1C2GA

Recruiting zinc to mediate potent, specific inhibition of serine proteases
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords TRYPSIN
publication title Design of potent selective zinc-mediated serine protease inhibitors.
pubmed doi rcsb
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c2gA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c2gA02
4SGBE 4CBNA 2DE8A 2FTLE 2XC4A 3PWCA 7GCHG 3R3GB 1UVPA 2FPZA 4OGYA 5EQRA 1HRTH 2ZPQA 4AFSA 5L2ZH 1CBWB 3KQDA 4ZKOU 1C5UA 1HAOH 5C1XA 3E90B 1ZGVA 1ZRKA 8GCHF 1A5GH 1M9UA 1H8IH 4I8GA 1EZXC 3MH6A 2AIQA 4K8YA 3M7QA 4JCNA 1P0SH 1GHXH 5A8YA 2ZECA 1L1GA 1ZPBA 2PGBB 2ILNA 1Z6JH 5E8EH 3TITA 2XTTB 3KQBA 1P9SA 1O3DA 1SHYA 1T4UH 4XDEA 2J4IA 2XRCA 1O32A 1QURH 3LU9B 4B75A 1C5ZB 2P3TB 2ANMH 3B8JA 1SL3A 3M7UA 2OC8A 3T29A 3ZV9A 4IGDA 1MUEB 4QT8C 3SI3H 4HTCH 2SGAA 3MYWA 1ANDA 5EODA 3RM0H 1Y3YA 1FMGA 2F3CE 3QUMP 4BANB 1DXPA 1HJAB 1IQKA 2ZIQH 3ZZ3A 2G55A 3L33A 2EI6A 3A8AA 2GCTC 4Q7YA 1AN1E 1SC8U 2XC0A 3AAUA 4IW4E 2XCNA 2WUBA 1W10U 2Z3CA 2GV6A 2QXIA 5A2MH 2EA3A 1O31A 1C5NH 4UDWH 1E0FD 1F7ZA 1SVPA 2A7HA 1PPGE 4YLQH 4IN2A 2XWBI 4IMZA 1SPJA 1VZQH 1SLUB 1ETRH 2Y82A 2Y5GA 3EGKH 1ZOMA 5HMAA 2GD4B 2ZHFH 3RXFA 1K1MA 1GJ9B 1NU9A 3D65E 4NZLA 1DX5M 4GCHF 2VGCB 3PLPA 1W11U 3BSQA 2ZGXH 4UONA 1ACBE 4ZROA 1BTWA 3MH4A 2A4OA 4CRDA 2ULLA 2BD2A 1O2LA 1BHXB 1FY1A 3ATMA 1DXWA 1UTJA 1QBNA 3K6ZA 5AFYH 2FODA 1NRPH 4WJG2 1BTYA 3HK6B 1GDNA 1SMFE 2BM2A 3BEFB 1P01A 3FP7E 4BOHA 1C2GA 1CQQA 1S82A 5G4BA 1OP0A 2RDLA 1GI9B 1C1TA 1P2NA 1O0DH 1JXPA 4INKA 2A31A 2PUXB 3A7TA 3MU8A 1IQNA 3TK5A 1O3HA 4I8KA 1C1PA 1WU1A 1EOLA 3M35A 3RC4A 1IQIA 2Z9KA 3QN7A 4NFEA 1F5LA 1XUHA 1UO6A 1YF4A 1O36A 3RXTA 4FU8A 3PV4A 2G8TA 1QR3E 3VEQB 2JH5D 2ZI2H 3SHCH 3A82A 3PMJA 4O3TA 4OS1A 1V3XA 1O3NA 4I8LA 1GBDA 1UK3A 4R8TB 2OQ5A 5C5NA 1C2HA 1FI8A 4GPGA 1E34B 2FM2A 1MZAA 2G51A 4OS4A 3VB7A 1V2WT 3MTYA 1LVMA 1CGHA 4YO9A 1ELEE 4Y8ZA 2QN5T 1GI3A 2P59A 5HXFA 1TNLA 3QK1A 1TPOA 3LC5A 1PFXC 5TJXA 1QJ1B 1DSTA 1G36A 3E91A 1GI8B 1C4Y2 3ODFA 1XKBC 1PQAA 1ELGA 4FUJA 2VWMA 2GV7A 1LPKB 1TGNA 2F91A 1OPHB 2QF0A 5EU8A 1TRNA 3LGWA 2AMQA 2R2MB 3ATWA 1QTFA 3PLBA 3DHKH 3KCGH 2A4GA 1RTLA 5JBAS 2BOKA 1O2YA 2WPHS 2UWLA 4AZ2B 1A4WH 2YNBA 1XUKA 1V2VT 2FX4A 1DFPA 1WV7H 2DE9A 3TVJB 5A8ZA 1NFUA 1SLWB 1HXEH 1ZLRA 3ZVBA 3RXVA 4JYUH 1HAVA 2FYQA 2GVFA 5GJ4B 1AKSA 4X8SH 1N8OC 3TNSA 1RFNA 2CF9H 3SV8A 2ODQA 1UTMA 1C2IA 3CENA 1TMBH 1TPAE 5DP7A 2WPIS 5ABWA 1FIZA 1DDJA 3T62A 2Z7FE 4YTAA 3RXUA 4B76A 2DUCA 4CRAA 3DA9B 3P8NA 3VFEA 1TRYA 2R9PA 4BTUB 1KIGH 1GL1A 4ABEA 1ZMLA 5DP6A 4B73A 3SU5A 2ZFQH 1UCYK 1D6RA 3ATIA 4H6SB 4BNRA 4CRBA 3VPKA 1OP8A 1K21H 1E36B 1O3AA 1GVKB 3T25A 2ZDKA 4NZQA 2GMTB 3OU0A 4ZXXH 4JK6A 1FUJA 4Y6DA 1G2LA 4LXBH 1GBBA 1MKWK 3LC3A 5FPYA 1ZR0A 3SNAA 4WVPE 5EPNA 3UQVA 1IQLA 1K1NA 2AGEX 1INCA 4DVAU 4IMQA 1RJXB 1YP9A 1TFXA 1YPEH 3GY7A 3RMNH 1GHAG 1LPGB 3M3TA 4A6LA 1D3TB 1LQEA 1C5MD 2VIWA 4DCDA 1YCPH 1MKXK 1C1SA 3SGAE 2BDIA 2BTCE 3Q77A 4X1QU 1EAIA 1TA2A 1TMUH 2WV4A 2FESH 4MDSA 1BCUH 1GWAA 1VR1H 4Y79A 1DLEA 1MTNB 5C1UA 2FEQH 1GJ4H 4TPYA 5GDSH 2I6QA 4AG1A 4K69A 1JRTA 5T3HA 1SGTA 4NG9H 4O9VA 1H9IE 2AIPA 2GCHF 3A7XA 1O2PA 1OWDA 3B9FH 3TK9A 2TGAA 4Y76A 2P93A 5GCHF 2AERH 2FS8A 3GY8A 4K60A 4TYDA 8KME2 2JETB 1SGFG 3SOSA 1NTPA 2Z9GA 1FN8A 1DSUA 2BY8X 2Q6GA 1KLJH 1EB1H 4WH8A 1TX8A 2GDEH 2J38A 3E3TA 4MPUA 2R3YA 4D9RA 1QRWA 3GY3A 1TA6A 2PW8H 1V2MT 2STAE 5ESTE 4D7FA 1GMHF 1E38B 8LPRA 3P8FA 5C20A 1O5CB 3E1XB 1NT1A 2XBXA 3PO1C 1F0TA 4YOIA 2CHAB 2HPQH 2OP9A 1CT0E 1YLDA 1P57B 4DIIH 2FP7B 2NU3E 1O34A 2STBE 3A86A 1KYNA 5CMXH 1QJ7B 1Y3UA 3L3TA 1CT4E 1LHGH 4CR9A 1P05A 2KAIB 1SLXB 2V6NA 2UUFB 5LPEA 3L6PA 3BG4B 1QRXA 1IOEA 4VGCB 4AFZA 2V0BA 5EXNA 1A7SA 2ODPA 2A7JA 2Z3DA 1DITH 1V2JT 1S6HA 2OD3B 3TH3H 1NC6A 2G4UA 2ZDLA 1H1BA 1ZJDA 1P2OA 3MNXA 5EQSA 2SNWA 1O3BA 1WUNH 4IBLH 1G32B 1QRZA 1P8VC 3HK3B 5A09A 1TB6H 1TE0A 2OC1A 1NN6A 1HXFH 3VXEH 4J2YB 2J2UA 2O8WA 4NA9H 2BVXH 3S9AA 4XSKU 3STJA 3LH1A 1WQVH 2BHGA 3MFJA 2AMPA 1O37A 4U32A 2NU1E 4IC5A 1RS0A 1ZSJA 3RXOA 3SJIA 1JBUH 2BLOA 1TOMH 4ISHH 1HJ8A 1C1QA 2R0KA 1GHZA 1UCYE 3SJOA 3ZZ4A 2P94A 5C3NA 2QXJA 2Y6TA 4OS7A 3R0FA 2A5KA 1OYQA 1F2SE 1EP5A 1C1RA 1V2PT 2HWLB 4I31A 5TCAA 4FUCA 5T6FA 2PUQH 1SGQE 1KTTB 3RXLA 2O8TA 3O8CA 3UY9A 4D9QA 3FP8E 1K1IA 5JPMH 1O3CA 3N7OA 5A0AE 1P2KA 3U98H 3O8BA 2IPHA 4B74A 3ZVCA 4RN6A 1NRNH 2B5TB 1HFDA 4B2BA 1FIWA 3NZIA 2XXLA 1EX3A 1GHBG 1HIAB 1ZTLA 2BLVA 2BY5X 1HAXB 3OYPA 2VH0A 1BBRH 2SNVA 3GDUA 4KP0A 4MNXA 4X2VA 3F9EA 3QGJA 1JIRA 1O2XA 1O2OA 1JWTA 1PPCE 4WF8A 1GI4A 2QIQA 4D7GA 2FI4E 1MU6B 2FS9A 2PFEA 3NWUA 3RLWH 1C4V2 5J4QA 1GBIA 5EW2H 3U8RH 2UWOA 2ANWA 4ZXYH 1OXGA 3TJUA 2WV5A 2QC2A 1BZXE 5HM9A 1MTSA 4FUEA 2C8WB 5SGAE 2F83A 2J94A 1GI7B 2WINI 3OTJE 2QGRA 2Y7XA 4F49A 1SGIB 2TIOA 1A5IA 4ZKSU 2C8XB 4YESB 1DLKB 4X1PU 4X2XA 4BXWA 4JMYA 2GT7A 4YLUA 2IJOB 2ZZUH 3E6PH 4CREA 3GOVB 4ABDA 1ELCA 1K28D 4YT7H 4M7GA 1WBGB 3RXAA 1YPGH 2VH6A 3EDXB 5CHAC 1GMDG 3A8DA 1UVTH 1L1NA 1GCTB 4BAKB 1SOTA 1PYTC 3SO3A 1P04A 1UTPA 1EXFA 3SUGA 1A1RA 2W3IA 1A0LA 1W2KH 3GCHC 3NUMA 3NCLA 3P6ZB 2WUCA 3M3VA 4OGXA 3TIUA 5FPSA 1ELBA 3V7TA 3MI4A 1O2JA 5DPAA 1OYTH 3A84A 1KDQA 4GVUA 1SFIA 5DGJA 3A83A 1CSOE 5I46H 3RXRA 3MU5A 2A4RA 1SGRE 1Y59T 3MU4A 1TONA 1V2QT 4K2YA 3GY6A 1YPJH 2ZU4A 1O2SA 1WTHD 2NU4E 4FUFA 2ZA5A 1IQMA 3QDZB 1HBTH 3SNDA 5L2YH 1G9IE 2EI7A 3T26A 1SBWA 2IN2A 4THNH 2HALA 4ZAEA 2V3HH 3GCTG 3RXPA 1GG6B 1NRSH 4MVNA 2ZU5A 3QX5H 1XUGA 2PKSC 2EI8A 1PPZA 4JZ1A 4B2CA 2OQUA 3RXMA 1CA0C 3ZZCA 1K1LA 1BJUA 1GPZA 1T31A 2PV9B 1TWXB 2A2XH 1UVUH 3SQEE 1PQ7A 1ZZZA 3PTBA 5AVDA 4ZKNU 1C1OA 1MH0A 1UTNA 4I7YH 1NM6A 3LT3A 3A7YA 1GDQA 3E8LA 2Q1JA 1C5PA 1C5XB 1ELVA 3A7WA 3F6UH 3UOUA 1V2NT 1OP2A 1KXEA 5JB8S 3P8GA 1NO9H 1DT2A 1FONA 4CHAC 4CH2B 1AUJA 4KTUA 1SQAA 3T27A 1CHOF 3C1KA 4XFQA 1RIWB 3ZZ5A 1LPZB 3EA9A 5EXMA 2FOEA 1ZTJA 2BVSH 2YOLA 3CP7A 3S69A 3K6YA 5GIBA 1U6QA 2P8OB 3OY5U 1C5OH 3A89A 1BT7A 1CBWC 2ANYA 4ZUHA 1LTOA 2ZGBH 2OUAA 1TQ0B 2XW9A 4HZHA 2NU2E 1BMAA 2FMJA 1ANEA 2R0LA 3BTDE 1AQ7A 4OS2A 4H6TA 4BTTB 2BQ6B 5LGOA 5LPRA 5BPEA 4KELA 1TAWA 2HNTC 1J14A 1Y3XA 1RGQA 1GI2A 2UUKB 4K3JA 1QB9A 3TJNA 1EPTA 4ABGA 2AGGX 1NRRH 1QIXB 1O2GH 1KSNA 1F0UA 1O2NA 1P11E 1MAYA 1GBFA 1WYKA 5JBBS 4Y10E 2JH6D 3F9HA 4LZ1H 2LPRA 8ESTE 2GX4A 2ANKH 3GICB 2UUJB 1KXAA 3U1JB 3BTKE 2ZO3H 3UREA 3UUZA 1NFWA 1Z8JB 3VGCC 4E06H 2FOFA 1VJAU 1W13U 1OS8A 1C5WB 4NGAH 5TCCA 3RMMH 1P12E 2W3KA 3RXHA 2VVUA 1SR5C 1BDAA 2GDDA 2ZKSA 2FOMB 1QCPA 4JZIA 1TPPA 2Z9JA 1IQGA 2ZHQH 3LIWA 4MLFB 4X6PA 5FX6A 1YPHE 3QZRA 3ZZ8A 2ZNKH 2OC7A 1LHFH 1V6DA 2TGTA 4ZH8A 3ZV8A 2ZF0H 5CE1A 3MHWU 3LPRA 3SJ9A 4FUBA 1N1LA 3UQOA 1FN6A 4JYVH 1TLDA 2BLWA 1SGPE 1ELDE 1AIXH 2F9NA 3LJOA 1FY4A 1GJ7B 3WY8A 4CH8B 2K1QA 2XBWA 3MNSA 1J9CH 1HAPH 1BBRE 2ZCLP 1G30B 1E37B 1NPMA 4I8JA 1C2FA 3Q3YA 7GCHF 3URDA 1TX7A 4KTSA 2G52A 2ZFFH 1UHBB 5GXPA 1W7GH 3KHVA 3F9GA 2XNIA 1VGCB 3MH7A 5F8ZA 1ELAA 1C5SA 3PMHB 4Y7AA 4E05H 1BMNH 3ZZ6A 2FOCA 2A1DB 3UR6A 1ELTA 2BMGB 1W3CA 1XVMA 1GVZA 2CMYA 2PGQB 4Z6AH 1L4DA 3UOPA 5DP8A 5LPFA 1Z7KA 1FJSA 1FLEE 1YPLH 3FAOA 2PLXA 6GCHG 3BTQE 5AFZH 3RXSA 1C1NA 1O2VA 2H9EH 4ZHLU 1OKXA 1C9PA 2HNTF 2BZ6H 1H9HE 5IYTA 3SV2H 2QCYA 4UEHH 2SFAA 1EQ9A 2SGQE 1ZSLA 1JMOH 3SNBA 1EZUC 1S81A 4NA7A 1ABJH 4Y11E 3SZNA 1TQ7B 2SGFE 1MMJN 4PROA 1P10A 2G4TA 1O2WA 3GDVA 4YOJA 1TABE 2A2QH 3UTUH 2CV3A 4DOQA 2FIRH 3AVZA 4GAWA 5DP5A 3ITIA 2TGDA 1FQ3A 4WXIA 1MD8A 1J16A 1K9OE 5F8XA 5T6GA 1DANH 1Q3XA 3TH4H 5L6NH 4O3UA 1QNJA 4AFQA 4X1RU 3ZVGA 2ZG0H 3IWMA 3P70B 1SHHB 2D2DA 3RMLH 2H2ZA 1SSXA 3QLPH 1YGCH 3U69H 1GI6A 1IQHA 2Y7ZA 5T6DA 1IHTH 2PTNA 2ZC9H 1MBQA 3BF6H 3UNQA 3UWJH 5F8TA 5E0JA 2P16A 1H4WA 5DK1A 1QGFA 2NWNA 1PJPA 2FYRA 1WSSH 1ESBA 3P17H 3M36A 3MOCA 1UJ1A 1YPHC 1ZSKA 4NSYA 1O5EH 1TGCA 2BXUH 1F92A 1O3GA 2J9NA 1LVOA 1S83A 3UIRA 2HLCA 4AB8A 3S7HB 1BTXA 2VNTA 4A1TA 1C2JA 1DWCH 3LONA 5HM2A 1DWBH 1DWDH 3GY4A 4MPXA 2VINA 3TPIZ 4ABFA 4CRGA 3SUDA 2W7SA 3RC6A 1AGJA 2ZGHA 1Z6EA 1KLIH 3GISB 1AD8H 1BMMH 1ZGIA 4ABBA 3KNXA 1O3OA 4FU9A 4ISIH 2H9HA 1D6WA 2BDCA 3UWIA 1AB9C 1EZQA 3P92A 1PQ8A 4JYTA 3KGPA 2BY6X 1RRKA 3IITA 2BYAX 2ZDAH 1Y8TA 5E2OA 1YPMH 4UE7H 2GZ9A 1BA8B 3ENSB 1MD7A 1GBKA 3TU7H 2W5EA 1F5RA 6CHAB 3SBKA 1P3EA 1W0ZU 4JZEH 1BRUP 3ZYEA 4GHQA 4A7IB 3FP6E 1SGNE 2A5AA 1HAZB 3PO1B 3A80A 1O3FA 3FANA 3S7KB 2F9OA 2H9TH 5C67A 1T8OA 2ZGCA 1YM0A 1C2LA 3BTME 2C93B 1EJAA 1GJ6A 5E0GA 1MTNC 2PHBA 1VITG 3VB6A 4BAMB 3M61U 1AWHB 3ZZ9A 4UD9H 5LH8A 3E0PB 2TBSA 1PPFE 2ZCHP 4BAHB 3LGIA 1W8BH 1BRBE 1XUFA 4AG2A 3FZDA 4Q80A 1Y5AT 3DT0H 1V2TT 3MH5A 4HGCA 1BIOA 4Y0ZE 4WMEA 4Y0YE 4AX9H 1RTKA 4UFFH 5JBCS 1YCPK 3PWBA 3BEIB 5JB9S 2Y80A 1WCZA 2BD3A 4INLA 1J8AA 3ZZ7A 3BTGE 1P9UA 3PROA 1GGDB 3DFJA 1GBHA 1SGFA 2A4QA 3U9AH 2G00A 4GHTA 4WMDA 2A0QB 2CXVA 3E16B 4H42U 1HAHH 5DP3A 4A5TS 1G3EA 3FVFB 1GHYH 3UR9A 2FDAA 2H5CA 3F1SB 2FX6A 1FV9A 3BTTE 4RSPA 4Q7ZA 2VIDA 4FVBA 3AW0A 1SGYE 3ESTA 2ZFTA 2ZDVH 3KL6A 5JYIA 2C3SA 1K1JA 2FZZA 2ZPSA 1UMAH 4MNYA 3H7OA 1AFEH 1ARCA 2XBYA 3HKIB 3M37A 2ASUB 1TYNA 5GWZA 3LOXA 2O8UA 3SU0A 3BG4C 4TY7A 1L2EA 1EB2A 4AYVB 3HATH 3FFGA 2EEKA 1GHAF 2Y5FA 2Z94A 1SLVB 1UTOA 3RXKA 1IQJA 1OWKA 4FU7A 1ZJKA 2CGAA 1C5TA 2JH0D 1PPEE 1SFQB 1HV7A 2BQ7B 3FZZA 3RXEA 1T8MA 5EGMA 5FCKA 1O38A 3RP2A 4FVDA 1MU8B 4LZ4B 2VJ1A 1PPBH 5E2PA 2ZU1A 3NXPA 1GMCG 1O35A 1P03A 2KAIA 2NU0E 2XBVA 4X6OA 3E0NB 2H6MA 3GDSA 1KXCA 2CF8H 2HGTH 1THPB 1ZHRA 2PWXA 1GVLA 2BQWB 1AE8H 3STIA 1O3MA 1MQ6A 4A1VA 2VU8E 2LNCA 3JZ1B 1A3BH 1TNIA 3RMOH 1BTPA 1L1JA 3G01A 4MQAA 5FBEA 1AZZA 3ZVAA 1FNIA 2QY0B 2WYJA 3GYMA 3T5FH 2F9VA 1DWEH 1THRH 4NIWA 4BTIB 2Y5HA 1NRQH 1EZSC 1FPCH 2OC0A 2W26A 1TPSA 3EE0B 1P2IA 3ZVDA 1O39A 3RXDA 8GCHG 4B2AA 2P3UB 1VCWA 2FOGA 2OINA 1AFQB 1WTGH 2F9BH 1O3JA 1XM1A 2BOHB 2HNTE 1C5LH 2FTMA 3I29A 1O5DH 3QZQA 1AE5A 2A5IA 1GI0A 2FOHA 3W95A 3MNCA 3O8DA 3VB3A 1MAXA 4DJZB 3HGNA 2ZWLH 1XUIA 1ZTKA 4NIXA 1A5HA 4R0IA 1AUTC 2ESTE 1LKBA 1QA0A 2WPLS 4KGAA 2M5TA 1TOCB 1Z1IA 1EAUA 1VITH 3M5NA 1GL0E 1KXFA 1C4U2 1L0ZA 4BAQB 5IDKA 2B7DH 2EC9H 1SOZA 3H7TA 3V3MA 4NCYA 1YCPM 1HIAA 1FDPA 2THFB 3RU4E 4BXSA 3D49H 5FPTA 1ESTA 1IAUA 2Z9IA 1FAXA 3O8RA 1BBRK 4ABHA 3MMGA 1O2HA 3EAJA 3ZYDA 2ZQ1A 5L30H 2RG3A 3DD2H 2G81E 4DW2U 1LHEH 3GCOA 1W12U 2ZFPH 1ID5H 4DIHH 2BLQA 1KY9A 2J95A 3U8OH 3M5OA 2R2WU 2AMDA 2BB4A 3SV9A 2ZQ2A 1HYLA 2PKSB 4GCHG 4UFEH 1E35B 1QY6A 5DP9A 1XMNB 1GCTC 2R3UA 4AOQA 1OWHA 4O03A 1O33A 1EKBB 6ESTA 4E7RG 2BVRH 3SU4A 1BTUA 5BRRE 6LPRA 2BD7A 2QF3A 3RXJA 1HAGE 1O2TA 1K2I1 3SU6A 4Q7XA 1F0SA 3D62A 1RXPA 1G2MA 2RA3A 1AO5A 1TIOA 1S6FA 2VVCA 4X1NU 3ZZBA 4FUHA 2A32A 1S84A 1P06A 4NA8A 1BMLA 4OS6A 1EAXA 2TPIZ 2VWNA 2C4FH 4MG3A 1S85A 1O3IA 3PB1E 1DM4B 4A1XA 2CN0H 4CHAB 5HYOA 4XBBA 2BXTH 1T8NA 3NPSA 3MO9A 1O5GH 5AHGH 4GUXA 1OWJA 4AYYB 3M7TA 1HB0B 1FY8E 2ZFSA 2B0FA 2PSXA 1ABIH 4YZUA 5EOKA 1WAYB 1XX9A 1GG6C 3D23A 1AWFH 1TMTH 1EPTC 4ISNA 3CS0A 1C2EA 2AYWA 2AGIX 4IS5A 2GCTB 2O8MA 4TPIZ 4TWYA 3MNBA 1O2QA 3TGJE 3HPTB 4UFDH 1GBEA 1ESAA 1CA8B 3NK8A 1ARBA 1SQTA 4X0WU 3SORA 1PYTD 1O2UA 1SG8B 3ZZDA 1JRSA 1NESE 2BZAA 3RUOA 3SNEA 1XXDA 3A8CA 1B0FA 1P2MA 4FUGA 3AAVA 1EJMA 3H5CB 4Y8XA 1AI8H 1O2RA 2OBQA 2BDHA 1S0QA 1F5KU 1DUAA 2VIVA 4O97A 5C5OA 1HDTH 1V2RT 4ABAA 1FXYA 2SGPE 3RLYH 1RIWC 3GCNA 3SGBE 3RDZA 1GMDF 1T7CA 3VGCB 1NZQH 3BTHE 9LPRA 2P8OC 5DJ7A 2O8LA 2VB0A 5FCRA 3LDXH 1ANCA 1HJAC 3QWCH 4AGKA 3RC5A 1YYY1 4MPVA 5A8XA 1V2LT 3QTOH 1GJ8B 2OTVA 3V12A 4KTCA 1AZ8A 1O3EA 3SU1A 1AHTH 1UVSH 4FXGH 3V13A 3SI4H 3PTNA 1EJNA 2H1UA 4HI3A 2P95A 4F4OC 2CJIA 3S0NA 4U01A 1TGBA 1A0JA 1NFXA 1O5AB 1ANBA 3URCA 3CS7A 2GTBA 1VCPA 3C27B 4K1TA 3TH2H 4A92A 1TGSZ 2VIPA 1IQFA 3TNTA 2ZTZA 3KIDU 1XVOA 3K9XB 1D3DB 4H4FA 5I25A 1FPHH 2G5VA 3BN9A 3GCTF 1AMHA 3M5LA 2G5NA 1O3LA 4AFUA 3A87A 3PM3A 5DP4A 2VGCC 2ZP0H 1K1OA 1MTUA 1TNGA 1FY5A 1EOJA 1B7XB 1Q2WA 2QV1A 4J1YA 1MQ5A 3LGTA 3OSYA 1UTLM 3TGKE 2XC5A 1DVAH 5EW1H 1O3PB 4IN1A 2FLRH 3ATLA 1GBTA 1FZZA 4K8BA 3SU2A 1GDUA 1MTVA 1TNKA 2GT8A 3SJKA 2VWOA 1GBMA 1PPHE 4DG4A 1YC0A 2BD5A 1HLTH 1D3QB 1HAVB 1ZPCA 4FUDA 1AKSB 4ZMAH 3QGNB 4SGAE 4ABIA 1LKAA 1MTWA 1Y3VA 1IHSH 5B6OA 2QXHA 1C1WH 1TBRH 2BDBA 3PYHA 2GCHG 3BTEE 3SGQE 5EXLA 1MCVA 1GBJA 1S5SA 1UCYH 1SQOA 2WYGA 4ZHAA 1C2KA 1BJVA 1NY22 1ETSH 2XYAA 3W94A 1NROH 5GCHG 2F9UA 2VWLA 4X8TH 1YPKH 1MKWH 1J15A 1HUTH 1PQ5A 4BAOB 1VGCC 1BRCE 4LOYH 5FHTA 3TK6A 1C5QA 3S9CA 3A81A 1WQSA 2FO9A 2JKHA 1N8OB 2Z3EA 5C1YA 4NSVA 2BD4A 4X8UH 3V0XA 1GMHG 1MKXH 1RTFB 2BDGA 2ZU3A 3RU4D 3U8TH 3ZVFA 4AN7A 2C8YB 4Y7BA 2W7UA 2AFQB 3LKWA 4INHA 2ZTYA 1DY8A 1QJ6B 1GHWH 1TGTA 5H4IB 2Q6DA 4ASHA 1GBLA 3MO6A 1O5BB 1UHBA 3SV6A 1K22H 3I78A 1QFKH 3NKKA 1AVXA 1VCQA 1B0EA 1A0HB 1Z71A 3HKJB 2HPPH 3LGUA 4X8VH 1HGTH 4DT7B 3Q3XA 1TBZH 1GJDB 2BD8A 3EYDA 3GYLB 4ESTE 1C9TA 1TNHA 5K7RA 4I8HA 1T32A 1QA7A 1QBOA 4XOJA 2UUYA 1GJAB 3QTVH 3S9BA 1BOQA 2ALPA 1KXDA 3P95A 4DY7B 1QB6A 1C2MA 4AORA 4CRFA 1P2QA 2C8ZB 1ZMNA 2Y81A 4HFPB 4GLYA 1EUFA 1LDTT 2ZHEH 1TALA 4OS5A 5K0HA 2VVVA 3PLKA 4FUIA 3KQEA 3KF2A 3SNCA 2WPKS 5C2ZA 4X2YA 2AEIH 3SU3A 4K1SA 2SGEE 2PTCE 4ISLA 1BHXF 1NS3A 4ISOA 2QXGA 1ZYOA 1AB9B 1LHDH 4JK5A 1GJBB 1VJ9U 1O2IA 3SUFA 2I6SA 3T2NA 1EP6A 3EQ0H 1D3PB 1C1MA 2GMTC 3ZVEA 4B71A 2HRVA 1P02A 1C5YB 1G3DA 3B23B 3MWIU 3ZZAA 1Y5BT 2FWWA 3MU0A 3KEEA 4MTBA 3UPEA 4NIYA 4UFGH 1BTHH 2H5DA 1CGIE 1P3CA 1DUEA 1Z8GA 1W14U 2J92A 1LHCH 4JZFH 2BY9X 1Z1JA 3MO3A 2VIQA 2FI3E 1GI1A 2ODYB 2V35A 2P3FH 2OLGA 2FLBH 2HVXA 1J17T 3ATKA 3DFLA 3SHAH 4B1TA 2ZPRA 2ZGJA 2AH4X 3BV9B 1H8DH 2A7CA 3RXGA 1A2CH 1G37A 1L4ZA 2BDAA 2PSYA 1NU7B 3BTFE 6GCHF 1CHGA 4RKOB 1O2ZA 3PMBB 3GY2A 2BDYA 1OOKB 7ESTE 2Z9LA 5ESBA 1P2JA 2ZDNA 1BB0B 1UTKA 2GZ8A 2ZHWH 4MNVA 2Z6BD 2Q6FA 1O2MA 5DG6A 5FAHA 1JOUB 1OWEA 3Q3KA 4YT6H 2B8OH 5FX5A 4ZKRU 5A0CA 6CHAC 4AGJA 1ELFA 2JETC 4TWWA 1HCGA 3DUXH 1GBCA 4WY3A 1CO7E 4MPWA 1Z8IB 1A46H 3K2UA 1CGJE 2BY7X 1V2OT 1XXFA 2ZFRH 1OSSA 4E7NA 5J4SA 3RXIA 3RXBA 1HNEE 3RXQA 1P09A 7LPRA 1XKAC 5EPYA 1BITA 4DGJA 4D76A 2OXSA 4NFFA 4ZHMU 2GP9B 3OY6U 2FOAA 1HAYB 1KXBA 1D4PB 5JBTA 2CHAC 1A3EH 3SUEA 1SB1H 1BQYA 2ALVA 3ELAH 1N6XA 4X6MA 1AVWA 1V2UT 5JDUB 1NFYA 1QQUA 7KMEH 2A45B 2PR3A 3HGPA 1LCYA 2PKAB 1LMWB 3BG8A 4NWLA 1V2KT 1MBMA 1CE5A 5EG4A 1QHRB 4NWKA 3UNRA 4XBCA 4I33A 1GJCB 1GGDC 4X6NA 2IOTA 1FAKH 2FOBA 4VGCC 2RCEA 3LGYA 5ETXA 1K1PA 1Z8RA 1IQEA 2BX4A 4Y71A 2QAAA 3OX7U 3A7VA 1C1VH 3UFAA 1EAWA 1DY9A 2BD9A 4NIVA 4WMFA 1Y5UT 1Q31A 1AVGH 1QBVH 3ODDA 1CVWH 4K5ZA 1UVOA 4ABJA 3BIVH 1DPOA 5DKMA 1C5VA 4Z0KA 1BTZA 3Q00A 1OX1A 3T28A 3TJOA 1A61H 1TBQH 2RA0A 4AB9A 1GCDA 1QQ4A 3TGIE 1BRAA 1O3KA 4MNWA 4WXVA 4K1EA 2XCFA 1LVYA 3F9FA 1ZMJA 1W0YH 2D26C 1C2DA 1W7XH 2ZEBA 1ZHMA 3P8OA 1OWIA 3LGVA 1KTSB 3SQHE 4X2WA 3TLOA 2ZHDA 2V3OH 2QA9E 2GKVE 2D1JA 1BUIA 2C90B 2WPMS 1YLCA 1C5RA 2J34A 2PKAA 2VIOA 3AW1A 3BIUH 4IC6A 1G3CA 1SGDE 2GGVB 1VITF 3RU4T 1O30A 1Y3WA 5A0BA 1KLTA 3SJ8A 1N6YA 3UNSA 5DO4H 2TGPZ 4XBDA 2GZ7A 4YOGA 1KDQB 1HJ9A 1GHVH 1EASA 3A85A 4Y8YA 1CHOG 3RM2H 1UK2A 3Q76A 5CHAB 3SW2B 1ORFA 1DS2E 2ZCKP 3A7ZA 3RXCA 1TNJA 5EQQA 3EA7A 1H9LB 2OCVB 4CRCA 3GCHB 3QO6A 5E0HA 1XUJA 1D9IA 1YKTA 1LQDB 1LVBA 1SGCA 1ZRBA 1ZPZA 2BX3A 3A8BA 1S0RA 3KQCA 4Q2KA 4KKDA 3I77A 1DICA 5AF9H 1T4VH 3VB4A 3KN2A 1AFQC 1LO6A 1QL7A 1X7AC 1SGEE 1JIMA 2YNAA 1QB1A 2ZDMA 4U30A 1MZDA 3EA8A 1HAIH 2OBOA 1B5GH 4YM9A 5HGGA 2XWAA 1WOFA 4TY6A 2QYIA 1AY6H 3SV7A 2B9LA 1UTQA 1EATA 1O2KA 1YBWA 1DE7H 3M5MA 1GJ5H 3GY5A 3U1IB 2TRMA 1G3BA 4X1SU 5F03A 3MU1A 1AU8A 5PTPA 5FXLA 2F9PA 2ZU2A 2FXRA 1T8LA 4LK4A 4I32A 3SN8A 1CA0B 1GI5A 3BEUA 3BTWE 5GPIB 2FI5E 1QL9A 1O5FH 2D8WA 1ETTH 1FY3A 3IG6B 1MCTA 3LJJA 4JZDH 1THSH 4DURA 3A88A 1DOJA 1HPGA 3K65B 1SI5H 1TX6A 1TRMA 2ZTXA 1RD3B 1UK4A 1GBAA 1GMCF 1CU1A 4RKJB 5F6MA 3AASA 4XE4A 2SGDE 3VXFH 4GSOA 1V2ST 4WH6A 2WPJS 2HOBA 3LH3A 3JZ2B 2AS9A 4CBOA 4WWYA 2UWPA 3M3SA 4D8NA 4U2WA 4CR5A 1GHBF 1ZHPA 2O9QA 1CT2E 1QL8A 3TJVA 3VB5A 9ESTA 1C1UH 1EPTB 3PMAB 3F68H 5FBIA 1F0RA
chains in the Genus database with same CATH superfamily
4SGBE 4CBNA 2DE8A 2FTLE 2XC4A 3PWCA 7GCHG 3R3GB 1UVPA 2FPZA 4OGYA 5EQRA 1HRTH 2ZPQA 4AFSA 5L2ZH 1CBWB 3KQDA 4ZKOU 1C5UA 1HAOH 5C1XA 3E90B 1ZGVA 1ZRKA 8GCHF 1A5GH 1M9UA 1H8IH 4I8GA 1EZXC 3MH6A 2AIQA 4K8YA 3M7QA 4JCNA 1P0SH 1GHXH 5A8YA 2ZECA 1L1GA 1ZPBA 2PGBB 2ILNA 1Z6JH 5E8EH 3TITA 2XTTB 3KQBA 1P9SA 1O3DA 1SHYA 1H8ED 1T4UH 4XDEA 2J4IA 2XRCA 1O32A 1QURH 3LU9B 2K0QA 4B75A 1C5ZB 2P3TB 2ANMH 3B8JA 1SL3A 3M7UA 2OC8A 3T29A 3ZV9A 4IGDA 1MUEB 4QT8C 3SI3H 4HTCH 2SGAA 3MYWA 1ANDA 5EODA 3RM0H 1Y3YA 1FMGA 2F3CE 3QUMP 4BANB 1DXPA 1HJAB 1IQKA 2ZIQH 3ZZ3A 2G55A 3L33A 2EI6A 3A8AA 2GCTC 4Q7YA 1AN1E 1SC8U 2XC0A 3AAUA 4IW4E 2XCNA 2WUBA 1W10U 2Z3CA 3DSOA 2GV6A 2QXIA 5A2MH 2EA3A 3FKSD 5F53A 1O31A 1C5NH 4UDWH 1E0FD 1F7ZA 1SVPA 2A7HA 1PPGE 4YLQH 4IN2A 2XWBI 4IMZA 1SPJA 1VZQH 4XD7D 2EY4C 2JJ1D 1SLUB 1ETRH 2Y82A 2Y5GA 3EGKH 1ZOMA 3WWBA 5HMAA 2GD4B 2ZHFH 3RXFA 1K1MA 1GJ9B 1NU9A 3D65E 4NZLA 1DX5M 4GCHF 2VGCB 3PLPA 1W11U 3BSQA 2ZGXH 4UONA 1ACBE 4ZROA 1BTWA 3MH4A 2A4OA 4CRDA 2ULLA 2BD2A 1O2LA 1BHXB 1FY1A 3ATMA 1DXWA 1UTJA 1QBNA 3K6ZA 5AFYH 2FODA 1NRPH 4WJG2 1BTYA 3HK6B 1GDNA 1SMFE 2BM2A 1EFRD 3BEFB 1P01A 3FP7E 1W0KD 4BOHA 1C2GA 1CQQA 1S82A 2XNDD 5G4BA 1OP0A 3DSGA 2RDLA 1GI9B 1C1TA 1P2NA 1O0DH 1JXPA 4INKA 2A31A 2PUXB 3A7TA 3MU8A 1IQNA 3TK5A 1O3HA 4I8KA 1C1PA 1WU1A 1EOLA 3M35A 3RC4A 1IQIA 2Z9KA 3QN7A 4NFEA 1F5LA 1XUHA 1UO6A 1YF4A 4FOUC 1O36A 3RXTA 4FU8A 3PV4A 2G8TA 1QR3E 3VEQB 2F4LA 2V7QD 2JH5D 2ZI2H 3SHCH 3A82A 3PMJA 4O3TA 4OS1A 1V3XA 1O3NA 4I8LA 1GBDA 1UK3A 4R8TB 2OQ5A 5C5NA 1C2HA 3N7DA 1FI8A 4GPGA 1E34B 2FM2A 1MZAA 2G51A 4OS4A 3VB7A 1V2WT 3MTYA 1LVMA 1CGHA 4YO9A 1ELEE 2IJD1 4Y8ZA 2QN5T 5KEDA 1GI3A 2P59A 5HXFA 1TNLA 3QK1A 1TPOA 3LC5A 1PFXC 5TJXA 1QJ1B 1DSTA 1G36A 3E91A 1GI8B 1C4Y2 3ODFA 1XKBC 1PQAA 1ELGA 4FUJA 2VWMA 2GV7A 1LPKB 1TGNA 2F91A 1OPHB 2QF0A 2JDID 5EU8A 1TRNA 3LGWA 2AMQA 2R2MB 3ATWA 1QTFA 3PLBA 3DHKH 3KCGH 2A4GA 3F0PA 1RTLA 5JBAS 2BOKA 1O2YA 2WPHS 2UWLA 2YMSD 3KYFA 4AZ2B 1A4WH 2L74A 2QF5A 2YNBA 1XUKA 1V2VT 2FX4A 1DFPA 1WV7H 2DE9A 4TT3D 3TVJB 5A8ZA 1NFUA 1SLWB 1HXEH 1ZLRA 3ZVBA 5C0UA 3RXVA 4JYUH 1HAVA 2FYQA 2GVFA 5GJ4B 1AKSA 4X8SH 1N8OC 3TNSA 1RFNA 2CF9H 3SV8A 2ODQA 1UTMA 1C2IA 3CENA 1TMBH 1TPAE 5DP7A 2WPIS 5ABWA 1FIZA 4RT1A 1DDJA 3T62A 2Z7FE 2LP6A 4YTAA 3RXUA 4B76A 2DUCA 4CRAA 3DA9B 3P8NA 3VFEA 1TRYA 2R9PA 4BTUB 1KIGH 1GL1A 4ABEA 1ZMLA 5DP6A 4B73A 3SU5A 2ZFQH 1UCYK 1D6RA 3ATIA 4H6SB 4BNRA 4CRBA 3OAAD 3VPKA 1OP8A 1K21H 1E36B 1O3AA 1GVKB 3T25A 2ZDKA 4NZQA 2GMTB 3OU0A 4ZXXH 2RFKC 4JK6A 1FUJA 4Y6DA 1G2LA 4LXBH 1GBBA 1MKWK 3LC3A 5FPYA 1ZR0A 3SNAA 4WVPE 5EPNA 3UQVA 1IQLA 1K1NA 2AGEX 1INCA 4DVAU 4IMQA 1RJXB 1YP9A 1TFXA 1YPEH 3GY7A 3RMNH 1GHAG 1LPGB 3M3TA 4A6LA 1D3TB 1LQEA 1C5MD 2VIWA 4DCDA 1YCPH 1MKXK 1C1SA 4HG6A 2BDIA 2BTCE 3SGAE 3Q77A 4X1QU 1EAIA 1TA2A 1TMUH 2WV4A 4Z1MD 2FESH 4MDSA 1BCUH 1GWAA 1VR1H 4Y79A 1DLEA 3OEHD 1MTNB 5C1UA 2FEQH 1GJ4H 4TPYA 5GDSH 2I6QA 4AG1A 4K69A 1JRTA 3OE7D 5T3HA 1SGTA 4NG9H 2L6OA 4O9VA 1H9IE 2AIPA 2GCHF 3A7XA 1O2PA 1OWDA 3B9FH 3TK9A 2TGAA 4Y76A 2P93A 5DSFA 5GNDA 5GCHF 2AERH 2FS8A 2LELA 3GY8A 4K60A 4TYDA 8KME2 2JETB 1SGFG 3SOSA 1NTPA 2Z9GA 1FN8A 1DSUA 5EJLA 2BY8X 2Q6GA 1KLJH 1EB1H 4WH8A 1TX8A 2GDEH 2J38A 3E3TA 4MPUA 2R3YA 4D9RA 1QRWA 3GY3A 3FO8D 1TA6A 2PW8H 1V2MT 2STAE 5ESTE 4D7FA 1GMHF 1E38B 4OM9A 8LPRA 3P8FA 5C20A 1O5CB 3E1XB 1NT1A 2XBXA 3PO1C 1F0TA 4P02A 4YOIA 2CHAB 2HPQH 1BMFD 1CT0E 2OP9A 1YLDA 1P57B 4DIIH 2FP7B 2NU3E 1O34A 2STBE 3A86A 1KYNA 5CMXH 1QJ7B 1Y3UA 3L3TA 1CT4E 1LHGH 4CR9A 1P05A 2KAIB 1SLXB 2V6NA 2UUFB 5LPEA 3L6PA 3BG4B 1QRXA 1IOEA 4VGCB 4AFZA 2V0BA 5EXNA 1A7SA 2ODPA 2A7JA 2Z3DA 1DITH 1V2JT 1S6HA 2OD3B 3TH3H 1NC6A 2QE7D 2G4UA 2ZDLA 1H1BA 1ZJDA 1P2OA 3MNXA 5EQSA 2SNWA 1O3BA 1WUNH 1W0JD 4IBLH 1G32B 1QRZA 1P8VC 3HK3B 5A09A 1TB6H 1TE0A 2OC1A 1NN6A 1HXFH 3VXEH 4J2YB 2KX4A 2J2UA 2O8WA 4NA9H 2BVXH 3S9AA 4XSKU 3STJA 3LH1A 1WQVH 2BHGA 3MFJA 2AMPA 1O37A 2V3MA 4U32A 2NU1E 4IC5A 1ZSJA 1RS0A 3RXOA 3SJIA 3GS9A 1JBUH 2BLOA 1TOMH 4ISHH 1HJ8A 1S6LA 1C1QA 2R0KA 1GHZA 1UCYE 3SJOA 3ZZ4A 2P94A 5C3NA 2QXJA 2Y6TA 4OS7A 3R0FA 2A5KA 1OYQA 1F2SE 1EP5A 1C1RA 1V2PT 2HWLB 4I31A 5TCAA 4FUCA 5T6FA 2PUQH 1SGQE 1KTTB 3RXLA 2O8TA 3O8CA 3UY9A 2KCYA 4D9QA 3FP8E 1K1IA 5JPMH 1O3CA 3N7OA 5A0AE 1P2KA 3U98H 3O8BA 2IPHA 4B74A 3ZVCA 4RN6A 1NRNH 4Q63A 2B5TB 1HFDA 4B2BA 1FIWA 3NZIA 2XXLA 1EX3A 1GHBG 2EQNA 1HIAB 1ZTLA 2BLVA 2BY5X 1HAXB 3OEED 3OYPA 2VH0A 1BBRH 2SNVA 3GDUA 4KP0A 4MNXA 3SYJA 4X2VA 3F9EA 2K8IA 3QGJA 1JIRA 1O2XA 1O2OA 1JWTA 1PPCE 4WF8A 1GI4A 2QIQA 4D7GA 2FI4E 1MU6B 2FS9A 2PFEA 3NWUA 3RLWH 1C4V2 5J4QA 1GBIA 5EW2H 3U8RH 2UWOA 2ANWA 4ZXYH 1E79D 1OXGA 3TJUA 2WV5A 2QC2A 1BZXE 5HM9A 3AK5A 1MTSA 4FUEA 2C8WB 5SGAE 2F83A 2J94A 1GI7B 2WINI 3OTJE 2QGRA 2Y7XA 4F49A 1SGIB 2TIOA 1A5IA 4ZKSU 2C8XB 4YESB 1DLKB 4X1PU 4X2XA 4BXWA 4JMYA 2GT7A 4YLUA 2IJOB 2ZZUH 3E6PH 4CREA 3GOVB 4ABDA 1ELCA 1K28D 4YT7H 4M7GA 1WBGB 3RXAA 1YPGH 2VH6A 3EDXB 5CHAC 1GMDG 3A8DA 1UVTH 1L1NA 1GCTB 4BAKB 1SOTA 1PYTC 3SO3A 1P04A 1UTPA 1EXFA 3SUGA 1A1RA 2W3IA 1A0LA 1W2KH 3GCHC 3NUMA 3NCLA 3P6ZB 2WUCA 3F2HA 3M3VA 4OGXA 3TIUA 5FPSA 1ELBA 3V7TA 3MI4A 1O2JA 5DPAA 1OYTH 3A84A 1KDQA 4GVUA 1SFIA 5DGJA 3A83A 3DSPA 1CSOE 5I46H 5KGOA 3RXRA 3MU5A 2A4RA 1SGRE 1Y59T 3MU4A 1TONA 1V2QT 4K2YA 3GY6A 3W1EA 1YPJH 2ZU4A 1O2SA 1WTHD 2NU4E 4M9FA 4FUFA 2WPDD 2ZA5A 1IQMA 3QDZB 3UB0A 1HBTH 3SNDA 5L2YH 1G9IE 2EI7A 3T26A 1SBWA 2IN2A 4THNH 2HALA 4ZAEA 2PP6A 2V3HH 3GCTG 3RXPA 1GG6B 1NRSH 4MVNA 2ZU5A 3QX5H 1XUGA 2PKSC 2EI8A 1PPZA 4JZ1A 4B2CA 2OQUA 3RXMA 1CA0C 3ZZCA 1K1LA 1BJUA 1GPZA 1T31A 2PV9B 1TWXB 2A2XH 4ACBA 1UVUH 3SQEE 1PQ7A 1ZZZA 3PTBA 5AVDA 4ZKNU 1C1OA 1MH0A 1UTNA 4I7YH 1NM6A 4FETA 3LT3A 3A7YA 1GDQA 3E8LA 2Q1JA 1C5PA 1C5XB 1ELVA 3A7WA 3F6UH 3UOUA 1V2NT 1OP2A 1KXEA 5JB8S 3P8GA 1NO9H 1DT2A 1FONA 4CHAC 4CH2B 1AUJA 4KTUA 5EJZA 1SQAA 3T27A 1CHOF 3C1KA 4XFQA 1RIWB 3ZZ5A 1LPZB 3EA9A 5EXMA 2FOEA 1ZTJA 2BVSH 2YOLA 3CP7A 3S69A 3K6YA 5GIBA 4F55A 1U6QA 2P8OB 3OY5U 5HIZA 1C5OH 3A89A 1BT7A 1CBWC 2ANYA 4ZUHA 1KMHB 1LTOA 2ZGBH 2OUAA 1TQ0B 2XW9A 4HZHA 2NU2E 1BMAA 2FMJA 1ANEA 2R0LA 3BTDE 1AQ7A 4OS2A 4H6TA 3WWFA 4BTTB 2BQ6B 5LGOA 5LPRA 5BPEA 4KELA 1TAWA 2HNTC 1J14A 1Y3XA 1RGQA 1GI2A 2UUKB 4K3JA 1QB9A 3TJNA 1EPTA 4ABGA 2AGGX 1NRRH 1QIXB 1O2GH 1KSNA 2YMSB 1F0UA 1O2NA 1P11E 1MAYA 1GBFA 1WYKA 5JBBS 4Y10E 2JH6D 3F9HA 4LZ1H 2WZQA 2LPRA 1SQRA 8ESTE 2GX4A 2ANKH 3GICB 2UUJB 1KXAA 3U1JB 5T1VA 3BTKE 2ZO3H 3UREA 3UUZA 1NFWA 1Z8JB 3VGCC 4E06H 5DN6D 2FOFA 1VJAU 1W13U 1OS8A 1C5WB 4NGAH 5TCCA 3RMMH 1QZ8A 1P12E 2W3KA 3RXHA 2VVUA 1SR5C 1BDAA 2GDDA 2ZKSA 2KCAA 2FOMB 1QCPA 4JZIA 1TPPA 2Z9JA 1IQGA 2ZHQH 3VG8A 3LIWA 4MLFB 2F43B 4X6PA 5FX6A 1YPHE 3QZRA 3ZZ8A 2ZNKH 2OC7A 1LHFH 1V6DA 2TGTA 4ZH8A 3ZV8A 2ZF0H 5CE1A 3MHWU 3LPRA 3SJ9A 4FUBA 1N1LA 3UQOA 1FN6A 2M2AA 4JYVH 1TLDA 2BLWA 1SGPE 1ELDE 1AIXH 2F9NA 3LJOA 3UAIC 1FY4A 1GJ7B 3WY8A 4CH8B 2K1QA 2XBWA 3MNSA 1J9CH 1HAPH 1BBRE 1E1QD 2ZCLP 1G30B 1WXRA 1E37B 1NPMA 4I8JA 1C2FA 3Q3YA 7GCHF 3URDA 1TX7A 4KTSA 2G52A 2ZFFH 1UHBB 5GXPA 1W7GH 3KHVA 3F9GA 2XNIA 1VGCB 3MH7A 5F8ZA 1ELAA 1FX0B 1C5SA 3PMHB 4Y7AA 3SZEA 4E05H 1BMNH 3ZZ6A 2FOCA 2A1DB 3UR6A 1ELTA 2BMGB 1W3CA 1XVMA 1GVZA 2KCPA 2CMYA 2PGQB 4Z6AH 1L4DA 2KZ4A 3UOPA 5DP8A 5LPFA 1Z7KA 1FJSA 1FLEE 1YPLH 3FAOA 2PLXA 6GCHG 3BTQE 5AFZH 3RXSA 1C1NA 1O2VA 2H9EH 4ZHLU 1OKXA 1C9PA 2HNTF 2BZ6H 1H9HE 5IYTA 3SV2H 2QCYA 4UEHH 3KQ5A 2SFAA 1EQ9A 2SGQE 1ZSLA 1JMOH 3SNBA 1EZUC 1S81A 4NA7A 1ABJH 4Y11E 3SZNA 1TQ7B 2SGFE 1MMJN 4PROA 1P10A 2G4TA 1O2WA 3GDVA 4YOJA 1TABE 2A2QH 2KCOA 3UTUH 2CV3A 4DOQA 2FIRH 3AVZA 4GAWA 5DP5A 3ITIA 2TGDA 1FQ3A 4WXIA 1MD8A 1J16A 1K9OE 5F8XA 5T6GA 1DANH 1Q3XA 3TH4H 5L6NH 4O3UA 1QNJA 4AFQA 4X1RU 3ZVGA 2ZG0H 3IWMA 3P70B 2J5UA 1SHHB 2D2DA 3RMLH 2H2ZA 1SSXA 3QLPH 4ACAA 1YGCH 3U69H 1GI6A 1IQHA 2Y7ZA 5T6DA 1IHTH 2PTNA 2ZC9H 1MBQA 3BF6H 3N7EA 3UNQA 3UWJH 5F8TA 5E0JA 2P16A 1H4WA 5DK1A 1QGFA 2NWNA 1PJPA 2FYRA 1WSSH 1ESBA 3P17H 3M36A 3MOCA 1UJ1A 1YPHC 1ZSKA 4NSYA 1O5EH 1NBME 5CDFE 1TGCA 2BXUH 1F92A 1O3GA 2J9NA 1LVOA 1S83A 3UIRA 2HLCA 4AB8A 3S7HB 1BTXA 2VNTA 3ZIAD 4A1TA 1C2JA 1DWCH 3LONA 5HM2A 1DWBH 1DWDH 3MQKC 3GY4A 4MPXA 2VINA 3TPIZ 4ABFA 4CRGA 3SUDA 2W7SA 2HVYB 3RC6A 1AGJA 2ZGHA 1Z6EA 1KLIH 4RT0A 3GISB 1AD8H 1BMMH 1ZGIA 4ABBA 3KNXA 1O3OA 4FU9A 4ISIH 2H9HA 1D6WA 2BDCA 3UWIA 1AB9C 1EZQA 3P92A 1PQ8A 4JYTA 3KGPA 2BY6X 1RRKA 3IITA 3U28C 2BYAX 2ZDAH 1Y8TA 5E2OA 1YPMH 4UE7H 2GZ9A 1BA8B 3ENSB 1MD7A 1GBKA 3TU7H 2W5EA 1F5RA 6CHAB 4P00A 1P3EA 1W0ZU 4JZEH 3SBKA 1BRUP 3ZYEA 4GHQA 4A7IB 3FP6E 1SGNE 2A5AA 1HAZB 3PO1B 3A80A 1O3FA 1K0HA 3FANA 3S7KB 2F9OA 2H9TH 5C67A 1T8OA 2ZGCA 1YM0A 1C2LA 2J98B 2C93B 1EJAA 1GJ6A 3BTME 5E0GA 1MTNC 2PHBA 1VITG 3VB6A 4BAMB 3M61U 1AWHB 3ZZ9A 4UD9H 5LH8A 3E0PB 2TBSA 1PPFE 2ZCHP 4BAHB 3LGIA 1W8BH 1BRBE 1XUFA 4AG2A 3FZDA 4Q80A 1Y5AT 3DT0H 1V2TT 3MH5A 4HGCA 1BIOA 4Y0ZE 4WMEA 4Y0YE 4AX9H 1RTKA 4UFFH 5JBCS 1YCPK 3PWBA 3BEIB 5JB9S 2Y80A 1WCZA 2BD3A 4INLA 1J8AA 3ZZ7A 3BTGE 1P9UA 3PROA 1GGDB 3DFJA 1GBHA 1SGFA 2A4QA 3U9AH 2G00A 4GHTA 4WMDA 2A0QB 2CXVA 1COWD 3E16B 4H42U 1HAHH 5DP3A 4A5TS 2WHXA 1VKYA 1G3EA 3FVFB 1GHYH 3UR9A 2FDAA 2H5CA 3F1SB 2FX6A 1FV9A 3FN8A 3BTTE 4RSPA 4Q7ZA 2VIDA 4FVBA 3AW0A 1SGYE 3ESTA 2ZFTA 2ZDVH 3KL6A 5JYIA 3NRLA 2C3SA 1K1JA 2FZZA 2ZPSA 1UMAH 4MNYA 3H7OA 1AFEH 1ARCA 2XBYA 3HKIB 3M37A 2ASUB 1TYNA 5GWZA 3LOXA 2O8UA 3SU0A 3BG4C 4TY7A 1L2EA 1EB2A 4AYVB 3HATH 3FFGA 2EEKA 1GHAF 2Y5FA 2Z94A 3F0OA 1SLVB 1UTOA 3RXKA 1IQJA 1OWKA 4FU7A 1ZJKA 2CGAA 1C5TA 2JH0D 1PPEE 1SFQB 1HV7A 2BQ7B 3FZZA 3RXEA 1T8MA 5EGMA 5FCKA 1O38A 3RP2A 4FVDA 1MU8B 4LZ4B 2VJ1A 1PPBH 5E2PA 2ZU1A 3NXPA 1GMCG 1O35A 1P03A 2J97A 2KAIA 2NU0E 2XBVA 4X6OA 2JIZD 2H6MA 3E0NB 3GDSA 1KXCA 2CF8H 2HGTH 1THPB 1ZHRA 2PWXA 1GVLA 2BQWB 1AE8H 5FL7D 1O3MA 1MQ6A 3STIA 2VU8E 4A1VA 2LNCA 3JZ1B 1A3BH 1TNIA 3RMOH 1BTPA 1L1JA 3G01A 4MQAA 5FBEA 1AZZA 3ZVAA 1FNIA 2QY0B 2WYJA 5B6LA 3GYMA 3T5FH 2F9VA 1DWEH 1THRH 4NIWA 4BTIB 2Y5HA 1NRQH 1EZSC 1FPCH 2OC0A 2W26A 1TPSA 5HIYA 3EE0B 1P2IA 3ZVDA 1O39A 3RXDA 8GCHG 4B2AA 2P3UB 1VCWA 2FOGA 2OINA 4YXWD 1AFQB 1WTGH 2F9BH 1O3JA 1XM1A 2BOHB 2HNTE 1C5LH 2FTMA 3I29A 1O5DH 3QZQA 1AE5A 2A5IA 1GI0A 2FOHA 3W95A 3MNCA 3O8DA 3VB3A 1MAXA 4DJZB 3HGNA 2ZWLH 1XUIA 1ZTKA 4NIXA 1MABB 1A5HA 4I86A 4R0IA 1AUTC 2ESTE 1LKBA 1QA0A 2WPLS 4KGAA 2M5TA 1TOCB 1Z1IA 1EAUA 1VITH 3M5NA 1GL0E 1KXFA 1C4U2 1L0ZA 4BAQB 5IDKA 2B7DH 2EC9H 1SOZA 3H7TA 3V3MA 4NCYA 1YCPM 4TSFD 1HIAA 4XRNA 1FDPA 2THFB 3RU4E 2W6JD 4BXSA 3D49H 5FPTA 1ESTA 1IAUA 2Z9IA 5EJ1A 4B6FA 1FAXA 3O8RA 1BBRK 4ABHA 3MMGA 1O2HA 3EAJA 2RDEA 3ZYDA 2ZQ1A 5L30H 2RG3A 3DD2H 2G81E 4DW2U 1LHEH 3GCOA 1NBMD 1W12U 2ZFPH 1ID5H 4DIHH 2BLQA 1KY9A 2J95A 3U8OH 3M5OA 2R2WU 2AMDA 2BB4A 3SV9A 2ZQ2A 1HYLA 2PKSB 4GCHG 4UFEH 1E35B 1QY6A 5DP9A 1XMNB 1GCTC 2R3UA 4AOQA 1OWHA 4O03A 1O33A 1EKBB 6ESTA 4E7RG 2BVRH 3OTPA 3SU4A 1BTUA 5BRRE 6LPRA 2BD7A 2QF3A 3RXJA 1HAGE 1O2TA 1K2I1 3SU6A 4Q7XA 1F0SA 3D62A 1RXPA 1G2MA 2RA3A 1AO5A 1TIOA 1S6FA 2VVCA 4X1NU 4DT4A 3ZZBA 4FUHA 2A32A 1S84A 1P06A 4NA8A 1BMLA 4OS6A 1EAXA 2TPIZ 2VWNA 2C4FH 3PRBA 4MG3A 1S85A 1O3IA 3PB1E 1DM4B 4A1XA 2CN0H 2W6ID 4CHAB 4XBBA 5HYOA 3DCLA 2BXTH 1T8NA 3NPSA 3MO9A 1O5GH 3WW7A 5AHGH 4GUXA 1OWJA 4AYYB 3M7TA 1HB0B 1FY8E 2ZFSA 2B0FA 1E1RD 2PSXA 1ABIH 4YZUA 5EOKA 1WAYB 1XX9A 1GG6C 3D23A 1AWFH 1TMTH 1EPTC 4ISNA 3CS0A 1C2EA 2AYWA 2AGIX 4IS5A 1YWUA 2GCTB 2O8MA 4TPIZ 4TWYA 3MNBA 1O2QA 3TGJE 3HPTB 4UFDH 1GBEA 1ESAA 1CA8B 3NK8A 1ARBA 1SQTA 4X0WU 3SORA 1PYTD 1O2UA 1SG8B 3ZZDA 1JRSA 1NESE 2BZAA 3RUOA 3SNEA 1XXDA 3A8CA 1B0FA 1P2MA 4FUGA 3AAVA 1EJMA 3H5CB 4Y8XA 1AI8H 1O2RA 2OBQA 2BDHA 1S0QA 1F5KU 1DUAA 2GJGA 2VIVA 4Q4LA 4O97A 5C5OA 1HDTH 1V2RT 4ABAA 1FXYA 2SGPE 3RLYH 1RIWC 3GCNA 3SGBE 3RDZA 1GMDF 1T7CA 3VGCB 1NZQH 3BTHE 9LPRA 2P8OC 5DJ7A 2O8LA 2VB0A 5FCRA 3LDXH 1ANCA 1HJAC 3QWCH 4AGKA 3RC5A 1YYY1 4MPVA 5A8XA 1V2LT 3QTOH 1GJ8B 2OTVA 3V12A 4ZCNA 4KTCA 4F48B 1AZ8A 1O3EA 3SU1A 5IK2D 1AHTH 1UVSH 4FXGH 3V13A 3SI4H 3PTNA 1EJNA 2H1UA 4HI3A 2P95A 4F4OC 2CJIA 3S0NA 5C0TA 4U01A 1TGBA 1A0JA 1NFXA 1O5AB 1ANBA 3URCA 3CS7A 2GTBA 1VCPA 2YMSC 3C27B 4K1TA 3TH2H 4A92A 1TGSZ 2VIPA 1IQFA 3TNTA 2WV9A 2ZTZA 3KIDU 1XVOA 3K9XB 1D3DB 4H4FA 5I25A 1FPHH 4RI0A 2G5VA 3BN9A 3GCTF 1AMHA 3M5LA 2G5NA 1O3LA 4AFUA 3A87A 3PM3A 5DP4A 2VGCC 2ZP0H 1K1OA 1MTUA 1TNGA 1FY5A 1EOJA 1B7XB 1Q2WA 2QV1A 4J1YA 1MQ5A 3LGTA 3OSYA 1UTLM 3PV5A 3TGKE 2XC5A 1DVAH 5EW1H 1O3PB 4IN1A 2FLRH 2KM0A 1GBTA 3ATLA 1FZZA 4K8BA 1OHHD 3SU2A 1GDUA 1MTVA 1TNKA 2GT8A 3SJKA 2VWOA 1GBMA 5KECA 1PPHE 4DG4A 1YC0A 2BD5A 1HLTH 1D3QB 1HAVB 1ZPCA 4FUDA 1AKSB 4ZMAH 3QGNB 2KFWA 4SGAE 4ABIA 1LKAA 1MTWA 1Y3VA 1IHSH 5B6OA 2QXHA 1C1WH 1TBRH 2BDBA 3PYHA 2GCHG 3BTEE 3SGQE 5EXLA 1MCVA 1GBJA 1S5SA 1UCYH 1SQOA 2WYGA 4ZHAA 1C2KA 1BJVA 1NY22 1ETSH 2XYAA 3W94A 3F2GA 1NROH 5GCHG 2F9UA 2QF4A 2VWLA 4X8TH 1YPKH 1MKWH 1J15A 1HUTH 1PQ5A 4BAOB 1VGCC 1BRCE 4LOYH 5FHTA 3TK6A 1C5QA 3S9CA 3A81A 1WQSA 2FO9A 2JKHA 1N8OB 2Z3EA 1SKYE 1H8HD 5C1YA 4NSVA 2BD4A 4X8UH 3V0XA 1GMHG 1MKXH 1RTFB 2BDGA 2ZU3A 3RU4D 3U8TH 3ZVFA 4AN7A 2C8YB 4Y7BA 2W7UA 2AFQB 3LKWA 4INHA 2ZTYA 1DY8A 1QJ6B 1GHWH 1TGTA 5H4IB 2Q6DA 4ASHA 1GBLA 3MO6A 1O5BB 1UHBA 3SV6A 1K22H 3I78A 2CK3D 1QFKH 3NKKA 1AVXA 1VCQA 1B0EA 1A0HB 1Z71A 3HKJB 2HPPH 3LGUA 4X8VH 1HGTH 4DT7B 3Q3XA 1TBZH 1GJDB 2BD8A 3EE7A 3EYDA 3GYLB 4ESTE 1C9TA 1TNHA 5K7RA 4I8HA 1T32A 1QA7A 1QBOA 4XOJA 2UUYA 1GJAB 3QTVH 3S9BA 1BOQA 2ALPA 1KXDA 1UW7A 3P95A 4DY7B 1QB6A 1C2MA 4AORA 4CRFA 1P2QA 2C8ZB 1ZMNA 2Y81A 4HFPB 4GLYA 1EUFA 1LDTT 2ZHEH 1TALA 4OS5A 5K0HA 2VVVA 3PLKA 4FUIA 3KQEA 3KF2A 3SNCA 2WPKS 3F2FA 5C2ZA 4X2YA 2AEIH 3SU3A 4K1SA 2SGEE 3PV2A 2PTCE 4ISLA 1BHXF 1NS3A 4ISOA 2QXGA 1ZYOA 1AB9B 1LHDH 4JK5A 1GJBB 1VJ9U 1O2IA 3SUFA 2I6SA 3T2NA 1EP6A 3EQ0H 1D3PB 1C1MA 2GMTC 3ZVEA 4B71A 3OFND 2HRVA 1P02A 1C5YB 1G3DA 3B23B 3MWIU 3ZZAA 1Y5BT 2FWWA 3MU0A 3KEEA 4MTBA 3UPEA 4NIYA 4UFGH 1BTHH 2H5DA 1CGIE 1P3CA 1DUEA 1Z8GA 1W14U 2J92A 1LHCH 4JZFH 2BY9X 1Z1JA 3MO3A 2VIQA 2FI3E 1GI1A 2ODYB 2V35A 2P3FH 2OLGA 2FLBH 2HVXA 1J17T 3ATKA 3DFLA 3SHAH 4B1TA 2ZPRA 2ZGJA 2AH4X 3BV9B 1H8DH 2A7CA 3RXGA 1A2CH 1G37A 1L4ZA 5C94A 2BDAA 2PSYA 1NU7B 3BTFE 6GCHF 1CHGA 4RKOB 1O2ZA 3PMBB 3GY2A 3PRDA 2BDYA 1OOKB 7ESTE 2Z9LA 5ESBA 1P2JA 2ZDNA 1BB0B 1UTKA 2GZ8A 2ZHWH 4MNVA 2Z6BD 2Q6FA 1O2MA 5DG6A 5FAHA 1JOUB 1YLNA 1OWEA 2IPQX 3Q3KA 4YT6H 2B8OH 5FX5A 4ZKRU 5A0CA 6CHAC 4AGJA 1ELFA 2JETC 4TWWA 1HCGA 3DUXH 1GBCA 4WY3A 1CO7E 4MPWA 5HKKD 1Z8IB 1A46H 3K2UA 1CGJE 2BY7X 1V2OT 1XXFA 2ZFRH 1OSSA 4E7NA 5J4SA 3RXIA 3RXBA 1HNEE 3RXQA 1P09A 2AHME 1XKAC 5EPYA 1BITA 7LPRA 4DGJA 2HLDD 4D76A 2OXSA 4NFFA 4ZHMU 2GP9B 3OY6U 2FOAA 1HAYB 1KXBA 1D4PB 5JBTA 2CHAC 1A3EH 3FOAA 3SUEA 1SB1H 1BQYA 2ALVA 3ELAH 1N6XA 4X6MA 1AVWA 1V2UT 5JDUB 1NFYA 1QQUA 7KMEH 2A45B 2PR3A 3HGPA 1LCYA 2PKAB 1LMWB 1WDIA 3BG8A 4NWLA 1V2KT 1MBMA 1CE5A 3H09A 5EG4A 1QHRB 4NWKA 3UNRA 4XBCA 4I33A 1GJCB 1GGDC 2J98A 4X6NA 2IOTA 1FAKH 2FOBA 4VGCC 2RCEA 3LGYA 5ETXA 1YY3A 1K1PA 1Z8RA 1IQEA 2BX4A 4Y71A 2QAAA 3OX7U 3A7VA 1C1VH 3UFAA 1EAWA 5EIYA 1DY9A 2BD9A 4NIVA 4WMFA 1Y5UT 1Q31A 1AVGH 1QBVH 3ODDA 1CVWH 4K5ZA 1UVOA 4ABJA 3BIVH 1DPOA 5DKMA 1C5VA 4Z0KA 1BTZA 3Q00A 1OX1A 3T28A 3TJOA 1A61H 1TBQH 2RA0A 4AB9A 1GCDA 1QQ4A 3TGIE 1BRAA 1O3KA 4MNWA 4WXVA 4K1EA 2XCFA 1LVYA 3F9FA 1ZMJA 1W0YH 2WSSD 2D26C 1C2DA 1W7XH 2ZEBA 3N99A 3CNRA 1ZHMA 3P8OA 1OWIA 3LGVA 1KTSB 3SQHE 4X2WA 2OK5A 3TLOA 2ZHDA 2V3OH 2QA9E 2KR7A 2GKVE 2D1JA 1BUIA 2C90B 2WPMS 2XOKD 1YLCA 1C5RA 2J34A 2PKAA 2VIOA 3AW1A 3BIUH 4IC6A 1G3CA 1SGDE 2GGVB 1VITF 3RU4T 1O30A 1Y3WA 5A0BA 1KLTA 3SJ8A 1N6YA 3UNSA 5DO4H 2TGPZ 4XBDA 2GZ7A 4YOGA 1KDQB 1HJ9A 1GHVH 1EASA 3A85A 4Y8YA 1CHOG 3RM2H 1UK2A 3Q76A 5CHAB 3SW2B 1ORFA 1DS2E 2ZCKP 3A7ZA 3RXCA 1TNJA 5EQQA 3EA7A 3KYGA 1H9LB 2OCVB 4CRCA 2VBCA 3GCHB 3QO6A 5E0HA 1XUJA 1D9IA 1YKTA 1LQDB 1LVBA 1SGCA 1ZRBA 1ZPZA 2BX3A 3A8BA 1S0RA 3KQCA 4Q2KA 4KKDA 3I77A 1DICA 5AF9H 1T4VH 3VB4A 3KN2A 1AFQC 1LO6A 1QL7A 1X7AC 1SGEE 1JIMA 2YNAA 1QB1A 2ZDMA 4U30A 4ASUD 1MZDA 3EA8A 1HAIH 2OBOA 1B5GH 4YM9A 5HGGA 2XWAA 1WOFA 4TY6A 2QYIA 4AC9A 1AY6H 3SV7A 2B9LA 1UTQA 1EATA 1O2KA 1YBWA 1DE7H 3M5MA 1GJ5H 3GY5A 3U1IB 2TRMA 1G3BA 4X1SU 5F03A 3MU1A 1AU8A 5PTPA 5FXLA 2F9PA 3F3BA 2ZU2A 2FXRA 1T8LA 4LK4A 4I32A 3SN8A 1CA0B 1GI5A 3BEUA 3BTWE 5GPIB 2FI5E 1QL9A 1O5FH 2JJ2D 2D8WA 1ETTH 1FY3A 3IG6B 1MCTA 3LJJA 4JZDH 1THSH 4DURA 3A88A 1DOJA 1HPGA 3K65B 1SI5H 1TX6A 1TRMA 2ZTXA 1RD3B 1UK4A 1GBAA 1GMCF 1CU1A 5C17A 4RKJB 5F6MA 3AASA 4XE4A 2SGDE 3VXFH 4GSOA 1V2ST 4WH6A 2WPJS 2HOBA 3LH3A 3JZ2B 2AS9A 4CBOA 4WWYA 2UWPA 3M3SA 4D8NA 4U2WA 4CR5A 1GHBF 1ZHPA 2O9QA 5CHBA 1CT2E 1QL8A 3TJVA 3VB5A 9ESTA 1C1UH 1EPTB 4B6EA 3PMAB 3F68H 5FBIA 1F0RA
chains in the Genus database with same CATH topology
4SGBE 4CBNA 2DE8A 2FTLE 2XC4A 3PWCA 7GCHG 3R3GB 1UVPA 2FPZA 4OGYA 5EQRA 1HRTH 2ZPQA 4AFSA 5L2ZH 1CBWB 3KQDA 4ZKOU 1C5UA 1HAOH 5C1XA 3E90B 1ZGVA 1ZRKA 8GCHF 1A5GH 1M9UA 1H8IH 4I8GA 1EZXC 3MH6A 2AIQA 4K8YA 3M7QA 4JCNA 1P0SH 1GHXH 5A8YA 2ZECA 1L1GA 1ZPBA 2PGBB 2ILNA 1Z6JH 5E8EH 3TITA 2XTTB 3KQBA 1P9SA 1O3DA 1SHYA 1T4UH 4XDEA 2J4IA 2XRCA 1O32A 1QURH 3LU9B 4B75A 1C5ZB 2P3TB 2ANMH 3B8JA 1SL3A 3M7UA 2OC8A 3T29A 3ZV9A 4IGDA 1MUEB 4QT8C 3SI3H 4HTCH 2SGAA 3MYWA 1ANDA 5EODA 3RM0H 1Y3YA 1FMGA 2F3CE 3QUMP 4BANB 1DXPA 1HJAB 1IQKA 2ZIQH 3ZZ3A 2G55A 3L33A 2EI6A 3A8AA 2GCTC 4Q7YA 1AN1E 1SC8U 2XC0A 3AAUA 4IW4E 2XCNA 2WUBA 1W10U 2Z3CA 2GV6A 2QXIA 5A2MH 2EA3A 1O31A 1C5NH 4UDWH 1E0FD 1F7ZA 1SVPA 2A7HA 1PPGE 4YLQH 4IN2A 2XWBI 4IMZA 1SPJA 1VZQH 1SLUB 1ETRH 2Y82A 2Y5GA 3EGKH 1ZOMA 5HMAA 2GD4B 2ZHFH 3RXFA 1K1MA 1GJ9B 1NU9A 3D65E 4NZLA 1DX5M 4GCHF 2VGCB 3PLPA 1W11U 3BSQA 2ZGXH 4UONA 1ACBE 4ZROA 1BTWA 3MH4A 2A4OA 4CRDA 2ULLA 2BD2A 1O2LA 1BHXB 1FY1A 3ATMA 1DXWA 1UTJA 1QBNA 3K6ZA 5AFYH 2FODA 1NRPH 4WJG2 1BTYA 3HK6B 1GDNA 1SMFE 2BM2A 3BEFB 1P01A 3FP7E 4BOHA 1C2GA 1CQQA 1S82A 5G4BA 1OP0A 2RDLA 1GI9B 1C1TA 1P2NA 1O0DH 1JXPA 4INKA 2A31A 2PUXB 3A7TA 3MU8A 1IQNA 3TK5A 1O3HA 4I8KA 1C1PA 1WU1A 1EOLA 3M35A 3RC4A 1IQIA 2Z9KA 3QN7A 4NFEA 1F5LA 1XUHA 1UO6A 1YF4A 1O36A 3RXTA 4FU8A 3PV4A 2G8TA 1QR3E 3VEQB 2JH5D 2ZI2H 3SHCH 3A82A 3PMJA 4O3TA 4OS1A 1V3XA 1O3NA 4I8LA 1GBDA 1UK3A 4R8TB 2OQ5A 5C5NA 1C2HA 1FI8A 4GPGA 1E34B 2FM2A 1MZAA 2G51A 4OS4A 3VB7A 1V2WT 3MTYA 1LVMA 1CGHA 4YO9A 1ELEE 4Y8ZA 2QN5T 1GI3A 2P59A 5HXFA 1TNLA 3QK1A 1TPOA 3LC5A 1PFXC 5TJXA 1QJ1B 1DSTA 1G36A 3E91A 1GI8B 1C4Y2 3ODFA 1XKBC 1PQAA 1ELGA 4FUJA 2VWMA 2GV7A 1LPKB 1TGNA 2F91A 1OPHB 2QF0A 5EU8A 1TRNA 3LGWA 2AMQA 2R2MB 3ATWA 1QTFA 3PLBA 3DHKH 3KCGH 2A4GA 1RTLA 5JBAS 2BOKA 1O2YA 2WPHS 2UWLA 4AZ2B 1A4WH 2YNBA 1XUKA 1V2VT 2FX4A 1DFPA 1WV7H 2DE9A 3TVJB 5A8ZA 1NFUA 1SLWB 1HXEH 1ZLRA 3ZVBA 3RXVA 4JYUH 1HAVA 2FYQA 2GVFA 5GJ4B 1AKSA 4X8SH 1N8OC 3TNSA 1RFNA 2CF9H 3SV8A 2ODQA 1UTMA 1C2IA 3CENA 1TMBH 1TPAE 5DP7A 2WPIS 5ABWA 1FIZA 1DDJA 3T62A 2Z7FE 4YTAA 3RXUA 4B76A 2DUCA 4CRAA 3DA9B 3P8NA 3VFEA 1TRYA 2R9PA 4BTUB 1KIGH 1GL1A 4ABEA 1ZMLA 5DP6A 4B73A 3SU5A 2ZFQH 1UCYK 1D6RA 3ATIA 4H6SB 4BNRA 4CRBA 3VPKA 1OP8A 1K21H 1E36B 1O3AA 1GVKB 3T25A 2ZDKA 4NZQA 2GMTB 3OU0A 4ZXXH 4JK6A 1FUJA 4Y6DA 1G2LA 4LXBH 1GBBA 1MKWK 3LC3A 5FPYA 1ZR0A 3SNAA 4WVPE 5EPNA 3UQVA 1IQLA 1K1NA 2AGEX 1INCA 4DVAU 4IMQA 1RJXB 1YP9A 1TFXA 1YPEH 3GY7A 3RMNH 1GHAG 1LPGB 3M3TA 4A6LA 1D3TB 1LQEA 1C5MD 2VIWA 4DCDA 1YCPH 1MKXK 1C1SA 3SGAE 2BDIA 2BTCE 3Q77A 4X1QU 1EAIA 1TA2A 1TMUH 2WV4A 2FESH 4MDSA 1BCUH 1GWAA 1VR1H 4Y79A 1DLEA 1MTNB 5C1UA 2FEQH 1GJ4H 4TPYA 5GDSH 2I6QA 4AG1A 4K69A 1JRTA 5T3HA 1SGTA 4NG9H 4O9VA 1H9IE 2AIPA 2GCHF 3A7XA 1O2PA 1OWDA 3B9FH 3TK9A 2TGAA 4Y76A 2P93A 5GCHF 2AERH 2FS8A 3GY8A 4K60A 4TYDA 8KME2 2JETB 1SGFG 3SOSA 1NTPA 2Z9GA 1FN8A 1DSUA 2BY8X 2Q6GA 1KLJH 1EB1H 4WH8A 1TX8A 2GDEH 2J38A 3E3TA 4MPUA 2R3YA 4D9RA 1QRWA 3GY3A 1TA6A 2PW8H 1V2MT 2STAE 5ESTE 4D7FA 1GMHF 1E38B 8LPRA 3P8FA 5C20A 1O5CB 3E1XB 1NT1A 2XBXA 3PO1C 1F0TA 4YOIA 2CHAB 2HPQH 2OP9A 1CT0E 1YLDA 1P57B 4DIIH 2FP7B 2NU3E 1O34A 2STBE 3A86A 1KYNA 5CMXH 1QJ7B 1Y3UA 3L3TA 1CT4E 1LHGH 4CR9A 1P05A 2KAIB 1SLXB 2V6NA 2UUFB 5LPEA 3L6PA 3BG4B 1QRXA 1IOEA 4VGCB 4AFZA 2V0BA 5EXNA 1A7SA 2ODPA 2A7JA 2Z3DA 1DITH 1V2JT 1S6HA 2OD3B 3TH3H 1NC6A 2G4UA 2ZDLA 1H1BA 1ZJDA 1P2OA 3MNXA 5EQSA 2SNWA 1O3BA 1WUNH 4IBLH 1G32B 1QRZA 1P8VC 3HK3B 5A09A 1TB6H 1TE0A 2OC1A 1NN6A 1HXFH 3VXEH 4J2YB 2J2UA 2O8WA 4NA9H 2BVXH 3S9AA 4XSKU 3STJA 3LH1A 1WQVH 2BHGA 3MFJA 2AMPA 1O37A 4U32A 2NU1E 4IC5A 1RS0A 1ZSJA 3RXOA 3SJIA 1JBUH 2BLOA 1TOMH 4ISHH 1HJ8A 1C1QA 2R0KA 1GHZA 1UCYE 3SJOA 3ZZ4A 2P94A 5C3NA 2QXJA 2Y6TA 4OS7A 3R0FA 2A5KA 1OYQA 1F2SE 1EP5A 1C1RA 1V2PT 2HWLB 4I31A 5TCAA 4FUCA 5T6FA 2PUQH 1SGQE 1KTTB 3RXLA 2O8TA 3O8CA 3UY9A 4D9QA 3FP8E 1K1IA 5JPMH 1O3CA 3N7OA 5A0AE 1P2KA 3U98H 3O8BA 2IPHA 4B74A 3ZVCA 4RN6A 1NRNH 2B5TB 1HFDA 4B2BA 1FIWA 3NZIA 2XXLA 1EX3A 1GHBG 1HIAB 1ZTLA 2BLVA 2BY5X 1HAXB 3OYPA 2VH0A 1BBRH 2SNVA 3GDUA 4KP0A 4MNXA 4X2VA 3F9EA 3QGJA 1JIRA 1O2XA 1O2OA 1JWTA 1PPCE 4WF8A 1GI4A 2QIQA 4D7GA 2FI4E 1MU6B 2FS9A 2PFEA 3NWUA 3RLWH 1C4V2 5J4QA 1GBIA 5EW2H 3U8RH 2UWOA 2ANWA 4ZXYH 1OXGA 3TJUA 2WV5A 2QC2A 1BZXE 5HM9A 1MTSA 4FUEA 2C8WB 5SGAE 2F83A 2J94A 1GI7B 2WINI 3OTJE 2QGRA 2Y7XA 4F49A 1SGIB 2TIOA 1A5IA 4ZKSU 2C8XB 4YESB 1DLKB 4X1PU 4X2XA 4BXWA 4JMYA 2GT7A 4YLUA 2IJOB 2ZZUH 3E6PH 4CREA 3GOVB 4ABDA 1ELCA 1K28D 4YT7H 4M7GA 1WBGB 3RXAA 1YPGH 2VH6A 3EDXB 5CHAC 1GMDG 3A8DA 1UVTH 1L1NA 1GCTB 4BAKB 1SOTA 1PYTC 3SO3A 1P04A 1UTPA 1EXFA 3SUGA 1A1RA 2W3IA 1A0LA 1W2KH 3GCHC 3NUMA 3NCLA 3P6ZB 2WUCA 3M3VA 4OGXA 3TIUA 5FPSA 1ELBA 3V7TA 3MI4A 1O2JA 5DPAA 1OYTH 3A84A 1KDQA 4GVUA 1SFIA 5DGJA 3A83A 1CSOE 5I46H 3RXRA 3MU5A 2A4RA 1SGRE 1Y59T 3MU4A 1TONA 1V2QT 4K2YA 3GY6A 1YPJH 2ZU4A 1O2SA 1WTHD 2NU4E 4FUFA 2ZA5A 1IQMA 3QDZB 1HBTH 3SNDA 5L2YH 1G9IE 2EI7A 3T26A 1SBWA 2IN2A 4THNH 2HALA 4ZAEA 2V3HH 3GCTG 3RXPA 1GG6B 1NRSH 4MVNA 2ZU5A 3QX5H 1XUGA 2PKSC 2EI8A 1PPZA 4JZ1A 4B2CA 2OQUA 3RXMA 1CA0C 3ZZCA 1K1LA 1BJUA 1GPZA 1T31A 2PV9B 1TWXB 2A2XH 1UVUH 3SQEE 1PQ7A 1ZZZA 3PTBA 5AVDA 4ZKNU 1C1OA 1MH0A 1UTNA 4I7YH 1NM6A 3LT3A 3A7YA 1GDQA 3E8LA 2Q1JA 1C5PA 1C5XB 1ELVA 3A7WA 3F6UH 3UOUA 1V2NT 1OP2A 1KXEA 5JB8S 3P8GA 1NO9H 1DT2A 1FONA 4CHAC 4CH2B 1AUJA 4KTUA 1SQAA 3T27A 1CHOF 3C1KA 4XFQA 1RIWB 3ZZ5A 1LPZB 3EA9A 5EXMA 2FOEA 1ZTJA 2BVSH 2YOLA 3CP7A 3S69A 3K6YA 5GIBA 1U6QA 2P8OB 3OY5U 1C5OH 3A89A 1BT7A 1CBWC 2ANYA 4ZUHA 1LTOA 2ZGBH 2OUAA 1TQ0B 2XW9A 4HZHA 2NU2E 1BMAA 2FMJA 1ANEA 2R0LA 3BTDE 1AQ7A 4OS2A 4H6TA 4BTTB 2BQ6B 5LGOA 5LPRA 5BPEA 4KELA 1TAWA 2HNTC 1J14A 1Y3XA 1RGQA 1GI2A 2UUKB 4K3JA 1QB9A 3TJNA 1EPTA 4ABGA 2AGGX 1NRRH 1QIXB 1O2GH 1KSNA 1F0UA 1O2NA 1P11E 1MAYA 1GBFA 1WYKA 5JBBS 4Y10E 2JH6D 3F9HA 4LZ1H 2LPRA 8ESTE 2GX4A 2ANKH 3GICB 2UUJB 1KXAA 3U1JB 3BTKE 2ZO3H 3UREA 3UUZA 1NFWA 1Z8JB 3VGCC 4E06H 2FOFA 1VJAU 1W13U 1OS8A 1C5WB 4NGAH 5TCCA 3RMMH 1P12E 2W3KA 3RXHA 2VVUA 1SR5C 1BDAA 2GDDA 2ZKSA 2FOMB 1QCPA 4JZIA 1TPPA 2Z9JA 1IQGA 2ZHQH 3LIWA 4MLFB 4X6PA 5FX6A 1YPHE 3QZRA 3ZZ8A 2ZNKH 2OC7A 1LHFH 1V6DA 2TGTA 4ZH8A 3ZV8A 2ZF0H 5CE1A 3MHWU 3LPRA 3SJ9A 4FUBA 1N1LA 3UQOA 1FN6A 4JYVH 1TLDA 2BLWA 1SGPE 1ELDE 1AIXH 2F9NA 3LJOA 1FY4A 1GJ7B 3WY8A 4CH8B 2K1QA 2XBWA 3MNSA 1J9CH 1HAPH 1BBRE 2ZCLP 1G30B 1E37B 1NPMA 4I8JA 1C2FA 3Q3YA 7GCHF 3URDA 1TX7A 4KTSA 2G52A 2ZFFH 1UHBB 5GXPA 1W7GH 3KHVA 3F9GA 2XNIA 1VGCB 3MH7A 5F8ZA 1ELAA 1C5SA 3PMHB 4Y7AA 4E05H 1BMNH 3ZZ6A 2FOCA 2A1DB 3UR6A 1ELTA 2BMGB 1W3CA 1XVMA 1GVZA 2CMYA 2PGQB 4Z6AH 1L4DA 3UOPA 5DP8A 5LPFA 1Z7KA 1FJSA 1FLEE 1YPLH 3FAOA 2PLXA 6GCHG 3BTQE 5AFZH 3RXSA 1C1NA 1O2VA 2H9EH 4ZHLU 1OKXA 1C9PA 2HNTF 2BZ6H 1H9HE 5IYTA 3SV2H 2QCYA 4UEHH 2SFAA 1EQ9A 2SGQE 1ZSLA 1JMOH 3SNBA 1EZUC 1S81A 4NA7A 1ABJH 4Y11E 3SZNA 1TQ7B 2SGFE 1MMJN 4PROA 1P10A 2G4TA 1O2WA 3GDVA 4YOJA 1TABE 2A2QH 3UTUH 2CV3A 4DOQA 2FIRH 3AVZA 4GAWA 5DP5A 3ITIA 2TGDA 1FQ3A 4WXIA 1MD8A 1J16A 1K9OE 5F8XA 5T6GA 1DANH 1Q3XA 3TH4H 5L6NH 4O3UA 1QNJA 4AFQA 4X1RU 3ZVGA 2ZG0H 3IWMA 3P70B 1SHHB 2D2DA 3RMLH 2H2ZA 1SSXA 3QLPH 1YGCH 3U69H 1GI6A 1IQHA 2Y7ZA 5T6DA 1IHTH 2PTNA 2ZC9H 1MBQA 3BF6H 3UNQA 3UWJH 5F8TA 5E0JA 2P16A 1H4WA 5DK1A 1QGFA 2NWNA 1PJPA 2FYRA 1WSSH 1ESBA 3P17H 3M36A 3MOCA 1UJ1A 1YPHC 1ZSKA 4NSYA 1O5EH 1TGCA 2BXUH 1F92A 1O3GA 2J9NA 1LVOA 1S83A 3UIRA 2HLCA 4AB8A 3S7HB 1BTXA 2VNTA 4A1TA 1C2JA 1DWCH 3LONA 5HM2A 1DWBH 1DWDH 3GY4A 4MPXA 2VINA 3TPIZ 4ABFA 4CRGA 3SUDA 2W7SA 3RC6A 1AGJA 2ZGHA 1Z6EA 1KLIH 3GISB 1AD8H 1BMMH 1ZGIA 4ABBA 3KNXA 1O3OA 4FU9A 4ISIH 2H9HA 1D6WA 2BDCA 3UWIA 1AB9C 1EZQA 3P92A 1PQ8A 4JYTA 3KGPA 2BY6X 1RRKA 3IITA 2BYAX 2ZDAH 1Y8TA 5E2OA 1YPMH 4UE7H 2GZ9A 1BA8B 3ENSB 1MD7A 1GBKA 3TU7H 2W5EA 1F5RA 6CHAB 3SBKA 1P3EA 1W0ZU 4JZEH 1BRUP 3ZYEA 4GHQA 4A7IB 3FP6E 1SGNE 2A5AA 1HAZB 3PO1B 3A80A 1O3FA