3VB3A

Crystal structure of sars-cov 3c-like protease in apo form
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
301
structure length
301
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Design, synthesis and crystallographic analysis of nitrile-based broad-spectrum peptidomimetic inhibitors for coronavirus 3C-like proteases
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 82
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-12-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3vb3A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3vb3A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3vb3A02
1C2DA 2PUXB 5FHTA 4JK5A 1HDTH 1CT2E 2NU4E 3BTME 1DOJA 3V12A 1GI3A 5GXPA 5C1XA 2OTVA 1HBTH 3NXPA 1S0RA 5LGOA 1QQUA 5EXLA 3ZZ5A 5J4QA 3NK8A 3PWBA 2BY5X 1VCWA 4AX9H 1GBIA 2DE9A 3UWJH 1MTNB 3T29A 1E38B 1UO6A 3R3GB 1WUNH 1TBRH 2UWPA 1HAZB 1MKXH 1TBZH 3QUMP 1A5IA 1SHYA 1YPKH 2TRMA 3SNCA 4CHAC 4HGCA 4NIXA 1FY5A 1DLEA 4LZ4B 3M3SA 2Z9JA 3EAJA 1MUEB 3KQBA 5A0AE 4AFSA 2FDAA 5L2YH 2G4TA 1P3EA 4D8NA 4INHA 3ODDA 3SU4A 3MU8A 1K1MA 8KME2 2C90B 1FN6A 1ELAA 4NFFA 1AVGH 1F92A 2C4FH 5DP5A 1BTYA 2UWLA 1DT2A 1H8IH 2BD2A 1C1MA 1O2PA 2XC5A 5DGJA 3SGBE 4ABEA 1ELTA 4UFGH 1G3DA 4BAQB 1RTFB 1XM1A 3RU4D 3U1JB 2XC4A 3IWMA 1P2NA 4BXSA 3FP7E 1JOUB 1YPJH 1DM4B 1QA0A 3QZRA 3L33A 3SBKA 1ZJDA 4DG4A 4CR9A 2O8UA 4HZHA 4YT7H 3U98H 3SUDA 1Y5BT 2O9QA 1FIZA 5DG6A 1QFKH 3NZIA 4GCHF 1VCQA 5DP4A 3RU4E 1FY3A 1K1IA 4U2WA 4WH8A 1LDTT 4D9QA 2WYJA 1ANEA 1YPEH 2ZDKA 3P95A 3ITIA 1S6HA 4JZFH 2V6NA 1CE5A 2ZDLA 3FP8E 1ACBE 2FXRA 1QHRB 1XKBC 1GJDB 1HPGA 2W3IA 1DS2E 2SFAA 2HPPH 1G36A 1VGCC 2ZFFH 1BTUA 1SL3A 1BMAA 1W13U 2Y7XA 4YZUA 1TPSA 2H9HA 3FVFB 2GMTC 1GG6B 3DA9B 1HJAB 1Z8GA 6ESTA 2BZ6H 3TPIZ 1O3KA 4AYYB 3MNBA 2A2QH 1P9SA 4FU9A 4Q7ZA 2AMQA 1ZSKA 1SGEE 1WSSH 2XNIA 1B7XB 2Y5FA 1DICA 1BRAA 2OINA 1O3BA 2XTTB 1L4ZA 5AVDA 2G8TA 2ZU1A 2IN2A 2JH6D 1UCYK 2ZHEH 3DFJA 3P70B 3M5MA 1O2KA 4A1VA 1TNJA 2TGPZ 1ELDE 4YTAA 1DSTA 1RIWC 1TA6A 4GAWA 1UK4A 1D6RA 1RRKA 2W26A 4KELA 4TWWA 1C5TA 4UDWH 1W3CA 2ZPSA 1VJ9U 2J2UA 2ZPRA 3RMNH 1O34A 1THPB 4UEHH 2IOTA 2PTCE 4BANB 1ZSJA 4Q7YA 2ZGXH 4GHQA 4OGXA 3GYMA 1OYTH 3VPKA 3A7YA 4NA7A 2DUCA 1ELVA 3VFEA 1C5RA 2F9OA 3TVJB 2FEQH 1FAKH 1C2KA 4AFQA 2M5TA 3VGCC 3LGTA 1WCZA 2GDDA 1L1GA 1ZPBA 4UE7H 1XX9A 2GDEH 4X8SH 1O2SA 3I78A 4BTIB 1GGDC 1UK3A 4JYVH 1O2HA 3LC3A 2OP9A 1DLKB 5EODA 1NRRH 2QXJA 1BTHH 1NFXA 1QURH 1VR1H 2ZDAH 3UFAA 3GY6A 3SOSA 2W7SA 1GDUA 1C5YB 2D1JA 4SGBE 4TYDA 2OBOA 3RU4T 4DURA 3RLWH 2R0KA 4ZH8A 1P2JA 3MH5A 1J15A 4NIVA 2GCHF 3H7TA 3VXEH 4YLUA 1BA8B 2JETC 2HOBA 1TPAE 1DPOA 1O2GH 1O36A 1JBUH 1NFUA 4OS7A 1BMLA 3PWCA 3A7TA 5G4BA 4Y7AA 2QYIA 5CE1A 5C1UA 2YOLA 1C2LA 1O3FA 1GDQA 2QXHA 1TBQH 2WPKS 2LPRA 2ZU3A 1ZMJA 5AFYH 1GCTC 1LKBA 2ZQ2A 2GZ7A 1C5ZB 1SBWA 3CENA 1H9LB 1KTSB 3GDUA 4OS5A 3GY2A 4OS1A 2G5NA 2ZFSA 4IW4E 3P8OA 1V2MT 3A87A 4X8TH 3SZNA 2ZFPH 1O3HA 2ZF0H 2BXUH 3PMHB 1NU7B 1QR3E 3RXLA 1GMCG 2ALPA 4FUBA 3RXVA 3HPTB 1EAXA 1LHGH 3GCHC 1PPZA 1GHXH 3UREA 1OP0A 4D9RA 1CA8B 2FOHA 1T4VH 4CRCA 4RKJB 2ANKH 2QGRA 4AGJA 1MU8B 3E90B 1DDJA 3RXQA 1S81A 2P3FH 2R2WU 2ZZUH 1PQAA 1TMBH 1LPGB 3MI4A 4KTUA 1RJXB 4ZHAA 3A7XA 4KGAA 2GV6A 3B23B 5DP6A 2XW9A 2ZGJA 1BJVA 1LKAA 1P2OA 3A82A 1XUGA 4YOIA 9ESTA 4XBDA 5EXMA 4LOYH 1KLIH 2BLVA 3T26A 5AHGH 1F5RA 1AHTH 1IHSH 2XBVA 1AZ8A 3QK1A 5A0CA 3SGAE 4QT8C 1BITA 3P17H 1GI7B 1YCPK 4INKA 3TH3H 5F8TA 1QCPA 1V2QT 4KP0A 3SQHE 4Y0YE 2ZCKP 1C2MA 4RSPA 4ISLA 1NRSH 1V6DA 2G00A 1N1LA 1KIGH 1UVUH 1C2FA 3UUZA 1YCPM 3TH2H 1H8DH 1LVBA 2ZQ1A 5EGMA 3ZZDA 2A1DB 4DVAU 3ESTA 2H6MA 1FZZA 3EBNA 1FMGA 2GVFA 1Z7KA 3A7VA 1AUTC 4X1RU 3MNXA 3MNSA 1HCGA 1KYNA 4J1YA 2Z9KA 1C1NA 1NS3A 5FBIA 1LPZB 3KQEA 1ARBA 2FS9A 2Q1JA 2PV9B 1GVZA 3HGNA 1GHBG 2LNCA 3ZVBA 2EI6A 1AWFH 1C4Y2 2BZAA 1T8NA 2G52A 4AN7A 4DCDA 5LH8A 2ZECA 1C1SA 1GI0A 1QL8A 3S7KB 1AKSB 4O97A 1NROH 2FYRA 2QAAA 1VZQH 3RXFA 4ABDA 1DWDH 5JDUB 2Z94A 2O8TA 1FXYA 3RXTA 1C2IA 2BLOA 3M61U 3MOCA 3GICB 1S85A 1RXPA 3QX5H 3UOUA 1E36B 2VIVA 4ZUHA 1BTXA 1P2IA 3MH6A 4WY3A 2R9PA 1ZTLA 4NA9H 2BQ6B 3Q77A 2RA3A 5DP3A 2NU1E 4A5TS 1PFXC 1C5WB 3KEEA 2WUBA 1E0FD 3LC5A 4YLQH 1SGPE 1O3DA 3S69A 1SGFA 2NU0E 3LONA 1JWTA 1VCPA 1V2NT 2F9BH 1ZYOA 1XXDA 3BEIB 2ANMH 1EZXC 4IC5A 1GBFA 1ESAA 3BG4C 1C5VA 4CRFA 1C4V2 2HGTH 1EQ9A 1JXPA 1G32B 3M35A 2ZWLH 4Z6AH 5F8ZA 2VWMA 2Z9GA 4JCNA 2GCTC 1DUAA 1D3TB 1SG8B 4IN2A 1HFDA 5F03A 3ZZ7A 1GI2A 5A8XA 3QN7A 3LIWA 1BHXF 3P92A 3UTUH 1P2MA 2Y7ZA 1G3CA 1SGYE 2ILNA 2F91A 7GCHG 1EAIA 2RG3A 1TGCA 2QF0A 2BX3A 1HAIH 3ZZCA 2KAIB 1O5EH 2VVCA 1EAWA 2QY0B 1GBTA 3LH1A 3BF6H 5LPEA 1TX6A 5IDKA 4FXGH 2FO9A 2BDGA 3LH3A 1NC6A 2ANYA 2CGAA 1BRBE 3LGVA 3VEQB 5DKMA 2SGEE 4NIWA 3W95A 2TPIZ 1V2WT 1LVMA 3VB3A 1O3OA 1ZRKA 1GWAA 1GG6C 1HIAA 2ODPA 4CRAA 4ZXXH 1W10U 2NU3E 5FBEA 1BBRK 2WYGA 5DP7A 2JKHA 1EUFA 1ORFA 3ZZ4A 1GJ9B 2FM2A 4MNVA 1QJ6B 3SQEE 1TRYA 4NCYA 3F9FA 4U01A 4AZ2B 3KNXA 2G55A 2BDAA 4JYUH 4NIYA 2CF8H 2A31A 1KDQB 2K1QA 3KQCA 4ISOA 1CU1A 1KTTB 1QBOA 5K0HA 5TCCA 3ZVCA 2WPHS 1KXBA 2SGAA 2XWBI 2P8OB 1O39A 1QJ1B 3RC5A 4ABBA 3LOXA 1P02A 4BXWA 6CHAB 4E05H 2GGVB 1AB9B 2GKVE 1TIOA 5DP8A 3OY5U 2HRVA 3D62A 2ZIQH 1QGFA 2ZP0H 3MO6A 3U1IB 3ATMA 1AE5A 3BTTE 2AGEX 4KTSA 4LZ1H 1OWHA 1SGRE 3SU3A 3UOPA 1TWXB 5B6OA 2BLWA 1QBVH 3GDSA 2GTBA 1Y5AT 1WU1A 1TGSZ 2OLGA 2VU8E 5E0JA 3JZ1B 5C5OA 1X7AC 1MZDA 3PM3A 1HNEE 4NGAH 5E8EH 2BVXH 3BSQA 4AB9A 3R0FA 1UHBB 3A8DA 3EYDA 3HGPA 2FOAA 4DJZB 3B8JA 1S6FA 4TPIZ 1A46H 4AG1A 2W3KA 2P95A 2XCFA 4JZEH 1W0ZU 2ZHQH 1GJ7B 1IQIA 1ZR0A 5T6FA 5HGGA 2F9VA 3RXPA 3KL6A 2BD8A 1TOCB 2SGQE 4H4FA 2PFEA 3GCTF 1A2CH 1T8LA 1C5XB 3UPEA 2FYQA 1OWJA 4Y8ZA 3EA7A 3QWCH 1ZLRA 1LVOA 3BN9A 2DE8A 4FUIA 2STBE 2ZC9H 5HMAA 2XXLA 2ZU5A 1IQNA 3KF2A 5A8ZA 3E8LA 1TA2A 1AD8H 4NFEA 3A81A 3HKIB 2WPLS 4WF8A 1ZHMA 2CMYA 8GCHF 4B2CA 2EC9H 1MCTA 3CP7A 5L2ZH 1YGCH 5C3NA 1SQTA 1BQYA 1LMWB 5FPYA 5JBCS 1YBWA 1BTZA 1BMMH 3ZZ8A 3T27A 1HXFH 3SU1A 4X2XA 4AYVB 2ALVA 1OWDA 4NZLA 4JK6A 1S5SA 3BV9B 2CF9H 2UUFB 3SV2H 1XKAC 1QRWA 3M7TA 1C9PA 1Z1JA 3EQ0H 4MPVA 5I46H 4CH8B 5L6NH 1GI6A 1SGFG 4VGCB 2J34A 6GCHG 1OXGA 1OSSA 2ZU4A 2HLCA 1ANCA 1DITH 4MQAA 1TAWA 3TITA 1FQ3A 3NPSA 2CHAB 2VIQA 2PKSB 1AFQC 3A80A 1TMTH 4MTBA 4YT6H 1V2LT 1A0JA 2VH0A 2ASUB 1TRMA 3E16B 3TK9A 2QXGA 1O5CB 2PLXA 1SB1H 1SGNE 2VGCC 1C2JA 3STJA 3IITA 3PLKA 1HAGE 2F83A 2PSYA 1S84A 1NESE 1HJ9A 3MU5A 1GBKA 1F0TA 4ABFA 1A3EH 1FNIA 4NG9H 3Q3KA 1MKXK 1L1JA 4CRBA 3IG6B 3K65B 2P16A 4X1SU 1K1NA 3GY3A 3EE0B 3LGUA 3LGWA 1EX3A 5ESBA 1HUTH 4A1TA 1EPTB 3UQOA 1LPKB 1KSNA 4K60A 4FVDA 2IPHA 2B8OH 2P94A 1AE8H 4GVUA 4SGAE 2PKAA 5A0BA 5CHAB 5AFZH 1H1BA 1SHHB 2Y81A 4ABIA 4F4OC 4NA8A 3ATWA 1N8OB 1AZZA 1KXAA 1Y3VA 2J38A 2BHGA 2XWAA 3L3TA 3RLYH 1ZMLA 5FCKA 1UCYE 1MBMA 4MNWA 3M3VA 1GCDA 2ZNKH 2BLQA 2A7JA 3FZZA 2UWOA 2AERH 1XUHA 2ZEBA 1C2HA 1QL9A 1DXWA 1L4DA 1PYTD 1O2NA 5IYTA 1P03A 4AGKA 1OS8A 2G51A 3RXBA 5GJ4B 1P2KA 1UTKA 3RUOA 2PGBB 1FPCH 3U9AH 3UQVA 5EG4A 2ODYB 3DFLA 3AAVA 1C1WH 4A92A 1HAYB 1K1LA 2B9LA 1IQHA 2WPMS 3SJKA 1XMNB 3OX7U 2SGFE 3RXSA 4IC6A 3BEUA 3A86A 3OTJE 1C4U2 1W7GH 1TRNA 3RMMH 1KLJH 1AFEH 3WY8A 1NY22 1PJPA 2A2XH 1OP8A 1ZRBA 2TGTA 1ZGVA 7KMEH 1HAVA 1D9IA 4I8GA 2NU2E 4MPWA 2BOKA 2Z3CA 1QQ4A 2VH6A 5GIBA 1V2OT 1NN6A 2OC8A 4WVPE 1SQOA 4OS6A 4CREA 3PMJA 5F8XA 2XC0A 2VWLA 2TGAA 3LJJA 2ZGCA 4Q7XA 2C8WB 2ZDNA 3PO1B 4Y79A 4A1XA 1CVWH 3RP2A 2B5TB 2J95A 1HIAB 1Z6EA 3B9FH 5EW1H 1MKWH 3SI4H 1H9IE 5EQRA 3A8BA 2ZHDA 3UR9A 4Y76A 2ZHWH 2CJIA 2YNAA 2FLRH 3MH4A 5C5NA 4WXVA 1MAXA 2GX4A 4ISIH 3SJ8A 3SORA 1GHAG 1THSH 3NUMA 4K8YA 1A3BH 1FY8E 4K3JA 5FPTA 3TGJE 1ELBA 1V2RT 2A4RA 2QC2A 2SNVA 5JPMH 1DSUA 2FTLE 4GPGA 1EJNA 1MD8A 3F6UH 4BAMB 1AMHA 1GHZA 1HLTH 4NSYA 4KTCA 1IOEA 1O3AA 4ZAEA 8ESTE 3GOVB 1O5BB 1LVYA 3AVZA 2GP9B 1YKTA 3QTVH 1U6QA 3KQDA 3RMLH 1CT0E 1NRPH 1LTOA 2F9NA 5DJ7A 1HRTH 2UUJB 1BIOA 2VIWA 5DK1A 1SC8U 4WH6A 1VITF 1W11U 2AEIH 2ZTYA 1C5MD 1GMDG 3RXDA 2CV3A 2FTMA 3V7TA 2VIDA 3QDZB 2WV5A 1D3QB 2OUAA 2TGDA 1O2LA 1SFIA 1UTJA 1NU9A 1TLDA 1ZZZA 1LCYA 4I8KA 2TIOA 1O5AB 1MTUA 4ISNA 1MQ5A 5K7RA 2XRCA 1TYNA 2P8OC 2BY9X 3LGIA 3ZZBA 1QBNA 1TALA 3SU5A 2QV1A 1GBMA 1Y3XA 4X0WU 6CHAC 1C5UA 3JZ2B 1WOFA 1GL1A 1P8VC 4ZMAH 2FOBA 2H9EH 1CA0C 3ODFA 3SNBA 1BUIA 5I25A 1P0SH 2HVXA 4WXIA 1Q3XA 1SOZA 4ISHH 1A61H 2RCEA 1V2KT 4O9VA 5GCHF 4CBOA 1TPOA 1L2EA 1SR5C 5A8YA 1E37B 3N7OA 1RFNA 1BTPA 1DANH 1K2I1 1MU6B 1EJAA 2Z9LA 1GMHF 2NWNA 4OS2A 2XCNA 4CHAB 1XUFA 3MNCA 3SHAH 3U8OH 3TNTA 4IMQA 2ZHFH 4X2VA 1NT1A 3SN8A 3RXCA 1ABIH 4FVBA 1GHYH 1LHDH 1OYQA 1SVPA 1AU8A 4NSVA 4NWLA 2FOCA 2ZGBH 5BPEA 4X6NA 1RTLA 4TY7A 3A88A 3H5CB 1O31A 1CBWB 3RXUA 2FX6A 2EEKA 1CHOF 2GZ8A 2V35A 1PYTC 4XDEA 4AORA 1V3XA 4I8JA 2GZ9A 4YESB 1QB6A 5T6DA 2XYAA 1TFXA 2HWLB 3P8GA 2JH0D 3ZZ6A 1O2ZA 2GT7A 2BD3A 3RXKA 4E7NA 1P05A 4H42U 1SMFE 1V2ST 3SUGA 3V0XA 2PWXA 3A85A 1GJ6A 1W14U 4LXBH 4M7GA 3T2NA 2ESTE 1K22H 4U30A 1PQ5A 1DWBH 1EB1H 1J17T 4GCHG 3M36A 1NO9H 3Q76A 1DY9A 2EA3A 1O2XA 4WJG2 5JYIA 5CMXH 3K2UA 1MTNC 5T3HA 4THNH 1CGJE 4DY7B 1NRQH 2QIQA 3V3MA 3LJOA 4AG2A 1CSOE 2C8YB 1LHFH 1WAYB 1SFQB 1O3NA 1GHVH 2Z7FE 1K1OA 3Q3XA 1C5NH 1C9TA 3RXEA 1OWEA 4ZROA 1EP5A 4IBLH 1UTPA 3TJUA 5J4SA 2GV7A 1WV7H 2ZFRH 3A8AA 1YPHE 4VGCC 5HXFA 2J92A 1ARCA 3K6ZA 1O35A 1EJMA 2BY6X 1GDNA 4PROA 3F9GA 1TE0A 2P3UB 2OC0A 2OCVB 1RS0A 5DP9A 3FZDA 2CHAC 1N6YA 1UTLM 2FI5E 2GMTB 3UWIA 4D7GA 5L30H 2FWWA 5BRRE 4ZKOU 1QL7A 3SGQE 1O3EA 4K1TA 1IQGA 1L0ZA 1BTWA 1H9HE 3DHKH 1AN1E 4I33A 3PTNA 2BQWB 1SGTA 3URCA 2FMJA 1BZXE 1JMOH 1XUKA 3C27B 3P6ZB 1KXCA 4IN1A 3OYPA 3RMOH 5C1YA 1RIWB 2BTCE 1L1NA 3SV9A 1D6WA 2LIZA 2STAE 4FUEA 1CQQA 7LPRA 3H7OA 2H1UA 1BJUA 1F0UA 4IS5A 1PQ7A 1YPMH 3S0NA 3FAOA 2XBYA 1BBRE 1AQ7A 1SGIB 1F2SE 4K69A 5CHAC 1O2QA 1TX7A 3E3TA 3W94A 1AIXH 1SGCA 3GCNA 1KXDA 1GJBB 3TK6A 2J94A 1Z1IA 2QCYA 5E0HA 3VGCB 3SV8A 1O3IA 2Y5GA 3M5NA 3OSYA 3E0NB 1XVMA 5JB9S 2Y6TA 1NRNH 4ABGA 3TH4H 1ELEE 1EOLA 2VWOA 1P01A 3E91A 3CS7A 4ABHA 4BAKB 1LQDB 4K1EA 1XXFA 2ZCLP 1HJAC 1QY6A 3QLPH 4FUGA 2QA9E 3ZZ3A 1BMNH 1TB6H 3HATH 4MNXA 1NFYA 1TABE 3TJVA 3BEFB 1C1VH 3RXAA 2BD9A 1J8AA 1EB2A 2RDLA 1A0LA 4ZKSU 3QZQA 2JH5D 1K1JA 2Y80A 1FY1A 3E0PB 4XBBA 1FUJA 2C3SA 2BDHA 2FOGA 5FXLA 2VIPA 1C1UH 3BTWE 2FZZA 4TPYA 1BOQA 2ZU2A 3RM2H 3MO3A 1INCA 1T31A 1UTQA 1V2VT 4O3TA 3A84A 2F9PA 2EI7A 1TMUH 2HALA 3T28A 2AFQB 1YM0A 3EGKH 4NWKA 4MDSA 3PMBB 1KY9A 4UFEH 3PO1C 2BX4A 3MFJA 2ULLA 2W7UA 1WBGB 5EW2H 5EPNA 1ID5H 4ABAA 5GPIB 1GBCA 3LDXH 4Y11E 3GCHB 1UVTH 4I31A 3T25A 3RDZA 4TY6A 1ZOMA 4CRGA 3GYLB 3ZVAA 2Q6GA 4B74A 5LPFA 2VJ1A 4D7FA 3D49H 2GT8A 1XUIA 1S0QA 4FUCA 2C8ZB 2IJOB 1SGQE 1AUJA 4JMYA 1FIWA 3MU4A 1YPHC 2V3OH 4WMDA 1F7ZA 1IQJA 1MTSA 1ZMNA 3A8CA 1V2PT 2YNBA 2PR3A 2BD5A 4AB8A 3A89A 2O8MA 4X1NU 4NZQA 1GVLA 1O3PB 1MQ6A 1O3CA 2A4QA 3RXMA 1O3MA 3ZVDA 4B71A 3BTQE 2FIRH 2J9NA 4KKDA 2BD4A 5EXNA 6LPRA 3SJOA 2B0FA 4ZKRU 3T5FH 7ESTE 1VJAU 1W7XH 2HPQH 3SW2B 2Y5HA 1O32A 2ANWA 3FFGA 1D3PB 3M7QA 3D23A 3M5OA 1IQEA 1GJCB 1DY8A 1MBQA 1ZPZA 1C1OA 2A4OA 4I7YH 3VB4A 2BQ7B 4X8UH 3A7WA 1C5QA 1P04A 1LQEA 4OGYA 1UJ1A 2THFB 5SGAE 2D26C 2A7HA 3PLBA 1GMCF 2P59A 3ATKA 3TNSA 4B76A 5DPAA 1D4PB 3PMAB 3ATLA 1V2TT 1NM6A 3U69H 4AFUA 3QTOH 1OPHB 4UFDH 2OXSA 3I77A 3F9EA 2G5VA 1CGHA 2R3UA 1EOJA 1P2QA 4R8TB 4RN6A 2OD3B 1AVXA 1EASA 1O2YA 3ENSB 3SO3A 2FLBH 1G37A 4DIIH 3AASA 3TIUA 3GY7A 1G30B 2V0BA 1O38A 1UMAH 1XVOA 4Q80A 4Y10E 2FS8A 3MYWA 2VNTA 3M37A 1C2EA 1GVKB 1FAXA 2FX4A 3BIVH 3KHVA 1JRSA 1SLUB 3P8FA 1SI5H 5EPYA 5LPRA 5ETXA 1TQ0B 3PROA 5F6MA 4O3UA 3SUFA 3UNRA 4X2YA 1RD3B 1FI8A 3HK6B 1GI4A 3KCGH 4CR5A 1J9CH 3F1SB 1O37A 2F3CE 2PW8H 1GBAA 1CBWC 2Z6BD 3RXRA 1T32A 4FU8A 1ZTJA 3RXGA 3EDXB 3FP6E 1S82A 2O8LA 2ZTZA 3BG4B 1NZQH 1DFPA 2BY8X 1O3GA 3FANA 2I6QA 1TNLA 3ZZ9A 1AKSA 2K7XA 4Q2KA 2VIOA 1W12U 4HI3A 1W0YH 4GUXA 1DVAH 2VVVA 2GCTB 4XE4A 2SNWA 1B5GH 5A2MH 1B0FA 4R0IA 1O2TA 4WMEA 1K28D 3LKWA 1AVWA 1QJ7B 3GY5A 1THRH 4ABJA 4CBNA 2P3TB 2WUCA 1TGTA 1UVOA 3SU0A 1C5LH 1ETTH 1EAUA 2EI8A 1QNJA 3K9XB 2WPIS 1AO5A 2WV4A 2PSXA 1GHBF 1F5KU 2H5CA 1UCYH 3G01A 1RTKA 3I29A 2D2DA 1JIRA 3Q3YA 4O03A 4TWYA 2A32A 1EXFA 5JB8S 1HGTH 4Y6DA 1VITH 4H6TA 2A0QB 3ATIA 1GJ4H 1UVPA 2QXIA 4H6SB 1SLVB 3O8DA 4JZIA 2ZG0H 4B1TA 1BT7A 1MTVA 3AAUA 1T7CA 1ZHPA 1O30A 1ANDA 2QN5T 2Q6FA 3BTGE 2FODA 2A5IA 2XBXA 1O5GH 1T8OA 1K1PA 1AGJA 1DWCH 1M9UA 1YP9A 3ELAH 4Y0ZE 1GBEA 3SU6A 1OKXA 3PYHA 1FLEE 1TOMH 2ZDVH 3ZVEA 1ZGIA 3TJOA 1TNGA 1TONA 1BHXB 1C1QA 2R0LA 2KAIA 3MO9A 5DO4H 1C5OH 4XSKU 1F5LA 1V2JT 4E7RG 4B2AA 5HM9A 2VVUA 1WYKA 3NCLA 1HYLA 3SU2A 3RC4A 2R3YA 1HAHH 3VXFH 1UVSH 1HAPH 5E2OA 1XUJA 3E6PH 2G4UA 2C93B 2CXVA 1PQ8A 1FPHH 3MH7A 1C1RA 1FY4A 1O2WA 1PPEE 3SHCH 2AIPA 1BDAA 3UIRA 7GCHF 2A5KA 3RXHA 1WTGH 4CH2B 4IGDA 4JZ1A 2O8WA 1SQAA 2P93A 1MH0A 3MMGA 1SLXB 4X6PA 2OC7A 3L6PA 2G81E 1EATA 1O0DH 1PPBH 4AFZA 1BCUH 1GBLA 5PTPA 1O3LA 1HAXB 2PUQH 1F0SA 2Z3DA 3SI3H 1TNIA 5ABWA 4Y71A 1C2GA 1KXEA 3DUXH 4MVNA 2B7DH 1KDQA 4RKOB 3VB6A 1OP2A 3GY8A 1LO6A 1PPFE 1QTFA 1HAOH 4DT7B 1ZHRA 2ZFQH 5TJXA 1GI8B 3TLOA 2PGQB 1GJ5H 2UUKB 3GISB 4X2WA 4J2YB 1MAYA 5EU8A 3K6YA 1G2LA 1SOTA 2BM2A 1ZJKA 1MKWK 4X1PU 1J16A 1KLTA 3DT0H 1IQKA 1YLDA 3GCTG 4F49A 2AS9A 2FI4E 2QF3A 2FP7B 3MU1A 2Z3EA 5EQQA 4GLYA 1DUEA 1F0RA 1AY6H 5GDSH 4BNRA 3M5LA 1O2IA 1Y59T 2FI3E 1PPCE 2BXTH 4MPXA 3F68H 1PPGE 4DIHH 3RM0H 1GBDA 1AWHB 1A5HA 1DE7H 1YPLH 4XOJA 1N6XA 1FDPA 4FUDA 2WPJS 8GCHG 1EKBB 4DOQA 1AB9C 3ZYEA 3NWUA 2BD7A 3UR6A 9LPRA 5GWZA 5HYOA 4I8LA 1EP6A 1QB9A 1UHBA 1Q31A 1YCPH 2FESH 4U32A 1MCVA 2FOFA 2VINA 1IHTH 2OQ5A 1QB1A 1AI8H 3SNDA 1NFWA 3M3TA 2ZFTA 2BDCA 3LT3A 1O2OA 3PLPA 2ZGHA 2ZDMA 2HNTE 3V13A 3ZYDA 3TJNA 2BDIA 5FX5A 1OWIA 1GBHA 3U8TH 1Z71A 5T6GA 2Q6DA 2SGPE 4K8BA 4X6MA 3Q00A 1P3CA 4HFPB 4BTTB 3S7HB 4E06H 3GDVA 3PB1E 1BRCE 2A7CA 3LU9B 3S9CA 1DX5M 3ZZAA 2ODQA 4YO9A 2AMPA 1AFQB 1FONA 4MNYA 1YF4A 1O5FH 1GBJA 2H5DA 1ZSLA 1H4WA 4A7IB 2BVSH 1EZQA 4GSOA 1J14A 4GHTA 4ASHA 2PHBA 2A5AA 2VGCB 1T8MA 1WQSA 1HB0B 2BB4A 3EA9A 1BRUP 2OC1A 1Y3UA 3RXJA 2Y82A 2ZPQA 1C1TA 1RGQA 1TNHA 3A7ZA 1Y5UT 1P9UA 1YPGH 2V3HH 1QRZA 1ELCA 4DW2U 2BOHB 1HXEH 3C1KA 3E1XB 1OOKB 1A5GH 8LPRA 4UONA 1A0HB 2C8XB 3BTFE 3OY6U 4YM9A 2F9UA 3O8BA 1GJAB 1K9OE 1OWKA 1OX1A 5AF9H 3GY4A 4I32A 4UD9H 1GJ8B 1QA7A 3NKKA 1Z8JB 3F9HA 3MU0A 3QO6A 4B2BA 4Y8YA 4BOHA 1W2KH 3TGIE 1GBBA 3SNAA 1BB0B 1VGCB 1TGNA 3D65E 4YOGA 2TBSA 2AMDA 4XFQA 1ZPCA 1LHEH 4ZHMU 6GCHF 2BMGB 1ELGA 3QGJA 2PKAB 1QIXB 2PKSC 3S9AA 2H2ZA 3EA8A 1GI5A 4CRDA 2H9TH 3OU0A 2SGDE 1YLCA 1EPTA 2W5EA 4B73A 2AGGX 1O2RA 1ETSH 2OQUA 4MLFB 3PTBA 2ZKSA 5E0GA 3QGNB 3SUEA 4D76A 2HNTF 3KN2A 1KXFA 3BTKE 1TGBA 4I8HA 4LK4A 3SNEA 2VB0A 1GPZA 1CGIE 5C67A 2BYAX 3UNQA 3TK5A 4YOJA 5JBBS 2FPZA 1P09A 3BIUH 3CS0A 5EQSA 2D8WA 1IQFA 1G2MA 3S9BA 2ZA5A 1MTWA 1EPTC 3ZVFA 1B0EA 1C5SA 2BVRH 1YYY1 1UTOA 2GD4B 4INLA 2FOEA 4HTCH 1Z8RA 2ZCHP 3TGKE 4ZKNU 1W8BH 1FV9A 3SJIA 1FN8A 1BBRH 5EOKA 1TQ7B 4X6OA 4Y7BA 1MMJN 1N8OC 1TX8A 1ETRH 1CHGA 3HKJB 1HJ8A 3SV7A 1JIMA 2UUYA 5FAHA 4OS4A 1GGDB 1Y3YA 3MTYA 1HAVB 1P57B 1PPHE 3KIDU 2AGIX 3O8CA 1HV7A 3GCOA 3VB5A 3SV6A 4ZXYH 4K1SA 4B75A 1GL0E 1O3JA 3BTEE 3TU7H 1ANBA 4WMFA 2AIQA 1SPJA 4FUHA 1O2JA 2HNTC 2GCHG 5TCAA 3HK3B 3O8RA 1WTHD 2BDBA 1P11E 4K2YA 3STIA 1ESBA 1O2MA 1Q2WA 1A7SA 3VB7A 1D3DB 4FUJA 1DXPA 1GI9B 3A83A 1TNKA 2I6SA 3BTHE 2JETB 4JZDH 3UNSA 1MD7A 1S83A 1GHWH 3MHWU 3DD2H 5A09A 2PTNA 4BAHB 4ESTE 1WQVH 5FPSA 1O5DH 1JRTA 3RXIA 4BAOB 1VITG 3T62A 4X1QU 3U8RH 3SJ9A 1GCTB 1G3EA 1T4UH 1QRXA 2XBWA 5C2ZA 4BTUB 1Z6JH 4IMZA 1LHCH 1P10A 2BDYA 4ZHLU 1UTNA 4FU7A 1E34B 4Z0KA 3BG8A 3LPRA 5ESTE 3KGPA 1V2UT 3AW1A 1EZUC 1IQMA 1SSXA 4XBCA 1C1PA 2ZO3H 1Y8TA 5E2PA 1TPPA 3URDA 2FOMB 4WWYA 5JBAS 1FJSA 1YC0A 4A6LA 1MZAA 1K21H 4JYTA 3UY9A 2CN0H 2J4IA 1A4WH 1ELFA 4K5ZA 1EZSC 2AH4X 4MG3A 1NTPA 1CA0B 5GCHG 2A45B 2A4GA 3AW0A 1ESTA 1GHAF 1SGDE 1CO7E 1SLWB 1GMHG 3RXOA 1NPMA 5FCRA 2WINI 1ZTKA 2BY7X 2RA0A 1A1RA 2Z9IA 1G9IE 1UK2A 1IQLA 2R2MB 4AOQA 1C5PA 1P12E 1Z8IB 3LGYA 4UFFH 1O2VA 2AYWA 1UTMA 3RC6A 1GI1A 4DGJA 1P06A 4FUFA 1G3BA 1DWEH 3M7UA 3PV4A 1CT4E 4X8VH 1ABJH 4Y8XA 3BTDE 1O33A 3ZVGA 2ZTXA 1CHOG 3MWIU 5JBTA 5H4IB 5HM2A 1IAUA 1O2UA 1Y3WA 1GMDF 2VWNA 4MPUA 5C20A 2ZI2H 3P8NA 5FX6A 1E35B 3ZV8A 3ZV9A 2OBQA
chains in the Genus database with same CATH superfamily
1C2DA 3WWFA 2PUXB 5FHTA 4JK5A 1HDTH 1CT2E 2NU4E 3BTME 1DOJA 3V12A 1GI3A 5GXPA 5C1XA 2OTVA 1HBTH 3NXPA 1S0RA 5LGOA 1QQUA 5EXLA 3ZZ5A 5J4QA 3NK8A 3PWBA 2BY5X 1VCWA 4AX9H 1GBIA 2DE9A 3UWJH 1MTNB 3T29A 1E38B 1UO6A 3R3GB 1WUNH 3PRBA 1TBRH 2UWPA 1HAZB 1MKXH 1TBZH 3QUMP 1A5IA 3DSPA 1SHYA 1YPKH 2TRMA 3UAIC 3SNCA 4CHAC 4HGCA 4NIXA 1FY5A 1DLEA 4LZ4B 3M3SA 2Z9JA 3EAJA 1MUEB 3KQBA 5A0AE 4AFSA 2FDAA 5L2YH 2G4TA 5T1VA 1P3EA 4D8NA 4INHA 3ODDA 3SU4A 3MU8A 1K1MA 8KME2 2C90B 1FN6A 1ELAA 4NFFA 1AVGH 1F92A 2C4FH 5DP5A 1BTYA 2UWLA 5KGOA 1DT2A 1H8IH 2BD2A 1C1MA 1O2PA 2XC5A 5DGJA 3SGBE 4ABEA 1ELTA 4UFGH 1G3DA 4BAQB 1RTFB 1XM1A 3RU4D 3U1JB 2XC4A 3IWMA 1P2NA 3U28C 4BXSA 3FP7E 1JOUB 1YPJH 1DM4B 3KYFA 1QA0A 3QZRA 2QF5A 3L33A 3SBKA 1ZJDA 4DG4A 3FN8A 4CR9A 2O8UA 4HZHA 4YT7H 3U98H 3SUDA 2L74A 1Y5BT 2O9QA 1FIZA 5C17A 5DG6A 1QFKH 3NZIA 3PV5A 4GCHF 1VCQA 5DP4A 3RU4E 1FY3A 4Z1MD 1K1IA 1WXRA 4U2WA 4WH8A 1LDTT 4D9QA 2WYJA 1ANEA 1YPEH 2ZDKA 3P95A 3ITIA 1S6HA 2JIZD 4JZFH 2V6NA 1CE5A 2ZDLA 3FP8E 1ACBE 2FXRA 1QHRB 1XKBC 1GJDB 1HPGA 2W3IA 1DS2E 2SFAA 2HPPH 1G36A 1VGCC 2ZFFH 1BTUA 1SL3A 1BMAA 1W13U 2Y7XA 1COWD 4YZUA 1TPSA 2H9HA 3FVFB 2KCAA 2GMTC 1GG6B 3DA9B 1HJAB 1Z8GA 6ESTA 2BZ6H 3TPIZ 1O3KA 4RT0A 4AYYB 3MNBA 2A2QH 1P9SA 4FU9A 4Q7ZA 2AMQA 1ZSKA 1SGEE 1WSSH 2XNIA 1B7XB 2Y5FA 1DICA 3KQ5A 1BRAA 2OINA 1O3BA 2XTTB 1E1QD 1L4ZA 5AVDA 2G8TA 2ZU1A 2IN2A 2JH6D 1UCYK 2ZHEH 3DFJA 3P70B 3M5MA 1O2KA 4A1VA 1TNJA 2TGPZ 1ELDE 4YTAA 1DSTA 1RIWC 1TA6A 4GAWA 1UK4A 1D6RA 1RRKA 2W26A 3AK5A 4KELA 4TWWA 1C5TA 4UDWH 1W3CA 2L6OA 2WV9A 2ZPSA 1VJ9U 2J2UA 2ZPRA 3RMNH 1O34A 1THPB 4UEHH 2IOTA 2PTCE 4BANB 1ZSJA 4Q7YA 2ZGXH 4GHQA 4OGXA 3GYMA 1OYTH 3VPKA 1WDIA 3A7YA 5KECA 4NA7A 4TT3D 2DUCA 1ELVA 3VFEA 2J98A 1C5RA 2J5UA 2F9OA 3TVJB 2FEQH 1FAKH 1S6LA 1C2KA 4AFQA 2M5TA 2YMSC 3LGTA 1WCZA 2GDDA 3VGCC 1L1GA 1ZPBA 4UE7H 1XX9A 2GDEH 4X8SH 1O2SA 3I78A 4BTIB 1GGDC 5IK2D 1UK3A 4JYVH 1O2HA 3LC3A 2OP9A 1DLKB 5EODA 1NRRH 2QXJA 1BTHH 1NFXA 1QURH 1VR1H 2ZDAH 2HVYB 3UFAA 3GY6A 3SOSA 2W7SA 1GDUA 1C5YB 2D1JA 4SGBE 4TYDA 2OBOA 3RU4T 4DURA 3RLWH 2R0KA 4ZH8A 1P2JA 3MH5A 1J15A 4NIVA 2GCHF 3H7TA 3VXEH 4YLUA 1BA8B 2JETC 2HOBA 1TPAE 1DPOA 1NBME 1O2GH 1O36A 1JBUH 1NFUA 4OS7A 1BMLA 3PWCA 3A7TA 5G4BA 4Y7AA 2QYIA 5CE1A 5C1UA 2YOLA 1C2LA 1O3FA 1GDQA 2QXHA 1TBQH 2WPKS 2LPRA 2ZU3A 1ZMJA 5AFYH 5EIYA 1GCTC 1LKBA 2ZQ2A 2GZ7A 1C5ZB 1SBWA 3CENA 1H9LB 1KTSB 3GDUA 4OS5A 3GY2A 4OS1A 2G5NA 2ZFSA 4IW4E 3P8OA 1V2MT 3A87A 4X8TH 3SZNA 2ZFPH 1O3HA 2KX4A 2ZF0H 2BXUH 3PMHB 1NU7B 1QR3E 3RXLA 1GMCG 2ALPA 4FUBA 5F53A 3RXVA 3HPTB 1EAXA 1LHGH 3GCHC 1PPZA 1GHXH 3UREA 1OP0A 4D9RA 1CA8B 2FOHA 1T4VH 4CRCA 4RKJB 2ANKH 2QGRA 4AGJA 1MU8B 3E90B 1DDJA 3RXQA 1S81A 2P3FH 2R2WU 2QF4A 2M2AA 2ZZUH 1PQAA 1TMBH 1LPGB 3MI4A 4KTUA 1RJXB 4ZHAA 3A7XA 4KGAA 2GV6A 3B23B 5DP6A 2XW9A 2ZGJA 1BJVA 1LKAA 1P2OA 3A82A 1XUGA 4YOIA 9ESTA 4XBDA 5EXMA 4YXWD 4LOYH 1KLIH 2BLVA 3T26A 5AHGH 1F5RA 1AHTH 1IHSH 2XBVA 1AZ8A 3QK1A 5A0CA 3SGAE 4QT8C 1BITA 3P17H 1GI7B 1YCPK 4INKA 3TH3H 5F8TA 1QCPA 1V2QT 4KP0A 3SQHE 4Y0YE 2ZCKP 1C2MA 4RSPA 4ISLA 1NRSH 1V6DA 2G00A 1N1LA 1KIGH 1UVUH 1C2FA 3UUZA 1YCPM 3TH2H 1H8DH 1VKYA 1LVBA 2ZQ1A 5EGMA 3ZZDA 2A1DB 4DVAU 3ESTA 2H6MA 1FZZA 3EBNA 1FMGA 2GVFA 1Z7KA 3A7VA 1AUTC 4X1RU 3MNXA 3MNSA 1HCGA 1KYNA 4J1YA 2Z9KA 1C1NA 1NS3A 5FBIA 1LPZB 3KQEA 1QZ8A 1ARBA 2FS9A 2Q1JA 2PV9B 1GVZA 3HGNA 1GHBG 2LNCA 3ZVBA 2EI6A 1AWFH 1C4Y2 2BZAA 2W6ID 1T8NA 2G52A 4AN7A 4DCDA 5LH8A 2ZECA 1C1SA 1GI0A 1QL8A 3S7KB 1AKSB 4O97A 1NROH 2FYRA 1FX0B 2QAAA 1VZQH 3RXFA 4ABDA 1DWDH 5JDUB 2Z94A 3OEED 2O8TA 1FXYA 3RXTA 1C2IA 2BLOA 3M61U 3MOCA 3GICB 1S85A 1RXPA 3QX5H 3UOUA 1E36B 2VIVA 4ZUHA 1BTXA 1P2IA 3MH6A 4WY3A 2R9PA 1ZTLA 4NA9H 2BQ6B 3Q77A 2RA3A 5DP3A 2NU1E 4A5TS 1PFXC 1C5WB 3KEEA 2WUBA 1E0FD 3LC5A 4YLQH 1SGPE 1O3DA 3S69A 1SGFA 2NU0E 3LONA 1JWTA 1VCPA 1V2NT 2F9BH 1ZYOA 1XXDA 3BEIB 2ANMH 1EZXC 4IC5A 1GBFA 1ESAA 3BG4C 1C5VA 3WWBA 4CRFA 1C4V2 2HGTH 1EQ9A 1JXPA 1G32B 3M35A 2ZWLH 4Z6AH 5F8ZA 2VWMA 2Z9GA 4JCNA 2GCTC 1DUAA 1D3TB 1SG8B 4IN2A 1HFDA 5F03A 3ZZ7A 1GI2A 5A8XA 3QN7A 3LIWA 1BHXF 3P92A 3UTUH 1P2MA 2Y7ZA 1G3CA 1SGYE 2ILNA 2F91A 7GCHG 1EAIA 2RG3A 5KEDA 1TGCA 2QF0A 2BX3A 1HAIH 3ZZCA 2KAIB 1O5EH 2VVCA 1EAWA 2QY0B 1GBTA 2W6JD 3LH1A 2RFKC 3BF6H 5LPEA 1TX6A 5IDKA 4FXGH 2FO9A 2BDGA 3LH3A 1NC6A 2ANYA 2CGAA 1BRBE 3LGVA 3VEQB 5DKMA 2SGEE 4NIWA 3W95A 2TPIZ 1V2WT 1LVMA 3VB3A 1O3OA 1ZRKA 1GWAA 1GG6C 1HIAA 2ODPA 4CRAA 4ZXXH 1W10U 2NU3E 4F55A 5FBEA 1BBRK 2WYGA 5DP7A 4I86A 2JKHA 1EUFA 1ORFA 3ZZ4A 1GJ9B 1W0KD 2FM2A 4MNVA 1QJ6B 3SQEE 1TRYA 4NCYA 3F9FA 4U01A 4AZ2B 3KNXA 2G55A 2BDAA 4JYUH 4NIYA 2CF8H 2A31A 1KDQB 2K1QA 2J97A 3KQCA 4ISOA 1CU1A 1KTTB 1QBOA 5K0HA 2QE7D 5TCCA 3ZVCA 2WPHS 1KXBA 2SGAA 2XWBI 2P8OB 1O39A 1QJ1B 2IJD1 3RC5A 4ABBA 3LOXA 1P02A 4BXWA 6CHAB 2JJ1D 4E05H 2GGVB 1AB9B 2GKVE 1TIOA 5DP8A 3OY5U 2HRVA 3D62A 2ZIQH 1QGFA 2ZP0H 3MO6A 3U1IB 3ATMA 1AE5A 3BTTE 2AGEX 4FOUC 4KTSA 4B6EA 1OWHA 1SGRE 3SU3A 3UOPA 4LZ1H 1TWXB 5B6OA 2BLWA 1QBVH 3GDSA 2GTBA 1Y5AT 1WU1A 1TGSZ 2OLGA 2VU8E 5E0JA 3JZ1B 5C5OA 1X7AC 1MZDA 3PM3A 1HNEE 4NGAH 5E8EH 2BVXH 3BSQA 4AB9A 3R0FA 1UHBB 3A8DA 3EYDA 3HGPA 5C0UA 5DN6D 2FOAA 4DJZB 3B8JA 1S6FA 4TPIZ 1A46H 2VBCA 4AG1A 2W3KA 2P95A 2XCFA 4JZEH 5HIYA 1W0ZU 2ZHQH 1GJ7B 1IQIA 1ZR0A 5T6FA 5HGGA 2F9VA 3RXPA 3KL6A 2BD8A 1TOCB 2SGQE 4H4FA 2PFEA 3GCTF 1A2CH 1T8LA 1C5XB 3UPEA 2FYQA 1OWJA 4Y8ZA 3EA7A 3QWCH 1ZLRA 1LVOA 3BN9A 2DE8A 1EFRD 4FUIA 2STBE 2ZC9H 5HMAA 2RDEA 2XXLA 2ZU5A 1IQNA 3H09A 3KF2A 5A8ZA 3E8LA 1TA2A 1AD8H 4Q4LA 4NFEA 3A81A 3HKIB 2WPLS 4WF8A 1ZHMA 2CMYA 8GCHF 4B2CA 2EC9H 3DCLA 1MCTA 3CP7A 3PV2A 5L2ZH 3MQKC 1YGCH 5C3NA 1SQTA 1BQYA 1LMWB 5FPYA 5JBCS 1YBWA 1BTZA 1BMMH 2WSSD 3ZZ8A 2F4LA 1YLNA 3T27A 1HXFH 3SU1A 4X2XA 4AYVB 2ALVA 1OWDA 4NZLA 4JK6A 1S5SA 3BV9B 2CF9H 2UUFB 2AHME 3SV2H 1XKAC 1QRWA 3M7TA 1C9PA 1Z1JA 3EQ0H 4MPVA 5I46H 3F3BA 4CH8B 5L6NH 1GI6A 1SGFG 4VGCB 2J34A 6GCHG 1OXGA 1OSSA 2ZU4A 2HLCA 1ANCA 1DITH 4B6FA 1W0JD 4MQAA 1TAWA 2KM0A 3TITA 1FQ3A 3NPSA 2CHAB 2VIQA 3FO8D 2PKSB 1AFQC 3A80A 1TMTH 3N7EA 4MTBA 4YT6H 1V2LT 1A0JA 2VH0A 2ASUB 1TRMA 3E16B 3TK9A 2QXGA 1O5CB 2PLXA 1SB1H 1SGNE 1YWUA 2VGCC 1C2JA 3STJA 3IITA 3PLKA 1HAGE 2F83A 2PSYA 1S84A 1NESE 4RT1A 1HJ9A 3MU5A 1GBKA 1F0TA 3OEHD 4ABFA 1A3EH 1FNIA 4NG9H 3Q3KA 1MKXK 1L1JA 4CRBA 3IG6B 3K65B 2P16A 4X1SU 1K1NA 3GY3A 3EE0B 3LGUA 3LGWA 1EX3A 5ESBA 1HUTH 4A1TA 1EPTB 3UQOA 4P00A 1LPKB 1KSNA 4K60A 4FVDA 2IPHA 2B8OH 2P94A 1AE8H 4GVUA 4SGAE 2PKAA 5A0BA 5CHAB 5AFZH 1H1BA 1SHHB 2Y81A 4ABIA 4F4OC 4NA8A 3ATWA 1N8OB 1AZZA 1KXAA 1Y3VA 2J38A 2BHGA 2XWAA 3L3TA 3RLYH 1ZMLA 5FCKA 1UCYE 1MBMA 4MNWA 3M3VA 1GCDA 2ZNKH 2BLQA 2A7JA 3FZZA 2UWOA 4ACAA 2AERH 1XUHA 2ZEBA 1C2HA 1QL9A 1DXWA 1L4DA 1PYTD 1O2NA 5IYTA 1P03A 4AGKA 1OS8A 2G51A 3RXBA 5GJ4B 1P2KA 1UTKA 3RUOA 2PGBB 1FPCH 3U9AH 2PP6A 3UQVA 5EG4A 2ODYB 3DFLA 3AAVA 1C1WH 4A92A 1HAYB 1K1LA 2WHXA 2B9LA 1IQHA 2WPMS 3SJKA 1XMNB 3OX7U 2SGFE 3RXSA 4IC6A 3BEUA 3A86A 3OTJE 1C4U2 1W7GH 1TRNA 3RMMH 1KLJH 1AFEH 3WY8A 1NY22 2V7QD 1PJPA 2A2XH 1OP8A 1ZRBA 2TGTA 1ZGVA 3F0PA 7KMEH 1HAVA 1D9IA 2IPQX 2NU2E 4I8GA 4MPWA 2BOKA 2Z3CA 1QQ4A 2VH6A 3WW7A 5GIBA 1V2OT 1NN6A 2OC8A 4WVPE 1SQOA 1H8ED 4OS6A 4CREA 3PMJA 4RI0A 5F8XA 2XC0A 2VWLA 2TGAA 3LJJA 2ZGCA 4Q7XA 2C8WB 2ZDNA 3PO1B 4Y79A 4A1XA 1CVWH 3RP2A 2B5TB 2J95A 1HIAB 1Z6EA 3B9FH 5EW1H 1MKWH 3SI4H 1E79D 1H9IE 2KZ4A 5EQRA 3A8BA 2ZHDA 3UR9A 4Y76A 2ZHWH 2CJIA 2YNAA 2FLRH 3MH4A 5C5NA 4WXVA 1MAXA 2GX4A 4ISIH 3SJ8A 3SORA 1GHAG 1THSH 3NUMA 4K8YA 1A3BH 1FY8E 4K3JA 5FPTA 3TGJE 1ELBA 1V2RT 2A4RA 2QC2A 2SNVA 5JPMH 1DSUA 2HLDD 2FTLE 4GPGA 1EJNA 1MD8A 3F6UH 4BAMB 1AMHA 1GHZA 1HLTH 4NSYA 4KTCA 1IOEA 1O3AA 4ZAEA 8ESTE 3GOVB 1O5BB 5FL7D 1LVYA 2KR7A 3AVZA 2GP9B 1YKTA 3QTVH 1U6QA 3KQDA 3RMLH 1CT0E 1NRPH 1LTOA 2F9NA 5DJ7A 1HRTH 2UUJB 1BIOA 2VIWA 5DK1A 1SC8U 4WH6A 1VITF 1W11U 2AEIH 2ZTYA 1C5MD 1GMDG 3RXDA 2CV3A 2FTMA 3V7TA 2VIDA 3QDZB 2WV5A 1D3QB 2OUAA 2TGDA 1O2LA 1SFIA 1UTJA 1NU9A 1TLDA 1ZZZA 1LCYA 4I8KA 2TIOA 1O5AB 1MTUA 2WPDD 4ISNA 1MQ5A 4AC9A 5K7RA 2XRCA 1TYNA 2P8OC 2BY9X 3LGIA 3ZZBA 1QBNA 1TALA 3SU5A 5EJ1A 2QV1A 1GBMA 1Y3XA 4X0WU 6CHAC 1C5UA 3JZ2B 1WOFA 1GL1A 1P8VC 4ZMAH 2FOBA 2H9EH 1CA0C 3ODFA 3SNBA 1BUIA 5I25A 1P0SH 2HVXA 4WXIA 1Q3XA 1SOZA 4ISHH 1A61H 2RCEA 3PRDA 1V2KT 4O9VA 5GCHF 4CBOA 1TPOA 1L2EA 1SR5C 5A8YA 1E37B 3N7OA 1RFNA 1BTPA 1DANH 1K2I1 1MU6B 1EJAA 2Z9LA 1GMHF 2NWNA 4OS2A 2XCNA 4CHAB 1XUFA 3MNCA 3SHAH 3U8OH 3TNTA 4IMQA 2ZHFH 4X2VA 1NT1A 3SN8A 3RXCA 1ABIH 4FVBA 1GHYH 1LHDH 1OYQA 1SVPA 2GJGA 1AU8A 4NSVA 4NWLA 2FOCA 2ZGBH 5BPEA 4X6NA 1RTLA 2XNDD 4TY7A 3A88A 3H5CB 1O31A 1CBWB 3F0OA 3RXUA 2FX6A 2EEKA 1CHOF 2GZ8A 2V35A 1PYTC 4XDEA 4AORA 1V3XA 2K0QA 4I8JA 4HG6A 2GZ9A 4YESB 1QB6A 5T6DA 2XYAA 1TFXA 2HWLB 3P8GA 2JH0D 3ZZ6A 1O2ZA 2GT7A 2BD3A 3RXKA 4Q63A 4E7NA 1P05A 4H42U 1SMFE 2EQNA 1V2ST 3SUGA 3V0XA 2PWXA 3A85A 1GJ6A 1W14U 4LXBH 4M7GA 3T2NA 2ESTE 1K22H 4U30A 1PQ5A 1DWBH 1EB1H 1J17T 4GCHG 3M36A 1NO9H 3Q76A 1DY9A 2EA3A 1O2XA 4WJG2 5JYIA 5CMXH 3K2UA 1MTNC 5T3HA 4THNH 1CGJE 4DY7B 1NRQH 2QIQA 3V3MA 3LJOA 4AG2A 1CSOE 2C8YB 1LHFH 1WAYB 1SFQB 1O3NA 1GHVH 2Z7FE 1K1OA 3Q3XA 1C5NH 1C9TA 3RXEA 1OWEA 4ZROA 1EP5A 4IBLH 1UTPA 3TJUA 5J4SA 2GV7A 1WV7H 2ZFRH 3A8AA 1YPHE 4VGCC 5HXFA 2J92A 1ARCA 3K6ZA 1O35A 1EJMA 2BY6X 1GDNA 3FOAA 4PROA 3F9GA 1TE0A 2P3UB 3EE7A 2OC0A 2OCVB 1RS0A 5DP9A 3FZDA 2CHAC 1N6YA 1UTLM 2FI5E 2GMTB 3UWIA 4D7GA 5L30H 2FWWA 5BRRE 4ZKOU 1QL7A 3SGQE 1O3EA 4K1TA 1IQGA 1L0ZA 1BTWA 1H9HE 3DHKH 1AN1E 4I33A 3PTNA 2BQWB 1SGTA 3URCA 2FMJA 1BZXE 1JMOH 1XUKA 3C27B 3P6ZB 1KXCA 4IN1A 3OYPA 4XD7D 3RMOH 5C1YA 1RIWB 2BTCE 1L1NA 3SV9A 1D6WA 2LIZA 2STAE 4FUEA 1CQQA 4ASUD 7LPRA 3H7OA 2H1UA 1BJUA 1F0UA 4IS5A 1PQ7A 1YPMH 3S0NA 3FAOA 2XBYA 1BBRE 1AQ7A 1SGIB 3OAAD 1F2SE 4K69A 5CHAC 1O2QA 1TX7A 3E3TA 3W94A 1AIXH 1SGCA 3GCNA 1KXDA 1GJBB 3TK6A 2J94A 1Z1IA 2QCYA 5E0HA 3VGCB 3SV8A 1O3IA 2XOKD 2Y5GA 3M5NA 3OSYA 3E0NB 1XVMA 5JB9S 2Y6TA 1NRNH 4ABGA 3TH4H 1ELEE 1EOLA 2VWOA 2WZQA 1P01A 3E91A 3CS7A 4ABHA 4BAKB 1LQDB 4K1EA 1XXFA 2ZCLP 1HJAC 1QY6A 3QLPH 4FUGA 2QA9E 3ZZ3A 1BMNH 1TB6H 2J98B 3HATH 4MNXA 1NFYA 1TABE 3TJVA 3BEFB 1C1VH 3RXAA 2BD9A 1J8AA 1EB2A 2RDLA 3W1EA 1A0LA 4ZKSU 2JDID 3QZQA 2JH5D 1K1JA 2Y80A 1FY1A 3E0PB 4XBBA 1FUJA 2C3SA 2BDHA 2FOGA 5FXLA 2VIPA 1C1UH 3BTWE 2FZZA 4TPYA 1BOQA 2ZU2A 3RM2H 3MO3A 1INCA 1T31A 1UTQA 1V2VT 4O3TA 3A84A 2F9PA 4ZCNA 2EI7A 1TMUH 2HALA 3T28A 2AFQB 1YM0A 3EGKH 4NWKA 4MDSA 3PMBB 1KY9A 4UFEH 1SKYE 3PO1C 2BX4A 3MFJA 2ULLA 2W7UA 1WBGB 5EW2H 5EPNA 1ID5H 4ABAA 5GPIB 1GBCA 3LDXH 4Y11E 3GCHB 1UVTH 4I31A 3T25A 3RDZA 4TY6A 1ZOMA 4CRGA 3GYLB 3ZVAA 2Q6GA 4B74A 5LPFA 2VJ1A 4D7FA 3D49H 2GT8A 1XUIA 1S0QA 4FUCA 2C8ZB 2IJOB 1SGQE 2K8IA 1AUJA 4JMYA 2KCPA 1FIWA 3MU4A 1YPHC 2V3OH 4WMDA 1F7ZA 1IQJA 1MTSA 1ZMNA 3A8CA 1V2PT 2YNBA 2PR3A 2BD5A 4AB8A 3A89A 2O8MA 4X1NU 4NZQA 1GVLA 1O3PB 1MQ6A 1O3CA 2A4QA 3RXMA 1O3MA 3ZVDA 4B71A 3BTQE 2FIRH 2J9NA 4KKDA 2BD4A 5EXNA 6LPRA 3SJOA 2B0FA 4ZKRU 2KFWA 3T5FH 7ESTE 1VJAU 1W7XH 2HPQH 3SW2B 2Y5HA 1O32A 2ANWA 3FFGA 2LELA 1D3PB 3M7QA 3D23A 3M5OA 1IQEA 1GJCB 1DY8A 1MBQA 1ZPZA 1C1OA 2A4OA 4I7YH 3VB4A 2BQ7B 4X8UH 3A7WA 3F2FA 1C5QA 1P04A 3SYJA 1LQEA 4OGYA 1UJ1A 2THFB 5SGAE 2D26C 3NRLA 2A7HA 3PLBA 1GMCF 2P59A 3ATKA 3TNSA 4B76A 5DPAA 1D4PB 2F43B 3PMAB 3ATLA 1V2TT 1NM6A 3DSGA 3U69H 4AFUA 3QTOH 1OPHB 4UFDH 2OXSA 3I77A 3F9EA 2G5VA 3OTPA 1CGHA 2R3UA 1EOJA 1P2QA 4R8TB 4RN6A 2OD3B 1AVXA 1EASA 1O2YA 3ENSB 3SO3A 2FLBH 1G37A 4DIIH 3AASA 3TIUA 3GY7A 1G30B 2V0BA 1O38A 1UMAH 1XVOA 4Q80A 4Y10E 2FS8A 3MYWA 3SZEA 2VNTA 3M37A 1C2EA 1GVKB 1FAXA 2FX4A 3BIVH 3KHVA 1JRSA 1SLUB 3P8FA 1SI5H 5EPYA 5LPRA 5ETXA 1TQ0B 3PROA 5F6MA 4O3UA 3SUFA 3UNRA 3F2HA 4X2YA 1RD3B 1FI8A 3HK6B 1GI4A 3KCGH 4CR5A 1J9CH 3F1SB 1O37A 2F3CE 2PW8H 1GBAA 1CBWC 2Z6BD 3RXRA 1T32A 4FU8A 1ZTJA 3RXGA 3EDXB 3FP6E 1S82A 2O8LA 2ZTZA 3BG4B 1NZQH 1DFPA 2BY8X 4M9FA 1O3GA 3FANA 2I6QA 1TNLA 3ZZ9A 1AKSA 2K7XA 4Q2KA 2VIOA 1W12U 4HI3A 1W0YH 4GUXA 1DVAH 2VVVA 2GCTB 4XE4A 2SNWA 1B5GH 5A2MH 1B0FA 4R0IA 1O2TA 4WMEA 1K28D 3LKWA 1AVWA 1QJ7B 3GY5A 1THRH 4ABJA 4CBNA 2P3TB 2WUCA 1TGTA 1UVOA 3SU0A 5B6LA 1C5LH 1ETTH 1EAUA 2EY4C 2EI8A 1QNJA 3K9XB 2WPIS 1AO5A 2WV4A 2PSXA 1GHBF 1F5KU 2H5CA 1UCYH 3G01A 1RTKA 3I29A 2D2DA 1JIRA 3Q3YA 4O03A 4TWYA 2A32A 1EXFA 5JB8S 1HGTH 4Y6DA 1VITH 4H6TA 5HKKD 2A0QB 3ATIA 1GJ4H 1UVPA 2QXIA 4H6SB 1SLVB 3O8DA 4JZIA 5CDFE 2ZG0H 4B1TA 1BT7A 1MTVA 3AAUA 1T7CA 1ZHPA 1O30A 1ANDA 2QN5T 2Q6FA 3BTGE 2FODA 2A5IA 2XBXA 1O5GH 1T8OA 1K1PA 2KCYA 1AGJA 1DWCH 1M9UA 1YP9A 3ELAH 4Y0ZE 1GBEA 3SU6A 1OKXA 3PYHA 1FLEE 1TOMH 2ZDVH 3ZVEA 1ZGIA 3TJOA 1TNGA 1TONA 1BHXB 1C1QA 2R0LA 2KAIA 3MO9A 5DO4H 1C5OH 4XSKU 1UW7A 1F5LA 1V2JT 4E7RG 4B2AA 5HM9A 2VVUA 1WYKA 3NCLA 1HYLA 3SU2A 5C94A 3N7DA 3RC4A 2R3YA 1HAHH 3VXFH 1UVSH 1HAPH 5E2OA 1XUJA 3E6PH 2G4UA 2C93B 2CXVA 1PQ8A 1FPHH 3MH7A 1C1RA 1FY4A 1O2WA 1PPEE 3SHCH 2AIPA 1BDAA 3F2GA 3UIRA 7GCHF 2A5KA 3RXHA 1WTGH 4CH2B 4IGDA 4JZ1A 2O8WA 1SQAA 2P93A 1MH0A 3MMGA 1SLXB 4X6PA 2OC7A 3L6PA 2G81E 1EATA 1O0DH 1PPBH 4AFZA 1BCUH 1GBLA 3N99A 5PTPA 1O3LA 3VG8A 1HAXB 2PUQH 1F0SA 2Z3DA 3SI3H 1TNIA 1NBMD 5ABWA 4Y71A 1C2GA 1KXEA 3DUXH 4MVNA 2B7DH 1KDQA 4RKOB 3VB6A 1OP2A 3GY8A 1LO6A 1PPFE 1QTFA 3UB0A 1HAOH 4DT7B 1ZHRA 2ZFQH 5TJXA 1GI8B 3TLOA 2PGQB 1GJ5H 2UUKB 3GISB 4X2WA 4J2YB 1MAYA 5EU8A 3K6YA 1G2LA 1SOTA 2BM2A 1ZJKA 1MKWK 4X1PU 1J16A 1KLTA 3DT0H 1IQKA 1YLDA 3GCTG 4F49A 2AS9A 2FI4E 2QF3A 2FP7B 3MU1A 2Z3EA 5EQQA 4GLYA 1DUEA 1F0RA 1AY6H 5GDSH 4BNRA 3M5LA 1O2IA 1Y59T 2FI3E 1PPCE 2BXTH 4MPXA 3F68H 1PPGE 4DIHH 3RM0H 1OHHD 4XRNA 1GBDA 1AWHB 1A5HA 1DE7H 1YPLH 4XOJA 1N6XA 1FDPA 4FUDA 2WPJS 8GCHG 1EKBB 4DOQA 1AB9C 1BMFD 4OM9A 3ZYEA 3NWUA 2BD7A 3UR6A 9LPRA 5GWZA 5HYOA 4I8LA 1EP6A 1QB9A 1UHBA 1Q31A 1YCPH 2FESH 4U32A 1MCVA 2FOFA 2VINA 1IHTH 2OQ5A 1QB1A 1AI8H 3SNDA 1NFWA 3M3TA 5DSFA 2ZFTA 2BDCA 3LT3A 1O2OA 3PLPA 3GS9A 2ZGHA 2ZDMA 2HNTE 3V13A 3ZYDA 3TJNA 2BDIA 5FX5A 1OWIA 1GBHA 3U8TH 1Z71A 5T6GA 2Q6DA 2SGPE 4K8BA 4X6MA 3Q00A 1P3CA 4HFPB 4BTTB 3S7HB 4E06H 3GDVA 3PB1E 1BRCE 5GNDA 2A7CA 3LU9B 3S9CA 1DX5M 3ZZAA 1SQRA 2ODQA 4YO9A 2AMPA 1AFQB 1FONA 4MNYA 1YF4A 1O5FH 4DT4A 1GBJA 2H5DA 1ZSLA 1H4WA 4A7IB 2BVSH 1EZQA 4GSOA 1J14A 4GHTA 4ASHA 2PHBA 2A5AA 2VGCB 1T8MA 1WQSA 1HB0B 2BB4A 3EA9A 1BRUP 2OC1A 1Y3UA 3RXJA 2Y82A 2ZPQA 1C1TA 1RGQA 1TNHA 3A7ZA 1Y5UT 1P9UA 1YPGH 2V3HH 1QRZA 1ELCA 4DW2U 2BOHB 1HXEH 3C1KA 3E1XB 1OOKB 1A5GH 8LPRA 4UONA 1A0HB 2C8XB 4P02A 3BTFE 3OY6U 4YM9A 2F9UA 3O8BA 1GJAB 1K9OE 1OWKA 1OX1A 5AF9H 3GY4A 4I32A 4UD9H 1GJ8B 1QA7A 3NKKA 1Z8JB 4ACBA 3F9HA 3MU0A 3QO6A 4B2BA 4Y8YA 4BOHA 1W2KH 3TGIE 1GBBA 3SNAA 1BB0B 1VGCB 3OFND 1TGNA 3D65E 4YOGA 2TBSA 2AMDA 4XFQA 1ZPCA 1LHEH 4ZHMU 6GCHF 2BMGB 1ELGA 3QGJA 2PKAB 1K0HA 1QIXB 2PKSC 3S9AA 2H2ZA 3EA8A 1GI5A 4CRDA 2H9TH 4TSFD 3OU0A 2SGDE 1YLCA 1EPTA 2W5EA 4B73A 2AGGX 1O2RA 1ETSH 2OQUA 4MLFB 3PTBA 2ZKSA 5E0GA 3QGNB 1KMHB 3SUEA 4D76A 2HNTF 2OK5A 3KN2A 1KXFA 3BTKE 1TGBA 4I8HA 4LK4A 3SNEA 3OE7D 2VB0A 1GPZA 1CGIE 5C67A 2BYAX 3UNQA 3DSOA 3TK5A 4YOJA 5JBBS 2FPZA 1P09A 3BIUH 3CS0A 5EQSA 2D8WA 1IQFA 1G2MA 3S9BA 2ZA5A 1MTWA 1EPTC 3ZVFA 1B0EA 1C5SA 2BVRH 1YYY1 1UTOA 1YY3A 2GD4B 4INLA 2FOEA 4HTCH 1Z8RA 2ZCHP 3TGKE 4ZKNU 1W8BH 1FV9A 3SJIA 1FN8A 1BBRH 4F48B 5EOKA 1TQ7B 4X6OA 4Y7BA 1MMJN 1N8OC 1TX8A 1ETRH 1CHGA 3HKJB 2YMSB 1HJ8A 3SV7A 1JIMA 2UUYA 5FAHA 4OS4A 1GGDB 1Y3YA 3MTYA 1HAVB 1P57B 1PPHE 3KIDU 2AGIX 3O8CA 1HV7A 3GCOA 3VB5A 3SV6A 4ZXYH 4K1SA 4B75A 1GL0E 1O3JA 3BTEE 3TU7H 1ANBA 4WMFA 2AIQA 1SPJA 4FUHA 1O2JA 2HNTC 2GCHG 3KYGA 5EJZA 5TCAA 3HK3B 3O8RA 1WTHD 2BDBA 1P11E 4K2YA 3STIA 1ESBA 1O2MA 1Q2WA 1A7SA 3VB7A 1D3DB 2V3MA 1DXPA 4FUJA 1GI9B 3A83A 1TNKA 2I6SA 5EJLA 3BTHE 2JETB 4JZDH 3UNSA 1MD7A 1S83A 1GHWH 3MHWU 3DD2H 5A09A 2PTNA 4BAHB 4ESTE 4FETA 1WQVH 2CK3D 5FPSA 1O5DH 2JJ2D 1JRTA 3RXIA 3FKSD 4BAOB 1VITG 3T62A 4X1QU 3U8RH 3SJ9A 1GCTB 1G3EA 1T4UH 1QRXA 2XBWA 5C2ZA 4BTUB 1Z6JH 4IMZA 1LHCH 1P10A 2BDYA 4ZHLU 1UTNA 4FU7A 1E34B 4Z0KA 3BG8A 3LPRA 5ESTE 3KGPA 1V2UT 3AW1A 1EZUC 1IQMA 1SSXA 4XBCA 1C1PA 2ZO3H 1Y8TA 5E2PA 3ZIAD 1TPPA 3URDA 2FOMB 4WWYA 5JBAS 1FJSA 1YC0A 4A6LA 1MZAA 1K21H 4JYTA 3UY9A 2CN0H 2J4IA 1A4WH 1ELFA 4K5ZA 2KCOA 2LP6A 1EZSC 2AH4X 4MG3A 1NTPA 1CA0B 5GCHG 2A45B 2A4GA 3AW0A 1ESTA 1GHAF 1SGDE 1CO7E 1SLWB 1GMHG 3RXOA 5CHBA 1NPMA 3CNRA 5FCRA 5C0TA 2WINI 1ZTKA 2BY7X 2RA0A 1A1RA 2Z9IA 1G9IE 1UK2A 1IQLA 2R2MB 4AOQA 1C5PA 1P12E 1Z8IB 3LGYA 4UFFH 1O2VA 2AYWA 1UTMA 3RC6A 1GI1A 4DGJA 1P06A 4FUFA 1G3BA 1MABB 1DWEH 3M7UA 3PV4A 1CT4E 4X8VH 1ABJH 4Y8XA 3BTDE 1O33A 5HIZA 3ZVGA 2ZTXA 1CHOG 1E1RD 3MWIU 5JBTA 5H4IB 5HM2A 1IAUA 1O2UA 1Y3WA 1GMDF 1H8HD 2VWNA 4MPUA 5C20A 2ZI2H 3P8NA 5FX6A 1E35B 3ZV8A 3ZV9A 2YMSD 2OBQA
chains in the Genus database with same CATH topology
1C2DA 2PUXB 5FHTA 4JK5A 1HDTH 1CT2E 2NU4E 3BTME 1DOJA 3V12A 1GI3A 5GXPA 5C1XA 2OTVA 1HBTH 3NXPA 1S0RA 5LGOA 1QQUA 5EXLA 3ZZ5A 5J4QA 3NK8A 3PWBA 2BY5X 1VCWA 4AX9H 1GBIA 2DE9A 3UWJH 1MTNB 3T29A 1E38B 1UO6A 3R3GB 1WUNH 1TBRH 2UWPA 1HAZB 1MKXH 1TBZH 3QUMP 1A5IA 1SHYA 1YPKH 2TRMA 3SNCA 4CHAC 4HGCA 4NIXA 1FY5A 1DLEA 4LZ4B 3M3SA 2Z9JA 3EAJA 1MUEB 3KQBA 5A0AE 4AFSA 2FDAA 5L2YH 2G4TA 1P3EA 4D8NA 4INHA 3ODDA 3SU4A 3MU8A 1K1MA 8KME2 2C90B 1FN6A 1ELAA 4NFFA 1AVGH 1F92A 2C4FH 5DP5A 1BTYA 2UWLA 1DT2A 1H8IH 2BD2A 1C1MA 1O2PA 2XC5A 5DGJA 3SGBE 4ABEA 1ELTA 4UFGH 1G3DA 4BAQB 1RTFB 1XM1A 3RU4D 3U1JB 2XC4A 3IWMA 1P2NA 4BXSA 3FP7E 1JOUB 1YPJH 1DM4B 1QA0A 3QZRA 3L33A 3SBKA 1ZJDA 4DG4A 4CR9A 2O8UA 4HZHA 4YT7H 3U98H 3SUDA 1Y5BT 2O9QA 1FIZA 5DG6A 1QFKH 3NZIA 4GCHF 1VCQA 5DP4A 3RU4E 1FY3A 1K1IA 4U2WA 4WH8A 1LDTT 4D9QA 2WYJA 1ANEA 1YPEH 2ZDKA 3P95A 3ITIA 1S6HA 4JZFH 2V6NA 1CE5A 2ZDLA 3FP8E 1ACBE 2FXRA 1QHRB 1XKBC 1GJDB 1HPGA 2W3IA 1DS2E 2SFAA 2HPPH 1G36A 1VGCC 2ZFFH 1BTUA 1SL3A 1BMAA 1W13U 2Y7XA 4YZUA 1TPSA 2H9HA 3FVFB 2GMTC 1GG6B 3DA9B 1HJAB 1Z8GA 6ESTA 2BZ6H 3TPIZ 1O3KA 4AYYB 3MNBA 2A2QH 1P9SA 4FU9A 4Q7ZA 2AMQA 1ZSKA 1SGEE 1WSSH 2XNIA 1B7XB 2Y5FA 1DICA 1BRAA 2OINA 1O3BA 2XTTB 1L4ZA 5AVDA 2G8TA 2ZU1A 2IN2A 2JH6D 1UCYK 2ZHEH 3DFJA 3P70B 3M5MA 1O2KA 4A1VA 1TNJA 2TGPZ 1ELDE 4YTAA 1DSTA 1RIWC 1TA6A 4GAWA 1UK4A 1D6RA 1RRKA 2W26A 4KELA 4TWWA 1C5TA 4UDWH 1W3CA 2ZPSA 1VJ9U 2J2UA 2ZPRA 3RMNH 1O34A 1THPB 4UEHH 2IOTA 2PTCE 4BANB 1ZSJA 4Q7YA 2ZGXH 4GHQA 4OGXA 3GYMA 1OYTH 3VPKA 3A7YA 4NA7A 2DUCA 1ELVA 3VFEA 1C5RA 2F9OA 3TVJB 2FEQH 1FAKH 1C2KA 4AFQA 2M5TA 3VGCC 3LGTA 1WCZA 2GDDA 1L1GA 1ZPBA 4UE7H 1XX9A 2GDEH 4X8SH 1O2SA 3I78A 4BTIB 1GGDC 1UK3A 4JYVH 1O2HA 3LC3A 2OP9A 1DLKB 5EODA 1NRRH 2QXJA 1BTHH 1NFXA 1QURH 1VR1H 2ZDAH 3UFAA 3GY6A 3SOSA 2W7SA 1GDUA 1C5YB 2D1JA 4SGBE 4TYDA 2OBOA 3RU4T 4DURA 3RLWH 2R0KA 4ZH8A 1P2JA 3MH5A 1J15A 4NIVA 2GCHF 3H7TA 3VXEH 4YLUA 1BA8B 2JETC 2HOBA 1TPAE 1DPOA 1O2GH 1O36A 1JBUH 1NFUA 4OS7A 1BMLA 3PWCA 3A7TA 5G4BA 4Y7AA 2QYIA 5CE1A 5C1UA 2YOLA 1C2LA 1O3FA 1GDQA 2QXHA 1TBQH 2WPKS 2LPRA 2ZU3A 1ZMJA 5AFYH 1GCTC 1LKBA 2ZQ2A 2GZ7A 1C5ZB 1SBWA 3CENA 1H9LB 1KTSB 3GDUA 4OS5A 3GY2A 4OS1A 2G5NA 2ZFSA 4IW4E 3P8OA 1V2MT 3A87A 4X8TH 3SZNA 2ZFPH 1O3HA 2ZF0H 2BXUH 3PMHB 1NU7B 1QR3E 3RXLA 1GMCG 2ALPA 4FUBA 3RXVA 3HPTB 1EAXA 1LHGH 3GCHC 1PPZA 1GHXH 3UREA 1OP0A 4D9RA 1CA8B 2FOHA 1T4VH 4CRCA 4RKJB 2ANKH 2QGRA 4AGJA 1MU8B 3E90B 1DDJA 3RXQA 1S81A 2P3FH 2R2WU 2ZZUH 1PQAA 1TMBH 1LPGB 3MI4A 4KTUA 1RJXB 4ZHAA 3A7XA 4KGAA 2GV6A 3B23B 5DP6A 2XW9A 2ZGJA 1BJVA 1LKAA 1P2OA 3A82A 1XUGA 4YOIA 9ESTA 4XBDA 5EXMA 4LOYH 1KLIH 2BLVA 3T26A 5AHGH 1F5RA 1AHTH 1IHSH 2XBVA 1AZ8A 3QK1A 5A0CA 3SGAE 4QT8C 1BITA 3P17H 1GI7B 1YCPK 4INKA 3TH3H 5F8TA 1QCPA 1V2QT 4KP0A 3SQHE 4Y0YE 2ZCKP 1C2MA 4RSPA 4ISLA 1NRSH 1V6DA 2G00A 1N1LA 1KIGH 1UVUH 1C2FA 3UUZA 1YCPM 3TH2H 1H8DH 1LVBA 2ZQ1A 5EGMA 3ZZDA 2A1DB 4DVAU 3ESTA 2H6MA 1FZZA 3EBNA 1FMGA 2GVFA 1Z7KA 3A7VA 1AUTC 4X1RU 3MNXA 3MNSA 1HCGA 1KYNA 4J1YA 2Z9KA 1C1NA 1NS3A 5FBIA 1LPZB 3KQEA 1ARBA 2FS9A 2Q1JA 2PV9B 1GVZA 3HGNA 1GHBG 2LNCA 3ZVBA 2EI6A 1AWFH 1C4Y2 2BZAA 1T8NA 2G52A 4AN7A 4DCDA 5LH8A 2ZECA 1C1SA 1GI0A 1QL8A 3S7KB 1AKSB 4O97A 1NROH 2FYRA 2QAAA 1VZQH 3RXFA 4ABDA 1DWDH 5JDUB 2Z94A 2O8TA 1FXYA 3RXTA 1C2IA 2BLOA 3M61U 3MOCA 3GICB 1S85A 1RXPA 3QX5H 3UOUA 1E36B 2VIVA 4ZUHA 1BTXA 1P2IA 3MH6A 4WY3A 2R9PA 1ZTLA 4NA9H 2BQ6B 3Q77A 2RA3A 5DP3A 2NU1E 4A5TS 1PFXC 1C5WB 3KEEA 2WUBA 1E0FD 3LC5A 4YLQH 1SGPE 1O3DA 3S69A 1SGFA 2NU0E 3LONA 1JWTA 1VCPA 1V2NT 2F9BH 1ZYOA 1XXDA 3BEIB 2ANMH 1EZXC 4IC5A 1GBFA 1ESAA 3BG4C 1C5VA 4CRFA 1C4V2 2HGTH 1EQ9A 1JXPA 1G32B 3M35A 2ZWLH 4Z6AH 5F8ZA 2VWMA 2Z9GA 4JCNA 2GCTC 1DUAA 1D3TB 1SG8B 4IN2A 1HFDA 5F03A 3ZZ7A 1GI2A 5A8XA 3QN7A 3LIWA 1BHXF 3P92A 3UTUH 1P2MA 2Y7ZA 1G3CA 1SGYE 2ILNA 2F91A 7GCHG 1EAIA 2RG3A 1TGCA 2QF0A 2BX3A 1HAIH 3ZZCA 2KAIB 1O5EH 2VVCA 1EAWA 2QY0B 1GBTA 3LH1A 3BF6H 5LPEA 1TX6A 5IDKA 4FXGH 2FO9A 2BDGA 3LH3A 1NC6A 2ANYA 2CGAA 1BRBE 3LGVA 3VEQB 5DKMA 2SGEE 4NIWA 3W95A 2TPIZ 1V2WT 1LVMA 3VB3A 1O3OA 1ZRKA 1GWAA 1GG6C 1HIAA 2ODPA 4CRAA 4ZXXH 1W10U 2NU3E 5FBEA 1BBRK 2WYGA 5DP7A 2JKHA 1EUFA 1ORFA 3ZZ4A 1GJ9B 2FM2A 4MNVA 1QJ6B 3SQEE 1TRYA 4NCYA 3F9FA 4U01A 4AZ2B 3KNXA 2G55A 2BDAA 4JYUH 4NIYA 2CF8H 2A31A 1KDQB 2K1QA 3KQCA 4ISOA 1CU1A 1KTTB 1QBOA 5K0HA 5TCCA 3ZVCA 2WPHS 1KXBA 2SGAA 2XWBI 2P8OB 1O39A 1QJ1B 3RC5A 4ABBA 3LOXA 1P02A 4BXWA 6CHAB 4E05H 2GGVB 1AB9B 2GKVE 1TIOA 5DP8A 3OY5U 2HRVA 3D62A 2ZIQH 1QGFA 2ZP0H 3MO6A 3U1IB 3ATMA 1AE5A 3BTTE 2AGEX 4KTSA 4LZ1H 1OWHA 1SGRE 3SU3A 3UOPA 1TWXB 5B6OA 2BLWA 1QBVH 3GDSA 2GTBA 1Y5AT 1WU1A 1TGSZ 2OLGA 2VU8E 5E0JA 3JZ1B 5C5OA 1X7AC 1MZDA 3PM3A 1HNEE 4NGAH 5E8EH 2BVXH 3BSQA 4AB9A 3R0FA 1UHBB 3A8DA 3EYDA 3HGPA 2FOAA 4DJZB 3B8JA 1S6FA 4TPIZ 1A46H 4AG1A 2W3KA 2P95A 2XCFA 4JZEH 1W0ZU 2ZHQH 1GJ7B 1IQIA 1ZR0A 5T6FA 5HGGA 2F9VA 3RXPA 3KL6A 2BD8A 1TOCB 2SGQE 4H4FA 2PFEA 3GCTF 1A2CH 1T8LA 1C5XB 3UPEA 2FYQA 1OWJA 4Y8ZA 3EA7A 3QWCH 1ZLRA 1LVOA 3BN9A 2DE8A 4FUIA 2STBE 2ZC9H 5HMAA 2XXLA 2ZU5A 1IQNA 3KF2A 5A8ZA 3E8LA 1TA2A 1AD8H 4NFEA 3A81A 3HKIB 2WPLS 4WF8A 1ZHMA 2CMYA 8GCHF 4B2CA 2EC9H 1MCTA 3CP7A 5L2ZH 1YGCH 5C3NA 1SQTA 1BQYA 1LMWB 5FPYA 5JBCS 1YBWA 1BTZA 1BMMH 3ZZ8A 3T27A 1HXFH 3SU1A 4X2XA 4AYVB 2ALVA 1OWDA 4NZLA 4JK6A 1S5SA 3BV9B 2CF9H 2UUFB 3SV2H 1XKAC 1QRWA 3M7TA 1C9PA 1Z1JA 3EQ0H 4MPVA 5I46H 4CH8B 5L6NH 1GI6A 1SGFG 4VGCB 2J34A 6GCHG 1OXGA 1OSSA 2ZU4A 2HLCA 1ANCA 1DITH 4MQAA 1TAWA 3TITA 1FQ3A 3NPSA 2CHAB 2VIQA 2PKSB 1AFQC 3A80A 1TMTH 4MTBA 4YT6H 1V2LT 1A0JA 2VH0A 2ASUB 1TRMA 3E16B 3TK9A 2QXGA 1O5CB 2PLXA 1SB1H 1SGNE 2VGCC 1C2JA 3STJA 3IITA 3PLKA 1HAGE 2F83A 2PSYA 1S84A 1NESE 1HJ9A 3MU5A 1GBKA 1F0TA 4ABFA 1A3EH 1FNIA 4NG9H 3Q3KA 1MKXK 1L1JA 4CRBA 3IG6B 3K65B 2P16A 4X1SU 1K1NA 3GY3A 3EE0B 3LGUA 3LGWA 1EX3A 5ESBA 1HUTH 4A1TA 1EPTB 3UQOA 1LPKB 1KSNA 4K60A 4FVDA 2IPHA 2B8OH 2P94A 1AE8H 4GVUA 4SGAE 2PKAA 5A0BA 5CHAB 5AFZH 1H1BA 1SHHB 2Y81A 4ABIA 4F4OC 4NA8A 3ATWA 1N8OB 1AZZA 1KXAA 1Y3VA 2J38A 2BHGA 2XWAA 3L3TA 3RLYH 1ZMLA 5FCKA 1UCYE 1MBMA 4MNWA 3M3VA 1GCDA 2ZNKH 2BLQA 2A7JA 3FZZA 2UWOA 2AERH 1XUHA 2ZEBA 1C2HA 1QL9A 1DXWA 1L4DA 1PYTD 1O2NA 5IYTA 1P03A 4AGKA 1OS8A 2G51A 3RXBA 5GJ4B 1P2KA 1UTKA 3RUOA 2PGBB 1FPCH 3U9AH 3UQVA 5EG4A 2ODYB 3DFLA 3AAVA 1C1WH 4A92A 1HAYB 1K1LA 2B9LA 1IQHA 2WPMS 3SJKA 1XMNB 3OX7U 2SGFE 3RXSA 4IC6A 3BEUA 3A86A 3OTJE 1C4U2 1W7GH 1TRNA 3RMMH 1KLJH 1AFEH 3WY8A 1NY22 1PJPA 2A2XH 1OP8A 1ZRBA 2TGTA 1ZGVA 7KMEH 1HAVA 1D9IA 4I8GA 2NU2E 4MPWA 2BOKA 2Z3CA 1QQ4A 2VH6A 5GIBA 1V2OT 1NN6A 2OC8A 4WVPE 1SQOA 4OS6A 4CREA 3PMJA 5F8XA 2XC0A 2VWLA 2TGAA 3LJJA 2ZGCA 4Q7XA 2C8WB 2ZDNA 3PO1B 4Y79A 4A1XA 1CVWH 3RP2A 2B5TB 2J95A 1HIAB 1Z6EA 3B9FH 5EW1H 1MKWH 3SI4H 1H9IE 5EQRA 3A8BA 2ZHDA 3UR9A 4Y76A 2ZHWH 2CJIA 2YNAA 2FLRH 3MH4A 5C5NA 4WXVA 1MAXA 2GX4A 4ISIH 3SJ8A 3SORA 1GHAG 1THSH 3NUMA 4K8YA 1A3BH 1FY8E 4K3JA 5FPTA 3TGJE 1ELBA 1V2RT 2A4RA 2QC2A 2SNVA 5JPMH 1DSUA 2FTLE 4GPGA 1EJNA 1MD8A 3F6UH 4BAMB 1AMHA 1GHZA 1HLTH 4NSYA 4KTCA 1IOEA 1O3AA 4ZAEA 8ESTE 3GOVB 1O5BB 1LVYA 3AVZA 2GP9B 1YKTA 3QTVH 1U6QA 3KQDA 3RMLH 1CT0E 1NRPH 1LTOA 2F9NA 5DJ7A 1HRTH 2UUJB 1BIOA 2VIWA 5DK1A 1SC8U 4WH6A 1VITF 1W11U 2AEIH 2ZTYA 1C5MD 1GMDG 3RXDA 2CV3A 2FTMA 3V7TA 2VIDA 3QDZB 2WV5A 1D3QB 2OUAA 2TGDA 1O2LA 1SFIA 1UTJA 1NU9A 1TLDA 1ZZZA 1LCYA 4I8KA 2TIOA 1O5AB 1MTUA 4ISNA 1MQ5A 5K7RA 2XRCA 1TYNA 2P8OC 2BY9X 3LGIA 3ZZBA 1QBNA 1TALA 3SU5A 2QV1A 1GBMA 1Y3XA 4X0WU 6CHAC 1C5UA 3JZ2B 1WOFA 1GL1A 1P8VC 4ZMAH 2FOBA 2H9EH 1CA0C 3ODFA 3SNBA 1BUIA 5I25A 1P0SH 2HVXA 4WXIA 1Q3XA 1SOZA 4ISHH 1A61H 2RCEA 1V2KT 4O9VA 5GCHF 4CBOA 1TPOA 1L2EA 1SR5C 5A8YA 1E37B 3N7OA 1RFNA 1BTPA 1DANH 1K2I1 1MU6B 1EJAA 2Z9LA 1GMHF 2NWNA 4OS2A 2XCNA 4CHAB 1XUFA 3MNCA 3SHAH 3U8OH 3TNTA 4IMQA 2ZHFH 4X2VA 1NT1A 3SN8A 3RXCA 1ABIH 4FVBA