA 1XVMA 3SJOA 1BMFD 3UQVA 2A5KA 2FOAA 4GUXA 3URCA 3W94A 3O8RA 1W12U 3SJ8A 2J92A 2PTNA 1G9IE 3VB3A 4ZHLU 2BLOA 1MQ5A 3KN2A 2GMTB 1TRYA 3EA8A 2CK3D 4CR9A 4DGJA 1XXFA 3UB0A 4R8TB 1GL1A 4JK5A 1Y5AT 1MAXA 1AQ7A 5HIZA 4OS4A 4ABAA 5DP4A 4Q7YA 1QBNA 1AE5A 4ZUHA 1TGSZ 2GVFA 5BPEA 2VWMA 1GG6B 4CRAA 3SJ9A 2J98B 3LT3A 4XD7D 4XDEA 1XKAC 5DKMA 3RLYH 1MTWA 1MABB 3BG4B 4FU8A 1SB1H 1JRSA 3ZVGA 2PTCE 2ZCHP 3T25A 3C1KA 3S7KB 2C8YB 2XC0A 4JZDH 1DM4B 1HXEH 4AORA 4CBNA 2JH6D 3SNDA 3NZIA 4BTUB 1SLVB 2ZO3H 1HJ9A 1TQ0B 2W3KA 1C5SA 1EOJA 1Z8JB 2ZFFH 1BBRE 2ZPRA 1GBHA 1A5HA 4AFQA 3RU4D 2HLDD 4AZ2B 1A46H 2HALA 3RU4E 2XC5A 1GJBB 1MUEB 3CENA 2F9UA 3M5MA 2V3HH 3LKWA 1FJSA 1IQLA 1ZJKA 2Y6TA 1B0EA 3P8OA 5CHAC 1XUHA 1O39A 3ATIA 3OX7U 2ZKSA 2L6OA 1EXFA 4JMYA 2M5TA 1ELBA 1PYTD 1S84A 1O36A 4NSVA 1H4WA 4Q4LA 1O3CA 2B0FA 1KSNA 2BVXH 1BTPA 1YC0A 4UONA 2WV9A 1SGTA 2ZCKP 1FUJA 3JZ2B 2YNBA 1SBWA 1U6QA 3CNRA 2CHAC 1ANDA 4JYVH 4FXGH 4AB9A 1TBZH 2G5NA 1MQ6A 3TJNA 1LHDH 3ODDA 1S85A 3MQKC 2KCYA 2OK5A 2OBOA 1V2UT 3DHKH 2VIWA 2K1QA 5FCRA 2QC2A 4OS2A 2QXGA 3RM2H 2IPHA 3KQCA 3OSYA 5E8EH 2RCEA 3LGWA 1C5MD 4IC5A 1GCDA 2O9QA 2FYQA 1FDPA 1SC8U 1W14U 2BOHB 4DVAU 2EEKA 1SQTA 2BM2A 1UK4A 1O2WA 5IK2D 3VEQB 3VXEH 1AMHA 3SI4H 1ZGIA 3NK8A 4BOHA 3VB7A 1BMLA 4RT0A 4X2XA 2ZP0H 3P92A 5DP9A 3BTEE 5JDUB 1W0JD 3L33A 3E1XB 3PM3A 2C90B 1F5RA 1K1MA 4OS1A 4I7YH 3ZZ7A 1XKBC 1BUIA 1TGCA 1UVTH 4BAKB 1SLWB 1PPCE 1ZRBA 4ZH8A 3EA9A 5DP3A 1Y5BT 3QX5H 1ZSJA 4ZXYH 2SGEE 3T62A 5GPIB 1O3OA 2LELA 1QZ8A 1AIXH 1YY3A 5EU8A 2TRMA 1O5EH 4YOGA 2VGCC 4RN6A 3BIUH 3M7UA 1ZMJA 3C27B 2SNVA 1RD3B 1Z7KA 1L1GA 1PJPA 7ESTE 4JZIA 2ANMH 1O2TA 1SGEE 3SU0A 4ESTE 3IG6B 4NZLA 3RXJA 2IJD1 1OHHD 1GJDB 2OQ5A 1V2KT 2STBE 3KF2A 2QCYA 1TOMH 3RXOA 5L30H 2HLCA 1SGDE 2CV3A 2KM0A 1EATA 8LPRA 3KQ5A 1TMBH 1EB1H 4UD9H 1LPZB 2Z94A 2BDAA 3M37A 1GI0A 4IGDA 4JK6A 1WCZA 1QQ4A 5LH8A 2YOLA 2H9HA 2Y81A 1CQQA 1DS2E 2VWOA 1A61H 1O38A 5A0AE 1C5OH 2FX4A 2UUYA 1FI8A 1AO5A 2OBQA 1TMUH 5JBTA 1S82A 2BQWB 2A7CA 5J4QA 2A1DB 2PR3A 3QGJA 3SUGA 1P02A 1K1LA 3SU1A 1GHAF 2FTLE 2I6SA 2ZEBA 4UE7H 2L74A 4A1XA 3A7YA 2O8TA 4Y79A 1AI8H 2Z7FE 5EG4A 4ZAEA 4H6TA 1YWUA 4K60A 2WV4A 4DT7B 2F83A 2C93B 2WZQA 3BTFE 1TB6H 4GLYA 1GI3A 1P04A 5IDKA 3RM0H 1A0HB 3AASA 1BRAA 1HV7A 3RXDA 5EXLA 1W0KD 2XTTB 1QB1A 1G3DA 1NU9A 1P2IA 2GZ9A 1QRXA 3LU9B 4Q80A 1D4PB 3U1IB 2ZDAH 2AGEX 3QO6A 1F2SE 2TGTA 1O2KA 5E0GA 1C4Y2 3KNXA 3Q76A 1FY5A 1TA6A 1EPTB 2VIQA 1OKXA 1UO6A 2EI6A 4IMQA 2JKHA 3P8GA 1O31A 1RTKA 2WYJA 4K3JA 4IN2A 1HAPH 5E0HA 4MVNA 2BD9A 4X1RU 1HLTH 1SHHB 1S6LA 2HPPH 3WWFA 3MU5A 1W13U 1N6XA 3RC6A 2Q1JA 1DSUA 1SPJA 2ZZUH 1P12E 3A8CA 2B5TB 3V7TA 5C20A 1IQIA 2AERH 3A8DA 1V2JT 2PSYA 1P2JA 1ZTKA 4FETA 2BLWA 1SOTA 4OS7A 2A2XH 1ETRH 4X8VH 1SGIB 3PV5A 2YMSD 1FAKH 1C5LH 3TJUA 3ZZBA 1KXCA 4IC6A 4BAOB 5JBCS 2BDBA 3A80A 3L6PA 1O2HA 3NRLA 1YPMH 1MD8A 2GMTC 2Y7XA 3DT0H 4A5TS 2ZFRH 5GIBA 1F0UA 1TFXA 1FY4A 5ETXA 3HKIB 3M3VA 4D9RA 5DSFA 3BTWE 5EIYA 4WMDA 3MH4A 3N7DA 2FS8A 1O2SA 4RI0A 2G4UA 4F4OC 4F49A 3HK6B 1GBBA 4ZHAA 2Z9JA 3E0NB 3M5OA 3S9BA 1GG6C 1ZTJA 1TGTA 1YBWA 1IHTH 4INHA 1UCYE 3E91A 3F9FA 2ANYA 1K0HA 1C9TA 2AS9A 2UUFB 5KEDA 5K0HA 1C2GA 3BG4C 1GBKA 4Y10E 1W3CA 2R2WU 1TNGA 1UVPA 1QHRB 4IMZA 4Y8ZA 3W1EA 1O2QA 4HFPB 4B6FA 1IQNA 2WPKS 9ESTA 4DIHH 1E34B 2F9BH 5A0CA 1P11E 1XUGA 2Q6DA 3Q3YA 7KMEH 3TITA 1YCPK 1LKAA 4ZMAH 2ZPQA 5KECA 2OC1A 2BY6X 3D23A 1GDUA 4ZKSU 1EJNA 2GT8A 2A4OA 2H5DA 3HPTB 4FUDA 1SGNE 4FUJA 3RXAA 3GICB 5GCHG 5GNDA 1QB6A 1HDTH 1S6FA 1KTSB 2J4IA 4ABEA 3PYHA 4ZXXH 2AIPA 1NFXA 1P03A 4HGCA 1P2OA 3DFJA 4AG2A 3V13A 3RMOH 1BRCE 2A31A 4MPUA 3QLPH 3QZRA 4NIYA 4ISNA 1QJ1B 4JZEH 5J4SA 2G8TA 2VWNA 5C5NA 1OS8A 5E0JA 1NZQH 1CGIE 4O03A 3ZZ9A 1C1MA 4H6SB 2P94A 1FN8A 1HAOH 2FESH 1A2CH 3A81A 1VR1H 2QV1A 2FS9A 4Y0YE 1UJ1A 1BTWA 1OYTH 5GJ4B 1Y59T 1V2WT 3E6PH 3FANA 2QXJA 2FI5E 3QWCH 2D1JA 2F43B 1YPGH 2KZ4A 3NCLA 2P3TB 2H9EH 4TPYA 2F9OA 1P06A 1WYKA 1NU7B 4FVDA 1DWBH 3SJIA 3U9AH 2F9NA 1V2ST 2G51A 1GJ9B 3LOXA 3TGKE 4YZUA 3RMNH 4H42U 1HAZB 2VIOA 1MTUA 1ZSKA 2AHME 4X1PU 4ZKNU 2BXUH 4K2YA 1C2KA 1JRTA 4YLUA 1PPFE 2QN5T 3GYMA 1BOQA 5JB9S 3BN9A 2Z3CA 1PQAA 1WU1A 4XBCA 6GCHF 2HPQH 2JJ1D 3A7VA 2BDYA 1A0LA 1C1RA 1HPGA 1QTFA 1SSXA 3OEHD 1UK2A 3F0OA 1YYY1 1EKBB 3ATMA 4B2CA 3MU0A 2WPDD 3SU3A 1G37A 1TX7A 2JH0D 1DE7H 3DUXH 1ELDE 1HAIH 3SN8A 1C2HA 2FWWA 2TPIZ 1CGJE 1SQOA 2LNCA 1T8MA 3TPIZ 3Q3KA 1PPBH 1LMWB 1ELAA 1MKXH 3TK5A 3KYGA 2RDEA 2XBXA 1GMCG 1GVKB 5AHGH 4AFSA 1ZHRA 4F55A 2CN0H 1S83A 3PRBA 3GCHB 2BD8A 3AVZA 1TBQH 3GY2A 1DT2A 2WUBA 3ZVCA 1IQHA 1O3NA 3ESTA 4MLFB 2J5UA 1C5QA 1E79D 4YT6H 3K6ZA 1LQDB 5G4BA 4LXBH 4TWYA 4ZKOU 2SGDE 5CDFE 5L2YH 1O2GH 1G30B 1XXDA 2ZG0H 1E35B 2BQ6B 2SGAA 1O35A 4NIVA 3ZV9A 3SZNA 1IOEA 3ZVBA 4UFGH 4D7GA 4MG3A 3ATWA 3SV8A 3PMHB 4WH8A 3T26A 1IAUA 1VJ9U 2FDAA 4P00A 5IYTA 3SW2B 3V12A 5AVDA 5EPYA 4IBLH 4I8GA 3RXBA 1AU8A 1HAVA 5T6FA 1BBRK 1HAXB 3S9AA 3BEFB 2ALVA 4DIIH 5DPAA 2HVXA 3RXEA 2ILNA 3HATH 1GBCA 2OC8A 5JB8S 2HGTH 4FU9A 1WDIA 5ESBA 5FPYA 1MTSA 5EW1H 2EC9H 3U8TH 1C5TA 2B7DH 1S81A 3RMMH 2W6JD 4YOIA 4ABDA 1C1WH 1EZXC 1ARCA 1TBRH 2ZTYA 4Y11E 2O8WA 4F48B 3BTDE 5EOKA 3TJVA 1BTYA 3TLOA 1O2IA 5FL7D 1C1QA 2FOMB 1V2TT 2D8WA 3IITA 2AEIH 3VPKA 4ABHA 1GCTB 4MPXA 3GCOA 1HFDA 1T8OA 1O2XA 4YT7H 1YPJH 1ZGVA 3M7TA 4RT1A 1GL0E 1BITA 1E37B 3SNAA 2AGIX 1GHXH 1ARBA 2BOKA 5L6NH 1CVWH 3F2FA 1AFEH 2C8XB 1NT1A 4A92A 1YPKH 1ZPCA 5T6GA 2GZ8A 2VVCA 1EPTC 2ZGCA 1GJCB 3GY4A 4K8BA 4XBDA 1V2OT 1NFWA 5HM9A 4FUCA 2AMPA 1ELGA 4KP0A 3I77A 3ODFA 3TK9A 2H1UA 3DA9B 1H8DH 1A1RA 3H09A 3LIWA 1C2DA 3LH3A 1DXPA 5HGGA 2GV6A 5DG6A 5C5OA 3K9XB 3MU1A 1L1JA 3SO3A 3ZZ5A 2OQUA 1O2MA 4IW4E 3SUDA 1UTNA 1EQ9A 2WYGA 3U1JB 5C94A 3NPSA 1A3BH 2BDIA 2V3MA 2KCPA 3A84A 4Q7ZA 4X6NA 1C5UA 1UTOA 1Y3XA 1QBOA 1K21H 3ZVAA 5FHTA 1O3GA 3PV4A 1V2MT 1L1NA 2QXHA 1QIXB 1EJMA 4MTBA 4TYDA 3DSPA 1E36B 4UFDH 3LGTA 3AW1A 3KYFA 2GJGA 5KGOA 5PTPA 3D49H 2P59A 3OU0A 1EX3A 4DCDA 1EP5A 2R0LA 1DUAA 1FX0B 3QZQA 3UR6A 1T32A 2XNDD 1YCPH 1TNKA 1HAYB 2ZU3A 5C1YA 4ACBA 2FODA 4Z6AH 2FOEA 2ESTE 1ESAA 1Y5UT 2VVVA 3MH6A 3GYLB 2JETB 1TE0A 2F9VA 1GMHF 1F7ZA 1IQMA 5L2ZH 3P6ZB 1MD7A 3QK1A 1TQ7B 4NZQA 3E90B 2EI8A 1OXGA 3PMBB 2IJOB 3SBKA 4U32A 2PHBA 2VH6A 3WW7A 2CJIA 1ZYOA 2GP9B 1AKSA 3U98H 5DO4H 1MCVA 4CR5A 1KDQA 2OTVA 3BG8A 5FX5A 1SGRE 1L2EA 3IWMA 4TY6A 2ALPA 1NFYA 1ANEA 1UVUH 2VIPA 4X2YA 5T6DA 2GCTB 2PUXB 5DP6A 3SI3H 2FOFA 3M35A 1IQJA 1T8LA 2FPZA 2A7JA 1JIRA 1IQKA 2TBSA 1LVBA 1O3JA 1FONA 3SU4A 1TNLA 4NIXA 2ZNKH 3SYJA 1GI5A 2FM2A 3A7XA 1V2RT 2ZGXH 1VCWA 5EW2H 5HXFA 1GBJA 3UY9A 1K2I1 2NWNA 1OOKB 2XWAA 1OWKA 1L0ZA 1LVMA 2R3UA 4TT3D 2IPQX 2XOKD 4ISIH 3ZZ4A 7LPRA 1GPZA 3F6UH 3H5CB 4AGJA 3CS0A 3EBNA 3SUEA 1EZUC 1BJUA 3VB5A 3DCLA 1WQSA 1SI5H 2HNTF 1JBUH 4X6MA 1VITG 2ZU5A 3OTPA 1QQUA 2GX4A 1NFUA 1H8IH 3A7ZA 3SHCH 4CH2B 2FP7B 1GI9B 3BTME 1HAHH 3W95A 1C5NH 1BMMH 2VIDA 3NWUA 3GCNA 3RLWH 1LDTT 1LCYA 2OC7A 1LHFH 3P8NA 1O2OA 2OXSA 3A7TA 2M2AA 3TNTA 4UFFH 1UK3A 3K65B 4U01A 2ZIQH 3B9FH 1DANH 3F2GA 2G55A 4VGCB 1CE5A 1OSSA 1TX8A 2PW8H 3F3BA 1WV7H 1HJ8A 3E16B 2JJ2D 1DDJA 1QA0A 2OC0A 1D6WA 1VGCB 1K1OA 4X2VA 1CA8B 5HYOA 1SOZA 1THRH 2Y5HA 1N8OB 1VITH 5CMXH 2ULLA 4BXWA 3FKSD 2FMJA 3HK3B 2JH5D 1BZXE 3SUFA 3QTOH 4YOJA 2THFB 4CHAB 2XBYA 1FXYA 3KQBA 2VU8E 2UUKB 4CRGA 4DG4A 2RFKC 2W26A 3O8CA 3CS7A 1SGYE 5JPMH 4K1SA 5DP5A 1UVOA 1YLDA 2BX4A 2A32A 2C3SA 4JYUH 3LC3A 2FLBH 3GCHC 3SQHE 3RXFA 1YF4A 4FVBA 1H8ED 3STIA 4DY7B 3LJJA 4Y7BA 4ZCNA 1CSOE 1PPGE 3ZZ8A 1J8AA 1P3EA 2F9PA 2ZECA 4AYVB 4D8NA 3PB1E 1BQYA 3VXFH 1TRMA 3SU2A 3KQDA 1TNIA 1TNJA 2I6QA 1BBRH 3I29A 1O3DA 1BMAA 1YPHE 4DW2U 2WUCA 1ID5H 2TGDA 3GDSA 1TABE 1C9PA 2A4QA 2W3IA 3HKJB 3KCGH 4ZHMU 3BTQE 4M9FA 1UMAH 3FZZA 4FU7A 3A7WA 4DT4A 1XMNB 3QUMP 4FOUC 1NBMD 1KXFA 1NBME 2AGGX 2K0QA 3FO8D 2A7HA 1TLDA 5FCKA 1O3HA 3RXCA 1WQVH 3D65E 1ORFA 3UPEA 1TALA 1OWDA 3A86A 2WSSD 5JYIA 1QRWA 2STAE 5E2PA 4WH6A 4BAQB 3ZZ3A 1SVPA 4Y6DA 1O5AB 3T5FH 1HBTH 3O8DA 2VVUA 4X1SU 1RTFB 1HAVB 4NGAH 1SLUB 4P02A 1V2LT 2H2ZA 3LGVA 6LPRA 1WTGH 1SGPE 2K8IA 1Y3UA 3G01A 2BVSH 3WWBA 5JBAS 3UWJH 2BD2A 1YCPM 4ABJA 5FX6A 3S69A 3LH1A 1P2NA 1AD8H 4X1NU 2OINA 4Y8XA 1ZMLA 3PLPA 1GCTC 5DJ7A 4Y76A 4ACAA 3A89A 1SR5C 5BRRE 2P8OB 2BXTH 4MQAA 4R0IA 1T4UH 3T27A 4LZ4B 4TWWA 4X2WA 1O33A 3A87A 3EQ0H 1TGBA 1EFRD 3GISB 5GXPA 3F0PA 5JBBS 2J95A 2BY8X 2OCVB 1QA7A 1P9UA 4X1QU 4BTTB 2ZU1A 2G4TA 1NROH 1FIZA 1DWDH 1T8NA 1P2QA 1B0FA 4O97A 4ABGA 3RXPA 1DY9A 1UTMA 6CHAB 3U28C 1DWCH 2DE8A 3ZV8A 2XXLA 3ATKA 3V3MA 3NUMA 2ZDLA 4UDWH 1AUTC 3PMAB 4K5ZA 5E2OA 4ASHA 2ODYB 1GBIA 2HNTC 2A45B 2FX6A 1RIWB 4LOYH 1DY8A 1J17T 1OWJA 3S0NA 1XUFA 3E3TA 1JIMA 4Y8YA 5B6LA 4O9VA 3EE7A 2HWLB 3MYWA 4ABBA 1SG8B 1SL3A 4Y71A 3BIVH 2UWLA 4MDSA 4BAMB 2XC4A 3F1SB 4X8UH 3KL6A 2VINA 3GDUA 3SNBA 1QR3E 3RXLA 3ZVFA 8KME2 1TOCB 2O8UA 5EJ1A 1O2PA 2D2DA 3LJOA 1BB0B 4GPGA 1L4ZA 4DJZB 1V2PT 2QAAA 2G00A 3SGBE 3MNBA 3A85A 2Y80A 1ELVA 1P0SH 2PWXA 1HIAA 1K1JA 5FPTA 1C1NA 4BTIB 2FTMA 2BVRH 4WVPE 2R3YA 3F68H 2GCHF 3UNSA 1ZSLA 3MNXA 2JETC 1BMNH 1OWHA 2FZZA 1P57B 1O5GH 3EGKH 4ZROA 1Y3VA 3AW0A 4Y0ZE 4AFUA 1QB9A 1ELTA 2FYRA 1UVSH 2PSXA 1P3CA 5C1XA 1OP8A 1OWIA 4DURA 1D3TB 3M61U 3TGIE 2V7QD 7GCHF 4GSOA 1YLCA 2XNIA 1FY3A 4M7GA 1PPZA 3UUZA 1K1NA 3KEEA 4INLA 4Y7AA 1HB0B 1AWFH 1HUTH 1GHAG 1DLEA 4GCHG 1FNIA 2GCTC 1O2LA 2BMGB 3A83A 5F8ZA 1ZHPA 1BRBE 1AKSB 2GKVE 2A4RA 2TGPZ 1DITH 4Q7XA 1TYNA 3QDZB 1GI1A 4GHQA 4OGYA 3TGJE 2PKSB 1EAUA 2HOBA 1KDQB 1KLJH 2BD7A 2GGVB 4MNVA 3WY8A 2PGBB 1T7CA 4O3UA 5C3NA 4K1EA 1HAGE 1AN1E 1FMGA 2FOBA 4OS5A 2NU3E 1AFQB 3M36A 2VNTA 2WV5A 2ZTZA 1MH0A 2QIQA 1GHZA 2FIRH 2GDDA 2WINI 2FO9A 2LIZA 1V3XA 4RKOB 1O2UA 3RXKA 1MCTA 1ABJH 1K9OE 1QY6A 3B23B 1C1UH 1KIGH 4GHTA 1BHXB 2QGRA 2QF3A 1C5VA 1HGTH 4XRNA 4X0WU 5B6OA 1MTVA 1AHTH 3LGIA 1LO6A 1RTLA 3OY6U 3EYDA 4LZ1H 2ZI2H 3BV9B 3FP7E 5EXNA 3EE0B 3K6YA 3OAAD 2BY5X 4Z0KA 5FPSA 5F8TA 3TIUA 4E7RG 3N99A 2R2MB 3VGCB 4CH8B 1KXDA 2ZU2A 1NRRH 5ABWA 4BANB 4J2YB 3RXQA 1GDNA 3RC5A 4RSPA 3H7OA 4BXSA 1RJXB 1Y8TA 2Z9LA 5TCCA 1K1IA 1CU1A 4I32A 2O8LA 2GZ7A 2RA3A 4VGCC 1RGQA 1COWD 2J94A 1O2JA 1JXPA 3S9CA 1F5LA 3A8AA 3M7QA 1O2VA 3O8BA 1SGFA 2BD4A 5I25A 2DE9A 1VGCC 3U69H 1B7XB 2UWOA 4DOQA 2A0QB 3TU7H 1N8OC 8GCHG 2V6NA 4XE4A 4WMFA 4B6EA 3FP6E 3RXSA 5A8XA 4CHAC 1SGFG 5F8XA 3EDXB 9LPRA 2ZHQH 1DSTA 4XFQA 4I8HA 1QJ7B 2ASUB 5A09A 3KQEA 1PQ7A 3GS9A 1FZZA 1QL8A 5HIYA 1C1VH 1S0RA 2ODPA 3BTKE 5EQSA 1BTUA 1GI6A 1LHGH 1Z8RA 4OS6A 5K7RA 1EJAA 3P17H 4XBBA 1P2KA 2SGPE 3RUOA 1O5DH 1DFPA 1AVXA 1MBQA 1FY8E 5T1VA 1TONA 4X6PA 1LQEA 4Z1MD 3E0PB 3T28A 1UTPA 1C5PA 3SOSA 3MO3A 3PTNA 4XSKU 1INCA 2CGAA 1O5FH 3TH3H 2ZHDA 1GJ6A 5C1UA 1C2MA 1Z1JA 2ZFPH 1UTKA 3LGUA 1UHBA 1CA0B 1X7AC 3OY5U 1MZDA 4THNH 4A7IB 1A5GH 3SGQE 4WMEA 2AH4X 2XBWA 3R3GB 1F92A 1S5SA 5EQQA 3VB4A 5AFYH 1EASA 2Z9GA 2XW9A 1LPKB 1VJAU 2F4LA 2ZF0H 1YPEH 1Z8IB 3SNEA 2F91A 3UNQA 2UWPA 5EODA 3MO9A 1CHGA 2BDCA 2VH0A 4I8KA 3EAJA 3MH7A 1P2MA 1DUEA 5AFZH 1BHXF 3MMGA 4A1VA 1MBMA 3KHVA 2AYWA 1Q3XA 1G2MA 3FOAA 3FAOA 1QCPA 5DP7A 1CBWB 1ELFA 3KGPA 1O30A 1VITF 2ZFSA 3LDXH 3QTVH 4AG1A 4JYTA 4MPWA 1GBAA 1NRPH 3RMLH 3SHAH 1G3CA 1MKWK 3DSOA 2BY9X 2CF8H 2PV9B 3BTHE 4CRDA 1UTLM 2C4FH 5LPRA 2FLRH 3UREA 1GJAB 3RXUA 1KXBA 3GCTG 2KX4A 3ZZAA 4Q63A 1GI8B 1G2LA 4U30A 1J16A 2Y5GA 1MU6B 1EZQA 3SV2H 2P8OC 1LTOA 2Q6FA 1UTJA 1NPMA 4MNYA 1O3AA 2ZC9H 4FUHA 2KCOA 4AYYB 5LPFA 1A7SA 1TX6A 1SGQE 2Z6BD 2ZU4A 2ZHEH 4NWKA 1IQFA 5A0BA 3RXMA 1GHBG 2QE7D 4ABFA 1KLTA 1ZZZA 2AFQB 3SQEE 2QXIA 4KTUA 3Q77A 1C1SA 1NRSH 1V2NT 1E1QD 2GV7A 2SNWA 3MH5A 4WY3A 4AFZA 6GCHG 5FAHA 6CHAC 4SGBE 1LPGB 4QT8C 4NA9H 1ZPZA 1GVZA 3TVJB 5GDSH 1QL9A 1RIWC 2K7XA 2W7UA 2GD4B 4CBOA 1FAXA 2WPIS 2OLGA 3ELAH 2C8WB 5F53A 4UFEH 3UOPA 1AGJA 2ZHFH 1ESBA 4O3TA 1G3BA 2FI3E 3SV7A 2D26C 3RXHA 3D62A 2ODQA 3TNSA 2ZQ1A 1W0YH 1UW7A 3A82A 3DSGA 2H5CA 1XUIA 3OTJE 1NC6A 2RG3A 4I8JA 1MTNB 5FBIA 2P16A 3M3TA 1O2ZA 4JZ1A 3MHWU 1SHYA 4A1TA 1OX1A 1WTHD 3UQOA 1E1RD 1NRNH 2NU2E 2W5EA 2V3OH 2WPHS 4GAWA 3PROA 4AOQA 1O3EA 2RDLA 5HKKD 1FPCH 2BDHA 1SMFE 1WUNH 1UTQA 1O3LA 1PFXC 2ZCLP 3UIRA 2PUQH 1XUJA 4JZFH 1HIAB 1NTPA 4WF8A 3U8OH 4ASUD 3GY5A 1DICA 4B76A 3ENSB 3RDZA 3MU8A 1ZR0A 2BY7X 1PPHE 2NU1E 2ZTXA 3V0XA 3SU6A 2Z9KA 5CHBA 4X8TH 5A2MH 2BZ6H 1ZLRA 4KGAA 3TH2H 2ZGHA 4OM9A 4YM9A 1HNEE 2PLXA 1CHOG 3RXTA 1P01A 5F03A 4ABIA 1LHCH 1BIOA 3AK5A 1V2QT 4B73A 1K28D 3SV9A 1QFKH 1ETTH 2O8MA 2VJ1A 2B8OH 2BTCE 2PGQB 4HTCH 1W0ZU 3P8FA 2P3FH 2ZGJA 3BSQA 4I86A 2G5VA 1A0JA 1AB9B 1SGCA 2SGFE 1Y3YA 2PKSC 4ISHH 1WSSH 1OPHB 1GJ7B 1GI4A 2VIVA 1C2IA 3UAIC 2J2UA 5HMAA 1Z1IA 1DOJA 3FP8E 2Z3EA 1AFQC 1E0FD 4JCNA 3A88A 1FPHH 1KLIH 2PP6A 1NM6A 1TGNA 1GMDG 2KR7A 5A8YA 3UNRA 1P09A 3OYPA 5DGJA 1GBDA 4HG6A 2YMSB 4NG9H 1C5YB 2IOTA 3GY7A 1GJ8B 3MNCA 4ZKRU 4KELA 2XWBI 3ZZCA 4U2WA 2HNTE 1BRUP 1ELEE 1C5RA 3GOVB 1TRNA 2Z3DA 1O0DH 1QGFA 5LGOA 3RXRA 2BLVA 2BD3A 1GI2A 2FOGA 3VGCC 5F6MA 1OP0A 1VCQA 2WPLS 4NIWA 1TA2A 3ZYDA 2BQ7B 2BD5A 4KTCA 4B2AA 1Z71A 2QF4A 3PRDA 3UWIA 4Q2KA 4PROA 1NY22 1B5GH 1BTXA 1EZSC 1W8BH 2YNAA 1IQEA 5SGAE 2ZHWH 1IHSH 2P93A 1RS0A 1FY1A 1O3KA 3MFJA 1HYLA 1MKXK 3F9HA 1HJAB 1ACBE 1YM0A 5GCHF 5CE1A 1M9UA 2VWLA 3HGPA 1SQRA 1WOFA 2AIQA 4SGAE 4J1YA 1GGDB 1SLXB 3PO1B 1D6RA 1UCYK 2FXRA 2V35A 3TH4H 4D76A 2QA9E 1Z6EA 5C0UA 3VG8A 1HRTH 3ZZDA 1H9HE 1LKBA 4KTSA 3RXGA 2HVYB 2PKAB 1LVYA 3ZYEA 1TNHA 1ZTLA 3BTTE 1KYNA 3FN8A 3SGAE 1N6YA 2Y5FA 2GDEH 1WBGB 1Q2WA 5EQRA 3AAVA 4TSFD 1W10U 3MO6A 1JMOH 1C2EA 1P05A 1SFQB 1TIOA 4TPIZ 1KY9A 3L3TA 2JIZD 1GMHG 1TAWA 4K69A 1PYTC 2EA3A 2ZDKA 1O37A 1O32A 4NFFA 3GY8A 5T3HA 5H4IB 1THSH 4GCHF 1F0RA 1GHWH 4XOJA 3RC4A 2P3UB 1H1BA 3MTYA 3PMJA 1K22H 2BYAX 2CXVA 1J15A 1MU8B 1FN6A 2C8ZB 2BB4A 2QF5A 2P95A 1MAYA 2KAIA 4I8LA 1CA0C 1DXWA 5ESTE 2GT7A 1GI7B 1P9SA 5DP8A 2XYAA 1DLKB 2ZFTA 2OD3B 1EAIA 3QN7A 4GVUA 5AF9H 3MNSA 1EAWA 2QY0B 3UOUA 1GVLA 1MKWH 1UHBB 1H8HD 3PWBA 2BZAA 5EJLA 1AE8H 3URDA 3PLKA 1G36A 1FV9A 1O5BB 2NU0E 2SFAA 2ZDMA 4CREA 3TJOA 1CBWC 2ZGBH 1EOLA 4WXVA 5FBEA 2VBCA 2J98A 4NWLA 2XRCA 3TK6A 3P95A 1C4V2 4I31A 3FZDA 3VB6A 1TPAE 4TY7A 2Y82A 3OEED 3RP2A 1XM1A 2ZWLH 1C1PA 3SNCA 1BCUH 5TCAA 2EI7A 1MMJN 2WHXA 1PPEE 3SZEA 5A8ZA 2R0KA 1V2VT 1J14A 1A5IA 2OP9A 3F2HA 1O3FA 1DX5M 2B9LA 5I46H 1A3EH 4ISOA 1C1TA 1W11U 4H4FA 1C1OA 1GMCF 1QNJA 2W6ID 3HGNA 2CF9H 1VZQH 3R0FA 2NU4E 1O5CB 1PQ8A 1Z6JH 3A8BA 1AWHB 1EUFA 1FLEE 3ZVDA 3BEIB 3N7EA 2LP6A 8GCHF 4NCYA 1ZMNA 1CT2E 5DN6D 3U8RH 2AMDA 4AGKA 1O2RA 2XCNA 4AB8A 1AY6H 2A2QH 2Y7ZA 2Z9IA 1GBMA 4AX9H 2EQNA 3JZ1B 5C2ZA 5EGMA 1AZZA 1O34A 2SGQE 3MU4A 3DD2H 5HM2A 1E38B 1WXRA 1ZHMA 1NRQH 1NN6A 4NSYA 5CHAB 1BTHH 4MPVA 3M5NA 1QURH 3F9GA 1CGHA 4B74A 4NA8A 1D3DB 4NA7A 4FUIA 4INKA 3MWIU 1CT0E 1Q31A 2G81E 1F0TA 4D9QA 2UUJB 4I33A 2TGAA 3EA7A 1ESTA 2CHAB 2A5IA 1YP9A 1EAXA 1MTNC 1GHVH 1C2FA 1ELCA 3KIDU 4FUEA 4K8YA 2FI4E 2JDID 1H9IE 4MNWA 1BDAA 1OP2A 4KKDA 4IN1A 3SJKA 2FEQH 3B8JA 1ZRKA 2ZFQH 1C5XB 2IN2A 2CMYA 1F0SA 1Y3WA 1YPHC 2RA0A 3OFND 1Z8GA 1CO7E 3DFLA 4WJG2 4B75A 1K1PA 2DUCA 2QYIA 1GBLA 4D7FA 3F9EA 3GDVA 2ANKH 3E8LA 4WXIA 1OWEA 3PTBA 1S6HA 4CRBA
chains in the Genus database with same CATH topology
1ANCA 1ANBA 3ITIA 3P70B 1RXPA 5LPEA 5GWZA 3BEUA 4BNRA 3SORA 1BTZA 1G3EA 3STJA 1HCGA 3CP7A 4NFEA 1O3PB 2H6MA 2W7SA 4UEHH 2FOHA 2ZDNA 3GCTF 3S7HB 3AAUA 5FXLA 1TWXB 1GBFA 4BAHB 1JOUB 2ZPSA 1NO9H 1DPOA 1AB9C 3QGNB 3UTUH 1IQGA 1DWEH 1C4U2 2XCFA 4YTAA 1TPOA 1H9LB 2PFEA 1C2LA 3GY6A 1ABIH 1QJ6B 1ZJDA 1S0QA 1KTTB 1CT4E 3RU4T 1W2KH 3MOCA 1GHBF 5TJXA 2VB0A 2VGCB 1O3MA 1AVWA 1D9IA 1T4VH 2BHGA 1YGCH 4X8SH 2A4GA 3FFGA 1GJ4H 2WPMS 3RXIA 1ZOMA 1W7XH 4E06H 3LPRA 1C5WB 1O2NA 6ESTA 2BDGA 1QL7A 4WWYA 3BTGE 2V0BA 1N1LA 4HI3A 1MZAA 4YO9A 1G32B 2J9NA 2FOCA 4IS5A 1J9CH 2BLQA 3K2UA 1NS3A 4CRCA 4B71A 3LC5A 4MNXA 2PKAA 4YLQH 1D3PB 1AUJA 3M3SA 2ZQ2A 1FQ3A 1PQ5A 3RXVA 2ZDVH 4E05H 4B1TA 3SV6A 1D3QB 1TPPA 2F3CE 1YPLH 1HXFH 1THPB 1XUKA 3BF6H 1TPSA 1JWTA 1GHYH 1QBVH 3UR9A 3LGYA 1EB2A 3T29A 4HZHA 1XX9A 1FIWA 2HRVA 2ANWA 1DVAH 2XBVA 2QF0A 4CRFA 1A4WH 1UCYH 2LPRA 1GWAA 4FUFA 1AZ8A 1YKTA 3UFAA 2WPJS 3NXPA 3I78A 1ZPBA 1HJAC 1O2YA 1LHEH 3Q00A 4LK4A 1SQAA 1W7GH 1GDQA 8ESTE 1BT7A 3ZZ6A 1GGDC 3PO1C 1V6DA 3FVFB 1GJ5H 5C67A 3Q3XA 4A6LA 1KXAA 2ZA5A 3MI4A 2BX3A 4FUBA 1C5ZB 1C2JA 3ATLA 1ETSH 1L4DA 1SFIA 3M5LA 2G52A 2GCHG 2J34A 1VCPA 3GY3A 1AVGH 5EXMA 1T31A 1GBTA 1P10A 1EPTA 3NKKA 4FUGA 1GBEA 1CHOF 1RFNA 4ISLA 1RRKA 1O3IA 3H7TA 3PLBA 3ZVEA 1BA8B 1BJVA 2Q6GA 1EP6A 1WAYB 3N7OA 5DK1A 1F5KU 3PWCA 1NESE 4YESB 2TIOA 1QRZA 1TMTH 2GTBA 1XVOA 7GCHG 2AMQA 3VFEA 1LVOA 1OYQA 3LONA 2A5AA 1KXEA 2H9TH 4E7NA 5EPNA 3T2NA 4RKJB 4X6OA 4B2BA 1GMDF 2OUAA 4AN7A 2R9PA 2KAIB 4K1TA 4OGXA 2J38A 3SU5A 1P8VC 1O3BA 1XVMA 3SJOA 3UQVA 2A5KA 2FOAA 4GUXA 3URCA 3W94A 3O8RA 1W12U 3SJ8A 2J92A 2PTNA 1G9IE 3VB3A 4ZHLU 2BLOA 1MQ5A 3KN2A 2GMTB 1TRYA 3EA8A 4CR9A 4DGJA 1XXFA 4R8TB 1GL1A 4JK5A 1Y5AT 1MAXA 1AQ7A 4OS4A 4ABAA 5DP4A 4Q7YA 1QBNA 1AE5A 4ZUHA 1TGSZ 2GVFA 5BPEA 2VWMA 1GG6B 4CRAA 3SJ9A 3LT3A 4XDEA 1XKAC 5DKMA 3RLYH 1MTWA 3BG4B 4FU8A 1SB1H 1JRSA 3ZVGA 2PTCE 2ZCHP 3T25A 3C1KA 3S7KB 2C8YB 2XC0A 4JZDH 1DM4B 1HXEH 4AORA 4CBNA 2JH6D 3SNDA 3NZIA 4BTUB 1SLVB 2ZO3H 1HJ9A 1TQ0B 2W3KA 1C5SA 1EOJA 1Z8JB 2ZFFH 1BBRE 2ZPRA 1GBHA 1A5HA 4AFQA 3RU4D 4AZ2B 1A46H 2HALA 3RU4E 2XC5A 1GJBB 1MUEB 3CENA 2F9UA 3M5MA 2V3HH 3LKWA 1FJSA 1IQLA 1ZJKA 2Y6TA 1B0EA 3P8OA 5CHAC 1XUHA 1O39A 3ATIA 3OX7U 2ZKSA 1EXFA 4JMYA 2M5TA 1ELBA 1PYTD 1S84A 1O36A 4NSVA 1H4WA 1O3CA 2B0FA 1KSNA 2BVXH 1BTPA 1YC0A 4UONA 1SGTA 2ZCKP 1FUJA 3JZ2B 2YNBA 1SBWA 1U6QA 2CHAC 1ANDA 4JYVH 4FXGH 4AB9A 1TBZH 2G5NA 1MQ6A 3TJNA 1LHDH 3ODDA 1S85A 2OBOA 1V2UT 3DHKH 2VIWA 2K1QA 5FCRA 2QC2A 4OS2A 2QXGA 3RM2H 2IPHA 3KQCA 3OSYA 5E8EH 2RCEA 3LGWA 1C5MD 4IC5A 1GCDA 2O9QA 2FYQA 1FDPA 1SC8U 1W14U 2BOHB 4DVAU 2EEKA 1SQTA 2BM2A 1UK4A 1O2WA 3VEQB 3VXEH 1AMHA 3SI4H 1ZGIA 3NK8A 4BOHA 3VB7A 1BMLA 4X2XA 2ZP0H 3P92A 5DP9A 3BTEE 5JDUB 3L33A 3E1XB 3PM3A 2C90B 1F5RA 1K1MA 4OS1A 4I7YH 3ZZ7A 1XKBC 1BUIA 1TGCA 1UVTH 4BAKB 1SLWB 1PPCE 1ZRBA 4ZH8A 3EA9A 5DP3A 1Y5BT 3QX5H 1ZSJA 4ZXYH 2SGEE 3T62A 5GPIB 1O3OA 1AIXH 5EU8A 2TRMA 1O5EH 4YOGA 2VGCC 4RN6A 3BIUH 3M7UA 1ZMJA 3C27B 2SNVA 1RD3B 1Z7KA 1L1GA 1PJPA 7ESTE 4JZIA 2ANMH 1O2TA 1SGEE 3SU0A 4ESTE 3IG6B 4NZLA 3RXJA 1GJDB 2OQ5A 1V2KT 2STBE 3KF2A 2QCYA 1TOMH 3RXOA 5L30H 2HLCA 1SGDE 2CV3A 1EATA 8LPRA 1TMBH 1EB1H 4UD9H 1LPZB 2Z94A 2BDAA 3M37A 1GI0A 4IGDA 4JK6A 1WCZA 1QQ4A 5LH8A 2YOLA 2H9HA 2Y81A 1CQQA 1DS2E 2VWOA 1A61H 1O38A 5A0AE 1C5OH 2FX4A 2UUYA 1FI8A 1AO5A 2OBQA 1TMUH 5JBTA 1S82A 2BQWB 2A7CA 5J4QA 2A1DB 2PR3A 3QGJA 3SUGA 1P02A 1K1LA 3SU1A 1GHAF 2FTLE 2I6SA 2ZEBA 4UE7H 4A1XA 3A7YA 2O8TA 4Y79A 1AI8H 2Z7FE 5EG4A 4ZAEA 4H6TA 4K60A 4DT7B 2WV4A 2F83A 2C93B 3BTFE 1TB6H 4GLYA 1GI3A 1P04A 5IDKA 3RM0H 1A0HB 3AASA 1BRAA 1HV7A 3RXDA 5EXLA 2XTTB 1QB1A 1G3DA 1NU9A 1P2IA 2GZ9A 1QRXA 3LU9B 4Q80A 1D4PB 3U1IB 2ZDAH 2AGEX 3QO6A 1F2SE 2TGTA 1O2KA 5E0GA 1C4Y2 3KNXA 3Q76A 1FY5A 1TA6A 1EPTB 2VIQA 1OKXA 1UO6A 2EI6A 4IMQA 2JKHA 3P8GA 1O31A 1RTKA 2WYJA 4K3JA 4IN2A 1HAPH 5E0HA 4MVNA 2BD9A 4X1RU 1HLTH 1SHHB 2HPPH 3MU5A 1W13U 1N6XA 3RC6A 2Q1JA 1DSUA 1SPJA 2ZZUH 1P12E 3A8CA 2B5TB 3V7TA 5C20A 1IQIA 2AERH 3A8DA 1V2JT 2PSYA 1P2JA 1ZTKA 2BLWA 1SOTA 4OS7A 2A2XH 1ETRH 4X8VH 1SGIB 1FAKH 1C5LH 3TJUA 3ZZBA 1KXCA 4IC6A 4BAOB 5JBCS 2BDBA 3A80A 3L6PA 1O2HA 1YPMH 1MD8A 2GMTC 2Y7XA 3DT0H 4A5TS 2ZFRH 5GIBA 1F0UA 1TFXA 1FY4A 5ETXA 3HKIB 3M3VA 4D9RA 3BTWE 4WMDA 3MH4A 2FS8A 1O2SA 2G4UA 4F4OC 4F49A 3HK6B 1GBBA 4ZHAA 2Z9JA 3E0NB 3M5OA 3S9BA 1GG6C 1ZTJA 1TGTA 1YBWA 1IHTH 4INHA 1UCYE 3E91A 3F9FA 2ANYA 1C9TA 2AS9A 2UUFB 5K0HA 1C2GA 3BG4C 1GBKA 4Y10E 1W3CA 2R2WU 1TNGA 1UVPA 1QHRB 4IMZA 4Y8ZA 1O2QA 4HFPB 1IQNA 2WPKS 9ESTA 4DIHH 1E34B 2F9BH 5A0CA 1P11E 1XUGA 2Q6DA 3Q3YA 7KMEH 3TITA 1YCPK 1LKAA 4ZMAH 2ZPQA 2OC1A 2BY6X 3D23A 1GDUA 4ZKSU 1EJNA 2GT8A 2A4OA 2H5DA 3HPTB 4FUDA 1SGNE 4FUJA 3RXAA 3GICB 5GCHG 1QB6A 1HDTH 1S6FA 1KTSB 2J4IA 4ABEA 3PYHA 4ZXXH 2AIPA 1NFXA 1P03A 4HGCA 1P2OA 3DFJA 4AG2A 3V13A 3RMOH 1BRCE 2A31A 4MPUA 3QLPH 3QZRA 4NIYA 4ISNA 1QJ1B 4JZEH 5J4SA 2G8TA 2VWNA 5C5NA 1OS8A 5E0JA 1NZQH 1CGIE 4O03A 3ZZ9A 1C1MA 4H6SB 2P94A 1FN8A 1HAOH 2FESH 1A2CH 3A81A 1VR1H 2QV1A 2FS9A 4Y0YE 1UJ1A 1BTWA 1OYTH 5GJ4B 1Y59T 1V2WT 3E6PH 3FANA 2QXJA 2FI5E 3QWCH 2D1JA 1YPGH 3NCLA 2P3TB 2H9EH 4TPYA 2F9OA 1P06A 1WYKA 1NU7B 4FVDA 1DWBH 3SJIA 3U9AH 2F9NA 1V2ST 2G51A 1GJ9B 3LOXA 3TGKE 4YZUA 3RMNH 4H42U 1HAZB 2VIOA 1MTUA 1ZSKA 4X1PU 4ZKNU 2BXUH 4K2YA 1C2KA 1JRTA 4YLUA 1PPFE 2QN5T 3GYMA 1BOQA 5JB9S 3BN9A 2Z3CA 1PQAA 1WU1A 4XBCA 6GCHF 2HPQH 3A7VA 2BDYA 1A0LA 1C1RA 1HPGA 1QTFA 1SSXA 1UK2A 1YYY1 1EKBB 3ATMA 4B2CA 3MU0A 3SU3A 1G37A 1TX7A 2JH0D 1DE7H 3DUXH 1ELDE 1HAIH 3SN8A 1C2HA 2FWWA 2TPIZ 1CGJE 1SQOA 2LNCA 1T8MA 3TPIZ 3Q3KA 1PPBH 1LMWB 1ELAA 1MKXH 3TK5A 2XBXA 1GMCG 1GVKB 5AHGH 4AFSA 1ZHRA 2CN0H 1S83A 3GCHB 2BD8A 3AVZA 1TBQH 3GY2A 1DT2A 2WUBA 3ZVCA 1IQHA 1O3NA 3ESTA 4MLFB 1C5QA 4YT6H 3K6ZA 1LQDB 5G4BA 4LXBH 4TWYA 4ZKOU 2SGDE 5L2YH 1O2GH 1G30B 1XXDA 2ZG0H 1E35B 2BQ6B 2SGAA 1O35A 4NIVA 3ZV9A 3SZNA 1IOEA 3ZVBA 4UFGH 4D7GA 4MG3A 3ATWA 3SV8A 3PMHB 4WH8A 3T26A 1IAUA 1VJ9U 2FDAA 5IYTA 3SW2B 3V12A 5AVDA 5EPYA 4IBLH 4I8GA 3RXBA 1AU8A 1HAVA 5T6FA 1BBRK 1HAXB 3S9AA 3BEFB 2ALVA 4DIIH 5DPAA 2HVXA 3RXEA 2ILNA 3HATH 1GBCA 2OC8A 5JB8S 2HGTH 4FU9A 5ESBA 5FPYA 1MTSA 5EW1H 2EC9H 3U8TH 1C5TA 2B7DH 1S81A 3RMMH 4YOIA 4ABDA 1C1WH 1EZXC 1ARCA 1TBRH 2ZTYA 4Y11E 2O8WA 3BTDE 5EOKA 3TJVA 1BTYA 3TLOA 1O2IA 1C1QA 2FOMB 1V2TT 2D8WA 3IITA 2AEIH 3VPKA 4ABHA 1GCTB 4MPXA 3GCOA 1HFDA 1T8OA 1O2XA 4YT7H 1YPJH 1ZGVA 3M7TA 1GL0E 1BITA 1E37B 3SNAA 2AGIX 1GHXH 1ARBA 2BOKA 5L6NH 1CVWH 1AFEH 2C8XB 1NT1A 4A92A 1YPKH 1ZPCA 5T6GA 2GZ8A 2VVCA 1EPTC 2ZGCA 1GJCB 3GY4A 4K8BA 4XBDA 1V2OT 1NFWA 5HM9A 4FUCA 2AMPA 1ELGA 4KP0A 3I77A 3ODFA 3TK9A 2H1UA 3DA9B 1H8DH 1A1RA 3LIWA 1C2DA 3LH3A 1DXPA 5HGGA 2GV6A 5DG6A 5C5OA 3K9XB 3MU1A 1L1JA 3SO3A 3ZZ5A 2OQUA 1O2MA 4IW4E 3SUDA 1UTNA 1EQ9A 2WYGA 3U1JB 3NPSA 1A3BH 2BDIA 3A84A 4Q7ZA 4X6NA 1C5UA 1UTOA 1Y3XA 1QBOA 1K21H 3ZVAA 5FHTA 1O3GA 3PV4A 1V2MT 1L1NA 2QXHA 1QIXB 1EJMA 4MTBA 4TYDA 1E36B 4UFDH 3LGTA 3AW1A 5PTPA 3D49H 2P59A 3OU0A 1EX3A 4DCDA 1EP5A 2R0LA 1DUAA 3QZQA 3UR6A 1T32A 1YCPH 1TNKA 1HAYB 2ZU3A 5C1YA 2FODA 4Z6AH 2FOEA 2ESTE 1ESAA 1Y5UT 2VVVA 3MH6A 3GYLB 2JETB 1TE0A 2F9VA 1GMHF 1F7ZA 1IQMA 5L2ZH 3P6ZB 1MD7A 3QK1A 1TQ7B 4NZQA 3E90B 2EI8A 1OXGA 3PMBB 2IJOB 3SBKA 4U32A 2PHBA 2VH6A 2CJIA 1ZYOA 2GP9B 1AKSA 3U98H 5DO4H 1MCVA 4CR5A 1KDQA 2OTVA 3BG8A 5FX5A 1SGRE 1L2EA 3IWMA 4TY6A 2ALPA 1NFYA 1ANEA 1UVUH 2VIPA 4X2YA 5T6DA 2GCTB 2PUXB 5DP6A 3SI3H 2FOFA 3M35A 1IQJA 1T8LA 2FPZA 2A7JA 1JIRA 1IQKA 2TBSA 1LVBA 1O3JA 1FONA 3SU4A 1TNLA 4NIXA 2ZNKH 1GI5A 2FM2A 3A7XA 1V2RT 2ZGXH 1VCWA 5EW2H 5HXFA 1GBJA 3UY9A 1K2I1 2NWNA 1OOKB 2XWAA 1OWKA 1L0ZA 1LVMA 2R3UA 4ISIH 3ZZ4A 7LPRA 1GPZA 3F6UH 3H5CB 4AGJA 3CS0A 3EBNA 3SUEA 1EZUC 1BJUA 3VB5A 1WQSA 1SI5H 2HNTF 1JBUH 4X6MA 1VITG 2ZU5A 1QQUA 2GX4A 1NFUA 1H8IH 3A7ZA 3SHCH 4CH2B 2FP7B 1GI9B 3BTME 1HAHH