4JCNA

Structure of esp, serine protease from staphylococcus epidermidis
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
216
structure length
216
Chain Sequence
VILPNNNRHQIFNTTQGHYDAVSFIYIPIDGGYMSGSGVVVGENEILTNKHVVNGAKGNPRNISVHPSAKNENDYPNGKFVGQEIIPYPGNSDLAILRVSPNEHNQHIGQVVKPATISSNTDTRINENITVTGYPGDKPLATMWESVGKVVYIGGEELRYDLSTVGGNSGSPVFNGKNQVIGIHYGGVDNKYNSSVYINDFVQQFLRNNIPDINIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamyl endopeptidase
publication title Secreted proteases control autolysin-mediated biofilm growth of Staphylococcus aureus
pubmed doi rcsb
source organism Staphylococcus epidermidis
molecule tags Hydrolase
total genus 55
structure length 216
sequence length 216
ec nomenclature ec 3.4.21.19: Glutamyl endopeptidase.
pdb deposition date 2013-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4jcnA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4jcnA02
2ZWLH 3TGIE 3RXAA 2B7DH 1UVOA 2BX4A 1BBRE 4K1EA 3GICB 3SV8A 4UEHH 1UTQA 1P2JA 2TRMA 3OY5U 1EB1H 1QQUA 4CREA 2SGFE 1UO6A 4PROA 1J8AA 1MTSA 1L4ZA 3LGYA 1TNIA 1KDQB 2ZDKA 1MTNB 1P2NA 1CQQA 1FY3A 4BAQB 1BIOA 5EQQA 1T8NA 5JBAS 3GY8A 3RXKA 3UOPA 3U98H 3M36A 3DFLA 1TA2A 5EXLA 1ZTJA 3GCNA 1J14A 2BOKA 1BBRK 3LU9B 2F9PA 1EZUC 1DXWA 5F8TA 4CR5A 4O3TA 1SQTA 3ATMA 3E90B 2W7SA 1A7SA 1QHRB 2F9UA 3SV2H 1SC8U 1TX6A 1QJ1B 4H42U 4TWYA 5HMAA 4CR9A 1EJAA 2VWLA 1HBTH 1XUHA 1YKTA 2JH6D 2TBSA 1O2SA 3V3MA 3ZZ8A 1C1OA 2ZIQH 2GDEH 2GMTC 3E16B 5FCKA 1SGIB 3KQCA 1RTKA 5TCAA 3TJOA 3WY8A 1A5HA 3SI3H 4HTCH 2B0FA 4I33A 4UDWH 3A84A 1C5LH 3STIA 1GL1A 3ENSB 2QF3A 1QJ6B 1GBFA 2EI8A 1VITH 3T2NA 1LKBA 2BOHB 1GJ6A 1EOJA 3P95A 3PO1B 3LDXH 3HK6B 1UTNA 2GKVE 3BV9B 4BANB 1IQEA 2QYIA 1AU8A 2VIVA 3UUZA 4I8GA 1H9HE 4KP0A 1AO5A 3P8OA 2P3UB 2XWAA 2O8TA 3LGTA 2H2ZA 1NFWA 1LVOA 1MKXH 3SGBE 2GCHG 4GCHG 1FLEE 2OINA 1GDQA 3SNBA 1TBQH 2ZI2H 1GJCB 1GBDA 1HPGA 3BF6H 1ZHPA 2AGIX 5LPRA 1Y3UA 3SUGA 3DUXH 1C2JA 1D6RA 5EXNA 2DE9A 1O2XA 2TGAA 3RXFA 1O35A 2G4UA 1FN6A 1GHBF 1N6YA 4MPVA 5AFZH 3HPTB 4Y7AA 1K1OA 1ELFA 1AMHA 1KY9A 3K6ZA 4ABIA 2FXRA 1O2UA 5DP4A 1GDUA 1EKBB 1MQ5A 1TFXA 1TMTH 1P9UA 2Y5HA 1C2KA 2XNIA 3MH4A 5F6MA 4NFEA 2ZFFH 6GCHG 1EX3A 3GY6A 4IN2A 1GHZA 3H7TA 2FLBH 1XUFA 3ZZDA 1V2TT 1ETTH 2FIRH 1HJ8A 2BXUH 1GVKB 5C1XA 2NU0E 2ZHFH 2Q6DA 2ZC9H 4ZKNU 1Y3VA 1OKXA 1L0ZA 1E0FD 3PV4A 1FXYA 5PTPA 3RC5A 3ZVEA 2F9BH 1CSOE 3Q76A 3VPKA 1YPHE 1SHYA 2VVUA 3BTTE 3DFJA 4K3JA 5LH8A 1K1MA 4ZROA 5EPYA 5IYTA 3K2UA 3SHAH 2FOBA 1YCPM 4AB8A 1XUIA 2CGAA 2YOLA 1CGIE 5EODA 5L6NH 3OU0A 1P2QA 1ZSKA 1FPHH 2THFB 3LONA 2I6QA 5ETXA 1YLDA 3LOXA 1SB1H 1SR5C 4MPXA 1IHSH 1YC0A 1KDQA 2P59A 3OY6U 5C5OA 3ZZ7A 4Y8ZA 3BEUA 1QB6A 1Z1JA 2PTCE 3MU4A 1V2RT 4OS7A 3SBKA 1PFXC 2VJ1A 1EPTB 2FOGA 3V0XA 2VB0A 3QWCH 3I77A 3A80A 2ZHQH 2IPHA 3LKWA 1E36B 4A6LA 1K1NA 3ZVDA 1GHVH 1OWDA 3RDZA 3LGUA 3BG4B 2HVXA 1C5ZB 7GCHF 4ZHAA 3VGCB 2HGTH 1YM0A 4I8HA 4IGDA 1UTOA 2WPHS 1C1QA 2FODA 4CRDA 3BIVH 1IQNA 1ZPBA 3LJJA 1D9IA 4X2XA 3MNBA 3ZVFA 1A0LA 5EU8A 3A88A 1P01A 2PHBA 1K2I1 3BTWE 4NWLA 1SGFG 1KTTB 2WUBA 1T8OA 2KAIB 1KLTA 1KSNA 1V2PT 1Z8JB 1BTWA 1NU9A 1KXCA 3Q3YA 5J4SA 2AEIH 2QGRA 3RUOA 2R3UA 1J16A 2OD3B 2OUAA 1D3TB 3RXIA 1D3DB 4AB9A 2D1JA 1AFEH 4SGBE 2F9VA 1KYNA 4CBOA 4YTAA 3T25A 1ZTLA 2C8ZB 2XRCA 4NIXA 3MMGA 1ORFA 1EAWA 4BAOB 4BAMB 2GCTB 1BJUA 2PSYA 1HYLA 4DW2U 5JBTA 3W95A 2QAAA 3RU4T 5C2ZA 3A83A 1Q31A 1QA7A 1Z6JH 2VIDA 1RFNA 3SU3A 2VGCC 2GV6A 2RA3A 3HKJB 1FIZA 2VIWA 1P10A 2XYAA 1C2DA 1O34A 1QB9A 3FP8E 1TQ0B 3QTVH 2AYWA 4X6PA 4ISOA 3A7ZA 3EA7A 1H8DH 1P57B 4A1XA 1GBKA 2Z7FE 4U2WA 3P8NA 1F2SE 2H5DA 1HAZB 2G52A 1LQDB 3SNDA 1FY4A 4MPWA 3T27A 1GBJA 1CU1A 2C8WB 4YT6H 4GAWA 2FX4A 3SV7A 5EW1H 1SLUB 2QXIA 1GCTB 3U8RH 2P3TB 1XMNB 2HNTF 1OP0A 3VB7A 3RXLA 4CHAB 5A0AE 3RXVA 3QTOH 4TYDA 4WXVA 1BDAA 1ABJH 1HIAB 1H1BA 1TBRH 4JYTA 2GZ9A 5K0HA 2H9HA 5HM9A 3RXBA 1TE0A 3B9FH 4FU9A 1C5NH 1ZMLA 5A8XA 4AFQA 1DFPA 2ZDLA 5HM2A 4Q2KA 1PQAA 3EGKH 3DD2H 2FESH 3NK8A 2A7CA 1YPMH 3PLPA 2FEQH 1UHBA 4JZ1A 3URDA 1IQKA 1YPKH 1C2LA 1MCTA 1ELAA 4SGAE 1DWBH 5DP3A 3F9EA 2VINA 1B0EA 2VU8E 3LGVA 3EA8A 3ELAH 2ZG0H 3ZZ3A 3UQOA 1B0FA 1C5TA 1DICA 2ODQA 1INCA 2SFAA 4ISHH 8GCHF 4RKJB 2BM2A 2ZU4A 3EAJA 1O3CA 1GI2A 2BXTH 2GD4B 4D9QA 2ZNKH 2JH0D 4BTUB 1T8MA 1JIRA 1O3JA 2Z9LA 5HGGA 1MMJN 3O8DA 1ELEE 1Z8RA 3JZ1B 2AERH 3AW0A 1A46H 5FHTA 4MQAA 1D3PB 3LH1A 1LKAA 2BD9A 3CS0A 1EPTA 4A7IB 4MVNA 4OS4A 4FUEA 1GDNA 1V6DA 5GXPA 1OYQA 3M37A 1S82A 2NWNA 4OS1A 4Y8XA 4B74A 1GI6A 5ESBA 5GDSH 3H5CB 1C4U2 2ANKH 1ZTKA 1UVPA 1G32B 2W26A 1A61H 2C3SA 2XW9A 1CA0B 4O03A 3UIRA 3ZZ9A 1PPBH 1PQ7A 1MCVA 1N1LA 2Z94A 4DIHH 3UNRA 1GI5A 3TLOA 2OBQA 2BB4A 1DM4B 2UWLA 4YM9A 2FOEA 4HI3A 2GP9B 4DT7B 1HJ9A 1BTYA 2XTTB 2KAIA 1VCWA 3KN2A 1ZOMA 3T26A 1BMAA 2BLOA 3A7WA 4DGJA 1LO6A 1TGNA 5EW2H 4ISNA 3ATWA 4GUXA 1UVUH 3TPIZ 4AN7A 2BQ6B 1FI8A 2A1DB 4UFDH 1P06A 1ACBE 1JRTA 1O2JA 2BDYA 5LPEA 1O39A 1QURH 5JB8S 1SHHB 3SV9A 3LPRA 2BHGA 1TGCA 2ZHWH 1TOMH 3U9AH 1SI5H 2JKHA 1C5OH 1LDTT 2AGEX 1GCDA 1DANH 3QN7A 2ZECA 4INHA 1PPGE 2XBYA 3EQ0H 4Q7ZA 1ZGIA 1LHEH 1O5DH 2ZHEH 1SL3A 5CHAC 3TJNA 5JYIA 4NZLA 1F5KU 3K9XB 1TWXB 1D3QB 1AVXA 2FTLE 1LPGB 1HJAB 1TALA 4Y71A 5DP6A 3MH7A 4HFPB 5FPSA 5EG4A 5FX6A 1TPAE 2ZDMA 4X1QU 4LZ1H 1AVWA 1PQ8A 3M5OA 4MLFB 3MNCA 1O38A 2OC0A 1HGTH 4ZAEA 1ZPCA 2G55A 4Q7XA 1BOQA 4IC6A 2W5EA 1QCPA 1QR3E 2ZGXH 3F9GA 1O3EA 3UY9A 2FMJA 1HIAA 4X1PU 3Q00A 1QY6A 1A0JA 1GJ5H 1ESBA 1TRNA 3BSQA 1DT2A 1QTFA 3A87A 1NZQH 1O2RA 3MYWA 1EAUA 1T4UH 4MNYA 2OXSA 3RU4E 1ELBA 2PUXB 5AFYH 1GI8B 1NROH 3ZZAA 1MBMA 1V2WT 5SGAE 1P05A 3T29A 4XFQA 2JETC 5AF9H 1F92A 3BTDE 1A1RA 1JBUH 1F0UA 2H9EH 2ZQ1A 1EUFA 3M5NA 1BB0B 2Y81A 3GCTF 1WUNH 3HGNA 3MH5A 4JCNA 2P3FH 1S6HA 1YPGH 2Z9KA 5CE1A 2ZPRA 5DG6A 2A5KA 1GGDB 3TH3H 2GTBA 2FPZA 1V2UT 4XBBA 3RMNH 2O8LA 1O3OA 4OGYA 1RGQA 3Q77A 2AMQA 5FPTA 3BN9A 3NUMA 2BDGA 1G3CA 2UUJB 3SUDA 1VGCC 1DSTA 2VH0A 2A5AA 1GBHA 1TONA 2P95A 2SNWA 4K5ZA 4LK4A 4FUFA 5I25A 1V3XA 2V0BA 3ESTA 1NPMA 1MAYA 2J2UA 1NO9H 2GV7A 1RRKA 2ZCHP 5C67A 2VVCA 2ZGCA 3GY4A 4ZXXH 2FO9A 4AZ2B 1UVTH 1DS2E 1GWAA 2ESTE 1VZQH 4B71A 3GCOA 2G8TA 4WH8A 1VR1H 1JMOH 1XUJA 5IDKA 3S0NA 1G9IE 1MKWH 1B5GH 2TGPZ 2PFEA 4ABEA 1F5LA 3RXGA 5B6OA 3SJ9A 4BAKB 1P3EA 2ZTYA 1GI4A 5JBBS 1TRYA 1GI3A 1MUEB 1V2MT 1L1NA 2Y7XA 3AAUA 2ZFRH 1AB9C 1DVAH 3LGIA 5A0CA 2A31A 1EAXA 3SNAA 1OXGA 4YESB 2OQ5A 3SHCH 1GI0A 1O3AA 4D8NA 1YYY1 4XBDA 4AFZA 1GBCA 1EATA 1GVLA 2AMDA 1ANCA 1TA6A 2ASUB 3GY7A 1XX9A 2P93A 4Y6DA 2OP9A 1UTJA 1ZYOA 1CGHA 1XUKA 2Y5GA 1O3HA 3IITA 2NU3E 1V2LT 1O2OA 3K65B 4I8LA 4Y7BA 1CHOF 1GG6C 5L2YH 4LOYH 1C9PA 1WV7H 1ZHMA 1QRWA 4ABAA 2ZFSA 1W0YH 1XVOA 3P17H 4H4FA 4KTCA 1W10U 3QDZB 4NA8A 1O2NA 3JZ2B 2VWOA 1YCPH 4FUIA 5E0HA 1TPOA 1ID5H 2JH5D 2WPLS 3B23B 1OWJA 2Z3CA 4UE7H 2P8OC 3QZRA 1DPOA 1GHBG 2PR3A 4JZDH 5GIBA 2OC7A 4NFFA 4ZUHA 2FOCA 4R0IA 3LC3A 1QL7A 4VGCB 5JB9S 1AFQC 2BX3A 1CBWB 2C8XB 3DT0H 1GMDF 1IQHA 3OTJE 2BTCE 1O37A 1JWTA 1GI9B 1O3DA 1KXBA 2BZAA 1LHFH 3C27B 2PKSB 1MBQA 6CHAC 4HZHA 3QLPH 2XCFA 1AUJA 3NKKA 1GI1A 5DGJA 1UTMA 4CH8B 3RMLH 2UWPA 3M7TA 4WY3A 1BRAA 5BPEA 1ANBA 4DIIH 5DP7A 5A2MH 3KEEA 3ZVAA 1YP9A 4UFFH 4MNXA 4INKA 2EC9H 3MU5A 1SGEE 3SU1A 1EQ9A 4NZQA 4J2YB 2HRVA 1P3CA 3ITIA 2YNBA 2R0LA 2F83A 3O8BA 3BTQE 3SU4A 2G51A 2OBOA 1FY5A 5DK1A 1RIWC 1Y5AT 2ZDNA 3O8RA 4ABHA 1GJDB 2ODPA 3HKIB 4X1SU 3A7YA 1W2KH 8LPRA 1ZGVA 2A45B 1O3LA 4NGAH 1UHBB 1MU8B 3ZZ5A 2ANMH 3E3TA 3FP6E 3PYHA 1EJMA 4I8KA 4I32A 4ZHLU 1V2JT 3A7XA 3AW1A 3K6YA 5FX5A 4X1NU 1BITA 3NZIA 1DUAA 2ZGHA 2BDCA 4E7RG 4AORA 3KCGH 3U1IB 2BVXH 3S7KB 4B73A 2BYAX 1SQAA 3Q3KA 1DE7H 2ZU3A 2XCNA 1F5RA 1PPZA 1AHTH 1QFKH 2OQUA 7GCHG 5JDUB 4RSPA 1JOUB 2VH6A 2TGDA 3S69A 4NIWA 1TABE 2A0QB 1OS8A 5F8XA 1EXFA 2O8MA 1NFUA 1N6XA 1QGFA 1ELGA 1WCZA 1HAGE 1RXPA 4BTIB 1FQ3A 2BD2A 1GL0E 1O5AB 3ZYEA 4Y8YA 1SGCA 3RM2H 4QT8C 1HAXB 4ISIH 4MPUA 3SO3A 4DJZB 3A7TA 4ZMAH 1HUTH 1F7ZA 1LVBA 3A81A 1BZXE 2VIOA 1O2TA 1LVYA 1SOZA 2F9OA 1YBWA 3LC5A 1A3EH 1KXEA 1T31A 3MO6A 2FWWA 1O2LA 1UCYE 4YLUA 4CRAA 1EZSC 1SQOA 1TMBH 1BBRH 2Y7ZA 3UR6A 3TH4H 2VNTA 2CHAC 2Y82A 5EQRA 1FY1A 3G01A 3CENA 1DY9A 2ANYA 1IOEA 1O3PB 1BTHH 2SGPE 3U1JB 3UTUH 3E6PH 1W3CA 4JZIA 2M5TA 2ZEBA 8KME2 3V7TA 1O32A 2RDLA 3RXPA 3TH2H 1FAXA 1GVZA 2GT8A 2PGQB 1UCYK 3AVZA 4IC5A 2FYRA 2EA3A 1RTFB 2CF9H 4FU7A 3IG6B 2BY6X 1SG8B 1FN8A 1P04A 3PLKA 3RLYH 1Q3XA 1P2IA 2C4FH 4X6MA 3SUFA 5F03A 2WUCA 1RTLA 4X2VA 1MTUA 1GBIA 1P8VC 3ZV9A 1LHCH 2QC2A 1NS3A 2AIPA 2ZZUH 4MTBA 4XOJA 1OOKB 4B75A 1YGCH 1KXFA 5AHGH 1V2NT 5C1YA 1Y8TA 3U8OH 1O2GH 1BTXA 2V6NA 4FU8A 1HAOH 2RA0A 3ATLA 4NIYA 3UNSA 4Z0KA 1QBOA 4YT7H 1A0HB 1N8OB 4MNVA 3UWIA 4ZXYH 4AOQA 5HXFA 4E05H 5DP9A 1GI7B 3VB6A 3ZZCA 3PWBA 3TK6A 1ZLRA 3SNEA 2O9QA 1W14U 1S84A 4KKDA 2D2DA 3BTME 4IW4E 1DDJA 1TNLA 2VIPA 1MTNC 1EP5A 1O5EH 1E34B 1EP6A 1ZSJA 3PMBB 2C90B 3SUEA 4X8UH 1AUTC 3HATH 1C1NA 4IMZA 4NA7A 1P2OA 2CV3A 3ATKA 1THPB 4GSOA 1J17T 1H9LB 2WPMS 8GCHG 3SZNA 4Q80A 1K1IA 2VVVA 1ELCA 2PUQH 1UK3A 1TGTA 4CRGA 1CT4E 1TPSA 1ESTA 1XUGA 1BHXB 2R3YA 3GDSA 5DKMA 3N7OA 3TITA 3RXDA 4NSYA 2IJOB 1TAWA 1TIOA 1EASA 2FI3E 1QRXA 3PTNA 4U32A 1Z8GA 2CJIA 4DY7B 1WYKA 1AKSB 2F91A 1TQ7B 1WTGH 2ZTZA 1K9OE 2AH4X 2GMTB 1T4VH 1F0SA 2XBXA 1GG6B 2HWLB 4FXGH 3ZVCA 4CRBA 1VITF 3PO1C 1C2HA 1C9TA 1O3IA 4RN6A 1LHDH 2J4IA 4K8YA 4M7GA 2PW8H 3RXUA 1O2IA 1ZR0A 3MNSA 2QN5T 1GJ4H 1GBLA 3SW2B 1NTPA 4FUCA 2FOFA 2EEKA 4J1YA 1MH0A 1AQ7A 3PTBA 3VB5A 2W7UA 4FVBA 2SGEE 1EOLA 1A5IA 1WOFA 3I29A 4WMEA 4Z6AH 1AD8H 2ZP0H 1LTOA 3ZYDA 3E0NB 1C5QA 3MWIU 3S9BA 1K1JA 2TIOA 3D65E 3BTEE 1P9SA 1HFDA 4JK5A 5DJ7A 5G4BA 3ZZBA 2BDIA 3QGJA 1G2LA 1CO7E 1SGTA 3MI4A 1BRUP 5ABWA 3NCLA 2TGTA 3P8FA 1K1PA 2BVSH 2SGDE 4JMYA 3QUMP 2G5NA 4UFGH 2ZFPH 1XKAC 3E1XB 3RXMA 4KTUA 3RC6A 3UQVA 5FBEA 2XBWA 3T5FH 1GBTA 4JYUH 4AGJA 3KNXA 1FY8E 2GZ7A 3FFGA 3SJOA 1TNHA 3GYLB 3TJVA 1XXDA 3VXFH 4JZEH 2A7HA 4UONA 1D4PB 1A5GH 1SMFE 1WAYB 4F49A 3TVJB 2I6SA 1AGJA 4YOJA 4OS5A 3FP7E 5FBIA 1C5RA 3FZZA 4ZKRU 3RXJA 2BLVA 7KMEH 5C3NA 1ZHRA 2QXHA 3MOCA 3MNXA 4D7FA 1DLKB 1TNJA 1P12E 3H7OA 5EGMA 1ANEA 2UUFB 3V13A 1O5BB 3L6PA 2SGAA 6ESTA 1J15A 4FUGA 3GY3A 4Y79A 3FAOA 5FPYA 2ZCKP 3SORA 2GDDA 1NRPH 1MZDA 5E2PA 2QCYA 1GHAF 1SLVB 5FAHA 4IS5A 2OC8A 3RP2A 4O9VA 1TPPA 3FZDA 1KTSB 3EA9A 3TGKE 1E35B 3M7QA 1QNJA 3GCHC 1SGQE 3ZZ4A 1BTUA 1C2EA 3GDUA 4X6OA 2FP7B 1CE5A 2J9NA 3T28A 3HGPA 3GISB 3UOUA 1G3BA 5FCRA 1QA0A 3P6ZB 1L4DA 2R2MB 3R0FA 4THNH 2H5CA 1UMAH 2BY8X 1XVMA 1C4V2 3BIUH 2STBE 3BTGE 3GCTG 4GVUA 1EPTC 3CS7A 1O2PA 2J38A 2BY7X 3C1KA 3L3TA 3M61U 1JIMA 2AGGX 1MKXK 1SGNE 3LT3A 4Q7YA 2WYJA 1SGFA 2HOBA 3AASA 1SFQB 1XKBC 3P8GA 5EPNA 1PPHE 3BG4C 4X1RU 1THSH 1WQSA 5HYOA 4X6NA 1QQ4A 5ESTE 3PROA 3S7HB 4YOIA 3NXPA 2QA9E 2Y5FA 1Y5UT 1ZRKA 3BTHE 3MU1A 4UFEH 3SN8A 4CRCA 1G3DA 1S0RA 4JK6A 3S9AA 4AFUA 3QX5H 2XC5A 1W7GH 4ABGA 1GJAB 1J9CH 1ESAA 1GMCF 4MNWA 3TNSA 3QK1A 3SGAE 3ATIA 1GJ8B 3LGWA 1GMHF 4AFSA 1SPJA 1AKSA 2ZDAH 1ZMNA 1FZZA 1UK2A 4KGAA 1C1SA 1MU6B 1O3FA 4D9RA 3PMJA 2BLWA 1WSSH 3A8BA 2Z9JA 2BQ7B 3M35A 1TX7A 2A4QA 1BJVA 2PGBB 3L33A 4TY6A 3GOVB 2PWXA 3A86A 4B1TA 1GHWH 4NG9H 4TPYA 5GWZA 1G36A 2EI7A 2FOAA 3ZVGA 1DXPA 3UR9A 2F3CE 5GCHF 1PQ5A 4WJG2 2FTMA 2GCTC 1DOJA 1MTWA 2ZU1A 1T32A 1DWEH 1P09A 4MDSA 1V2QT 2OC1A 3TGJE 4WVPE 1QRZA 1NFYA 5E8EH 3SNCA 4FUHA 1OWIA 2ZKSA 1TGBA 2W3KA 1AI8H 1IQJA 2Z6BD 1LHGH 4TPIZ 3O8CA 3M5LA 2VGCB 3PWCA 1C5YB 1AVGH 1C5VA 3SI4H 1NRQH 4A5TS 3TIUA 1NESE 3TK9A 4U30A 4DVAU 3T62A 1HAHH 3RMOH 4OGXA 1P03A 1C1RA 4K60A 4JYVH 1CHOG 3DA9B 3RM0H 4RKOB 3BEFB 2SGQE 1GCTC 2A5IA 4F4OC 2ALVA 2PV9B 1Z6EA 4CHAC 1S5SA 4ZH8A 3MTYA 2FM2A 6LPRA 5DPAA 1LQEA 2CXVA 1ZJDA 2FOMB 3ZVBA 4INLA 2BMGB 1C4Y2 1E37B 2BD8A 4LXBH 2R9PA 1V2VT 1NC6A 2B8OH 1Z71A 4XDEA 3HK3B 1P0SH 2FX6A 1YPEH 4A92A 3UFAA 4X2WA 1SGPE 3LH3A 2V35A 4FUJA 1BMMH 4FUBA 2BD4A 5C20A 2WV4A 1M9UA 4ASHA 3FANA 2CMYA 1CHGA 5A8YA 3IWMA 1C1VH 2SNVA 1O2MA 1GPZA 2C93B 2CN0H 2HNTC 4FVDA 1UK4A 1AN1E 2GZ8A 2ZPSA 2WINI 2BD5A 3PLBA 1GMDG 5DP5A 4E7NA 1IQGA 1IQMA 4NWKA 1BT7A 1Y3XA 3P70B 3M3TA 1OP8A 3RXCA 2WPKS 1HXEH 2AS9A 2NU4E 1QL9A 3QGNB 1SVPA 5GJ4B 1C5XB 5TJXA 2ZU2A 2FI5E 1ZSLA 2FS9A 2NU1E 3RXRA 1H8IH 4NCYA 1YPLH 3A85A 1Z1IA 2BD3A 4AG2A 1ELTA 2HPPH 1WBGB 2V3HH 1C5MD 4I31A 4NA9H 4ZHMU 3OYPA 2RG3A 4DCDA 1P11E 2AFQB 3PMHB 1RD3B 1MQ6A 2BDBA 1Y3YA 2QIQA 2BD7A 4IMQA 2XWBI 2HPQH 1P02A 1L1JA 1FJSA 1CA0C 1L2EA 2FZZA 1ETSH 2STAE 5JBCS 1G37A 4H6SB 3EDXB 4K2YA 3A8CA 1C5SA 5LGOA 7ESTE 2VWNA 4ABBA 3SJIA 1AY6H 1W12U 2BDAA 1BQYA 1MZAA 4YLQH 2A4RA 4IBLH 1TNKA 5E0JA 1O2KA 1GJ9B 3M5MA 2Y80A 5TCCA 1YPJH 1C2MA 1RS0A 2PTNA 4WMFA 2H1UA 3A89A 1ELDE 1GBEA 3MU8A 4YOGA 1EAIA 2GCHF 2V3OH 4GCHF 5AVDA 2CF8H 1WQVH 4X8VH 1XM1A 1H4WA 1HDTH 3F68H 1C2IA 1JRSA 3MH6A 1LVMA 1CGJE 4GPGA 3QZQA 1NY22 1HAPH 2AMPA 4U01A 5E2OA 3VXEH 3SGQE 1ARCA 4H6TA 1DSUA 3M3SA 1MD8A 5L30H 3SU2A 2G4TA 2GT7A 3A8AA 3NPSA 4MG3A 4HGCA 1HAIH 2ZDVH 1YF4A 4BAHB 2IN2A 3B8JA 1C1WH 1FONA 1MD7A 3ODDA 1OPHB 3GY2A 3W94A 6GCHF 3UREA 1C5PA 1HJAC 1GBAA 3RXOA 2Q6GA 3SU6A 5CHAB 2AIQA 1H9IE 1OWKA 1TRMA 1HXFH 4IN1A 3BTFE 2O8UA 2G00A 2A2QH 2BZ6H 2FYQA 2J92A 3GCHB 2DE8A 4AGKA 2BDHA 2A4GA 1SSXA 3VB4A 1TBZH 1O2QA 2P16A 1GJBB 2GVFA 4B2BA 1TMUH 1RJXB 3M3VA 1L1GA 3S9CA 1VJ9U 3RXHA 3QO6A 3SOSA 3UPEA 2O8WA 2ZHDA 1O0DH 2ZTXA 1W13U 1FUJA 1ZZZA 3RXQA 1S81A 2ZU5A 1QBVH 2PLXA 2A7JA 1LPZB 1V2ST 4E06H 3KHVA 5E0GA 4A1TA 1OYTH 3V12A 9ESTA 1LPKB 1PYTD 2QF0A 3GDVA 1DX5M 3BG8A 1G2MA 1U6QA 2JETB 1BTPA 2ZF0H 2FLRH 1IQFA 2BY9X 9LPRA 4D76A 1AE5A 1GGDC 4R8TB 4BNRA 4ABFA 3SU5A 1W8BH 1EJNA 2EI6A 2VWMA 1D6WA 2XC4A 2UWOA 2PKAB 2ZPQA 1QIXB 1C2GA 1FIWA 3MU0A 1DUEA 1ANDA 1AE8H 2YNAA 1S83A 4O97A 3STJA 1O2VA 1C1TA 1O5GH 3SJ8A 1O5FH 1PPCE 4NSVA 5A09A 4WWYA 3RXSA 5DP8A 1P2MA 4I8JA 1VGCB 1UTPA 1O2HA 1VJAU 3ZV8A 1HNEE 2UUKB 1GHYH 2PSXA 1GBBA 2Z3DA 5BRRE 1PPEE 4ISLA 1G30B 1AZZA 1SLWB 1UJ1A 1ABIH 1C2FA 1AZ8A 1BHXF 4KELA 1NN6A 3E91A 3F9HA 1IHTH 4GHTA 3DHKH 1O31A 4AX9H 4X0WU 1HB0B 1UTKA 2D26C 1FDPA 3KQDA 2ZO3H 1DY8A 2GGVB 2F9NA 1PJPA 1BMNH 1C5WB 1C1UH 2ZFTA 1OWHA 4D7GA 1KLIH 5C5NA 5LPFA 2Q1JA 4ABJA 1NU7B 1V2KT 2RCEA 2WPJS 4K1SA 1P2KA 1TYNA 1W7XH 4A1VA 1AB9B 1TNGA 1VITG 1OP2A 1W11U 1BRBE 3E8LA 4BTTB 4DURA 7LPRA 1TX8A 4ZKSU 1BCUH 4JZFH 1THRH 1KXDA 3F1SB 4K69A 3KIDU 4X8SH 1A4WH 1ELVA 2HLCA 2WPIS 2WV5A 3UWJH 1DWDH 1CA8B 1O36A 3BTKE 2BLQA 5F8ZA 4ABDA 3KQBA 1O3MA 2QXGA 1IQLA 1K22H 4OS2A 1BMLA 3AAVA 2H6MA 4B2AA 1TLDA 5T6GA 2Y6TA 4YZUA 2R2WU 3CP7A 2C8YB 2ZGJA 3TU7H 1F0TA 1DLEA 3TJUA 2UUYA 2B5TB 1BA8B 2G81E 4YO9A 1OX1A 1Y59T 1K21H 1HLTH 3NWUA 3LIWA 1LMWB 3M7UA 2J95A 1HCGA 4VGCC 1MTVA 4XBCA 2Z3EA 2P8OB 3A7VA 2P94A 1KLJH 1BUIA 2DUCA 2FI4E 1CBWC 1BTZA 1S85A 3OSYA 3F6UH 1NRNH 2QV1A 1JXPA 3D62A 3OX7U 1V2OT 1EZXC 1VCQA 5H4IB 2PKSC 3I78A 2IOTA 1AFQB 1C1PA 1Y5BT 4Y0ZE 4NIVA 1NFXA 5EXMA 4WH6A 1G3EA 3R3GB 1AIXH 5JPMH 1O2YA 3RLWH 4X2YA 2OCVB 2HNTE 1MKWK 1SBWA 2D8WA 2ZA5A 1FNIA 1C5UA 1GHXH 6CHAB 1OSSA 1HAVB 1YPHC 1NRRH 3FVFB 1AWFH 4ZKOU 2J34A 5T6DA 4BXSA 3RU4D 2ZFQH 1FPCH 3RC4A 4Y10E 2HALA 1AWHB 2ZGBH 1OWEA 3MFJA 1FAKH 1YLCA 2PKAA 1PPFE 4ESTE 2A32A 1GHAG 1VCPA 1LCYA 2TPIZ 4TWWA 4XE4A 1X7AC 3KL6A 3KQEA 1MAXA 1WTHD 4DOQA 4AYYB 4WF8A 3U8TH 4I7YH 3BEIB 1UCYH 5T6FA 3SU0A 1CT0E 1QB1A 1O3KA 1RIWB 1XXFA 2R0KA 4TY7A 3MO3A 3VB3A 2BVRH 1CVWH 3D49H 5J4QA 4LZ4B 3RXEA 1IQIA 3VFEA 4AG1A 1O5CB 5DO4H 1QJ7B 2FDAA 4B76A 1F0RA 1FMGA 1IAUA 4BXWA 8ESTE 3A82A 2Z9IA 5A8ZA 5EQSA 4Y0YE 1YCPK 4UD9H 2J94A 3MHWU 2A4OA 2A2XH 1TB6H 1Q2WA 4KTSA 3D23A 2FS8A 3PMAB 1SFIA 1A3BH 4Y76A 4CRFA 1O2ZA 3URCA 2WYGA 1GMCG 3UNQA 2BY5X 1TGSZ 4FUDA 3SQHE 3EYDA 5FXLA 2ALPA 1GMHG 2QY0B 1ZMJA 4BOHA 1SGYE 5L2ZH 2ANWA 5CMXH 3Q3XA 1K28D 5EOKA 5C1UA 5I46H 4K1TA 1QL8A 3VGCC 3KGPA 2Q6FA 5T3HA 1DITH 3TNTA 1SGDE 2G5VA 2W3IA 4WMDA 2ULLA 1HV7A 1A2CH 1T7CA 3VEQB 1O2WA 4GHQA 2FOHA 5K7RA 4K8BA 4B2CA 1NRSH 5GCHG 3KF2A 1ZJKA 4Y11E 4XSKU 2LPRA 1EZQA 4AYVB 1B7XB 1KIGH 4O3UA 2CHAB 3LJOA 1K1LA 4GLYA 1DWCH 1Y3WA 1FV9A 3PB1E 1S6FA 1UTLM 2BQWB 4CBNA 3ZZ6A 1HAYB 1C1MA 1SOTA 2OTVA 3GY5A 2VIQA 3P92A 3SV6A 1ZRBA 2ZQ2A 2XC0A 2Z9GA 1E38B 3EE0B 3RXTA 3GYMA 5GPIB 4OS6A 3SJKA 4DG4A 2OLGA 2QXJA 1NM6A 2ODYB 2K1QA 2XBVA 1SGRE 5A0BA 3E0PB 3A8DA 2B9LA 2XXLA 1TOCB 4X8TH 1QBNA 1O33A 1BRCE 1W0ZU 1ETRH 1PYTC 2LNCA 1UVSH 1EB2A 1NT1A 3U69H 1GBMA 1GJ7B 4WXIA 1O3NA 3RMMH 1KXAA 1T8LA 3ODFA 1Z7KA 2NU2E 3SQEE 2H9TH 3F9FA 1SLXB 3MO9A 1ARBA 1CT2E 1N8OC 1O3BA 2ZCLP 2GX4A 1Z8IB 1HRTH 1O30A 4CH2B 1WU1A 3TK5A 1O3GA 3PM3A 1ZPZA 2ILNA 1HAVA 1S0QA
chains in the Genus database with same CATH superfamily
2ZWLH 3TGIE 2F4LA 2B7DH 3RXAA 1UVOA 2BX4A 1BBRE 4K1EA 3GICB 3SV8A 4UEHH 1UTQA 1P2JA 2TRMA 3OY5U 1EB1H 1QQUA 4CREA 2L6OA 2SGFE 1UO6A 4PROA 1J8AA 1MTSA 1L4ZA 3LGYA 1TNIA 2HVYB 1KDQB 2ZDKA 1MTNB 1P2NA 1CQQA 1FY3A 4BAQB 1BIOA 4P00A 5EQQA 1T8NA 5JBAS 3GY8A 3RXKA 3UOPA 2WHXA 3U98H 3M36A 3DFLA 1TA2A 5EXLA 1ZTJA 3GCNA 1J14A 2BOKA 1BBRK 3LU9B 2F9PA 1EZUC 1DXWA 5F8TA 4CR5A 4F48B 4O3TA 1SQTA 3ATMA 3E90B 2W7SA 1A7SA 1QHRB 2F9UA 3SV2H 1SC8U 1TX6A 1QJ1B 4H42U 4TWYA 4B6EA 5HMAA 4CR9A 3PV2A 1EJAA 2VWLA 1HBTH 1XUHA 1YKTA 2JH6D 2TBSA 1O2SA 3V3MA 3ZZ8A 1C1OA 2ZIQH 2GDEH 3F3BA 2GMTC 3E16B 5FCKA 1SGIB 3KQCA 1RTKA 5TCAA 3TJOA 3WY8A 2KCYA 3OE7D 1A5HA 3SI3H 4HTCH 2B0FA 4I33A 4UDWH 3A84A 1C5LH 3STIA 1GL1A 3ENSB 2QF3A 1QJ6B 1GBFA 2EI8A 1VITH 3T2NA 1LKBA 3OTPA 2BOHB 1GJ6A 1EOJA 3P95A 3PO1B 3LDXH 3HK6B 1UTNA 2GKVE 3BV9B 3UB0A 4BANB 1IQEA 2QYIA 1AU8A 2VIVA 3UUZA 4I8GA 1H9HE 4KP0A 1AO5A 3P8OA 5KGOA 2P3UB 2XWAA 2O8TA 3LGTA 2H2ZA 1NFWA 1LVOA 1MKXH 3SGBE 2GCHG 4GCHG 1FLEE 2OINA 1GDQA 3KYGA 3SNBA 1TBQH 2ZI2H 1GJCB 1GBDA 1HPGA 3BF6H 1ZHPA 2AGIX 5LPRA 1Y3UA 4FETA 3SUGA 3DUXH 1C2JA 1D6RA 3OFND 5EXNA 2DE9A 1O2XA 2TGAA 3RXFA 1O35A 2G4UA 1FN6A 1GHBF 1N6YA 4MPVA 5AFZH 3HPTB 4Y7AA 1K1OA 1ELFA 1AMHA 1KY9A 3K6ZA 4ABIA 2FXRA 1O2UA 5DP4A 1GDUA 1EKBB 1MQ5A 1TFXA 1TMTH 1P9UA 2Y5HA 1C2KA 2XNIA 3MH4A 5F6MA 4NFEA 2ZFFH 6GCHG 1EX3A 3GY6A 4IN2A 1GHZA 3H7TA 2FLBH 1XUFA 3CNRA 3ZZDA 1V2TT 1ETTH 1NBMD 2FIRH 1HJ8A 2BXUH 1GVKB 5C1XA 2NU0E 2ZHFH 2Q6DA 2ZC9H 4ZKNU 1Y3VA 1OKXA 1L0ZA 1E0FD 3PV4A 1FXYA 5PTPA 5DN6D 3RC5A 3ZVEA 2F9BH 1CSOE 3Q76A 3VPKA 1YPHE 1SHYA 2VVUA 3BTTE 3DFJA 4K3JA 5LH8A 1K1MA 4ZROA 5EPYA 5IYTA 3K2UA 3SHAH 2FOBA 1YCPM 4AB8A 1XUIA 2CGAA 2YOLA 1CGIE 5EODA 5L6NH 3OU0A 1P2QA 1ZSKA 1FPHH 2THFB 3LONA 2I6QA 5ETXA 1YLDA 5HIYA 3LOXA 1SB1H 1SR5C 4MPXA 1IHSH 1YC0A 1KDQA 2P59A 3OY6U 5C5OA 3ZZ7A 4Y8ZA 3BEUA 1QB6A 1Z1JA 2PTCE 3MU4A 1V2RT 4OS7A 3SBKA 1PFXC 2VJ1A 1EPTB 2FOGA 4OM9A 3V0XA 2VB0A 3QWCH 3I77A 3A80A 2ZHQH 2IPHA 3LKWA 1E36B 4A6LA 1K1NA 3ZVDA 1GHVH 1OWDA 3RDZA 3LGUA 2QE7D 3BG4B 2HVXA 1C5ZB 7GCHF 4ZHAA 3VGCB 2HGTH 1YM0A 4I8HA 4IGDA 1UTOA 2WPHS 1C1QA 2FODA 4CRDA 3BIVH 1IQNA 1ZPBA 3LJJA 1D9IA 4X2XA 3MNBA 3ZVFA 1A0LA 5EU8A 3A88A 1P01A 2PHBA 1K2I1 3BTWE 4NWLA 1SGFG 3UAIC 1KTTB 5KEDA 2WUBA 1T8OA 2KAIB 1KLTA 1KSNA 1V2PT 3FO8D 1Z8JB 1BTWA 1NU9A 1KXCA 3Q3YA 5J4SA 2AEIH 2QGRA 3RUOA 2R3UA 1J16A 2OD3B 2OUAA 1D3TB 3RXIA 1K0HA 1D3DB 4AB9A 2D1JA 4FOUC 1AFEH 4SGBE 2F9VA 1KYNA 4CBOA 4YTAA 3T25A 1ZTLA 2C8ZB 2XRCA 4NIXA 3MMGA 1ORFA 3KYFA 1EAWA 4HG6A 4BAMB 4BAOB 2GCTB 2JJ2D 1BJUA 2PSYA 1HYLA 4DW2U 5JBTA 3W95A 2QAAA 3RU4T 5C2ZA 3A83A 1Q31A 1QA7A 1Z6JH 2VIDA 1RFNA 3SU3A 2VGCC 2GV6A 2RA3A 3HKJB 1FIZA 2VIWA 1P10A 2XYAA 1C2DA 1O34A 1QB9A 3FP8E 1TQ0B 3QTVH 2AYWA 4X6PA 4ISOA 3A7ZA 2JDID 3EA7A 1H8DH 1P57B 4A1XA 1GBKA 2Z7FE 4U2WA 3P8NA 2V3MA 1F2SE 2H5DA 1HAZB 2G52A 1LQDB 3SNDA 1FY4A 4MPWA 3T27A 1GBJA 1CU1A 2C8WB 4YT6H 4GAWA 2FX4A 3SV7A 5EW1H 1SLUB 3FOAA 2QXIA 1GCTB 3U8RH 2P3TB 1XMNB 2HNTF 1OP0A 3VB7A 3RXLA 4CHAB 5A0AE 3RXVA 3QTOH 4TYDA 4WXVA 1BDAA 1ABJH 1HIAB 1H1BA 1TBRH 4JYTA 2GZ9A 5K0HA 2H9HA 5HM9A 3PRBA 3RXBA 1TE0A 3B9FH 4FU9A 1C5NH 1ZMLA 5IK2D 5A8XA 4AFQA 1DFPA 2WPDD 2ZDLA 5HM2A 4Q2KA 1E1RD 1PQAA 3EGKH 2FESH 3NK8A 3DD2H 2A7CA 1YPMH 3PLPA 2FEQH 1UHBA 2LP6A 4JZ1A 3URDA 1IQKA 1YPKH 1C2LA 1MCTA 1ELAA 4SGAE 1DWBH 5DP3A 3F9EA 2VINA 1B0EA 2VU8E 3F0PA 3LGVA 3EA8A 3ELAH 2ZG0H 3ZZ3A 1FX0B 3UQOA 1B0FA 1C5TA 1DICA 2WZQA 2ODQA 1INCA 2SFAA 4ISHH 8GCHF 4RKJB 2BM2A 2ZU4A 3EAJA 2QF5A 1O3CA 1GI2A 2BXTH 2GD4B 4D9QA 2ZNKH 2JH0D 4BTUB 1T8MA 1JIRA 1O3JA 2Z9LA 5HGGA 1MMJN 3O8DA 1ELEE 1Z8RA 3F0OA 3JZ1B 2YMSB 2AERH 3AW0A 1A46H 5FHTA 4MQAA 1D3PB 3LH1A 1LKAA 2BD9A 3CS0A 1EPTA 4A7IB 4MVNA 4OS4A 4FUEA 1GDNA 1V6DA 5GXPA 1OYQA 3M37A 1S82A 2NWNA 4OS1A 4Y8XA 4B74A 1GI6A 5ESBA 5GDSH 3H5CB 1C4U2 2ANKH 1ZTKA 1UVPA 1G32B 2W26A 1A61H 2C3SA 2XW9A 1CA0B 4O03A 3UIRA 3ZZ9A 1PPBH 1PQ7A 1MCVA 1N1LA 2Z94A 4DIHH 3UNRA 1GI5A 3TLOA 2OBQA 2BB4A 1DM4B 2UWLA 4YM9A 2FOEA 4HI3A 2GP9B 4DT7B 1HJ9A 1BTYA 2XTTB 2KAIA 1VCWA 3KN2A 1ZOMA 3T26A 1BMAA 2BLOA 3A7WA 4DGJA 1LO6A 1TGNA 5EW2H 4ISNA 3ATWA 4GUXA 1UVUH 3TPIZ 4RI0A 4AN7A 2BQ6B 1FI8A 2A1DB 4UFDH 1P06A 1ACBE 1JRTA 1O2JA 2BDYA 5LPEA 1O39A 3U28C 1QURH 5JB8S 1SHHB 3SV9A 3LPRA 2BHGA 1TGCA 1WXRA 2ZHWH 1TOMH 3U9AH 1SI5H 2JKHA 1C5OH 1LDTT 2AGEX 1GCDA 1DANH 3QN7A 2ZECA 4INHA 1PPGE 2XBYA 3EQ0H 4Q7ZA 1ZGIA 1LHEH 1O5DH 2ZHEH 1SL3A 5CHAC 3TJNA 4Q4LA 5JYIA 4NZLA 1F5KU 3K9XB 1TWXB 1D3QB 1AVXA 2FTLE 1LPGB 1HJAB 1TALA 4Y71A 5DP6A 3MH7A 4HFPB 5FPSA 5EG4A 5FX6A 1TPAE 4TSFD 2ZDMA 4X1QU 4LZ1H 2KZ4A 1AVWA 1PQ8A 3M5OA 4MLFB 3MNCA 1O38A 2OC0A 1HGTH 4ZAEA 1ZPCA 2G55A 4Q7XA 1BOQA 4IC6A 2W5EA 1QCPA 1QR3E 2ZGXH 3F9GA 1O3EA 3UY9A 2FMJA 1HIAA 4X1PU 3Q00A 1QY6A 3NRLA 1A0JA 1GJ5H 1ESBA 1TRNA 3BSQA 1DT2A 1QTFA 3A87A 1NZQH 1O2RA 3MYWA 1EAUA 1T4UH 4MNYA 2OXSA 3RU4E 1ELBA 2PUXB 5AFYH 1GI8B 1NROH 3ZZAA 1MBMA 1V2WT 5SGAE 1P05A 3T29A 1E79D 4XFQA 2JETC 5AF9H 1F92A 3BTDE 1A1RA 1JBUH 1F0UA 2H9EH 2ZQ1A 4I86A 1EUFA 3M5NA 1BB0B 2Y81A 3GCTF 1WUNH 3HGNA 3MH5A 3AK5A 3DCLA 4JCNA 2P3FH 3DSOA 1S6HA 1YPGH 2Z9KA 5CE1A 2ZPRA 5DG6A 2A5KA 1GGDB 3TH3H 2GTBA 2FPZA 1V2UT 4XBBA 3RMNH 2O8LA 1O3OA 4OGYA 1RGQA 3Q77A 2AMQA 5FPTA 3BN9A 3NUMA 1KMHB 2BDGA 1G3CA 2UUJB 3SUDA 1VGCC 1DSTA 2VH0A 2A5AA 1GBHA 1TONA 2P95A 2SNWA 4K5ZA 4LK4A 4FUFA 5I25A 1V3XA 2V0BA 3ESTA 2KR7A 3EE7A 1NPMA 1MAYA 2J2UA 1NO9H 2GV7A 1RRKA 2ZCHP 3H09A 5C67A 2VVCA 2ZGCA 3GY4A 4ZXXH 2FO9A 4AZ2B 1UVTH 1DS2E 1GWAA 2ESTE 1VZQH 4B71A 3GCOA 2G8TA 4WH8A 1VR1H 1JMOH 1XUJA 5IDKA 3S0NA 1G9IE 1MKWH 1YWUA 1B5GH 2TGPZ 2PFEA 4ABEA 1F5LA 3RXGA 5B6OA 3SJ9A 4BAKB 1P3EA 2ZTYA 1GI4A 5JBBS 1TRYA 1GI3A 1MUEB 1V2MT 1L1NA 2Y7XA 3AAUA 2ZFRH 1AB9C 1DVAH 3LGIA 5A0CA 2A31A 1EAXA 3SNAA 1OXGA 2KFWA 2OQ5A 4YESB 3SHCH 1GI0A 1O3AA 4D8NA 1YYY1 4XBDA 4AFZA 1GBCA 1EATA 1GVLA 2AMDA 1ANCA 1TA6A 2ASUB 3GY7A 1XX9A 2P93A 4Y6DA 2OP9A 1UTJA 1ZYOA 1CGHA 1XUKA 2Y5GA 1O3HA 3IITA 2NU3E 1V2LT 1O2OA 3K65B 4I8LA 4Y7BA 1CHOF 1GG6C 5L2YH 4LOYH 1C9PA 1WV7H 3WW7A 1ZHMA 1QRWA 3OEHD 4ABAA 2ZFSA 1W0YH 1XVOA 3WWFA 3P17H 4H4FA 4KTCA 1W10U 3PV5A 3QDZB 4NA8A 1O2NA 3JZ2B 2VWOA 1YCPH 4FUIA 5E0HA 1TPOA 1ID5H 2JH5D 2WPLS 3B23B 1OWJA 2Z3CA 4UE7H 2P8OC 3QZRA 1DPOA 1GHBG 2PR3A 4JZDH 5GIBA 2OC7A 4NFFA 4ZUHA 2FOCA 4R0IA 3LC3A 4B6FA 1QL7A 4VGCB 5JB9S 1AFQC 2BX3A 1CBWB 2C8XB 3DT0H 1GMDF 1IQHA 3OTJE 2BTCE 1O37A 1JWTA 1GI9B 1O3DA 1KXBA 2BZAA 1LHFH 3C27B 2PKSB 1MBQA 6CHAC 4HZHA 3QLPH 2XCFA 1AUJA 3NKKA 1GI1A 5DGJA 1UTMA 4CH8B 3RMLH 2UWPA 3M7TA 4WY3A 1BRAA 5BPEA 1ANBA 4DIIH 5DP7A 5A2MH 3KEEA 3ZVAA 1YP9A 4UFFH 4MNXA 4INKA 2EC9H 2WV9A 3MU5A 1SGEE 3SU1A 1EQ9A 4NZQA 4J2YB 2HRVA 1P3CA 3ITIA 2YNBA 2R0LA 2F83A 3O8BA 3BTQE 3SU4A 2G51A 2OBOA 1FY5A 5DK1A 1RIWC 1Y5AT 2ZDNA 3O8RA 4ABHA 1GJDB 2ODPA 3HKIB 2K8IA 3SZEA 4X1SU 3A7YA 1W2KH 8LPRA 1ZGVA 2A45B 1O3LA 4NGAH 2V7QD 1UHBB 1MU8B 3ZZ5A 2ANMH 3E3TA 3FP6E 3PYHA 1EJMA 4I8KA 4I32A 4ZHLU 1V2JT 3A7XA 3AW1A 3K6YA 5FX5A 4X1NU 1BITA 3NZIA 1DUAA 2ZGHA 2BDCA 4E7RG 4AORA 3KCGH 3U1IB 2BVXH 3S7KB 4B73A 2BYAX 1SQAA 3Q3KA 1DE7H 2ZU3A 2XCNA 1F5RA 1PPZA 1AHTH 1QFKH 2OQUA 7GCHG 5JDUB 4RSPA 1JOUB 2VH6A 2HLDD 2TGDA 2KM0A 3S69A 4NIWA 1TABE 2A0QB 1OS8A 5GNDA 5F8XA 1EXFA 2O8MA 1NFUA 1N6XA 1QGFA 1ELGA 1WCZA 1HAGE 1RXPA 4BTIB 1FQ3A 2BD2A 1GL0E 1O5AB 3ZYEA 4Y8YA 1SGCA 3RM2H 4QT8C 1HAXB 3OAAD 5KECA 4ISIH 4MPUA 3SO3A 4DJZB 3A7TA 4ZMAH 2XNDD 1HUTH 1F7ZA 1LVBA 3A81A 1BZXE 2VIOA 1O2TA 1LVYA 1SOZA 2F9OA 1YBWA 3LC5A 1A3EH 1KXEA 1T31A 3MO6A 2FWWA 1O2LA 1UCYE 4YLUA 4CRAA 1EZSC 1SQOA 3ZIAD 1COWD 1BBRH 1TMBH 2Y7ZA 3UR6A 3TH4H 2VNTA 2CHAC 2Y82A 5EQRA 1FY1A 3G01A 3CENA 1DY9A 5F53A 2ANYA 1IOEA 1O3PB 1BTHH 2SGPE 3U1JB 3UTUH 3E6PH 1W3CA 2GJGA 4JZIA 2M5TA 2ZEBA 8KME2 3V7TA 1O32A 2RDLA 3RXPA 3TH2H 1FAXA 1GVZA 1NBME 2GT8A 2PGQB 1UCYK 3AVZA 4IC5A 2FYRA 5C0TA 2EA3A 2OK5A 1RTFB 2CF9H 4FU7A 3IG6B 2BY6X 1SG8B 1FN8A 1MABB 1P04A 3PLKA 3RLYH 1Q3XA 2RFKC 1P2IA 2C4FH 4X6MA 3SUFA 5F03A 2WUCA 1RTLA 4X2VA 1MTUA 1GBIA 1P8VC 3ZV9A 1LHCH 2QC2A 1NS3A 2AIPA 2ZZUH 4MTBA 4XOJA 1OOKB 4B75A 1YGCH 1KXFA 5AHGH 1V2NT 5C1YA 1Y8TA 3U8OH 1O2GH 3MQKC 1BTXA 2V6NA 4FU8A 1HAOH 2RA0A 3ATLA 4NIYA 3UNSA 4Z0KA 1QBOA 4YT7H 1A0HB 1N8OB 4MNVA 3UWIA 4ZXYH 4AOQA 4ASUD 5HXFA 4E05H 5DP9A 1GI7B 3VB6A 3ZZCA 3PWBA 3TK6A 1ZLRA 3SNEA 2O9QA 1W14U 1S84A 4KKDA 2D2DA 3BTME 4IW4E 1DDJA 1TNLA 2VIPA 1MTNC 1EP5A 1O5EH 2W6ID 1E34B 1EP6A 1ZSJA 3PMBB 2C90B 3SUEA 4X8UH 1AUTC 3HATH 1C1NA 4IMZA 4XD7D 4F55A 4NA7A 1P2OA 2CV3A 3ATKA 1THPB 4GSOA 1J17T 1H9LB 2WPMS 8GCHG 2YMSD 3SZNA 4Q80A 1K1IA 2VVVA 1ELCA 2PUQH 1UK3A 1TGTA 4CRGA 1CT4E 1TPSA 1ESTA 1XUGA 1BHXB 2R3YA 3GDSA 5DKMA 4P02A 3N7OA 5CHBA 3TITA 3KQ5A 3RXDA 4NSYA 2IJOB 1TAWA 1TIOA 1EASA 2FI3E 1QRXA 3F2GA 3PTNA 4U32A 1Z8GA 2CJIA 4DY7B 1WYKA 1AKSB 2F91A 1TQ7B 1WTGH 2ZTZA 1K9OE 2AH4X 2GMTB 1T4VH 1F0SA 2XBXA 1GG6B 2HWLB 4FXGH 3ZVCA 4CRBA 1VITF 3PO1C 1C2HA 3OEED 1C9TA 1O3IA 4RN6A 1LHDH 2J4IA 4K8YA 4M7GA 2PW8H 3RXUA 1O2IA 1ZR0A 3MNSA 2QN5T 1GJ4H 1GBLA 3SW2B 1NTPA 4FUCA 5EJ1A 2FOFA 2EEKA 4J1YA 1MH0A 1AQ7A 3PTBA 3VB5A 2W7UA 4FVBA 5C0UA 2SGEE 1EOLA 1A5IA 1WOFA 3I29A 4WMEA 4Z6AH 1AD8H 2ZP0H 1LTOA 3ZYDA 3E0NB 1C5QA 3MWIU 3S9BA 1K1JA 2CK3D 2TIOA 3D65E 3BTEE 1P9SA 1HFDA 4JK5A 5DJ7A 2XOKD 5G4BA 3ZZBA 1H8HD 2BDIA 3QGJA 1G2LA 1CO7E 1SGTA 1SKYE 3MI4A 1BRUP 5ABWA 3NCLA 2TGTA 3P8FA 1K1PA 2BVSH 2SGDE 4JMYA 3QUMP 2G5NA 4UFGH 1OHHD 2ZFPH 1XKAC 3E1XB 3RXMA 4KTUA 3RC6A 2K0QA 3UQVA 5FBEA 2XBWA 3T5FH 1GBTA 4JYUH 4AGJA 3KNXA 1FY8E 2GZ7A 3FFGA 3SJOA 1TNHA 3GYLB 3TJVA 1XXDA 3VXFH 4JZEH 2A7HA 2M2AA 1D4PB 3F2FA 4UONA 1A5GH 1SMFE 1WAYB 4F49A 3TVJB 2I6SA 1AGJA 4YOJA 4OS5A 4TT3D 3FP7E 5FBIA 1C5RA 3VG8A 3FZZA 4ZKRU 3RXJA 2BLVA 7KMEH 5C3NA 1ZHRA 2QXHA 3MOCA 3MNXA 4D7FA 1DLKB 1TNJA 1P12E 3H7OA 5EGMA 1ANEA 2UUFB 3V13A 1O5BB 3L6PA 2SGAA 6ESTA 1J15A 4FUGA 3GY3A 4Y79A 3FAOA 5FPYA 2ZCKP 3SORA 2GDDA 4Q63A 1NRPH 1YY3A 1MZDA 5E2PA 5EIYA 2QCYA 1GHAF 1SLVB 5FAHA 4IS5A 2OC8A 3RP2A 4O9VA 1TPPA 3FZDA 1KTSB 3EA9A 3TGKE 1E35B 3M7QA 1QNJA 3GCHC 1SGQE 3ZZ4A 1BTUA 3PRDA 5CDFE 1C2EA 3GDUA 4X6OA 2FP7B 1CE5A 2J9NA 3T28A 3HGPA 3GISB 4XRNA 3UOUA 1G3BA 5FCRA 1QA0A 3N99A 3P6ZB 1L4DA 2R2MB 3R0FA 4THNH 2H5CA 1UMAH 2BY8X 1XVMA 1C4V2 3BIUH 2STBE 2WSSD 3BTGE 3GCTG 4GVUA 1EPTC 3CS7A 1O2PA 2J38A 2BY7X 3C1KA 3L3TA 3M61U 1JIMA 2AGGX 1MKXK 1SGNE 3LT3A 4Q7YA 2WYJA 1SGFA 2HOBA 3AASA 1SFQB 1XKBC 3P8GA 5EPNA 1PPHE 3BG4C 4X1RU 1THSH 1WQSA 5HYOA 4X6NA 1QQ4A 5ESTE 3PROA 3S7HB 4YOIA 3NXPA 2QA9E 2Y5FA 1Y5UT 1ZRKA 3BTHE 3MU1A 4UFEH 3SN8A 4CRCA 1G3DA 1S0RA 4JK6A 3S9AA 4AFUA 3QX5H 2XC5A 1W7GH 4ABGA 1GJAB 1J9CH 1ESAA 1GMCF 4MNWA 3TNSA 3QK1A 3SGAE 3ATIA 1GJ8B 3LGWA 1GMHF 4AFSA 1SPJA 1AKSA 2ZDAH 1ZMNA 1SQRA 1FZZA 1UK2A 4KGAA 1C1SA 1MU6B 1O3FA 2J5UA 4D9RA 3PMJA 2BLWA 1WSSH 3A8BA 2Z9JA 1S6LA 2BQ7B 3M35A 1TX7A 2A4QA 1BJVA 2PGBB 2KCPA 3L33A 4TY6A 3GOVB 2PWXA 3A86A 4B1TA 1GHWH 4NG9H 4TPYA 5GWZA 1G36A 2EI7A 2FOAA 3ZVGA 1DXPA 3UR9A 2F3CE 5GCHF 1PQ5A 4WJG2 2FTMA 2GCTC 1DOJA 1MTWA 2ZU1A 1T32A 1DWEH 1P09A 4MDSA 1V2QT 2OC1A 3TGJE 4WVPE 1QRZA 1NFYA 5E8EH 3SNCA 4FUHA 1OWIA 2F43B 2ZKSA 1TGBA 2W3KA 1AI8H 1IQJA 2Z6BD 1LHGH 4TPIZ 3O8CA 3M5LA 2VGCB 3PWCA 1C5YB 4ACBA 1AVGH 1C5VA 3SI4H 1NRQH 4A5TS 3TIUA 1NESE 3TK9A 4U30A 4DVAU 3T62A 1HAHH 3RMOH 3F2HA 4OGXA 1P03A 1C1RA 4K60A 1EFRD 4JYVH 1CHOG 3DA9B 3RM0H 4RKOB 3BEFB 2SGQE 1GCTC 2A5IA 4F4OC 2ALVA 2PV9B 1Z6EA 4CHAC 1S5SA 4ZH8A 3MTYA 2FM2A 6LPRA 5DPAA 1LQEA 2CXVA 1ZJDA 2FOMB 3ZVBA 4INLA 2BMGB 1C4Y2 1E37B 2BD8A 4LXBH 2R9PA 1V2VT 1NC6A 2B8OH 1Z71A 4XDEA 3HK3B 1P0SH 2FX6A 1YPEH 4A92A 3UFAA 4X2WA 3FKSD 1SGPE 3LH3A 2EY4C 2V35A 4FUJA 1BMMH 2VBCA 4FUBA 2BD4A 5C20A 2WV4A 1M9UA 4ASHA 3FANA 2CMYA 1CHGA 5A8YA 3IWMA 1C1VH 2SNVA 1O2MA 1GPZA 2C93B 2CN0H 2HNTC 4FVDA 1UK4A 1AN1E 2GZ8A 2ZPSA 2WINI 4Z1MD 2BD5A 3PLBA 2LELA 1GMDG 5DP5A 4E7NA 1IQGA 1IQMA 4NWKA 1BT7A 1Y3XA 3P70B 3M3TA 1OP8A 3RXCA 2WPKS 1HXEH 2AS9A 2NU4E 1QL9A 3QGNB 1SVPA 5GJ4B 1C5XB 5TJXA 2ZU2A 2FI5E 1ZSLA 2YMSC 1E1QD 2FS9A 2NU1E 3RXRA 1H8IH 4NCYA 5C17A 1YPLH 3A85A 1Z1IA 2BD3A 4AG2A 1ELTA 2W6JD 3DSGA 2HPPH 1WBGB 2V3HH 1C5MD 4I31A 4NA9H 4ZHMU 3OYPA 2RG3A 4DCDA 1P11E 2AFQB 3PMHB 1RD3B 1MQ6A 2BDBA 5C94A 1Y3YA 2QIQA 2BD7A 4IMQA 2XWBI 2HPQH 1P02A 1L1JA 1FJSA 1CA0C 1L2EA 2FZZA 1ETSH 2STAE 5JBCS 1G37A 4H6SB 3EDXB 4K2YA 3A8CA 1C5SA 5LGOA 7ESTE 5HIZA 2VWNA 4ABBA 2J97A 3SJIA 1WDIA 1AY6H 1W12U 3WWBA 2BDAA 1BQYA 1MZAA 4YLQH 2RDEA 2A4RA 4IBLH 1TNKA 5E0JA 1O2KA 1GJ9B 3M5MA 3W1EA 2Y80A 5TCCA 1YPJH 1C2MA 1RS0A 2AHME 2PTNA 4WMFA 2H1UA 3A89A 1ELDE 1GBEA 3MU8A 4YOGA 1EAIA 2GCHF 2V3OH 4GCHF 5AVDA 2CF8H 1WQVH 3GS9A 4X8VH 1XM1A 1H4WA 1HDTH 3F68H 1C2IA 1JRSA 3MH6A 1LVMA 1CGJE 4GPGA 3QZQA 4DT4A 1NY22 1HAPH 2AMPA 4U01A 5E2OA 3VXEH 3SGQE 1ARCA 4H6TA 1DSUA 3M3SA 1MD8A 5L30H 3SU2A 2G4TA 2GT7A 3A8AA 3NPSA 4MG3A 4HGCA 1HAIH 2ZDVH 1YF4A 2J98A 4BAHB 2IN2A 3B8JA 1C1WH 1FONA 1MD7A 3ODDA 1OPHB 3GY2A 3W94A 6GCHF 3UREA 1C5PA 1HJAC 1GBAA 3RXOA 2Q6GA 3SU6A 4ZCNA 5CHAB 2AIQA 1H9IE 1OWKA 1TRMA 1HXFH 4IN1A 3BTFE 2O8UA 2G00A 2A2QH 2BZ6H 2FYQA 2J92A 3GCHB 2DE8A 4AGKA 2BDHA 2A4GA 1SSXA 3VB4A 1TBZH 2IPQX 1O2QA 2P16A 1GJBB 2GVFA 4B2BA 1TMUH 1RJXB 3M3VA 5B6LA 1L1GA 3S9CA 1VJ9U 3RXHA 3QO6A 3SOSA 3UPEA 1H8ED 2O8WA 2ZHDA 1O0DH 2ZTXA 1W13U 1FUJA 1ZZZA 3RXQA 3DSPA 1S81A 2ZU5A 1QBVH 2PLXA 2A7JA 1LPZB 1V2ST 4E06H 3KHVA 5E0GA 4A1TA 3N7DA 1OYTH 3V12A 9ESTA 1LPKB 1PYTD 2QF0A 3GDVA 1DX5M 3BG8A 1G2MA 1U6QA 2JETB 1BTPA 2ZF0H 2FLRH 1IQFA 2BY9X 4M9FA 9LPRA 4D76A 1AE5A 1GGDC 4R8TB 4BNRA 4ABFA 3SU5A 1W8BH 1EJNA 2EI6A 2VWMA 1D6WA 1BMFD 2XC4A 2UWOA 2PKAB 2ZPQA 1QIXB 1C2GA 1FIWA 3MU0A 1DUEA 1ANDA 1AE8H 2YNAA 2JJ1D 1S83A 4O97A 3STJA 1O2VA 1C1TA 1O5GH 2JIZD 3SJ8A 1O5FH 1PPCE 4NSVA 5A09A 4WWYA 3RXSA 5DP8A 1P2MA 4I8JA 1VGCB 1UTPA 1O2HA 1VJAU 3ZV8A 1HNEE 2UUKB 1GHYH 1W0JD 2PSXA 1GBBA 2Z3DA 5BRRE 1PPEE 4ISLA 1G30B 1AZZA 1SLWB 1UJ1A 1ABIH 1C2FA 1AZ8A 1BHXF 4KELA 1NN6A 3E91A 3F9HA 1IHTH 4GHTA 3DHKH 1O31A 4AX9H 4X0WU 1HB0B 1UTKA 2D26C 1FDPA 3KQDA 2ZO3H 1DY8A 2GGVB 2F9NA 1PJPA 1BMNH 1C5WB 1C1UH 2ZFTA 2KX4A 1OWHA 4D7GA 1KLIH 5C5NA 5LPFA 2Q1JA 4ABJA 5FL7D 1NU7B 1V2KT 2RCEA 2WPJS 4K1SA 1P2KA 1TYNA 1W7XH 4A1VA 1AB9B 1TNGA 1VITG 1OP2A 1W11U 1BRBE 3E8LA 4BTTB 4DURA 7LPRA 1TX8A 4ZKSU 1BCUH 4JZFH 1THRH 1KXDA 2KCOA 3F1SB 3FN8A 4K69A 3KIDU 4X8SH 1A4WH 1ELVA 2HLCA 2WPIS 2WV5A 3UWJH 1DWDH 1CA8B 1O36A 3BTKE 2BLQA 5F8ZA 4ABDA 3KQBA 1O3MA 2QXGA 1IQLA 1K22H 4OS2A 1BMLA 1YLNA 3AAVA 2H6MA 4B2AA 1TLDA 5T6GA 2Y6TA 4YZUA 4ACAA 2R2WU 3CP7A 2C8YB 2ZGJA 3TU7H 1F0TA 1DLEA 3TJUA 2UUYA 2B5TB 1BA8B 5EJLA 2G81E 4YO9A 1OX1A 1Y59T 1K21H 1HLTH 3NWUA 3LIWA 1LMWB 3M7UA 2J95A 1HCGA 4VGCC 2L74A 1MTVA 4XBCA 4AC9A 2Z3EA 2P8OB 3A7VA 2P94A 1KLJH 2IJD1 1BUIA 1QZ8A 2DUCA 2FI4E 1CBWC 1VKYA 3SYJA 1BTZA 1S85A 3OSYA 3F6UH 1NRNH 2QV1A 1JXPA 3D62A 3OX7U 1V2OT 1EZXC 1VCQA 5H4IB 2PKSC 3I78A 2IOTA 1AFQB 1C1PA 1Y5BT 4Y0ZE 4NIVA 1NFXA 5EXMA 4WH6A 1G3EA 3R3GB 1AIXH 5JPMH 1O2YA 3RLWH 4X2YA 2OCVB 2HNTE 1MKWK 4RT1A 1SBWA 2D8WA 2ZA5A 1FNIA 1C5UA 1GHXH 6CHAB 1OSSA 1HAVB 1YPHC 1NRRH 3FVFB 1AWFH 4ZKOU 2J34A 5T6DA 4BXSA 3RU4D 2ZFQH 2EQNA 1FPCH 3RC4A 4Y10E 2HALA 1AWHB 2ZGBH 1OWEA 3MFJA 1FAKH 1YLCA 2PKAA 1PPFE 4ESTE 2A32A 1GHAG 1VCPA 1LCYA 2TPIZ 4TWWA 4XE4A 1X7AC 3KL6A 3KQEA 1MAXA 1WTHD 5EJZA 4DOQA 4AYYB 4WF8A 3U8TH 4I7YH 3BEIB 1UCYH 5T6FA 3SU0A 1CT0E 1QB1A 1O3KA 1RIWB 1XXFA 2R0KA 4TY7A 3MO3A 3VB3A 2BVRH 1CVWH 2PP6A 3D49H 5J4QA 4LZ4B 3RXEA 1IQIA 3VFEA 4AG1A 1O5CB 5DO4H 1QJ7B 2FDAA 4B76A 1F0RA 1FMGA 1IAUA 4BXWA 8ESTE 5DSFA 3A82A 2Z9IA 5A8ZA 5EQSA 4Y0YE 1YCPK 4UD9H 5HKKD 2J94A 3MHWU 2A4OA 2A2XH 1TB6H 1Q2WA 4KTSA 3D23A 2FS8A 3PMAB 1SFIA 1A3BH 4Y76A 2QF4A 4CRFA 1O2ZA 3URCA 2WYGA 1GMCG 3UNQA 2BY5X 1TGSZ 4FUDA 3SQHE 3EYDA 5FXLA 2ALPA 3N7EA 1GMHG 2QY0B 1ZMJA 4BOHA 1SGYE 5L2ZH 2ANWA 5CMXH 3Q3XA 1K28D 5EOKA 5C1UA 5I46H 4K1TA 1QL8A 3VGCC 3KGPA 2Q6FA 5T3HA 1DITH 3TNTA 1SGDE 2G5VA 2W3IA 4WMDA 2ULLA 1HV7A 1A2CH 1T7CA 3VEQB 1O2WA 4GHQA 2FOHA 5K7RA 4K8BA 4B2CA 1NRSH 5GCHG 3KF2A 1ZJKA 4Y11E 4XSKU 2LPRA 1EZQA 1W0KD 4AYVB 1B7XB 1KIGH 4O3UA 2CHAB 3LJOA 1K1LA 4GLYA 1DWCH 1UW7A 1Y3WA 1FV9A 3PB1E 1S6FA 1UTLM 2BQWB 4CBNA 3ZZ6A 5T1VA 1HAYB 1C1MA 1SOTA 2OTVA 3GY5A 2VIQA 3P92A 3SV6A 1ZRBA 2ZQ2A 2XC0A 2Z9GA 1E38B 3EE0B 3RXTA 3GYMA 4RT0A 4OS6A 5GPIB 3SJKA 4DG4A 2OLGA 2QXJA 1NM6A 2ODYB 2K1QA 2XBVA 1SGRE 5A0BA 3E0PB 3A8DA 2B9LA 2XXLA 1TOCB 4X8TH 1QBNA 1O33A 1BRCE 1W0ZU 4YXWD 1ETRH 1PYTC 2LNCA 1UVSH 1EB2A 1NT1A 3U69H 1GBMA 1GJ7B 4WXIA 1O3NA 2J98B 3RMMH 1KXAA 1T8LA 3ODFA 1Z7KA 2NU2E 3SQEE 2H9TH 3F9FA 1SLXB 3MO9A 1ARBA 1CT2E 1N8OC 1O3BA 2KCAA 2GX4A 2ZCLP 1Z8IB 1HRTH 1O30A 4CH2B 1WU1A 3TK5A 1O3GA 3PM3A 1ZPZA 2ILNA 1HAVA 1S0QA
chains in the Genus database with same CATH topology
2ZWLH 3TGIE 3RXAA 2B7DH 1UVOA 2BX4A 1BBRE 4K1EA 3GICB 3SV8A 4UEHH 1UTQA 1P2JA 2TRMA 3OY5U 1EB1H 1QQUA 4CREA 2SGFE 1UO6A 4PROA 1J8AA 1MTSA 1L4ZA 3LGYA 1TNIA 1KDQB 2ZDKA 1MTNB 1P2NA 1CQQA 1FY3A 4BAQB 1BIOA 5EQQA 1T8NA 5JBAS 3GY8A 3RXKA 3UOPA 3U98H 3M36A 3DFLA 1TA2A 5EXLA 1ZTJA 3GCNA 1J14A 2BOKA 1BBRK 3LU9B 2F9PA 1EZUC 1DXWA 5F8TA 4CR5A 4O3TA 1SQTA 3ATMA 3E90B 2W7SA 1A7SA 1QHRB 2F9UA 3SV2H 1SC8U 1TX6A 1QJ1B 4H42U 4TWYA 5HMAA 4CR9A 1EJAA 2VWLA 1HBTH 1XUHA 1YKTA 2JH6D 2TBSA 1O2SA 3V3MA 3ZZ8A 1C1OA 2ZIQH 2GDEH 2GMTC 3E16B 5FCKA 1SGIB 3KQCA 1RTKA 5TCAA 3TJOA 3WY8A 1A5HA 3SI3H 4HTCH 2B0FA 4I33A 4UDWH 3A84A 1C5LH 3STIA 1GL1A 3ENSB 2QF3A 1QJ6B 1GBFA 2EI8A 1VITH 3T2NA 1LKBA 2BOHB 1GJ6A 1EOJA 3P95A 3PO1B 3LDXH 3HK6B 1UTNA 2GKVE 3BV9B 4BANB 1IQEA 2QYIA 1AU8A 2VIVA 3UUZA 4I8GA 1H9HE 4KP0A 1AO5A 3P8OA 2P3UB 2XWAA 2O8TA 3LGTA 2H2ZA 1NFWA 1LVOA 1MKXH 3SGBE 2GCHG 4GCHG 1FLEE 2OINA 1GDQA 3SNBA 1TBQH 2ZI2H 1GJCB 1GBDA 1HPGA 3BF6H 1ZHPA 2AGIX 5LPRA 1Y3UA 3SUGA 3DUXH 1C2JA 1D6RA 5EXNA 2DE9A 1O2XA 2TGAA 3RXFA 1O35A 2G4UA 1FN6A 1GHBF 1N6YA 4MPVA 5AFZH 3HPTB 4Y7AA 1K1OA 1ELFA 1AMHA 1KY9A 3K6ZA 4ABIA 2FXRA 1O2UA 5DP4A 1GDUA 1EKBB 1MQ5A 1TFXA 1TMTH 1P9UA 2Y5HA 1C2KA 2XNIA 3MH4A 5F6MA 4NFEA 2ZFFH 6GCHG 1EX3A 3GY6A 4IN2A 1GHZA 3H7TA 2FLBH 1XUFA 3ZZDA 1V2TT 1ETTH 2FIRH 1HJ8A 2BXUH 1GVKB 5C1XA 2NU0E 2ZHFH 2Q6DA 2ZC9H 4ZKNU 1Y3VA 1OKXA 1L0ZA 1E0FD 3PV4A 1FXYA 5PTPA 3RC5A 3ZVEA 2F9BH 1CSOE 3Q76A 3VPKA 1YPHE 1SHYA 2VVUA 3BTTE 3DFJA 4K3JA 5LH8A 1K1MA 4ZROA 5EPYA 5IYTA 3K2UA 3SHAH 2FOBA 1YCPM 4AB8A 1XUIA 2CGAA 2YOLA 1CGIE 5EODA 5L6NH 3OU0A 1P2QA 1ZSKA 1FPHH 2THFB 3LONA 2I6QA 5ETXA 1YLDA 3LOXA 1SB1H 1SR5C 4MPXA 1IHSH 1YC0A 1KDQA 2P59A 3OY6U 5C5OA 3ZZ7A 4Y8ZA 3BEUA 1QB6A 1Z1JA 2PTCE 3MU4A 1V2RT 4OS7A 3SBKA 1PFXC 2VJ1A 1EPTB 2FOGA 3V0XA 2VB0A 3QWCH 3I77A 3A80A 2ZHQH 2IPHA 3LKWA 1E36B 4A6LA 1K1NA 3ZVDA 1GHVH 1OWDA 3RDZA 3LGUA 3BG4B 2HVXA 1C5ZB 7GCHF 4ZHAA 3VGCB 2HGTH 1YM0A 4I8HA 4IGDA 1UTOA 2WPHS 1C1QA 2FODA 4CRDA 3BIVH 1IQNA 1ZPBA 3LJJA 1D9IA 4X2XA 3MNBA 3ZVFA 1A0LA 5EU8A 3A88A 1P01A 2PHBA 1K2I1 3BTWE 4NWLA 1SGFG 1KTTB 2WUBA 1T8OA 2KAIB 1KLTA 1KSNA 1V2PT 1Z8JB 1BTWA 1NU9A 1KXCA 3Q3YA 5J4SA 2AEIH 2QGRA 3RUOA 2R3UA 1J16A 2OD3B 2OUAA 1D3TB 3RXIA 1D3DB 4AB9A 2D1JA 1AFEH 4SGBE 2F9VA 1KYNA 4CBOA 4YTAA 3T25A 1ZTLA 2C8ZB 2XRCA 4NIXA 3MMGA 1ORFA 1EAWA 4BAOB 4BAMB 2GCTB 1BJUA 2PSYA 1HYLA 4DW2U 5JBTA 3W95A 2QAAA 3RU4T 5C2ZA 3A83A 1Q31A 1QA7A 1Z6JH 2VIDA 1RFNA 3SU3A 2VGCC 2GV6A 2RA3A 3HKJB 1FIZA 2VIWA 1P10A 2XYAA 1C2DA 1O34A 1QB9A 3FP8E 1TQ0B 3QTVH 2AYWA 4X6PA 4ISOA 3A7ZA 3EA7A 1H8DH 1P57B 4A1XA 1GBKA 2Z7FE 4U2WA 3P8NA 1F2SE 2H5DA 1HAZB 2G52A 1LQDB 3SNDA 1FY4A 4MPWA 3T27A 1GBJA 1CU1A 2C8WB 4YT6H 4GAWA 2FX4A 3SV7A 5EW1H 1SLUB 2QXIA 1GCTB 3U8RH 2P3TB 1XMNB 2HNTF 1OP0A 3VB7A 3RXLA 4CHAB 5A0AE 3RXVA 3QTOH 4TYDA 4WXVA 1BDAA 1ABJH 1HIAB 1H1BA 1TBRH 4JYTA 2GZ9A 5K0HA 2H9HA 5HM9A 3RXBA 1TE0A 3B9FH 4FU9A 1C5NH 1ZMLA 5A8XA 4AFQA 1DFPA 2ZDLA 5HM2A 4Q2KA 1PQAA 3EGKH 3DD2H 2FESH 3NK8A 2A7CA 1YPMH 3PLPA 2FEQH 1UHBA 4JZ1A 3URDA 1IQKA 1YPKH 1C2LA 1MCTA 1ELAA 4SGAE 1DWBH 5DP3A 3F9EA 2VINA 1B0EA 2VU8E 3LGVA 3EA8A 3ELAH 2ZG0H 3ZZ3A 3UQOA 1B0FA 1C5TA 1DICA 2ODQA 1INCA 2SFAA 4ISHH 8GCHF 4RKJB 2BM2A 2ZU4A 3EAJA 1O3CA 1GI2A 2BXTH 2GD4B 4D9QA 2ZNKH 2JH0D 4BTUB 1T8MA 1JIRA 1O3JA 2Z9LA 5HGGA 1MMJN 3O8DA 1ELEE 1Z8RA 3JZ1B 2AERH 3AW0A 1A46H 5FHTA 4MQAA 1D3PB 3LH1A 1LKAA 2BD9A 3CS0A 1EPTA 4A7IB 4MVNA 4OS4A 4FUEA 1GDNA 1V6DA 5GXPA 1OYQA 3M37A 1S82A 2NWNA 4OS1A 4Y8XA 4B74A 1GI6A 5ESBA 5GDSH 3H5CB 1C4U2 2ANKH 1ZTKA 1UVPA 1G32B 2W26A 1A61H 2C3SA 2XW9A 1CA0B 4O03A 3UIRA 3ZZ9A 1PPBH 1PQ7A 1MCVA 1N1LA 2Z94A 4DIHH 3UNRA 1GI5A 3TLOA 2OBQA 2BB4A 1DM4B 2UWLA 4YM9A 2FOEA 4HI3A 2GP9B 4DT7B 1HJ9A 1BTYA 2XTTB 2KAIA 1VCWA 3KN2A 1ZOMA 3T26A 1BMAA 2BLOA 3A7WA 4DGJA 1LO6A 1TGNA 5EW2H 4ISNA 3ATWA 4GUXA 1UVUH 3TPIZ 4AN7A 2BQ6B 1FI8A 2A1DB 4UFDH 1P06A 1ACBE 1JRTA 1O2JA 2BDYA 5LPEA 1O39A 1QURH 5JB8S 1SHHB 3SV9A 3LPRA 2BHGA 1TGCA 2ZHWH 1TOMH 3U9AH 1SI5H 2JKHA 1C5OH 1LDTT 2AGEX 1GCDA 1DANH 3QN7A 2ZECA 4INHA 1PPGE 2XBYA 3EQ0H 4Q7ZA 1ZGIA 1LHEH 1O5DH 2ZHEH 1SL3A 5CHAC 3TJNA 5JYIA 4NZLA 1F5KU 3K9XB 1TWXB 1D3QB 1AVXA 2FTLE 1LPGB 1HJAB 1TALA 4Y71A 5DP6A 3MH7A 4HFPB 5FPSA 5EG4A 5FX6A 1TPAE 2ZDMA 4X1QU 4LZ1H 1AVWA 1PQ8A 3M5OA 4MLFB 3MNCA 1O38A 2OC0A 1HGTH 4ZAEA 1ZPCA 2G55A 4Q7XA 1BOQA 4IC6A 2W5EA 1QCPA 1QR3E 2ZGXH 3F9GA 1O3EA 3UY9A 2FMJA 1HIAA 4X1PU 3Q00A 1QY6A 1A0JA 1GJ5H 1ESBA 1TRNA 3BSQA 1DT2A 1QTFA 3A87A 1NZQH 1O2RA 3MYWA 1EAUA 1T4UH 4MNYA 2OXSA 3RU4E 1ELBA 2PUXB 5AFYH 1GI8B 1NROH 3ZZAA 1MBMA 1V2WT 5SGAE 1P05A 3T29A 4XFQA 2JETC 5AF9H 1F92A 3BTDE 1A1RA 1JBUH 1F0UA 2H9EH 2ZQ1A 1EUFA 3M5NA 1BB0B 2Y81A 3GCTF 1WUNH 3HGNA 3MH5A 4JCNA 2P3FH 1S6HA 1YPGH 2Z9KA 5CE1A 2ZPRA 5DG6A 2A5KA 1GGDB 3TH3H 2GTBA 2FPZA 1V2UT 4XBBA 3RMNH 2O8LA 1O3OA 4OGYA 1RGQA 3Q77A 2AMQA 5FPTA 3BN9A 3NUMA 2BDGA 1G3CA 2UUJB 3SUDA 1VGCC 1DSTA 2VH0A 2A5AA 1GBHA 1TONA 2P95A 2SNWA 4K5ZA 4LK4A 4FUFA 5I25A 1V3XA 2V0BA 3ESTA 1NPMA 1MAYA 2J2UA 1NO9H 2GV7A 1RRKA 2ZCHP 5C67A 2VVCA 2ZGCA 3GY4A 4ZXXH 2FO9A 4AZ2B 1UVTH 1DS2E 1GWAA 2ESTE 1VZQH 4B71A 3GCOA 2G8TA 4WH8A 1VR1H 1JMOH 1XUJA 5IDKA 3S0NA 1G9IE 1MKWH 1B5GH 2TGPZ 2PFEA 4ABEA 1F5LA 3RXGA 5B6OA 3SJ9A 4BAKB 1P3EA 2ZTYA 1GI4A 5JBBS 1TRYA 1GI3A 1MUEB 1V2MT 1L1NA 2Y7XA 3AAUA 2ZFRH 1AB9C 1DVAH 3LGIA 5A0CA 2A31A 1EAXA 3SNAA 1OXGA 4YESB 2OQ5A 3SHCH 1GI0A 1O3AA 4D8NA 1YYY1 4XBDA 4AFZA 1GBCA 1EATA 1GVLA 2AMDA 1ANCA 1TA6A 2ASUB 3GY7A 1XX9A 2P93A 4Y6DA 2OP9A 1UTJA 1ZYOA 1CGHA 1XUKA 2Y5GA 1O3HA 3IITA 2NU3E 1V2LT 1O2OA 3K65B 4I8LA 4Y7BA 1CHOF 1GG6C 5L2YH 4LOYH 1C9PA 1WV7H 1ZHMA 1QRWA 4ABAA 2ZFSA 1W0YH 1XVOA 3P17H 4H4FA 4KTCA 1W10U 3QDZB 4NA8A 1O2NA 3JZ2B 2VWOA 1YCPH 4FUIA 5E0HA 1TPOA 1ID5H 2JH5D 2WPLS 3B23B 1OWJA 2Z3CA 4UE7H 2P8OC 3QZRA 1DPOA 1GHBG 2PR3A 4JZDH 5GIBA 2OC7A 4NFFA 4ZUHA 2FOCA 4R0IA 3LC3A 1QL7A 4VGCB 5JB9S 1AFQC 2BX3A 1CBWB 2C8XB 3DT0H 1GMDF 1IQHA 3OTJE 2BTCE 1O37A 1JWTA 1GI9B 1O3DA 1KXBA 2BZAA 1LHFH 3C27B 2PKSB 1MBQA 6CHAC 4HZHA 3QLPH 2XCFA 1AUJA 3NKKA 1GI1A 5DGJA 1UTMA 4CH8B 3RMLH 2UWPA 3M7TA 4WY3A 1BRAA 5BPEA 1ANBA 4DIIH 5DP7A 5A2MH 3KEEA 3ZVAA 1YP9A 4UFFH 4MNXA 4INKA 2EC9H 3MU5A 1SGEE 3SU1A 1EQ9A 4NZQA 4J2YB 2HRVA 1P3CA 3ITIA 2YNBA 2R0LA 2F83A 3O8BA 3BTQE 3SU4A 2G51A 2OBOA 1FY5A 5DK1A 1RIWC 1Y5AT 2ZDNA 3O8RA 4ABHA 1GJDB 2ODPA 3HKIB 4X1SU 3A7YA 1W2KH 8LPRA 1ZGVA 2A45B 1O3LA 4NGAH 1UHBB 1MU8B 3ZZ5A 2ANMH 3E3TA 3FP6E 3PYHA 1EJMA 4I8KA 4I32A 4ZHLU 1V2JT 3A7XA 3AW1A 3K6YA 5FX5A 4X1NU 1BITA 3NZIA 1DUAA 2ZGHA 2BDCA 4E7RG 4AORA 3KCGH 3U1IB 2BVXH 3S7KB 4B73A 2BYAX 1SQAA 3Q3KA 1DE7H 2ZU3A 2XCNA 1F5RA 1PPZA 1AHTH 1QFKH 2OQUA 7GCHG 5JDUB 4RSPA 1JOUB 2VH6A 2TGDA 3S69A 4NIWA 1TABE 2A0QB 1OS8A 5F8XA 1EXFA 2O8MA 1NFUA 1N6XA 1QGFA 1ELGA 1WCZA 1HAGE 1RXPA 4BTIB 1FQ3A 2BD2A 1GL0E 1O5AB 3ZYEA 4Y8YA 1SGCA 3RM2H 4QT8C 1HAXB 4ISIH 4MPUA 3SO3A 4DJZB 3A7TA 4ZMAH 1HUTH 1F7ZA 1LVBA 3A81A 1BZXE 2VIOA 1O2TA 1LVYA 1SOZA 2F9OA 1YBWA 3LC5A 1A3EH 1KXEA 1T31A 3MO6A 2FWWA 1O2LA 1UCYE 4YLUA 4CRAA 1EZSC 1SQOA 1TMBH 1BBRH 2Y7ZA 3UR6A 3TH4H 2VNTA 2CHAC 2Y82A 5EQRA 1FY1A 3G01A 3CENA 1DY9A 2ANYA 1IOEA 1O3PB 1BTHH 2SGPE 3U1JB 3UTUH 3E6PH 1W3CA 4JZIA 2M5TA 2ZEBA 8KME2 3V7TA 1O32A 2RDLA 3RXPA 3TH2H 1FAXA 1GVZA 2GT8A 2PGQB 1UCYK 3AVZA 4IC5A 2FYRA 2EA3A 1RTFB 2CF9H 4FU7A 3IG6B 2BY6X 1SG8B 1FN8A 1P04A 3PLKA 3RLYH 1Q3XA 1P2IA 2C4FH 4X6MA 3SUFA 5F03A 2WUCA 1RTLA 4X2VA 1MTUA 1GBIA 1P8VC 3ZV9A 1LHCH 2QC2A 1NS3A 2AIPA 2ZZUH 4MTBA 4XOJA 1OOKB 4B75A 1YGCH 1KXFA 5AHGH 1V2NT 5C1YA 1Y8TA 3U8OH 1O2GH 1BTXA 2V6NA 4FU8A 1HAOH 2RA0A 3ATLA 4NIYA 3UNSA 4Z0KA 1QBOA 4YT7H 1A0HB 1N8OB 4MNVA 3UWIA 4ZXYH 4AOQA 5HXFA 4E05H 5DP9A 1GI7B 3VB6A 3ZZCA 3PWBA 3TK6A 1ZLRA 3SNEA 2O9QA 1W14U 1S84A 4KKDA 2D2DA 3BTME 4IW4E 1DDJA 1TNLA 2VIPA 1MTNC 1EP5A 1O5EH 1E34B 1EP6A 1ZSJA 3PMBB 2C90B 3SUEA 4X8UH 1AUTC 3HATH 1C1NA 4IMZA