1KDQA

Crystal structure analysis of the mutant s189d rat chymotrypsin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
130
structure length
130
Chain Sequence
VNGEDAIPGSWPWQVSLQDKTGFHFCGGSLISEDWVVTAAHCGVKTSDVVVAGEFDQGSDEENIQVLKIAQVFKNPKFNMFTVRNDITLLKLATPAQFSETVSAVSLPNVDDDFPPGTVCATTGWGKTKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHYMOTRYPSIN B, B CHAIN
publication title Three Dimensional Structures of S189D Chymotrypsin and D189S Trypsin Mutants: The Effect of Polarity at Site 189 on a Protease-specific Stabilization of the Substrate-binding Site
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 14
structure length 130
sequence length 130
ec nomenclature ec 3.4.21.1: Chymotrypsin.
pdb deposition date 2001-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1kdqA00
2K1QA 1WU1A 2H1UA 1M9UA 1GBKA 1IQHA 4XBBA 1BQYA 3A8BA 3TJNA 2BX3A 4NFFA 1TOMH 1DWEH 5FPYA 1TPPA 2UWPA 4ASHA 5LGOA 1ZTLA 1EAWA 3MNBA 1O2OA 3Q76A 4RN6A 6CHAB 1C5ZB 5A0AE 3D23A 3FP6E 4K8BA 1Q2WA 5LPEA 1SGDE 1HAVA 3BTEE 1MTNB 4B2AA 4IW4E 3PV4A 1P3CA 3VFEA 1CE5A 3U8RH 3PTBA 1E36B 1C5XB 2A5IA 2JETB 3RXOA 4YT6H 1MZAA 2ASUB 2FI4E 2CHAB 1MCVA 2A7CA 5HM2A 2UWLA 1GGDC 2AS9A 1SGFG 5EXLA 1O5BB 1SGRE 1C5LH 1YC0A 2O8WA 2C3SA 4IBLH 1QB9A 2VJ1A 3RC5A 1OS8A 1MTVA 2WV5A 4KTSA 1TNKA 5IDKA 1SC8U 4K2YA 2P95A 3RXSA 1OOKB 1ZSKA 3ZVGA 3UQOA 1DVAH 1UTJA 1PQ5A 2FPZA 1SLWB 1XM1A 2D2DA 2JH0D 1OWHA 1Y59T 4MPWA 2QXGA 2R2WU 4Y8XA 5AF9H 1FY4A 2QAAA 4HFPB 1Z8RA 1MU6B 3NUMA 2ZDAH 1CVWH 3TU7H 2FMJA 3ESTA 1O3AA 1BZXE 5C67A 2B8OH 1ZSLA 3OX7U 3SV7A 3SBKA 5DK1A 1JOUB 2PSXA 3RU4D 4Y10E 2XBYA 3SU3A 4MTBA 4KKDA 2WPMS 3P17H 1Y3WA 4H6SB 2TGTA 4BANB 3NZIA 1O33A 1GJAB 1Y5UT 5GXPA 2A7JA 2R3YA 2H6MA 3TIUA 2Y82A 4AG1A 1LQEA 5A0BA 1Y5AT 2CF9H 2B5TB 3BF6H 3LGVA 3PWBA 2BD5A 1ZSJA 1RXPA 1QNJA 5T3HA 3QDZB 1UCYH 3VGCC 5L2ZH 2GT7A 1EXFA 1IQFA 2BB4A 2FI3E 3I78A 3UY9A 1C2LA 4B2BA 3MH5A 4YOIA 1DXWA 1UO6A 2V6NA 1BTYA 1HIAA 7LPRA 1SGTA 2W7SA 1AQ7A 1Y3XA 1W12U 2BDCA 5DPAA 3Q00A 2ZHDA 1C1TA 4JK5A 1BTZA 2FWWA 2IOTA 4ZMAH 3A80A 7ESTE 2H5DA 5LPRA 1TX8A 1EP6A 1O5FH 4WXIA 4Y0ZE 1ANDA 4DIHH 1G32B 2QF0A 2ZDLA 1GBHA 5ESBA 4YZUA 3TPIZ 3IG6B 3PWCA 1AVGH 2G8TA 4CR5A 4GUXA 2BDHA 5T6FA 3ZZBA 4D76A 1NY22 2XCFA 2P8OC 2WPLS 2UUJB 1TMUH 4X8VH 3PO1B 3U69H 3A88A 5FX5A 1YCPH 1AUTC 3T62A 3BN9A 2SNWA 2OP9A 5DP5A 2BY5X 2OQ5A 1KXBA 3BTWE 3RXBA 3BTDE 3H5CB 4I8HA 1W7XH 1SGYE 1AKSB 1O5EH 3KN2A 3FFGA 1WBGB 1AU8A 2ZPSA 1IQLA 3ZZCA 4XBDA 3HATH 3U8TH 1C5RA 2GD4B 4XOJA 2GCHF 2V0BA 3RXUA 4NCYA 2Z3DA 4ABHA 3MWIU 1MTSA 1UK4A 2FIRH 1GI2A 1FN6A 1J9CH 1A7SA 1IQIA 1F5LA 4OGYA 1F5KU 3SZNA 2TBSA 1ANBA 1K1PA 3M37A 1BBRK 1QQ4A 2ZA5A 1P2MA 1OPHB 1GJ7B 2ANWA 1T31A 4I8JA 2Y5FA 3F9EA 1BRAA 5EQQA 1S0QA 1DFPA 3HK6B 2VWNA 2SGDE 1FLEE 1GCTB 1A46H 2BTCE 1GVZA 3BG8A 4CRCA 2ZQ2A 3MO9A 1N8OB 2Z3EA 3BG4C 3TVJB 1D3QB 1K1IA 1KLIH 1GHBG 1FIZA 1UTPA 5JBCS 7GCHF 1YPGH 3RXHA 1AKSA 1CGIE 4Y71A 1IAUA 1O2MA 1PPCE 2ZTZA 3CP7A 1CT4E 1UCYK 3UTUH 1NFYA 2CXVA 1LCYA 3DFJA 5A0CA 2QY0B 1CT0E 1OYTH 1UK2A 1CHGA 5PTPA 1O34A 1HXFH 1ZGVA 1ZZZA 4X1NU 1P8VC 1TBRH 4A92A 1GGDB 2XXLA 3E90B 3LC5A 3S7KB 1LPGB 1J16A 1T8OA 2AIPA 2FXRA 2F9VA 3BTHE 4UE7H 1G36A 1GPZA 1GBCA 2GTBA 9ESTA 1EKBB 1ELBA 2PLXA 1GBEA 4D9QA 2FOEA 1S84A 3GY5A 4FU7A 1L4ZA 4DCDA 1V3XA 1N6YA 1HFDA 2ZU5A 2HWLB 1THRH 3SUEA 1YKTA 5GIBA 1V2UT 3SHCH 2A4GA 4BAOB 3QTVH 1UJ1A 1Z1IA 1LQDB 1W3CA 4K60A 1UVSH 1SGCA 4AYYB 5L2YH 1A1RA 1O5CB 3SNCA 1Z6JH 3STIA 4HGCA 4FUBA 3SJKA 2VB0A 4K1SA 3MOCA 4ZHLU 1FN8A 3Q3KA 5FPSA 3OYPA 1GG6B 2EEKA 4Z0KA 4JYUH 3KNXA 2RA0A 3GYLB 4INKA 2AYWA 1O3NA 5A2MH 3GYMA 2R0KA 1YYY1 1E37B 2J92A 2XCNA 4BTUB 2ZHFH 4XFQA 4I8GA 2AEIH 4K69A 4X6OA 4BOHA 3RXVA 3VGCB 1ZYOA 4JK6A 1TLDA 1MTWA 1SLUB 3ZZ7A 1SGQE 1A3EH 2PGQB 1MU8B 1GMCF 2ZKSA 3ZVEA 2Y5GA 1C2KA 3QUMP 3RDZA 9LPRA 5EW2H 2BY6X 2ZFPH 3SN8A 3UNQA 2ANMH 4U32A 3E0NB 4NIYA 4A1TA 2F9PA 3UOUA 2XW9A 1MUEB 3FZZA 2QCYA 1EB1H 3RM0H 1QGFA 1CBWC 3GCHC 3QK1A 1YPLH 1O2ZA 4I8KA 4UD9H 1V2PT 5ETXA 3QTOH 2TRMA 3SHAH 1EASA 1TPOA 2ZFTA 2VVUA 2BDAA 1O2VA 1V6DA 1NN6A 4ZHMU 1O2YA 1GI4A 5E0JA 1SPJA 2A5KA 1V2NT 1EUFA 2OD3B 3SUFA 1VR1H 3A7VA 4XDEA 4PROA 5JPMH 4AGKA 1SHHB 2PV9B 2CJIA 4MNVA 2ODQA 1O31A 2PSYA 2M5TA 4H6TA 4B74A 1GMHF 3S69A 3KIDU 1O2LA 3TJVA 1E34B 3S0NA 1W8BH 4JYTA 5GWZA 3PB1E 1QRZA 2FTMA 3QZRA 1SGFA 3A7ZA 1GJ5H 3HK3B 1NFWA 4WMEA 1G3BA 1HJ9A 1TWXB 1Z8GA 1PPFE 1ZMNA 3GOVB 4NG9H 1JIRA 4WH8A 3GY7A 4XBCA 4Z6AH 3RXCA 2I6SA 3SI4H 3F1SB 5F8XA 1D6RA 4KGAA 1K1OA 4LK4A 1TABE 1NRRH 4FUFA 3GY3A 1D9IA 1L1JA 1GVLA 3GY4A 2A0QB 1LVOA 3M61U 1B0EA 3A7WA 1QB6A 3T29A 4RSPA 1PPGE 1ABIH 2BQ7B 1W0YH 2OC1A 5DP3A 5BPEA 4X8UH 2C8ZB 3A8CA 5EPYA 2FESH 2NU3E 3SNEA 3OTJE 1C4U2 4I31A 3OSYA 2XBVA 2AGIX 1F2SE 3M3VA 2HALA 1W11U 2D8WA 1AN1E 3RLYH 3RM2H 1MCTA 3ODFA 4E06H 1SL3A 2EI6A 3SU2A 2VIDA 2ULLA 4CHAC 1SQOA 2VVCA 3KHVA 2XNIA 4NIWA 2FLRH 2VU8E 2F9BH 1AI8H 2GCHG 4CBOA 1C5OH 3D62A 4OS2A 2A4RA 1SG8B 4ZKRU 2PGBB 1LVBA 2BD9A 1C2IA 1K1JA 2ALPA 1BT7A 3H7TA 5I25A 3T26A 1KYNA 5E2PA 3O8RA 2FOGA 3F9HA 2BDYA 2SFAA 1V2QT 3VB4A 4GHQA 1S85A 1QTFA 1DS2E 1AFQB 2Q6DA 3P8FA 1AO5A 5H4IB 3P8OA 3GDVA 2Z3CA 3ZZDA 1GBLA 1OWDA 1OP8A 3LC3A 1DLEA 1QL7A 1C1NA 1OXGA 1TALA 4AFSA 2SNVA 2WPKS 3A8AA 1O2UA 1TIOA 2Z94A 5F8TA 4FVDA 1A5HA 1MQ6A 1ELVA 1TQ0B 1O3IA 3W95A 8ESTE 2PFEA 5B6OA 2XRCA 3R3GB 3MTYA 2Z9LA 3MU5A 2ANKH 1EP5A 4D9RA 1VCWA 1TBZH 1SLVB 1CGJE 2GZ7A 3VB5A 4F49A 2HNTC 3SU0A 4D8NA 4JCNA 1DXPA 1G3DA 3D65E 1NPMA 3RMNH 1MTUA 4AFUA 1HAXB 1UVOA 2TGAA 1A0JA 2A2QH 1T8NA 2FS9A 3BEUA 2AIQA 1KIGH 3M3SA 1TRNA 3B9FH 4ABBA 3GICB 3M36A 1WTGH 4INLA 3MHWU 1E35B 2ZI2H 2AMDA 4BAQB 4JZEH 1SOTA 4GAWA 4MQAA 5K0HA 2YOLA 1GBFA 1HNEE 1E38B 3DA9B 4KELA 4TWWA 1VCPA 3TK5A 1FUJA 1BA8B 1DUEA 4Q2KA 1UTLM 4CR9A 4IGDA 3G01A 2HLCA 1GHXH 1K1NA 2DE8A 1W13U 2BOKA 3RXIA 1Q31A 1OYQA 4O03A 1ID5H 3U8OH 1RRKA 3T27A 2UUYA 3SI3H 4E05H 2QIQA 3CS0A 1YPJH 1BUIA 1UK3A 3ELAH 4ZROA 3SNBA 2A5AA 3UREA 1CBWB 3GCHB 1ELEE 2VIWA 5LPFA 4MPXA 2HRVA 1KY9A 1L2EA 2EA3A 1GBAA 1NU7B 2YNBA 1O3MA 1DT2A 1PPEE 1C5QA 2P3TB 1FY5A 1D6WA 3SJ8A 5ABWA 3ZVAA 1NM6A 2YNAA 4BTTB 1BMLA 8KME2 4MPVA 5AHGH 1N1LA 3MO3A 1TOCB 1BTUA 5DJ7A 5J4QA 1EZXC 5EGMA 1KTSB 1O5AB 4CRDA 3RMMH 1PQ8A 5A8YA 3QN7A 1GMCG 4KTCA 4U30A 1MKXH 1SFQB 2Z6BD 1ELAA 3NKKA 1AZ8A 4LZ4B 1Z1JA 2ZIQH 1DX5M 3VXEH 4MNXA 4UONA 3BTKE 3QGJA 4AOQA 1DPOA 1HAZB 1ZJKA 5C2ZA 2ZHQH 3P70B 1L0ZA 1QURH 2GCTC 4ISHH 1DDJA 1SHYA 3ZYEA 4O3UA 1HJAC 1HLTH 4ZAEA 4VGCB 1QY6A 4MNYA 1O3DA 5F6MA 1EOJA 1ETTH 1YPMH 4AZ2B 3ZZAA 1ZR0A 5EXMA 4A1VA 1O38A 1CQQA 1Y3VA 3GISB 3BEIB 1QJ6B 3SJIA 1AZZA 3TNSA 2TIOA 3RXLA 3NWUA 1XX9A 4ZHAA 1TBQH 1S81A 3UPEA 4DW2U 1AMHA 1TRMA 3DUXH 4DGJA 2ILNA 2O8MA 1P57B 1QRWA 3Q3XA 1K1MA 4O9VA 1GMHG 4TWYA 2CN0H 2VVVA 1ZRKA 2R3UA 2BD2A 3A7TA 4BXSA 3KCGH 2G52A 2Q6FA 2A4QA 3ATKA 1AB9B 1TX6A 3LT3A 3ATLA 4NGAH 3NK8A 5DG6A 3PLKA 4X2XA 1P01A 1O2QA 1O35A 1TA6A 2XYAA 3RXTA 1BMAA 3URDA 2FDAA 1GWAA 1GJDB 1HV7A 1BBRE 1GJ8B 3ZVFA 3BV9B 2C8YB 1C5PA 5EXNA 3UOPA 1QBOA 2ZQ1A 3GCTG 1ZTKA 1GI7B 1SB1H 1TQ7B 3RXGA 3A8DA 2BVXH 2VINA 5L30H 2PUQH 3OU0A 4FUGA 1C9PA 1G2LA 1Z71A 3PTNA 1U6QA 1C1QA 2BYAX 1G30B 3RXJA 2BMGB 2JH5D 5EQSA 3RXFA 4TYDA 3QX5H 3T28A 2Q6GA 3K65B 1HB0B 1YPKH 2RDLA 2WPJS 1SQAA 4THNH 1C5YB 2IJOB 3SGBE 2HGTH 1F7ZA 2FX4A 1LKBA 4K3JA 1ETSH 1HXEH 1THPB 4JZDH 1PPBH 4OGXA 2OXSA 1TA2A 4AX9H 4YOGA 3CENA 3SUGA 3FANA 2FOHA 4E7RG 1SI5H 1HAIH 3S9BA 1EPTC 3MU4A 4IS5A 4ZKOU 2ZGXH 3SV9A 3MNXA 1YBWA 4X2VA 1IHTH 4JMYA 3MYWA 3RXEA 4DIIH 3K6YA 3I77A 1O39A 3F6UH 2HNTF 2OC8A 1C5WB 3MU0A 3SGQE 1GJ6A 1MKXK 1QJ7B 3E0PB 1E0FD 1C1RA 3HGPA 2QXHA 4TPIZ 4QT8C 1TNJA 5DP4A 4Q7ZA 1BJUA 4IN2A 3AAUA 3SORA 2F9UA 3KQDA 1KDQB 2OLGA 1V2JT 1WCZA 2J38A 5EG4A 1JXPA 3O8DA 5FX6A 2BLVA 2SGFE 1GMDF 4CH8B 1P9SA 1EQ9A 2BLOA 1CA0C 3EDXB 4Q80A 5EODA 3TH3H 1HAOH 3L33A 2BXUH 1H9IE 5C3NA 1O32A 1O2XA 4ABJA 1ESAA 2A7HA 1P2JA 4X1QU 1UVUH 4ESTE 4FUIA 1AIXH 3RXDA 3SV2H 4DURA 3M5LA 3A87A 2XBXA 3PMAB 2GZ9A 3KQBA 1FMGA 1ABJH 5JBAS 2F9NA 3LOXA 4HI3A 1T4UH 1A3BH 1BIOA 2R9PA 3TNTA 2SGQE 1RIWC 1ANEA 3M5OA 4JZ1A 1BHXB 4ABDA 4Y0YE 3TGIE 2XWBI 1D4PB 1GHWH 1ARCA 1AE5A 3QZQA 1O3EA 1AWFH 1BHXF 4FUHA 4ISNA 2PW8H 6ESTA 1D3TB 3SO3A 2XBWA 2WV4A 3KQCA 1Q3XA 2ZDNA 1IQEA 1WQVH 2SGEE 1EZSC 1FDPA 3BIVH 1K9OE 1KDQA 2BXTH 3VXFH 1KTTB 1RTLA 1YM0A 4WXVA 5FPTA 5F03A 1KLTA 1T8MA 3LH3A 5F8ZA 1QL9A 3MNCA 3V3MA 2LNCA 2ZCHP 3BIUH 2XC5A 3K2UA 5EOKA 1SGPE 4MPUA 3QWCH 1S6FA 2A32A 4D7GA 3TH4H 2FS8A 1O2NA 1W0ZU 2WYGA 4Y7BA 1HJAB 4X2YA 3TITA 3L6PA 1P2IA 1EX3A 1P04A 1CHOF 1P2KA 3ATIA 2O8LA 1P9UA 2BY8X 5TCCA 3SQEE 1YCPK 1SBWA 5SGAE 1GBMA 1LPZB 1C1VH 1FIWA 1WAYB 1VGCC 1XVOA 2PWXA 3LDXH 4YLUA 1RD3B 1UTMA 2BX4A 3DT0H 4DVAU 5AFYH 1YF4A 2NU4E 1K21H 4NWKA 3RLWH 5T6GA 1VITF 4YO9A 4Y8ZA 1QRXA 2ZDKA 1ARBA 2UUKB 5I46H 2OINA 3BTQE 1J14A 3KL6A 4CREA 1O2IA 2EI8A 4TPYA 2FYQA 1GI8B 2ZFFH 2F9OA 2Z9JA 1DSTA 1Y3YA 1C5NH 5FCRA 1DE7H 3LGUA 3L3TA 3P92A 1H9LB 2BD3A 1O2GH 4UDWH 1ZOMA 2QV1A 3PLBA 2P59A 4NA7A 1A0LA 1IOEA 3SU4A 4BXWA 4DT7B 1C2EA 1O3OA 3WY8A 1P3EA 3KF2A 2CMYA 2CGAA 1SR5C 1XUKA 3E3TA 2G00A 1INCA 2VIOA 1BMNH 2ZEBA 2VNTA 2O9QA 1MQ5A 2A1DB 3GCNA 2AGGX 2GZ8A 1THSH 4FUDA 2SGAA 5DP9A 1P05A 1F5RA 1Y8TA 1C1UH 1GHZA 1HBTH 3A83A 1RS0A 2TPIZ 4YESB 1FNIA 1DSUA 4OS1A 1C2HA 5FBIA 3CS7A 2P8OB 4HTCH 1VZQH 1XVMA 1ELDE 1MAXA 4UFDH 3UR6A 3ZZ9A 1P06A 2XWAA 2Z7FE 5FHTA 1TNGA 1NRPH 4K1EA 2P3FH 3STJA 5DGJA 1GI3A 1TPAE 2AFQB 3FAOA 2ZGHA 1GJBB 1SGEE 1C1MA 1LDTT 2FOBA 3V12A 1GBDA 5DP8A 1GI6A 5TJXA 4WVPE 5C1UA 5CMXH 6LPRA 1ZJDA 2NU1E 3BSQA 3SOSA 1GBTA 3HGNA 1O0DH 1EJNA 1GL0E 6CHAC 3UIRA 4BAHB 1O2JA 3SNAA 1DOJA 1GI9B 1XXFA 4U2WA 2ZPQA 2BHGA 1AWHB 2H9TH 1MTNC 1P11E 3LPRA 1O3BA 3LGIA 3PLPA 4WF8A 2JETC 2Z9KA 3RU4T 2C8WB 2Z9IA 1PJPA 2FLBH 4IC6A 1F0RA 4ZXXH 1EZUC 3SU1A 1EJMA 2PKAB 2QF3A 3A86A 1CA0B 3SV8A 2RG3A 3E8LA 2ODPA 1KLJH 3A89A 5E8EH 1NROH 1LHEH 3C1KA 4D7FA 1A5IA 3BTFE 4J2YB 2BVSH 2GP9B 1GHAF 4JYVH 2H9HA 2PR3A 1VJ9U 4BTIB 4ZXYH 2W26A 5C5OA 3UWIA 4X1PU 1C2DA 1NT1A 2OTVA 1WTHD 3R0FA 2CV3A 5EU8A 5C20A 3SQHE 1FJSA 1SMFE 3BG4B 2G5NA 1TNHA 2W5EA 2GV6A 4ISOA 1Y3UA 1ZPCA 1LTOA 3ENSB 1SOZA 2BOHB 4NA9H 3U1IB 1DUAA 1CU1A 1J17T 1RIWB 5GJ4B 4NIXA 2PTNA 3LIWA 1HAYB 1FONA 3GDSA 4LZ1H 1BCUH 3ZVBA 1L1NA 1QJ1B 4FVBA 3T5FH 4H4FA 3RXQA 5JDUB 1O2KA 2B0FA 5LH8A 1GJ4H 3E6PH 2ZPRA 2GDEH 1O2SA 1TMTH 8LPRA 3SNDA 4WWYA 1IQMA 3MI4A 3OY6U 3ZZ8A 3UR9A 1GMDG 1EOLA 2PTCE 4TY7A 3TK9A 1OKXA 1BB0B 4A5TS 3SJ9A 2UUFB 2PKAA 2FOCA 1KXDA 3UUZA 1FY3A 2NU0E 1QCPA 2OC0A 1C1SA 4M7GA 1C2GA 3EE0B 2VIPA 4NA8A 2ZGJA 3RU4E 1HPGA 2H2ZA 1ELCA 3JZ1B 2BM2A 3AASA 2ZG0H 2ZZUH 1XUGA 4DOQA 4AFQA 2QGRA 1QFKH 3ATWA 1CA8B 7GCHG 1C2MA 4B1TA 2BDIA 5DP7A 3NXPA 1T4VH 2QXJA 1MKWH 1GDUA 4ISLA 4NZQA 3B23B 5CHAC 2I6QA 3GCOA 1BTWA 3SGAE 3M7UA 2V3OH 1C5SA 1ANCA 3LH1A 3A7YA 3MH4A 4O3TA 3PO1C 2G81E 4X6NA 1C9TA 3UNSA 5K7RA 1O3HA 2ZU1A 5E0HA 1C1WH 1T8LA 5GCHF 1DWCH 1LHGH 1RTFB 2IN2A 3MNSA 1EATA 1VITH 1O2PA 5E0GA 2Y7XA 1CSOE 2SGPE 1B5GH 1F0SA 2AERH 4MVNA 1KXAA 1MAYA 3P95A 2ZGBH 1PQAA 1AE8H 4ISIH 5BRRE 1JMOH 1ELFA 2D26C 3RXMA 1WYKA 2DUCA 4NWLA 1JIMA 1LVMA 1NRNH 4Y7AA 4K5ZA 2Z9GA 1ORFA 3BTTE 2ZU2A 2R0LA 1UVPA 1C4V2 1XUIA 2QXIA 3MO6A 2ZGCA 4UFEH 2STBE 1ZHMA 2WPHS 2ZHWH 4Y6DA 3A82A 2ZO3H 1W14U 3GDUA 3PROA 2XTTB 4AG2A 3S7HB 1SGIB 1H4WA 4X8TH 2A4OA 1C1PA 4IMZA 3NPSA 1OP2A 2FOAA 3M7QA 1RTKA 4Y8YA 2HPPH 1P2NA 1K22H 1GCTC 4UFFH 2WUBA 1O3LA 1YGCH 1KXEA 1J15A 1FPCH 2FYRA 2UWOA 5JB9S 1IQGA 1N8OC 1YPEH 4YT7H 1XUHA 1YCPM 5EQRA 1OWJA 1TGSZ 4KP0A 2ZTXA 3TGJE 3TGKE 1BJVA 1DWDH 5TCAA 3E1XB 1KSNA 4WMFA 1FAKH 1BTHH 2BZAA 1ZRBA 4OS6A 3FZDA 2C8XB 2VWOA 1OWKA 3URCA 4CBNA 2STAE 2OC7A 1GBBA 2BLQA 5J4SA 1SFIA 1EB2A 1NU9A 2HOBA 1YP9A 4GLYA 2TGDA 4ABAA 2BVRH 1FZZA 1ZHRA 1C5MD 1GDNA 1O36A 2FOMB 5CE1A 3LONA 3TH2H 3MU8A 4ZKSU 1HIAB 1G3CA 4CRAA 5FCKA 2FTLE 5GDSH 1DY9A 1PPZA 1NFXA 1F92A 3F9FA 5GPIB 1AVWA 1JRTA 1LHDH 4Q7YA 1MKWK 3SW2B 4ZUHA 1CGHA 1MD8A 1UHBB 2AGEX 1AY6H 3ZZ3A 1BBRH 4B73A 1ZTJA 1B7XB 1GI1A 2OUAA 1Z8IB 1NESE 2BQWB 1ESBA 3OY5U 5HXFA 4CHAB 2ZFQH 1EJAA 1GG6C 1NRSH 1AVXA 5L6NH 4ABFA 1Z7KA 4TY6A 1OWEA 3UNRA 1DICA 3LKWA 5ESTE 2FOFA 2G51A 1NRQH 1H9HE 3HKJB 3SUDA 2ZF0H 2ZC9H 2GX4A 1NO9H 4I32A 4LXBH 5HMAA 2GMTC 2PKSC 3PMJA 1O2WA 3ZZ5A 4GVUA 2BY7X 1OWIA 2BLWA 3AAVA 3ZVDA 3C27B 4ABIA 1GL1A 1QHRB 2FODA 2BDGA 4Y79A 3NCLA 1GHAG 1A4WH 2WPIS 3JZ2B 3VEQB 3EA8A 3ITIA 4AORA 4ZKNU 4DJZB 3KEEA 4IC5A 3EGKH 2OQUA 1UCYE 1UHBA 4WY3A 4Y11E 2Y5HA 3RXRA 1AUJA 3MFJA 4CRBA 1SQTA 1FY1A 4CRFA 1Z6EA 3H7OA 1TGTA 4OS4A 1AGJA 1GHYH 1UTNA 2WUCA 5A8ZA 4FUCA 1F0UA 5CHAB 2C93B 2GGVB 2THFB 1LHCH 4BAKB 1VJAU 4RKJB 3EA9A 1O2TA 4IMQA 4WMDA 4AB8A 1MH0A 2O8UA 1SGNE 2Y81A 4MDSA 1WQSA 3PM3A 1O5GH 1V2TT 2OBOA 3A85A 1GDQA 2V35A 3ODDA 1UTOA 5A09A 1FI8A 1ZGIA 1FAXA 2BD4A 4GCHF 1QBVH 2EC9H 3FP8E 2ZHEH 5C1XA 1H1BA 1QBNA 1GBIA 1GJCB 2LPRA 4X1SU 5T6DA 1OX1A 1G37A 3E91A 3S9CA 1PPHE 4NZLA 3RMOH 4AGJA 1QA7A 2OBQA 4LOYH 3SU5A 2QN5T 1MD7A 3PYHA 2F83A 2ZU4A 3AVZA 5C5NA 1QIXB 1DITH 1KXCA 3A81A 2BZ6H 1TGBA 4FUEA 2Y7ZA 2ZCLP 1TRYA 2RA3A 2G4TA 4NSYA 3ZYDA 3RXPA 1GVKB 2H5CA 3E16B 3KGPA 2PHBA 1GI5A 3TLOA 1V2KT 1NC6A 2VH0A 3U1JB 3F68H 1O3GA 1F0TA 3PMHB 3TJUA 2GKVE 3DD2H 1Z8JB 3W94A 1BMMH 1O3PB 2GV7A 2ODYB 1TAWA 1TYNA 2P93A 2VIQA 3VB6A 1FV9A 1TONA 2GDDA 1HCGA 4OS5A 4NFEA 2F3CE 1MMJN 2BD8A 1MZDA 5IYTA 5GCHG 2FO9A 3RXAA 1XUFA 2ALVA 1A61H 1UVTH 1ZMLA 4B71A 1O30A 5JYIA 4K8YA 1CT2E 1GHVH 4X8SH 1ELTA 1YLCA 2EI7A 2QYIA 4I33A 4AN7A 3RUOA 1O5DH 1HAHH 2ZECA 2ZU3A 4Y76A 1BITA 2VIVA 2B9LA 1SLXB 1K28D 1TFXA 3QLPH 3LGWA 1ACBE 2AMPA 1NTPA 2QA9E 1WUNH 4AFZA 5FXLA 3QO6A 1LO6A 3EQ0H 4RKOB 8GCHF 2ANYA 2GCTB 1P03A 1D3PB 1LMWB 4H42U 2VH6A 1EAIA 5DKMA 5EW1H 1PYTC 1DLKB 5DP6A 1V2RT 1GBJA 4DY7B 2R2MB 1AFQC 1BDAA 5E2OA 2J2UA 1BRUP 2WYJA 6GCHF 1C5VA 2OCVB 4I8LA 1O37A 1SVPA 1JWTA 1QB1A 2BY9X 2DE9A 4BAMB 1UTQA 2ZCKP 1ETRH 4MG3A 1IQKA 2W7UA 1FXYA 4MNWA 1C2FA 1V2LT 1TGNA 2XC0A 3ZV8A 1DM4B 1G9IE 1O3FA 1W7GH 5JBBS 1AD8H 1YLDA 1C5TA 4FXGH 2C4FH 1S6HA 4X1RU 1TPSA 3PMBB 1QL8A 1XUJA 3GY2A 1P02A 3AW0A 1O3KA 3GY6A 1A0HB 4ZH8A 2Y80A 1LHFH 1LPKB 3K9XB 4DG4A 2AH4X 1W10U 1HYLA 4K1TA 4X0WU 2BDBA 3P8GA 1DY8A 1MBMA 3O8BA 3MMGA 7KMEH 1P10A 1S0RA 2GMTB 2PKSB 2J4IA 3QGNB 1FPHH 2F91A 2ZDMA 3P6ZB 3F9GA 1EZQA 2VGCC 3V7TA 2O8TA 3VB3A 1GI0A 1NFUA 3RC4A 1PQ7A 1SSXA 1X7AC 4X6PA 2ZNKH 1EAXA 1LKAA 1HJ8A 1S82A 2FP7B 1TB6H 1GJ9B 1ZHPA 1C4Y2 4WH6A 1OP0A 1PYTD 2NU2E 4CH2B 1XKBC 1BRCE 2J95A 1T7CA 4R8TB 5AFZH 5HGGA 2W3KA 1QR3E 1EAUA 2HPQH 1EPTB 2A45B 4IN1A 3U9AH 4YLQH 1RGQA 3T25A 4O97A 4INHA 1HAGE 2RCEA 3ZZ4A 3IITA 1DWBH 3V0XA 3ZZ6A 3KQEA 4YOJA 3N7OA 1LVYA 2W3IA 4KTUA 3T2NA 1FY8E 1JRSA 1P2OA 1TNIA 3I29A 3SJOA 2XC4A 1O3CA 1MBQA 2AMQA 3BTGE 1P2QA 1ELGA 3DFLA 3TK6A 4SGBE 1AHTH 2ZTYA 3SU6A 3AW1A 3HKIB 4YM9A 4J1YA 1WV7H 1GCDA 1AFEH 1FQ3A 3FP7E 1HRTH 3RMLH 2CHAC 1T32A 2NWNA 1A2CH 2ESTE 3DHKH 4CRGA 1K2I1 2VWLA 1J8AA 1NS3A 5AVDA 4MLFB 1G3EA 4SGAE 1JBUH 1TMBH 1B0FA 1C5UA 5A8XA 1O3JA 3GCTF 3RC6A 3IWMA 2P94A 5FAHA 1OSSA 2B7DH 3Q77A 1NZQH 1RJXB 4F4OC 1V2MT 4OS7A 1EPTA 2KAIB 4VGCC 3LGYA 3LJJA 3P8NA 3LJOA 1S83A 1A5GH 3BEFB 1RFNA 5EPNA 3A7XA 2G4UA 2HNTE 1PFXC 4ABGA 1BOQA 2BD7A 2C90B 2P16A 1UTKA 4X6MA 4A7IB 2TGPZ 1TE0A 2ZWLH 3EA7A 1C2JA 1IHSH 1WSSH 4HZHA 1WOFA 3FVFB 4GCHG 4UFGH 2A2XH 2HVXA 5G4BA 4X2WA 1YPHE 1BTXA 3EAJA 3LGTA 4E7NA 2J9NA 3GY8A 4WJG2 1HUTH 3RP2A 4A6LA 4AB9A 1AB9C 4AYVB 4FUJA 2FX6A 3ZVCA 4YTAA 4Q7XA 5HYOA 1H8IH 4B75A 3D49H 3SV6A 1L1GA 2D1JA 2J34A 1VCQA 3UFAA 2Y6TA 1V2WT 2FI5E 1S5SA 2ZDVH 1O2HA 3M3TA 3M5MA 2QC2A 5FBEA 1BTPA 3B8JA 1TGCA 1P12E 1P0SH 1QQUA 1V2ST 3ATMA 1HDTH 4B76A 3RXKA 2V3HH 3M35A 2KAIA 1O2RA 3UWJH 1VGCB 4NIVA 2IPHA 2ZP0H 2ZFSA 4FU9A 2P3UB 2FEQH 1QA0A 2Q1JA 1ZLRA 3ZV9A 4GHTA 2VWMA 1K1LA 1ZPBA 4XE4A 1ZPZA 4BNRA 3Q3YA 1C1OA 3LU9B 2G5VA 4UEHH 2G55A 1D3DB 3MH7A 1IQJA 2BQ6B 3EYDA 3VPKA 4ABEA 3BTME 5HM9A 2GVFA 1HAPH 1H8DH 2FZZA 3TJOA 1BRBE 2JH6D 4R0IA 3UQVA 4JZFH 2CF8H 4B2CA 4XSKU 5C1YA 4GPGA 3K6ZA 1KXFA 4A1XA 1IQNA 1ZMJA 1CO7E 1GHBF 2H9EH 4U01A 1DANH 1XKAC 2WINI 4I7YH 5JBTA 2FM2A 1TX7A 4FU8A 2GT8A 1HAVB 1L4DA 1W2KH 8GCHG 3A84A 1YPHC 3S9AA 1XMNB 1CHOG 1G2MA 2VGCB 3VB7A 2J94A 1HGTH 5DO4H 3MH6A 1TNLA 1V2VT 3HPTB 3U98H 1UMAH 1ESTA 3MU1A 6GCHG 2PUXB 5JB8S 3O8CA 2JKHA 4JZIA 3V13A 3M7TA 1XXDA 1Y5BT 2A31A 3M5NA 2ZFRH 1N6XA 1VITG 1V2OT 1P09A 4GSOA 4NSVA
chains in the Genus database with same CATH superfamily
2K1QA 1WU1A 2H1UA 1M9UA 1GBKA 1IQHA 4XBBA 1BQYA 3A8BA 3F2GA 3TJNA 2BX3A 4NFFA 1TOMH 1DWEH 5FPYA 1TPPA 2UWPA 4ASHA 5LGOA 1ZTLA 1EAWA 2JJ2D 3MNBA 1O2OA 3Q76A 4RN6A 6CHAB 1C5ZB 5A0AE 3D23A 3FP6E 4K8BA 1Q2WA 5LPEA 1SGDE 5EJ1A 1HAVA 3BTEE 1MTNB 4B2AA 4IW4E 3DSOA 3PV4A 1P3CA 3VG8A 1CE5A 3U8RH 3VFEA 3PTBA 1E36B 1C5XB 2A5IA 2JETB 3RXOA 4YT6H 1MZAA 2ASUB 2FI4E 2CHAB 1MCVA 2A7CA 5HM2A 2UWLA 1GGDC 2AS9A 1SGFG 3OTPA 1O5BB 1SGRE 1C5LH 5EXLA 1YC0A 2O8WA 2C3SA 4IBLH 1E1QD 1QB9A 2VJ1A 3RC5A 1OS8A 1MTVA 2WV5A 4KTSA 1TNKA 5IDKA 1SC8U 4K2YA 2P95A 3RXSA 1OOKB 1ZSKA 3ZVGA 3UQOA 1DVAH 1UTJA 1PQ5A 2FPZA 1SLWB 1XM1A 2D2DA 2JH0D 1OWHA 1Y59T 4MPWA 5CHBA 2QXGA 3KYGA 2R2WU 4Y8XA 5AF9H 1FY4A 2QAAA 4HFPB 1Z8RA 1MU6B 3NUMA 2ZDAH 1CVWH 3TU7H 2FMJA 3ESTA 3AK5A 1O3AA 1BZXE 5C67A 2B8OH 1ZSLA 3OX7U 3SV7A 3SBKA 5DK1A 1JOUB 2PSXA 3RU4D 4Y10E 2XBYA 3SU3A 4MTBA 4KKDA 2WPMS 3P17H 1Y3WA 4H6SB 2TGTA 4BANB 2RFKC 3NZIA 5DSFA 1O33A 1GJAB 1Y5UT 5GXPA 2A7JA 2R3YA 2H6MA 3TIUA 2Y82A 4AG1A 1LQEA 2CK3D 5A0BA 1Y5AT 2CF9H 2B5TB 3BF6H 3LGVA 3PWBA 2BD5A 1ZSJA 1RXPA 1QNJA 5T3HA 3QDZB 1UCYH 3VGCC 5L2ZH 2GT7A 1EXFA 1IQFA 2BB4A 2FI3E 3I78A 3UY9A 1C2LA 4B2BA 3MH5A 4YOIA 3W1EA 1DXWA 1UO6A 2V6NA 1BTYA 1HIAA 7LPRA 1SGTA 2W7SA 1AQ7A 1Y3XA 1W12U 2BDCA 5DPAA 2KCOA 3Q00A 2ZHDA 1C1TA 4JK5A 1BTZA 2FWWA 2IOTA 4ZMAH 3A80A 7ESTE 2H5DA 5LPRA 1TX8A 1EP6A 1O5FH 4WXIA 4Y0ZE 1ANDA 4DIHH 1G32B 2QF0A 2ZDLA 1GBHA 5ESBA 4YZUA 3TPIZ 3IG6B 3PWCA 1AVGH 2G8TA 4CR5A 4GUXA 2BDHA 5T6FA 3ZZBA 4D76A 1NY22 2XCFA 2P8OC 2WPLS 2UUJB 1TMUH 3OAAD 4X8VH 3PO1B 3U69H 3A88A 3KYFA 5FX5A 1YCPH 1AUTC 3T62A 3BN9A 2M2AA 2SNWA 2OP9A 5DP5A 2BY5X 2OQ5A 1KXBA 1SKYE 3BTWE 3RXBA 3BTDE 3H5CB 4I8HA 1W7XH 2L74A 1SGYE 3CNRA 1AKSB 1O5EH 3KN2A 3FFGA 1WBGB 1AU8A 2AHME 1IQLA 2ZPSA 3ZZCA 4XBDA 3HATH 3U8TH 1C5RA 4TT3D 2GD4B 4XOJA 2GCHF 2V0BA 3RXUA 4NCYA 2Z3DA 4ABHA 3MWIU 1MTSA 1UK4A 3OE7D 2FIRH 1GI2A 1FN6A 1J9CH 1A7SA 1IQIA 1F5LA 4OGYA 1F5KU 3SZNA 2TBSA 3DCLA 1ANBA 1K1PA 3M37A 1BBRK 1QQ4A 2ZA5A 1P2MA 1OPHB 1GJ7B 4B6FA 2ANWA 1T31A 4I8JA 2Y5FA 3F9EA 1BRAA 5EQQA 1S0QA 1DFPA 3HK6B 2VWNA 2SGDE 1FLEE 1GCTB 1A46H 2BTCE 1GVZA 3BG8A 5KEDA 4CRCA 2ZQ2A 3MO9A 1N8OB 2Z3EA 3BG4C 3TVJB 1D3QB 1K1IA 1KLIH 1GHBG 1FIZA 1UTPA 5JBCS 7GCHF 1YPGH 3RXHA 1AKSA 1CGIE 4Y71A 1IAUA 1O2MA 1PPCE 2ZTZA 3CP7A 1CT4E 1UCYK 3UTUH 1NFYA 2CXVA 1LCYA 3DFJA 5A0CA 2QY0B 1CT0E 1OYTH 5KGOA 1UK2A 1CHGA 5PTPA 1O34A 1HXFH 1ZGVA 1ZZZA 4X1NU 1P8VC 1TBRH 4A92A 1GGDB 2XXLA 3E90B 3LC5A 3S7KB 1LPGB 1J16A 1T8OA 2AIPA 2FXRA 4TSFD 2F9VA 3BTHE 4UE7H 1G36A 1GPZA 1GBCA 2GTBA 9ESTA 1EKBB 1ELBA 2PLXA 1GBEA 4D9QA 2FOEA 4ZCNA 1S84A 3GY5A 4FU7A 1L4ZA 4DCDA 1V3XA 1N6YA 1HFDA 2ZU5A 2HWLB 1THRH 3SUEA 1YKTA 1WXRA 5GIBA 1V2UT 3SHCH 2A4GA 4BAOB 3QTVH 5B6LA 1UJ1A 1Z1IA 1LQDB 1W3CA 4K60A 1UVSH 1SGCA 4AYYB 5L2YH 1A1RA 1O5CB 5T1VA 1Z6JH 3SNCA 3STIA 4HGCA 4FUBA 3SJKA 2VB0A 4K1SA 3MOCA 4ZHLU 1FN8A 3Q3KA 5FPSA 3OYPA 1GG6B 2EEKA 4Z0KA 4JYUH 3OEHD 3KNXA 2RA0A 3GYLB 4INKA 2AYWA 1O3NA 5A2MH 3GYMA 2R0KA 1YYY1 1E37B 2J92A 2XCNA 4BTUB 2ZHFH 4XFQA 4I8GA 2AEIH 4K69A 2GJGA 4X6OA 4BOHA 2KCYA 3RXVA 3VGCB 1ZYOA 2W6JD 4JK6A 1TLDA 1MTWA 1SLUB 3ZZ7A 1SGQE 1A3EH 2PGQB 4P02A 1MU8B 2F4LA 1GMCF 2ZKSA 3ZVEA 2Y5GA 1C2KA 3QUMP 3RDZA 9LPRA 5EW2H 2BY6X 2ZFPH 3SN8A 3UNQA 2ANMH 4U32A 3E0NB 4NIYA 4A1TA 2F9PA 3UOUA 2XW9A 1MUEB 3FZZA 2QCYA 1EB1H 3RM0H 1QGFA 1CBWC 3GCHC 3QK1A 3WWBA 1YPLH 1O2ZA 4I8KA 4UD9H 5C17A 1V2PT 5ETXA 3QTOH 2TRMA 3SHAH 1EASA 1TPOA 2ZFTA 2VVUA 2BDAA 1O2VA 1V6DA 1NN6A 4ZHMU 1O2YA 1GI4A 5E0JA 1SPJA 2A5KA 1V2NT 1EUFA 2OD3B 3SUFA 1VR1H 3A7VA 4XDEA 4PROA 5JPMH 4AGKA 4B6EA 1SHHB 2PV9B 2CJIA 4MNVA 2ODQA 1O31A 2PSYA 2M5TA 4H6TA 4B74A 4RT1A 1GMHF 3S69A 3KIDU 1O2LA 3TJVA 1E34B 3S0NA 1W8BH 4JYTA 3WW7A 5GWZA 3PB1E 1QRZA 2FTMA 3QZRA 1SGFA 3A7ZA 1GJ5H 3HK3B 1NFWA 4WMEA 1G3BA 1HJ9A 1TWXB 1Z8GA 1PPFE 1ZMNA 3GOVB 4NG9H 1JIRA 4WH8A 3GY7A 4XBCA 4Z6AH 3RXCA 2I6SA 3SI4H 3F1SB 5F8XA 5C94A 1D6RA 4KGAA 1K1OA 4LK4A 1TABE 1NRRH 4FUFA 3GY3A 1D9IA 1L1JA 1GVLA 3GY4A 3H09A 2A0QB 1LVOA 3M61U 1B0EA 3A7WA 1QB6A 1KMHB 4RSPA 1PPGE 3T29A 1ABIH 2BQ7B 1W0YH 1OHHD 2LP6A 2OC1A 5DP3A 5BPEA 4X8UH 2C8ZB 3A8CA 5EPYA 2FESH 2NU3E 3SNEA 3OTJE 1C4U2 4I31A 3OSYA 2XBVA 2AGIX 1F2SE 3M3VA 2HALA 1W11U 2D8WA 4FETA 1AN1E 3RLYH 3RM2H 1MCTA 3ODFA 4E06H 1SL3A 2EI6A 3SU2A 2VIDA 2ULLA 3F2FA 4CHAC 1SQOA 3SYJA 2VVCA 3KHVA 2XNIA 4NIWA 2FLRH 2VU8E 2F9BH 1AI8H 2GCHG 4CBOA 1C5OH 3UB0A 3D62A 4OS2A 2A4RA 1SG8B 4ZKRU 2PGBB 1LVBA 2BD9A 1C2IA 1K1JA 2ALPA 1BT7A 3H7TA 5I25A 2QF4A 3T26A 1KYNA 5E2PA 3O8RA 2FOGA 3F9HA 2BDYA 2SFAA 1V2QT 3VB4A 4GHQA 1S85A 1QTFA 1DS2E 1AFQB 2Q6DA 3P8FA 1AO5A 5H4IB 3P8OA 3GDVA 2Z3CA 3ZZDA 1GBLA 1OWDA 5IK2D 1OP8A 3LC3A 1DLEA 1QL7A 1C1NA 1OXGA 1TALA 4AFSA 2SNVA 2WPKS 3A8AA 1O2UA 1TIOA 2Z94A 5F8TA 4FVDA 3OFND 1A5HA 1MQ6A 1ELVA 1TQ0B 1O3IA 3W95A 8ESTE 2KZ4A 2PFEA 5B6OA 2XRCA 3R3GB 3MTYA 2Z9LA 3MU5A 2ANKH 1EP5A 4D9RA 1VCWA 1TBZH 1SLVB 1CGJE 4P00A 2GZ7A 3VB5A 4F49A 2HNTC 3SU0A 4D8NA 4JCNA 1DXPA 1G3DA 2K0QA 3D65E 1NPMA 3RMNH 1MTUA 4AFUA 1HAXB 1UVOA 2TGAA 1A0JA 2A2QH 1T8NA 2FS9A 3BEUA 3F0PA 2AIQA 1KIGH 3M3SA 1TRNA 3B9FH 4ABBA 3GICB 3M36A 1WTGH 4INLA 3MHWU 1E35B 3GS9A 2ZI2H 2AMDA 4BAQB 4JZEH 1SOTA 4GAWA 1WDIA 4MQAA 5K0HA 2YOLA 1GBFA 1HNEE 1E38B 3DA9B 4KELA 4TWWA 1VCPA 3TK5A 1FUJA 1BA8B 1DUEA 4Q2KA 1UTLM 5GNDA 4CR9A 4IGDA 3G01A 2HLCA 1GHXH 1K1NA 2DE8A 1W13U 2WSSD 2BOKA 3RXIA 1Q31A 1OYQA 4O03A 1ID5H 3U8OH 1RRKA 3T27A 2UUYA 3SI3H 4E05H 2QIQA 3CS0A 1YPJH 5HIYA 1BUIA 1UK3A 3ELAH 4ZROA 3SNBA 2A5AA 3UREA 1CBWB 3GCHB 1ELEE 2VIWA 5LPFA 4MPXA 2HRVA 1KY9A 1L2EA 2EA3A 1GBAA 1NU7B 2YNBA 1O3MA 1DT2A 1PPEE 1C5QA 2KM0A 1FY5A 1D6WA 2P3TB 3SJ8A 5ABWA 3ZVAA 1NM6A 2YNAA 4BTTB 1BMLA 8KME2 4MPVA 1YWUA 5AHGH 1N1LA 3MO3A 1TOCB 1BTUA 5DJ7A 5J4QA 2JDID 1EZXC 5EGMA 1KTSB 1O5AB 4CRDA 3RMMH 1PQ8A 5A8YA 3QN7A 1GMCG 4KTCA 4U30A 1MKXH 1SFQB 2Z6BD 1ELAA 3NKKA 1AZ8A 4LZ4B 1Z1JA 2ZIQH 1DX5M 3VXEH 4MNXA 4UONA 3BTKE 3QGJA 4Q63A 1S6LA 4AOQA 2XNDD 1DPOA 1HAZB 1ZJKA 2YMSC 5C2ZA 2ZHQH 3P70B 1L0ZA 1QURH 2GCTC 4ISHH 1DDJA 1SHYA 3ZYEA 4O3UA 1HJAC 1HLTH 4ZAEA 4VGCB 1QY6A 4MNYA 1O3DA 5F6MA 1EOJA 1ETTH 1YPMH 4DT4A 2F43B 4AZ2B 3ZZAA 1ZR0A 5EXMA 4A1VA 1O38A 1CQQA 1Y3VA 3GISB 3BEIB 1QJ6B 3SJIA 1AZZA 3TNSA 2TIOA 3RXLA 3NWUA 1XX9A 4ZHAA 1TBQH 1S81A 3UPEA 4DW2U 1AMHA 1TRMA 3DUXH 4DGJA 2ILNA 2O8MA 1P57B 1QRWA 3Q3XA 1K1MA 4O9VA 1GMHG 4TWYA 2CN0H 2VVVA 1ZRKA 2R3UA 2BD2A 3A7TA 4BXSA 2L6OA 3KCGH 2G52A 2Q6FA 2A4QA 3ATKA 1H8HD 1AB9B 1TX6A 3LT3A 3ATLA 4NGAH 3NK8A 5DG6A 3PLKA 4X2XA 1P01A 1O2QA 1O35A 1TA6A 2XYAA 3RXTA 1BMAA 3URDA 2FDAA 1GWAA 1GJDB 1HV7A 1BBRE 1GJ8B 3ZVFA 3BV9B 2C8YB 1C5PA 5EXNA 3UOPA 1QBOA 2ZQ1A 3GCTG 5C0UA 3UAIC 1ZTKA 1GI7B 1SB1H 1TQ7B 3RXGA 3A8DA 5C0TA 2BVXH 2VINA 5L30H 2PUQH 3OU0A 4FUGA 1C9PA 4Z1MD 1G2LA 1Z71A 3PTNA 1U6QA 1C1QA 1NBME 3FO8D 2BYAX 1G30B 3RXJA 2BMGB 2JH5D 5EQSA 3RXFA 4I86A 4TYDA 3QX5H 3T28A 2Q6GA 3K65B 1HB0B 1YPKH 2RDLA 2WPJS 1SQAA 4THNH 1C5YB 2IJOB 3SGBE 2HGTH 1F7ZA 2FX4A 1LKBA 4K3JA 1ETSH 1HXEH 1THPB 4JZDH 1PPBH 4OGXA 2OXSA 1TA2A 4AX9H 4YOGA 3CENA 3SUGA 3FANA 2FOHA 4E7RG 1SI5H 1HAIH 3S9BA 1EPTC 3MU4A 4IS5A 4ZKOU 2ZGXH 3SV9A 3MNXA 1YBWA 4X2VA 1IHTH 4JMYA 3MYWA 3RXEA 4DIIH 3K6YA 3I77A 1O39A 4ACBA 3F6UH 2HNTF 2OC8A 1C5WB 3MU0A 4M9FA 3SGQE 1GJ6A 1MKXK 1QJ7B 3E0PB 1E0FD 1C1RA 3HGPA 2QXHA 4TPIZ 1K0HA 4QT8C 1TNJA 5DP4A 4Q7ZA 1BJUA 4IN2A 3AAUA 3SORA 2F9UA 3KQDA 1KDQB 2OLGA 1V2JT 1WCZA 2J38A 5EG4A 3DSPA 1JXPA 3O8DA 5FX6A 2BLVA 2SGFE 1GMDF 4CH8B 5EJLA 1P9SA 1EQ9A 2BLOA 1CA0C 3EDXB 4Q80A 5EODA 3TH3H 1HAOH 3L33A 2BXUH 1H9IE 5C3NA 1O32A 1O2XA 4ABJA 1ESAA 2A7HA 1P2JA 4X1QU 1UVUH 4ESTE 4FUIA 1AIXH 3RXDA 3SV2H 4DURA 3M5LA 3A87A 2XBXA 3PMAB 2GZ9A 3KQBA 1FMGA 1ABJH 5JBAS 2F9NA 3LOXA 4HI3A 1T4UH 1A3BH 1BIOA 2R9PA 3TNTA 2SGQE 1RIWC 1ANEA 3M5OA 4JZ1A 1BHXB 4ABDA 4Y0YE 3TGIE 2XWBI 1D4PB 1GHWH 1ARCA 1AE5A 3QZQA 1O3EA 1AWFH 1BHXF 4FUHA 4ISNA 2PW8H 6ESTA 1D3TB 3SO3A 2XBWA 2WV4A 3KQCA 1Q3XA 2ZDNA 1IQEA 1WQVH 2SGEE 1EZSC 1FDPA 3BIVH 1K9OE 1KDQA 2BXTH 2KCPA 3VXFH 1KTTB 1RTLA 1YM0A 4WXVA 5FPTA 5F03A 1KLTA 1T8MA 3LH3A 5F8ZA 3KQ5A 1QL9A 3MNCA 3V3MA 2LNCA 2ZCHP 3BIUH 2XC5A 3K2UA 5EOKA 1SGPE 4MPUA 3QWCH 1S6FA 2A32A 4D7GA 3TH4H 2FS8A 1O2NA 1W0ZU 2WYGA 4Y7BA 1HJAB 4X2YA 3TITA 3L6PA 1P2IA 1EX3A 1P04A 1CHOF 1P2KA 3ATIA 2O8LA 1P9UA 2BY8X 5TCCA 3SQEE 1YCPK 1SBWA 5SGAE 1GBMA 1LPZB 1C1VH 1FIWA 1WAYB 1VGCC 1XVOA 2PWXA 3LDXH 4YLUA 1RD3B 1UTMA 2BX4A 3DT0H 4DVAU 5AFYH 1YF4A 3N7EA 2NU4E 1K21H 4NWKA 3RLWH 5T6GA 1VITF 4YO9A 4Y8ZA 1QRXA 2ZDKA 1ARBA 2UUKB 5I46H 2OINA 3BTQE 1J14A 3KL6A 4CREA 1O2IA 2EI8A 4TPYA 2FYQA 1GI8B 2ZFFH 2F9OA 2Z9JA 1DSTA 1Y3YA 1C5NH 2J98B 5FCRA 1DE7H 3LGUA 3L3TA 3P92A 1H9LB 2BD3A 1O2GH 4UDWH 1ZOMA 2QV1A 3PLBA 2P59A 4NA7A 1A0LA 1IOEA 3SU4A 4BXWA 4DT7B 1C2EA 1O3OA 3WY8A 1P3EA 3KF2A 2CMYA 2CGAA 1SR5C 1XUKA 2HLDD 3E3TA 2G00A 1INCA 2VIOA 1BMNH 2ZEBA 2VNTA 2O9QA 1MQ5A 2A1DB 1E79D 3GCNA 2AGGX 1SQRA 2GZ8A 1THSH 4FUDA 2SGAA 5DP9A 1P05A 1F5RA 1Y8TA 1C1UH 1GHZA 1HBTH 2WV9A 3A83A 1RS0A 2TPIZ 4YESB 1FNIA 1DSUA 2EY4C 4OS1A 1C2HA 5FBIA 3CS7A 2P8OB 4HTCH 1VZQH 1XVMA 1ELDE 1MAXA 4UFDH 3UR6A 1MABB 3ZZ9A 1P06A 2XWAA 2Z7FE 5FHTA 2WZQA 1TNGA 1NRPH 4K1EA 2P3FH 3STJA 5DGJA 1GI3A 1TPAE 2AFQB 3FAOA 2ZGHA 1GJBB 4HG6A 1SGEE 1C1MA 1LDTT 2FOBA 3PRDA 3V12A 1GBDA 5DP8A 1GI6A 3EE7A 5TJXA 4WVPE 5C1UA 2J98A 5CMXH 6LPRA 1ZJDA 2NU1E 3BSQA 3SOSA 1GBTA 3HGNA 1O0DH 1EJNA 1GL0E 6CHAC 3UIRA 4BAHB 1O2JA 3SNAA 1DOJA 1GI9B 1XXFA 4RT0A 4U2WA 2ZPQA 2BHGA 1AWHB 2H9TH 1MTNC 1P11E 3LPRA 1O3BA 3LGIA 3PLPA 4WF8A 2JETC 2Z9KA 3RU4T 2C8WB 2Z9IA 1PJPA 2FLBH 4IC6A 1F0RA 2LELA 4ZXXH 3PRBA 1EZUC 3SU1A 1EJMA 2PKAB 2QF3A 3A86A 1CA0B 3SV8A 2RG3A 3E8LA 2ODPA 1KLJH 3A89A 5E8EH 1NROH 1LHEH 3C1KA 4D7FA 1A5IA 3BTFE 4J2YB 2BVSH 2GP9B 1GHAF 4JYVH 2H9HA 2PR3A 1VJ9U 1W0JD 4BTIB 4ZXYH 2W26A 5C5OA 1W0KD 3UWIA 4X1PU 1C2DA 1NT1A 3F2HA 2OTVA 2W6ID 1WTHD 3R0FA 2CV3A 5EU8A 5C20A 3SQHE 1FJSA 2PP6A 1SMFE 3BG4B 2G5NA 1TNHA 2W5EA 2GV6A 4ISOA 1Y3UA 1ZPCA 1LTOA 3ENSB 1SOZA 2BOHB 4NA9H 3U1IB 1DUAA 1CU1A 1J17T 1RIWB 5GJ4B 4NIXA 2PTNA 3LIWA 1HAYB 1FONA 3GDSA 4LZ1H 1BCUH 3ZVBA 1L1NA 1QJ1B 2VBCA 4FVBA 3T5FH 4H4FA 3RXQA 5JDUB 1O2KA 2B0FA 5LH8A 1GJ4H 3E6PH 2K8IA 2ZPRA 2GDEH 1O2SA 1TMTH 8LPRA 3SNDA 4WWYA 1IQMA 3MI4A 3OY6U 3ZZ8A 3UR9A 1GMDG 1EOLA 2PTCE 4TY7A 3TK9A 1OKXA 1BB0B 4A5TS 3SJ9A 1YY3A 2UUFB 2PKAA 2FOCA 1KXDA 3UUZA 1FY3A 2NU0E 2J97A 1QCPA 2OC0A 1C1SA 4M7GA 3N7DA 1C2GA 3EE0B 2VIPA 4NA8A 2ZGJA 3RU4E 1HPGA 2H2ZA 3WWFA 1ELCA 3JZ1B 2BM2A 3AASA 2ZG0H 2ZZUH 3F3BA 1XUGA 4DOQA 4AFQA 2QGRA 2J5UA 1QFKH 3ATWA 3SZEA 1CA8B 2XOKD 7GCHG 1C2MA 4B1TA 2BDIA 5DP7A 3NXPA 1T4VH 2QXJA 1MKWH 1GDUA 4ISLA 4NZQA 3B23B 5CHAC 2I6QA 3GCOA 1BTWA 3SGAE 3M7UA 2V3OH 5EIYA 1C5SA 1ANCA 3LH1A 3A7YA 3MH4A 4O3TA 3PO1C 2G81E 4X6NA 1C9TA 3UNSA 5K7RA 1O3HA 2ZU1A 5E0HA 1C1WH 1T8LA 5GCHF 1DWCH 1LHGH 1RTFB 2IN2A 3MNSA 1EATA 1VITH 1O2PA 4F55A 5E0GA 2Y7XA 1CSOE 2SGPE 1B5GH 1F0SA 2AERH 4MVNA 1KXAA 1MAYA 3P95A 2ZGBH 1PQAA 1AE8H 4ISIH 5BRRE 1JMOH 1ELFA 2D26C 3RXMA 2WHXA 1WYKA 2DUCA 4NWLA 1JIMA 1LVMA 1NRNH 4Y7AA 4K5ZA 2Z9GA 1ORFA 3BTTE 2EQNA 2ZU2A 2R0LA 1UVPA 1C4V2 1XUIA 2QXIA 3MO6A 2ZGCA 4UFEH 2STBE 1ZHMA 2WPHS 2ZHWH 4Y6DA 1H8ED 3A82A 4XD7D 2ZO3H 1W14U 3GDUA 3PROA 2XTTB 4AG2A 3S7HB 1SGIB 1H4WA 5EJZA 4X8TH 2A4OA 1C1PA 4IMZA 3FKSD 3NPSA 1OP2A 2FOAA 3M7QA 1RTKA 4Y8YA 2HPPH 1P2NA 1K22H 1GCTC 4UFFH 2WUBA 1O3LA 1YGCH 1KXEA 1J15A 1FPCH 2FYRA 2UWOA 5JB9S 1IQGA 1N8OC 1YPEH 4YT7H 1XUHA 1YCPM 5EQRA 1OWJA 1TGSZ 4KP0A 2ZTXA 3TGJE 2QF5A 3TGKE 1BJVA 1DWDH 5TCAA 3E1XB 1KSNA 4WMFA 1FAKH 1BTHH 2BZAA 1ZRBA 4OS6A 3FZDA 2C8XB 2VWOA 1OWKA 3URCA 4CBNA 2STAE 2OC7A 1GBBA 2BLQA 5J4SA 1SFIA 1EB2A 1NU9A 2HOBA 1YP9A 4GLYA 2TGDA 4ABAA 2BVRH 1FZZA 1ZHRA 1C5MD 1GDNA 1O36A 2FOMB 5CE1A 3LONA 3TH2H 3MU8A 4ZKSU 1HIAB 1G3CA 4CRAA 5FCKA 2FTLE 5GDSH 1DY9A 1PPZA 1NFXA 1F92A 3F9FA 5GPIB 1AVWA 1JRTA 1LHDH 4Q7YA 1MKWK 3SW2B 4ZUHA 3OEED 1CGHA 1MD8A 1UHBB 2AGEX 1AY6H 3ZZ3A 1BBRH 4B73A 1ZTJA 2KFWA 1B7XB 1GI1A 1E1RD 2OUAA 1Z8IB 1NESE 2BQWB 1ESBA 3OY5U 5HXFA 4CHAB 2ZFQH 1EJAA 3FN8A 1GG6C 1NRSH 1AVXA 5L6NH 4ABFA 1Z7KA 4TY6A 1OWEA 3UNRA 1DICA 3LKWA 3FOAA 5ESTE 2FOFA 2G51A 1NRQH 1H9HE 3HKJB 3SUDA 5CDFE 2ZF0H 2ZC9H 2GX4A 1NO9H 4I32A 4LXBH 5HMAA 2GMTC 2PKSC 3PMJA 1O2WA 3ZZ5A 4GVUA 2BY7X 3ZIAD 1OWIA 2BLWA 3AAVA 3ZVDA 3C27B 4ABIA 1GL1A 1QHRB 2FODA 2BDGA 4Y79A 2YMSD 3NCLA 1GHAG 1A4WH 2WPIS 3JZ2B 3VEQB 3EA8A 3ITIA 4AORA 4ZKNU 4DJZB 3KEEA 4IC5A 3EGKH 2OQUA 1UCYE 1UHBA 4WY3A 4Y11E 2Y5HA 3RXRA 1AUJA 3MFJA 4CRBA 1SQTA 1FY1A 4CRFA 3MQKC 1Z6EA 3H7OA 1TGTA 4OS4A 1AGJA 1GHYH 1UTNA 2WUCA 5A8ZA 4FUCA 1F0UA 5CHAB 2C93B 2GGVB 2THFB 1LHCH 4BAKB 1VJAU 4RKJB 3EA9A 1O2TA 4IMQA 4WMDA 4AB8A 1MH0A 2O8UA 1SGNE 2Y81A 4MDSA 1WQSA 3PM3A 1O5GH 1V2TT 2OBOA 3A85A 1GDQA 2V35A 3ODDA 1UTOA 5A09A 1FI8A 5KECA 1ZGIA 1FAXA 2BD4A 4GCHF 1QBVH 2EC9H 3FP8E 2ZHEH 5C1XA 1H1BA 1QBNA 1GBIA 1GJCB 2LPRA 4X1SU 5T6DA 1OX1A 1G37A 3E91A 3S9CA 1PPHE 4NZLA 3RMOH 4AGJA 1QA7A 2OBQA 4LOYH 1EFRD 3SU5A 2QN5T 1MD7A 3PYHA 2F83A 2ZU4A 3AVZA 5C5NA 1QIXB 1DITH 1KXCA 3A81A 2BZ6H 2IJD1 3N99A 1TGBA 4FUEA 2Y7ZA 2ZCLP 1TRYA 2RA3A 2G4TA 4NSYA 3ZYDA 3RXPA 1GVKB 2H5CA 3E16B 3KGPA 2PHBA 1GI5A 4Q4LA 3TLOA 1V2KT 1NC6A 2VH0A 3U1JB 3F68H 1O3GA 1F0TA 3PMHB 4ACAA 3TJUA 2GKVE 2RDEA 3DD2H 1Z8JB 3W94A 1BMMH 1O3PB 2GV7A 2ODYB 1TAWA 1TYNA 2P93A 2VIQA 3VB6A 1FV9A 1TONA 2GDDA 1HCGA 4OS5A 4NFEA 2F3CE 1MMJN 2BD8A 1MZDA 5IYTA 5GCHG 2FO9A 3RXAA 1XUFA 3U28C 2ALVA 1A61H 1UVTH 1ZMLA 4B71A 1O30A 5JYIA 4K8YA 1CT2E 1GHVH 4X8SH 1ELTA 1YLCA 2EI7A 2QYIA 4I33A 4AN7A 3RUOA 2V7QD 4AC9A 1O5DH 1HAHH 2ZECA 1COWD 2ZU3A 4Y76A 1BITA 2VIVA 2B9LA 1SLXB 1K28D 1TFXA 3QLPH 3LGWA 1ACBE 2AMPA 1NTPA 2QA9E 1WUNH 4AFZA 4RI0A 5FXLA 3QO6A 1LO6A 2YMSB 3EQ0H 4RKOB 8GCHF 2ANYA 2GCTB 1P03A 1D3PB 1LMWB 4H42U 2VH6A 1EAIA 5DKMA 5EW1H 1PYTC 1YLNA 1DLKB 5DP6A 1V2RT 1GBJA 4ASUD 4DY7B 2R2MB 1AFQC 2JIZD 1BDAA 5E2OA 2J2UA 1BRUP 5HIZA 2WYJA 6GCHF 1C5VA 2OCVB 4I8LA 1O37A 1SVPA 1JWTA 1QB1A 1NBMD 2BY9X 2DE9A 1FX0B 1UTQA 4BAMB 2ZCKP 1ETRH 4MG3A 1IQKA 2W7UA 1FXYA 3DSGA 4MNWA 1C2FA 1V2LT 1TGNA 2XC0A 3ZV8A 1DM4B 1G9IE 1O3FA 1W7GH 5JBBS 1AD8H 2KCAA 1YLDA 1C5TA 4FXGH 2C4FH 1S6HA 4X1RU 1TPSA 3PMBB 1QL8A 1XUJA 3GY2A 1P02A 3AW0A 1O3KA 3GY6A 1A0HB 4ZH8A 2Y80A 1LHFH 1LPKB 3K9XB 5FL7D 2AH4X 4DG4A 1W10U 1HYLA 4K1TA 4X0WU 2BDBA 3P8GA 1DY8A 1MBMA 3O8BA 3MMGA 7KMEH 1P10A 1S0RA 2GMTB 2PKSB 2J4IA 3QGNB 1FPHH 2F91A 2ZDMA 3P6ZB 3F9GA 1EZQA 2VGCC 3V7TA 2O8TA 3VB3A 1GI0A 1NFUA 3RC4A 1PQ7A 1SSXA 1X7AC 4X6PA 3PV2A 2HVYB 2ZNKH 4FOUC 1EAXA 1LKAA 1HJ8A 1S82A 2FP7B 1TB6H 1GJ9B 1ZHPA 1C4Y2 4WH6A 1OP0A 1PYTD 2KX4A 2NU2E 4CH2B 1XKBC 1BRCE 2J95A 1T7CA 4R8TB 5AFZH 5HGGA 2W3KA 1QR3E 1EAUA 2HPQH 1EPTB 2A45B 4IN1A 3U9AH 4YLQH 1RGQA 3T25A 4O97A 4INHA 1HAGE 2RCEA 3ZZ4A 3IITA 1DWBH 3V0XA 3ZZ6A 3KQEA 1QZ8A 4YOJA 3N7OA 1LVYA 2W3IA 4KTUA 2QE7D 1FY8E 3T2NA 1JRSA 2KR7A 1P2OA 1TNIA 3I29A 3SJOA 2XC4A 1O3CA 1MBQA 2AMQA 3BTGE 1P2QA 1ELGA 3DFLA 5F53A 3TK6A 4SGBE 1AHTH 2ZTYA 4YXWD 3SU6A 3AW1A 3HKIB 4YM9A 4J1YA 1WV7H 1GCDA 1AFEH 1FQ3A 3FP7E 1HRTH 3RMLH 2CHAC 1T32A 2NWNA 1A2CH 2ESTE 3DHKH 4CRGA 1K2I1 2IPQX 1J8AA 2VWLA 1NS3A 5AVDA 4MLFB 1G3EA 4SGAE 1JBUH 1TMBH 1B0FA 1C5UA 5A8XA 1O3JA 3GCTF 3RC6A 3IWMA 2P94A 5FAHA 1OSSA 2B7DH 3Q77A 1NZQH 1RJXB 4F4OC 5HKKD 1V2MT 4OS7A 1EPTA 2KAIB 4VGCC 3LGYA 3LJJA 3P8NA 1BMFD 1S83A 3LJOA 1A5GH 3BEFB 1RFNA 5EPNA 3A7XA 2G4UA 2HNTE 1PFXC 4ABGA 4OM9A 1BOQA 3NRLA 2BD7A 5DN6D 2C90B 2P16A 1UTKA 4X6MA 4A7IB 2TGPZ 1TE0A 2ZWLH 3EA7A 1C2JA 1IHSH 1WSSH 4HZHA 1WOFA 3FVFB 4GCHG 4UFGH 2A2XH 2HVXA 5G4BA 4X2WA 1YPHE 1BTXA 3EAJA 3LGTA 4E7NA 2J9NA 3GY8A 4WJG2 1HUTH 3RP2A 4A6LA 4AB9A 1AB9C 4AYVB 4FUJA 2FX6A 3ZVCA 4YTAA 4Q7XA 5HYOA 1H8IH 4B75A 3D49H 3SV6A 1L1GA 2D1JA 2J34A 1VCQA 3UFAA 2Y6TA 1V2WT 2FI5E 1S5SA 2ZDVH 1O2HA 3M3TA 3M5MA 2QC2A 5FBEA 1BTPA 3B8JA 1TGCA 1P12E 1P0SH 1QQUA 1V2ST 3ATMA 1VKYA 1HDTH 4B76A 3RXKA 2V3HH 3F0OA 3M35A 2KAIA 1O2RA 3UWJH 1VGCB 4NIVA 2IPHA 2ZP0H 2ZFSA 1UW7A 2P3UB 4FU9A 2FEQH 1QA0A 2Q1JA 1ZLRA 3ZV9A 4GHTA 2VWMA 1K1LA 1ZPBA 4XE4A 1ZPZA 4BNRA 2WPDD 3Q3YA 1C1OA 3LU9B 2G5VA 4F48B 2OK5A 4UEHH 2G55A 1D3DB 3MH7A 1IQJA 2BQ6B 3EYDA 2JJ1D 3VPKA 3BTME 4ABEA 2GVFA 5HM9A 1HAPH 1H8DH 2FZZA 3TJOA 1BRBE 2JH6D 4R0IA 3UQVA 4JZFH 2CF8H 4B2CA 4XSKU 5C1YA 4GPGA 3K6ZA 1KXFA 4A1XA 1IQNA 1ZMJA 1CO7E 1GHBF 2H9EH 4U01A 1DANH 1XKAC 2WINI 4I7YH 5JBTA 2FM2A 1TX7A 4FU8A 2GT8A 1HAVB 1L4DA 1W2KH 8GCHG 3A84A 1YPHC 3S9AA 2V3MA 1XMNB 1CHOG 1G2MA 2VGCB 3VB7A 2J94A 1HGTH 5DO4H 3MH6A 1TNLA 1V2VT 3HPTB 3U98H 1UMAH 1ESTA 3MU1A 6GCHG 2PUXB 5JB8S 3O8CA 2JKHA 4JZIA 3V13A 3M7TA 1XXDA 1Y5BT 2A31A 3M5NA 4XRNA 2ZFRH 1N6XA 1VITG 1V2OT 3PV5A 1P09A 4GSOA 4NSVA
chains in the Genus database with same CATH topology
2K1QA 1WU1A 2H1UA 1M9UA 1GBKA 1IQHA 4XBBA 1BQYA 3A8BA 3TJNA 2BX3A 4NFFA 1TOMH 1DWEH 5FPYA 1TPPA 2UWPA 4ASHA 5LGOA 1ZTLA 1EAWA 3MNBA 1O2OA 3Q76A 4RN6A 6CHAB 1C5ZB 5A0AE 3D23A 3FP6E 4K8BA 1Q2WA 5LPEA 1SGDE 1HAVA 3BTEE 1MTNB 4B2AA 4IW4E 3PV4A 1P3CA 3VFEA 1CE5A 3U8RH 3PTBA 1E36B 1C5XB 2A5IA 2JETB 3RXOA 4YT6H 1MZAA 2ASUB 2FI4E 2CHAB 1MCVA 2A7CA 5HM2A 2UWLA 1GGDC 2AS9A 1SGFG 5EXLA 1O5BB 1SGRE 1C5LH 1YC0A 2O8WA 2C3SA 4IBLH 1QB9A 2VJ1A 3RC5A 1OS8A 1MTVA 2WV5A 4KTSA 1TNKA 5IDKA 1SC8U 4K2YA 2P95A 3RXSA 1OOKB 1ZSKA 3ZVGA 3UQOA 1DVAH 1UTJA 1PQ5A 2FPZA 1SLWB 1XM1A 2D2DA 2JH0D 1OWHA 1Y59T 4MPWA 2QXGA 2R2WU 4Y8XA 5AF9H 1FY4A 2QAAA 4HFPB 1Z8RA 1MU6B 3NUMA 2ZDAH 1CVWH 3TU7H 2FMJA 3ESTA 1O3AA 1BZXE 5C67A 2B8OH 1ZSLA 3OX7U 3SV7A 3SBKA 5DK1A 1JOUB 2PSXA 3RU4D 4Y10E 2XBYA 3SU3A 4MTBA 4KKDA 2WPMS 3P17H 1Y3WA 4H6SB 2TGTA 4BANB 3NZIA 1O33A 1GJAB 1Y5UT 5GXPA 2A7JA 2R3YA 2H6MA 3TIUA 2Y82A 4AG1A 1LQEA 5A0BA 1Y5AT 2CF9H 2B5TB 3BF6H 3LGVA 3PWBA 2BD5A 1ZSJA 1RXPA 1QNJA 5T3HA 3QDZB 1UCYH 3VGCC 5L2ZH 2GT7A 1EXFA 1IQFA 2BB4A 2FI3E 3I78A 3UY9A 1C2LA 4B2BA 3MH5A 4YOIA 1DXWA 1UO6A 2V6NA 1BTYA 1HIAA 7LPRA 1SGTA 2W7SA 1AQ7A 1Y3XA 1W12U 2BDCA 5DPAA 3Q00A 2ZHDA 1C1TA 4JK5A 1BTZA 2FWWA 2IOTA 4ZMAH 3A80A 7ESTE 2H5DA 5LPRA 1TX8A 1EP6A 1O5FH 4WXIA 4Y0ZE 1ANDA 4DIHH 1G32B 2QF0A 2ZDLA 1GBHA 5ESBA 4YZUA 3TPIZ 3IG6B 3PWCA 1AVGH 2G8TA 4CR5A 4GUXA 2BDHA 5T6FA 3ZZBA 4D76A 1NY22 2XCFA 2P8OC 2WPLS 2UUJB 1TMUH 4X8VH 3PO1B 3U69H 3A88A 5FX5A 1YCPH 1AUTC 3T62A 3BN9A 2SNWA 2OP9A 5DP5A 2BY5X 2OQ5A 1KXBA 3BTWE 3RXBA 3BTDE 3H5CB 4I8HA 1W7XH 1SGYE 1AKSB 1O5EH 3KN2A 3FFGA 1WBGB 1AU8A 2ZPSA 1IQLA 3ZZCA 4XBDA 3HATH 3U8TH 1C5RA 2GD4B 4XOJA 2GCHF 2V0BA 3RXUA 4NCYA 2Z3DA 4ABHA 3MWIU 1MTSA 1UK4A 2FIRH 1GI2A 1FN6A 1J9CH 1A7SA 1IQIA 1F5LA 4OGYA 1F5KU 3SZNA 2TBSA 1ANBA 1K1PA 3M37A 1BBRK 1QQ4A 2ZA5A 1P2MA 1OPHB 1GJ7B 2ANWA 1T31A 4I8JA 2Y5FA 3F9EA 1BRAA 5EQQA 1S0QA 1DFPA 3HK6B 2VWNA 2SGDE 1FLEE 1GCTB 1A46H 2BTCE 1GVZA 3BG8A 4CRCA 2ZQ2A 3MO9A 1N8OB 2Z3EA 3BG4C 3TVJB 1D3QB 1K1IA 1KLIH 1GHBG 1FIZA 1UTPA 5JBCS 7GCHF 1YPGH 3RXHA 1AKSA 1CGIE 4Y71A 1IAUA 1O2MA 1PPCE 2ZTZA 3CP7A 1CT4E 1UCYK 3UTUH 1NFYA 2CXVA 1LCYA 3DFJA 5A0CA 2QY0B 1CT0E 1OYTH 1UK2A 1CHGA 5PTPA 1O34A 1HXFH 1ZGVA 1ZZZA 4X1NU 1P8VC 1TBRH 4A92A 1GGDB 2XXLA 3E90B 3LC5A 3S7KB 1LPGB 1J16A 1T8OA 2AIPA 2FXRA 2F9VA 3BTHE 4UE7H 1G36A 1GPZA 1GBCA 2GTBA 9ESTA 1EKBB 1ELBA 2PLXA 1GBEA 4D9QA 2FOEA 1S84A 3GY5A 4FU7A 1L4ZA 4DCDA 1V3XA 1N6YA 1HFDA 2ZU5A 2HWLB 1THRH 3SUEA 1YKTA 5GIBA 1V2UT 3SHCH 2A4GA 4BAOB 3QTVH 1UJ1A 1Z1IA 1LQDB 1W3CA 4K60A 1UVSH 1SGCA 4AYYB 5L2YH 1A1RA 1O5CB 3SNCA 1Z6JH 3STIA 4HGCA 4FUBA 3SJKA 2VB0A 4K1SA 3MOCA 4ZHLU 1FN8A 3Q3KA 5FPSA 3OYPA 1GG6B 2EEKA 4Z0KA 4JYUH 3KNXA 2RA0A 3GYLB 4INKA 2AYWA 1O3NA 5A2MH 3GYMA 2R0KA 1YYY1 1E37B 2J92A 2XCNA 4BTUB 2ZHFH 4XFQA 4I8GA 2AEIH 4K69A 4X6OA 4BOHA 3RXVA 3VGCB 1ZYOA 4JK6A 1TLDA 1MTWA 1SLUB 3ZZ7A 1SGQE 1A3EH 2PGQB 1MU8B 1GMCF 2ZKSA 3ZVEA 2Y5GA 1C2KA 3QUMP 3RDZA 9LPRA 5EW2H 2BY6X 2ZFPH 3SN8A 3UNQA 2ANMH 4U32A 3E0NB 4NIYA 4A1TA 2F9PA 3UOUA 2XW9A 1MUEB 3FZZA 2QCYA 1EB1H 3RM0H 1QGFA 1CBWC 3GCHC 3QK1A 1YPLH 1O2ZA 4I8KA 4UD9H 1V2PT 5ETXA 3QTOH 2TRMA 3SHAH 1EASA 1TPOA 2ZFTA 2VVUA 2BDAA 1O2VA 1V6DA 1NN6A 4ZHMU 1O2YA 1GI4A 5E0JA 1SPJA 2A5KA 1V2NT 1EUFA 2OD3B 3SUFA 1VR1H 3A7VA 4XDEA 4PROA 5JPMH 4AGKA 1SHHB 2PV9B 2CJIA 4MNVA 2ODQA 1O31A 2PSYA 2M5TA 4H6TA 4B74A 1GMHF 3S69A 3KIDU 1O2LA 3TJVA 1E34B 3S0NA 1W8BH 4JYTA 5GWZA 3PB1E 1QRZA 2FTMA 3QZRA 1SGFA 3A7ZA 1GJ5H 3HK3B 1NFWA 4WMEA 1G3BA 1HJ9A 1TWXB 1Z8GA 1PPFE 1ZMNA 3GOVB 4NG9H 1JIRA 4WH8A 3GY7A 4XBCA 4Z6AH 3RXCA 2I6SA 3SI4H 3F1SB 5F8XA 1D6RA 4KGAA 1K1OA 4LK4A 1TABE 1NRRH 4FUFA 3GY3A 1D9IA 1L1JA 1GVLA 3GY4A 2A0QB 1LVOA 3M61U 1B0EA 3A7WA 1QB6A 3T29A 4RSPA 1PPGE 1ABIH 2BQ7B 1W0YH 2OC1A 5DP3A 5BPEA 4X8UH 2C8ZB 3A8CA 5EPYA 2FESH 2NU3E 3SNEA 3OTJE 1C4U2 4I31A 3OSYA 2XBVA 2AGIX 1F2SE 3M3VA 2HALA 1W11U 2D8WA 1AN1E 3RLYH 3RM2H 1MCTA 3ODFA 4E06H 1SL3A 2EI6A 3SU2A 2VIDA 2ULLA 4CHAC 1SQOA 2VVCA 3KHVA 2XNIA 4NIWA 2FLRH 2VU8E 2F9BH 1AI8H 2GCHG 4CBOA 1C5OH 3D62A 4OS2A 2A4RA 1SG8B 4ZKRU 2PGBB 1LVBA 2BD9A 1C2IA 1K1JA 2ALPA 1BT7A 3H7TA 5I25A 3T26A 1KYNA 5E2PA 3O8RA 2FOGA 3F9HA 2BDYA 2SFAA 1V2QT 3VB4A 4GHQA 1S85A 1QTFA 1DS2E 1AFQB 2Q6DA 3P8FA 1AO5A 5H4IB 3P8OA 3GDVA 2Z3CA 3ZZDA 1GBLA 1OWDA 1OP8A 3LC3A 1DLEA 1QL7A 1C1NA 1OXGA 1TALA 4AFSA 2SNVA 2WPKS 3A8AA 1O2UA 1TIOA 2Z94A 5F8TA 4FVDA 1A5HA 1MQ6A 1ELVA 1TQ0B 1O3IA 3W95A 8ESTE 2PFEA 5B6OA 2XRCA 3R3GB 3MTYA 2Z9LA 3MU5A 2ANKH 1EP5A 4D9RA 1VCWA 1TBZH 1SLVB 1CGJE 2GZ7A 3VB5A 4F49A 2HNTC 3SU0A 4D8NA 4JCNA 1DXPA 1G3DA 3D65E 1NPMA 3RMNH 1MTUA 4AFUA 1HAXB 1UVOA 2TGAA 1A0JA 2A2QH 1T8NA 2FS9A 3BEUA 2AIQA 1KIGH 3M3SA 1TRNA 3B9FH 4ABBA 3GICB 3M36A 1WTGH 4INLA 3MHWU 1E35B 2ZI2H 2AMDA 4BAQB 4JZEH 1SOTA 4GAWA 4MQAA 5K0HA 2YOLA 1GBFA 1HNEE 1E38B 3DA9B 4KELA 4TWWA 1VCPA 3TK5A 1FUJA 1BA8B 1DUEA 4Q2KA 1UTLM 4CR9A 4IGDA 3G01A 2HLCA 1GHXH 1K1NA 2DE8A 1W13U 2BOKA 3RXIA 1Q31A 1OYQA 4O03A 1ID5H 3U8OH 1RRKA 3T27A 2UUYA 3SI3H 4E05H 2QIQA 3CS0A 1YPJH 1BUIA 1UK3A 3ELAH 4ZROA 3SNBA 2A5AA 3UREA 1CBWB 3GCHB 1ELEE 2VIWA 5LPFA 4MPXA 2HRVA 1KY9A 1L2EA 2EA3A 1GBAA 1NU7B 2YNBA 1O3MA 1DT2A 1PPEE 1C5QA 2P3TB 1FY5A 1D6WA 3SJ8A 5ABWA 3ZVAA 1NM6A 2YNAA 4BTTB 1BMLA 8KME2 4MPVA 5AHGH 1N1LA 3MO3A 1TOCB 1BTUA 5DJ7A 5J4QA 1EZXC 5EGMA 1KTSB 1O5AB 4CRDA 3RMMH 1PQ8A 5A8YA 3QN7A 1GMCG 4KTCA 4U30A 1MKXH 1SFQB 2Z6BD 1ELAA 3NKKA 1AZ8A 4LZ4B 1Z1JA 2ZIQH 1DX5M 3VXEH 4MNXA 4UONA 3BTKE 3QGJA 4AOQA 1DPOA 1HAZB 1ZJKA 5C2ZA 2ZHQH 3P70B 1L0ZA 1QURH 2GCTC 4ISHH 1DDJA 1SHYA 3ZYEA 4O3UA 1HJAC 1HLTH 4ZAEA 4VGCB 1QY6A 4MNYA 1O3DA 5F6MA 1EOJA 1ETTH 1YPMH 4AZ2B 3ZZAA 1ZR0A 5EXMA 4A1VA 1O38A 1CQQA 1Y3VA 3GISB 3BEIB 1QJ6B 3SJIA 1AZZA 3TNSA 2TIOA 3RXLA 3NWUA 1XX9A 4ZHAA 1TBQH 1S81A 3UPEA 4DW2U 1AMHA 1TRMA 3DUXH 4DGJA 2ILNA 2O8MA 1P57B 1QRWA 3Q3XA 1K1MA 4O9VA 1GMHG 4TWYA 2CN0H 2VVVA 1ZRKA 2R3UA 2BD2A 3A7TA 4BXSA 3KCGH 2G52A 2Q6FA 2A4QA 3ATKA 1AB9B 1TX6A 3LT3A 3ATLA 4NGAH 3NK8A 5DG6A 3PLKA 4X2XA 1P01A 1O2QA 1O35A 1TA6A 2XYAA 3RXTA 1BMAA 3URDA 2FDAA 1GWAA 1GJDB 1HV7A 1BBRE 1GJ8B 3ZVFA 3BV9B 2C8YB 1C5PA 5EXNA 3UOPA 1QBOA 2ZQ1A 3GCTG 1ZTKA 1GI7B 1SB1H 1TQ7B 3RXGA 3A8DA 2BVXH 2VINA 5L30H 2PUQH 3OU0A 4FUGA 1C9PA 1G2LA 1Z71A 3PTNA 1U6QA 1C1QA 2BYAX 1G30B 3RXJA 2BMGB 2JH5D 5EQSA 3RXFA 4TYDA 3QX5H 3T28A 2Q6GA 3K65B 1HB0B 1YPKH 2RDLA 2WPJS 1SQAA 4THNH 1C5YB 2IJOB 3SGBE 2HGTH 1F7ZA 2FX4A 1LKBA 4K3JA 1ETSH 1HXEH 1THPB 4JZDH 1PPBH 4OGXA 2OXSA 1TA2A 4AX9H 4YOGA 3CENA 3SUGA 3FANA 2FOHA 4E7RG 1SI5H 1HAIH 3S9BA 1EPTC 3MU4A 4IS5A 4ZKOU 2ZGXH 3SV9A 3MNXA 1YBWA 4X2VA 1IHTH 4JMYA 3MYWA 3RXEA 4DIIH 3K6YA 3I77A 1O39A 3F6UH 2HNTF 2OC8A 1C5WB 3MU0A 3SGQE 1GJ6A 1MKXK 1QJ7B 3E0PB 1E0FD 1C1RA 3HGPA 2QXHA 4TPIZ 4QT8C 1TNJA 5DP4A 4Q7ZA 1BJUA 4IN2A 3AAUA 3SORA 2F9UA 3KQDA 1KDQB 2OLGA 1V2JT 1WCZA 2J38A 5EG4A 1JXPA 3O8DA 5FX6A 2BLVA 2SGFE 1GMDF 4CH8B 1P9SA 1EQ9A 2BLOA 1CA0C 3EDXB 4Q80A 5EODA 3TH3H 1HAOH 3L33A 2BXUH 1H9IE 5C3NA 1O32A 1O2XA 4ABJA 1ESAA 2A7HA 1P2JA 4X1QU 1UVUH 4ESTE 4FUIA 1AIXH 3RXDA 3SV2H 4DURA 3M5LA 3A87A 2XBXA 3PMAB 2GZ9A 3KQBA 1FMGA 1ABJH 5JBAS 2F9NA 3LOXA 4HI3A 1T4UH 1A3BH 1BIOA 2R9PA 3TNTA 2SGQE 1RIWC 1ANEA 3M5OA 4JZ1A 1BHXB 4ABDA 4Y0YE 3TGIE 2XWBI 1D4PB 1GHWH 1ARCA 1AE5A 3QZQA 1O3EA 1AWFH 1BHXF 4FUHA 4ISNA 2PW8H 6ESTA 1D3TB 3SO3A 2XBWA 2WV4A 3KQCA 1Q3XA 2ZDNA 1IQEA 1WQVH 2SGEE 1EZSC 1FDPA 3BIVH 1K9OE 1KDQA 2BXTH 3VXFH 1KTTB 1RTLA 1YM0A 4WXVA 5FPTA 5F03A 1KLTA 1T8MA 3LH3A 5F8ZA 1QL9A 3MNCA 3V3MA 2LNCA 2ZCHP 3BIUH 2XC5A 3K2UA 5EOKA 1SGPE 4MPUA 3QWCH 1S6FA 2A32A 4D7GA 3TH4H 2FS8A 1O2NA 1W0ZU 2WYGA 4Y7BA 1HJAB 4X2YA 3TITA 3L6PA 1P2IA 1EX3A 1P04A 1CHOF 1P2KA 3ATIA 2O8LA 1P9UA 2BY8X 5TCCA 3SQEE 1YCPK 1SBWA 5SGAE 1GBMA 1LPZB 1C1VH 1FIWA 1WAYB 1VGCC 1XVOA 2PWXA 3LDXH 4YLUA 1RD3B 1UTMA 2BX4A 3DT0H 4DVAU 5AFYH 1YF4A 2NU4E 1K21H 4NWKA 3RLWH 5T6GA 1VITF 4YO9A 4Y8ZA 1QRXA 2ZDKA 1ARBA 2UUKB 5I46H 2OINA