4JCNA

Structure of esp, serine protease from staphylococcus epidermidis
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
216
structure length
216
Chain Sequence
VILPNNNRHQIFNTTQGHYDAVSFIYIPIDGGYMSGSGVVVGENEILTNKHVVNGAKGNPRNISVHPSAKNENDYPNGKFVGQEIIPYPGNSDLAILRVSPNEHNQHIGQVVKPATISSNTDTRINENITVTGYPGDKPLATMWESVGKVVYIGGEELRYDLSTVGGNSGSPVFNGKNQVIGIHYGGVDNKYNSSVYINDFVQQFLRNNIPDINIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamyl endopeptidase
publication title Secreted proteases control autolysin-mediated biofilm growth of Staphylococcus aureus
pubmed doi rcsb
source organism Staphylococcus epidermidis
molecule tags Hydrolase
total genus 55
structure length 216
sequence length 216
ec nomenclature ec 3.4.21.19: Glutamyl endopeptidase.
pdb deposition date 2013-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4jcnA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4jcnA02
1FI8A 3STJA 1GBFA 3SJOA 3SHCH 2D26C 2Q1JA 4J1YA 3S0NA 5FBEA 2BVXH 3SU5A 1J16A 5FBIA 2TPIZ 3SQEE 3SGBE 3KCGH 7LPRA 1G37A 3ZZ9A 2B0FA 2FEQH 1TONA 1O3EA 3CP7A 2CN0H 1P0SH 1L0ZA 4B74A 1MTSA 2ZZUH 2GV7A 2FXRA 3T27A 3HATH 1ZPZA 3UNSA 2GCHG 3GYMA 5DP8A 2QN5T 2VVCA 1FDPA 1SG8B 2XRCA 1RS0A 3MU4A 4BTTB 2J2UA 1QQUA 3NXPA 1RIWB 1ELDE 1O3KA 1UTLM 1Y5AT 1BHXF 1O31A 2H5DA 1MZAA 4DURA 4YESB 1S0RA 3TGIE 2UUYA 2BMGB 5A0BA 4D8NA 1G3CA 1CHOG 1FLEE 1BDAA 4ABEA 1B0FA 5E2OA 2P93A 3RMLH 1NU9A 4BNRA 2G55A 1GJ9B 4DOQA 1F5LA 2H9HA 3U98H 1YPGH 2C8XB 2GZ7A 1E35B 4UE7H 1P3CA 4CRGA 2ZHFH 3A87A 3GICB 4IGDA 4DGJA 1KDQB 3RXVA 1HAIH 2Y7XA 4ZUHA 4KP0A 1H9IE 3EDXB 4JZFH 3JZ1B 3EA7A 1PQ5A 3UR6A 1P02A 1TX6A 1YC0A 2G00A 3HKJB 5C20A 1IQHA 7GCHG 2D2DA 1AUTC 1P2JA 1YBWA 4X1PU 4Y8YA 2ALPA 3B9FH 2VIQA 5J4QA 3UFAA 2BZAA 5T6FA 2FLBH 3M61U 1GJ7B 5ETXA 1T32A 1A5HA 1H4WA 1GHZA 1H8DH 1K1MA 1LPGB 2F9PA 8GCHF 4AFZA 3E0NB 1H9LB 2GVFA 2SFAA 1GL1A 2BY6X 2OLGA 3BTHE 1SHHB 4JZIA 1BTUA 1YCPH 1HYLA 3LGVA 4NSVA 1PQ8A 1DT2A 4AN7A 1UK3A 1EP6A 1K22H 4A1TA 1GBBA 1GCDA 2B8OH 2ZFFH 1L1NA 2TGDA 1GHAF 1XUIA 5DG6A 3TJVA 1ZJKA 1QL7A 2DE8A 1C1TA 1PPEE 2VWOA 1O2KA 1D9IA 3A83A 2Z9KA 1ACBE 1C5WB 1TX7A 2VB0A 2ODQA 1F0TA 1JWTA 2XXLA 1AMHA 5DP3A 1GHBF 3MHWU 3LJJA 2OQ5A 2Z3DA 3MO6A 5EODA 4TY7A 2C4FH 4NGAH 1TBZH 2FS9A 2GKVE 1ZTKA 1O3FA 3ATLA 4B76A 1J14A 1FAXA 2FM2A 3RXCA 4O3TA 2ZDVH 1GCTB 1NRSH 3TH2H 2UWOA 5GCHF 3DHKH 2ALVA 1CBWC 1IAUA 3MU5A 3D49H 3ATWA 1ESBA 3F9GA 3MH6A 3URCA 2IOTA 1BTHH 2BOKA 3C27B 3RU4E 3LH3A 2ZC9H 3RXEA 1OX1A 4ZXXH 4MNWA 4NWKA 2B9LA 3GOVB 1EAWA 1T7CA 1L2EA 1SL3A 1CA0C 1GJ6A 1O2ZA 1O32A 1VITF 1MH0A 1P01A 1S81A 1CT0E 1GMCG 3LGTA 3T2NA 3HK3B 2PUQH 2AIQA 4ZKNU 4AFQA 1BRUP 1GVLA 2J94A 4WF8A 1YLCA 1C5RA 1UVPA 3M36A 2ZQ2A 4GCHG 4LK4A 1GBEA 2ZHEH 2F9OA 2KAIA 1SFQB 2VU8E 1K1OA 1FY5A 5K0HA 4WMEA 2PSXA 3CS0A 1O2SA 1ZTLA 4O9VA 1O2WA 2Y5FA 1BITA 2RG3A 3PMHB 1ETRH 2FIRH 4BXWA 1UK2A 1MTWA 1JIRA 1VJAU 1HAZB 2BB4A 2TGAA 5F8TA 3STIA 1ELGA 1W11U 1C1NA 2OBOA 2R9PA 1TRNA 4MG3A 3MO3A 1SC8U 5EU8A 3ODFA 1NRPH 2Y5HA 3ZYDA 1O2IA 2UUJB 1V2PT 3SO3A 3FP7E 1GI1A 2ZFTA 5CHAC 3NCLA 1Y59T 4DIIH 4K1EA 2F9NA 1C2EA 3U1IB 3PLBA 1V2LT 2J34A 4E06H 5JB9S 3O8RA 1P2NA 1YPMH 4OS4A 4UONA 3NKKA 2ULLA 1O37A 4WMDA 3QWCH 1AUJA 1NFUA 5E0HA 2QXJA 2BZ6H 3OX7U 5LGOA 4DG4A 1A5GH 2FI3E 2BD8A 2BY9X 1O5DH 1ZRBA 1UCYH 2G5VA 4FUHA 4Y0YE 2H1UA 2GGVB 4Y8XA 2ZKSA 1B5GH 3A8BA 2A2QH 1CGHA 1SGPE 2ANMH 3PLPA 3LGIA 1C5UA 1SPJA 4K69A 1ZPCA 4AGJA 5DP9A 2R0LA 3UY9A 4Q80A 1Z8JB 1C5NH 2XC0A 2G4TA 2Y5GA 1YM0A 4K8BA 1HNEE 3A7XA 2RCEA 3LGYA 3KIDU 3PWCA 2JH5D 1MTUA 2PKSC 2THFB 2ZCLP 3PTNA 2FTLE 1FAKH 2A32A 2GV6A 1Y3VA 2Z7FE 2P59A 1GL0E 3SQHE 1CE5A 2B5TB 3U8RH 3VB5A 1JRTA 1T8MA 2BD5A 1TGCA 1D3QB 5TCCA 4GHQA 1DFPA 1GJBB 1MCVA 4Y11E 1DX5M 1O35A 1ZZZA 1LQDB 3R3GB 1QRXA 4Q7ZA 1OKXA 1DICA 4ZAEA 3P70B 1K28D 1TQ7B 4IMZA 5IDKA 5LPEA 1N8OB 2NU3E 4GHTA 4X2XA 1V2JT 4GUXA 2BDAA 2FWWA 2G52A 1O3NA 1SGIB 5TCAA 1RJXB 2A4OA 1T8OA 4HZHA 1TAWA 1F0SA 3TK6A 1TNJA 3E91A 2XBYA 1EB2A 2CXVA 3D23A 2JH6D 4WMFA 4CHAC 4WJG2 3S9BA 5GPIB 1MKWH 2P8OC 1MQ5A 1ELVA 4X8SH 1TRYA 1W10U 5A8ZA 1C4Y2 3HKIB 3RXDA 3OY5U 1EJAA 3BTDE 1ESTA 1XVOA 3MNSA 1TNIA 1EZQA 1BQYA 2P16A 2DUCA 2SGFE 2FOCA 4NG9H 2AGGX 3PTBA 1NT1A 1O3PB 3K6YA 5FX6A 4ZHAA 3RXAA 2A2XH 2AFQB 1PYTD 1TA6A 5A0AE 1O2YA 1SGFA 2ZDKA 4A6LA 1W3CA 1O2TA 5BPEA 4ZKOU 1V2QT 4MNXA 2A4QA 2JETB 5FAHA 1K1IA 4RKOB 1EPTC 5EOKA 2NU1E 1C2KA 4BXSA 4UFEH 2JH0D 5DP6A 2HNTC 2VGCC 1VCPA 3OTJE 1EZSC 1JMOH 3MTYA 2A4GA 4E7RG 1E37B 3H5CB 1IHTH 4MLFB 1UVSH 1HAOH 2I6SA 9ESTA 1TPPA 4VGCB 1ELEE 5JB8S 1S5SA 3UNQA 1RXPA 1QB1A 1XUHA 3A86A 8GCHG 1FN6A 1UTOA 1SOZA 1AE8H 2BXUH 2QF0A 2SGEE 4Y76A 2O8UA 3EE0B 5E0GA 2A0QB 4BAMB 3T62A 1C9TA 2H5CA 1SGTA 3CS7A 4ISOA 1WAYB 1GMDF 2HWLB 1WV7H 3ZV8A 4K2YA 1GI2A 3SW2B 1C1WH 2EI8A 4RSPA 2AGIX 2ZA5A 1OPHB 1W8BH 1Y5BT 3PV4A 4ABHA 3KQBA 1GJ5H 1FZZA 1THRH 5DPAA 1NESE 1UCYK 4WY3A 1C5TA 1O3CA 1GMHF 1O3GA 1W0ZU 3MOCA 8KME2 2ZCHP 1FY1A 4YO9A 1ZSKA 1T31A 1GDNA 1F5RA 3RXQA 1F5KU 4X1NU 1D6RA 1YPHC 1QL8A 2H6MA 4JK5A 1EOLA 1ARCA 3BG8A 3RU4D 3P8FA 3BTME 3ZVFA 2IN2A 2ZGJA 3KHVA 5PTPA 1P05A 1BTWA 1EKBB 5HM2A 6GCHF 2G81E 4JYUH 3SU4A 3FFGA 4AFSA 2BQ6B 1PPGE 1QGFA 1QTFA 1TYNA 2UUFB 1P06A 4CH2B 2QIQA 4FUJA 4KGAA 4Y79A 1A4WH 2FS8A 3LT3A 1P9SA 1CBWB 3QZQA 4IN1A 3SV8A 3AW1A 1N6XA 3PB1E 4Q7XA 3U9AH 1F2SE 2ZCKP 1ELFA 1AVXA 3UUZA 1MD8A 1XUKA 1O3AA 2WUBA 4WXVA 3BEFB 7KMEH 3UIRA 2F9UA 4ASHA 1C1SA 1GBCA 1AI8H 3QUMP 2IJOB 4XSKU 1C5PA 3UPEA 2CHAC 4INKA 2QCYA 3HGPA 2FESH 3VFEA 3RXIA 3DT0H 5DGJA 1N6YA 5T6DA 2BDCA 3MH4A 4ZXYH 2Z9IA 1N1LA 3SV7A 2VIPA 4Z0KA 1FONA 1WQVH 2R3UA 5IYTA 2W7SA 2HLCA 3K65B 4MPVA 1NRNH 1P2IA 2HALA 3QTOH 2GMTB 2BDBA 4Y7AA 1P09A 2D1JA 2C8YB 4I8HA 3W94A 1TGSZ 4JCNA 3E6PH 3FP8E 1VGCB 3ZVBA 1ORFA 3GY8A 1Z8GA 3FAOA 3P17H 8ESTE 1O5CB 3A88A 4SGBE 1V3XA 1OSSA 2AMDA 3UNRA 5FXLA 2FOHA 4FUIA 5C3NA 3FZZA 2J9NA 1IQJA 4MNYA 2V35A 4YT6H 1DUAA 4OGXA 1ZRKA 2Y7ZA 4MDSA 2A31A 5E8EH 2ZPRA 3TU7H 3RMMH 4J2YB 4YLUA 1Z1IA 2WV4A 3LIWA 2ZNKH 1THPB 2VIOA 2XCFA 3SNBA 5L2YH 4NCYA 3RP2A 4ISLA 1L4DA 2SNVA 2BM2A 4K3JA 4QT8C 1D3DB 3KQDA 2HRVA 1P2MA 3UTUH 2A45B 1Y3UA 4LZ1H 4MQAA 1P11E 1LDTT 1OWDA 2Y82A 4KTSA 4XFQA 1TNLA 5E2PA 2UWPA 1GPZA 1EPTA 2RA0A 6CHAC 4D7GA 2B7DH 4YTAA 1A7SA 1VCWA 3RMNH 3T25A 2W3KA 2ODPA 4XBBA 1O2UA 1UO6A 1YLDA 1YP9A 3BTWE 1AN1E 5LPFA 3F1SB 3DFJA 1V2MT 3EA9A 1FUJA 5DP5A 3BTGE 3GCHB 2PGQB 1OP2A 4B2BA 3A8CA 2XBVA 1WSSH 1OYQA 4AX9H 1QBNA 2TBSA 1AIXH 3AAVA 2BLVA 1AWFH 4IBLH 3RXTA 5B6OA 4INLA 3BV9B 3PWBA 2FP7B 4I32A 1BUIA 1Y3WA 3A8DA 2A1DB 1Z7KA 3QO6A 2ZTXA 3PO1C 3KNXA 3ESTA 3ELAH 5HYOA 1M9UA 4IS5A 4HI3A 1E34B 3TH3H 2ZECA 5JBBS 4OS5A 3RC6A 1KXDA 2A4RA 4X1QU 1EAXA 2PW8H 2HOBA 1GI0A 4Y6DA 4AORA 3AVZA 1GG6B 1A3EH 2OP9A 4CH8B 5JYIA 1F0UA 4LXBH 2XC4A 1IQGA 3BG4C 2PTCE 3F9HA 5GWZA 1QHRB 4B1TA 3UQVA 1H9HE 4I31A 1C2JA 2YNBA 5G4BA 1CU1A 3TITA 1TGNA 1O2LA 3TK9A 2HGTH 2O8TA 2PKAA 4M7GA 1AQ7A 2C8ZB 3ZV9A 1AY6H 1OP8A 5HGGA 4CHAB 2EC9H 3PYHA 4ABAA 1C2MA 2BD3A 3EYDA 1LHCH 3SBKA 4I8LA 1VITH 2JKHA 1ETSH 1O2PA 2FX6A 5ESBA 1CSOE 1AB9B 2WYJA 3QTVH 3WY8A 2BLWA 5AHGH 3BTFE 1GBDA 3GY6A 4JZDH 3Q77A 4X2VA 1O2XA 2F91A 1HGTH 1ESAA 5ESTE 1KXEA 1DE7H 2HNTE 2ZU4A 3FVFB 2BDIA 2SGAA 1KYNA 1MKXH 4KELA 4U32A 5F6MA 1GJ8B 2FOEA 3MI4A 1GJAB 1QB6A 1ZMJA 1EAUA 5AVDA 2GCTB 2OCVB 3VGCB 4MTBA 1C2IA 1GHWH 3SU1A 3B23B 2R0KA 2ZG0H 3ZZ4A 4NIXA 4F49A 2DE9A 1MAXA 1Y8TA 3SV9A 2FYQA 1FN8A 2VIWA 1NROH 3UWIA 1ETTH 1AGJA 1ZYOA 1V6DA 1DY9A 1O3BA 1FXYA 1SR5C 2AGEX 1GBJA 2PUXB 1AFQC 4AYVB 3SN8A 4IMQA 3MH5A 5EXMA 4BAKB 5EPYA 3RXJA 3TVJB 2IPHA 2XW9A 5DK1A 1C2HA 1CO7E 3RXGA 7ESTE 1J17T 1BIOA 1VJ9U 4NIWA 1FPCH 1A61H 1RTFB 2FOBA 1UCYE 1HXEH 1HBTH 1LVOA 2BDYA 3A84A 3Q3YA 1UTNA 1O3MA 4Y0ZE 1GGDC 2J95A 1KLJH 2Z6BD 1EQ9A 5FX5A 3UWJH 2OTVA 1YPHE 1KXAA 5T3HA 1XX9A 2G5NA 1HJAC 1QJ6B 3F9FA 4X6NA 4JYVH 4XOJA 1UK4A 1SSXA 3ZZAA 3A85A 1NS3A 1CGIE 6GCHG 4JK6A 1CT2E 1Z71A 1MTNC 2AIPA 2OINA 3BTTE 4X0WU 3GDUA 4AOQA 4JYTA 3S7HB 5I46H 2Z9LA 1EJNA 4ZMAH 3VXEH 1SLVB 2GDEH 3TLOA 1FNIA 2PKAB 1S0QA 2ZU5A 2ZF0H 2XNIA 4YZUA 2FPZA 4D9QA 1HUTH 4A7IB 4U30A 2AERH 1SB1H 1OXGA 3L3TA 2A7CA 3LKWA 2VWLA 3F68H 2R2MB 1O33A 5DJ7A 1IQIA 3CENA 4YOIA 4JMYA 4CRFA 3ZZ6A 1Q31A 2V0BA 2ODYB 1OOKB 5EPNA 8LPRA 1Y3YA 1Z6EA 2LPRA 1MU6B 3P8OA 2Y80A 2STBE 1ABIH 3K6ZA 4H6SB 1DWBH 1TOMH 1UTJA 1TALA 1TPSA 2BLQA 1L1GA 2BD4A 1O2RA 4PROA 4AB9A 2A5IA 1PPCE 2Q6FA 1GBIA 4GPGA 4NZLA 3RXRA 1V2UT 2VH0A 1BMAA 4DT7B 2K1QA 5LH8A 2NU0E 1EJMA 5A2MH 2CGAA 1CHOF 2HPPH 5E0JA 5SGAE 1K1JA 2XBWA 4FU7A 3A8AA 1Q3XA 3EGKH 1FY4A 1GJDB 2Q6DA 2VINA 5GXPA 3P8GA 1Y3XA 3GCTG 3RXFA 3T29A 2H9EH 3ZVDA 4Y10E 4A5TS 1SGNE 4OS7A 2PFEA 1QRWA 1K1NA 1LKBA 2Z3CA 3NWUA 3S7KB 2GD4B 3M3VA 4FUEA 4BTIB 2ZFSA 4BOHA 1C5XB 1G9IE 1AVWA 1BRBE 1MKXK 4A1VA 1W7XH 2Y81A 5L30H 2PWXA 1IQNA 2ZDNA 4K60A 1HRTH 2FOAA 3NUMA 1O36A 2KAIB 5L6NH 1YCPM 4FUFA 3PMBB 1NN6A 2ILNA 1LHEH 3R0FA 3GY4A 1GBHA 1ZR0A 3ATIA 1NTPA 3V7TA 4CRCA 2R2WU 1P3EA 1X7AC 1LVBA 1LPZB 3A7WA 3KGPA 1SQOA 2P95A 4X6MA 2J38A 1SHYA 4A1XA 1KTSB 2J4IA 1ARBA 3LPRA 1BTPA 2ZGCA 2VNTA 1WBGB 1H1BA 1RRKA 4INHA 4X8UH 2C3SA 2OC7A 1ABJH 3HPTB 5C1XA 4CREA 1HJ9A 1T8NA 1QRZA 3ZZDA 2F9BH 3RXUA 1A1RA 3TNTA 3MNBA 3BSQA 1PPHE 4KTUA 4IN2A 2VJ1A 4LZ4B 1CQQA 1MTVA 2ZDAH 3M37A 3T28A 2SGQE 3A80A 5A8XA 7GCHF 3RXKA 1PYTC 3U8TH 5ABWA 1UTMA 2FODA 2ZGBH 1GBTA 1TLDA 2RDLA 2CMYA 1HAVA 1O3JA 5J4SA 2FI4E 2V3HH 3T5FH 1Y5UT 1CVWH 5A09A 4E7NA 3JZ2B 4F4OC 4YLQH 3OYPA 1C5OH 3D65E 1XVMA 1NPMA 4R8TB 4WH6A 1TA2A 1TMUH 5EG4A 1GHXH 3LGWA 1O38A 3ZZ8A 3Q3XA 1TPAE 3ODDA 1HXFH 2ZQ1A 3UOPA 1G30B 2QXHA 4WH8A 3ZVEA 5JDUB 1YKTA 3RC4A 1BA8B 1HAXB 2O8MA 3ITIA 1GJCB 2CF8H 1T8LA 1DOJA 3A89A 1O39A 1PPZA 2ZDMA 4NA9H 4KKDA 3P92A 1Q2WA 1CT4E 1QNJA 5JBTA 1GI9B 4X1SU 3M35A 1DVAH 2UWLA 1GHAG 2GTBA 2ZHDA 5AF9H 1GCTC 1GDQA 3QLPH 3TH4H 4E05H 1JIMA 1ELTA 1O2JA 1ZJDA 2ZPSA 1GBMA 4KTCA 1K21H 4FU9A 3S9AA 1NM6A 1TMBH 1BJVA 3AASA 2ZPQA 3E1XB 3KN2A 3LGUA 2A5AA 1GHBG 4FVBA 1ZPBA 1OYTH 5EGMA 1FQ3A 1QJ7B 2ANWA 4B73A 2AYWA 3ZZBA 4FUBA 4YT7H 1TGTA 2UUKB 5CMXH 1SOTA 1J15A 3SV6A 4GLYA 1HJ8A 4OS6A 4Y8ZA 3OU0A 5F8XA 4A92A 1AHTH 2ZFPH 2CF9H 1PQ7A 2NU2E 2FDAA 3VB3A 4AZ2B 5GCHG 1YPEH 2BDGA 3F9EA 3H7TA 4JZ1A 1K1PA 1S6HA 2ZU3A 1TRMA 1EX3A 1UVOA 3MU0A 3OY6U 3SHAH 4O3UA 1V2TT 2OC8A 1DM4B 3SGAE 5HMAA 4XDEA 1GMCF 3RM0H 1DDJA 4TPIZ 1V2OT 4UFFH 1JOUB 1C2FA 1A0LA 1NRQH 3RXHA 4GCHF 1P03A 1C1OA 2FYRA 2OD3B 3A7VA 1MUEB 1WTGH 1FV9A 1QA7A 1VITG 1V2WT 4WWYA 5EXLA 2EI7A 1FY8E 2ZTYA 2TGPZ 1RGQA 4UFGH 4ZKRU 1P2OA 1SLXB 2BY7X 1DLKB 1WOFA 1XM1A 4U01A 2C8WB 1CA0B 1O3HA 1BBRH 1C5YB 3SUDA 2LNCA 2M5TA 3M3TA 1DWCH 4FUGA 1DXPA 3E8LA 4SGAE 3AW0A 1IQLA 2P94A 2AEIH 3O8DA 2VIVA 2XBXA 4FU8A 4B2AA 5JBCS 1H8IH 2PV9B 3PMAB 1AFEH 3N7OA 1SVPA 3DFLA 1SGCA 1XKBC 1SMFE 1LKAA 1W13U 1WYKA 3VB6A 1IOEA 3HGNA 2EEKA 1GDUA 1XMNB 1EZUC 2GT8A 1RFNA 1GBLA 1V2VT 1DS2E 1QL9A 1KDQA 3MU1A 4FUCA 1DANH 1WTHD 4BTUB 1EP5A 3BEIB 3M7UA 4ABJA 3RXOA 3UR9A 1CHGA 2GP9B 4TYDA 1AWHB 1V2KT 3HK6B 1QBOA 4UDWH 2F3CE 2GZ9A 2VVUA 2ANKH 5CHAB 3VB4A 2Y6TA 1S84A 1SFIA 2BX3A 3RUOA 1UHBA 1C1VH 5EW2H 2BYAX 1BRAA 2OC0A 1G36A 4RN6A 3RXPA 4HTCH 1MBMA 3ZZ5A 1DXWA 1BMMH 2WPLS 4DVAU 1TBRH 4XE4A 3KQCA 1HDTH 1MZDA 2P3UB 3RLWH 4K1SA 1LCYA 3RMOH 4ZHMU 5FCRA 1W12U 3M5LA 4I8GA 1IHSH 2AMQA 1W2KH 1EAIA 3SORA 1MAYA 3NPSA 1FIZA 1GJ4H 3IWMA 1B0EA 4NIYA 3EQ0H 1O5GH 3MYWA 1O2OA 4AYYB 2PSYA 1SLWB 1S85A 2QAAA 3RXSA 4TY6A 1OWJA 1N8OC 4Q7YA 1O2NA 1OP0A 2BOHB 1HAYB 2XWBI 3A7ZA 1C5SA 2XTTB 2ZFQH 1AZZA 1AE5A 1TNGA 3GY2A 2O8WA 3H7OA 4AG1A 1E36B 1V2RT 1L4ZA 3E0PB 1GVKB 1NC6A 4GAWA 1O3DA 2PKSB 3DD2H 5DKMA 1NO9H 1NZQH 4NZQA 4CRAA 1WUNH 2ZO3H 3LU9B 1DPOA 1LQEA 2D8WA 4DJZB 1LVMA 3U1JB 2FO9A 1ID5H 2GZ8A 4IW4E 3MU8A 1WCZA 1F0RA 2V3OH 1KSNA 1XUJA 1V2ST 1FIWA 3V0XA 2BTCE 4ESTE 3MWIU 4MVNA 2SNWA 1LHFH 3SGQE 2AH4X 3BEUA 1A2CH 4GSOA 1ANBA 2ZP0H 3T26A 4UFDH 2JETC 3M5NA 3GY5A 1BTXA 1EUFA 3P95A 3QX5H 2Z9GA 4OGYA 2EA3A 1ZLRA 2O8LA 4HFPB 4K5ZA 4CRBA 1BTZA 2Q6GA 1C4U2 4H42U 4DY7B 1EASA 4BANB 1TBQH 1CA8B 5EXNA 3TJOA 1AO5A 2TRMA 3LDXH 1SBWA 4FUDA 4U2WA 3GDVA 2BD2A 2ZHQH 2AS9A 1YGCH 4VGCC 5A8YA 3NK8A 2P8OB 3M3SA 2W7UA 1GI6A 3RLYH 2TIOA 3UREA 1WU1A 1ZTJA 1QJ1B 1NU7B 1ZGVA 3PMJA 1UHBB 1O30A 1J9CH 2OXSA 4K1TA 2J92A 2XC5A 3GCOA 2BY5X 1SGRE 1FMGA 1BBRK 5CE1A 1IQKA 2WINI 1O3OA 1P10A 3SU2A 3LC5A 1GI7B 1PQAA 3QK1A 3KQEA 2SGPE 5C67A 3K2UA 1YPLH 1IQEA 1EPTB 4THNH 4UD9H 1C1PA 1OWHA 1IQFA 3M5OA 3KEEA 3P6ZB 4UEHH 4X2YA 3IITA 1HAHH 1C2GA 2VGCB 2XCNA 1P57B 4DW2U 3TGJE 1C1RA 4ISHH 2F9VA 2Z3EA 3RM2H 3V13A 1SGYE 5JPMH 2FLRH 1Z1JA 3EAJA 2OBQA 1T4UH 3SNEA 1BJUA 1B7XB 1HCGA 1O0DH 1O2GH 4TWWA 2GT7A 1C1MA 2G8TA 1KTTB 3SNCA 1P2KA 4I8JA 1MCTA 1GMDG 3ZZ3A 4ABGA 5EW1H 1QCPA 2ZGHA 1BMNH 4XBDA 1KXBA 2QF3A 5F8ZA 2H2ZA 2BD9A 4NSYA 1GMHG 4ZH8A 4X6OA 3C1KA 2OC1A 5DP4A 1OS8A 1THSH 1UVUH 4ABIA 4H4FA 3E16B 2GDDA 4IC5A 1D3PB 3SJKA 1CGJE 5F03A 2PTNA 2WUCA 2ZEBA 3I78A 2WPMS 4X1RU 2QC2A 1G3EA 1U6QA 1ZSLA 3MNXA 3RDZA 1GI5A 3SU6A 1ANCA 2BXTH 1PFXC 3TGKE 3MH7A 4ISNA 1AZ8A 1HPGA 4RKJB 1SQAA 2PGBB 1O5AB 5DO4H 1SGQE 1SGEE 4H6TA 1FY3A 1C1QA 1J8AA 3SI4H 2W3IA 3Q00A 1TB6H 1TFXA 3E3TA 1GI4A 2GMTC 1OWEA 3LC3A 4CRDA 1ZGIA 1G2MA 3SUGA 3ZVCA 1VGCC 2FMJA 2ZTZA 3SUEA 3TK5A 2FOGA 1LHDH 2VH6A 9LPRA 1TIOA 2FOFA 2BQWB 2QYIA 1T4VH 3IG6B 2BLOA 3SJ8A 4D7FA 4MNVA 1A0JA 4Y7BA 1P9UA 1IQMA 1UTKA 2HPQH 5DP7A 2CHAB 4Y71A 4OS1A 1TABE 1BTYA 1QBVH 1GI8B 5FHTA 3MFJA 4O03A 3SNAA 1HIAA 1DWDH 1V2NT 3QDZB 1GBKA 2WPHS 1ZHPA 2BX4A 3URDA 1P04A 1A3BH 4O97A 1DLEA 2V6NA 4AB8A 2VWMA 2VIDA 3G01A 4YOGA 3SU3A 1WQSA 1NY22 2SGDE 3K9XB 3I29A 1EATA 2ZFRH 3VEQB 1LHGH 1QURH 1TOCB 3SNDA 3A7YA 1QQ4A 1SQTA 1QFKH 2GX4A 1C4V2 1DSTA 1W14U 2STAE 3BIVH 1D3TB 1P2QA 2Z94A 3A81A 2P3FH 1UTPA 3GCHC 2WV5A 1L1JA 2ASUB 4D76A 1ELBA 1MU8B 3M5MA 2HNTF 4OS2A 2ZIQH 1A0HB 2GCHF 1TNKA 2C93B 1RIWC 1GWAA 3S69A 4TWYA 1C5VA 4ABBA 1C5ZB 4CR5A 3B8JA 3RC5A 2OQUA 1YCPK 1K2I1 1TGBA 4BAOB 1XXDA 3UOUA 1G2LA 3KL6A 1Z8RA 5HM9A 1HAGE 1LPKB 3UQOA 1P12E 2C90B 3O8CA 3GY7A 2QA9E 1LVYA 6CHAB 1PPBH 4CBOA 4K8YA 1EOJA 1DY8A 1SI5H 3BTQE 5C1UA 1GG6C 2TGTA 3DA9B 1GBAA 4R0IA 1RTLA 3GDSA 2ZWLH 4AG2A 1DITH 2QXGA 4I7YH 1ZMNA 5LPRA 2WPJS 1NFYA 3LJOA 1G32B 2Z9JA 3SJ9A 3BTKE 2FTMA 3MO9A 2EI6A 2ANYA 1FJSA 1C9PA 4X2WA 4ABFA 2G51A 5I25A 1Z6JH 5FPTA 2A5KA 1KXFA 2BVRH 2YNAA 3AAUA 2CV3A 3PO1B 1LTOA 1QB9A 3M7QA 1RTKA 2R3YA 1K9OE 5EQSA 4D9RA 1OWIA 1ZMLA 1AB9C 2WYGA 5C5NA 1EB1H 1HIAB 1BRCE 1W0YH 3ZZCA 2HVXA 1S6FA 3TJNA 1KLTA 1O34A 5JBAS 3SUFA 5HXFA 1NRRH 4NA7A 3PM3A 1SGFG 4X8VH 1O5FH 3GY3A 3M7TA 2W26A 2ZU1A 5GDSH 1C5QA 1O2HA 3SJIA 1C5LH 3BG4B 2YOLA 1VZQH 2FI5E 1MD7A 5EQRA 3O8BA 5T6GA 5FCKA 1QA0A 3ZYEA 3D62A 5A0CA 1ELCA 4B75A 1ELAA 1JRSA 1KY9A 4I33A 5AFZH 1O3IA 2GCTC 3VGCC 1O2MA 3BF6H 3SU0A 1XXFA 1LMWB 2PR3A 4I8KA 1TX8A 3A82A 1UTQA 2AMPA 3S9CA 1BOQA 1EXFA 3ENSB 5EQQA 1BB0B 3ZZ7A 1HAPH 1KIGH 3QGNB 3RXBA 5AFYH 4YM9A 2OUAA 4MPXA 3TJUA 1TPOA 3SI3H 4NFEA 4CR9A 4DCDA 1YYY1 3VB7A 1BBRE 1AKSA 5H4IB 2W5EA 1DSUA 4WXIA 1O3LA 4BAHB 6LPRA 3RU4T 1BZXE 3FZDA 3SOSA 3TNSA 2I6QA 2FOMB 3QN7A 3U69H 2ZU2A 3BIUH 4X6PA 4AFUA 4IC6A 1TMTH 2O9QA 4YOJA 4DIHH 1RD3B 4MPWA 1PPFE 2ZGXH 2VVVA 2QXIA 1C2DA 1E0FD 1P8VC 1ZHRA 4CBNA 1DUEA 3GISB 6ESTA 2A7JA 1XKAC 1A46H 1GI3A 1ZOMA 3MNCA 5FPYA 2PLXA 1GHYH 3MMGA 1S82A 1VCQA 1YPKH 3TIUA 3ATMA 1BHXB 1JXPA 1ANEA 3DUXH 1TWXB 5TJXA 2QGRA 1Z8IB 4HGCA 1G3DA 2BVSH 1AVGH 3SZNA 1BT7A 2ESTE 3NZIA 3E90B 4B71A 3Q76A 1HV7A 1HFDA 4XBCA 1C2LA 3ZVGA 1TE0A 1FPHH 4JZEH 1AFQB 1INCA 3VPKA 1XUGA 1UMAH 1D4PB 5C2ZA 1JBUH 3FANA 1TNHA 3Q3KA 3L6PA 1ZSJA 4ZROA 1K1LA 1A5IA 1BCUH 2BQ7B 1ANDA 1O5EH 1G3BA 4GVUA 2QV1A 1QR3E 3FP6E 3ATKA 4TPYA 2A7HA 1HAVB 4NWLA 1F92A 4Z6AH 1GHVH 3V12A 1QY6A 4AGKA 2FZZA 2G4UA 1F7ZA 4NA8A 2FX4A 3I77A 1GGDB 3LONA 2BHGA 3LOXA 1GVZA 1O5BB 3EA8A 5BRRE 5L2ZH 1XUFA 1YPJH 1UJ1A 1C1UH 1KLIH 3GYLB 2PHBA 1DWEH 4FXGH 1HJAB 1C5MD 3BN9A 3ZVAA 2BY8X 2XWAA 3U8OH 3KF2A 2WPIS 2QY0B 1HB0B 1MTNB 3SV2H 3P8NA 2ZHWH 1AU8A 2H9TH 3F6UH 2P3TB 1MMJN 1MQ6A 3BTEE 3QZRA 1ZHMA 3V3MA 3GCNA 3A7TA 2NWNA 4ABDA 4Q2KA 1O2QA 3VXFH 1QIXB 3QGJA 2NU4E 2BD7A 4WVPE 4LOYH 4B2CA 1E38B 1KXCA 3RXMA 3L33A 4BAQB 3W95A 5C1YA 2XYAA 2WPKS 4ZKSU 1SLUB 3PROA 1UVTH 1D6WA 5C5OA 1PJPA 3OSYA 1AKSB 1NFWA 5K7RA 1HLTH 1MBQA 1NFXA 1MKWK 1YF4A 3TPIZ 2VWNA 2ZDLA 4ISIH 1BMLA 1S83A 1AD8H 3RXLA 2BDHA 1O2VA 2ZI2H 1LO6A 2RA3A 1W7GH 1VR1H 5GIBA 1SGDE 4ZHLU 4NIVA 4NFFA 1OWKA 4FVDA 2CJIA 3GCTF 4X8TH 1EZXC 3PLKA 5GJ4B 1TQ0B 5FPSA 4MPUA 3LH1A 2F83A
chains in the Genus database with same CATH superfamily
1FI8A 3STJA 1GBFA 3SJOA 3SHCH 2YMSB 2D26C 2Q1JA 4J1YA 3S0NA 5FBEA 2BVXH 3SU5A 1J16A 5EJ1A 5FBIA 2J5UA 2TPIZ 3SQEE 3SGBE 3KCGH 4Q4LA 7LPRA 1G37A 3ZZ9A 2B0FA 2FEQH 1TONA 1O3EA 3CP7A 2CN0H 1P0SH 1L0ZA 4B74A 1MTSA 2ZZUH 2GV7A 2FXRA 1SKYE 3T27A 3HATH 1ZPZA 3UNSA 2GCHG 3GYMA 5DP8A 2HLDD 1W0JD 2QN5T 2VVCA 1FDPA 1SG8B 2XRCA 1RS0A 3MU4A 4BTTB 2J2UA 1QQUA 3NXPA 1RIWB 1ELDE 1O3KA 1UTLM 1Y5AT 1BHXF 1O31A 2H5DA 1MZAA 4DURA 4YESB 1S0RA 2XOKD 3TGIE 2UUYA 2BMGB 5A0BA 4D8NA 1G3CA 1CHOG 1FLEE 1BDAA 4ABEA 1B0FA 5E2OA 1NBME 2P93A 3RMLH 1NU9A 4BNRA 2G55A 1GJ9B 4DOQA 1F5LA 2H9HA 3U98H 1YPGH 2C8XB 2GZ7A 1E35B 4UE7H 1P3CA 3FO8D 4CRGA 2ZHFH 3A87A 3GICB 4IGDA 2QF5A 4DGJA 1KDQB 3RXVA 1HAIH 2Y7XA 4ZUHA 4KP0A 1H9IE 3EDXB 4JZFH 3JZ1B 3EA7A 1PQ5A 2KCPA 3UR6A 1P02A 1TX6A 1YC0A 2G00A 3HKJB 5C20A 1IQHA 7GCHG 2D2DA 1AUTC 1P2JA 1YBWA 4X1PU 4Y8YA 2ALPA 3B9FH 2VIQA 5J4QA 3UFAA 2BZAA 5T6FA 2FLBH 3M61U 1GJ7B 5ETXA 1T32A 1A5HA 1H4WA 4XRNA 1GHZA 1H8DH 1K1MA 1LPGB 2F9PA 8GCHF 4AFZA 3E0NB 1H9LB 2GVFA 2SFAA 1GL1A 2BY6X 2OLGA 3BTHE 1SHHB 4JZIA 1BTUA 1YCPH 1HYLA 3LGVA 4NSVA 1PQ8A 1DT2A 4AN7A 1UK3A 1EP6A 1K22H 4A1TA 1GBBA 2L74A 1GCDA 2B8OH 2ZFFH 1L1NA 2TGDA 1GHAF 1XUIA 5DG6A 3TJVA 1ZJKA 1QL7A 2DE8A 1C1TA 1PPEE 2VWOA 1O2KA 1D9IA 3A83A 2Z9KA 1ACBE 1C5WB 1TX7A 2VB0A 2ODQA 1F0TA 1JWTA 2XXLA 1AMHA 5DP3A 1GHBF 3MHWU 3LJJA 2OQ5A 2Z3DA 3MO6A 5EODA 4TY7A 2C4FH 4NGAH 1TBZH 2FS9A 2GKVE 1ZTKA 1O3FA 3ATLA 4B76A 1J14A 1FAXA 2FM2A 3RXCA 4O3TA 2K8IA 2ZDVH 1GCTB 1NRSH 5KGOA 3KYFA 2UWOA 5GCHF 3TH2H 5IK2D 3DHKH 2ALVA 1CBWC 1IAUA 3MU5A 3D49H 3ATWA 1ESBA 3F9GA 3MH6A 3URCA 2IOTA 1BTHH 2BOKA 3C27B 3RU4E 3LH3A 2ZC9H 3RXEA 1OX1A 4ZXXH 4MNWA 4NWKA 2B9LA 3GOVB 1EAWA 1T7CA 1L2EA 1SL3A 1CA0C 1GJ6A 2KM0A 1O2ZA 1O32A 1VITF 1MH0A 1P01A 1S81A 1CT0E 1GMCG 3LGTA 3T2NA 3HK3B 2PUQH 2AIQA 4ZKNU 4AFQA 2LELA 1BRUP 1GVLA 2J94A 4WF8A 1YLCA 1C5RA 1UVPA 3M36A 2ZQ2A 4GCHG 4LK4A 1GBEA 2ZHEH 2F9OA 2KAIA 1SFQB 2VU8E 1K1OA 1FY5A 5K0HA 4WMEA 2PSXA 3CS0A 1O2SA 1ZTLA 4O9VA 1O2WA 2Y5FA 1BITA 2RG3A 3PMHB 1ETRH 2FIRH 4BXWA 1UK2A 1MTWA 1JIRA 1VJAU 1HAZB 2BB4A 2TGAA 5F8TA 3STIA 1ELGA 1W11U 1C1NA 2OBOA 2R9PA 1TRNA 4MG3A 3MO3A 1SC8U 5EU8A 3ODFA 1NRPH 2Y5HA 3ZYDA 1O2IA 2UUJB 1V2PT 3SO3A 3FP7E 1GI1A 4B6FA 2ZFTA 2RFKC 5CHAC 3NCLA 1Y59T 4DIIH 4K1EA 2F9NA 1C2EA 3U1IB 3PLBA 1V2LT 2J34A 4E06H 5JB9S 3O8RA 1P2NA 1YPMH 4OS4A 4UONA 3NKKA 2ULLA 1O37A 4WMDA 3QWCH 1AUJA 1NFUA 5E0HA 2QXJA 3F2GA 2BZ6H 3OX7U 5LGOA 4DG4A 1A5GH 2FI3E 2BD8A 2BY9X 1O5DH 1ZRBA 1UCYH 2G5VA 4FUHA 4Y0YE 2H1UA 2GGVB 4Y8XA 2ZKSA 1B5GH 3A8BA 2A2QH 5EIYA 1CGHA 1SGPE 2ANMH 3PLPA 3LGIA 1C5UA 2YMSD 1SPJA 4K69A 1ZPCA 4AGJA 5DP9A 2R0LA 3UY9A 4Q80A 1Z8JB 1C5NH 2XC0A 2G4TA 2Y5GA 1YM0A 2IJD1 4K8BA 1HNEE 3A7XA 2RCEA 3LGYA 3KIDU 3PWCA 2JH5D 1MTUA 3EE7A 2PKSC 2THFB 2ZCLP 3PTNA 2FTLE 1FAKH 2A32A 2GV6A 1Y3VA 2Z7FE 2P59A 1GL0E 3SQHE 1CE5A 2B5TB 3U8RH 3VB5A 1JRTA 1T8MA 2BD5A 1TGCA 1D3QB 5TCCA 4GHQA 1DFPA 1GJBB 1MCVA 4Y11E 1DX5M 1O35A 1ZZZA 1LQDB 3R3GB 1QRXA 4Q7ZA 1OKXA 1DICA 4ZAEA 3P70B 1K28D 1TQ7B 4IMZA 5IDKA 5LPEA 1N8OB 2NU3E 4GHTA 4X2XA 1V2JT 4GUXA 1K0HA 2BDAA 2FWWA 2G52A 1O3NA 1SGIB 5TCAA 1RJXB 2A4OA 1T8OA 4HZHA 1TAWA 1F0SA 3TK6A 1TNJA 2KCOA 3E91A 3GS9A 2XBYA 1EB2A 2CXVA 3D23A 2JH6D 4WMFA 4CHAC 4WJG2 3S9BA 5GPIB 1MKWH 2P8OC 1MQ5A 1ELVA 2WZQA 4X8SH 1TRYA 1W10U 5A8ZA 1C4Y2 3HKIB 3RXDA 3OY5U 1EJAA 3BTDE 1ESTA 1XVOA 3MNSA 1TNIA 1EZQA 1BQYA 2P16A 2DUCA 2SGFE 2FOCA 4NG9H 2AGGX 3PTBA 1NT1A 1O3PB 3K6YA 5FX6A 4ZHAA 3RXAA 2A2XH 2AFQB 1PYTD 1TA6A 5A0AE 1O2YA 1SGFA 2ZDKA 4A6LA 1W3CA 1O2TA 5BPEA 4ZKOU 1V2QT 4MNXA 2A4QA 2JETB 2KR7A 1K1IA 4RKOB 5FAHA 1EPTC 5EOKA 2NU1E 1C2KA 4BXSA 4UFEH 2JH0D 5DP6A 3OEHD 2HNTC 2VGCC 1VCPA 3OTJE 1EZSC 1JMOH 3MTYA 2A4GA 4E7RG 1E37B 3H5CB 1IHTH 4MLFB 1UVSH 1HAOH 2I6SA 9ESTA 1TPPA 4VGCB 3F0PA 1ELEE 5JB8S 1S5SA 3KYGA 5HKKD 3UNQA 1RXPA 5FL7D 1QB1A 1XUHA 3A86A 8GCHG 1FN6A 1UTOA 1SOZA 1AE8H 2BXUH 2QF0A 2SGEE 4Y76A 2O8UA 3EE0B 5E0GA 2A0QB 4BAMB 3T62A 1C9TA 2H5CA 1SGTA 5DN6D 3CS7A 4ISOA 1WAYB 1GMDF 2HWLB 2RDEA 3ZIAD 1WV7H 3ZV8A 1YY3A 4K2YA 1GI2A 3SW2B 2CK3D 1C1WH 1FX0B 2EI8A 4RSPA 2AGIX 2ZA5A 5DSFA 1OPHB 1W8BH 1Y5BT 3PV4A 4ABHA 4Z1MD 3KQBA 1GJ5H 1FZZA 1THRH 5DPAA 1NESE 1UCYK 4WY3A 1QZ8A 1C5TA 1O3CA 1GMHF 1O3GA 1W0ZU 3MOCA 3PV5A 8KME2 2ZCHP 1FY1A 4YO9A 1ZSKA 1T31A 1GDNA 1F5RA 3RXQA 1F5KU 4X1NU 1D6RA 1YPHC 1QL8A 2H6MA 4JK5A 1EOLA 1ARCA 3BG8A 3RU4D 3P8FA 3BTME 3ZVFA 2IN2A 2ZGJA 3KHVA 5PTPA 1P05A 1BTWA 1EKBB 5HM2A 6GCHF 2G81E 4JYUH 3SU4A 2W6ID 3FFGA 2JIZD 4AFSA 2BQ6B 1PPGE 1QGFA 1QTFA 1TYNA 2UUFB 1P06A 4CH2B 2QIQA 4FUJA 4KGAA 4Y79A 1A4WH 2FS8A 3LT3A 1P9SA 1CBWB 3QZQA 4IN1A 3SV8A 3AW1A 1N6XA 2J98B 3PB1E 4Q7XA 3U9AH 1F2SE 2ZCKP 1ELFA 1AVXA 3F2FA 3UUZA 1MD8A 1XUKA 1O3AA 2WUBA 4WXVA 3BEFB 7KMEH 3UIRA 2F9UA 2PP6A 4ASHA 1C1SA 1GBCA 1AI8H 3QUMP 2IJOB 4XSKU 1C5PA 3NRLA 3UPEA 2CHAC 4INKA 2QCYA 3HGPA 2FESH 3VFEA 3RXIA 4AC9A 3DT0H 5DGJA 1N6YA 5T6DA 2BDCA 3MH4A 4ZXYH 2Z9IA 1N1LA 3SV7A 2VIPA 4Z0KA 1FONA 1WQVH 2R3UA 5IYTA 2W7SA 2HLCA 3K65B 4MPVA 1NRNH 1P2IA 2HALA 3QTOH 2GMTB 2BDBA 4Y7AA 1P09A 2D1JA 5F53A 2C8YB 4I8HA 3W94A 1TGSZ 4JCNA 1H8ED 3E6PH 1VGCB 3FP8E 3ZVBA 1ORFA 3GY8A 1Z8GA 3FAOA 3P17H 3AK5A 5C0TA 8ESTE 1O5CB 3A88A 4SGBE 1V3XA 1OSSA 2AMDA 3UNRA 5FXLA 2FOHA 4FUIA 4ACAA 5C3NA 3FZZA 2J9NA 1IQJA 4MNYA 2V35A 4YT6H 1DUAA 4OGXA 1ZRKA 2Y7ZA 4MDSA 4B6EA 2A31A 5E8EH 2ZPRA 3TU7H 3RMMH 4J2YB 4YLUA 1Z1IA 2WV4A 3LIWA 2ZNKH 1THPB 2VIOA 2XCFA 3SNBA 5L2YH 4NCYA 3RP2A 4ISLA 1L4DA 2SNVA 2BM2A 4K3JA 4QT8C 1D3DB 3KQDA 2HRVA 1P2MA 3UTUH 2A45B 2L6OA 1Y3UA 4LZ1H 4MQAA 1P11E 1LDTT 1OWDA 2Y82A 4KTSA 4XFQA 1TNLA 5E2PA 2UWPA 1GPZA 5GNDA 1EPTA 1SQRA 2RA0A 6CHAC 4D7GA 2B7DH 4YTAA 1A7SA 1VCWA 3RMNH 3T25A 2W3KA 2ODPA 4XBBA 1O2UA 1UO6A 1YLDA 1YP9A 3BTWE 1AN1E 5LPFA 3F1SB 3DFJA 1V2MT 3EA9A 1FUJA 5DP5A 3BTGE 3GCHB 2PGQB 1OP2A 4B2BA 3A8CA 2XBVA 5HIYA 1WSSH 1OYQA 4AX9H 1QBNA 2TBSA 1AIXH 3AAVA 2BLVA 1AWFH 4IBLH 3RXTA 5B6OA 4INLA 3BV9B 3PWBA 2FP7B 4I32A 1BUIA 1Y3WA 3A8DA 2A1DB 1Z7KA 3QO6A 2ZTXA 3PO1C 3KNXA 3ESTA 3ELAH 5HYOA 1M9UA 4IS5A 4HI3A 1E34B 3TH3H 2ZECA 5JBBS 1E1RD 4OS5A 3RC6A 1KXDA 2A4RA 4X1QU 1EAXA 2PW8H 2HOBA 1GI0A 4ACBA 4Y6DA 4AORA 3AVZA 1GG6B 1A3EH 2OP9A 4CH8B 5JYIA 2JJ1D 1F0UA 4LXBH 2XC4A 1IQGA 3BG4C 2PTCE 3F9HA 2WSSD 5GWZA 1QHRB 4B1TA 3UQVA 1H9HE 4I31A 4FOUC 1C2JA 4RI0A 2YNBA 5G4BA 1CU1A 3TITA 1TGNA 1O2LA 3TK9A 2HGTH 2O8TA 2PKAA 4M7GA 1AQ7A 2C8ZB 3ZV9A 1AY6H 1OP8A 5HGGA 4CHAB 2EC9H 3PYHA 4ABAA 1C2MA 2BD3A 3EYDA 1LHCH 3SBKA 3KQ5A 4I8LA 1OHHD 1VITH 2JKHA 1ETSH 1O2PA 2FX6A 5ESBA 1CSOE 1AB9B 2WYJA 3QTVH 3WY8A 2BLWA 5AHGH 3BTFE 1GBDA 3GY6A 4JZDH 3Q77A 4X2VA 1O2XA 2F91A 1HGTH 1ESAA 5ESTE 1KXEA 1DE7H 2HNTE 2ZU4A 3FVFB 2BDIA 2SGAA 1KYNA 1MKXH 4KELA 4U32A 5F6MA 1GJ8B 2FOEA 3MI4A 1GJAB 1QB6A 3WW7A 1ZMJA 1EAUA 5AVDA 2GCTB 2OCVB 3VGCB 4MTBA 1C2IA 3FOAA 1GHWH 3SU1A 3B23B 2R0KA 2ZG0H 3ZZ4A 4NIXA 4F49A 2DE9A 1MAXA 1Y8TA 3SV9A 2FYQA 1FN8A 2VIWA 1NROH 3UWIA 1ETTH 1AGJA 1ZYOA 1V6DA 1DY9A 1O3BA 1FXYA 1SR5C 2AGEX 1GBJA 2PUXB 1AFQC 4AYVB 2WV9A 3SN8A 4IMQA 2F43B 3MH5A 3OE7D 5EXMA 4BAKB 5EPYA 3RXJA 5C94A 3TVJB 2IPHA 2XW9A 5DK1A 1C2HA 1CO7E 3RXGA 7ESTE 1J17T 1BIOA 1VJ9U 4NIWA 5EJZA 1FPCH 1A61H 1RTFB 2FOBA 1UCYE 1HXEH 1HBTH 1LVOA 2BDYA 3A84A 3Q3YA 1UTNA 3SYJA 1E79D 1O3MA 4Y0ZE 1GGDC 2J95A 5KECA 1KLJH 2Z6BD 1EQ9A 5FX5A 3UWJH 2OTVA 1YPHE 1KXAA 5T3HA 5C0UA 1XX9A 2G5NA 1HJAC 1QJ6B 3F9FA 4X6NA 4JYVH 4XOJA 1UK4A 4P02A 1SSXA 3ZZAA 3A85A 3DSOA 1NS3A 1CGIE 6GCHG 4JK6A 1CT2E 1Z71A 1MTNC 2AIPA 2OINA 3BTTE 4X0WU 3GDUA 4AOQA 4JYTA 3S7HB 5I46H 2Z9LA 1EJNA 4ZMAH 3VXEH 1SLVB 2GDEH 3TLOA 1FNIA 2PKAB 1S0QA 2ZU5A 2ZF0H 2XNIA 4YZUA 2FPZA 4D9QA 1HUTH 4A7IB 4U30A 2AERH 4RT1A 1SB1H 1OXGA 3L3TA 2A7CA 3OEED 3LKWA 2VWLA 3F68H 2KX4A 2R2MB 5CDFE 1O33A 5DJ7A 1IQIA 3CENA 4YOIA 4JMYA 4CRFA 2IPQX 3ZZ6A 1Q31A 2V0BA 2ODYB 1OOKB 5EPNA 8LPRA 1Y3YA 4RT0A 1Z6EA 2LPRA 1MU6B 4TT3D 3P8OA 2Y80A 2STBE 1ABIH 3K6ZA 4H6SB 1DWBH 1TOMH 1UTJA 1TALA 1TPSA 2BLQA 1L1GA 2BD4A 1O2RA 4PROA 4AB9A 2A5IA 1PPCE 2Q6FA 1GBIA 4GPGA 4NZLA 3RXRA 1V2UT 3PV2A 2VH0A 1BMAA 2YMSC 4DT7B 2K1QA 5LH8A 3VG8A 2NU0E 1EJMA 5A2MH 2CGAA 1CHOF 2HPPH 5E0JA 5SGAE 1K1JA 2XBWA 4FU7A 3A8AA 1Q3XA 3EGKH 1FY4A 1GJDB 2Q6DA 2VINA 5GXPA 3P8GA 1Y3XA 3GCTG 3RXFA 3T29A 2H9EH 3ZVDA 4Y10E 4A5TS 1SGNE 2WPDD 4OS7A 2PFEA 1QRWA 1K1NA 1LKBA 2Z3CA 3NWUA 3S7KB 2GD4B 3M3VA 4FUEA 4BTIB 2ZFSA 4BOHA 1C5XB 1G9IE 1AVWA 1BRBE 1MKXK 4A1VA 1W7XH 2Y81A 5L30H 2PWXA 1IQNA 2ZDNA 4K60A 1HRTH 2FOAA 3NUMA 1O36A 2KAIB 5L6NH 1YCPM 4FUFA 3PMBB 1NN6A 2ILNA 1LHEH 5HIZA 3R0FA 3GY4A 1GBHA 1ZR0A 3ATIA 1NTPA 3V7TA 4CRCA 2R2WU 1P3EA 1X7AC 1LVBA 1LPZB 1NBMD 3A7WA 3KGPA 1SQOA 2P95A 4X6MA 2J38A 1SHYA 4A1XA 1KTSB 4ZCNA 2J4IA 1ARBA 3LPRA 1BTPA 2ZGCA 5B6LA 2VNTA 1WBGB 1H1BA 1RRKA 4INHA 4X8UH 2C3SA 2OC7A 1ABJH 3HPTB 3SZEA 5C1XA 4CREA 1HJ9A 1T8NA 1QRZA 3ZZDA 2F9BH 3RXUA 1A1RA 3TNTA 3MNBA 3BSQA 1PPHE 4KTUA 4IN2A 2VJ1A 4LZ4B 1CQQA 1MTVA 2ZDAH 3M37A 3T28A 2SGQE 3A80A 5A8XA 7GCHF 5EJLA 3RXKA 1PYTC 3U8TH 5ABWA 1UTMA 2FODA 2ZGBH 1GBTA 1TLDA 2RDLA 2CMYA 1HAVA 1O3JA 5J4SA 2FI4E 2EQNA 2V3HH 3T5FH 1Y5UT 2GJGA 1MABB 1CVWH 5A09A 4E7NA 3JZ2B 4F4OC 4YLQH 3OYPA 1C5OH 3D65E 1H8HD 1XVMA 1NPMA 4R8TB 4WH6A 1TA2A 1TMUH 5EG4A 1GHXH 3DCLA 3LGWA 1O38A 3ZZ8A 3Q3XA 1TPAE 3ODDA 1HXFH 2ZQ1A 3UOPA 1G30B 2QXHA 4WH8A 3ZVEA 5JDUB 1YKTA 3RC4A 1BA8B 1HAXB 2O8MA 3ITIA 1GJCB 2CF8H 2J97A 1T8LA 1DOJA 3A89A 1O39A 1PPZA 2ZDMA 4NA9H 4KKDA 3P92A 1Q2WA 1CT4E 1QNJA 5JBTA 1GI9B 4X1SU 3M35A 1DVAH 2UWLA 1GHAG 2GTBA 2ZHDA 5AF9H 1GCTC 1GDQA 3QLPH 3TH4H 4E05H 1JIMA 1ELTA 1O2JA 1ZJDA 2ZPSA 1GBMA 4KTCA 1K21H 3N7DA 4FU9A 3S9AA 1NM6A 3UB0A 1TMBH 1BJVA 3AASA 2ZPQA 3E1XB 3KN2A 3LGUA 2A5AA 1GHBG 4FVBA 1ZPBA 1OYTH 2KCAA 5EGMA 1FQ3A 1QJ7B 2ANWA 4B73A 2AYWA 3ZZBA 4ASUD 4FUBA 4YT7H 1TGTA 2UUKB 5CMXH 1SOTA 1J15A 3SV6A 4GLYA 1HJ8A 4OS6A 4Y8ZA 3OU0A 5F8XA 4A92A 1AHTH 2ZFPH 2CF9H 1PQ7A 2NU2E 2FDAA 3VB3A 4AZ2B 5GCHG 1YPEH 2BDGA 2LP6A 3F9EA 3H7TA 4JZ1A 1K1PA 1S6HA 2ZU3A 1TRMA 1EX3A 1UVOA 3MU0A 2VBCA 3OY6U 3SHAH 4O3UA 1V2TT 2OC8A 1DM4B 4XD7D 3SGAE 5HMAA 4XDEA 1GMCF 3RM0H 1DDJA 4TPIZ 1COWD 1V2OT 4UFFH 1JOUB 1C2FA 1A0LA 1NRQH 3RXHA 4GCHF 1P03A 1C1OA 2FYRA 2OD3B 3A7VA 1MUEB 1WTGH 1FV9A 1QA7A 1VITG 1V2WT 4WWYA 5EXLA 2EI7A 1FY8E 2ZTYA 2TGPZ 1RGQA 4UFGH 4ZKRU 1P2OA 1SLXB 2BY7X 1DLKB 1WOFA 1XM1A 4U01A 2C8WB 1CA0B 1O3HA 1BBRH 1C5YB 3SUDA 2LNCA 2M5TA 3M3TA 1DWCH 4FUGA 1DXPA 3E8LA 4SGAE 3AW0A 1IQLA 2P94A 2AEIH 3O8DA 2VIVA 2XBXA 4FU8A 4B2AA 5JBCS 1H8IH 2PV9B 3PMAB 1AFEH 3FKSD 3N7OA 1SVPA 3DFLA 1SGCA 1XKBC 1SMFE 1LKAA 1W13U 1WYKA 3VB6A 1IOEA 3HGNA 2EEKA 1GDUA 1XMNB 1EZUC 2OK5A 2GT8A 3OAAD 1RFNA 1GBLA 1V2VT 1DS2E 1QL9A 1KDQA 3MU1A 4FUCA 1DANH 1WTHD 4BTUB 1EP5A 3BEIB 3M7UA 4ABJA 3RXOA 1YWUA 3UR9A 1CHGA 2GP9B 4TYDA 1AWHB 1V2KT 3HK6B 1QBOA 4UDWH 2F3CE 2GZ9A 2VVUA 2ANKH 5CHAB 3VB4A 2Y6TA 1S84A 1SFIA 2BX3A 3RUOA 1UHBA 1C1VH 5EW2H 2BYAX 1BRAA 2OC0A 1G36A 4RN6A 3RXPA 4HTCH 1MBMA 4TSFD 3ZZ5A 1DXWA 1BMMH 2WPLS 4DVAU 1TBRH 4XE4A 3KQCA 1HDTH 1MZDA 2P3UB 3RLWH 4K1SA 1LCYA 3RMOH 4ZHMU 5FCRA 2AHME 1W12U 2V3MA 3M5LA 4I8GA 1IHSH 2AMQA 1W2KH 1EAIA 3SORA 1MAYA 3NPSA 1FIZA 1GJ4H 3IWMA 1B0EA 4NIYA 3EQ0H 1O5GH 3MYWA 1O2OA 4AYYB 2PSYA 3FN8A 1SLWB 1S85A 3WWBA 2QAAA 3RXSA 4TY6A 2KZ4A 1OWJA 1N8OC 4Q7YA 1O2NA 1OP0A 2BOHB 1HAYB 2XWBI 3A7ZA 1C5SA 2XTTB 2ZFQH 1AZZA 1AE5A 1TNGA 1EFRD 3GY2A 2O8WA 3H7OA 4AG1A 1E36B 1V2RT 1L4ZA 3E0PB 1GVKB 1NC6A 4GAWA 1O3DA 2PKSB 3DD2H 5DKMA 1NO9H 1NZQH 4NZQA 4CRAA 1WUNH 2ZO3H 3LU9B 1DPOA 1LQEA 2D8WA 4HG6A 4DJZB 1LVMA 3U1JB 2FO9A 2XNDD 1ID5H 2GZ8A 4IW4E 2JJ2D 1WCZA 3MU8A 1F0RA 2V3OH 1KSNA 1XUJA 1V2ST 1FIWA 3V0XA 2BTCE 4ESTE 3MWIU 4MVNA 2SNWA 1LHFH 1YLNA 3SGQE 2AH4X 3BEUA 1A2CH 4GSOA 1ANBA 2ZP0H 3T26A 4UFDH 2JETC 3M5NA 3GY5A 1BTXA 1EUFA 3P95A 3QX5H 2Z9GA 4OGYA 2EA3A 1ZLRA 2O8LA 4HFPB 4K5ZA 4CRBA 1BTZA 3F0OA 2Q6GA 1C4U2 4H42U 4DY7B 1EASA 4BANB 1TBQH 3MQKC 1CA8B 5EXNA 3TJOA 1AO5A 2TRMA 3LDXH 1SBWA 4FUDA 4OM9A 4U2WA 3GDVA 2BD2A 2ZHQH 2AS9A 1YGCH 4VGCC 5A8YA 3DSPA 3NK8A 2P8OB 3M3SA 2W7UA 1GI6A 3RLYH 2TIOA 3UREA 1WU1A 1ZTJA 1QJ1B 3F3BA 1NU7B 1ZGVA 3PMJA 1UHBB 1O30A 1J9CH 2OXSA 3PRDA 4K1TA 2J92A 2XC5A 3GCOA 2BY5X 1SGRE 1FMGA 1BBRK 5CE1A 1IQKA 2WINI 1O3OA 2M2AA 5C17A 1P10A 3SU2A 3LC5A 1GI7B 1PQAA 3QK1A 3KQEA 2SGPE 1WDIA 5C67A 3K2UA 1YPLH 1IQEA 1EPTB 4THNH 4UD9H 1C1PA 3W1EA 1OWHA 1IQFA 3M5OA 3KEEA 3P6ZB 4UEHH 4X2YA 3IITA 1HAHH 1C2GA 2VGCB 2XCNA 1P57B 4DW2U 3TGJE 1C1RA 4ISHH 2F9VA 5T1VA 2Z3EA 3RM2H 2K0QA 3V13A 1SGYE 5JPMH 2FLRH 1Z1JA 3EAJA 2OBQA 1T4UH 3SNEA 1BJUA 1B7XB 1HCGA 1O0DH 1O2GH 4TWWA 2GT7A 1C1MA 2G8TA 1KTTB 3N99A 3SNCA 1P2KA 4I8JA 1MCTA 1UW7A 1GMDG 3ZZ3A 4ABGA 3U28C 5EW1H 1QCPA 3N7EA 2ZGHA 1BMNH 4XBDA 1KXBA 2QF3A 5F8ZA 2H2ZA 2BD9A 4NSYA 1GMHG 4ZH8A 3DSGA 4X6OA 3C1KA 2OC1A 5DP4A 1OS8A 1THSH 1UVUH 4ABIA 4H4FA 3E16B 4Q63A 2GDDA 4IC5A 1D3PB 2F4LA 3SJKA 1CGJE 5F03A 2PTNA 2WUCA 2ZEBA 3I78A 2WPMS 4X1RU 2QC2A 1G3EA 1U6QA 1ZSLA 3MNXA 3RDZA 1GI5A 3SU6A 1ANCA 2BXTH 1PFXC 3TGKE 3MH7A 4ISNA 1AZ8A 1HPGA 4RKJB 1SQAA 2PGBB 1O5AB 5DO4H 1SGQE 1SGEE 4H6TA 1FY3A 1C1QA 1J8AA 3SI4H 3H09A 2W3IA 3Q00A 1TB6H 1TFXA 3E3TA 1GI4A 2GMTC 1OWEA 3LC3A 4CRDA 1ZGIA 1G2MA 3SUGA 3ZVCA 1VGCC 2FMJA 2ZTZA 3SUEA 3TK5A 2FOGA 1LHDH 2VH6A 9LPRA 1TIOA 2FOFA 2BQWB 2QYIA 1T4VH 3IG6B 2BLOA 3SJ8A 4D7FA 4MNVA 1A0JA 4Y7BA 1P9UA 1IQMA 1UTKA 2HPQH 5DP7A 2CHAB 4Y71A 4OS1A 1TABE 1BTYA 1QBVH 1GI8B 5FHTA 3MFJA 4O03A 3SNAA 1HIAA 1DWDH 1V2NT 3QDZB 1GBKA 2WPHS 1ZHPA 2BX4A 3URDA 1P04A 1A3BH 4O97A 1VKYA 1DLEA 2V6NA 4AB8A 2VWMA 2VIDA 3G01A 4YOGA 3SU3A 1WQSA 1NY22 2SGDE 3K9XB 2KCYA 3I29A 1EATA 2ZFRH 3VEQB 1LHGH 1QURH 1TOCB 3SNDA 3A7YA 1QQ4A 1SQTA 1QFKH 2GX4A 1C4V2 1DSTA 1W14U 2STAE 3BIVH 1D3TB 1P2QA 2QE7D 2Z94A 3A81A 2P3FH 4P00A 1UTPA 3GCHC 2WV5A 1L1JA 2ASUB 2V7QD 4D76A 1ELBA 1MU8B 3M5MA 2QF4A 2HNTF 4OS2A 2ZIQH 1A0HB 2GCHF 1TNKA 2C93B 1RIWC 1GWAA 3S69A 4TWYA 1C5VA 4ABBA 1C5ZB 4CR5A 3B8JA 3RC5A 2OQUA 1YCPK 1K2I1 1TGBA 4BAOB 1XXDA 3UOUA 1G2LA 3KL6A 1Z8RA 5HM9A 1HAGE 1LPKB 3UQOA 1P12E 2C90B 3O8CA 3GY7A 2QA9E 1LVYA 6CHAB 1PPBH 4CBOA 2KFWA 4K8YA 1EOJA 1DY8A 1SI5H 3BTQE 5C1UA 1GG6C 2TGTA 3DA9B 1GBAA 4R0IA 2EY4C 1RTLA 3GDSA 2ZWLH 4AG2A 1DITH 2QXGA 4I7YH 1ZMNA 5LPRA 2WPJS 1NFYA 3LJOA 1G32B 2Z9JA 3SJ9A 3BTKE 2FTMA 3MO9A 2EI6A 2ANYA 1FJSA 1C9PA 4X2WA 4ABFA 2G51A 5I25A 1Z6JH 5FPTA 2A5KA 1KXFA 2BVRH 4M9FA 2YNAA 3AAUA 2CV3A 3PO1B 1LTOA 1QB9A 3M7QA 1RTKA 4F48B 5KEDA 2R3YA 1K9OE 5EQSA 4D9RA 1OWIA 1ZMLA 1AB9C 2WYGA 5C5NA 1EB1H 1HIAB 1BRCE 1W0YH 2J98A 3ZZCA 2HVXA 1S6FA 3TJNA 1KLTA 1O34A 5JBAS 3SUFA 5HXFA 1NRRH 4NA7A 3PM3A 1SGFG 4X8VH 1O5FH 3GY3A 3M7TA 2W26A 2ZU1A 5GDSH 1C5QA 1O2HA 3SJIA 1C5LH 2W6JD 3BG4B 2YOLA 1VZQH 2FI5E 1MD7A 5EQRA 3O8BA 5T6GA 5FCKA 1QA0A 3ZYEA 3D62A 5A0CA 1ELCA 4B75A 1ELAA 1JRSA 1KY9A 4I33A 5AFZH 1O3IA 2GCTC 3VGCC 3OFND 1O2MA 3OTPA 3BF6H 3SU0A 1XXFA 1LMWB 4I86A 2PR3A 4I8KA 1TX8A 3A82A 1UTQA 2AMPA 3S9CA 1BOQA 1EXFA 2HVYB 3ENSB 5EQQA 1BB0B 3ZZ7A 1HAPH 1KIGH 3QGNB 3RXBA 5AFYH 4YM9A 2OUAA 4MPXA 3TJUA 1TPOA 3SI3H 4NFEA 4CR9A 4DCDA 1YYY1 3VB7A 1BBRE 1AKSA 5H4IB 2W5EA 1DSUA 4WXIA 1O3LA 1W0KD 4BAHB 6LPRA 3RU4T 1BZXE 3FZDA 3SOSA 3TNSA 2I6QA 2FOMB 3QN7A 3U69H 2ZU2A 3BIUH 4X6PA 4AFUA 4IC6A 3UAIC 1TMTH 2O9QA 4YOJA 3WWFA 4DIHH 1RD3B 4MPWA 1PPFE 2ZGXH 2VVVA 2QXIA 1C2DA 1E0FD 1P8VC 1ZHRA 4CBNA 1DUEA 3GISB 6ESTA 2A7JA 1E1QD 1XKAC 1A46H 1GI3A 1ZOMA 1KMHB 3MNCA 5FPYA 2PLXA 1GHYH 3MMGA 1S82A 2WHXA 1VCQA 1YPKH 3TIUA 3ATMA 1BHXB 1JXPA 1ANEA 3DUXH 1BMFD 1TWXB 5TJXA 2QGRA 1Z8IB 4HGCA 1G3DA 2BVSH 1AVGH 3SZNA 1BT7A 2ESTE 3NZIA 3E90B 4B71A 3Q76A 1HV7A 1HFDA 4XBCA 1C2LA 3ZVGA 1TE0A 1FPHH 4JZEH 1AFQB 1INCA 3VPKA 1XUGA 1UMAH 1D4PB 5C2ZA 1JBUH 3FANA 1TNHA 3Q3KA 3L6PA 1ZSJA 4ZROA 3CNRA 1K1LA 1A5IA 1BCUH 2BQ7B 1S6LA 1ANDA 1O5EH 1G3BA 4GVUA 2QV1A 1QR3E 3FP6E 3ATKA 4TPYA 2A7HA 1HAVB 4NWLA 1F92A 4Z6AH 1GHVH 3V12A 1QY6A 4AGKA 2FZZA 2G4UA 3F2HA 1F7ZA 4FETA 4NA8A 2FX4A 3I77A 1GGDB 3LONA 2BHGA 3LOXA 1GVZA 1O5BB 3EA8A 5BRRE 5L2ZH 1XUFA 1YPJH 1UJ1A 1C1UH 1KLIH 3GYLB 2PHBA 1DWEH 4FXGH 1HJAB 1C5MD 3BN9A 3ZVAA 2BY8X 2XWAA 3U8OH 3KF2A 2WPIS 2QY0B 1HB0B 1MTNB 3SV2H 3P8NA 2ZHWH 2JDID 1AU8A 2H9TH 5CHBA 3F6UH 2P3TB 1MMJN 1MQ6A 3BTEE 3QZRA 1ZHMA 3V3MA 3GCNA 4F55A 3A7TA 2NWNA 4ABDA 4Q2KA 1O2QA 3VXFH 1QIXB 3QGJA 2NU4E 2BD7A 4WVPE 4DT4A 4LOYH 4YXWD 4B2CA 1E38B 1KXCA 3RXMA 3L33A 3PRBA 4BAQB 3W95A 5C1YA 2XYAA 2WPKS 4ZKSU 1SLUB 3PROA 1UVTH 1D6WA 5C5OA 1PJPA 3OSYA 1AKSB 1NFWA 5K7RA 1HLTH 1MBQA 1NFXA 1MKWK 1YF4A 3TPIZ 2VWNA 2ZDLA 4ISIH 1BMLA 1S83A 1AD8H 3RXLA 2BDHA 1O2VA 2ZI2H 1LO6A 2RA3A 1WXRA 1W7GH 1VR1H 5GIBA 1SGDE 4ZHLU 4NIVA 4NFFA 1OWKA 4FVDA 2CJIA 3GCTF 4X8TH 1EZXC 3PLKA 5GJ4B 1TQ0B 5FPSA 4MPUA 3LH1A 2F83A
chains in the Genus database with same CATH topology
1FI8A 3STJA 1GBFA 3SJOA 3SHCH 2D26C 2Q1JA 4J1YA 3S0NA 5FBEA 2BVXH 3SU5A 1J16A 5FBIA 2TPIZ 3SQEE 3SGBE 3KCGH 7LPRA 1G37A 3ZZ9A 2B0FA 2FEQH 1TONA 1O3EA 3CP7A 2CN0H 1P0SH 1L0ZA 4B74A 1MTSA 2ZZUH 2GV7A 2FXRA 3T27A 3HATH 1ZPZA 3UNSA 2GCHG 3GYMA 5DP8A 2QN5T 2VVCA 1FDPA 1SG8B 2XRCA 1RS0A 3MU4A 4BTTB 2J2UA 1QQUA 3NXPA 1RIWB 1ELDE 1O3KA 1UTLM 1Y5AT 1BHXF 1O31A 2H5DA 1MZAA 4DURA 4YESB 1S0RA 3TGIE 2UUYA 2BMGB 5A0BA 4D8NA 1G3CA 1CHOG 1FLEE 1BDAA 4ABEA 1B0FA 5E2OA 2P93A 3RMLH 1NU9A 4BNRA 2G55A 1GJ9B 4DOQA 1F5LA 2H9HA 3U98H 1YPGH 2C8XB 2GZ7A 1E35B 4UE7H 1P3CA 4CRGA 2ZHFH 3A87A 3GICB 4IGDA 4DGJA 1KDQB 3RXVA 1HAIH 2Y7XA 4ZUHA 4KP0A 1H9IE 3EDXB 4JZFH 3JZ1B 3EA7A 1PQ5A 3UR6A 1P02A 1TX6A 1YC0A 2G00A 3HKJB 5C20A 1IQHA 7GCHG 2D2DA 1AUTC 1P2JA 1YBWA 4X1PU 4Y8YA 2ALPA 3B9FH 2VIQA 5J4QA 3UFAA 2BZAA 5T6FA 2FLBH 3M61U 1GJ7B 5ETXA 1T32A 1A5HA 1H4WA 1GHZA 1H8DH 1K1MA 1LPGB 2F9PA 8GCHF 4AFZA 3E0NB 1H9LB 2GVFA 2SFAA 1GL1A 2BY6X 2OLGA 3BTHE 1SHHB 4JZIA 1BTUA 1YCPH 1HYLA 3LGVA 4NSVA 1PQ8A 1DT2A 4AN7A 1UK3A 1EP6A 1K22H 4A1TA 1GBBA 1GCDA 2B8OH 2ZFFH 1L1NA 2TGDA 1GHAF 1XUIA 5DG6A 3TJVA 1ZJKA 1QL7A 2DE8A 1C1TA 1PPEE 2VWOA 1O2KA 1D9IA 3A83A 2Z9KA 1ACBE 1C5WB 1TX7A 2VB0A 2ODQA 1F0TA 1JWTA 2XXLA 1AMHA 5DP3A 1GHBF 3MHWU 3LJJA 2OQ5A 2Z3DA 3MO6A 5EODA 4TY7A 2C4FH 4NGAH 1TBZH 2FS9A 2GKVE 1ZTKA 1O3FA 3ATLA 4B76A 1J14A 1FAXA 2FM2A 3RXCA 4O3TA 2ZDVH 1GCTB 1NRSH 3TH2H 2UWOA 5GCHF 3DHKH 2ALVA 1CBWC 1IAUA 3MU5A 3D49H 3ATWA 1ESBA 3F9GA 3MH6A 3URCA 2IOTA 1BTHH 2BOKA 3C27B 3RU4E 3LH3A 2ZC9H 3RXEA 1OX1A 4ZXXH 4MNWA 4NWKA 2B9LA 3GOVB 1EAWA 1T7CA 1L2EA 1SL3A 1CA0C 1GJ6A 1O2ZA 1O32A 1VITF 1MH0A 1P01A 1S81A 1CT0E 1GMCG 3LGTA 3T2NA 3HK3B 2PUQH 2AIQA 4ZKNU 4AFQA 1BRUP 1GVLA 2J94A 4WF8A 1YLCA 1C5RA 1UVPA 3M36A 2ZQ2A 4GCHG 4LK4A 1GBEA 2ZHEH 2F9OA 2KAIA 1SFQB 2VU8E 1K1OA 1FY5A 5K0HA 4WMEA 2PSXA 3CS0A 1O2SA 1ZTLA 4O9VA 1O2WA 2Y5FA 1BITA 2RG3A 3PMHB 1ETRH 2FIRH 4BXWA 1UK2A 1MTWA 1JIRA 1VJAU 1HAZB 2BB4A 2TGAA 5F8TA 3STIA 1ELGA 1W11U 1C1NA 2OBOA 2R9PA 1TRNA 4MG3A 3MO3A 1SC8U 5EU8A 3ODFA 1NRPH 2Y5HA 3ZYDA 1O2IA 2UUJB 1V2PT 3SO3A 3FP7E 1GI1A 2ZFTA 5CHAC 3NCLA 1Y59T 4DIIH 4K1EA 2F9NA 1C2EA 3U1IB 3PLBA 1V2LT 2J34A 4E06H 5JB9S 3O8RA 1P2NA 1YPMH 4OS4A 4UONA 3NKKA 2ULLA 1O37A 4WMDA 3QWCH 1AUJA 1NFUA 5E0HA 2QXJA 2BZ6H 3OX7U 5LGOA 4DG4A 1A5GH 2FI3E 2BD8A 2BY9X 1O5DH 1ZRBA 1UCYH 2G5VA 4FUHA 4Y0YE 2H1UA 2GGVB 4Y8XA 2ZKSA 1B5GH 3A8BA 2A2QH 1CGHA 1SGPE 2ANMH 3PLPA 3LGIA 1C5UA 1SPJA 4K69A 1ZPCA 4AGJA 5DP9A 2R0LA 3UY9A 4Q80A 1Z8JB 1C5NH 2XC0A 2G4TA 2Y5GA 1YM0A 4K8BA 1HNEE 3A7XA 2RCEA 3LGYA 3KIDU 3PWCA 2JH5D 1MTUA 2PKSC 2THFB 2ZCLP 3PTNA 2FTLE 1FAKH 2A32A 2GV6A 1Y3VA 2Z7FE 2P59A 1GL0E 3SQHE 1CE5A 2B5TB 3U8RH 3VB5A 1JRTA 1T8MA 2BD5A 1TGCA 1D3QB 5TCCA 4GHQA 1DFPA 1GJBB 1MCVA 4Y11E 1DX5M 1O35A 1ZZZA 1LQDB 3R3GB 1QRXA 4Q7ZA 1OKXA 1DICA 4ZAEA 3P70B 1K28D 1TQ7B 4IMZA 5IDKA 5LPEA 1N8OB 2NU3E 4GHTA 4X2XA 1V2JT 4GUXA 2BDAA 2FWWA 2G52A 1O3NA 1SGIB 5TCAA 1RJXB 2A4OA 1T8OA 4HZHA 1TAWA 1F0SA 3TK6A 1TNJA 3E91A 2XBYA 1EB2A 2CXVA 3D23A 2JH6D 4WMFA 4CHAC 4WJG2 3S9BA 5GPIB 1MKWH 2P8OC 1MQ5A 1ELVA 4X8SH 1TRYA 1W10U 5A8ZA 1C4Y2 3HKIB 3RXDA 3OY5U 1EJAA 3BTDE 1ESTA 1XVOA 3MNSA 1TNIA 1EZQA 1BQYA 2P16A 2DUCA 2SGFE 2FOCA 4NG9H 2AGGX 3PTBA 1NT1A 1O3PB 3K6YA 5FX6A 4ZHAA 3RXAA 2A2XH 2AFQB 1PYTD 1TA6A 5A0AE 1O2YA 1SGFA 2ZDKA 4A6LA 1W3CA 1O2TA 5BPEA 4ZKOU 1V2QT 4MNXA 2A4QA 2JETB 5FAHA 1K1IA 4RKOB 1EPTC 5EOKA 2NU1E 1C2KA 4BXSA 4UFEH 2JH0D 5DP6A 2HNTC 2VGCC 1VCPA 3OTJE 1EZSC 1JMOH 3MTYA 2A4GA 4E7RG 1E37B 3H5CB 1IHTH 4MLFB 1UVSH 1HAOH 2I6SA 9ESTA 1TPPA 4VGCB 1ELEE 5JB8S 1S5SA 3UNQA 1RXPA 1QB1A 1XUHA 3A86A 8GCHG 1FN6A 1UTOA 1SOZA 1AE8H 2BXUH 2QF0A 2SGEE 4Y76A 2O8UA 3EE0B 5E0GA 2A0QB 4BAMB 3T62A 1C9TA 2H5CA 1SGTA 3CS7A 4ISOA 1WAYB 1GMDF 2HWLB 1WV7H 3ZV8A 4K2YA 1GI2A 3SW2B 1C1WH 2EI8A 4RSPA 2AGIX 2ZA5A 1OPHB 1W8BH 1Y5BT 3PV4A 4ABHA 3KQBA 1GJ5H 1FZZA 1THRH 5DPAA 1NESE 1UCYK 4WY3A 1C5TA 1O3CA 1GMHF 1O3GA 1W0ZU 3MOCA 8KME2 2ZCHP 1FY1A 4YO9A 1ZSKA 1T31A 1GDNA 1F5RA 3RXQA 1F5KU 4X1NU 1D6RA 1YPHC 1QL8A 2H6MA 4JK5A 1EOLA 1ARCA 3BG8A 3RU4D 3P8FA 3BTME 3ZVFA 2IN2A 2ZGJA 3KHVA 5PTPA 1P05A 1BTWA 1EKBB 5HM2A 6GCHF 2G81E 4JYUH 3SU4A 3FFGA 4AFSA 2BQ6B 1PPGE 1QGFA 1QTFA 1TYNA 2UUFB 1P06A 4CH2B 2QIQA 4FUJA 4KGAA 4Y79A 1A4WH 2FS8A 3LT3A 1P9SA 1CBWB 3QZQA 4IN1A 3SV8A 3AW1A 1N6XA 3PB1E 4Q7XA 3U9AH 1F2SE 2ZCKP 1ELFA 1AVXA 3UUZA 1MD8A 1XUKA 1O3AA 2WUBA 4WXVA 3BEFB 7KMEH 3UIRA 2F9UA 4ASHA 1C1SA 1GBCA 1AI8H 3QUMP 2IJOB 4XSKU 1C5PA 3UPEA 2CHAC 4INKA 2QCYA 3HGPA 2FESH 3VFEA 3RXIA 3DT0H 5DGJA 1N6YA 5T6DA 2BDCA 3MH4A 4ZXYH 2Z9IA 1N1LA 3SV7A 2VIPA 4Z0KA 1FONA 1WQVH 2R3UA 5IYTA 2W7SA 2HLCA 3K65B 4MPVA 1NRNH 1P2IA 2HALA 3QTOH 2GMTB 2BDBA 4Y7AA 1P09A 2D1JA 2C8YB 4I8HA 3W94A 1TGSZ 4JCNA 3E6PH 3FP8E 1VGCB 3ZVBA 1ORFA 3GY8A 1Z8GA 3FAOA 3P17H 8ESTE 1O5CB 3A88A 4SGBE 1V3XA 1OSSA 2AMDA 3UNRA 5FXLA 2FOHA 4FUIA 5C3NA 3FZZA 2J9NA 1IQJA 4MNYA 2V35A 4YT6H 1DUAA 4OGXA 1ZRKA 2Y7ZA 4MDSA 2A31A 5E8EH 2ZPRA 3TU7H 3RMMH 4J2YB 4YLUA 1Z1IA 2WV4A 3LIWA 2ZNKH 1THPB 2VIOA 2XCFA 3SNBA 5L2YH 4NCYA 3RP2A 4ISLA 1L4DA 2SNVA 2BM2A 4K3JA 4QT8C 1D3DB 3KQDA 2HRVA 1P2MA 3UTUH 2A45B 1Y3UA 4LZ1H 4MQAA 1P11E 1LDTT 1OWDA 2Y82A 4KTSA 4XFQA 1TNLA 5E2PA 2UWPA 1GPZA 1EPTA 2RA0A 6CHAC 4D7GA 2B7DH 4YTAA 1A7SA 1VCWA 3RMNH 3T25A 2W3KA 2ODPA 4XBBA 1O2UA 1UO6A 1YLDA 1YP9A 3BTWE 1AN1E 5LPFA 3F1SB 3DFJA 1V2MT 3EA9A 1FUJA 5DP5A 3BTGE 3GCHB 2PGQB 1OP2A 4B2BA 3A8CA 2XBVA 1WSSH 1OYQA 4AX9H 1QBNA 2TBSA 1AIXH 3AAVA 2BLVA 1AWFH 4IBLH 3RXTA 5B6OA 4INLA 3BV9B 3PWBA 2FP7B 4I32A 1BUIA 1Y3WA 3A8DA 2A1DB 1Z7KA 3QO6A 2ZTXA 3PO1C 3KNXA 3ESTA 3ELAH 5HYOA 1M9UA 4IS5A 4HI3A 1E34B 3TH3H 2ZECA 5JBBS 4OS5A 3RC6A 1KXDA 2A4RA 4X1QU 1EAXA 2PW8H 2HOBA 1GI0A 4Y6DA 4AORA 3AVZA 1GG6B 1A3EH 2OP9A 4CH8B 5JYIA 1F0UA 4LXBH 2XC4A 1IQGA 3BG4C 2PTCE 3F9HA 5GWZA 1QHRB 4B1TA 3UQVA 1H9HE 4I31A 1C2JA 2YNBA 5G4BA 1CU1A 3TITA 1TGNA 1O2LA 3TK9A 2HGTH 2O8TA 2PKAA 4M7GA 1AQ7A 2C8ZB 3ZV9A 1AY6H 1OP8A 5HGGA 4CHAB 2EC9H 3PYHA 4ABAA 1C2MA 2BD3A 3EYDA 1LHCH 3SBKA 4I8LA 1VITH 2JKHA 1ETSH 1O2PA 2FX6A 5ESBA 1CSOE 1AB9B 2WYJA 3QTVH 3WY8A 2BLWA 5AHGH 3BTFE 1GBDA 3GY6A 4JZDH 3Q77A 4X2VA 1O2XA 2F91A 1HGTH 1ESAA 5ESTE 1KXEA 1DE7H 2HNTE 2ZU4A 3FVFB 2BDIA 2SGAA 1KYNA 1MKXH 4KELA 4U32A 5F6MA 1GJ8B 2FOEA 3MI4A 1GJAB 1QB6A 1ZMJA 1EAUA 5AVDA 2GCTB 2OCVB 3VGCB 4MTBA 1C2IA 1GHWH 3SU1A 3B23B 2R0KA 2ZG0H 3ZZ4A 4NIXA 4F49A 2DE9A 1MAXA 1Y8TA 3SV9A 2FYQA 1FN8A 2VIWA 1NROH 3UWIA 1ETTH 1AGJA 1ZYOA 1V6DA 1DY9A 1O3BA 1FXYA 1SR5C 2AGEX 1GBJA 2PUXB 1AFQC 4AYVB 3SN8A 4IMQA 3MH5A 5EXMA 4BAKB 5EPYA 3RXJA 3TVJB 2IPHA 2XW9A 5DK1A 1C2HA 1CO7E 3RXGA 7ESTE 1J17T 1BIOA 1VJ9U 4NIWA 1FPCH 1A61H 1RTFB 2FOBA 1UCYE 1HXEH 1HBTH 1LVOA 2BDYA 3A84A 3Q3YA 1UTNA 1O3MA 4Y0ZE 1GGDC 2J95A 1KLJH 2Z6BD 1EQ9A 5FX5A 3UWJH 2OTVA 1YPHE 1KXAA 5T3HA 1XX9A 2G5NA 1HJAC 1QJ6B 3F9FA 4X6NA 4JYVH 4XOJA 1UK4A 1SSXA 3ZZAA 3A85A 1NS3A 1CGIE 6GCHG 4JK6A 1CT2E 1Z71A 1MTNC 2AIPA 2OINA 3BTTE 4X0WU 3GDUA 4AOQA 4JYTA 3S7HB 5I46H 2Z9LA 1EJNA 4ZMAH 3VXEH 1SLVB 2GDEH 3TLOA 1FNIA 2PKAB 1S0QA 2ZU5A 2ZF0H 2XNIA 4YZUA 2FPZA 4D9QA 1HUTH 4A7IB 4U30A 2AERH 1SB1H 1OXGA 3L3TA 2A7CA 3LKWA 2VWLA 3F68H 2R2MB 1O33A 5DJ7A 1IQIA 3CENA 4YOIA 4JMYA 4CRFA 3ZZ6A 1Q31A 2V0BA 2ODYB 1OOKB 5EPNA 8LPRA 1Y3YA 1Z6EA 2LPRA 1MU6B 3P8OA 2Y80A 2STBE 1ABIH 3K6ZA 4H6SB 1DWBH 1TOMH 1UTJA 1TALA 1TPSA 2BLQA 1L1GA 2BD4A 1O2RA 4PROA 4AB9A 2A5IA 1PPCE 2Q6FA 1GBIA 4GPGA 4NZLA 3RXRA 1V2UT 2VH0A 1BMAA 4DT7B 2K1QA 5LH8A 2NU0E 1EJMA 5A2MH 2CGAA 1CHOF 2HPPH 5E0JA 5SGAE 1K1JA 2XBWA 4FU7A 3A8AA 1Q3XA 3EGKH 1FY4A 1GJDB 2Q6DA 2VINA 5GXPA 3P8GA 1Y3XA 3GCTG 3RXFA 3T29A 2H9EH 3ZVDA 4Y10E 4A5TS 1SGNE 4OS7A 2PFEA 1QRWA 1K1NA 1LKBA 2Z3CA 3NWUA 3S7KB 2GD4B 3M3VA 4FUEA 4BTIB 2ZFSA 4BOHA 1C5XB 1G9IE 1AVWA 1BRBE 1MKXK 4A1VA 1W7XH 2Y81A 5L30H 2PWXA 1IQNA 2ZDNA 4K60A 1HRTH 2FOAA 3NUMA 1O36A 2KAIB 5L6NH 1YCPM 4FUFA 3PMBB