4JCNA

Structure of esp, serine protease from staphylococcus epidermidis
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
216
structure length
216
Chain Sequence
b'VILPNNNRHQIFNTTQGHYDAVSFIYIPIDGGYMSGSGVVVGENEILTNKHVVNGAKGNPRNISVHPSAKNENDYPNGKFVGQEIIPYPGNSDLAILRVSPNEHNQHIGQVVKPATISSNTDTRINENITVTGYPGDKPLATMWESVGKVVYIGGEELRYDLSTVGGNSGSPVFNGKNQVIGIHYGGVDNKYNSSVYINDFVQQFLRNNIPDINIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamyl endopeptidase
publication title Secreted proteases control autolysin-mediated biofilm growth of Staphylococcus aureus
pubmed doi rcsb
source organism Staphylococcus epidermidis
molecule tags Hydrolase
total genus 55
structure length 216
sequence length 216
ec nomenclature ec 3.4.21.19: Glutamyl endopeptidase.
pdb deposition date 2013-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4jcnA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4jcnA02
2GV6A 1SMFE 4YOJA 1W7XH 2SGPE 3BEIB 3M37A 5A0BA 2BHGA 2F9PA 5TJXA 3SU2A 2WV4A 2EI8A 1OS8A 1GCDA 1RTFB 2AIQA 2ZECA 3HKIB 1GJCB 4BTUB 2TGAA 4I33A 3U1IB 1QBNA 4Y11E 1RTLA 1AKSA 1GHYH 4YLQH 2PTNA 1TQ0B 1UTPA 1LPKB 3QO6A 1JRTA 2BZAA 1G36A 4MLFB 1EATA 3GY3A 4OS4A 1PYTD 5B6OA 1RGQA 3PYHA 1NC6A 4O03A 3O8CA 1TMTH 1Z8RA 2XCNA 3P17H 2NU4E 2KAIB 3KQDA 1ZR0A 4JZDH 3EYDA 5FBEA 2Y82A 2VVCA 1IQFA 5JYIA 1CA0C 2FOBA 1T8LA 3KQCA 4IW4E 4ABJA 3SNDA 2FPZA 1O33A 2PSXA 3SGQE 2O8TA 1K1PA 1Y5UT 1T8OA 1ETSH 1ELBA 1Z7KA 4O97A 5DK1A 1XX9A 2WUCA 3GCTF 2FLRH 3SV7A 1FMGA 1ACBE 1K1JA 4SGAE 1GHBG 1UHBA 1PPBH 2XC5A 3KEEA 2CXVA 1GWAA 2ZIQH 2BYAX 2FIRH 1LVMA 4GHQA 2STBE 2HPQH 1QB9A 1GBKA 1DOJA 1HFDA 1Q2WA 1GHVH 3EDXB 3ZVEA 2CJIA 1O3KA 1Q3XA 1SHHB 5DO4H 3QZRA 3SV9A 3SBKA 1KDQB 2HPPH 1P2MA 3LT3A 2VWLA 1K21H 4X2WA 1GBTA 1GJ8B 1CU1A 1ESBA 2V6NA 1O2JA 4YOGA 4X1NU 1TPOA 3ATWA 3FAOA 3M3VA 1TBZH 3U8OH 3QGNB 1DUAA 5F8ZA 1HV7A 1HAIH 2QIQA 3FP6E 1DWCH 1RD3B 1P06A 1P05A 3S7KB 1GJBB 3DA9B 4MNXA 2CMYA 2BX4A 1G32B 2EC9H 1HAZB 2GKVE 2C8YB 1K1IA 3SI4H 1EB1H 4K60A 1W0ZU 3MOCA 1C5UA 1EP6A 1BRAA 2ODPA 1FY1A 2BMGB 1SQTA 1NFYA 3HGNA 1FN8A 1F0UA 1J9CH 2BDIA 2ASUB 4MG3A 1C9TA 2B9LA 3RXHA 3VEQB 2ZFQH 1TGCA 4NA7A 3TH3H 1TA2A 1MZDA 1O2XA 3L3TA 1A5HA 3URCA 4AB9A 2P3FH 1FNIA 3BG4B 1HXFH 1TNKA 5CHAC 1KLTA 2C8XB 2UWOA 1TE0A 4GLYA 4H42U 3VPKA 2A2QH 1NTPA 1UVPA 1KIGH 1KXEA 3A87A 4NSYA 1DVAH 3RC6A 1W8BH 3UWJH 3Q3KA 1CO7E 2M5TA 2ZDLA 1GBLA 1GDUA 2BX3A 3PMHB 3F9FA 1EPTB 2F9OA 4IMQA 1MU6B 2G55A 4MNWA 3LGYA 4Q7XA 2VIWA 1HBTH 1ZOMA 1L2EA 3BF6H 3GY4A 4KELA 1G30B 1O3MA 2B0FA 1AE5A 1ZRKA 1THSH 3RXOA 3AVZA 1IQNA 2STAE 2G8TA 1TA6A 1YLDA 2Z9JA 4YM9A 1C5LH 1O2MA 2GZ7A 2GMTC 4BTIB 2FESH 3E90B 3A80A 3ZVCA 4A5TS 4IBLH 3VFEA 4AFZA 1P01A 4THNH 2GX4A 5EPYA 4ZKRU 1WCZA 3EA7A 3MU0A 4H6TA 2HALA 1DPOA 1KXCA 2VIOA 1Z6EA 3FP8E 3H5CB 2ZO3H 1N8OB 5J4SA 3A7VA 1LHFH 3SZNA 2D1JA 1QHRB 2Y80A 1QJ1B 1CHGA 1GBBA 1P8VC 1UVTH 2FOGA 1E35B 1QFKH 2ZDNA 1J15A 6GCHG 1C2GA 1G2MA 4LXBH 2XBWA 2Y5GA 5ETXA 2Z9LA 1MTWA 3KN2A 1SLXB 3K2UA 1NM6A 4YT7H 2J94A 3RUOA 1AO5A 2ZFSA 3A83A 1SGCA 6ESTA 1DWBH 2R0KA 2H5CA 1JIMA 1QGFA 9LPRA 5GJ4B 1BMMH 4MPWA 3QLPH 1LPZB 4MPUA 2OC8A 2GCTC 1TNIA 1D3DB 2TPIZ 2OBQA 2FI4E 2FOHA 1O5CB 2ZU5A 2XYAA 2TGPZ 2BD7A 1NFUA 1NRPH 2GCHG 1F5RA 3ATMA 2TBSA 2HRVA 3RXAA 2ZC9H 3Q77A 1G3BA 4X1PU 3UNSA 2OQ5A 4NSVA 2XRCA 5C67A 3HK6B 1Y3WA 4XDEA 1OYQA 2P93A 2VIVA 2ZDAH 4KTCA 1EKBB 1YM0A 2VH0A 1PPHE 1L1NA 1F5KU 1GL0E 4OS5A 1AI8H 3RC5A 1HJAB 4CRCA 1GBEA 2UUFB 2I6QA 4OS6A 2A4OA 2XBYA 3KCGH 2VWNA 3U8TH 1XXDA 1UO6A 2ZU4A 3QN7A 1AVXA 1C1WH 1V2QT 4UD9H 2ZNKH 5HM2A 3SHAH 3SNBA 1O2PA 3TU7H 1A0LA 5C1YA 4WVPE 4MQAA 3RXDA 3PO1C 3EE0B 1K2I1 4ABIA 3I29A 1L4ZA 1ABJH 3P8OA 3ZV9A 1IQJA 2P8OB 2Y5FA 4JYUH 1C2LA 2P3UB 2QAAA 4AYYB 1OSSA 1IQMA 4NIYA 4U01A 4X8TH 2DUCA 1TGNA 3LGUA 1VZQH 2QF3A 1A3BH 4VGCB 2FWWA 3ZZBA 1ZSJA 1FPCH 1DANH 2WYJA 1MKXH 5GPIB 1GMDG 2FOCA 4ZAEA 4UEHH 5F8XA 3BIUH 1C1NA 2IJOB 2PGQB 4PROA 1QTFA 2F9VA 2TGDA 4BAQB 3MU8A 1FJSA 6CHAB 4YTAA 4FUHA 1RIWB 2FM2A 3ZZ7A 3TGJE 3BSQA 1BMAA 1BIOA 4FUGA 5J4QA 2G81E 1V2WT 2UWLA 2PFEA 3RXMA 3UPEA 2JH6D 1B5GH 1BB0B 3PMJA 1EZQA 1DLKB 3R0FA 2C90B 2ZFPH 1NESE 1W7GH 4BTTB 1C5TA 1ZPZA 4OGYA 1ZMJA 1PQAA 2Z3DA 5GWZA 2BVRH 3NPSA 4NA8A 2SGQE 2ZZUH 1QY6A 4I7YH 4FUEA 3RLWH 1YF4A 2VWOA 3HKJB 3RXBA 1EAUA 1T4UH 4GPGA 4X8SH 3RXPA 4DW2U 1O5EH 1NU7B 2XNIA 2ILNA 1G3EA 3ZVAA 4FU7A 1NFXA 2QV1A 1FZZA 4TYDA 2BY9X 1MUEB 5L6NH 1ELVA 1OWKA 1GJ7B 1SGFG 5DGJA 1O2UA 3MWIU 1NROH 1W12U 4CR5A 5FBIA 1G3DA 3KQBA 1A0HB 1O2RA 4DVAU 3TITA 2BDAA 4WF8A 3C1KA 3LJJA 1VGCC 3PLKA 2IPHA 4FVDA 1YPHE 3B23B 1L0ZA 4IC5A 1T8NA 1T4VH 3A88A 3STJA 5HGGA 3U1JB 1MD7A 1BITA 1IHTH 4ZKSU 1GDQA 1Z6JH 3QTOH 1DT2A 3VB4A 2R2WU 1C1PA 2ODQA 1GCTB 1GJ9B 4D9RA 2DE8A 2XW9A 3ESTA 3FVFB 3OYPA 5A09A 1Y3UA 1O34A 1KSNA 2GDDA 2XWAA 1ZZZA 1EXFA 1JWTA 3SJ9A 3QZQA 1EAXA 1FQ3A 1GG6B 2GGVB 1PQ8A 2CF8H 4DJZB 1E34B 4AGJA 1NRQH 1O31A 2WPHS 4X2VA 3UNQA 1MQ5A 2V0BA 1IHSH 4WXIA 3UWIA 1O35A 3VB5A 2VIPA 4IS5A 2ZTYA 4KGAA 2ZTZA 1ZGVA 2UWPA 3TK6A 5AF9H 2AS9A 4INHA 1NRNH 2A5KA 1GI3A 4ABAA 3DUXH 1VR1H 4OS2A 4SGBE 3SU0A 3ZYEA 1LDTT 2G4UA 1AN1E 2AYWA 2O9QA 3S69A 4HTCH 1PPZA 3H7TA 1QJ7B 4CBNA 3W95A 3TLOA 1HJ9A 1XUJA 1ARCA 3P70B 1H1BA 3MNBA 5FX6A 1ZMLA 2ZPSA 3TGKE 2ZGXH 4RKJB 5EQQA 2YNBA 1SQAA 1T8MA 1WAYB 2BD3A 1UVSH 3M61U 1CHOG 2C8WB 2QXJA 1UTLM 2AGGX 1O3NA 1ZTJA 2HOBA 1SHYA 1SGDE 3CP7A 1V2TT 1J8AA 3S9BA 1V2ST 8GCHG 1HJ8A 1ABIH 1J16A 1MTNB 2H9EH 1V2MT 2WYGA 3A7YA 7KMEH 4ABDA 3A7ZA 1GJ4H 5HXFA 1E38B 1O2OA 2ZCKP 2NU3E 1V2LT 2JETC 1K9OE 1TPSA 1GHAG 4ABBA 5FCRA 1HAYB 5LPFA 1TRYA 1HUTH 1MCVA 3MO3A 4TY6A 1GBCA 2PUQH 4YLUA 4BXSA 1RXPA 2P95A 4X1QU 2ESTE 2F3CE 1EUFA 4I8KA 4ISIH 2Q6FA 1C5YB 4CREA 7GCHF 4GVUA 4K1SA 4AORA 1Y5BT 4K8YA 1GI0A 1P02A 1BOQA 3SJKA 1O2VA 1AUJA 3LC3A 1SGTA 1AU8A 1P11E 3BTEE 1LVOA 4XOJA 1SGIB 2HNTF 4WH8A 1ZHMA 3QWCH 4KP0A 1SPJA 1A5IA 3TJNA 3F68H 3ZVBA 1S83A 1K28D 1NRRH 3Q3YA 4Y79A 1E37B 3QK1A 1O3AA 1BBRK 2G4TA 3TJVA 1GBJA 2RA3A 1A2CH 9ESTA 5EW1H 4ZKOU 2PKSB 1O0DH 1C1RA 1XMNB 2PLXA 4ZROA 3RU4E 1UCYH 1DE7H 4Y0YE 2HNTE 3UIRA 2WPKS 1PPCE 3M7QA 1AY6H 4M7GA 4E06H 4FVBA 1PFXC 2ZF0H 1VITH 5AVDA 1P2JA 2BOKA 1FXYA 1TWXB 1X7AC 3GDUA 1GHXH 1GGDB 1QNJA 1GI6A 3PTNA 2A1DB 1ESTA 1GBDA 1C1VH 2EI6A 2J2UA 1ZJDA 4AOQA 1PQ7A 4FUFA 1ZHRA 3K6ZA 3M3TA 5DP8A 5EOKA 4MVNA 3WY8A 1EJMA 1HRTH 4AFQA 2VWMA 5T6GA 3UY9A 1YCPH 1G9IE 1EZXC 3TGIE 1C5SA 1DLEA 1Y8TA 3D23A 4R8TB 3SGAE 1DY8A 5C5NA 5EXNA 4B73A 2Z9KA 1TB6H 1DFPA 1DM4B 1SI5H 3SW2B 1F7ZA 2ZU3A 3A89A 5LPRA 3MNSA 5A8XA 1QIXB 4O9VA 3SNAA 3OTJE 1S6FA 2OUAA 2BD8A 5C2ZA 1BA8B 3ZZ6A 1MTSA 4DIIH 3TPIZ 5JPMH 7LPRA 2J4IA 1AVGH 3B9FH 4X8UH 1TMUH 2OXSA 1AFQC 5JB8S 4DURA 1V2RT 3URDA 2P59A 1TLDA 1TX8A 3TH4H 3V13A 4Z6AH 3IWMA 2BLOA 3HPTB 2BQ7B 2FP7B 4Y7BA 4MPVA 3T62A 1G37A 3ODFA 3E8LA 4H6SB 1CA0B 5AHGH 1NN6A 1NZQH 1CGHA 1P2IA 1SSXA 2ZGCA 1N6XA 4Q2KA 5F03A 1RRKA 4X0WU 5T6FA 1SBWA 5EW2H 1TAWA 1O3JA 1BHXB 3GCNA 3GYLB 3M5OA 4HFPB 4AGKA 2JH5D 3CS7A 1CT0E 1V2KT 4CRBA 8KME2 3KF2A 3BIVH 2VGCC 1KTSB 4ISOA 2FOMB 2SGDE 1FAKH 4IMZA 2C3SA 2JH0D 3EGKH 3CS0A 4KTUA 4RSPA 2OINA 2THFB 2A31A 2VIDA 1B0EA 1EZSC 5FCKA 4U32A 1A1RA 1W10U 2QGRA 4OS1A 1E36B 1V2UT 3UFAA 2UUJB 3RXFA 2PSYA 1C1QA 3AW0A 5FHTA 2AMDA 5E0GA 1IQHA 1O3CA 3W94A 2XWBI 1B7XB 3QGJA 1J17T 1D4PB 1XKAC 3PROA 1HAHH 2ANYA 4JZEH 4FUIA 1V2PT 5DJ7A 4MPXA 3BTGE 1HB0B 1QRZA 2FDAA 2BD4A 1ELEE 3TK5A 4NWLA 1VITG 3SV8A 4TPYA 4A1XA 3LPRA 3NCLA 3KIDU 5JBCS 1ZGIA 1PQ5A 2H2ZA 1EB2A 1NU9A 1Y3YA 2Y6TA 1A3EH 2C4FH 2F9UA 1YPMH 3UQVA 1SGFA 1O3GA 3LKWA 4HZHA 2GD4B 3VB3A 1A5GH 1O3PB 7GCHG 2WINI 4NWKA 2LNCA 2ZGBH 1BTWA 5LH8A 2GT7A 4D9QA 3PWCA 1EZUC 1AMHA 5CHAB 3RLYH 1GI4A 2EA3A 2H6MA 4IGDA 5C3NA 1MTUA 1P2NA 2WPIS 1SOTA 1DX5M 2PR3A 3SJOA 3M7UA 1Z8JB 2HWLB 2OLGA 1W3CA 4TY7A 4Y76A 4B2CA 1YPHC 3RMLH 4D76A 1CVWH 3V0XA 1Y3VA 2XC4A 1GBAA 1MD8A 5ESTE 1QCPA 3ZVGA 1O5DH 1KTTB 1QBVH 1C5ZB 1LHGH 1C9PA 3SOSA 4WJG2 2ZPRA 3JZ1B 3IITA 1WOFA 1QL7A 1TNGA 2OD3B 4FUDA 2QF0A 2GMTB 2TIOA 1CT2E 2NU1E 2XTTB 4HGCA 1GJ5H 1XUFA 2EI7A 1TNLA 3LIWA 1JXPA 5EXMA 3AASA 5GXPA 2D2DA 1O2HA 1A61H 1P2KA 3SU6A 1AWFH 1DSTA 4LZ1H 1S81A 5K7RA 3BTQE 1O2NA 2GTBA 3DD2H 3RXUA 1QRWA 3LONA 3VXEH 1Y5AT 2FMJA 1SC8U 1SFQB 4CH8B 5C1XA 1SGEE 1ELAA 1O2LA 4CRDA 5F6MA 1D3QB 1VCWA 3L6PA 4BAHB 1L1JA 1VCQA 1JMOH 1LKAA 1C5RA 3I78A 1QQ4A 2FYRA 3LU9B 5I46H 3UUZA 4D8NA 2Z94A 4DIHH 1S82A 5JBAS 1AGJA 2ZFTA 5FAHA 3D62A 4H4FA 2ZHEH 3GICB 1NS3A 1ELFA 2EEKA 3M7TA 4FUCA 1BTHH 2O8WA 1A7SA 3NKKA 1AZ8A 2Z6BD 3GDSA 1TMBH 2GCTB 2Y5HA 4K1EA 3GCHC 1AB9C 2O8LA 2Q1JA 1KDQA 3GCTG 2OC7A 3ATLA 1KYNA 5TCCA 4KKDA 2FTLE 4TWYA 3TIUA 1XM1A 3FFGA 1ZPCA 4J1YA 4X2XA 5A2MH 2WPJS 1OWDA 4Y8YA 4BXWA 1MMJN 1MKXK 2ZDMA 1BTXA 4WXVA 4INLA 3NWUA 3RXLA 4BNRA 1BMLA 1GI8B 1EP5A 1JIRA 1C5OH 1P9UA 1GVLA 3RXRA 4CR9A 3P8GA 1BDAA 4JZIA 3OSYA 1P3EA 1O2ZA 1WTGH 3K65B 3RXKA 1GJDB 3SV2H 3QTVH 3BV9B 2BY6X 1P09A 3SV6A 2ZQ2A 2GP9B 3BEUA 4MNVA 4MDSA 4ZH8A 2P3TB 4E7RG 1D3PB 4YOIA 3PO1B 1ZMNA 2W7SA 4ABEA 1EASA 1MQ6A 5JBTA 4XBBA 1SB1H 2PKAA 2W3IA 5E0JA 1BT7A 1O3EA 4AB8A 1BHXF 4NFFA 4X6NA 5L30H 1ELCA 3RDZA 2BVSH 3STIA 2BLWA 1S0QA 3MI4A 3M3SA 5EGMA 2ZDKA 1HAVB 2FO9A 3PLPA 1SLUB 1BTPA 5DPAA 3A8BA 1THRH 3U8RH 1MAXA 1EJAA 2A7HA 2PUXB 2A2XH 1CA8B 2J95A 1ZPBA 1FV9A 1TRMA 3OX7U 1T31A 1FAXA 4XBDA 2Z3CA 3EA9A 1OKXA 2BM2A 1F0RA 3LGVA 1TOMH 1GI9B 3A8DA 1WQVH 4RN6A 1G3CA 1ANEA 3U98H 4AFUA 2GZ8A 5HYOA 3V12A 2ANWA 2FXRA 3GCOA 5F8TA 1BJVA 1CT4E 1JOUB 2V35A 1ZHPA 3A8AA 2ZHQH 4WY3A 2SGAA 1Y3XA 2GV7A 2VH6A 7ESTE 3I77A 2Y7XA 1O3BA 2B8OH 4NIXA 2HLCA 1TBRH 1H8DH 5JB9S 2W7UA 2PV9B 2R2MB 3FZDA 2F9BH 1IQEA 2ALVA 2BQWB 1XVOA 1CBWC 1F2SE 2J34A 2ZTXA 2H1UA 1T32A 4WMEA 2ZDVH 4A6LA 1O2WA 1GMHF 4MTBA 4Y8ZA 2ZCHP 4ZXYH 2FOEA 1GI2A 1FI8A 2O8UA 1C1SA 2FX6A 2NWNA 2A5IA 3F6UH 2CN0H 5GCHF 1BRUP 2BD5A 1ZLRA 1WV7H 1FY5A 2H9TH 4FU9A 4GAWA 4Q7ZA 2VU8E 1O3IA 2BXTH 5BRRE 3UTUH 1UTKA 2IN2A 4JK5A 3T28A 2XC0A 3ZZAA 2C8ZB 1O3OA 4TPIZ 1VCPA 1XVMA 3O8RA 1C5WB 3VGCC 2VINA 2SGEE 2BY7X 2FYQA 4UE7H 3B8JA 3E16B 2FOAA 2A4GA 1AVWA 2R9PA 3OY5U 3TH2H 2QXHA 1VGCB 4ZHAA 4Y7AA 1ANDA 1GBFA 1O2QA 1AZZA 1GHWH 3MH5A 3ZYDA 1ELGA 3DFLA 3SNEA 2GT8A 1TBQH 2BD9A 3Q3XA 1P2QA 1W11U 3ZZ9A 2Q6DA 3KQEA 1TYNA 1MCTA 1S5SA 3N7OA 1TONA 4YO9A 4OGXA 8ESTE 1SFIA 3MH7A 1BTZA 2ZGHA 4CHAC 3SU1A 4AFSA 3VXFH 3LH3A 1S6HA 1AKSB 2TRMA 5SGAE 3T2NA 1O2SA 1LHCH 3MNCA 1LHDH 2BLVA 3F9HA 4KTSA 4AZ2B 5A8YA 1WU1A 3O8DA 3GDVA 3EAJA 3A86A 1ZSLA 1LO6A 1JRSA 4ABHA 1YGCH 3SQEE 4DT7B 2D8WA 1MTVA 1FY4A 2FEQH 2FS9A 1MAYA 2CHAC 1LMWB 3K9XB 1N6YA 1GBHA 2BOHB 3UR6A 1W13U 5C5OA 4I8HA 3A7WA 2VB0A 4K3JA 2SFAA 3V3MA 1C5QA 1SOZA 1UK3A 4A1TA 3RU4T 2BDGA 3ZVDA 1UHBB 2WV5A 3SI3H 5DP4A 4WMFA 5EQRA 5E0HA 4JK6A 1GVZA 3A7TA 1UCYK 1C2IA 1EAWA 1XUHA 1TPPA 1WTHD 4LOYH 2SNVA 3KHVA 5DG6A 2B5TB 3P92A 1K1LA 4D7FA 2WPLS 3ZZ4A 2ANKH 2O8MA 3LDXH 4ZMAH 1OPHB 3A85A 1WBGB 3LGTA 3M36A 2JETB 4ABFA 1YKTA 1NFWA 1P12E 4B76A 2ZHFH 3ATIA 1PPFE 4YT6H 3GYMA 1MBMA 1ANBA 1YYY1 2IOTA 3TJUA 3R3GB 5DP9A 1IOEA 4ZHLU 4ZKNU 1GJ6A 1O30A 3FP7E 2A7CA 1SLWB 1W0YH 1LKBA 1C2JA 1Z8IB 1TGTA 4Q80A 3SU4A 1UTNA 1SGQE 3SQHE 4ESTE 1MU8B 2ZI2H 2P16A 1C2KA 1D6RA 4QT8C 4X6MA 3P8FA 2A0QB 2D26C 1C1OA 3BG8A 2A32A 3LOXA 2RA0A 4NIWA 1PPEE 1LVBA 3RXSA 1GHZA 1GVKB 1EX3A 1XUKA 3HGPA 2YNAA 1P57B 3BTME 3BTKE 3G01A 1F5LA 5IYTA 1DDJA 1GMHG 1FN6A 3GISB 1FPHH 5A8ZA 1JBUH 1DWEH 3EA8A 2FZZA 1AQ7A 1TFXA 2XCFA 1GMCF 4UFDH 4Y6DA 1DY9A 3DHKH 4UFEH 3RXVA 2AERH 1IAUA 1BBRE 1O39A 1SL3A 1ARBA 1P10A 3AW1A 4Y0ZE 4D7GA 2G52A 3RXQA 1C5VA 1ZTLA 2BZ6H 1HCGA 1OX1A 4K2YA 2RCEA 2PTCE 1CGJE 1HPGA 3UOUA 2A4QA 4ISNA 5EODA 1ZSKA 4O3UA 2FODA 2HGTH 1MKWH 4GSOA 4E05H 1D6WA 3RMMH 6GCHF 3SUEA 1XUIA 4JYTA 1KY9A 3UREA 3BTWE 3F9GA 3GY7A 4FUBA 2OC1A 1AFQB 1LQEA 2V3HH 4A1VA 2VIQA 4LZ4B 3S9CA 1H9IE 2AEIH 4ZXXH 4UONA 3D49H 5EPNA 1H4WA 1O2YA 2SNWA 2ZEBA 2AGEX 1YC0A 3P6ZB 4B71A 1BBRH 1LCYA 5A0CA 2I6SA 4XE4A 1SGYE 3GY2A 1HNEE 1DITH 1O2TA 2Y81A 1VJAU 4K5ZA 4X8VH 3SJIA 3T26A 2ZWLH 1EAIA 3T25A 1C4U2 2BY5X 3ELAH 1UK2A 2VGCB 1EOLA 2GCHF 1HIAA 2ULLA 1IQKA 1UTOA 1TX6A 3PMAB 2QC2A 5DKMA 2QA9E 1WUNH 1O3HA 2W26A 4LK4A 1NT1A 3K6YA 1BMNH 1FIWA 3CENA 1CSOE 2QXGA 2RG3A 3MO9A 4I31A 4NG9H 1L1GA 1HAXB 1SVPA 1W14U 2BDBA 4CBOA 4JYVH 1RJXB 1GJAB 1V2NT 3ZZ5A 1QB1A 4GCHF 4X6OA 2ZHWH 1EOJA 1TGBA 1ID5H 1W2KH 3ZVFA 4I8JA 1XXFA 2QY0B 3FANA 2XBXA 2ZPQA 5E8EH 2OP9A 1TPAE 1YPEH 4CH2B 1FIZA 4X2YA 3SUFA 3ITIA 1O38A 2OCVB 1QJ6B 2FLBH 3SNCA 1K1NA 2AH4X 4X6PA 3SU3A 3P8NA 3SORA 1C2MA 2G51A 1C5PA 3MMGA 1ORFA 2RDLA 2B7DH 5ESBA 4B1TA 4TWWA 3LGWA 3TK9A 1OWHA 2UUKB 4XBCA 2GDEH 3SN8A 1P2OA 5FPSA 2CV3A 3Q00A 5LGOA 2ZCLP 3GY6A 1WQSA 1V2VT 3LGIA 3GY5A 4B2AA 3BG4C 1QA7A 3A81A 2QCYA 1SG8B 2PKAB 2NU2E 2ZA5A 2QN5T 5CE1A 2ZQ1A 3F1SB 3MU5A 1O37A 1GMDF 2BD2A 2F83A 2AMQA 3UQOA 4DCDA 1AHTH 1EPTC 3A8CA 3TJOA 1OWJA 5C20A 1M9UA 5GDSH 4Z0KA 1DSUA 2A5AA 5TCAA 4AYVB 1FY8E 1DICA 3SHCH 5DP6A 5BPEA 1AWHB 3H7OA 3KNXA 1UK4A 1LHEH 3BTDE 2GZ9A 5DP3A 4BAMB 3D65E 1YPJH 2BDHA 4AN7A 2OBOA 3PV4A 1G2LA 1GBIA 1GI5A 3E1XB 1U6QA 5EXLA 1GMCG 1K22H 3E91A 1K1MA 2W3KA 1TX7A 4U30A 2FI5E 1TIOA 3MO6A 1N8OC 1GL1A 1O3DA 1O3LA 1ETTH 4OS7A 2BLQA 3M35A 2KAIA 1A0JA 1ESAA 4BOHA 4K69A 2XXLA 1C5XB 4JCNA 3VB6A 2QXIA 1V2OT 5AFZH 1DXWA 3M5MA 1IQIA 1UVUH 1D3TB 1A4WH 1BJUA 2Z7FE 5AFYH 1DUEA 3M5LA 1BZXE 5LPEA 1UTQA 3MTYA 1NPMA 3SO3A 1DS2E 3ZZ3A 3MU4A 3ZZDA 1UTMA 2BY8X 1C5MD 4WH6A 5DP5A 4YESB 1KXDA 2TGTA 4DOQA 2J92A 4DY7B 1Z1JA 4ZHMU 2GVFA 2ZFFH 1Y59T 3SGBE 1ANCA 4Q7YA 2FS8A 5I25A 2A45B 2OTVA 4IN2A 2OC0A 4B2BA 5C1UA 1S85A 1HAPH 5IDKA 2VNTA 1YLCA 1IQLA 3GCHB 1AB9B 2A7JA 2VVVA 4DG4A 1HLTH 2YOLA 4O3TA 2BDCA 3KL6A 2CGAA 1HGTH 3RXGA 4I32A 5L2YH 1DXPA 1GBMA 1YPGH 1RS0A 2ZU1A 2ALPA 1GI1A 2BXUH 4AX9H 2H9HA 1TQ7B 2G5NA 4X1RU 3PLBA 4CRGA 1TALA 2A4RA 3RP2A 2QYIA 2R3UA 1B0FA 2BB4A 1BUIA 1PJPA 5JBBS 1HJAC 3HATH 1OOKB 2J38A 5G4BA 2NU0E 6LPRA 1NY22 1T7CA 1NO9H 1HAOH 3TVJB 4NA9H 1BTUA 1V2JT 3S9AA 5FPYA 2H5DA 1H8IH 2DE9A 1FLEE 4GCHG 1AFEH 3RXCA 1FONA 3OY6U 5FXLA 5H4IB 3SU5A 1QRXA 2WUBA 3ODDA 3V7TA 2HNTC 1EQ9A 2G00A 2P8OC 4UFGH 3UNRA 1Z8GA 3RXJA 4A92A 3QDZB 3ZV8A 4ABGA 8LPRA 1O5FH 1C4Y2 1QL9A 2CF9H 3U9AH 2Z3EA 1AD8H 4RKOB 4AG2A 1CHOF 1EPTA 1O36A 3KGPA 3PB1E 2AIPA 4VGCC 1KLJH 3E0NB 8GCHF 1Z1IA 1ZJKA 3BTHE 1QURH 1HDTH 2P94A 2FOFA 3T29A 3A84A 3BN9A 1GHAF 1O32A 4Y8XA 4E7NA 4DGJA 1O5AB 3RMOH 3OU0A 1P03A 1QA0A 1ZTKA 3MFJA 1THPB 2R3YA 3A82A 3MH6A 5PTPA 3BTTE 6CHAC 2V3OH 1BRCE 1TOCB 3DT0H 4GUXA 4XSKU 1RIWC 5FX5A 1F0TA 4CRAA 1S0RA 2FI3E 3TNSA 2WPMS 4NCYA 3SUGA 2F91A 3MNXA 1EJNA 1TNHA 1FUJA 1C1TA 3RU4D 2J9NA 3SJ8A 5E2OA 1Q31A 4CRFA 1GDNA 1CBWB 2ZP0H 3C27B 2Q6GA 3IG6B 1C1MA 3AAUA 3LJOA 2W5EA 1INCA 1MBQA 1WYKA 4I8LA 3PWBA 2PW8H 3DFJA 1OWEA 5T3HA 1C2HA 1OWIA 4K1TA 1MZAA 1IQGA 3E0PB 1O5BB 3GY8A 2BVXH 2G5VA 1H9LB 4NFEA 1ETRH 1WSSH 4NIVA 1Z71A 3AAVA 3RXIA 1P04A 1K1OA 5FPTA 1VJ9U 4K8BA 3VB7A 3VGCB 3UOPA 1N1LA 1D9IA 1SGPE 3M5NA 2FX4A 5CMXH 2ZU2A 4ISLA 3ENSB 3PTBA 1UMAH 3PM3A 3T27A 1P9SA 3MH4A 1BCUH 2R0LA 3PMBB 4GHTA 4UFFH 4B74A 2HVXA 1O2IA 1GCTC 1P3CA 1TNJA 1P0SH 1UTJA 4WMDA 4IN1A 2F9NA 1OP0A 5DP7A 1BTYA 1SGNE 4Y71A 1KXAA 1AIXH 3RXEA 5L2ZH 1LVYA 5A0AE 3U69H 2PHBA 3JZ2B 4CHAB 4YZUA 2AGIX 3NXPA 1GG6C 3SUDA 3HK3B 1C4V2 1V6DA 2K1QA 1BQYA 2ZG0H 2FTMA 4INKA 3BTFE 5T6DA 5K0HA 1C2FA 1MH0A 5EG4A 3TNTA 4BAOB 4BAKB 1CGIE 1OYTH 3A7XA 3QUMP 1OP8A 1O2GH 3F9EA 1GHBF 1GPZA 1XUGA 2AFQB 1XKBC 4MNYA 3ZZCA 1SLVB 2CHAB 1C1UH 2Z9GA 3FZZA 4J2YB 4NZQA 1O5GH 1OXGA 5GIBA 1C5NH 1NRSH 1HAVA 2C93B 1F0SA 3E3TA 1LTOA 1HXEH 4BANB 3GOVB 4IC6A 1ELTA 1SR5C 2OQUA 3Q76A 4AG1A 2ANMH 2PWXA 5HMAA 1YP9A 4HI3A 1H9HE 4U2WA 3BEFB 3EQ0H 4XFQA 1ELDE 1SGRE 5JDUB 1C2EA 2BQ6B 4FU8A 3MU1A 1BRBE 1HIAB 2UUYA 2ZFRH 1MTNC 5E2PA 4ASHA 1F92A 1QBOA 5HM9A 1PPGE 1ZYOA 1TGSZ 1FDPA 1V3XA 1VITF 1RFNA 1UVOA 2BTCE 2SGFE 3S7HB 1QL8A 3RMNH 1YCPK 4FXGH 1TABE 3MYWA 1UCYE 1AE8H 3UR9A 2ODYB 1ZRBA 2AMPA 2VVUA 4WWYA 2ZKSA 3O8BA 4ISHH 4JZFH 3RM2H 3S0NA 3ATKA 1A46H 1QB6A 3E6PH 1AUTC 1QR3E 3P95A 2ZGJA 3ZZ8A 1MKWK 4ZUHA 1DWDH 5EU8A 1GI7B 4F49A 1S84A 2VJ1A 4JZ1A 3NUMA 1PYTC 4NGAH 4F4OC 1YBWA 2JKHA 2XBVA 1O3FA 1CE5A 1LQDB 4X1SU 3RC4A 1RTKA 5ABWA 1LPGB 1O2KA 1HYLA 1UJ1A 3T5FH 2Y7ZA 1E0FD 3QX5H 3NZIA 3RM0H 4Y10E 3LC5A 1HAGE 2PKSC 2BDYA 5EQSA 2Z9IA 1QQUA 1TRNA 4R0IA 1KLIH 4UDWH 3RXTA 2PGBB 3L33A 1J14A 1YPKH 1YPLH 5GCHG 1SQOA 1YCPM 2ZHDA 3LH1A 4B75A 4I8GA 3MHWU 4FUJA 3NK8A 1FY3A 1GGDC 1OP2A 4NZLA 2LPRA 1KXBA 1CQQA 4JMYA 4A7IB 1KXFA 1C2DA 1L4DA
chains in the Genus database with same CATH superfamily
2GV6A 1SMFE 2IPQX 1W7XH 2SGPE 3BEIB 4YOJA 3M37A 5A0BA 3F2GA 2BHGA 2F9PA 5TJXA 3SU2A 2WV4A 2EI8A 1OS8A 1GCDA 1RTFB 2AIQA 2ZECA 3DSOA 1GJCB 3HKIB 4BTUB 2TGAA 4I33A 3U1IB 1QBNA 4Y11E 1RTLA 1AKSA 4Q4LA 1GHYH 4YLQH 2PTNA 5C17A 1TQ0B 1UTPA 1LPKB 3QO6A 1JRTA 2BZAA 4TSFD 1G36A 4MLFB 1EATA 3GY3A 4OS4A 1PYTD 5B6OA 1RGQA 3PYHA 1NC6A 4O03A 3O8CA 1TMTH 1Z8RA 2XCNA 3P17H 2NU4E 5IK2D 2KAIB 3KQDA 1ZR0A 4JZDH 3EYDA 5FBEA 2Y82A 2VVCA 1IQFA 5JYIA 1CA0C 2FOBA 1T8LA 3KQCA 4IW4E 4ABJA 5KEDA 3FKSD 3SNDA 2FPZA 1O33A 2PSXA 3SGQE 2O8TA 1K1PA 1Y5UT 1T8OA 1ETSH 1ELBA 1YLNA 1Z7KA 4O97A 5DK1A 1XX9A 2WUCA 3GCTF 2FLRH 3SV7A 1FMGA 1ACBE 1K1JA 4SGAE 1GHBG 1UHBA 1PPBH 2XC5A 3KEEA 2CXVA 1GWAA 2ZIQH 2BYAX 2FIRH 1LVMA 4GHQA 2STBE 2HPQH 1QB9A 1GBKA 1DOJA 5DN6D 1HFDA 1Q2WA 1GHVH 3EDXB 3ZVEA 2CJIA 1O3KA 1Q3XA 1SHHB 5DO4H 3QZRA 3SV9A 3SBKA 1KDQB 2HPPH 5KGOA 1P2MA 3LT3A 2VWLA 1K21H 4X2WA 5B6LA 1GBTA 1GJ8B 1CU1A 1ESBA 2V6NA 1O2JA 4YOGA 4X1NU 4YXWD 1TPOA 3ATWA 3FAOA 2AHME 3M3VA 1TBZH 3FN8A 3U8OH 3QGNB 1DUAA 5F8ZA 1HV7A 1HAIH 2QIQA 3FP6E 1DWCH 1RD3B 1P06A 1P05A 3S7KB 1GJBB 3DA9B 4MNXA 2CMYA 2BX4A 1G32B 2EC9H 1HAZB 2GKVE 2C8YB 5EJLA 1K1IA 3SI4H 1EB1H 4K60A 1W0ZU 3MOCA 1C5UA 1EP6A 1BRAA 2ODPA 1FY1A 2BMGB 1SQTA 1NFYA 3HGNA 1FN8A 1F0UA 2PP6A 1J9CH 2BDIA 2ASUB 4MG3A 1C9TA 2B9LA 3RXHA 3VEQB 2ZFQH 1TGCA 4NA7A 3TH3H 1TA2A 1MZDA 1O2XA 3L3TA 1A5HA 3URCA 4AB9A 2P3FH 1FNIA 3F0PA 3BG4B 1HXFH 1TNKA 5CHAC 1KLTA 2C8XB 2UWOA 1TE0A 4GLYA 4H42U 3VPKA 2A2QH 1NTPA 1UVPA 1KIGH 1KXEA 3A87A 4NSYA 1DVAH 3RC6A 1W8BH 3UWJH 3Q3KA 1CO7E 2M5TA 2ZDLA 1GBLA 1GDUA 2BX3A 3PMHB 3F9FA 1EPTB 2F9OA 4IMQA 4B6EA 1MU6B 2G55A 4MNWA 3LGYA 4Q7XA 2VIWA 1HBTH 1ZOMA 1L2EA 3BF6H 3GY4A 4KELA 1G30B 1O3MA 2B0FA 1AE5A 1ZRKA 1E79D 1THSH 3AVZA 5HIYA 3RXOA 1IQNA 2STAE 2G8TA 1TA6A 1YLDA 2Z9JA 4YM9A 1C5LH 1O2MA 2GZ7A 2F4LA 2GMTC 4BTIB 2FESH 3E90B 3A80A 3ZVCA 3KYFA 4A5TS 4IBLH 3VFEA 4AFZA 1P01A 4THNH 2GX4A 1E1RD 5EPYA 4ZKRU 1WCZA 1H8ED 3EA7A 3MU0A 4H6TA 2HALA 1DPOA 1KXCA 2JDID 2VIOA 1Z6EA 3FP8E 3H5CB 2ZO3H 1N8OB 5J4SA 3A7VA 1LHFH 3SZNA 2D1JA 1QHRB 2Y80A 1QJ1B 1CHGA 1GBBA 1P8VC 1UVTH 2FOGA 3PRBA 1E35B 1QFKH 2ZDNA 1J15A 6GCHG 1C2GA 1G2MA 4LXBH 2XBWA 2Y5GA 5ETXA 2Z9LA 1MTWA 3KN2A 1SLXB 3K2UA 1NM6A 2W6JD 4YT7H 2J94A 3RUOA 1AO5A 2ZFSA 3A83A 1SGCA 4RT1A 6ESTA 1DWBH 2R0KA 2H5CA 1JIMA 1QGFA 9LPRA 5GJ4B 2WPDD 1BMMH 4MPWA 3QLPH 1LPZB 4MPUA 2OC8A 2GCTC 1TNIA 1D3DB 2TPIZ 2OBQA 2FI4E 2FOHA 1O5CB 2ZU5A 2XYAA 3OTPA 2TGPZ 2BD7A 1NFUA 1NRPH 2GCHG 1F5RA 3ATMA 2TBSA 2HRVA 3RXAA 2ZC9H 3Q77A 1G3BA 4X1PU 3UNSA 2OQ5A 4NSVA 2XRCA 5C67A 3HK6B 1Y3WA 4XDEA 1OYQA 2P93A 2VIVA 2ZDAH 4KTCA 1EKBB 1YM0A 2VH0A 1PPHE 1L1NA 1F5KU 1GL0E 4OS5A 1AI8H 3RC5A 1HJAB 4CRCA 1GBEA 2UUFB 2KCPA 2I6QA 4OS6A 2KCYA 2A4OA 2XBYA 3KCGH 2VWNA 3U8TH 1XXDA 1UO6A 2ZU4A 3QN7A 1AVXA 1C1WH 1V2QT 4UD9H 2ZNKH 5HM2A 3SHAH 3SNBA 1O2PA 3TU7H 1A0LA 5C1YA 4WVPE 4MQAA 3RXDA 3PO1C 1K0HA 3EE0B 1K2I1 4ABIA 4F55A 3I29A 1L4ZA 1ABJH 3P8OA 3ZV9A 1IQJA 2P8OB 2Y5FA 4JYUH 1C2LA 2P3UB 2QAAA 4AYYB 1OSSA 1IQMA 4NIYA 4U01A 4X8TH 2DUCA 1TGNA 3LGUA 1VZQH 2QF3A 1A3BH 4VGCB 2FWWA 3ZZBA 1ZSJA 1FPCH 1DANH 2WYJA 1MKXH 5GPIB 1GMDG 2FOCA 4ZAEA 4UEHH 5F8XA 3BIUH 2WZQA 1C1NA 2IJOB 2PGQB 4PROA 1QTFA 2F9VA 2TGDA 4BAQB 2KFWA 3MU8A 1FJSA 6CHAB 4YTAA 4FUHA 1RIWB 2FM2A 3ZZ7A 3TGJE 3BSQA 1BMAA 1BIOA 4FUGA 5J4QA 2G81E 1V2WT 2UWLA 2PFEA 3RXMA 3UPEA 2JH6D 1B5GH 1BB0B 3PMJA 1EZQA 1DLKB 3R0FA 2C90B 2ZFPH 1NESE 1W7GH 4BTTB 1C5TA 1ZPZA 1E1QD 4OGYA 1ZMJA 1PQAA 2Z3DA 5GWZA 2BVRH 3NPSA 4NA8A 2SGQE 2ZZUH 1QY6A 4I7YH 4FUEA 3RLWH 1YF4A 2VWOA 3HKJB 3RXBA 1EAUA 1T4UH 4GPGA 4X8SH 3RXPA 4DW2U 1O5EH 1NU7B 2XNIA 2ILNA 1G3EA 3ZVAA 4FU7A 1NFXA 2QV1A 1FZZA 4TYDA 2BY9X 1MUEB 5L6NH 1ELVA 1OWKA 1GJ7B 1SGFG 5DGJA 1O2UA 3MWIU 1NROH 1W12U 4CR5A 5FBIA 1G3DA 3KQBA 1A0HB 1O2RA 4DVAU 3TITA 2BDAA 4WF8A 3C1KA 3LJJA 1VGCC 3PLKA 2IPHA 4FVDA 1YPHE 3B23B 1L0ZA 4IC5A 1T8NA 1T4VH 3A88A 3STJA 1EFRD 5HGGA 3U1JB 1MD7A 1BITA 1IHTH 4ZKSU 1GDQA 1Z6JH 3QTOH 1DT2A 3VB4A 2R2WU 1C1PA 2ODQA 1GCTB 1GJ9B 4D9RA 2DE8A 2QF4A 2XW9A 3ESTA 3FVFB 3OYPA 5A09A 1Y3UA 1O34A 1KSNA 2GDDA 2XWAA 1ZZZA 1EXFA 1JWTA 3SJ9A 3QZQA 1EAXA 1FQ3A 1GG6B 2GGVB 1PQ8A 2CF8H 4DJZB 1E34B 4AGJA 1NRQH 1O31A 2WPHS 4X2VA 3UNQA 1MQ5A 2V0BA 1IHSH 4WXIA 3UWIA 1O35A 3VB5A 2VIPA 4IS5A 2ZTYA 4KGAA 2ZTZA 4XRNA 1ZGVA 2UWPA 3TK6A 5AF9H 2AS9A 4INHA 1NRNH 2A5KA 2K8IA 1GI3A 4ABAA 3DUXH 1VR1H 4OS2A 4SGBE 3SU0A 1WXRA 3ZYEA 1LDTT 2G4UA 1AN1E 2AYWA 2O9QA 3S69A 4HTCH 1PPZA 3H7TA 1QJ7B 4CBNA 3W95A 3TLOA 1HJ9A 1XUJA 3U28C 3F3BA 1ARCA 3P70B 1H1BA 3MNBA 5FX6A 1ZMLA 2ZPSA 3TGKE 2ZGXH 4RKJB 5EQQA 2YNBA 1SQAA 1T8MA 1WAYB 2BD3A 1UVSH 3M61U 1CHOG 2C8WB 2QXJA 1UTLM 2AGGX 1O3NA 1ZTJA 2M2AA 2HOBA 1SHYA 1SGDE 3CP7A 1V2TT 1J8AA 3S9BA 1V2ST 8GCHG 4F48B 1HJ8A 1ABIH 1J16A 1MTNB 2H9EH 1V2MT 2WYGA 3A7YA 7KMEH 4ABDA 3A7ZA 1GJ4H 2QE7D 5HXFA 1E38B 1O2OA 2ZCKP 1NBME 2NU3E 3SYJA 1V2LT 2JETC 1K9OE 1TPSA 1GHAG 4ABBA 5FCRA 1HAYB 5LPFA 1TRYA 1HUTH 1MCVA 3MO3A 4TY6A 1GBCA 2PUQH 4YLUA 4BXSA 1RXPA 2P95A 4X1QU 2ESTE 2F3CE 1EUFA 4I8KA 4ISIH 2Q6FA 1C5YB 4CREA 7GCHF 4GVUA 4K1SA 4AORA 1Y5BT 4K8YA 1GI0A 1P02A 1BOQA 3SJKA 2KR7A 1O2VA 1AUJA 3LC3A 1SGTA 1AU8A 5F53A 1P11E 3BTEE 5KECA 2KM0A 1LVOA 3FO8D 4XOJA 1SGIB 2HNTF 4WH8A 1ZHMA 3QWCH 4KP0A 1W0JD 1SPJA 1A5IA 3TJNA 3F68H 3ZVBA 1S83A 1K28D 1NRRH 3Q3YA 4Y79A 4Q63A 2JJ2D 1E37B 3FOAA 3QK1A 1O3AA 1BBRK 2G4TA 3TJVA 1GBJA 2RA3A 1A2CH 9ESTA 5EW1H 4ZKOU 2PKSB 1O0DH 2W6ID 1C1RA 1XMNB 2PLXA 4ZROA 3RU4E 1UCYH 1DE7H 4Y0YE 2HNTE 3UIRA 2WPKS 3DCLA 1PPCE 2IJD1 3M7QA 1AY6H 4M7GA 4E06H 4FVBA 1PFXC 2ZF0H 1VITH 5AVDA 1P2JA 2BOKA 2HVYB 1FXYA 1TWXB 1X7AC 3GDUA 1GHXH 1GGDB 1QNJA 1GI6A 3PTNA 2A1DB 1ESTA 1GBDA 1C1VH 2EI6A 2J2UA 1ZJDA 4AOQA 2J98A 1PQ7A 4FUFA 1ZHRA 3K6ZA 5DSFA 3M3TA 5DP8A 5EOKA 4MVNA 3WY8A 2KCOA 1EJMA 1HRTH 4AFQA 2VWMA 5T6GA 3UY9A 1YCPH 1G9IE 1EZXC 3TGIE 1C5SA 1DLEA 1Y8TA 3D23A 4R8TB 3SGAE 1DY8A 5C5NA 5EXNA 4B73A 2Z9KA 1TB6H 1DFPA 1DM4B 1SI5H 3SW2B 1F7ZA 2ZU3A 3A89A 5LPRA 3MNSA 5A8XA 1QIXB 4O9VA 3SNAA 3OTJE 1S6FA 2OUAA 2BD8A 5C2ZA 1BA8B 3ZZ6A 1MTSA 4DIIH 3TPIZ 5JPMH 3KYGA 7LPRA 2J4IA 1AVGH 3B9FH 4X8UH 1TMUH 2OXSA 1AFQC 5JB8S 4DURA 1V2RT 3URDA 2P59A 1TLDA 4RT0A 1TX8A 3TH4H 3V13A 4Z6AH 3IWMA 2BLOA 3HPTB 2BQ7B 2FP7B 4Y7BA 4MPVA 3T62A 2RFKC 1G37A 3ODFA 3E8LA 4H6SB 1CA0B 5AHGH 1NN6A 1NZQH 2J5UA 1CGHA 4P00A 1P2IA 1SSXA 2ZGCA 1N6XA 4Q2KA 5F03A 1RRKA 4X0WU 5T6FA 1SBWA 5EW2H 1TAWA 1O3JA 1BHXB 3GCNA 3GYLB 3M5OA 4HFPB 4AGKA 2JH5D 3CS7A 1CT0E 1V2KT 4CRBA 8KME2 3KF2A 3BIVH 2VGCC 1KTSB 4ISOA 2FOMB 2SGDE 1FAKH 4IMZA 2C3SA 2JH0D 3EGKH 3CS0A 1UW7A 4KTUA 4RSPA 2OINA 2THFB 2A31A 2VIDA 1B0EA 4ACAA 1EZSC 5FCKA 4U32A 1A1RA 1W10U 2QGRA 4OS1A 1E36B 1V2UT 3UFAA 2UUJB 3RXFA 2PSYA 1C1QA 3AW0A 5FHTA 2AMDA 5E0GA 2EY4C 1IQHA 1O3CA 3W94A 2XWBI 1B7XB 3QGJA 1J17T 1D4PB 1XKAC 3PROA 3WWBA 1HAHH 2ANYA 4JZEH 4FUIA 1V2PT 5DJ7A 4MPXA 3BTGE 1HB0B 1QRZA 2WV9A 2FDAA 2BD4A 1ELEE 3TK5A 4NWLA 1VITG 3SV8A 4TPYA 4A1XA 3LPRA 3NCLA 3KIDU 5JBCS 1ZGIA 1PQ5A 2H2ZA 1EB2A 1NU9A 1Y3YA 2Y6TA 1A3EH 2C4FH 2F9UA 1YPMH 3UQVA 1SGFA 1O3GA 3LKWA 4HZHA 2GD4B 2L6OA 3VB3A 1A5GH 1O3PB 7GCHG 2WINI 4NWKA 2LNCA 2ZGBH 1BTWA 5LH8A 2GT7A 4D9QA 3PWCA 1EZUC 1AMHA 5CHAB 3RLYH 1GI4A 2EA3A 2H6MA 4IGDA 5C3NA 1MTUA 1P2NA 2WPIS 1SOTA 1DX5M 2PR3A 3SJOA 3M7UA 1Z8JB 2HWLB 2OLGA 1W3CA 4TY7A 4Y76A 4B2CA 1YPHC 3RMLH 4D76A 1CVWH 3V0XA 1Y3VA 3PRDA 2XC4A 1GBAA 1MD8A 5ESTE 1QCPA 3ZVGA 1O5DH 1KTTB 1QBVH 1C5ZB 1LHGH 3N7DA 1C9PA 3SOSA 4WJG2 2ZPRA 3JZ1B 3IITA 1WOFA 1QL7A 1TNGA 2OD3B 4FUDA 2QF0A 2GMTB 2TIOA 1CT2E 2NU1E 2XTTB 4HGCA 1GJ5H 1XUFA 2EI7A 1TNLA 3LIWA 1JXPA 5EXMA 3AASA 5GXPA 2D2DA 1O2HA 1A61H 3MQKC 1P2KA 3SU6A 1AWFH 1DSTA 4LZ1H 1S81A 5K7RA 3BTQE 1O2NA 2GTBA 3DD2H 3RXUA 1QRWA 3LONA 3VXEH 1Y5AT 2FMJA 4ACBA 1SC8U 1SFQB 4CH8B 5C1XA 1SGEE 1ELAA 1O2LA 4CRDA 5F6MA 1D3QB 1VCWA 3L6PA 4BAHB 1L1JA 1VCQA 1JMOH 2YMSC 2V3MA 1LKAA 1C5RA 3I78A 1QQ4A 2FYRA 3LU9B 5I46H 3UUZA 4D8NA 2Z94A 4DIHH 1S82A 5JBAS 1AGJA 2ZFTA 5FAHA 3D62A 4H4FA 2ZHEH 1OHHD 3GICB 1NS3A 5CHBA 1ELFA 2EEKA 4DT4A 3M7TA 4FUCA 1BTHH 1VKYA 2O8WA 1A7SA 3NKKA 1AZ8A 2Z6BD 3GDSA 1TMBH 2GCTB 2Y5HA 4K1EA 3GCHC 1AB9C 2O8LA 4OM9A 2Q1JA 1KDQA 3GCTG 2OC7A 3ATLA 1KYNA 5TCCA 4KKDA 2FTLE 4TWYA 3TIUA 1XM1A 3FFGA 2F43B 1ZPCA 4J1YA 5C94A 3W1EA 4X2XA 5A2MH 2WPJS 1OWDA 4Y8YA 4BXWA 1MMJN 1MKXK 2ZDMA 2RDEA 1BTXA 4WXVA 4INLA 3OEED 3NWUA 3RXLA 4BNRA 1BMLA 1GI8B 1EP5A 1JIRA 1C5OH 1P9UA 1GVLA 3RXRA 4CR9A 3P8GA 1BDAA 4JZIA 3OSYA 1P3EA 1O2ZA 1WTGH 3K65B 3RXKA 1GJDB 3SV2H 3QTVH 3BV9B 2BY6X 1P09A 3SV6A 1YWUA 2YMSD 2ZQ2A 2GP9B 3BEUA 4MNVA 4MDSA 4ZH8A 2P3TB 4E7RG 1D3PB 1FX0B 4YOIA 3PO1B 1ZMNA 2W7SA 3OAAD 4ABEA 1EASA 1MQ6A 5JBTA 4XBBA 1SB1H 2PKAA 2W3IA 5E0JA 1BT7A 1O3EA 4AB8A 1BHXF 4NFFA 4X6NA 5L30H 3PV2A 1BMFD 1ELCA 3RDZA 2BVSH 3STIA 2BLWA 1S0QA 3MI4A 3M3SA 5EGMA 2ZDKA 1HAVB 2FO9A 3PLPA 1SLUB 1BTPA 5DPAA 3A8BA 1THRH 3U8RH 1MAXA 1EJAA 2A7HA 2PUXB 2A2XH 1CA8B 2J95A 1ZPBA 1FV9A 1TRMA 3OX7U 1T31A 1FAXA 4XBDA 2Z3CA 3EA9A 1OKXA 2BM2A 1F0RA 1NBMD 5C0UA 3LGVA 1TOMH 1GI9B 3A8DA 1WQVH 4RN6A 1G3CA 1ANEA 3U98H 4AFUA 2GZ8A 5HYOA 3V12A 2ANWA 2FXRA 3GCOA 5F8TA 1W0KD 1BJVA 1CT4E 1JOUB 2V35A 1ZHPA 3A8AA 2ZHQH 4WY3A 2SGAA 1Y3XA 2GV7A 2VH6A 7ESTE 3I77A 1H8HD 2Y7XA 1O3BA 2B8OH 4NIXA 2HLCA 3DSGA 1TBRH 1H8DH 5JB9S 2W7UA 2PV9B 2R2MB 3FZDA 1SKYE 2F9BH 1IQEA 2ALVA 2KZ4A 4RI0A 2BQWB 1XVOA 1CBWC 1F2SE 2J34A 2ZTXA 2H1UA 1T32A 4WMEA 2ZDVH 4A6LA 1O2WA 1GMHF 4MTBA 4Y8ZA 5T1VA 2ZCHP 4ZXYH 2FOEA 1GI2A 1FI8A 2O8UA 1C1SA 2FX6A 2NWNA 2A5IA 3F6UH 2CN0H 5GCHF 1BRUP 3VG8A 2BD5A 1ZLRA 1WV7H 1FY5A 2H9TH 4FU9A 4GAWA 4Q7ZA 2VU8E 1O3IA 2BXTH 5BRRE 3UTUH 1UTKA 2IN2A 4JK5A 3T28A 2XC0A 3ZZAA 2C8ZB 1O3OA 4TPIZ 2WSSD 1VCPA 1XVMA 3O8RA 1C5WB 3VGCC 2VINA 2SGEE 2BY7X 2FYQA 4UE7H 3B8JA 3E16B 2FOAA 2A4GA 1AVWA 2R9PA 3OY5U 3TH2H 2QXHA 1VGCB 4ZHAA 4Y7AA 1ANDA 1GBFA 1O2QA 1AZZA 1GHWH 3MH5A 3ZYDA 1ELGA 3DFLA 3SNEA 2GT8A 1TBQH 2BD9A 3Q3XA 1P2QA 1W11U 2KCAA 3ZZ9A 2V7QD 2Q6DA 3KQEA 1TYNA 1MCTA 1S5SA 3N7OA 1TONA 4YO9A 4OGXA 3UB0A 8ESTE 1SFIA 3MH7A 1BTZA 2ZGHA 4CHAC 3SU1A 4AFSA 3VXFH 3LH3A 1S6HA 1AKSB 2TRMA 3ZIAD 5SGAE 3T2NA 1O2SA 1LHCH 3MNCA 1LHDH 2BLVA 3F9HA 4KTSA 4AZ2B 2J97A 5A8YA 1WU1A 3O8DA 3GDVA 3EAJA 3A86A 1ZSLA 1LO6A 1JRSA 4ABHA 1YGCH 3SQEE 4DT7B 2D8WA 1MTVA 1FY4A 2FEQH 2FS9A 1MAYA 2CHAC 1LMWB 3K9XB 1N6YA 1GBHA 2BOHB 3UR6A 1W13U 5C5OA 4I8HA 3A7WA 2VB0A 4K3JA 2SFAA 3V3MA 1C5QA 1SOZA 4FOUC 1UK3A 4A1TA 3RU4T 2BDGA 3ZVDA 1UHBB 2WV5A 3SI3H 5DP4A 4WMFA 5EQRA 5E0HA 4JK6A 1GVZA 3A7TA 1UCYK 1C2IA 1EAWA 1XUHA 3WWFA 1TPPA 1WTHD 4LOYH 2SNVA 3KHVA 5DG6A 1MABB 2B5TB 3P92A 1K1LA 4D7FA 2WPLS 3ZZ4A 2ANKH 2O8MA 3LDXH 4ZMAH 1OPHB 3A85A 1WBGB 3LGTA 3M36A 2JETB 4ABFA 1YKTA 1NFWA 1P12E 4B76A 2ZHFH 3ATIA 1PPFE 4YT6H 3GYMA 1MBMA 1ANBA 1YYY1 2IOTA 3TJUA 3R3GB 5DP9A 1IOEA 4ZHLU 4ZKNU 1GJ6A 3KQ5A 1O30A 3FP7E 2A7CA 1SLWB 1W0YH 1LKBA 1C2JA 1Z8IB 1TGTA 4Q80A 3SU4A 1UTNA 1SGQE 3SQHE 4ESTE 1MU8B 2ZI2H 2P16A 1C2KA 1D6RA 4QT8C 4X6MA 3P8FA 2A0QB 2D26C 1C1OA 3BG8A 2A32A 3LOXA 2RA0A 4NIWA 1PPEE 1LVBA 3RXSA 1GHZA 1GVKB 2HLDD 1EX3A 4AC9A 1XUKA 3HGPA 2YNAA 1P57B 3BTME 3BTKE 3G01A 1F5LA 5IYTA 1DDJA 1GMHG 1FN6A 3GISB 3NRLA 1FPHH 5A8ZA 1JBUH 1DWEH 3EA8A 2FZZA 1AQ7A 1TFXA 2XCFA 1GMCF 4UFDH 4Y6DA 1DY9A 3DHKH 4UFEH 3RXVA 2AERH 1IAUA 2KX4A 1BBRE 1O39A 1SL3A 2JIZD 1ARBA 1P10A 3AW1A 4Y0ZE 4D7GA 2G52A 3RXQA 1C5VA 1ZTLA 2BZ6H 1HCGA 1OX1A 4K2YA 2RCEA 2PTCE 2XNDD 1CGJE 1HPGA 2GJGA 3UOUA 2A4QA 4ISNA 5EODA 1ZSKA 4O3UA 2FODA 2HGTH 4FETA 1MKWH 4GSOA 4E05H 1D6WA 5HIZA 3RMMH 6GCHF 3SUEA 1XUIA 4JYTA 1KY9A 3UREA 3BTWE 3F9GA 3GY7A 4FUBA 2OC1A 1AFQB 1LQEA 2V3HH 4A1VA 2LELA 2VIQA 4LZ4B 3S9CA 1H9IE 2AEIH 4ZXXH 4UONA 2L74A 3D49H 5EPNA 1H4WA 1O2YA 2SNWA 2ZEBA 2AGEX 1YC0A 3P6ZB 4B71A 1BBRH 1LCYA 5A0CA 2I6SA 4XE4A 1SGYE 3GY2A 1HNEE 1DITH 1O2TA 2Y81A 1VJAU 4K5ZA 4X8VH 3SJIA 3T26A 2ZWLH 1EAIA 3T25A 1C4U2 2BY5X 3ELAH 1UK2A 2VGCB 1EOLA 2GCHF 1HIAA 2ULLA 1SQRA 1IQKA 1UTOA 1TX6A 3PMAB 2QC2A 3F2FA 5DKMA 2QA9E 1WUNH 1O3HA 2W26A 4LK4A 1NT1A 3K6YA 1BMNH 1FIWA 3CENA 1CSOE 2QXGA 2RG3A 3MO9A 4I31A 4NG9H 1L1GA 1HAXB 1SVPA 3N7EA 1W14U 2BDBA 4CBOA 4XD7D 4JYVH 1RJXB 1GJAB 1V2NT 3ZZ5A 1QB1A 4GCHF 4X6OA 2ZHWH 1EOJA 1TGBA 1ID5H 2LP6A 1W2KH 3ZVFA 4I8JA 1XXFA 2QY0B 3FANA 2XBXA 2ZPQA 5E8EH 2OP9A 1TPAE 1YPEH 4CH2B 1FIZA 4X2YA 3SUFA 3ITIA 1O38A 2OCVB 1QJ6B 2FLBH 3SNCA 1K1NA 2AH4X 4X6PA 3SU3A 3P8NA 3OE7D 2K0QA 3SORA 1C2MA 2G51A 1C5PA 3MMGA 1ORFA 2RDLA 2B7DH 5ESBA 4B1TA 4TWWA 3LGWA 3TK9A 1OWHA 2UUKB 4XBCA 2GDEH 3SN8A 1P2OA 5FPSA 2CV3A 3Q00A 5LGOA 2ZCLP 3GY6A 1WQSA 1V2VT 3LGIA 3GY5A 4B2AA 3BG4C 1QA7A 3A81A 2QCYA 1SG8B 4TT3D 2NU2E 2PKAB 2ZA5A 2QN5T 5CE1A 2ZQ1A 3F1SB 3MU5A 1O37A 1GMDF 2BD2A 2F83A 2AMQA 3UQOA 4DCDA 1AHTH 1EPTC 3A8CA 3TJOA 1OWJA 1YY3A 5C20A 1M9UA 5GDSH 4Z0KA 1DSUA 2A5AA 5TCAA 4AYVB 1FY8E 2CK3D 1DICA 3SHCH 5DP6A 5BPEA 1AWHB 3H7OA 3KNXA 1UK4A 1LHEH 3BTDE 2GZ9A 5DP3A 4BAMB 3D65E 1YPJH 2BDHA 4AN7A 2OBOA 3PV4A 1G2LA 1GBIA 1GI5A 3E1XB 1U6QA 5EXLA 1GMCG 1K22H 3E91A 1K1MA 2W3KA 1TX7A 4U30A 2FI5E 1TIOA 3MO6A 1N8OC 1GL1A 1O3DA 1O3LA 1ETTH 4OS7A 2BLQA 3M35A 1QZ8A 2KAIA 1A0JA 1ESAA 4BOHA 4K69A 2XXLA 1C5XB 4JCNA 3VB6A 2QXIA 1V2OT 4B6FA 5AFZH 1DXWA 3M5MA 1IQIA 1UVUH 1D3TB 1A4WH 1BJUA 2Z7FE 5AFYH 1DUEA 3M5LA 1BZXE 5C0TA 5LPEA 1UTQA 3MTYA 1NPMA 3SO3A 2YMSB 1DS2E 3ZZ3A 3MU4A 3ZZDA 1UTMA 2BY8X 1C5MD 4WH6A 5DP5A 4YESB 1KXDA 2TGTA 4DOQA 2J92A 4DY7B 1Z1JA 4ZHMU 2GVFA 2ZFFH 1Y59T 3SGBE 1ANCA 3SZEA 5FL7D 3CNRA 4Q7YA 2FS8A 5I25A 2A45B 2OTVA 4IN2A 2OC0A 4B2BA 5C1UA 1S85A 1HAPH 5IDKA 2VNTA 1YLCA 1IQLA 3GCHB 1AB9B 2A7JA 5HKKD 2VVVA 4DG4A 1HLTH 2YOLA 4O3TA 5EJZA 2BDCA 3KL6A 2CGAA 1HGTH 3RXGA 4I32A 5L2YH 1DXPA 1GBMA 1YPGH 1RS0A 2ZU1A 3N99A 2ALPA 1GI1A 2BXUH 4AX9H 2H9HA 1TQ7B 2G5NA 4X1RU 3PLBA 4CRGA 1TALA 2A4RA 3RP2A 2QYIA 2R3UA 1B0FA 4I86A 2BB4A 1BUIA 1PJPA 5JBBS 1HJAC 3HATH 1OOKB 2J38A 5G4BA 2JJ1D 2NU0E 6LPRA 1NY22 1T7CA 1NO9H 3EE7A 1HAOH 3TVJB 4NA9H 1BTUA 1V2JT 3S9AA 5FPYA 2H5DA 1H8IH 2DE9A 1FLEE 4GCHG 1AFEH 3RXCA 1FONA 3OY6U 5FXLA 5H4IB 3SU5A 1QRXA 2WUBA 3ODDA 3V7TA 2HNTC 1EQ9A 2G00A 2P8OC 4UFGH 3UNRA 1Z8GA 3RXJA 4A92A 3QDZB 3ZV8A 4ABGA 8LPRA 1O5FH 1C4Y2 1QL9A 2CF9H 3U9AH 2Z3EA 1AD8H 4RKOB 4AG2A 1CHOF 1EPTA 1O36A 3KGPA 3PB1E 2AIPA 4VGCC 1KLJH 3E0NB 8GCHF 1Z1IA 1ZJKA 3BTHE 1QURH 1HDTH 2P94A 2FOFA 3T29A 3A84A 3BN9A 1GHAF 1O32A 4Y8XA 4E7NA 4DGJA 1O5AB 3RMOH 3OU0A 1P03A 1QA0A 1ZTKA 3MFJA 1THPB 2R3YA 3A82A 3MH6A 5PTPA 3BTTE 6CHAC 3DSPA 2V3OH 1BRCE 1TOCB 3DT0H 4GUXA 4XSKU 2XOKD 4ZCNA 1RIWC 3H09A 5FX5A 2QF5A 1F0TA 4CRAA 1S0RA 2FI3E 2EQNA 3TNSA 2WPMS 4NCYA 3SUGA 2F91A 3MNXA 1EJNA 1TNHA 1FUJA 1C1TA 3RU4D 2J9NA 3SJ8A 3AK5A 5E2OA 1Q31A 4CRFA 1GDNA 1CBWB 2ZP0H 3C27B 2Q6GA 3IG6B 1C1MA 3AAUA 3LJOA 2W5EA 1INCA 1MBQA 1WYKA 4I8LA 3PWBA 2PW8H 3DFJA 3OEHD 1OWEA 5T3HA 1C2HA 1OWIA 4K1TA 1MZAA 1IQGA 3E0PB 1O5BB 3GY8A 2BVXH 2G5VA 1H9LB 4NFEA 1ETRH 1WSSH 4NIVA 1Z71A 3AAVA 3RXIA 1P04A 1K1OA 5FPTA 1VJ9U 4K8BA 3VB7A 3UAIC 3VGCB 3UOPA 1N1LA 1D9IA 2WHXA 1SGPE 3M5NA 2FX4A 5CMXH 2ZU2A 4ISLA 3ENSB 3PTBA 1UMAH 3PM3A 3T27A 1P9SA 3MH4A 1BCUH 2R0LA 3PMBB 4GHTA 4UFFH 4B74A 2HVXA 1O2IA 1GCTC 1P3CA 1TNJA 4HG6A 1P0SH 1UTJA 4WMDA 2J98B 4IN1A 2F9NA 1OP0A 5DP7A 1BTYA 1SGNE 2VBCA 4Y71A 1KXAA 1AIXH 3RXEA 5L2ZH 1LVYA 5A0AE 3U69H 2PHBA 3JZ2B 4CHAB 4YZUA 2AGIX 3NXPA 1GG6C 3SUDA 3HK3B 1C4V2 1V6DA 2K1QA 1BQYA 4ASUD 2ZG0H 2FTMA 4INKA 3BTFE 5T6DA 5K0HA 1C2FA 1MH0A 3GS9A 5EG4A 3TNTA 4BAOB 4BAKB 1CGIE 1OYTH 3A7XA 5CDFE 3QUMP 1OP8A 1COWD 1O2GH 3F9EA 1GHBF 1KMHB 4P02A 1GPZA 1XUGA 2AFQB 1XKBC 4MNYA 3ZZCA 1SLVB 2CHAB 3F2HA 1C1UH 2Z9GA 3FZZA 4J2YB 4NZQA 1O5GH 1OXGA 5GIBA 1C5NH 1NRSH 1HAVA 2C93B 1F0SA 3E3TA 1LTOA 1HXEH 4BANB 3GOVB 4IC6A 1ELTA 3PV5A 1SR5C 2OQUA 3Q76A 4AG1A 2ANMH 2PWXA 5HMAA 3F0OA 1YP9A 4HI3A 1H9HE 4U2WA 3BEFB 3EQ0H 4XFQA 1ELDE 3OFND 1SGRE 5JDUB 1C2EA 2BQ6B 4FU8A 3MU1A 1BRBE 1HIAB 2UUYA 3WW7A 2ZFRH 1MTNC 5E2PA 4ASHA 1F92A 1QBOA 5HM9A 1PPGE 1ZYOA 1TGSZ 1FDPA 1V3XA 1VITF 1RFNA 1UVOA 2BTCE 2SGFE 3S7HB 1QL8A 3RMNH 1YCPK 5EIYA 4FXGH 1TABE 3MYWA 1UCYE 5EJ1A 1AE8H 3UR9A 2ODYB 1ZRBA 2AMPA 2VVUA 4WWYA 2ZKSA 3O8BA 4ISHH 4JZFH 3RM2H 3S0NA 3ATKA 1A46H 1QB6A 3E6PH 1AUTC 1QR3E 3P95A 2ZGJA 3ZZ8A 1MKWK 4ZUHA 1DWDH 5EU8A 1GI7B 4F49A 1S84A 2VJ1A 4JZ1A 1S6LA 1PYTC 3NUMA 4NGAH 4F4OC 1YBWA 2JKHA 2XBVA 1O3FA 1CE5A 1LQDB 4X1SU 3RC4A 1RTKA 5ABWA 1LPGB 1O2KA 2OK5A 1HYLA 1UJ1A 4M9FA 2Y7ZA 1E0FD 3T5FH 3QX5H 3NZIA 3RM0H 4Y10E 3LC5A 1HAGE 2PKSC 2BDYA 5EQSA 2Z9IA 1QQUA 1TRNA 4R0IA 1KLIH 4UDWH 3RXTA 2PGBB 3L33A 1J14A 1YPKH 1YPLH 5GCHG 1SQOA 1YCPM 4Z1MD 2ZHDA 3LH1A 4B75A 4I8GA 3MHWU 5GNDA 1WDIA 4FUJA 3NK8A 1FY3A 1GGDC 1OP2A 4NZLA 2LPRA 1KXBA 1CQQA 4JMYA 4A7IB 1KXFA 1C2DA 1L4DA
chains in the Genus database with same CATH topology
2GV6A 1SMFE 4YOJA 1W7XH 2SGPE 3BEIB 3M37A 5A0BA 2BHGA 2F9PA 5TJXA 3SU2A 2WV4A 2EI8A 1OS8A 1GCDA 1RTFB 2AIQA 2ZECA 3HKIB 1GJCB 4BTUB 2TGAA 4I33A 3U1IB 1QBNA 4Y11E 1RTLA 1AKSA 1GHYH 4YLQH 2PTNA 1TQ0B 1UTPA 1LPKB 3QO6A 1JRTA 2BZAA 1G36A 4MLFB 1EATA 3GY3A 4OS4A 1PYTD 5B6OA 1RGQA 3PYHA 1NC6A 4O03A 3O8CA 1TMTH 1Z8RA 2XCNA 3P17H 2NU4E 2KAIB 3KQDA 1ZR0A 4JZDH 3EYDA 5FBEA 2Y82A 2VVCA 1IQFA 5JYIA 1CA0C 2FOBA 1T8LA 3KQCA 4IW4E 4ABJA 3SNDA 2FPZA 1O33A 2PSXA 3SGQE 2O8TA 1K1PA 1Y5UT 1T8OA 1ETSH 1ELBA 1Z7KA 4O97A 5DK1A 1XX9A 2WUCA 3GCTF 2FLRH 3SV7A 1FMGA 1ACBE 1K1JA 4SGAE 1GHBG 1UHBA 1PPBH 2XC5A 3KEEA 2CXVA 1GWAA 2ZIQH 2BYAX 2FIRH 1LVMA 4GHQA 2STBE 2HPQH 1QB9A 1GBKA 1DOJA 1HFDA 1Q2WA 1GHVH 3EDXB 3ZVEA 2CJIA 1O3KA 1Q3XA 1SHHB 5DO4H 3QZRA 3SV9A 3SBKA 1KDQB 2HPPH 1P2MA 3LT3A 2VWLA 1K21H 4X2WA 1GBTA 1GJ8B 1CU1A 1ESBA 2V6NA 1O2JA 4YOGA 4X1NU 1TPOA 3ATWA 3FAOA 3M3VA 1TBZH 3U8OH 3QGNB 1DUAA 5F8ZA 1HV7A 1HAIH 2QIQA 3FP6E 1DWCH 1RD3B 1P06A 1P05A 3S7KB 1GJBB 3DA9B 4MNXA 2CMYA 2BX4A 1G32B 2EC9H 1HAZB 2GKVE 2C8YB 1K1IA 3SI4H 1EB1H 4K60A 1W0ZU 3MOCA 1C5UA 1EP6A 1BRAA 2ODPA 1FY1A 2BMGB 1SQTA 1NFYA 3HGNA 1FN8A 1F0UA 1J9CH 2BDIA 2ASUB 4MG3A 1C9TA 2B9LA 3RXHA 3VEQB 2ZFQH 1TGCA 4NA7A 3TH3H 1TA2A 1MZDA 1O2XA 3L3TA 1A5HA 3URCA 4AB9A 2P3FH 1FNIA 3BG4B 1HXFH 1TNKA 5CHAC 1KLTA 2C8XB 2UWOA 1TE0A 4GLYA 4H42U 3VPKA 2A2QH 1NTPA 1UVPA 1KIGH 1KXEA 3A87A 4NSYA 1DVAH 3RC6A 1W8BH 3UWJH 3Q3KA 1CO7E 2M5TA 2ZDLA 1GBLA 1GDUA 2BX3A 3PMHB 3F9FA 1EPTB 2F9OA 4IMQA 1MU6B 2G55A 4MNWA 3LGYA 4Q7XA 2VIWA 1HBTH 1ZOMA 1L2EA 3BF6H 3GY4A 4KELA 1G30B 1O3MA 2B0FA 1AE5A 1ZRKA 1THSH 3RXOA 3AVZA 1IQNA 2STAE 2G8TA 1TA6A 1YLDA 2Z9JA 4YM9A 1C5LH 1O2MA 2GZ7A 2GMTC 4BTIB 2FESH 3E90B 3A80A 3ZVCA 4A5TS 4IBLH 3VFEA 4AFZA 1P01A 4THNH 2GX4A 5EPYA 4ZKRU 1WCZA 3EA7A 3MU0A 4H6TA 2HALA 1DPOA 1KXCA 2VIOA 1Z6EA 3FP8E 3H5CB 2ZO3H 1N8OB 5J4SA 3A7VA 1LHFH 3SZNA 2D1JA 1QHRB 2Y80A 1QJ1B 1CHGA 1GBBA 1P8VC 1UVTH 2FOGA 1E35B 1QFKH 2ZDNA 1J15A 6GCHG 1C2GA 1G2MA 4LXBH 2XBWA 2Y5GA 5ETXA 2Z9LA 1MTWA 3KN2A 1SLXB 3K2UA 1NM6A 4YT7H 2J94A 3RUOA 1AO5A 2ZFSA 3A83A 1SGCA 6ESTA 1DWBH 2R0KA 2H5CA 1JIMA 1QGFA 9LPRA 5GJ4B 1BMMH 4MPWA 3QLPH 1LPZB 4MPUA 2OC8A 2GCTC 1TNIA 1D3DB 2TPIZ 2OBQA 2FI4E 2FOHA 1O5CB 2ZU5A 2XYAA 2TGPZ 2BD7A 1NFUA 1NRPH 2GCHG 1F5RA 3ATMA 2TBSA 2HRVA 3RXAA 2ZC9H 3Q77A 1G3BA 4X1PU 3UNSA 2OQ5A 4NSVA 2XRCA 5C67A 3HK6B 1Y3WA 4XDEA 1OYQA 2P93A 2VIVA 2ZDAH 4KTCA 1EKBB 1YM0A 2VH0A 1PPHE 1L1NA 1F5KU 1GL0E 4OS5A 1AI8H 3RC5A 1HJAB 4CRCA 1GBEA 2UUFB 2I6QA 4OS6A 2A4OA 2XBYA 3KCGH 2VWNA 3U8TH 1XXDA 1UO6A 2ZU4A 3QN7A 1AVXA 1C1WH 1V2QT 4UD9H 2ZNKH 5HM2A 3SHAH 3SNBA 1O2PA 3TU7H 1A0LA 5C1YA 4WVPE 4MQAA 3RXDA 3PO1C 3EE0B 1K2I1 4ABIA 3I29A 1L4ZA 1ABJH 3P8OA 3ZV9A 1IQJA 2P8OB 2Y5FA 4JYUH 1C2LA 2P3UB 2QAAA 4AYYB 1OSSA 1IQMA 4NIYA 4U01A 4X8TH 2DUCA 1TGNA 3LGUA 1VZQH 2QF3A 1A3BH 4VGCB 2FWWA 3ZZBA 1ZSJA 1FPCH 1DANH 2WYJA 1MKXH 5GPIB 1GMDG 2FOCA 4ZAEA 4UEHH 5F8XA 3BIUH 1C1NA 2IJOB 2PGQB 4PROA 1QTFA 2F9VA 2TGDA 4BAQB 3MU8A 1FJSA 6CHAB 4YTAA 4FUHA 1RIWB 2FM2A 3ZZ7A 3TGJE 3BSQA 1BMAA 1BIOA 4FUGA 5J4QA 2G81E 1V2WT 2UWLA 2PFEA 3RXMA 3UPEA 2JH6D 1B5GH 1BB0B 3PMJA 1EZQA 1DLKB 3R0FA 2C90B 2ZFPH 1NESE 1W7GH 4BTTB 1C5TA 1ZPZA 4OGYA 1ZMJA 1PQAA 2Z3DA 5GWZA 2BVRH 3NPSA 4NA8A 2SGQE 2ZZUH 1QY6A 4I7YH 4FUEA 3RLWH 1YF4A 2VWOA 3HKJB 3RXBA 1EAUA 1T4UH 4GPGA 4X8SH 3RXPA 4DW2U 1O5EH 1NU7B 2XNIA 2ILNA 1G3EA 3ZVAA 4FU7A 1NFXA 2QV1A 1FZZA 4TYDA 2BY9X 1MUEB 5L6NH 1ELVA 1OWKA 1GJ7B 1SGFG 5DGJA 1O2UA 3MWIU 1NROH 1W12U 4CR5A 5FBIA 1G3DA 3KQBA 1A0HB 1O2RA 4DVAU 3TITA 2BDAA 4WF8A 3C1KA 3LJJA 1VGCC 3PLKA 2IPHA 4FVDA 1YPHE 3B23B 1L0ZA 4IC5A 1T8NA 1T4VH 3A88A 3STJA 5HGGA 3U1JB 1MD7A 1BITA 1IHTH 4ZKSU 1GDQA 1Z6JH 3QTOH 1DT2A 3VB4A 2R2WU 1C1PA 2ODQA 1GCTB 1GJ9B 4D9RA 2DE8A 2XW9A 3ESTA 3FVFB 3OYPA 5A09A 1Y3UA 1O34A 1KSNA 2GDDA 2XWAA 1ZZZA 1EXFA 1JWTA 3SJ9A 3QZQA 1EAXA 1FQ3A 1GG6B 2GGVB 1PQ8A 2CF8H 4DJZB 1E34B 4AGJA 1NRQH 1O31A 2WPHS 4X2VA 3UNQA 1MQ5A 2V0BA 1IHSH 4WXIA 3UWIA 1O35A 3VB5A 2VIPA 4IS5A 2ZTYA 4KGAA 2ZTZA 1ZGVA 2UWPA 3TK6A 5AF9H 2AS9A 4INHA 1NRNH 2A5KA 1GI3A 4ABAA 3DUXH 1VR1H 4OS2A 4SGBE 3SU0A 3ZYEA 1LDTT 2G4UA 1AN1E 2AYWA 2O9QA 3S69A 4HTCH 1PPZA 3H7TA 1QJ7B 4CBNA 3W95A 3TLOA 1HJ9A 1XUJA 1ARCA 3P70B 1H1BA 3MNBA 5FX6A 1ZMLA 2ZPSA 3TGKE 2ZGXH 4RKJB 5EQQA 2YNBA 1SQAA 1T8MA 1WAYB 2BD3A 1UVSH 3M61U 1CHOG 2C8WB 2QXJA 1UTLM 2AGGX 1O3NA 1ZTJA 2HOBA 1SHYA 1SGDE 3CP7A 1V2TT 1J8AA 3S9BA 1V2ST 8GCHG 1HJ8A 1ABIH 1J16A 1MTNB 2H9EH 1V2MT 2WYGA 3A7YA 7KMEH 4ABDA 3A7ZA 1GJ4H 5HXFA 1E38B 1O2OA 2ZCKP 2NU3E 1V2LT 2JETC 1K9OE 1TPSA 1GHAG 4ABBA 5FCRA 1HAYB 5LPFA 1TRYA 1HUTH 1MCVA 3MO3A 4TY6A 1GBCA 2PUQH 4YLUA 4BXSA 1RXPA 2P95A 4X1QU 2ESTE 2F3CE 1EUFA 4I8KA 4ISIH 2Q6FA 1C5YB 4CREA 7GCHF 4GVUA 4K1SA 4AORA 1Y5BT 4K8YA 1GI0A 1P02A 1BOQA 3SJKA 1O2VA 1AUJA 3LC3A 1SGTA 1AU8A 1P11E 3BTEE 1LVOA 4XOJA 1SGIB 2HNTF 4WH8A 1ZHMA 3QWCH 4KP0A 1SPJA 1A5IA 3TJNA 3F68H 3ZVBA 1S83A 1K28D 1NRRH 3Q3YA 4Y79A 1E37B 3QK1A 1O3AA 1BBRK 2G4TA 3TJVA 1GBJA 2RA3A 1A2CH 9ESTA 5EW1H 4ZKOU 2PKSB 1O0DH 1C1RA 1XMNB 2PLXA 4ZROA 3RU4E 1UCYH 1DE7H 4Y0YE 2HNTE 3UIRA 2WPKS 1PPCE 3M7QA 1AY6H 4M7GA 4E06H 4FVBA 1PFXC 2ZF0H 1VITH 5AVDA 1P2JA 2BOKA 1FXYA 1TWXB 1X7AC 3GDUA 1GHXH 1GGDB 1QNJA 1GI6A 3PTNA 2A1DB 1ESTA 1GBDA 1C1VH 2EI6A 2J2UA 1ZJDA 4AOQA 1PQ7A 4FUFA 1ZHRA 3K6ZA 3M3TA 5DP8A 5EOKA 4MVNA 3WY8A 1EJMA 1HRTH 4AFQA 2VWMA 5T6GA 3UY9A 1YCPH 1G9IE 1EZXC 3TGIE 1C5SA 1DLEA 1Y8TA 3D23A 4R8TB 3SGAE 1DY8A 5C5NA 5EXNA 4B73A 2Z9KA 1TB6H 1DFPA 1DM4B 1SI5H 3SW2B 1F7ZA 2ZU3A 3A89A 5LPRA 3MNSA 5A8XA 1QIXB 4O9VA 3SNAA 3OTJE 1S6FA 2OUAA 2BD8A 5C2ZA 1BA8B 3ZZ6A 1MTSA 4DIIH 3TPIZ 5JPMH 7LPRA 2J4IA 1AVGH 3B9FH 4X8UH 1TMUH 2OXSA 1AFQC 5JB8S 4DURA 1V2RT 3URDA 2P59A 1TLDA 1TX8A 3TH4H 3V13A 4Z6AH 3IWMA 2BLOA 3HPTB 2BQ7B 2FP7B 4Y7BA 4MPVA 3T62A 1G37A 3ODFA 3E8LA 4H6SB 1CA0B 5AHGH 1NN6A 1NZQH 1CGHA 1P2IA 1SSXA 2ZGCA 1N6XA 4Q2KA 5F03A 1RRKA 4X0WU 5T6FA 1SBWA 5EW2H 1TAWA 1O3JA 1BHXB 3GCNA 3GYLB 3M5OA 4HFPB 4AGKA 2JH5D 3CS7A 1CT0E 1V2KT 4CRBA 8KME2 3KF2A 3BIVH 2VGCC 1KTSB 4ISOA 2FOMB 2SGDE 1FAKH 4IMZA 2C3SA 2JH0D 3EGKH 3CS0A 4KTUA 4RSPA 2OINA 2THFB 2A31A 2VIDA 1B0EA 1EZSC 5FCKA 4U32A 1A1RA 1W10U 2QGRA 4OS1A 1E36B 1V2UT 3UFAA 2UUJB 3RXFA 2PSYA 1C1QA 3AW0A 5FHTA 2AMDA 5E0GA 1IQHA 1O3CA 3W94A 2XWBI 1B7XB 3QGJA 1J17T 1D4PB 1XKAC 3PROA 1HAHH 2ANYA 4JZEH 4FUIA 1V2PT 5DJ7A 4MPXA 3BTGE 1HB0B 1QRZA 2FDAA 2BD4A 1ELEE 3TK5A 4NWLA 1VITG 3SV8A 4TPYA 4A1XA 3LPRA 3NCLA 3KIDU 5JBCS 1ZGIA 1PQ5A 2H2ZA 1EB2A 1NU9A 1Y3YA 2Y6TA 1A3EH 2C4FH 2F9UA 1YPMH 3UQVA 1SGFA 1O3GA 3LKWA 4HZHA 2GD4B 3VB3A 1A5GH 1O3PB 7GCHG 2WINI 4NWKA 2LNCA 2ZGBH 1BTWA 5LH8A 2GT7A 4D9QA 3PWCA 1EZUC 1AMHA 5CHAB 3RLYH 1GI4A 2EA3A 2H6MA 4IGDA 5C3NA 1MTUA 1P2NA 2WPIS 1SOTA 1DX5M 2PR3A 3SJOA 3M7UA 1Z8JB 2HWLB 2OLGA 1W3CA 4TY7A 4Y76A 4B2CA 1YPHC 3RMLH 4D76A 1CVWH 3V0XA 1Y3VA 2XC4A 1GBAA 1MD8A 5ESTE 1QCPA 3ZVGA 1O5DH 1KTTB 1QBVH 1C5ZB 1LHGH 1C9PA 3SOSA 4WJG2 2ZPRA 3JZ1B 3IITA 1WOFA 1QL7A 1TNGA 2OD3B 4FUDA 2QF0A 2GMTB 2TIOA 1CT2E 2NU1E 2XTTB 4HGCA 1GJ5H 1XUFA 2EI7A 1TNLA 3LIWA 1JXPA 5EXMA 3AASA 5GXPA 2D2DA 1O2HA 1A61H 1P2KA 3SU6A 1AWFH 1DSTA 4LZ1H 1S81A 5K7RA 3BTQE 1O2NA 2GTBA 3DD2H 3RXUA 1QRWA 3LONA 3VXEH 1Y5AT 2FMJA 1SC8U 1SFQB 4CH8B 5C1XA 1SGEE 1ELAA 1O2LA 4CRDA 5F6MA 1D3QB 1VCWA 3L6PA 4BAHB 1L1JA 1VCQA 1JMOH 1LKAA 1C5RA 3I78A 1QQ4A 2FYRA 3LU9B 5I46H 3UUZA 4D8NA 2Z94A 4DIHH 1S82A 5JBAS 1AGJA 2ZFTA 5FAHA 3D62A 4H4FA 2ZHEH 3GICB 1NS3A 1ELFA 2EEKA 3M7TA 4FUCA 1BTHH 2O8WA 1A7SA 3NKKA 1AZ8A 2Z6BD 3GDSA 1TMBH 2GCTB 2Y5HA 4K1EA 3GCHC 1AB9C 2O8LA 2Q1JA 1KDQA 3GCTG 2OC7A 3ATLA 1KYNA 5TCCA 4KKDA 2FTLE 4TWYA 3TIUA 1XM1A 3FFGA 1ZPCA 4J1YA 4X2XA 5A2MH 2WPJS 1OWDA 4Y8YA 4BXWA 1MMJN 1MKXK 2ZDMA 1BTXA 4WXVA 4INLA 3NWUA 3RXLA 4BNRA 1BMLA 1GI8B 1EP5A 1JIRA 1C5OH 1P9UA 1GVLA 3RXRA 4CR9A 3P8GA 1BDAA 4JZIA 3OSYA 1P3EA 1O2ZA 1WTGH 3K65B 3RXKA 1GJDB