1KDQA

Crystal structure analysis of the mutant s189d rat chymotrypsin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
130
structure length
130
Chain Sequence
VNGEDAIPGSWPWQVSLQDKTGFHFCGGSLISEDWVVTAAHCGVKTSDVVVAGEFDQGSDEENIQVLKIAQVFKNPKFNMFTVRNDITLLKLATPAQFSETVSAVSLPNVDDDFPPGTVCATTGWGKTKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three Dimensional Structures of S189D Chymotrypsin and D189S Trypsin Mutants: The Effect of Polarity at Site 189 on a Protease-specific Stabilization of the Substrate-binding Site
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
molecule keywords CHYMOTRYPSIN B, B CHAIN
total genus 14
structure length 130
sequence length 130
ec nomenclature ec 3.4.21.1: Chymotrypsin.
pdb deposition date 2001-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1kdqA00
2VGCC 1Y3VA 4NA8A 2HALA 1XXFA 3TGIE 4AG1A 1D4PB 4K1SA 3SI3H 2W5EA 4FUCA 1FI8A 3BV9B 4GPGA 1EATA 1H1BA 1EAWA 3EGKH 4Q80A 4CBOA 5JBTA 1K1MA 4UFDH 1GL1A 1OPHB 3RUOA 2A7JA 4WWYA 4MNWA 1SGDE 1A46H 4JZIA 2BOKA 2WYJA 1NRPH 1QJ7B 3VGCB 1ACBE 1IQGA 3F1SB 1O3GA 2JH0D 2XCNA 1FPHH 2Z9GA 3E0PB 4DOQA 1EPTC 5G4BA 1ANEA 2PLXA 4VGCC 1FMGA 3BIVH 1Z6EA 2YNAA 3R0FA 1Z8JB 1JBUH 1M9UA 3PO1C 4DIHH 2H6MA 1XUJA 2SNWA 3P8FA 2CV3A 2ZQ1A 1P05A 3LDXH 1V2TT 4MDSA 1THRH 1ZHMA 2R2MB 5I25A 2FM2A 2UUKB 2ZPSA 1A1RA 2ZHQH 4TYDA 1HPGA 1O2JA 5L30H 4IC6A 1Y3UA 2Y5HA 4KELA 2ODYB 3M5MA 1S83A 3M36A 3VGCC 1UVTH 1Z7KA 1MKXK 1GL0E 5A0BA 1FNIA 4E7NA 4YZUA 4ABDA 1EPTB 2ZU5A 1TGSZ 3ZV8A 4AORA 2ZFTA 2K1QA 2STAE 1HAVB 1TPPA 3ATLA 3FVFB 2XRCA 2ZDAH 4R8TB 4FVDA 2FIRH 1BMLA 1BITA 1QRXA 2XTTB 1YPLH 3RXOA 1HAYB 1KXAA 2C8YB 2XBXA 5AVDA 4OS5A 2SFAA 3LC3A 1WTHD 3O8RA 4MPXA 1MUEB 1LHDH 3LGVA 1BTZA 3RC4A 1IQKA 4ZHMU 3TK5A 2VB0A 2OQUA 5L2ZH 2NU0E 4NIWA 4K69A 3ZZDA 2QYIA 1ELCA 1H4WA 2ANMH 2IJOB 2XYAA 3BTGE 2PW8H 5F8XA 4X6PA 3SU2A 1PYTD 3SV2H 2WPLS 2XBYA 2BDHA 3A88A 3GY4A 4O3UA 2NWNA 5EXLA 1V6DA 1K28D 1QB1A 3BIUH 1SGPE 1NRNH 4I31A 1P11E 2J94A 1HAVA 1KXBA 2FODA 1HB0B 4KTUA 2BVXH 2FWWA 4H6TA 3RMNH 9ESTA 1A3BH 1DVAH 2FXRA 2FI5E 3SHCH 1NTPA 4AN7A 5LPFA 2D2DA 4X1RU 2FMJA 1OP0A 1E35B 2VVUA 2H2ZA 3HGPA 1GBLA 5ESBA 1ZLRA 5CHAB 1EJAA 1VCPA 3LOXA 4FU7A 2AGIX 1GVKB 5E0JA 4THNH 4WJG2 2P59A 2HRVA 1E38B 4AZ2B 3M3SA 3SV9A 1C5MD 2GT7A 2UWLA 1AU8A 1GHXH 1GI4A 1BJUA 3O8BA 3Q00A 3AASA 3BEFB 4UDWH 3RXJA 1KIGH 3IWMA 4XSKU 4DGJA 1HAXB 1AIXH 2WUBA 1WSSH 1K1OA 1GWAA 4NA7A 1C1OA 2GP9B 1FV9A 2EI8A 2TGPZ 2GT8A 2AMPA 1F7ZA 4ZXYH 2FZZA 2P8OB 5H4IB 3GY5A 2CJIA 1ZRBA 4K2YA 5SGAE 1AZZA 2DE8A 2J38A 1V2VT 1W8BH 2D26C 1NM6A 2V6NA 1UTLM 1QL8A 1MKWK 4A1TA 5C3NA 1QJ6B 2A4GA 2AFQB 2HPPH 5HMAA 1TRMA 4SGBE 1FONA 3RXCA 4K8YA 1XVMA 3UNSA 2ALPA 1W7GH 3MU5A 2GTBA 4CRCA 4IBLH 1AZ8A 1PPGE 2HPQH 2WV5A 1UTJA 5LPRA 2EC9H 1KDQB 1YYY1 2BZ6H 2P93A 1C2HA 2G4TA 4WMDA 5C1YA 1EZXC 3PTBA 3EAJA 1O37A 3SW2B 1DSUA 1VJ9U 2FYQA 3T2NA 4AGJA 3SGBE 3BTDE 3D49H 1GI6A 1GJ5H 1O5AB 5FPSA 4OS1A 1BJVA 1LHEH 3KNXA 4D7FA 3A7TA 4WH8A 1GBEA 4NCYA 4ZKRU 1P03A 2A4QA 4AG2A 4K8BA 3RXTA 3Q3XA 2Y7ZA 3ZVCA 1HJAB 1AE5A 2HVXA 1D3TB 1NU9A 3LU9B 1C1TA 4FUDA 2C93B 1Z1IA 1DXWA 3GDVA 4DCDA 4WF8A 2FTLE 3BN9A 1OWKA 1O3LA 1QA7A 1CHOG 2QIQA 2B9LA 3DHKH 3MU4A 2ZHFH 2PSXA 1AN1E 2BD7A 2G5NA 1MKWH 2FOFA 3A84A 4CRDA 1AB9C 3K2UA 1V2OT 2W7UA 3A7ZA 3P8OA 1GJ9B 1C2IA 1ZGIA 1CA8B 3FP6E 1A4WH 1BB0B 1SBWA 1JIMA 3M35A 1TOMH 3SORA 4GCHG 2G81E 2M5TA 3TJOA 1WUNH 3SI4H 1XUIA 1O3HA 4B71A 1AO5A 2QXGA 1N8OB 1Z1JA 1O3IA 1O2VA 3RXSA 3S0NA 4JK5A 3BSQA 2FPZA 1FZZA 2GCHG 3SUGA 1JMOH 1TQ0B 1LPKB 1J14A 1TBQH 4B73A 2BD5A 1TNGA 3SGQE 1JOUB 3VB4A 3RU4D 2BYAX 1DXPA 4HZHA 3TVJB 1OS8A 3RXHA 1OP2A 2W26A 1O36A 1UJ1A 1DWDH 1ELEE 2OP9A 3ZZ6A 3QTOH 1HJ8A 2NU4E 3F9HA 1RFNA 3RXGA 4RKOB 1ZMLA 3P92A 1IQEA 1YPHC 1W13U 1ZOMA 3TK6A 2BD2A 1O3MA 4KGAA 2BD4A 3QZRA 4MPWA 2NU2E 4ABJA 1L4ZA 3NUMA 2JETB 3TK9A 1IAUA 3S7KB 4Y7AA 4IW4E 2OINA 1O3BA 1IQFA 1N6XA 2IOTA 1E34B 2H5CA 1C5ZB 4NIYA 1PPCE 4X1QU 2GZ9A 2ZDVH 1UTNA 2ZCHP 1O3EA 4GUXA 2BXTH 2F9BH 1ZZZA 1TGTA 2ZP0H 1FJSA 1D6WA 1P2IA 2V0BA 3MOCA 4MPUA 1AWFH 1CA0B 2V3OH 1O2IA 4J1YA 4U32A 1T32A 3FZZA 2J4IA 4Y0ZE 1AKSA 1T4VH 1CA0C 1FY3A 2H9HA 1SLVB 3BF6H 2VH6A 4AFQA 3SJIA 1NFUA 3SUFA 1GDQA 1TALA 1QBNA 1W12U 2BVSH 3BEIB 2AS9A 3NK8A 5A0CA 5DKMA 5FBIA 1UMAH 1TQ7B 2FOGA 4IMZA 1UTQA 1Y5AT 1PJPA 1F0TA 2BY8X 3MYWA 5DPAA 3EA8A 3AVZA 3SJ8A 2GD4B 2Q6DA 3ODDA 2FOBA 5FXLA 5C5OA 4E7RG 3IG6B 5JBAS 1K9OE 3LH1A 4ABHA 1SGYE 5JB9S 1XX9A 3A8CA 2QXHA 5CHAC 3SBKA 1C1UH 2ZHWH 1LVMA 1RRKA 3MTYA 1V2KT 1FUJA 2F9PA 4I8GA 4DURA 4JZDH 1P57B 4DJZB 4PROA 1KY9A 1YPMH 2Y7XA 3DT0H 5F03A 1Q3XA 1K1LA 2AYWA 3C1KA 2WYGA 2BD3A 1P3CA 1HRTH 1OWJA 3ZVBA 1GI8B 4OS7A 5GIBA 1K22H 5IDKA 3SV7A 1LHCH 1NZQH 2G5VA 8GCHG 1RIWB 4FUFA 2PTCE 4XBDA 2QGRA 1IQJA 1EQ9A 1P9SA 1MTWA 3U98H 3KQEA 3LJOA 3VB5A 1ZJDA 2ZZUH 1PPFE 3JZ1B 1C1MA 4ZKSU 5DP7A 3U69H 2I6QA 1BIOA 4CH2B 2F9NA 1HXEH 3TGJE 1AVXA 1HAIH 1S81A 1UTPA 1G30B 1FAXA 1ZTKA 1Y5UT 1P01A 3S9AA 2ZFRH 2ZF0H 1GJ6A 2Y80A 2BY5X 4CREA 1ZSLA 1S6HA 1UO6A 4ZHLU 1GMHF 1O2RA 1BHXB 1O31A 3SNDA 1MD7A 2DUCA 2ZTXA 4H6SB 1W14U 5ETXA 3H7OA 3UWJH 3ELAH 3M3TA 3PLBA 2G00A 1QBOA 3VEQB 1SFIA 3MH5A 1HXFH 1EKBB 2XBVA 1BRBE 1O3KA 1BBRE 2ZGCA 1ZHPA 1PQ7A 3B9FH 2WINI 5GDSH 5GWZA 4I8HA 1OWIA 3EA9A 2ZHDA 4B2BA 4FVBA 2CGAA 1CSOE 4D8NA 3RXMA 1SQTA 4GVUA 1G3DA 1J8AA 2P8OC 3LH3A 1QNJA 2P95A 5E2OA 1TX6A 3L33A 1BTYA 1QHRB 1O35A 3ATMA 1EPTA 3P8NA 1GBKA 3A7VA 1ORFA 1Q31A 1Q2WA 1O39A 1LTOA 1LDTT 1KLJH 5C1UA 1TMBH 1AHTH 4BANB 1GHYH 1UK2A 1G3BA 1UK4A 5TJXA 3UNRA 3ZZ8A 4ABBA 2KAIA 2RG3A 2GZ8A 1MKXH 4MNVA 5JPMH 1SHYA 1A5GH 1C1PA 2EA3A 3EYDA 1QQ4A 1A5IA 4ABFA 2ZO3H 3EQ0H 2A5IA 1ZTLA 2SGDE 3GOVB 5L6NH 2G55A 1DITH 3OYPA 3KQBA 3P17H 4IS5A 2ZG0H 4Y10E 1GVZA 1HCGA 1TFXA 1XKAC 4E05H 1E37B 2BOHB 3A7XA 2C4FH 3MFJA 1H8DH 2RA0A 1GBAA 4CRAA 1ZTJA 2CN0H 3AAVA 2XC0A 1C1RA 4HGCA 3QK1A 1DWBH 1QQUA 1O2NA 2BY9X 3KQCA 2ZDNA 3UR9A 4BXSA 4X0WU 1WBGB 2ANWA 2O8WA 1CT4E 3SNCA 1HGTH 1PPBH 4ZROA 1UVOA 4VGCB 2XXLA 2VGCB 1SGTA 2Z9LA 1HAOH 3TJVA 4Z0KA 1RJXB 2XBWA 2J9NA 3GYMA 5EPYA 1O5FH 3W95A 8ESTE 2EEKA 1WU1A 1DOJA 1T8OA 2HLCA 2BD9A 3LPRA 5F8ZA 3H7TA 1RS0A 4H42U 4TY6A 2PKSB 1P2NA 1AB9B 2ZEBA 5E2PA 1S5SA 2QN5T 1O2WA 1KYNA 4YTAA 5A2MH 3RP2A 3ZZ3A 3ATKA 2OUAA 2IPHA 3SJ9A 2CMYA 3HPTB 3I29A 1ZGVA 2H5DA 3RXDA 1IHSH 2UUYA 1NY22 1XUKA 2GV6A 1O0DH 4ISHH 2XNIA 4RSPA 4YT7H 2BQ6B 3QZQA 5TCAA 4D7GA 2VIPA 4NG9H 4NSYA 1QCPA 3E16B 5C1XA 3MO6A 6CHAB 1EZSC 5B6OA 1ELFA 5K0HA 2QV1A 2HGTH 1Y5BT 2BDBA 2QA9E 4BTTB 1OYTH 4BTIB 1FN8A 1ESBA 3SNEA 4FUEA 1F5KU 3ZYDA 1S85A 1O5DH 1C2DA 3QWCH 1GBFA 4DVAU 3FP8E 1EX3A 3ESTA 1RIWC 1ELVA 1MAXA 3HKJB 2Z3EA 3BG8A 3SUEA 3ZZ5A 3DFJA 4OS4A 1TB6H 1S0QA 4BAOB 2VWLA 1P06A 3LGIA 4FXGH 4FU8A 5T6DA 1F0SA 6CHAC 3RMOH 1RXPA 1TNLA 1G37A 3O8CA 4Y11E 5EW2H 3A8BA 1LCYA 1NC6A 2QF0A 4Y0YE 3AW0A 3TLOA 1GBIA 1MTNB 3GY3A 1C5TA 1PQAA 3SN8A 1LQDB 4WXIA 2SGAA 2PWXA 1S82A 4CRGA 3GCOA 1DSTA 1OYQA 2PHBA 3V0XA 2CHAB 2A2QH 4UONA 1N6YA 1H9HE 3MU1A 1F92A 1GJAB 3Q77A 1GI7B 5EXMA 1CO7E 1LVYA 3UUZA 3A83A 3SU5A 1FY5A 1YCPK 1Y8TA 3OX7U 3GCNA 2ZU2A 1XUGA 1VCQA 1NO9H 1TYNA 1EJMA 2BLWA 2BQWB 2H9TH 2QCYA 5BRRE 3SHAH 1SGEE 1NESE 1GVLA 2SGQE 2ZGXH 1QL7A 1SHHB 1O2YA 1VGCB 4ZAEA 1GBBA 1TA2A 1OOKB 1OXGA 1SC8U 2O8MA 2JKHA 1C1NA 1C1SA 1EP5A 1FY8E 2BY7X 4NA9H 1C5LH 1IHTH 2UUFB 4X8UH 1C5VA 1ZMJA 4K60A 4NWKA 5IYTA 1P04A 2R9PA 3T28A 1AQ7A 3UOPA 1C5SA 3A86A 2ANKH 1S0RA 5FCKA 4GHQA 4XDEA 1TX8A 3ZZBA 1SG8B 1UTOA 1P2KA 3M5OA 3A80A 1UCYH 4ABAA 2IN2A 1C9TA 3BTHE 1F5LA 1CT0E 2C90B 1QURH 1QJ1B 4WVPE 1BTWA 2OXSA 4FUHA 5ESTE 3P95A 1A61H 4I32A 3SU3A 1OKXA 1O33A 1PPEE 2W3IA 2VVCA 1PQ8A 2A4OA 2PR3A 1ESTA 1E36B 2UUJB 1QY6A 1GBTA 3M7TA 1VITF 3S7HB 5FX5A 3CS7A 1O2ZA 2PKAB 4AOQA 3E91A 2FP7B 1P10A 2Q6FA 1GMCF 6GCHF 4BAHB 4Q7YA 1TIOA 1LKAA 1L1JA 1O2HA 3MWIU 3FANA 1EXFA 2WPIS 1TBZH 2ZTZA 4Q7ZA 4FUBA 1DWCH 1GJCB 3OSYA 3MHWU 1GCTB 1E0FD 1TX7A 2RA3A 1NFWA 1XUFA 2P3TB 3W94A 1J15A 2C8WB 4NIXA 3RXIA 4FUIA 3RC5A 3T62A 3A89A 3P6ZB 3UR6A 1YPGH 2GGVB 2A32A 2WPHS 1YKTA 1GI5A 1GI2A 2PUXB 1A3EH 2ALVA 1MTNC 1HYLA 4UD9H 2Y82A 3V12A 3S9CA 1L0ZA 1CU1A 3ITIA 4A92A 1RTLA 1G3CA 1OWHA 2Z9IA 3NKKA 2D8WA 4JZEH 1V2JT 2QY0B 2QC2A 1TABE 1UVUH 5BPEA 1CGJE 4Q7XA 1NPMA 3GCTF 1DUAA 2CF9H 1O3CA 2HOBA 1L4DA 2AERH 2BQ7B 1GJBB 2F9OA 1H9LB 3EA7A 4O3TA 1A7SA 1SMFE 2G8TA 1N8OC 2AGEX 1LQEA 3LONA 3F9EA 1GHBG 2A5KA 1TPSA 4RKJB 4XE4A 4ZXXH 1V2UT 1C1VH 1FQ3A 2GDDA 1DLEA 1VCWA 1NS3A 1WOFA 3PWBA 1O2XA 3LGYA 1F0RA 4ZMAH 3SV8A 1SB1H 2F3CE 1MQ6A 1W0YH 1F2SE 3BTFE 1ELBA 4Y79A 3RLWH 3E1XB 3RXFA 5DP5A 3GCHC 3PMAB 4OS6A 2FEQH 2ULLA 1C5NH 3L3TA 1FY1A 1WV7H 3SU6A 1SI5H 1OWDA 3MU0A 1X7AC 4B75A 3PLPA 2C8XB 4ASHA 3F6UH 1O2UA 1C1WH 1GJDB 1TONA 1Y3WA 3UWIA 7GCHG 2HNTC 2PKSC 1JWTA 4J2YB 4QT8C 3DD2H 2GCTC 1GDUA 1UVPA 2J92A 2A7HA 2JH5D 4GLYA 1NROH 3VPKA 1TWXB 4LK4A 3RC6A 1O3DA 1AVGH 5EXNA 2F91A 1O5GH 3MMGA 1D3DB 1VITH 2OQ5A 1K21H 1GI9B 1C1QA 1C5QA 1MD8A 1SGFG 3FP7E 5T6GA 2FYRA 1D3QB 1W3CA 1BTUA 1O2QA 5A09A 1YPEH 1W11U 5E8EH 3RXUA 5EOKA 1AUTC 4CHAC 6GCHG 1D6RA 3Q3YA 2ZIQH 2XCFA 3UQVA 1IQIA 4A1XA 3GY6A 1TGBA 1BOQA 1D9IA 3A8AA 1NT1A 1SLWB 2VINA 1SVPA 4K3JA 3TJNA 4IN2A 1HAHH 3RXKA 3WY8A 4IMQA 1P8VC 3F9GA 5EQQA 1BTXA 2TBSA 1C2MA 1DUEA 1OWEA 1PFXC 4YESB 2BDAA 5FCRA 3AW1A 1GI1A 3ZVFA 3ZZAA 1O2OA 4KTSA 4X2WA 3P8GA 2OCVB 3RXVA 1W2KH 3MH4A 3TITA 1BMNH 3T26A 1SGFA 1C5UA 1GG6C 2ZFPH 2EI6A 1THPB 5EGMA 4CRBA 1IOEA 2ZTYA 5A8YA 4OS2A 3ENSB 3TJUA 1GI3A 1PPZA 3MI4A 1MZDA 2F9UA 4GSOA 5FBEA 5FX6A 1DX5M 1NRQH 2GDEH 3M7UA 3PROA 1SQAA 3CS0A 1EASA 4ISLA 2W7SA 4DT7B 2JETC 2ZKSA 2XC4A 3KL6A 8KME2 3PWCA 2FS8A 2AMQA 3KGPA 1Y3XA 2XC5A 3LGUA 1A0LA 5DG6A 2ZC9H 4MPVA 2TPIZ 3RDZA 1JRTA 1HV7A 3LT3A 1TMTH 2J95A 1O2PA 5DO4H 1YGCH 1GGDB 1ZSJA 4TPIZ 1OX1A 2AH4X 1THSH 4CBNA 4MQAA 4AYYB 1T4UH 2ZWLH 3BTTE 1B0FA 2R3YA 3T5FH 1QIXB 2BX3A 1YCPM 4A7IB 1BTHH 1QL9A 1T8LA 1EAUA 1PPHE 1WTGH 3T25A 1ANCA 3NPSA 5FPTA 1P0SH 5TCCA 4BOHA 1O2KA 2PGQB 1G2LA 2A31A 4GAWA 1NRSH 2ASUB 1BRUP 2V3HH 2HNTE 1GMDF 1SL3A 4JYUH 4Y8XA 2BB4A 4HFPB 4U01A 2GVFA 3D23A 5GJ4B 1EB2A 3SGAE 2SGFE 2ZFQH 3MNSA 4Z6AH 1DICA 3A87A 4B2CA 5CMXH 1SQOA 3MH6A 4JCNA 1ZMNA 2OC0A 3C27B 3O8DA 3SO3A 1DDJA 1ELTA 1OP8A 2GMTB 1C5YB 3BG4B 2Z9JA 4U2WA 1Z6JH 1GCTC 1SGRE 1EB1H 1WQSA 1XMNB 3NWUA 3HGNA 1KSNA 3QGNB 3T27A 2QF3A 2Y81A 1AKSB 3UOUA 1G3EA 1ARCA 1GCDA 3K9XB 1NFYA 1BRCE 2WPMS 1QA0A 3L6PA 1EOLA 5A0AE 5AFYH 1NRRH 3I78A 5JYIA 2G52A 1A0HB 1LPZB 1O3JA 4ESTE 3UPEA 4D9RA 2V35A 2ZNKH 2VIWA 3TPIZ 3FAOA 3MO3A 4ZKNU 1L1NA 1HJ9A 4Y71A 1SFQB 2VIDA 3I77A 1O3PB 2ZFFH 1CE5A 2BD8A 2O8TA 1ANBA 3A82A 1RTFB 1GI0A 2R0KA 4WMFA 1AE8H 3RLYH 1UCYE 2F83A 1INCA 3U1IB 4O03A 1AFQB 2VU8E 5DP3A 1VR1H 3RMMH 2TGAA 1TLDA 3SOSA 3UTUH 4U30A 2ZCKP 3SQHE 3QUMP 3NCLA 3MNXA 1QRZA 1C2KA 2FI4E 5HXFA 2QXJA 1KXCA 5FHTA 3SQEE 1FIZA 1GDNA 3E3TA 1YLDA 3STJA 2SGEE 1L2EA 2BVRH 1RGQA 5JB8S 1OSSA 1IQHA 5C67A 5DK1A 1IQLA 1PYTC 1J17T 2Z94A 1DFPA 2A4RA 2VNTA 1GHAF 3P70B 1DS2E 4F4OC 1C2GA 1ZYOA 1TAWA 1WAYB 6ESTA 1GHZA 1AFQC 3RU4E 2BDYA 3PMBB 3BTME 4SGAE 4ZUHA 9LPRA 2NU3E 3PM3A 3UNQA 1MTVA 1QRWA 4JMYA 3R3GB 1C2JA 1P2JA 5E0HA 2W3KA 4AX9H 2OC8A 2FOMB 4K1EA 2YOLA 1T8NA 3OU0A 5EQSA 3PYHA 1FDPA 1SLUB 4ZHAA 4ISIH 1FXYA 4WMEA 1UCYK 3M5LA 4ISOA 1FY4A 3LGTA 1GMHG 1EZUC 1V2ST 1YP9A 3HK3B 3BEUA 3STIA 2P16A 2B8OH 1C2EA 3KEEA 1TMUH 3F68H 4JK6A 1BMAA 4X1PU 1KTTB 1TBRH 4KTCA 2A5AA 2OLGA 2ZU1A 2Q1JA 2FTMA 2C8ZB 3E90B 3SJKA 3PTNA 5EODA 5JBBS 5AFZH 1HJAC 3A7YA 2O8UA 2FOCA 3RM2H 1ZPBA 1EP6A 2H1UA 3UY9A 1AI8H 1JIRA 3URDA 1YC0A 1HUTH 3UQOA 2VWOA 4JYVH 1H9IE 2JH6D 3ZZ4A 4INLA 1KLIH 4M7GA 1MBMA 1LO6A 1O32A 3ZZCA 3KIDU 1GJ7B 1RD3B 1BT7A 5HM2A 1VITG 5F6MA 1TNKA 3UFAA 2ILNA 2VWNA 4BTUB 1U6QA 1MCVA 1GJ8B 3QTVH 2YNBA 4B74A 1CHGA 5K7RA 4D9QA 1FLEE 1XUHA 3SU1A 3ZVAA 4TPYA 3B23B 4HTCH 1BHXF 4R0IA 3M7QA 1BTPA 1MU6B 3KN2A 5HGGA 2UWPA 4YO9A 1QTFA 4UFEH 5C20A 3ZZ9A 4TWWA 1TA6A 4BXWA 1QB6A 1QR3E 2O8LA 2OBQA 1AGJA 1MQ5A 2Z9KA 1AD8H 1DLKB 2H9EH 3PLKA 4X8VH 1O30A 4ZH8A 1DY9A 1GBCA 1MBQA 3VB3A 1SGIB 5PTPA 2GKVE 1O5CB 5EG4A 3TNSA 2O9QA 5AF9H 1P09A 3URCA 8GCHF 4BAMB 4AB9A 1H8IH 1HIAA 1C2FA 4B76A 3VFEA 6LPRA 5AHGH 1T31A 1CT2E 4AFSA 3U9AH 1WYKA 1YM0A 7KMEH 1DM4B 5J4SA 2BDGA 2WPJS 2SNVA 4NIVA 2VIVA 3NXPA 3Q76A 1KTSB 2C3SA 2ANYA 3ZVEA 1XVOA 1V2QT 5DP9A 2NU1E 2TGDA 2FX6A 2PGBB 2SGPE 2BLVA 1ZRKA 1O34A 2ZDLA 1YLCA 3N7OA 1O5EH 3QO6A 5EW1H 2ZGHA 2A1DB 2F9VA 2Z6BD 2TIOA 3GCTG 5C5NA 1ETRH 7ESTE 5DP6A 3JZ2B 1AUJA 1C4U2 4NSVA 4AFZA 2CXVA 1O2SA 3F9FA 4UEHH 1FIWA 1YCPH 2GX4A 3LGWA 4MNXA 3A81A 2FLBH 1P2OA 2FOAA 2FLRH 1C5XB 4KP0A 2BDCA 4DIIH 2J34A 3BTWE 1GBHA 1NFXA 3SZNA 1BRAA 4X2YA 3T29A 4H4FA 3BTQE 1HNEE 1P9UA 1BQYA 3KQDA 4YOIA 4CR9A 5ABWA 3GDSA 3KF2A 1ABIH 1ETSH 1ELDE 2ZPQA 1DY8A 5DP4A 1NN6A 5C2ZA 2HWLB 1HIAB 4TY7A 3M5NA 4NGAH 4INHA 3ZVDA 2AIQA 5FAHA 1ZSKA 4NFFA 1WCZA 4ABIA 2ZU3A 2GCTB 1GMDG 1ABJH 3BTKE 1QGFA 1GMCG 3V13A 1MU8B 3ZZ7A 2CHAC 1BDAA 1A2CH 3ZV9A 1T8MA 1GHAG 1V2MT 1EAIA 1HBTH 1SLXB 1UVSH 1AFEH 1G9IE 2BLOA 1F5RA 3GCHB 2Z3CA 1UK3A 3K65B 1GHVH 2P3UB 3GY7A 2QAAA 4LXBH 3RM0H 3E6PH 2BXUH 2BHGA 4ABGA 1GHWH 1C5OH 3VXEH 4I7YH 4Y6DA 3S69A 4Q2KA 3SU4A 1TNHA 1AWHB 5DP8A 2QXIA 1ELAA 3MH7A 2TGTA 1ZPCA 2TRMA 3E8LA 1LHGH 4IGDA 3RXRA 3HATH 2D1JA 3MNBA 1Z8IB 5EQRA 2FDAA 2GCHF 1HAGE 2R3UA 2RCEA 3EE0B 1O5BB 1T7CA 3M3VA 2PTNA 3GY2A 5HYOA 1YPJH 3M61U 2A45B 2ESTE 5GCHG 5GCHF 1P2MA 1DPOA 4MG3A 1YF4A 4CHAB 1S84A 4UFGH 5J4QA 1SOTA 2A0QB 4IN1A 3DA9B 1B5GH 3G01A 2Q6GA 4XOJA 1O38A 3DFLA 2THFB 1ZJKA 1F0UA 2ZQ2A 1AVWA 7GCHF 4BAQB 3SV6A 2GV7A 1TNJA 4X6MA 3KCGH 3OY5U 3U1JB 4LZ4B 1K1JA 1CGIE 1O2MA 3H5CB 5DGJA 2HNTF 2VIOA 4BAKB 2G51A 2XWAA 2KAIB 3RXQA 1ZR0A 3K6ZA 3D65E 4X6OA 5JDUB 3VB7A 1V2PT 2ODQA 2ZGJA 3UIRA 1O3OA 2R0LA 3Q3KA 2UWOA 3RMLH 2WUCA 8LPRA 2AMDA 4INKA 4E06H 2ZFSA 4MVNA 1C9PA 1TRNA 4O97A 1MH0A 1C4Y2 1EUFA 1FPCH 1GG6B 2I6SA 2ZPRA 2VIQA 1WQVH 4JZFH 4JYTA 1V2RT 3A8DA 1P2QA 3RXPA 1B0EA 1MZAA 1TNIA 3TH4H 2GZ7A 4UE7H 3SNAA 2BM2A 5CE1A 3QGJA 5LGOA 3SJOA 1KLTA 2WV4A 1YPKH 1Z8GA 4DW2U 2VWMA 1CQQA 3GISB 2ZU4A 1W10U 3M37A 4WY3A 2ZGBH 1DANH 1KXEA 4ISNA 1Z71A 1RTKA 4ZKOU 2ZI2H 2ZHEH 1L1GA 2P94A 3LJJA 3BTEE 4ABEA 3PMJA 4AYVB 1CHOF 1O3FA 2BTCE 1KXDA 1LVBA 1ZHRA 4FUJA 4X1NU 3PO1B 1LHFH 1MAYA 4CR5A 5E0GA 2GMTC 1VGCC 2ZDMA 2BMGB 1ELGA 4JZ1A 2OC7A 4GHTA 1GBMA 1O2LA 4D76A 1DWEH 5LH8A 4YLQH 1ZPZA 3V7TA 3K6YA 3U8RH 3ODFA 4TWYA 1BBRK 2Z3DA 3MNCA 1AMHA 4WXVA 4BNRA 1EAXA 2FOHA 3GDUA 1ETTH 4DY7B 2PKAA 4I33A 4I8KA 3QN7A 1V3XA 1GBDA 5EPNA 2B7DH 3TIUA 4I8JA 2PV9B 1ESAA 1TGCA 2WPKS 4X8TH 2OD3B 5T6FA 1BA8B 2AIPA 3QDZB 1P3EA 4CRFA 2A2XH 1EJNA 1HFDA 2OBOA 3CENA 1C5WB 2FESH 1V2WT 5DJ7A 4YM9A 1CBWC 1K1IA 1SGNE 3GYLB 4NZLA 1GBJA 4Y76A 4OGXA 4A6LA 1CBWB 4NFEA 4A5TS 4YOJA 2PFEA 1DT2A 1TE0A 5FPYA 1YPHE 4YT6H 3LIWA 1EOJA 1TPOA 2ZDKA 4Y7BA 4KKDA 4AB8A 1C2LA 1J16A 4LZ1H 3HKIB 1PQ5A 2LPRA 3FZDA 1ARBA 4GCHF 3S9BA 3D62A 4OGYA 3OY6U 3QLPH 5T3HA 1P02A 3ATIA 1G36A 1N1LA 5GPIB 3OTJE 2AGGX 1BZXE 7LPRA 1QB9A 2ZCLP 4DG4A 1Z8RA 2FOEA 1G32B 2BZAA 1TOCB 3VXFH 4MTBA 1EZQA 1JRSA 1UHBA 1LPGB 1LVOA 1O2GH 2PSYA 1ID5H 4NWLA 2P3FH 1YBWA 4A1VA 2XW9A 5F8TA 1A0JA 3TNTA 1V2NT 3CP7A 4O9VA 1QBVH 1IQMA 1HAPH 1AY6H 2BY6X 3IITA 3MU8A 2LNCA 1UTKA 1P12E 2STBE 2Z7FE 3PV4A 2AEIH 2R2WU 2Y6TA 3NZIA 4AFUA 4B2AA 4Y8YA 1MMJN 3SNBA 4LOYH 1FAKH 1O3AA 2BX4A 3A7WA 1NU7B 4YLUA 2BLQA 1SOZA 4K1TA 3TH2H 1G2MA 1GGDC 1CVWH 5HM9A 2DE9A 4I8LA 1XM1A 2B0FA 1VZQH 3PMHB 1W7XH 1W0ZU 3ZVGA 1BUIA 1D3PB 2J2UA 4CH8B 2RDLA 1O2TA 1TGNA 1HDTH 4MNYA 1MCTA 2ZECA 1TPAE 3LC5A 3U8OH 2FX4A 1Y59T 3DUXH 5L2YH 2PUQH 3RU4T 3TU7H 1IQNA 1JXPA 1HLTH 3RXLA 1C4V2 4IC5A 1CGHA 4X2XA 3LKWA 1XKBC 2EI7A 3GICB 1SGCA 1C5PA 1GJ4H 1K2I1 1SR5C 4AGKA 4YOGA 1A5HA 5EU8A 1KXFA 1QFKH 1DE7H 2ZA5A 2CF8H 2Y5GA 1J9CH 1SSXA 1UHBB 2A7CA 1ANDA 4WH6A 2B5TB 1Y3YA 1VJAU 2ODPA 3TH3H 4F49A 5A8XA 2FI3E 3B8JA 3E0NB 3MO9A 1C5RA 3FFGA 3UREA 1GHBF 3PB1E 5JBCS 3EDXB 2FS9A 1V2LT 4K5ZA 3SU0A 1MTUA 2VVVA 2G4UA 4UFFH 4XBBA 4B1TA 3KHVA 1MTSA 4XFQA 4MLFB 3ZYEA 3VB6A 1TRYA 4Y8ZA 1S6FA 5LPEA 5I46H 5GXPA 1LKBA 1B7XB 1HAZB 2VJ1A 3BG4C 4X2VA 1BCUH 3AAUA 3V3MA 4FUGA 4XBCA 1GPZA 1FN6A 2BDIA 5A8ZA 3RXAA 3SUDA 1XXDA 4RN6A 3GY8A 1K1NA 3A85A 1UTMA 3RXBA 2XWBI 1BMMH 3TGKE 4X6NA 1SPJA 3QX5H 1LMWB 4NZQA 4X1SU 2VH0A 3HK6B 3RXEA 3ATWA 4HI3A 2Y5FA 2OC1A 2FO9A 1K1PA 4FU9A 3U8TH 1SGQE 1O3NA 1BBRH 4X8SH 1KDQA 2OTVA
chains in the Genus database with same CATH superfamily
2VGCC 1Y3VA 4NA8A 2HALA 1XXFA 3TGIE 4AG1A 1D4PB 4K1SA 3SI3H 2W5EA 2AHME 4FUCA 1FI8A 3BV9B 4GPGA 1EATA 1H1BA 1EAWA 3EGKH 4Q80A 4CBOA 5JBTA 1K1MA 4UFDH 1GL1A 1OPHB 3RUOA 2A7JA 4WWYA 4MNWA 1SGDE 1A46H 4JZIA 2BOKA 2WYJA 1NRPH 1QJ7B 3VGCB 1ACBE 1IQGA 2JDID 3F0PA 3F1SB 1O3GA 2JH0D 2XCNA 1FPHH 2Z9GA 3E0PB 4DOQA 1EPTC 5G4BA 1ANEA 2PLXA 4VGCC 1FMGA 3BIVH 1Z6EA 2YNAA 3R0FA 1Z8JB 1JBUH 1M9UA 3PO1C 4DIHH 2H6MA 1XUJA 2SNWA 3P8FA 2CV3A 2ZQ1A 1P05A 3LDXH 3N7EA 1V2TT 4MDSA 1THRH 1ZHMA 2R2MB 5I25A 2FM2A 2UUKB 2ZPSA 3PV5A 1A1RA 2ZHQH 4TYDA 1HPGA 1O2JA 5L30H 4IC6A 1Y3UA 2Y5HA 4KELA 4Z1MD 2ODYB 3M5MA 1S83A 3M36A 3VGCC 1UVTH 1Z7KA 1MKXK 1GL0E 2JIZD 5A0BA 1FNIA 4E7NA 4YZUA 1E1QD 4ABDA 1EPTB 2ZU5A 1TGSZ 3ZV8A 4AORA 2ZFTA 2K1QA 2STAE 1NBME 1HAVB 1TPPA 3ATLA 3FVFB 3H09A 2XRCA 2ZDAH 4R8TB 4FVDA 2FIRH 1BMLA 1BITA 5T1VA 1QRXA 2XTTB 1YPLH 3RXOA 1HAYB 1KXAA 2C8YB 2XBXA 5KECA 5AVDA 4OS5A 2SFAA 3LC3A 1WTHD 3O8RA 4MPXA 1MUEB 1LHDH 4P02A 3LGVA 1BTZA 3RC4A 1IQKA 4ZHMU 3TK5A 2VB0A 2OQUA 5L2ZH 2NU0E 4NIWA 4K69A 3ZZDA 2QYIA 1ELCA 1H4WA 2ANMH 2IJOB 2XYAA 3BTGE 2PW8H 5F8XA 3DSGA 4X6PA 3SU2A 1PYTD 1YWUA 3SV2H 2WPLS 1EFRD 2XBYA 2BDHA 3A88A 3GY4A 4O3UA 2NWNA 5EXLA 1V6DA 1K28D 1QB1A 3BIUH 1SGPE 5GNDA 1NRNH 4I31A 1P11E 2J94A 1HAVA 1KXBA 2FODA 1HB0B 4KTUA 2J97A 2BVXH 2FWWA 4H6TA 3RMNH 9ESTA 1A3BH 1DVAH 2FXRA 2FI5E 3SHCH 1NTPA 4AN7A 5LPFA 2D2DA 4X1RU 2FMJA 1OP0A 1E35B 2VVUA 2H2ZA 3HGPA 1GBLA 5ESBA 1ZLRA 5CHAB 1EJAA 1VCPA 3LOXA 4FU7A 2AGIX 1GVKB 5E0JA 4THNH 4WJG2 2P59A 2HRVA 1E38B 4AZ2B 3M3SA 3SV9A 1C5MD 2GT7A 2UWLA 1AU8A 1GHXH 1GI4A 1BJUA 3O8BA 3Q00A 3AASA 3BEFB 4UDWH 3RXJA 1KIGH 3IWMA 4XSKU 4DGJA 1HAXB 1AIXH 2WUBA 1WSSH 1K1OA 1GWAA 4NA7A 1C1OA 2GP9B 1FV9A 2EI8A 2TGPZ 2GT8A 2AMPA 1F7ZA 4ZXYH 2FZZA 2P8OB 5H4IB 3GY5A 2CJIA 1ZRBA 4K2YA 5SGAE 1AZZA 2DE8A 2J38A 1V2VT 1W8BH 2D26C 1NM6A 2V6NA 1UTLM 1QL8A 1MKWK 4A1TA 5C3NA 1QJ6B 2A4GA 2AFQB 2HPPH 5HMAA 1TRMA 4SGBE 1FONA 3RXCA 4K8YA 1XVMA 3UNSA 2ALPA 1W7GH 3MU5A 2GTBA 5KGOA 4CRCA 4IBLH 1AZ8A 1PPGE 2HPQH 1E1RD 2QF4A 1UTJA 2WV5A 4DT4A 5LPRA 2EC9H 1KDQB 1YYY1 2BZ6H 2P93A 4F55A 1C2HA 2G4TA 4WMDA 5C1YA 1EZXC 3PTBA 3EAJA 1O37A 3SW2B 1DSUA 1VJ9U 2FYQA 3T2NA 4AGJA 3SGBE 3BTDE 3D49H 3VG8A 1GI6A 1GJ5H 1O5AB 5FPSA 4OS1A 1BJVA 1LHEH 3KNXA 4D7FA 3A7TA 4WH8A 1GBEA 4NCYA 4ZKRU 1P03A 2A4QA 2YMSC 4AG2A 4K8BA 3RXTA 3Q3XA 2Y7ZA 3ZVCA 1HJAB 1AE5A 2HVXA 1D3TB 1NU9A 3LU9B 1C1TA 4FUDA 2C93B 1Z1IA 1DXWA 3GDVA 4DCDA 4WF8A 2FTLE 3BN9A 1OWKA 2OK5A 1O3LA 1QA7A 1CHOG 2QIQA 2B9LA 3DHKH 3MU4A 2ZHFH 2PSXA 1AN1E 2BD7A 2G5NA 1MKWH 2FOFA 3A84A 4CRDA 1AB9C 3K2UA 1V2OT 2W7UA 3A7ZA 3P8OA 1GJ9B 1C2IA 1ZGIA 1CA8B 3FP6E 1A4WH 1BB0B 1SBWA 1JIMA 3W1EA 3M35A 1TOMH 3SORA 4GCHG 2G81E 2M5TA 3TJOA 1WUNH 3SI4H 4RT1A 1XUIA 1O3HA 4B71A 1AO5A 2QXGA 1N8OB 1Z1JA 1O3IA 1O2VA 3RXSA 3S0NA 4JK5A 3BSQA 1FX0B 2FPZA 1FZZA 2GCHG 3SUGA 1JMOH 1TQ0B 1LPKB 1J14A 1TBQH 4B73A 2BD5A 1TNGA 3SGQE 1JOUB 3VB4A 3RU4D 5HIYA 2BYAX 1DXPA 4HZHA 3TVJB 1OS8A 3RXHA 1OP2A 2W26A 1O36A 1UJ1A 1DWDH 1ELEE 2GJGA 2OP9A 3ZZ6A 3QTOH 1HJ8A 2NU4E 3F9HA 1RFNA 3RXGA 1NBMD 4RKOB 1ZMLA 3P92A 1IQEA 1YPHC 1W13U 1ZOMA 3TK6A 2BD2A 1O3MA 4KGAA 2BD4A 3QZRA 4MPWA 2NU2E 4ABJA 1L4ZA 3NUMA 2JETB 3TK9A 1IAUA 3S7KB 4Y7AA 4IW4E 2OINA 1O3BA 1IQFA 1N6XA 2IOTA 1E34B 1WXRA 2H5CA 1C5ZB 4NIYA 1PPCE 4X1QU 2GZ9A 2ZDVH 1UTNA 2ZCHP 1O3EA 4GUXA 4I86A 2BXTH 2F9BH 1ZZZA 1TGTA 2ZP0H 1FJSA 1D6WA 1P2IA 3KYFA 2V0BA 3MOCA 4MPUA 1AWFH 1CA0B 2V3OH 1O2IA 4J1YA 4U32A 1T32A 3FZZA 1OHHD 2J4IA 4Y0ZE 1AKSA 1T4VH 1CA0C 1FY3A 2H9HA 1SLVB 3BF6H 2VH6A 4AFQA 3SJIA 1NFUA 3SUFA 1GDQA 1W0KD 1TALA 1QBNA 1W12U 2RDEA 2BVSH 3BEIB 2AS9A 3NK8A 5A0CA 5DKMA 5FBIA 1UMAH 1TQ7B 2FOGA 4IMZA 1UTQA 1Y5AT 4ASUD 1PJPA 1F0TA 2BY8X 3MYWA 5DPAA 3EA8A 3AVZA 3SJ8A 2GD4B 2Q6DA 3ODDA 2FOBA 5FXLA 3GS9A 5C5OA 4E7RG 3IG6B 5JBAS 1K9OE 3LH1A 4ABHA 1SGYE 5JB9S 1XX9A 3A8CA 2QXHA 5CHAC 3SBKA 2WV9A 1C1UH 2ZHWH 1LVMA 1RRKA 3MTYA 1V2KT 1FUJA 2F9PA 4I8GA 4DURA 4JZDH 1P57B 4DJZB 4PROA 1KY9A 1YPMH 2Y7XA 3DT0H 5F03A 1Q3XA 1K1LA 2AYWA 3C1KA 2WYGA 2BD3A 1P3CA 1HRTH 1OWJA 3ZVBA 1GI8B 4OS7A 5GIBA 1K22H 5IDKA 3SV7A 1LHCH 1NZQH 2G5VA 8GCHG 1RIWB 4FUFA 2PTCE 4XBDA 2QGRA 1IQJA 1EQ9A 1P9SA 1MTWA 3U98H 3KQEA 3LJOA 3VB5A 1ZJDA 2ZZUH 1PPFE 2PP6A 3JZ1B 1C1MA 4ZKSU 5DP7A 3U69H 2I6QA 1BIOA 4CH2B 2F9NA 1HXEH 3TGJE 1AVXA 1HAIH 1S81A 1UTPA 1G30B 4TSFD 1FAXA 1ZTKA 1Y5UT 1P01A 3S9AA 2ZFRH 2ZF0H 1GJ6A 2Y80A 2BY5X 4CREA 1ZSLA 1S6HA 1UO6A 4ZHLU 1GMHF 1O2RA 1BHXB 3OEHD 1O31A 3SNDA 1MD7A 2DUCA 2ZTXA 4H6SB 1W14U 5ETXA 3H7OA 3UWJH 3ELAH 1KMHB 3M3TA 3PLBA 2G00A 1QBOA 3VEQB 1SFIA 3MH5A 1HXFH 1EKBB 2XBVA 1BRBE 1O3KA 1BBRE 2ZGCA 1ZHPA 1PQ7A 3B9FH 2WINI 5GDSH 5GWZA 4I8HA 1OWIA 3EA9A 2ZHDA 4B2BA 4FVBA 2CGAA 1CSOE 4D8NA 3RXMA 1SQTA 4GVUA 1G3DA 4F48B 1J8AA 2P8OC 3LH3A 1QNJA 2P95A 5E2OA 1TX6A 3L33A 1BTYA 1QHRB 1O35A 3ATMA 1EPTA 3P8NA 1GBKA 3A7VA 1ORFA 1Q31A 1Q2WA 2WHXA 1O39A 1LTOA 1LDTT 1KLJH 5C1UA 1TMBH 1AHTH 4BANB 1GHYH 1UK2A 1G3BA 1UK4A 4Q4LA 5TJXA 3UNRA 3ZZ8A 4ABBA 3MQKC 2KAIA 2RG3A 2GZ8A 1MKXH 4MNVA 5JPMH 1SHYA 1A5GH 1C1PA 2EA3A 3EYDA 1QQ4A 1A5IA 4ABFA 2ZO3H 3EQ0H 2A5IA 1ZTLA 2SGDE 3GOVB 5L6NH 2G55A 1DITH 3OYPA 3KQBA 3P17H 4IS5A 2ZG0H 4Y10E 1GVZA 1HCGA 1TFXA 1XKAC 4E05H 1E37B 2BOHB 3A7XA 5IK2D 2C4FH 3MFJA 1H8DH 2RA0A 5C0UA 1GBAA 4CRAA 1ZTJA 2CN0H 3AAVA 2XC0A 1C1RA 4HGCA 3QK1A 1DWBH 1QQUA 1O2NA 2BY9X 3KQCA 5DN6D 2ZDNA 3UR9A 4BXSA 4X0WU 1WBGB 2ANWA 2O8WA 1CT4E 3SNCA 1HGTH 1PPBH 4ZROA 1UVOA 4VGCB 2XXLA 2VGCB 1SGTA 2Z9LA 1HAOH 3TJVA 4Z0KA 1RJXB 2XBWA 2J9NA 3GYMA 5EPYA 4ACAA 2KZ4A 1O5FH 3W95A 8ESTE 2EEKA 1WU1A 1DOJA 1T8OA 2HLCA 2BD9A 3LPRA 5F8ZA 3H7TA 5KEDA 3CNRA 1RS0A 4H42U 4TY6A 2PKSB 1P2NA 1AB9B 2ZEBA 5E2PA 1S5SA 2QN5T 1O2WA 1KYNA 4YTAA 5A2MH 3RP2A 3ZZ3A 3ATKA 2OUAA 2IPHA 3SJ9A 2CMYA 5EIYA 3HPTB 3I29A 1ZGVA 2H5DA 3RXDA 1IHSH 2UUYA 1NY22 1XUKA 2GV6A 1O0DH 4ISHH 2XNIA 4RSPA 4YT7H 2BQ6B 3QZQA 5TCAA 4D7GA 2VIPA 4NG9H 4NSYA 1QCPA 3E16B 5C1XA 3MO6A 6CHAB 1EZSC 5B6OA 1ELFA 5K0HA 2QV1A 2HGTH 1Y5BT 4HG6A 2BDBA 2QA9E 4BTTB 1OYTH 4BTIB 1FN8A 3FKSD 1ESBA 1WDIA 4FUEA 1F5KU 3SNEA 3ZYDA 2XOKD 4YXWD 1S85A 1O5DH 1C2DA 3QWCH 1GBFA 4DVAU 3FP8E 1EX3A 3ESTA 1RIWC 3FO8D 2K8IA 1ELVA 1MAXA 3HKJB 2Z3EA 3BG8A 3SUEA 3ZZ5A 3DFJA 4OS4A 1TB6H 1S0QA 4BAOB 2VWLA 1P06A 3LGIA 4FXGH 4FU8A 5T6DA 1F0SA 6CHAC 3RMOH 1RXPA 1TNLA 1G37A 3O8CA 4Y11E 5EW2H 3A8BA 1LCYA 1NC6A 2QF0A 2KCYA 3AW0A 4Y0YE 3TLOA 1GBIA 1MTNB 3GY3A 1C5TA 1PQAA 3SN8A 1LQDB 4WXIA 2SGAA 2PWXA 1S82A 4CRGA 3GCOA 1DSTA 1OYQA 2PHBA 3V0XA 2CHAB 2A2QH 4UONA 1N6YA 1H9HE 3MU1A 1F92A 1GJAB 3Q77A 1GI7B 5EXMA 1CO7E 2KX4A 1LVYA 3UUZA 3A83A 3SU5A 1FY5A 1YCPK 1Y8TA 3OX7U 3GCNA 2ZU2A 1XUGA 1VCQA 1NO9H 1TYNA 1EJMA 2BLWA 2BQWB 2H9TH 2QCYA 5BRRE 3SHAH 1SGEE 1NESE 3NRLA 1GVLA 2SGQE 2ZGXH 3OTPA 1QL7A 1SHHB 1O2YA 1VGCB 4Q63A 4ZAEA 1GBBA 1TA2A 1OOKB 1OXGA 1SC8U 2O8MA 2JKHA 1C1NA 1C1SA 1EP5A 1FY8E 2BY7X 4NA9H 1C5LH 1IHTH 2UUFB 4X8UH 1C5VA 1ZMJA 4K60A 4NWKA 5IYTA 1P04A 2R9PA 3T28A 1AQ7A 3UOPA 1C5SA 3A86A 2ANKH 1S0RA 5FCKA 4GHQA 4XDEA 1TX8A 3ZZBA 3F2FA 5HKKD 1SG8B 1UTOA 1P2KA 3M5OA 3A80A 1UCYH 4FOUC 4ABAA 2IN2A 2YMSB 1C9TA 3BTHE 1F5LA 1CT0E 1UW7A 2C90B 1QURH 1QJ1B 4WVPE 1BTWA 2OXSA 4FUHA 5ESTE 3P95A 1A61H 4I32A 3SU3A 1OKXA 1O33A 1PPEE 2W3IA 2VVCA 1PQ8A 2A4OA 2PR3A 3WW7A 1ESTA 1E36B 2UUJB 1QY6A 1GBTA 3M7TA 1VITF 3S7HB 5FX5A 3CS7A 2V7QD 1O2ZA 2PKAB 4AOQA 3E91A 2FP7B 1P10A 2Q6FA 1GMCF 2XNDD 6GCHF 4BAHB 4Q7YA 1TIOA 1LKAA 1L1JA 1O2HA 1YLNA 3AK5A 3MWIU 3FANA 1EXFA 2WPIS 1TBZH 2ZTZA 4Q7ZA 4FUBA 1DWCH 1GJCB 3OSYA 3MHWU 1GCTB 1E0FD 1TX7A 2RA3A 1NFWA 1XUFA 2P3TB 3W94A 1J15A 2C8WB 4NIXA 3RXIA 4FUIA 3RC5A 3T62A 3A89A 3P6ZB 3UR6A 1YPGH 3OE7D 2GGVB 2A32A 2WPHS 1YKTA 1GI5A 1GI2A 2PUXB 4M9FA 1A3EH 2ALVA 1MTNC 1HYLA 4UD9H 1SQRA 5EJZA 2Y82A 3V12A 3S9CA 1L0ZA 1CU1A 3ITIA 4A92A 1RTLA 1G3CA 1OWHA 2Z9IA 3NKKA 2D8WA 4JZEH 1V2JT 2QY0B 2QC2A 1TABE 1UVUH 5BPEA 1CGJE 4Q7XA 3EE7A 1NPMA 3GCTF 1DUAA 2CF9H 1O3CA 2HOBA 1L4DA 2AERH 2BQ7B 1GJBB 2F9OA 1H9LB 3EA7A 4O3TA 1A7SA 1SMFE 3WWFA 2G8TA 1N8OC 2AGEX 1LQEA 3LONA 3F9EA 1GHBG 2A5KA 1TPSA 4RKJB 4XE4A 4ZXXH 4RI0A 1V2UT 1C1VH 1FQ3A 2GDDA 1DLEA 1VCWA 1NS3A 1WOFA 3PWBA 1O2XA 3LGYA 1F0RA 2KM0A 4ZMAH 3SV8A 1SB1H 2F3CE 1MQ6A 1H8ED 1W0YH 1F2SE 3BTFE 1ELBA 4Y79A 3RLWH 1MABB 3E1XB 3RXFA 5DP5A 3ZIAD 3GCHC 3PMAB 4OS6A 2FEQH 2ULLA 1C5NH 3L3TA 1FY1A 1WV7H 3SU6A 1SI5H 1OWDA 3MU0A 1X7AC 4B75A 3PLPA 2W6JD 2C8XB 4ASHA 3F6UH 1O2UA 1C1WH 1GJDB 1TONA 1Y3WA 3UWIA 7GCHG 2HNTC 2PKSC 1JWTA 4J2YB 4QT8C 3DD2H 2GCTC 1GDUA 1UVPA 2J92A 2A7HA 2JH5D 4GLYA 1NROH 3VPKA 1TWXB 4LK4A 3RC6A 1O3DA 1AVGH 5EJ1A 5EXNA 2F91A 1O5GH 3MMGA 1D3DB 1VITH 2J98B 1K21H 2OQ5A 1GI9B 1C1QA 1C5QA 1MD8A 1SGFG 3FP7E 5T6GA 2FYRA 1D3QB 1W3CA 1BTUA 1O2QA 5A09A 1YPEH 1W11U 5E8EH 2KFWA 3RXUA 2V3MA 5EOKA 4XRNA 3UB0A 1AUTC 4CHAC 6GCHG 1D6RA 3Q3YA 2ZIQH 2XCFA 3UQVA 1IQIA 4A1XA 3GY6A 1TGBA 1BOQA 1D9IA 3A8AA 1NT1A 1SLWB 2VINA 1SVPA 4K3JA 3TJNA 4IN2A 1HAHH 3RXKA 3WY8A 4IMQA 1SKYE 1P8VC 3F9GA 5EQQA 1BTXA 2TBSA 1C2MA 1DUEA 1OWEA 1PFXC 4YESB 2BDAA 5FCRA 3AW1A 1GI1A 3ZVFA 3ZZAA 1O2OA 4KTSA 4X2WA 5FL7D 2WZQA 3P8GA 2OCVB 3RXVA 1W2KH 3KYGA 3MH4A 3TITA 1BMNH 3T26A 1SGFA 1C5UA 1GG6C 3OFND 2ZFPH 5HIZA 2EI6A 1THPB 5EGMA 4CRBA 1IOEA 2ZTYA 5A8YA 4OS2A 3ENSB 3TJUA 1GI3A 1PPZA 3MI4A 1MZDA 2F9UA 4GSOA 5FBEA 5FX6A 1DX5M 1NRQH 2GDEH 3M7UA 3PROA 1SQAA 3CS0A 1EASA 4ISLA 2W7SA 4DT7B 2JETC 2ZKSA 2XC4A 3KL6A 8KME2 1QZ8A 3PWCA 2FS8A 2AMQA 3KGPA 1Y3XA 2XC5A 3LGUA 1A0LA 5DG6A 2ZC9H 4MPVA 2TPIZ 3RDZA 1JRTA 1HV7A 3LT3A 3N99A 1TMTH 2J95A 1O2PA 5DO4H 1YGCH 1GGDB 1ZSJA 4B6EA 3U28C 4TPIZ 1OX1A 2AH4X 1THSH 4CBNA 4MQAA 4AYYB 1T4UH 2ZWLH 3BTTE 1B0FA 2R3YA 3T5FH 1QIXB 2BX3A 4XD7D 1YCPM 4A7IB 5C17A 1BTHH 1QL9A 1T8LA 1EAUA 1PPHE 1WTGH 3T25A 1ANCA 3UAIC 3NPSA 5FPTA 1P0SH 5TCCA 4BOHA 1O2KA 2PGQB 1G2LA 2A31A 4GAWA 1NRSH 2ASUB 1BRUP 2V3HH 2HNTE 1GMDF 1SL3A 4JYUH 4Y8XA 2BB4A 4HFPB 4U01A 2GVFA 3D23A 5GJ4B 1EB2A 3SGAE 2SGFE 2ZFQH 3MNSA 4Z6AH 1DICA 3A87A 4B2CA 5CMXH 1SQOA 3MH6A 4JCNA 1ZMNA 2OC0A 3C27B 3O8DA 3SO3A 1DDJA 1ELTA 1OP8A 2EQNA 2GMTB 1C5YB 3BG4B 2Z9JA 4U2WA 1Z6JH 1GCTC 1SGRE 1EB1H 3KQ5A 1WQSA 1XMNB 3NWUA 3HGNA 1KSNA 3QGNB 3T27A 2QF3A 2Y81A 1AKSB 3UOUA 1G3EA 1ARCA 1GCDA 3K9XB 1NFYA 1BRCE 2WPMS 1QA0A 3L6PA 1EOLA 5A0AE 5AFYH 1NRRH 3I78A 5JYIA 2G52A 1A0HB 1LPZB 1O3JA 4ESTE 3UPEA 4D9RA 2V35A 2ZNKH 2VIWA 3TPIZ 3FAOA 3MO3A 4ZKNU 2F4LA 1L1NA 1HJ9A 4Y71A 1SFQB 2VIDA 3I77A 1O3PB 2ZFFH 3PRBA 1CE5A 2BD8A 2O8TA 1ANBA 3A82A 1RTFB 1GI0A 2R0KA 4WMFA 1AE8H 3RLYH 1UCYE 2F83A 1INCA 3U1IB 4O03A 1AFQB 2VU8E 3PRDA 5DP3A 1VR1H 3RMMH 2TGAA 2KCAA 1TLDA 3SOSA 3UTUH 4U30A 2ZCKP 3SQHE 3QUMP 3NCLA 3MNXA 1QRZA 1C2KA 2FI4E 2VBCA 1VKYA 2QXJA 5HXFA 1KXCA 5FHTA 4RT0A 3SQEE 1FIZA 1GDNA 3E3TA 1YLDA 3STJA 2SGEE 1L2EA 2BVRH 1RGQA 5JB8S 1OSSA 1IQHA 5C67A 5DK1A 1IQLA 1PYTC 1J17T 2Z94A 1DFPA 2A4RA 2VNTA 1GHAF 1COWD 3OEED 3P70B 1DS2E 4F4OC 1C2GA 1ZYOA 1TAWA 1WAYB 6ESTA 3PV2A 1GHZA 1AFQC 3RU4E 2BDYA 2EY4C 3PMBB 3BTME 4SGAE 4ZUHA 9LPRA 2NU3E 3PM3A 3UNQA 1MTVA 1QRWA 4JMYA 3R3GB 1C2JA 1P2JA 5E0HA 2W3KA 4AX9H 2OC8A 2FOMB 4K1EA 2YOLA 1T8NA 3OU0A 5EQSA 3PYHA 1FDPA 1SLUB 4ZHAA 4ISIH 1FXYA 4WMEA 1UCYK 3M5LA 4ISOA 1FY4A 3LGTA 1GMHG 1EZUC 1V2ST 1YP9A 3HK3B 3BEUA 3STIA 2P16A 2B8OH 1C2EA 3KEEA 1TMUH 3F68H 4JK6A 1BMAA 4X1PU 1KTTB 1TBRH 4KTCA 2A5AA 2OLGA 2ZU1A 2Q1JA 2FTMA 2C8ZB 3E90B 3SJKA 3PTNA 5EODA 5JBBS 5AFZH 1HJAC 3A7YA 2O8UA 2FOCA 3RM2H 1ZPBA 5EJLA 1EP6A 2H1UA 3UY9A 1AI8H 1JIRA 3URDA 1YC0A 1HUTH 3UQOA 2VWOA 4JYVH 1H9IE 2JH6D 3ZZ4A 4INLA 1E79D 1KLIH 4M7GA 1MBMA 1LO6A 1O32A 3ZZCA 3KIDU 1GJ7B 1RD3B 1BT7A 5HM2A 3SYJA 1VITG 5F6MA 1TNKA 3UFAA 2ILNA 2VWNA 4BTUB 1U6QA 1MCVA 1GJ8B 3QTVH 2KCPA 2YNBA 4B74A 1CHGA 5K7RA 4D9QA 1FLEE 1XUHA 3SU1A 3ZVAA 1H8HD 4TPYA 3B23B 3DCLA 1W0JD 4HTCH 2WPDD 1BHXF 4R0IA 3M7QA 1BTPA 1MU6B 3KN2A 5HGGA 2UWPA 4YO9A 1QTFA 4UFEH 5C20A 3ZZ9A 4TWWA 1TA6A 4BXWA 1QB6A 1QR3E 2O8LA 2OBQA 1AGJA 1MQ5A 2Z9KA 1AD8H 1DLKB 2H9EH 3PLKA 4X8VH 1O30A 4ZH8A 1DY9A 1GBCA 1MBQA 3VB3A 1SGIB 5PTPA 2GKVE 1O5CB 5EG4A 3TNSA 2O9QA 5AF9H 1P09A 3URCA 8GCHF 1YY3A 4BAMB 4AB9A 5F53A 1H8IH 1HIAA 1C2FA 4B76A 3VFEA 6LPRA 5AHGH 1T31A 1CT2E 4B6FA 4AFSA 3U9AH 1WYKA 1YM0A 7KMEH 1DM4B 5J4SA 2BDGA 2WPJS 2JJ1D 2SNVA 4NIVA 2VIVA 3NXPA 2HVYB 3Q76A 1KTSB 2C3SA 2ANYA 3ZVEA 1XVOA 1V2QT 5DP9A 2NU1E 2TGDA 2FX6A 2PGBB 2SGPE 2BLVA 2M2AA 1ZRKA 4AC9A 1O34A 2ZDLA 1YLCA 3N7OA 1O5EH 3QO6A 5EW1H 2ZGHA 2A1DB 2F9VA 2J98A 2TIOA 2Z6BD 3GCTG 5C5NA 1ETRH 7ESTE 5DP6A 3JZ2B 1AUJA 1C4U2 4NSVA 4AFZA 2CXVA 1O2SA 5DSFA 3F9FA 4UEHH 1FIWA 1YCPH 2GX4A 3LGWA 4MNXA 3A81A 2FLBH 1P2OA 2FOAA 2FLRH 1C5XB 4KP0A 2BDCA 4DIIH 2J34A 3BTWE 1GBHA 1NFXA 3SZNA 1BRAA 4X2YA 3T29A 4H4FA 3BTQE 1HNEE 3F3BA 1P9UA 1BQYA 3KQDA 4YOIA 4CR9A 5ABWA 3GDSA 3KF2A 1ABIH 3F2GA 1ETSH 1ELDE 2ZPQA 1DY8A 5DP4A 1NN6A 5C2ZA 2HWLB 1HIAB 4TY7A 3M5NA 4NGAH 3F2HA 4INHA 2AIQA 3ZVDA 1ZSKA 5FAHA 4NFFA 1WCZA 4ABIA 2ZU3A 2GCTB 1GMDG 1ABJH 3BTKE 1QGFA 1GMCG 3V13A 1MU8B 3ZZ7A 3WWBA 2CHAC 1BDAA 1A2CH 3ZV9A 1T8MA 1GHAG 1V2MT 1EAIA 1HBTH 1SLXB 1UVSH 1AFEH 1G9IE 2BLOA 1F5RA 3GCHB 2Z3CA 1UK3A 3K65B 1GHVH 2P3UB 3GY7A 2QAAA 4LXBH 3RM0H 3E6PH 2BXUH 2BHGA 4ABGA 1GHWH 1C5OH 3VXEH 4I7YH 4Y6DA 3S69A 4Q2KA 3SU4A 1TNHA 1AWHB 5DP8A 2QXIA 1ELAA 3MH7A 2TGTA 1ZPCA 2TRMA 3E8LA 1LHGH 2LELA 4IGDA 4P00A 3RXRA 3HATH 2D1JA 3MNBA 1Z8IB 5EQRA 2FDAA 2GCHF 1HAGE 2R3UA 2RCEA 3EE0B 1O5BB 1T7CA 3M3VA 2PTNA 3GY2A 2L6OA 5HYOA 1YPJH 3M61U 2A45B 2ESTE 3FOAA 5GCHG 5GCHF 1P2MA 1DPOA 4MG3A 1YF4A 4CHAB 1S84A 3OAAD 4UFGH 1S6LA 5J4QA 4OM9A 1SOTA 2A0QB 4IN1A 3DA9B 2IPQX 1B5GH 3G01A 2Q6GA 2YMSD 4XOJA 1O38A 3DFLA 2THFB 1ZJKA 1F0UA 2ZQ2A 1AVWA 7GCHF 4BAQB 3SV6A 2GV7A 1TNJA 4X6MA 3KCGH 3OY5U 3U1JB 4LZ4B 1K1JA 1CGIE 1O2MA 3H5CB 5DGJA 2HNTF 2VIOA 4BAKB 2G51A 2XWAA 2KAIB 3RXQA 1ZR0A 3K6ZA 3D65E 4X6OA 2KR7A 4ZCNA 5JDUB 3VB7A 1V2PT 2ODQA 2ZGJA 3UIRA 1O3OA 2R0LA 3Q3KA 2UWOA 3RMLH 2WUCA 8LPRA 2AMDA 4INKA 4E06H 2ZFSA 4MVNA 1C9PA 1TRNA 4O97A 1MH0A 1C4Y2 1EUFA 1FPCH 1GG6B 2I6SA 2ZPRA 2VIQA 1WQVH 4JZFH 3SZEA 4JYTA 1V2RT 3A8DA 1P2QA 3RXPA 1B0EA 1MZAA 1TNIA 3TH4H 2GZ7A 4UE7H 3SNAA 2BM2A 5CE1A 3QGJA 5LGOA 3SJOA 1KLTA 2WV4A 1YPKH 1Z8GA 4DW2U 2VWMA 1CQQA 3GISB 2ZU4A 1W10U 3M37A 5B6LA 4WY3A 2ZGBH 1BMFD 1DANH 1KXEA 4ISNA 1Z71A 1RTKA 4ZKOU 2ZI2H 2ZHEH 1L1GA 2P94A 3LJJA 3BTEE 4ABEA 3PMJA 4AYVB 1CHOF 1O3FA 2IJD1 2BTCE 2HLDD 1KXDA 1LVBA 1ZHRA 4FUJA 4X1NU 3PO1B 1LHFH 1MAYA 4CR5A 5E0GA 2GMTC 1VGCC 2ZDMA 2BMGB 1ELGA 4JZ1A 2OC7A 4GHTA 1GBMA 1O2LA 4D76A 1DWEH 5LH8A 2QF5A 4YLQH 1ZPZA 3V7TA 3K6YA 3U8RH 3ODFA 4TWYA 1BBRK 2Z3DA 3MNCA 1AMHA 4WXVA 5CHBA 1EAXA 4BNRA 2FOHA 3GDUA 1ETTH 4DY7B 2PKAA 4I33A 4I8KA 3QN7A 1V3XA 1GBDA 5EPNA 2W6ID 2B7DH 3TIUA 4I8JA 2PV9B 1ESAA 1TGCA 2WPKS 4X8TH 2OD3B 5T6FA 1BA8B 2AIPA 3QDZB 1P3EA 4CRFA 2A2XH 1EJNA 1HFDA 4TT3D 2OBOA 3CENA 1C5WB 2FESH 1V2WT 5DJ7A 4YM9A 1CBWC 1K1IA 1SGNE 3GYLB 4NZLA 1GBJA 4Y76A 4OGXA 4A6LA 1CBWB 4NFEA 4A5TS 4YOJA 2PFEA 1DT2A 1TE0A 5FPYA 1YPHE 4YT6H 3F0OA 3LIWA 1EOJA 1TPOA 2ZDKA 4Y7BA 4KKDA 4AB8A 1C2LA 1J16A 4LZ1H 1K0HA 3HKIB 1PQ5A 2LPRA 3FZDA 1ARBA 4GCHF 3S9BA 3D62A 4OGYA 3OY6U 3QLPH 5T3HA 1P02A 3ATIA 1G36A 1N1LA 5GPIB 3OTJE 2AGGX 1BZXE 7LPRA 1QB9A 2ZCLP 4DG4A 1Z8RA 2FOEA 1G32B 2BZAA 1TOCB 3VXFH 4MTBA 1EZQA 1JRSA 1UHBA 1LPGB 1LVOA 1O2GH 2PSYA 1ID5H 4NWLA 2P3FH 1YBWA 4A1VA 2XW9A 5F8TA 1A0JA 3TNTA 2J5UA 1V2NT 3CP7A 4O9VA 1QBVH 1IQMA 1HAPH 1AY6H 2BY6X 3IITA 3MU8A 2LNCA 1UTKA 1P12E 2STBE 2Z7FE 3PV4A 2AEIH 2R2WU 2Y6TA 3NZIA 4AFUA 4B2AA 4Y8YA 1MMJN 3FN8A 3SNBA 4ACBA 4LOYH 1FAKH 1O3AA 2BX4A 3A7WA 1NU7B 4YLUA 2BLQA 1SOZA 4K1TA 3TH2H 1G2MA 1GGDC 1CVWH 5HM9A 2DE9A 4I8LA 1XM1A 2B0FA 1VZQH 3PMHB 1W7XH 1W0ZU 3ZVGA 1BUIA 1D3PB 2J2UA 4CH8B 2RDLA 1O2TA 1TGNA 1HDTH 4MNYA 1MCTA 2ZECA 1TPAE 3LC5A 3U8OH 2FX4A 1Y59T 3DUXH 5L2YH 2PUQH 3RU4T 3TU7H 2F43B 1IQNA 1JXPA 1HLTH 3RXLA 1C4V2 4IC5A 1CGHA 4X2XA 3LKWA 1XKBC 2EI7A 3GICB 1SGCA 1C5PA 1GJ4H 1K2I1 1SR5C 4AGKA 4YOGA 1A5HA 5EU8A 1KXFA 1QFKH 1DE7H 2ZA5A 2CF8H 2Y5GA 1J9CH 1SSXA 1UHBB 2A7CA 1ANDA 2L74A 2B5TB 4WH6A 1Y3YA 1VJAU 2ODPA 3TH3H 4F49A 5A8XA 2FI3E 3B8JA 3E0NB 3MO9A 2RFKC 1C5RA 3FFGA 3UREA 1GHBF 5CDFE 3PB1E 5JBCS 2JJ2D 3EDXB 2FS9A 1V2LT 4K5ZA 3SU0A 1MTUA 2VVVA 2G4UA 4UFFH 4XBBA 4B1TA 3KHVA 1MTSA 2KCOA 4XFQA 4MLFB 3ZYEA 3VB6A 1TRYA 4Y8ZA 1S6FA 5LPEA 5I46H 5GXPA 1LKBA 1B7XB 5C94A 1HAZB 2VJ1A 3BG4C 3DSOA 4X2VA 1BCUH 5C0TA 3AAUA 3V3MA 4FUGA 4XBCA 1GPZA 1FN6A 3DSPA 4FETA 2BDIA 5A8ZA 3RXAA 3N7DA 2LP6A 3SUDA 2WSSD 1XXDA 4RN6A 3GY8A 1K1NA 3A85A 1UTMA 3RXBA 2XWBI 1BMMH 3TGKE 4X6NA 1SPJA 3QX5H 1LMWB 4NZQA 2QE7D 4X1SU 2VH0A 3HK6B 3RXEA 3ATWA 4HI3A 2Y5FA 2K0QA 2OC1A 2FO9A 2CK3D 1K1PA 4FU9A 3U8TH 1SGQE 1O3NA 1BBRH 4X8SH 1KDQA 2OTVA
chains in the Genus database with same CATH topology
2VGCC 1Y3VA 4NA8A 2HALA 1XXFA 3TGIE 4AG1A 1D4PB 4K1SA 3SI3H 2W5EA 4FUCA 1FI8A 3BV9B 4GPGA 1EATA 1H1BA 1EAWA 3EGKH 4Q80A 4CBOA 5JBTA 1K1MA 4UFDH 1GL1A 1OPHB 3RUOA 2A7JA 4WWYA 4MNWA 1SGDE 1A46H 4JZIA 2BOKA 2WYJA 1NRPH 1QJ7B 3VGCB 1ACBE 1IQGA 3F1SB 1O3GA 2JH0D 2XCNA 1FPHH 2Z9GA 3E0PB 4DOQA 1EPTC 5G4BA 1ANEA 2PLXA 4VGCC 1FMGA 3BIVH 1Z6EA 2YNAA 3R0FA 1Z8JB 1JBUH 1M9UA 3PO1C 4DIHH 2H6MA 1XUJA 2SNWA 3P8FA 2CV3A 2ZQ1A 1P05A 3LDXH 1V2TT 4MDSA 1THRH 1ZHMA 2R2MB 5I25A 2FM2A 2UUKB 2ZPSA 1A1RA 2ZHQH 4TYDA 1HPGA 1O2JA 5L30H 4IC6A 1Y3UA 2Y5HA 4KELA 2ODYB 3M5MA 1S83A 3M36A 3VGCC 1UVTH 1Z7KA 1MKXK 1GL0E 5A0BA 1FNIA 4E7NA 4YZUA 4ABDA 1EPTB 2ZU5A 1TGSZ 3ZV8A 4AORA 2ZFTA 2K1QA 2STAE 1HAVB 1TPPA 3ATLA 3FVFB 2XRCA 2ZDAH 4R8TB 4FVDA 2FIRH 1BMLA 1BITA 1QRXA 2XTTB 1YPLH 3RXOA 1HAYB 1KXAA 2C8YB 2XBXA 5AVDA 4OS5A 2SFAA 3LC3A 1WTHD 3O8RA 4MPXA 1MUEB 1LHDH 3LGVA 1BTZA 3RC4A 1IQKA 4ZHMU 3TK5A 2VB0A 2OQUA 5L2ZH 2NU0E 4NIWA 4K69A 3ZZDA 2QYIA 1ELCA 1H4WA 2ANMH 2IJOB 2XYAA 3BTGE 2PW8H 5F8XA 4X6PA 3SU2A 1PYTD 3SV2H 2WPLS 2XBYA 2BDHA 3A88A 3GY4A 4O3UA 2NWNA 5EXLA 1V6DA 1K28D 1QB1A 3BIUH 1SGPE 1NRNH 4I31A 1P11E 2J94A 1HAVA 1KXBA 2FODA 1HB0B 4KTUA 2BVXH 2FWWA 4H6TA 3RMNH 9ESTA 1A3BH 1DVAH 2FXRA 2FI5E 3SHCH 1NTPA 4AN7A 5LPFA 2D2DA 4X1RU 2FMJA 1OP0A 1E35B 2VVUA 2H2ZA 3HGPA 1GBLA 5ESBA 1ZLRA 5CHAB 1EJAA 1VCPA 3LOXA 4FU7A 2AGIX 1GVKB 5E0JA 4THNH 4WJG2 2P59A 2HRVA 1E38B 4AZ2B 3M3SA 3SV9A 1C5MD 2GT7A 2UWLA 1AU8A 1GHXH 1GI4A 1BJUA 3O8BA 3Q00A 3AASA 3BEFB 4UDWH 3RXJA 1KIGH 3IWMA 4XSKU 4DGJA 1HAXB 1AIXH 2WUBA 1WSSH 1K1OA 1GWAA 4NA7A 1C1OA 2GP9B 1FV9A 2EI8A 2TGPZ 2GT8A 2AMPA 1F7ZA 4ZXYH 2FZZA 2P8OB 5H4IB 3GY5A 2CJIA 1ZRBA 4K2YA 5SGAE 1AZZA 2DE8A 2J38A 1V2VT 1W8BH 2D26C 1NM6A 2V6NA 1UTLM 1QL8A 1MKWK 4A1TA 5C3NA 1QJ6B 2A4GA 2AFQB 2HPPH 5HMAA 1TRMA 4SGBE 1FONA 3RXCA 4K8YA 1XVMA 3UNSA 2ALPA 1W7GH 3MU5A 2GTBA 4CRCA 4IBLH 1AZ8A 1PPGE 2HPQH 2WV5A 1UTJA 5LPRA 2EC9H 1KDQB 1YYY1 2BZ6H 2P93A 1C2HA 2G4TA 4WMDA 5C1YA 1EZXC 3PTBA 3EAJA 1O37A 3SW2B 1DSUA 1VJ9U 2FYQA 3T2NA 4AGJA 3SGBE 3BTDE 3D49H 1GI6A 1GJ5H 1O5AB 5FPSA 4OS1A 1BJVA 1LHEH 3KNXA 4D7FA 3A7TA 4WH8A 1GBEA 4NCYA 4ZKRU 1P03A 2A4QA 4AG2A 4K8BA 3RXTA 3Q3XA 2Y7ZA 3ZVCA 1HJAB 1AE5A 2HVXA 1D3TB 1NU9A 3LU9B 1C1TA 4FUDA 2C93B 1Z1IA 1DXWA 3GDVA 4DCDA 4WF8A 2FTLE 3BN9A 1OWKA 1O3LA 1QA7A 1CHOG 2QIQA 2B9LA 3DHKH 3MU4A 2ZHFH 2PSXA 1AN1E 2BD7A 2G5NA 1MKWH 2FOFA 3A84A 4CRDA 1AB9C 3K2UA 1V2OT 2W7UA 3A7ZA 3P8OA 1GJ9B 1C2IA 1ZGIA 1CA8B 3FP6E 1A4WH 1BB0B 1SBWA 1JIMA 3M35A 1TOMH 3SORA 4GCHG 2G81E 2M5TA 3TJOA 1WUNH 3SI4H 1XUIA 1O3HA 4B71A 1AO5A 2QXGA 1N8OB 1Z1JA 1O3IA 1O2VA 3RXSA 3S0NA 4JK5A 3BSQA 2FPZA 1FZZA 2GCHG 3SUGA 1JMOH 1TQ0B 1LPKB 1J14A 1TBQH 4B73A 2BD5A 1TNGA 3SGQE 1JOUB 3VB4A 3RU4D 2BYAX 1DXPA 4HZHA 3TVJB 1OS8A 3RXHA 1OP2A 2W26A 1O36A 1UJ1A 1DWDH 1ELEE 2OP9A 3ZZ6A 3QTOH 1HJ8A 2NU4E 3F9HA 1RFNA 3RXGA 4RKOB 1ZMLA 3P92A 1IQEA 1YPHC 1W13U 1ZOMA 3TK6A 2BD2A 1O3MA 4KGAA 2BD4A 3QZRA 4MPWA 2NU2E 4ABJA 1L4ZA 3NUMA 2JETB 3TK9A 1IAUA 3S7KB 4Y7AA 4IW4E 2OINA 1O3BA 1IQFA 1N6XA 2IOTA 1E34B 2H5CA 1C5ZB 4NIYA 1PPCE 4X1QU 2GZ9A 2ZDVH 1UTNA 2ZCHP 1O3EA 4GUXA 2BXTH 2F9BH 1ZZZA 1TGTA 2ZP0H 1FJSA 1D6WA 1P2IA 2V0BA 3MOCA 4MPUA 1AWFH 1CA0B 2V3OH 1O2IA 4J1YA 4U32A 1T32A 3FZZA 2J4IA 4Y0ZE 1AKSA 1T4VH 1CA0C 1FY3A 2H9HA 1SLVB 3BF6H 2VH6A 4AFQA 3SJIA 1NFUA 3SUFA 1GDQA 1TALA 1QBNA 1W12U 2BVSH 3BEIB 2AS9A 3NK8A 5A0CA 5DKMA 5FBIA 1UMAH 1TQ7B 2FOGA 4IMZA 1UTQA 1Y5AT 1PJPA 1F0TA 2BY8X 3MYWA 5DPAA 3EA8A 3AVZA 3SJ8A 2GD4B 2Q6DA 3ODDA 2FOBA 5FXLA 5C5OA 4E7RG 3IG6B 5JBAS 1K9OE 3LH1A 4ABHA 1SGYE 5JB9S 1XX9A 3A8CA 2QXHA 5CHAC 3SBKA 1C1UH 2ZHWH 1LVMA 1RRKA 3MTYA 1V2KT 1FUJA 2F9PA 4I8GA 4DURA 4JZDH 1P57B 4DJZB 4PROA 1KY9A 1YPMH 2Y7XA 3DT0H 5F03A 1Q3XA 1K1LA 2AYWA 3C1KA 2WYGA 2BD3A 1P3CA 1HRTH 1OWJA 3ZVBA 1GI8B 4OS7A 5GIBA 1K22H 5IDKA 3SV7A 1LHCH 1NZQH 2G5VA 8GCHG 1RIWB 4FUFA 2PTCE 4XBDA 2QGRA 1IQJA 1EQ9A 1P9SA 1MTWA 3U98H 3KQEA 3LJOA 3VB5A 1ZJDA 2ZZUH 1PPFE 3JZ1B 1C1MA 4ZKSU 5DP7A 3U69H 2I6QA 1BIOA 4CH2B 2F9NA 1HXEH 3TGJE 1AVXA 1HAIH 1S81A 1UTPA 1G30B 1FAXA 1ZTKA 1Y5UT 1P01A 3S9AA 2ZFRH 2ZF0H 1GJ6A 2Y80A 2BY5X 4CREA 1ZSLA 1S6HA 1UO6A 4ZHLU 1GMHF 1O2RA 1BHXB 1O31A 3SNDA 1MD7A 2DUCA 2ZTXA 4H6SB 1W14U 5ETXA 3H7OA 3UWJH 3ELAH 3M3TA 3PLBA 2G00A 1QBOA 3VEQB 1SFIA 3MH5A 1HXFH 1EKBB 2XBVA 1BRBE 1O3KA 1BBRE 2ZGCA 1ZHPA 1PQ7A 3B9FH 2WINI 5GDSH 5GWZA 4I8HA 1OWIA 3EA9A 2ZHDA 4B2BA 4FVBA 2CGAA 1CSOE 4D8NA 3RXMA 1SQTA 4GVUA 1G3DA 1J8AA 2P8OC 3LH3A 1QNJA 2P95A 5E2OA 1TX6A 3L33A 1BTYA 1QHRB 1O35A 3ATMA 1EPTA 3P8NA 1GBKA 3A7VA 1ORFA 1Q31A 1Q2WA 1O39A 1LTOA 1LDTT 1KLJH 5C1UA 1TMBH 1AHTH 4BANB 1GHYH 1UK2A 1G3BA 1UK4A 5TJXA 3UNRA 3ZZ8A 4ABBA 2KAIA 2RG3A 2GZ8A 1MKXH 4MNVA 5JPMH 1SHYA 1A5GH 1C1PA 2EA3A 3EYDA 1QQ4A 1A5IA 4ABFA 2ZO3H 3EQ0H 2A5IA 1ZTLA 2SGDE 3GOVB 5L6NH 2G55A 1DITH 3OYPA 3KQBA 3P17H 4IS5A 2ZG0H 4Y10E 1GVZA 1HCGA 1TFXA 1XKAC 4E05H 1E37B 2BOHB 3A7XA 2C4FH 3MFJA 1H8DH 2RA0A 1GBAA 4CRAA 1ZTJA 2CN0H 3AAVA 2XC0A 1C1RA 4HGCA 3QK1A 1DWBH 1QQUA 1O2NA 2BY9X 3KQCA 2ZDNA 3UR9A 4BXSA 4X0WU 1WBGB 2ANWA 2O8WA 1CT4E 3SNCA 1HGTH 1PPBH 4ZROA 1UVOA 4VGCB 2XXLA 2VGCB 1SGTA 2Z9LA 1HAOH 3TJVA 4Z0KA 1RJXB 2XBWA 2J9NA 3GYMA 5EPYA 1O5FH 3W95A 8ESTE 2EEKA 1WU1A 1DOJA 1T8OA 2HLCA 2BD9A 3LPRA 5F8ZA 3H7TA 1RS0A 4H42U 4TY6A 2PKSB 1P2NA 1AB9B 2ZEBA 5E2PA 1S5SA 2QN5T 1O2WA 1KYNA 4YTAA 5A2MH 3RP2A 3ZZ3A 3ATKA 2OUAA 2IPHA 3SJ9A 2CMYA 3HPTB 3I29A 1ZGVA 2H5DA 3RXDA 1IHSH 2UUYA 1NY22 1XUKA 2GV6A 1O0DH 4ISHH 2XNIA 4RSPA 4YT7H 2BQ6B 3QZQA 5TCAA 4D7GA 2VIPA 4NG9H 4NSYA 1QCPA 3E16B 5C1XA 3MO6A 6CHAB 1EZSC 5B6OA 1ELFA 5K0HA 2QV1A 2HGTH 1Y5BT 2BDBA 2QA9E 4BTTB 1OYTH 4BTIB 1FN8A 1ESBA 3SNEA 4FUEA 1F5KU 3ZYDA 1S85A 1O5DH 1C2DA 3QWCH 1GBFA 4DVAU 3FP8E 1EX3A 3ESTA 1RIWC 1ELVA 1MAXA 3HKJB 2Z3EA 3BG8A 3SUEA 3ZZ5A 3DFJA 4OS4A 1TB6H 1S0QA 4BAOB 2VWLA 1P06A 3LGIA 4FXGH 4FU8A 5T6DA 1F0SA 6CHAC 3RMOH 1RXPA 1TNLA 1G37A 3O8CA 4Y11E 5EW2H 3A8BA 1LCYA 1NC6A 2QF0A 4Y0YE 3AW0A 3TLOA 1GBIA 1MTNB 3GY3A 1C5TA 1PQAA 3SN8A 1LQDB 4WXIA 2SGAA 2PWXA 1S82A 4CRGA 3GCOA 1DSTA 1OYQA 2PHBA 3V0XA 2CHAB 2A2QH 4UONA 1N6YA 1H9HE 3MU1A 1F92A 1GJAB 3Q77A 1GI7B 5EXMA 1CO7E 1LVYA 3UUZA 3A83A 3SU5A 1FY5A 1YCPK 1Y8TA 3OX7U 3GCNA 2ZU2A 1XUGA 1VCQA 1NO9H 1TYNA 1EJMA 2BLWA 2BQWB 2H9TH 2QCYA 5BRRE 3SHAH 1SGEE 1NESE 1GVLA 2SGQE 2ZGXH 1QL7A 1SHHB 1O2YA 1VGCB 4ZAEA 1GBBA 1TA2A 1OOKB 1OXGA 1SC8U 2O8MA 2JKHA 1C1NA 1C1SA 1EP5A 1FY8E 2BY7X 4NA9H 1C5LH 1IHTH 2UUFB 4X8UH 1C5VA 1ZMJA 4K60A 4NWKA 5IYTA 1P04A 2R9PA 3T28A 1AQ7A 3UOPA 1C5SA 3A86A 2ANKH 1S0RA 5FCKA 4GHQA 4XDEA 1TX8A 3ZZBA 1SG8B 1UTOA 1P2KA 3M5OA 3A80A 1UCYH 4ABAA 2IN2A 1C9TA 3BTHE 1F5LA 1CT0E 2C90B 1QURH 1QJ1B 4WVPE 1BTWA 2OXSA 4FUHA 5ESTE 3P95A 1A61H 4I32A 3SU3A 1OKXA 1O33A 1PPEE 2W3IA 2VVCA 1PQ8A 2A4OA 2PR3A 1ESTA 1E36B 2UUJB 1QY6A 1GBTA 3M7TA 1VITF 3S7HB 5FX5A 3CS7A 1O2ZA 2PKAB 4AOQA 3E91A 2FP7B 1P10A 2Q6FA 1GMCF 6GCHF 4BAHB 4Q7YA 1TIOA 1LKAA 1L1JA 1O2HA 3MWIU 3FANA 1EXFA 2WPIS 1TBZH 2ZTZA 4Q7ZA 4FUBA 1DWCH 1GJCB 3OSYA 3MHWU 1GCTB 1E0FD 1TX7A 2RA3A 1NFWA 1XUFA 2P3TB 3W94A 1J15A 2C8WB 4NIXA 3RXIA 4FUIA 3RC5A 3T62A 3A89A 3P6ZB 3UR6A 1YPGH 2GGVB 2A32A 2WPHS 1YKTA 1GI5A 1GI2A 2PUXB 1A3EH 2ALVA 1MTNC 1HYLA 4UD9H 2Y82A 3V12A 3S9CA 1L0ZA 1CU1A 3ITIA 4A92A 1RTLA 1G3CA 1OWHA 2Z9IA 3NKKA 2D8WA 4JZEH 1V2JT 2QY0B 2QC2A 1TABE 1UVUH 5BPEA 1CGJE 4Q7XA 1NPMA 3GCTF 1DUAA 2CF9H 1O3CA 2HOBA 1L4DA 2AERH 2BQ7B 1GJBB 2F9OA 1H9LB 3EA7A 4O3TA 1A7SA 1SMFE 2G8TA 1N8OC 2AGEX 1LQEA 3LONA 3F9EA 1GHBG 2A5KA 1TPSA 4RKJB 4XE4A 4ZXXH 1V2UT 1C1VH 1FQ3A 2GDDA 1DLEA 1VCWA 1NS3A 1WOFA 3PWBA 1O2XA 3LGYA 1F0RA 4ZMAH 3SV8A 1SB1H 2F3CE 1MQ6A 1W0YH 1F2SE 3BTFE 1ELBA 4Y79A 3RLWH 3E1XB 3RXFA 5DP5A 3GCHC 3PMAB 4OS6A 2FEQH 2ULLA 1C5NH 3L3TA 1FY1A 1WV7H 3SU6A 1SI5H 1OWDA 3MU0A 1X7AC 4B75A 3PLPA 2C8XB 4ASHA 3F6UH 1O2UA 1C1WH 1GJDB 1TONA 1Y3WA 3UWIA 7GCHG 2HNTC 2PKSC 1JWTA 4J2YB 4QT8C 3DD2H 2GCTC 1GDUA 1UVPA 2J92A 2A7HA 2JH5D 4GLYA 1NROH