1KDQA

Crystal structure analysis of the mutant s189d rat chymotrypsin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
130
structure length
130
Chain Sequence
VNGEDAIPGSWPWQVSLQDKTGFHFCGGSLISEDWVVTAAHCGVKTSDVVVAGEFDQGSDEENIQVLKIAQVFKNPKFNMFTVRNDITLLKLATPAQFSETVSAVSLPNVDDDFPPGTVCATTGWGKTKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CHYMOTRYPSIN B, B CHAIN
publication title Three Dimensional Structures of S189D Chymotrypsin and D189S Trypsin Mutants: The Effect of Polarity at Site 189 on a Protease-specific Stabilization of the Substrate-binding Site
pubmed doi rcsb
source organism Rattus norvegicus
total genus 14
structure length 130
sequence length 130
ec nomenclature ec 3.4.21.1: Chymotrypsin.
pdb deposition date 2001-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1kdqA00
1GHBF 2SGQE 3Q3KA 3QLPH 4BOHA 1L0ZA 2BDHA 1O2IA 2GCHF 3U1JB 1DY9A 3C1KA 1GI6A 3RUOA 5JPMH 4B74A 1Z1JA 2JH6D 3EA9A 2K1QA 2P93A 4MNXA 1KIGH 3UWIA 5JB8S 4M7GA 5GCHF 4TYDA 2AGEX 1FXYA 5EW1H 3TH3H 2UUYA 3GOVB 5DP8A 1V2VT 3MNBA 1QRZA 4BAQB 2G4TA 4E05H 3NCLA 1TPSA 1FONA 1TOCB 5JBTA 2ZGHA 1TRYA 1IQFA 1Q31A 1UCYK 2UUJB 3OY5U 1B7XB 1HAXB 5L6NH 1XVOA 1IQGA 2FLBH 3U98H 3S69A 3PMBB 5I46H 1SSXA 1O5CB 2BD2A 1SGTA 3GY7A 1ZOMA 2NU4E 4AB8A 8GCHG 3SU1A 2Z9LA 3SNAA 1C4V2 5HXFA 1PPHE 1ZJKA 3OSYA 2HOBA 1Z8IB 2ANKH 1NFUA 2BY5X 1BBRH 3SW2B 1O3NA 3SU3A 1LQDB 3SI3H 2ZU3A 1L4ZA 1MQ5A 1BRAA 4TWWA 1ID5H 6CHAB 3UR6A 1W0YH 1BTPA 2BY6X 3A85A 5HMAA 2B5TB 2CF8H 3ZVGA 1WQSA 5EPNA 3TPIZ 2GT7A 2HWLB 3E1XB 4Y71A 2VH0A 1C1MA 3KL6A 3V0XA 1F0TA 3RC6A 3A84A 2ZWLH 1LPKB 3BTHE 1EZUC 1P0SH 1MCVA 1TX7A 3O8RA 3OU0A 3QGJA 1ELGA 1GJ9B 1GJ6A 4I8KA 1TPOA 3BF6H 1OS8A 1P12E 2QYIA 3HKJB 1O2YA 1C5VA 1GPZA 1V2KT 2BDCA 1C5MD 2QXIA 1C2LA 2A4OA 6GCHG 3KNXA 1HAIH 1IQJA 3A8CA 5FBEA 2IOTA 4CRBA 2VGCC 3UTUH 1RFNA 5TCCA 1SR5C 3DD2H 2AGGX 1DFPA 3RMMH 1LHGH 2GT8A 1SL3A 2BD9A 3EE0B 1B0EA 2JKHA 4YLQH 3Q77A 4LK4A 1ZMJA 3ODDA 1DITH 3CS0A 4MPUA 5FPYA 1V2RT 2P3UB 3BTEE 2BDAA 1GMCF 2H1UA 1CBWB 1HIAB 1ZHRA 3P8NA 1GJ7B 2PR3A 1AKSB 1EUFA 1RJXB 1J8AA 3TGJE 1FY3A 4J2YB 4Y11E 3V7TA 2QAAA 3ZZ3A 1GG6B 1XXFA 1C5XB 2VNTA 2VH6A 5JB9S 5GWZA 2A2XH 1SGRE 3BG4B 2NU2E 3E6PH 4BAKB 3PYHA 3QUMP 2ULLA 1O2SA 2AEIH 1O2HA 1XUKA 3F9EA 2J34A 4ISLA 2VIDA 4JZDH 1AO5A 1O2TA 3T25A 4B73A 1NESE 1Y8TA 1ANCA 1ABJH 5C3NA 2R0LA 2YNAA 1OWDA 3URCA 2UWLA 2F91A 1ZHPA 2ODYB 3EYDA 4XBDA 2A45B 5LPEA 5ETXA 1GBLA 4X8TH 2ILNA 3B8JA 2RG3A 2I6SA 4I8JA 4K2YA 1QBVH 4PROA 3RLWH 1TGCA 4GLYA 4U01A 1O38A 2ZTYA 1GBHA 4INLA 4NIVA 2OQ5A 1NRQH 5J4SA 1EP6A 1EOJA 1YPGH 4MNWA 4VGCC 1MTNB 5E8EH 5DKMA 3K65B 3ZVDA 1WV7H 4X8SH 2GZ8A 4XBCA 1BHXF 1HFDA 1SGNE 4DT7B 3F9GA 1Z6JH 1AY6H 1QGFA 1Y3UA 2XCFA 2P16A 2LPRA 1J17T 1F5RA 4ABBA 4WY3A 1GGDB 2ZFSA 2CHAB 1AUJA 1VGCC 5FPSA 4DY7B 2O8UA 1H8IH 1IHTH 1MKWH 1OP2A 1UTNA 4ZAEA 1ZRKA 3M5OA 1YF4A 1HJ9A 1J15A 2AMPA 4Q7XA 1O35A 1UVOA 2FP7B 1CE5A 1JRSA 4ABAA 2JH0D 5EU8A 1HYLA 2ZI2H 1L1NA 1DVAH 2FZZA 3CS7A 1FY8E 4F4OC 1QB9A 3ZZ4A 1OWEA 1P3CA 3KQBA 2WPHS 3OX7U 3ATMA 1LO6A 2OD3B 1Q3XA 1QBOA 2FI4E 3LDXH 3DFLA 4Q7ZA 3UQVA 1MD8A 4JK6A 2FLRH 1O5DH 3MNCA 1QCPA 1PQ7A 1VCWA 7ESTE 1T8NA 2HNTC 3ZYEA 1M9UA 5EQRA 1EASA 3QK1A 4FUCA 5A8YA 1YLCA 4OS1A 4CHAC 1EATA 2SGEE 3SUDA 3UOPA 2XCNA 4LXBH 4D76A 1RTFB 2XBVA 2GV7A 3UWJH 5DP3A 1GMHG 4AOQA 3MH4A 3HKIB 1EX3A 2RDLA 1YPJH 2O9QA 1H8DH 2FO9A 4Q7YA 3M61U 1LHDH 4WJG2 2G55A 3MOCA 1SOZA 2PWXA 1AZ8A 3TLOA 3DFJA 4WMFA 2OINA 1WQVH 1ZPZA 1GBCA 1P2JA 4J1YA 4ZH8A 1JMOH 1FMGA 1VR1H 4LOYH 2SGDE 2OTVA 5AFYH 1P2OA 2GCTB 1O32A 2J94A 3HGPA 1UK4A 2JH5D 3W94A 1EPTC 1G3BA 1T32A 1B0FA 4X2YA 1H9IE 4WMEA 2OC7A 2GKVE 2ZHDA 4MPXA 4FUDA 8GCHF 2STBE 3E0PB 4CREA 3VB3A 2ZA5A 3KN2A 3QX5H 2A4QA 2OXSA 4OS2A 1PPBH 3T28A 4Y7AA 1T4VH 2BLVA 1LPZB 2ZU2A 4DVAU 1HV7A 3RC5A 4OS5A 2BLQA 1HAPH 4ZHLU 8KME2 3QTOH 4CR5A 1BTZA 3G01A 3H7OA 2GP9B 1TNIA 1O33A 1THSH 3ITIA 3U8OH 1D3TB 1HAHH 3SNEA 1XXDA 4WMDA 1FI8A 1C5UA 3PTBA 3RM2H 1O2UA 3KHVA 1QURH 2BX4A 5FXLA 1O2KA 2WINI 1WAYB 2GCHG 2P95A 3SUEA 5L30H 2RA3A 3VB5A 3M3VA 1MTSA 3K2UA 1TB6H 1PPEE 2W3IA 3M35A 4IC5A 4Y0YE 1G9IE 4HGCA 1DE7H 1RTKA 2FODA 3SHCH 6GCHF 1FLEE 3QTVH 1GJBB 1J16A 2KAIA 3FFGA 2G52A 2OC0A 4R8TB 1AD8H 3A7VA 1SHYA 3FP6E 1ARBA 1GBMA 1KLTA 1LTOA 2O8MA 4JK5A 4YOGA 4X8UH 3Q76A 1HAOH 2C93B 1DT2A 1O3CA 3V13A 1C2JA 1EZXC 1UTOA 1MAXA 1K1JA 1GJCB 2BTCE 4Q80A 1XKAC 3UNSA 1Z8JB 1A2CH 2B0FA 2FS9A 4FUFA 1K21H 1C1RA 3F6UH 1HXFH 4Y76A 3HK6B 2ZP0H 3M36A 1ELFA 2BDIA 3UREA 1DDJA 2A0QB 2A7HA 2FI3E 4AZ2B 1EZSC 2PKSC 5C1UA 4GSOA 1BHXB 3C27B 3P70B 2ZKSA 1YPEH 3O8BA 2EI7A 1TBQH 4DOQA 4O3UA 1UTQA 1DS2E 2FYQA 1C5NH 1ZGIA 1S84A 1WOFA 5HM2A 1YKTA 1P01A 1LVBA 4AB9A 1YM0A 5EPYA 1FPHH 2HGTH 1XVMA 1IAUA 3N7OA 4XFQA 5CE1A 2TRMA 4WVPE 4XOJA 2FIRH 2ZTXA 1S81A 2VINA 4UONA 1Z6EA 1S85A 3RXVA 3BG8A 1IOEA 1DM4B 4FUIA 1CGJE 1C5SA 2VIOA 2O8WA 1NU7B 1DWDH 1ZR0A 3ZVAA 4O97A 1W14U 3FZDA 1OSSA 1A0LA 2Y6TA 4ZROA 1ZMLA 4B2BA 1L2EA 1UHBA 1CA8B 2QY0B 1DX5M 3CENA 5EOKA 3VPKA 4ZKSU 1ELAA 4IS5A 3S7HB 5JDUB 3BN9A 3SV7A 2B8OH 2XC5A 3SJOA 3GY6A 1OP0A 2WPKS 3SV6A 1TX8A 1TOMH 3NPSA 1ZTLA 3O8CA 3OYPA 1HJAC 2HPPH 1UK2A 3T62A 2SFAA 5DO4H 1IQNA 2F9VA 2GZ9A 1GHVH 1GBAA 4A5TS 1ANBA 1W12U 1C5PA 2HNTF 1Z1IA 1KYNA 3FVFB 3HPTB 1P05A 4NWLA 2BXTH 1VZQH 1K1PA 1ELBA 3BTGE 5T6DA 2CF9H 9ESTA 3A8DA 3RXGA 1QY6A 1LPGB 2QA9E 2A31A 4H6SB 4BTUB 1PFXC 4UD9H 2DE9A 4ZHAA 2Y7ZA 3RU4E 3QWCH 2AS9A 3M5MA 3VGCB 2GVFA 2BOKA 1UCYE 2G81E 4AFUA 2TGDA 2QV1A 1AVWA 2VWMA 2P3TB 2RA0A 4UFFH 3NKKA 1O2ZA 3F9FA 1GMHF 2ZCKP 2WV4A 1KXDA 1NN6A 3SOSA 1P57B 2TPIZ 3DUXH 1HAVA 1A5GH 3ESTA 3PWBA 1K28D 2O8TA 3PO1C 1HCGA 3H5CB 1FIZA 3LGTA 3ZZ6A 4IMZA 1BTUA 1QB1A 1TNLA 1GCTC 2XXLA 2Z3EA 3PMHB 2NU3E 2XTTB 4CR9A 1AUTC 3A86A 2H2ZA 2OBQA 2VGCB 2ANYA 2FESH 1C1SA 1C1TA 4TPYA 2H9HA 2ZGJA 1LVYA 2BVXH 1A4WH 1T31A 3ZZBA 4FU8A 4AG2A 4DCDA 2R9PA 1TGBA 3STJA 1C2GA 1F5LA 1V2WT 1XMNB 3PMJA 4OS7A 4X6MA 5AF9H 2R3UA 3EA7A 1N6YA 1P9SA 4KTCA 2CGAA 1MU6B 3S9BA 2GTBA 1E36B 3UQOA 1BA8B 1TRMA 3BV9B 3M7QA 5FCRA 4IBLH 5LPRA 4O9VA 4UDWH 1ZPBA 2PTCE 2WPMS 1C1WH 1QA0A 1RS0A 3H7TA 1ESBA 1EAWA 5EXNA 1PPCE 1V2QT 4SGBE 4F49A 3TGIE 1AFQB 3FP8E 3P6ZB 4JZEH 4WH8A 1NS3A 2P8OC 1S83A 2HRVA 5DP9A 4YOIA 2V3OH 3RXFA 3MU8A 1TGSZ 3FP7E 1W0ZU 1HGTH 2VIVA 3TH2H 1AE5A 1O3IA 2ZFRH 1H1BA 3SNCA 3MU1A 1DSUA 3ATWA 2H6MA 1AGJA 3BTFE 1H9LB 3RXLA 3T2NA 4A1XA 3S9CA 1V2PT 4X1RU 1NFYA 3T26A 1D3PB 2PUXB 3SU0A 2Q6GA 3PLBA 1UO6A 3GY4A 1P2NA 2EI8A 4K8BA 2FOBA 2P94A 1SQOA 2BHGA 2JETC 3KF2A 3LGIA 5A09A 3EA8A 2QGRA 4D7FA 5FCKA 4O3TA 3P92A 1TYNA 1O3MA 1AIXH 5GIBA 1ZYOA 5GXPA 2Z9KA 1TWXB 1BCUH 3UNQA 1NU9A 4K60A 3SNBA 1F0RA 1ACBE 1SQTA 2M5TA 1VGCB 4JZFH 1LCYA 1NROH 1ZJDA 2ZPSA 4CRDA 1O2GH 2V3HH 1CU1A 2A7JA 5E0HA 1MMJN 3SGBE 1EAIA 4CRAA 4A1TA 2FTMA 1G37A 1ORFA 1UVPA 2H5CA 3E16B 4NA8A 2A4GA 3LGVA 3FANA 3RU4D 2RCEA 4HFPB 1MKXH 1VITH 3FZZA 1MZAA 5B6OA 2F9OA 1TNHA 1F0SA 1NRPH 3ATKA 1P3EA 1A5IA 1FN6A 1O2QA 1G2LA 1Z71A 1A1RA 5FAHA 5GPIB 1GVLA 2CN0H 2ZFTA 1CA0C 4JMYA 4NSVA 1TA2A 3MH6A 2PGBB 5BRRE 1GL0E 1SLUB 5DP6A 1CT2E 4B71A 3MNXA 1GBTA 4BAOB 2C8XB 1A7SA 1OP8A 1OOKB 2ZGCA 3RLYH 2QCYA 1NM6A 4CHAB 4IN1A 3SZNA 4X2XA 2Z9IA 2IPHA 2BY8X 1CVWH 2BB4A 1FDPA 3R3GB 2R3YA 1MQ6A 4A6LA 2OBOA 2W7UA 4JZIA 1GI1A 1O2VA 4SGAE 3P95A 4INKA 1PYTD 3I77A 1Z7KA 3RXCA 4AYYB 4Y79A 2OC1A 1W11U 1OXGA 3BIVH 3ZZ7A 1XX9A 1A46H 5AFZH 3SN8A 1JBUH 3SV2H 3BTME 3A88A 1TNKA 3E0NB 3MNSA 3MYWA 5EW2H 4ZKRU 3GCTF 4MNYA 3TJOA 3GY3A 1TX6A 1UTJA 1ZTKA 1H9HE 1LMWB 4HTCH 2ALPA 3LGUA 3RMOH 1EPTB 3IITA 2D1JA 1BRUP 4D9QA 3BTQE 4TPIZ 1P8VC 2V0BA 1O3GA 3W95A 3A7YA 3Q3XA 5AVDA 1WTHD 3A8AA 4YESB 2AERH 1IQHA 1GBKA 1LQEA 4MPVA 5AHGH 2A2QH 1A3EH 2A5IA 4Y8ZA 2C8YB 4IGDA 1GHZA 1KXCA 2ZHWH 3GYMA 5DK1A 3ZYDA 1UMAH 2PUQH 1XUGA 1D4PB 4B2AA 1NRNH 1BITA 1JIRA 1UVUH 3RXIA 1QRWA 3ZVBA 2ESTE 1HBTH 3RXHA 1C5ZB 1SLXB 2WUBA 5TJXA 3ZZ8A 1Y5BT 3QDZB 1FY1A 1GI4A 4IW4E 3S7KB 1GDUA 3L6PA 2AH4X 4X6PA 3V12A 3RXAA 2FI5E 2ZO3H 3SI4H 1A3BH 1GJ5H 1UJ1A 2F83A 2ODPA 4JYVH 4X2WA 2ZPQA 3PM3A 1J14A 1K1OA 3JZ2B 3RC4A 3STIA 1E37B 2J92A 1BRCE 3K6ZA 3RXMA 6CHAC 2XRCA 2Z9JA 4K8YA 5A0CA 2ZDAH 4MVNA 4THNH 2GD4B 2Y81A 5DP4A 1SG8B 4MG3A 4AFSA 5H4IB 5DG6A 3MU4A 5E2PA 1G36A 1AQ7A 3SU6A 1EQ9A 5PTPA 8ESTE 4GVUA 5CHAB 1D6WA 4WXIA 2C90B 2ZEBA 3BEIB 3P8OA 1W10U 1BIOA 3QO6A 3MMGA 2F9NA 3KEEA 2AGIX 2ZPRA 1MTUA 2R2WU 4ABEA 4I31A 3EDXB 2W5EA 2FS8A 4KTSA 1SGIB 5C2ZA 4RN6A 3RXUA 4MDSA 4DW2U 1T8OA 1KTSB 1SFQB 3URDA 1BB0B 1CBWC 1CT0E 1PPGE 1UCYH 1ZRBA 1XM1A 1K1LA 4MPWA 4DIIH 4RKJB 1TLDA 3F68H 4ABDA 2A32A 3EGKH 3A80A 3B9FH 5K7RA 1YCPK 1OYTH 1KXEA 3SHAH 3VB6A 1HLTH 1VCQA 2Y5HA 3TNSA 3GY2A 1RD3B 1BJUA 1ELVA 1GBIA 1RIWC 3P8GA 1W7GH 1LVMA 2OUAA 4TY7A 2VU8E 4JYUH 4BAHB 2Z7FE 4X1QU 4ZXYH 3SV9A 2ASUB 1Y5AT 1MBMA 1KDQB 2TGAA 4I8GA 1SGCA 3GICB 3F1SB 4U30A 4KGAA 3ODFA 3GCHC 1GHWH 3NWUA 4AX9H 3AASA 3IWMA 1FPCH 3U9AH 1YPHC 1C9TA 1S5SA 2WPLS 3SUGA 2BLOA 1TABE 1CGHA 3DA9B 4X1SU 5ABWA 2Q1JA 1C1UH 1MTNC 1WU1A 3KQDA 3BTTE 3LT3A 5EXLA 3SUFA 1HIAA 1GI3A 1HJAB 5G4BA 1AKSA 1GI0A 1MTVA 2Q6DA 1C5OH 1INCA 4K1SA 4ZKNU 3KCGH 2G00A 1ZSJA 5C5OA 3I78A 1GVZA 1T8LA 1TQ7B 4K69A 3LJOA 3SGQE 1GGDC 5F8TA 1D3QB 1K9OE 3UOUA 1DSTA 5L2YH 1XUJA 2ZCLP 3U69H 4A92A 1V2TT 2IN2A 2ZHFH 1TRNA 3PB1E 1DANH 1C1QA 1NY22 5F8XA 3B23B 4D8NA 1HAYB 1SHHB 5A8ZA 1ESTA 2FPZA 1C2KA 5FX5A 1BMLA 4WH6A 4X2VA 1P11E 2O8LA 4DIHH 1O2RA 1ETSH 1TA6A 4E7NA 3D23A 3UPEA 1RRKA 4KELA 2FOGA 3SU2A 3V3MA 2PLXA 2ZHQH 2B7DH 1TBZH 4BXSA 1UTLM 1V2OT 2W26A 1O2OA 4X6OA 1SC8U 1SI5H 1V2NT 3TK9A 2XNIA 3PROA 1C2EA 3D49H 1AI8H 1K1IA 4JZ1A 1DXPA 4NIXA 4YM9A 3AAVA 4GAWA 5HYOA 4NWKA 4ISHH 4FUGA 1DWBH 1NFWA 1SLVB 3ATLA 5E2OA 4ASHA 2VJ1A 3HATH 3KGPA 3M37A 5GDSH 3GCOA 5T6GA 1WBGB 1WYKA 4GCHG 3UIRA 4K5ZA 3BEFB 1QIXB 4TY6A 1P2KA 1G3DA 2C8WB 1Y3VA 5FHTA 1AWHB 2GGVB 3RMNH 2H9TH 4BANB 3LKWA 1MAYA 1PJPA 1S0RA 3GDSA 3M5NA 1KLIH 1OYQA 3MHWU 5L2ZH 4UEHH 2H9EH 1EAUA 2J38A 1YCPM 1MCTA 3RXTA 1K1MA 2GMTC 2G4UA 1ABIH 2G5NA 3ENSB 1DY8A 1TNGA 1O2NA 4I33A 3HK3B 1PPZA 2BX3A 2PV9B 1AE8H 2GV6A 5DJ7A 3F9HA 1ZSKA 1GBEA 1QQUA 4OS4A 4ESTE 1N1LA 1V2MT 2ZQ2A 3TNTA 3LH3A 2UUKB 3GDUA 1TMBH 1YYY1 3UY9A 2P8OB 5J4QA 2NU1E 1YP9A 1HPGA 2QC2A 1L4DA 1O3KA 1BDAA 2Z6BD 1GBBA 1P9UA 3VEQB 5E0GA 1F0UA 1NPMA 3LONA 1O2WA 1C1PA 2A7CA 1BUIA 4YZUA 1UVSH 4Y10E 2WPJS 2ZF0H 3GCTG 1K2I1 4I8HA 3ZZDA 2WUCA 1BZXE 3BTKE 1O3OA 4MTBA 2HLCA 3LOXA 3UNRA 2NU0E 3U8RH 1RGQA 1EB1H 3AW0A 4ABGA 1CO7E 4I7YH 1AVGH 3OY6U 1FAXA 4GUXA 1LHFH 1QL8A 1VJ9U 4Y8YA 1P2IA 2JETB 1IQMA 2OP9A 4A1VA 2Y80A 4DJZB 4ISOA 1J9CH 3MO3A 1FY4A 2J2UA 1O5GH 3KIDU 1C5WB 1TMTH 1C1OA 1BTWA 3JZ1B 4AORA 4ZMAH 4D9RA 2Z3DA 1V6DA 2XW9A 4CRGA 1DWEH 1QRXA 1AFEH 3CP7A 2HNTE 2PKAA 5JBCS 1TNJA 3ZZ5A 1EAXA 1SGEE 1O5FH 1ZLRA 2ZGXH 3PLPA 3TK6A 5SGAE 1AWFH 1QHRB 2D8WA 4B76A 5EGMA 1A5HA 1CGIE 1EJMA 4UFEH 3ZZAA 1C1NA 1GI8B 5DGJA 2BZ6H 1EB2A 1GJAB 1P06A 4AN7A 1L1GA 1LKBA 3LIWA 4CBOA 1A0JA 3A7XA 3A7ZA 5C67A 2G51A 1RXPA 1C4Y2 2ZZUH 1ARCA 1MKWK 2YNBA 2ZFPH 1ANEA 2OLGA 1HDTH 1TGNA 1EJAA 1MZDA 2PW8H 2BZAA 1FV9A 3DHKH 2BQ6B 3M3SA 1QFKH 1W13U 1C5RA 1TALA 2VVUA 1GHAG 1G3CA 1ZPCA 3WY8A 1JOUB 3MTYA 1D9IA 3MH7A 2Z94A 3BEUA 3BSQA 4RKOB 1E34B 1D6RA 1DLEA 1KXBA 3GDVA 1UTMA 2EI6A 1S82A 4MNVA 4X1NU 4FVDA 2UUFB 1BTYA 2VIWA 1C5QA 1MBQA 3RXKA 4R0IA 1YGCH 4Y8XA 3ZVFA 1YC0A 9LPRA 1O39A 1YPHE 2WPIS 4BTIB 2G5VA 1HUTH 4OS6A 1G3EA 1O3HA 1UTPA 1Z8RA 5FBIA 2ZIQH 1O5BB 2DUCA 1WCZA 4ISNA 4AYVB 3TVJB 1DXWA 1C5YB 1O0DH 1O3LA 4I32A 2A1DB 3S0NA 4BNRA 1AB9C 3U1IB 1TGTA 1GVKB 1O2XA 2XWAA 2ZDVH 3AW1A 3MO6A 1VITG 2ZDMA 4VGCB 1HB0B 1V2UT 2I6QA 4TWYA 3RU4T 2W3KA 4YT7H 1O31A 5JYIA 1NT1A 2F9UA 3SNDA 1O37A 1C2IA 1QL7A 2CV3A 2F3CE 2F9PA 3RP2A 4AGKA 5LH8A 3VB4A 1YLDA 3PTNA 2ZHEH 3TU7H 4XBBA 1UVTH 1ELEE 1O30A 3LJJA 2FEQH 1QTFA 4HI3A 4QT8C 1O5AB 1GI7B 5ESBA 4XDEA 1F2SE 1OWIA 1V2ST 1ELCA 2BYAX 1MU8B 1SGFA 3UR9A 3VGCC 5A8XA 2VWNA 2B9LA 2VVCA 1BTXA 1GBDA 1IQKA 4MQAA 4AFQA 1C2HA 2ANWA 4FU9A 2NWNA 3D62A 4GCHF 1BQYA 4A7IB 2PHBA 4NSYA 3U8TH 3MU5A 2AYWA 1KXAA 5T3HA 1TMUH 1KY9A 1O2MA 1HRTH 1O2JA 1YBWA 2HALA 6LPRA 3ATIA 1SVPA 1IHSH 4DGJA 1HJ8A 1OWKA 1W7XH 3UUZA 2WYGA 2G8TA 2XYAA 1LVOA 2VVVA 4Q2KA 4NZLA 3A8BA 2TIOA 3GYLB 1O2PA 3A83A 1GI5A 5C1YA 1OKXA 1W3CA 1IQEA 4JCNA 2Y7XA 3TK5A 2XBXA 4ISIH 3SJ9A 2R2MB 1N8OC 2Y5GA 5A0AE 2QIQA 4DURA 2ZU4A 1ZTJA 1GMDG 1Y3WA 1W2KH 3MWIU 1CT4E 1LKAA 3BTDE 1GDQA 2ZU5A 1W8BH 2GX4A 5HM9A 4NIYA 2CMYA 2ALVA 2BMGB 3GY8A 1RIWB 4Y6DA 4FUJA 5HGGA 2KAIB 1EZQA 4H42U 1Y5UT 1AFQC 1A0HB 1AU8A 1G30B 2EC9H 5F8ZA 1ELDE 2FM2A 4WXVA 1GBJA 3LH1A 1G32B 2QN5T 3SU5A 1PQAA 4RSPA 1MD7A 4X0WU 1T8MA 1WSSH 1FUJA 2BD8A 2BVSH 3LPRA 4NFFA 3QN7A 4LZ4B 1IQLA 3NXPA 3GCHB 1E38B 2WV5A 2FX4A 3RXOA 3MI4A 1O3DA 1Q2WA 2HVXA 3A81A 3P17H 4XSKU 3D65E 1A61H 1NFXA 1CHOG 2BD4A 4DG4A 1EKBB 5F6MA 4GHTA 2Z3CA 1ZZZA 4FXGH 1SB1H 3TJNA 7GCHG 2BQWB 4E7RG 2BLWA 3E8LA 2FWWA 3VXFH 2J4IA 5C20A 4K1TA 2BQ7B 1AN1E 2AIPA 5ESTE 1S6HA 1FY5A 3RXDA 5EG4A 4MLFB 1C2FA 4B2CA 4XE4A 1O36A 5C5NA 4BXWA 2FYRA 2J9NA 3DT0H 1QJ1B 1E35B 4FU7A 1V2JT 1K22H 1EP5A 2OCVB 2THFB 4WWYA 1DICA 1BRBE 1GWAA 5DP5A 2C8ZB 2ZU1A 3E91A 1GJ8B 1HXEH 1ANDA 1TE0A 2ZFQH 2ZC9H 1V3XA 5E0JA 2FMJA 1GBFA 1D3DB 3QZQA 1BTHH 1GHAF 2ZDLA 1QJ6B 3RDZA 5EQQA 1DOJA 4CH2B 5IYTA 4NG9H 3IG6B 1UHBB 3MU0A 3TH4H 1GI9B 3LU9B 3MH5A 4I8LA 1ELTA 1Y59T 2A5AA 4IMQA 2PKSB 3T29A 3A89A 3SQHE 2VIQA 1HAGE 1C9PA 1DPOA 3ZZCA 1S0QA 1AVXA 4NZQA 1KSNA 1DUAA 1Y3XA 2GDEH 2V35A 3QGNB 4YO9A 1TPPA 5A2MH 3I29A 1CSOE 1PQ8A 3TJVA 4YLUA 1BT7A 4IN2A 3M5LA 1YPMH 1DUEA 4NGAH 4JYTA 1QNJA 5TCAA 1GG6C 4Z0KA 1DLKB 3PMAB 3Q00A 2ANMH 4GPGA 2SGFE 1ESAA 4HZHA 3SO3A 3BG4C 2BD5A 3HGNA 1ETTH 1NRSH 5A0BA 1KTTB 1QB6A 1RTLA 1VITF 2YOLA 1QL9A 1PYTC 2BD7A 4ZHMU 4NFEA 2LNCA 4IC6A 4BTTB 5EXMA 1P03A 4OGYA 4KTUA 4X1PU 4CBNA 4NA7A 2GMTB 2ZNKH 3SGAE 2F9BH 5F03A 3KQEA 3EAJA 2FOMB 1BBRE 4CRFA 1SMFE 1TBRH 1OX1A 1EJNA 1FN8A 2QF0A 1FZZA 2AFQB 4K1EA 1B5GH 2D26C 2QF3A 4YOJA 1F92A 4U2WA 4FUHA 4Z6AH 1TPAE 1BOQA 1HAVB 3TITA 1Z8GA 2PKAB 2STAE 4YTAA 3SJ8A 2EA3A 2BOHB 1MTWA 2QXHA 4AGJA 1FQ3A 3PWCA 3ZVEA 1THRH 1F7ZA 2PSYA 1C2MA 1GHBG 3TIUA 4Y7BA 4UFGH 5EQSA 2CXVA 2CHAC 3RMLH 3KQCA 4FVBA 4U32A 2IJOB 1BMAA 1O2LA 3K6YA 3BIUH 3LC5A 2ZECA 1SFIA 3K9XB 1BMNH 3TJUA 2C4FH 1O3AA 4ZXXH 3NK8A 2VWOA 1GDNA 2FOHA 1CHGA 1QJ7B 1ZHMA 1P2MA 5GCHG 1P2QA 5JBAS 1O3FA 1SGQE 2FOFA 4E06H 2AMQA 1UTKA 5K0HA 1AMHA 1EPTA 2SNVA 3VB7A 1MUEB 5FX6A 1FNIA 5BPEA 7KMEH 4CRCA 1T7CA 4ABJA 3QZRA 1XUIA 3S9AA 4ABHA 2Z9GA 3SV8A 1E0FD 2DE8A 2SNWA 2VWLA 4FUBA 3PV4A 4AG1A 3GY5A 1GMDF 3PO1B 1N6XA 2R0KA 2ZQ1A 4BAMB 1P09A 1UK3A 5T6FA 1JIMA 5CHAC 2WYJA 1TIOA 1O3BA 5C1XA 1ZGVA 2AIQA 1GCTB 5JBBS 2CJIA 3SORA 2QXJA 3LGWA 2XC0A 3Q3YA 4CH8B 4ABFA 3A7WA 3ZVCA 1BBRK 2GDDA 2FXRA 3MO9A 1SOTA 1OWHA 1SGYE 1SGDE 1JXPA 1C4U2 2W7SA 5EODA 1XKBC 1ZSLA 2FOAA 1GL1A 1ETRH 4FUEA 1K1NA 4ZKOU 1QA7A 4X6NA 3E3TA 2V6NA 5CMXH 3TGKE 3GISB 1SPJA 3FAOA 1P02A 2GCTC 5I25A 4B1TA 4UE7H 1OPHB 3RXBA 1MKXK 1C1VH 1CHOF 2Y5FA 1CQQA 3EQ0H 2SGAA 1P10A 3SJIA 1BJVA 2XBYA 3RM0H 1AHTH 2GZ7A 1YPKH 4D7GA 1C5TA 1O3EA 3AAUA 2BD3A 3OTJE 2VB0A 7GCHF 4NA9H 2ZFFH 3T5FH 4O03A 2HPQH 1XUFA 3M7TA 1MH0A 4WF8A 5FPTA 2BY7X 1TFXA 2BDYA 1DWCH 1YPLH 2FDAA 1PPFE 1FJSA 1JRTA 1KLJH 1GMCG 3AVZA 3VXEH 1FIWA 1WUNH 2XC4A 2XBWA 4OGXA 7LPRA 4ZUHA 1GHYH 8LPRA 1QQ4A 1S6FA 1OWJA 1XUHA 3SU4A 3M3TA 2A5KA 3P8FA 1VJAU 3T27A 1NC6A 1O5EH 5IDKA 1O34A 2FOCA 1ZMNA 2FTLE 4H4FA 1LHCH 2TGTA 1FAKH 1O3JA 2PFEA 1VCPA 2Y82A 3E90B 1SQAA 1AB9B 3M7UA 2PSXA 1SLWB 2P3FH 2EEKA 4B75A 1EOLA 1IQIA 2BVRH 1SBWA 2FOEA 3RXQA 1TQ0B 1NZQH 2BM2A 2FX6A 2ZCHP 4NCYA 5LPFA 2Q6FA 2XWBI 1GJ4H 3LGYA 4LZ1H 3PLKA 1LDTT 2ZTZA 3O8DA 5GJ4B 4K3JA 1Y3YA 6ESTA 2D2DA 2BDBA 1GI2A 1KDQA 1GJDB 2P59A 4X8VH 2OC8A 2BY9X 3RXJA 2ZG0H 2H5DA 3BTWE 5DPAA 4KKDA 1QBNA 1L1JA 1YCPH 2ZGBH 1LHEH 4UFDH 1TAWA 2BXUH 2TGPZ 2TBSA 3A82A 1C2DA 2ZDNA 3NZIA 1JWTA 1G2MA 2UWPA 4INHA 3RXPA 3MFJA 3A87A 1THPB 1EXFA 2ZDKA 4KP0A 1F5KU 4Y0ZE 3ZZ9A 3A7TA 1T4UH 3ZV9A 4YT6H 2ODQA 2C3SA 3UFAA 1KXFA 4ABIA 1NRRH 1GHXH 4NIWA 1CA0B 4H6TA 2SGPE 1TONA 1AZZA 1O3PB 1U6QA 3VFEA 3RXEA 3L33A 1HNEE 1GCDA 3LC3A 5DP7A 2OQUA 1NO9H 1X7AC 4GHQA 3SBKA 1BMMH 1C5LH 1P04A 2AMDA 2PGQB 2UWOA 2VIPA 1NTPA 1WTGH 1H4WA 3SQEE 5LGOA 2J95A 1SGFG 1N8OB 4AFZA 3R0FA 3GCNA 2QXGA 2BDGA 3ZV8A 3L3TA 3NUMA 1QR3E 3ELAH 1SGPE 2PTNA 3RXSA 1PQ5A 3SJKA 3RXRA 2A4RA 1HAZB 1V2LT
chains in the Genus database with same CATH superfamily
5HIYA 1GHBF 2SGQE 3Q3KA 3QLPH 1UW7A 4BOHA 1L0ZA 2BDHA 1O2IA 2GCHF 3U1JB 1DY9A 3C1KA 1GI6A 3RUOA 5JPMH 4B74A 1Z1JA 2JH6D 3EA9A 2K1QA 2P93A 4MNXA 1KIGH 3UWIA 5JB8S 4M7GA 5GCHF 4TYDA 2AGEX 1FXYA 5C94A 5EW1H 3TH3H 2UUYA 3GOVB 5DP8A 1V2VT 3MNBA 1QRZA 4BAQB 2G4TA 4E05H 3NCLA 1TPSA 1FONA 1TOCB 5JBTA 2ZGHA 1TRYA 1IQFA 1Q31A 1UCYK 2UUJB 3OY5U 1B7XB 1HAXB 5L6NH 1XVOA 1IQGA 2FLBH 3U98H 3S69A 3PMBB 1BMFD 5I46H 1SSXA 1O5CB 2BD2A 1SGTA 3GY7A 1ZOMA 2NU4E 4AB8A 8GCHG 3SU1A 2Z9LA 3SNAA 1C4V2 5KECA 5HXFA 1PPHE 1ZJKA 3OSYA 2PP6A 2HOBA 1Z8IB 2ANKH 1NFUA 2BY5X 1BBRH 3SW2B 1O3NA 3SU3A 1LQDB 3SI3H 2ZU3A 1L4ZA 1MQ5A 1YY3A 1BRAA 4TWWA 1ID5H 6CHAB 3UR6A 1W0YH 1BTPA 2BY6X 3A85A 5HMAA 2B5TB 2CF8H 3ZVGA 1WQSA 5EPNA 3TPIZ 2GT7A 2HWLB 3E1XB 4Y71A 2HLDD 2VH0A 2QF5A 1C1MA 3KL6A 3V0XA 1F0TA 3RC6A 3A84A 2ZWLH 1LPKB 3BTHE 1EZUC 1P0SH 1MCVA 1TX7A 3O8RA 3OU0A 3QGJA 1ELGA 1GJ9B 1GJ6A 4I8KA 1TPOA 3BF6H 1OS8A 1P12E 2QYIA 3HKJB 1O2YA 1C5VA 1GPZA 1V2KT 2BDCA 1C5MD 2QXIA 1C2LA 2A4OA 6GCHG 3KNXA 1HAIH 1IQJA 3A8CA 5FBEA 2IOTA 4CRBA 2VGCC 3UTUH 2IPQX 1RFNA 5TCCA 1SR5C 2GJGA 3DD2H 2AGGX 1DFPA 3RMMH 1LHGH 2GT8A 1SL3A 2BD9A 3EE0B 1B0EA 2JKHA 4YLQH 3Q77A 4LK4A 1ZMJA 3ODDA 1DITH 3CS0A 4MPUA 5DSFA 5FPYA 1V2RT 2P3UB 3BTEE 2BDAA 1GMCF 2H1UA 1CBWB 1HIAB 1ZHRA 3KYGA 3P8NA 1GJ7B 1QZ8A 2PR3A 5IK2D 1AKSB 1EUFA 1RJXB 1J8AA 3TGJE 1FY3A 4J2YB 4Y11E 3V7TA 2QAAA 3ZZ3A 1GG6B 1XXFA 1C5XB 2VNTA 2VH6A 5JB9S 5GWZA 2A2XH 1SGRE 3BG4B 2NU2E 3E6PH 4BAKB 3PYHA 3QUMP 2ULLA 1O2SA 2AEIH 1O2HA 1XUKA 3F9EA 2J34A 4ISLA 2VIDA 4JZDH 1AO5A 1O2TA 3T25A 4B73A 1NESE 1Y8TA 1ANCA 1ABJH 5C3NA 2R0LA 2YNAA 1OWDA 3URCA 2UWLA 2F91A 1ZHPA 2ODYB 4DT4A 3EYDA 4XBDA 2A45B 5LPEA 5ETXA 1GBLA 4X8TH 2ILNA 3B8JA 2RG3A 2I6SA 4I8JA 4K2YA 1QBVH 4PROA 3RLWH 1TGCA 3WWBA 4GLYA 4U01A 1O38A 2ZTYA 1GBHA 4INLA 4NIVA 2OQ5A 1NRQH 5J4SA 1EP6A 1EOJA 1YPGH 4MNWA 4VGCC 1MTNB 5E8EH 5DKMA 3K65B 3ZVDA 1WV7H 4X8SH 2GZ8A 4XBCA 1BHXF 1HFDA 1SGNE 4DT7B 3F9GA 3GS9A 1Z6JH 1AY6H 3FO8D 1WDIA 1QGFA 1Y3UA 2XCFA 3WW7A 2P16A 2LPRA 1J17T 1F5RA 4ABBA 4WY3A 1GGDB 2ZFSA 2CHAB 1AUJA 1VGCC 5FPSA 4DY7B 2O8UA 1H8IH 1IHTH 1MKWH 1OP2A 1UTNA 4ZAEA 1ZRKA 3M5OA 1YF4A 1HJ9A 1J15A 2AMPA 4Q7XA 1O35A 1UVOA 2YMSC 2FP7B 1CE5A 4XD7D 1JRSA 4ABAA 2JH0D 5EU8A 1HYLA 2ZI2H 1L1NA 1DVAH 2FZZA 3CS7A 1FY8E 4F4OC 1QB9A 3ZZ4A 1OWEA 1P3CA 3KQBA 2WPHS 3OX7U 1YLNA 3ATMA 1LO6A 2OD3B 1Q3XA 2KFWA 1QBOA 2FI4E 2KM0A 3DFLA 3LDXH 4Q7ZA 1MD8A 4JK6A 3UQVA 2FLRH 1O5DH 3MNCA 1QCPA 1PQ7A 1VCWA 7ESTE 1T8NA 2HNTC 3ZYEA 1M9UA 5EQRA 1EASA 3QK1A 4FUCA 3VG8A 1YLCA 4OS1A 5A8YA 4CHAC 1EATA 2SGEE 4RT1A 3SUDA 3UOPA 2XCNA 4LXBH 4D76A 1RTFB 2XBVA 2GV7A 5HIZA 3UWJH 5DP3A 1GMHG 4AOQA 3MH4A 3HKIB 1EX3A 2RDLA 1YPJH 2O9QA 1H8DH 2FO9A 4Q7YA 3M61U 1LHDH 4WJG2 2G55A 3MOCA 1SOZA 2PWXA 1AZ8A 3TLOA 3DFJA 4WMFA 2OINA 1WQVH 1ZPZA 1GBCA 1P2JA 4J1YA 4ZH8A 4FOUC 1JMOH 1FMGA 1VR1H 4LOYH 2SGDE 2OTVA 5AFYH 1P2OA 2GCTB 1O32A 2J94A 3HGPA 1UK4A 2JH5D 3W94A 1EPTC 2J97A 1G3BA 1T32A 1B0FA 4X2YA 1H9IE 4WMEA 2OC7A 2GKVE 2ZHDA 4MPXA 4FUDA 8GCHF 2STBE 3E0PB 4CREA 3VB3A 2ZA5A 3KN2A 3QX5H 2A4QA 2OXSA 4OS2A 1PPBH 3T28A 4Y7AA 1T4VH 2BLVA 1LPZB 2ZU2A 4DVAU 1HV7A 3RC5A 4OS5A 2BLQA 3OEED 1HAPH 4ZHLU 8KME2 3QTOH 2WV9A 4CR5A 1BTZA 3G01A 3H7OA 2GP9B 1TNIA 1O33A 1THSH 3ITIA 3U8OH 1D3TB 1HAHH 3SNEA 1XXDA 4WMDA 1FI8A 1C5UA 3PTBA 3RM2H 1O2UA 3KHVA 1QURH 2BX4A 5FXLA 1O2KA 2WINI 1WAYB 2GCHG 2P95A 3SUEA 5L30H 2RA3A 3VB5A 3M3VA 1MTSA 3K2UA 1TB6H 1PPEE 2W3IA 3M35A 4IC5A 4Y0YE 1G9IE 4HGCA 1DE7H 1RTKA 2FODA 3SHCH 6GCHF 1FLEE 3QTVH 1GJBB 1J16A 2KAIA 3FFGA 2G52A 2OC0A 4R8TB 1AD8H 4TT3D 3A7VA 1SHYA 3FP6E 1ARBA 1GBMA 1KLTA 1LTOA 2O8MA 4JK5A 4YOGA 4X8UH 3Q76A 1HAOH 2C93B 1DT2A 1O3CA 3V13A 1C2JA 1EZXC 1UTOA 1MAXA 1K1JA 1GJCB 2BTCE 4Q80A 1XKAC 3UNSA 1Z8JB 1A2CH 2B0FA 2FS9A 4FUFA 1K21H 1C1RA 3F6UH 1HXFH 2JDID 4Y76A 3HK6B 2ZP0H 3M36A 1ELFA 2BDIA 3UREA 1DDJA 2A0QB 2A7HA 2FI3E 4AZ2B 1EZSC 2PKSC 5C1UA 4GSOA 1BHXB 3C27B 2WHXA 3P70B 2ZKSA 1YPEH 3O8BA 2EI7A 1TBQH 4DOQA 4O3UA 5FL7D 1UTQA 1DS2E 2FYQA 1C5NH 1ZGIA 1S84A 1WOFA 5HM2A 1YKTA 1P01A 1LVBA 4AB9A 1YM0A 5EPYA 1FPHH 2HGTH 1XVMA 1IAUA 3N7OA 4OM9A 4XFQA 5CE1A 2TRMA 1SKYE 4WVPE 4XOJA 5CDFE 2FIRH 2ZTXA 1S81A 2VINA 4UONA 1Z6EA 1S85A 3RXVA 3BG8A 1IOEA 3KYFA 1DM4B 4FUIA 1CGJE 1C5SA 2VIOA 2O8WA 1NU7B 1DWDH 1ZR0A 3ZVAA 4O97A 1W14U 3FZDA 1OSSA 1A0LA 2Y6TA 4ZROA 1ZMLA 4B2BA 4ACBA 1L2EA 4P00A 1UHBA 1CA8B 2QY0B 3F2HA 1DX5M 3CENA 5EOKA 3VPKA 4ZKSU 3MQKC 1ELAA 3FOAA 4IS5A 3S7HB 5JDUB 3BN9A 3SV7A 2B8OH 2XC5A 3SJOA 3GY6A 1OP0A 2WPKS 3SV6A 1TX8A 1TOMH 3NPSA 1ZTLA 3O8CA 3OYPA 1HJAC 2HPPH 1UK2A 3T62A 5KGOA 2SFAA 5DO4H 2K8IA 1IQNA 2F9VA 2GZ9A 1GHVH 1GBAA 4A5TS 1ANBA 1W12U 1C5PA 2HNTF 1Z1IA 1KYNA 2CK3D 3FVFB 1P05A 3HPTB 4NWLA 2BXTH 1VZQH 1K1PA 1ELBA 3BTGE 5T6DA 2CF9H 3ZIAD 9ESTA 3A8DA 3RXGA 1QY6A 1LPGB 2QA9E 2A31A 4H6SB 4BTUB 1PFXC 4UD9H 2DE9A 4ZHAA 2Y7ZA 3RU4E 3QWCH 2AS9A 3M5MA 3VGCB 2GVFA 2BOKA 1UCYE 2G81E 4AFUA 2TGDA 2QV1A 1AVWA 2VWMA 2P3TB 2RA0A 4UFFH 1H8ED 3NKKA 1O2ZA 3F9FA 1GMHF 2ZCKP 1WXRA 2WV4A 1KXDA 2RDEA 1NN6A 3SOSA 1P57B 2TPIZ 3DUXH 2KCAA 1HAVA 4TSFD 1A5GH 3ESTA 3PWBA 1K28D 2O8TA 3PO1C 1HCGA 3H5CB 1FIZA 3LGTA 3ZZ6A 4IMZA 1BTUA 1QB1A 1TNLA 1GCTC 2XXLA 2Z3EA 3PMHB 3FKSD 2M2AA 2NU3E 2XTTB 3F0OA 4CR9A 1AUTC 3A86A 2H2ZA 2OBQA 2VGCB 2ANYA 2FESH 1C1SA 1C1TA 4TPYA 2H9HA 2ZGJA 1LVYA 2BVXH 1A4WH 1T31A 3ZZBA 4FU8A 4AG2A 4DCDA 2R9PA 1TGBA 3STJA 1C2GA 1F5LA 1V2WT 1XMNB 3PMJA 4OS7A 4X6MA 5AF9H 2R3UA 3EA7A 1N6YA 1P9SA 4KTCA 2CGAA 1MU6B 3S9BA 2GTBA 1E36B 3UQOA 1BA8B 1TRMA 3BV9B 3M7QA 5FCRA 4IBLH 5LPRA 4O9VA 4UDWH 1ZPBA 2PTCE 2WPMS 1C1WH 1QA0A 1RS0A 3H7TA 1ESBA 1EAWA 5EXNA 1PPCE 1V2QT 4SGBE 4F49A 3TGIE 1AFQB 3FP8E 3P6ZB 4JZEH 4WH8A 1NS3A 2P8OC 1S83A 2HRVA 5DP9A 4YOIA 2V3OH 3RXFA 3MU8A 1TGSZ 3FP7E 1W0ZU 1HGTH 2VIVA 3TH2H 1AE5A 1O3IA 2ZFRH 1H1BA 3SNCA 3MU1A 1DSUA 3ATWA 2H6MA 1AGJA 3BTFE 3PRDA 1H9LB 3RXLA 3T2NA 4A1XA 3S9CA 1V2PT 4X1RU 1NFYA 3T26A 1D3PB 2J98B 2PUXB 3SU0A 2Q6GA 3PLBA 1UO6A 3GY4A 1P2NA 2L6OA 2EI8A 5GNDA 4K8BA 2FOBA 2P94A 1SQOA 2BHGA 2JETC 3KF2A 3LGIA 5A09A 3EA8A 2QGRA 4D7FA 5FCKA 4O3TA 3P92A 1TYNA 1O3MA 1AIXH 5GIBA 1ZYOA 5GXPA 2Z9KA 1TWXB 1BCUH 3UNQA 1NU9A 4K60A 3SNBA 3N99A 1F0RA 1ACBE 1SQTA 2M5TA 1VGCB 4JZFH 1LCYA 1NROH 1ZJDA 2ZPSA 4CRDA 1O2GH 2V3HH 1CU1A 2A7JA 5E0HA 1MMJN 3SGBE 1EAIA 4CRAA 4A1TA 2FTMA 1G37A 1ORFA 1UVPA 2H5CA 3E16B 4NA8A 2A4GA 3LGVA 3FANA 3RU4D 2RCEA 4HFPB 1MKXH 1VITH 3FZZA 1MZAA 5B6OA 2F9OA 1TNHA 5C0UA 1F0SA 1NRPH 3ATKA 1P3EA 1A5IA 1FN6A 1O2QA 1G2LA 1Z71A 1A1RA 5FAHA 5GPIB 1GVLA 2CN0H 2ZFTA 1K0HA 1CA0C 4JMYA 4NSVA 1TA2A 3MH6A 2PGBB 5BRRE 1GL0E 1SLUB 5DP6A 1CT2E 4B71A 3MNXA 1GBTA 4BAOB 2C8XB 1A7SA 1OP8A 1OOKB 2ZGCA 3RLYH 2QCYA 1NM6A 4CHAB 4IN1A 3SZNA 4X2XA 2Z9IA 2IPHA 2BY8X 1CVWH 2BB4A 1FDPA 3R3GB 2R3YA 1MQ6A 4A6LA 2OBOA 2W7UA 4JZIA 1GI1A 1O2VA 4SGAE 3P95A 4INKA 1PYTD 3I77A 1Z7KA 3RXCA 4F48B 4AYYB 4Y79A 2OC1A 1W11U 1OXGA 4ACAA 3BIVH 3ZZ7A 1XX9A 1A46H 5AFZH 3SN8A 1JBUH 3SV2H 3BTME 4AC9A 3A88A 5DN6D 1TNKA 3E0NB 3MNSA 3MYWA 5EW2H 4ZKRU 3GCTF 4MNYA 3TJOA 3GY3A 1TX6A 1UTJA 1ZTKA 1H9HE 1LMWB 4HTCH 2ALPA 3LGUA 3RMOH 1EPTB 3IITA 2D1JA 1BRUP 4D9QA 2EQNA 3BTQE 4TPIZ 1P8VC 2V0BA 1O3GA 3W95A 3A7YA 4YXWD 1COWD 3Q3XA 5AVDA 1WTHD 3A8AA 4YESB 2AERH 1IQHA 1GBKA 1LQEA 4MPVA 5AHGH 2A2QH 3N7EA 1A3EH 3PV5A 2A5IA 4Y8ZA 2C8YB 4IGDA 1GHZA 1KXCA 2ZHWH 3GYMA 3H09A 5DK1A 3ZYDA 1UMAH 2PUQH 1XUGA 1D4PB 4B2AA 1NRNH 1BITA 1JIRA 1UVUH 3RXIA 1QRWA 3ZVBA 2ESTE 1HBTH 3RXHA 1C5ZB 1SLXB 2WUBA 5TJXA 3ZZ8A 1Y5BT 3QDZB 1FY1A 1GI4A 4IW4E 4I86A 3S7KB 1GDUA 3L6PA 2AH4X 4X6PA 3V12A 3RXAA 2FI5E 2ZO3H 3SI4H 1A3BH 1GJ5H 1UJ1A 2F83A 2EY4C 2ODPA 4JYVH 4X2WA 2ZPQA 3PM3A 1J14A 1K1OA 3JZ2B 3RC4A 3STIA 1E37B 2J92A 1BRCE 3K6ZA 3RXMA 6CHAC 2XRCA 4P02A 2Z9JA 4K8YA 5A0CA 2ZDAH 4MVNA 4THNH 2GD4B 2XNDD 2Y81A 5DP4A 1SG8B 4MG3A 4AFSA 5H4IB 5DG6A 3MU4A 2J5UA 5E2PA 1G36A 1AQ7A 3SU6A 1EQ9A 5PTPA 8ESTE 4GVUA 5CHAB 1D6WA 4WXIA 2C90B 2ZEBA 3BEIB 3P8OA 1W10U 1BIOA 3QO6A 3MMGA 2F9NA 3KEEA 2AGIX 2ZPRA 1MTUA 2R2WU 4ABEA 4I31A 3EDXB 2W5EA 2FS8A 4KTSA 1SGIB 5C2ZA 4F55A 4RN6A 3RXUA 4MDSA 4DW2U 1T8OA 1KTSB 1SFQB 3URDA 1BB0B 1CBWC 1CT0E 1PPGE 1UCYH 1ZRBA 1XM1A 1K1LA 4MPWA 4DIIH 4RKJB 1TLDA 3F68H 4ABDA 5HKKD 2A32A 3EGKH 3A80A 3B9FH 5K7RA 1YCPK 1OYTH 1KXEA 3SHAH 3VB6A 5KEDA 1HLTH 1VCQA 2Y5HA 3TNSA 3GY2A 1RD3B 1BJUA 1ELVA 1GBIA 1RIWC 3P8GA 1W7GH 1LVMA 2OUAA 1NBME 4TY7A 2VU8E 4JYUH 4BAHB 2Z7FE 4X1QU 4ZXYH 3SV9A 2ASUB 1Y5AT 1MBMA 1KDQB 3OFND 2TGAA 4I8GA 1EFRD 2KX4A 1SGCA 3GICB 3F1SB 4U30A 4KGAA 3ODFA 3GCHC 1GHWH 3NWUA 4AX9H 3AASA 3IWMA 1FPCH 3U9AH 1YPHC 1C9TA 1S5SA 2WPLS 3SUGA 2BLOA 1TABE 1CGHA 3DA9B 4X1SU 5ABWA 2Q1JA 1C1UH 1MTNC 1WU1A 3KQDA 3BTTE 3LT3A 5EXLA 3SUFA 1HIAA 1GI3A 1HJAB 5G4BA 1AKSA 1GI0A 4RT0A 1MTVA 2Q6DA 1C5OH 1INCA 4K1SA 4ZKNU 3KCGH 2G00A 1ZSJA 5C5OA 2KR7A 3I78A 1GVZA 1T8LA 1TQ7B 4K69A 3LJOA 3SGQE 1GGDC 5F8TA 1D3QB 1K9OE 3UOUA 1DSTA 5L2YH 1XUJA 2ZCLP 3U69H 4A92A 1V2TT 2IN2A 2ZHFH 1TRNA 3PB1E 1DANH 1C1QA 1NY22 5F8XA 2KCOA 3B23B 4D8NA 1HAYB 2W6JD 1SHHB 5A8ZA 2JJ2D 1ESTA 2FPZA 1C2KA 5FX5A 1BMLA 4WH6A 4X2VA 1P11E 2O8LA 4DIHH 1O2RA 1ETSH 1TA6A 4E7NA 3D23A 3UPEA 1RRKA 4KELA 2FOGA 3SU2A 3V3MA 5EJLA 2PLXA 2ZHQH 2B7DH 1TBZH 4BXSA 2WZQA 1UTLM 1V2OT 2W26A 1O2OA 4X6OA 1SC8U 1SI5H 1V2NT 3TK9A 2XNIA 3PROA 1C2EA 3D49H 1AI8H 1K1IA 4JZ1A 1DXPA 4NIXA 3DSOA 3AAVA 4YM9A 4GAWA 5HYOA 4NWKA 4ISHH 4FUGA 1DWBH 1NFWA 1SLVB 3ATLA 2OK5A 5E2OA 4ASHA 2VJ1A 3HATH 3KGPA 3M37A 5GDSH 3GCOA 5T1VA 5T6GA 2VBCA 1WBGB 1WYKA 4GCHG 3UIRA 4K5ZA 3BEFB 1QIXB 3OE7D 4TY6A 1P2KA 1G3DA 2C8WB 1Y3VA 5FHTA 1AWHB 2GGVB 3RMNH 2H9TH 4BANB 3LKWA 1MAYA 1PJPA 3F3BA 1S0RA 3GDSA 3M5NA 1KLIH 1OYQA 3MHWU 5L2ZH 4UEHH 2H9EH 1EAUA 2J38A 1YCPM 1MCTA 3RXTA 1K1MA 2GMTC 2G4UA 1ABIH 2G5NA 3ENSB 1DY8A 1TNGA 1O2NA 4I33A 3HK3B 1PPZA 2BX3A 2PV9B 1AE8H 3WWFA 2GV6A 5DJ7A 3F9HA 1ZSKA 1GBEA 1NBMD 1QQUA 4OS4A 4B6FA 4ESTE 1N1LA 1V2MT 2ZQ2A 3TNTA 3LH3A 2UUKB 3GDUA 1TMBH 1YYY1 3UY9A 2P8OB 5J4QA 2NU1E 1YP9A 1HPGA 2QC2A 1L4DA 1O3KA 1BDAA 2Z6BD 1GBBA 1P9UA 3VEQB 5E0GA 1F0UA 1NPMA 3LONA 1O2WA 1C1PA 2A7CA 1BUIA 4YZUA 1UVSH 4Y10E 2WPJS 2ZF0H 3GCTG 1K2I1 4I8HA 3ZZDA 2WUCA 1BZXE 3BTKE 1O3OA 4MTBA 2HLCA 3LOXA 3UNRA 2NU0E 3U8RH 1RGQA 1EB1H 3AW0A 4ABGA 1CO7E 4I7YH 1AVGH 3OY6U 1FAXA 4GUXA 1LHFH 1QL8A 1VJ9U 4Y8YA 1P2IA 2JETB 1IQMA 2OP9A 4A1VA 2Y80A 2L74A 4DJZB 4ISOA 1J9CH 3MO3A 1FY4A 2J2UA 1O5GH 3KIDU 1C5WB 1TMTH 1C1OA 1BTWA 3JZ1B 4AORA 4ZMAH 2F43B 4D9RA 1H8HD 2Z3DA 1V6DA 2XW9A 4CRGA 1DWEH 1QRXA 1AFEH 3CP7A 2HNTE 2PKAA 5JBCS 1TNJA 3ZZ5A 1EAXA 1SGEE 1O5FH 1ZLRA 2ZGXH 3PLPA 3TK6A 5SGAE 4RI0A 1AWFH 1QHRB 2D8WA 4B76A 5EGMA 1A5HA 1CGIE 1EJMA 4UFEH 3ZZAA 1C1NA 2JJ1D 1GI8B 5DGJA 2BZ6H 1EB2A 1GJAB 1P06A 4AN7A 1L1GA 1LKBA 3LIWA 4CBOA 1A0JA 3UAIC 3A7XA 3A7ZA 5C67A 2G51A 1RXPA 1C4Y2 2ZZUH 1ARCA 1MKWK 2YNBA 2ZFPH 1ANEA 2OLGA 1HDTH 1TGNA 1EJAA 1MZDA 2PW8H 2BZAA 5B6LA 1FV9A 3DHKH 2BQ6B 3M3SA 1QFKH 1W13U 1C5RA 1TALA 2VVUA 1GHAG 1G3CA 1ZPCA 3WY8A 1JOUB 3MTYA 1D9IA 3MH7A 2Z94A 3BEUA 3BSQA 4RKOB 1E34B 1D6RA 1DLEA 1KXBA 3GDVA 1UTMA 2EI6A 1S82A 4MNVA 4X1NU 4FVDA 2UUFB 1BTYA 2VIWA 1C5QA 1MBQA 3RXKA 4R0IA 1YGCH 4Y8XA 3ZVFA 1YC0A 9LPRA 1O39A 1YPHE 4Q4LA 2WPIS 2IJD1 4BTIB 2G5VA 1HUTH 4OS6A 1G3EA 1O3HA 1UTPA 1Z8RA 5FBIA 2ZIQH 1O5BB 2DUCA 1WCZA 4ISNA 4AYVB 3TVJB 5EJ1A 1DXWA 1C5YB 1O0DH 1O3LA 4I32A 2A1DB 3S0NA 4BNRA 1AB9C 3U1IB 1TGTA 1GVKB 1O2XA 2XWAA 2ZDVH 3AW1A 3MO6A 1VITG 2ZDMA 4VGCB 1HB0B 1V2UT 2I6QA 4TWYA 3RU4T 2W3KA 4YT7H 1O31A 5JYIA 1NT1A 2F9UA 3SNDA 1O37A 1C2IA 1QL7A 2CV3A 2F3CE 2F9PA 3RP2A 4AGKA 5LH8A 3VB4A 1YLDA 3PTNA 2ZHEH 3TU7H 4XBBA 1UVTH 1ELEE 1O30A 3LJJA 2FEQH 1QTFA 4HI3A 4QT8C 2YMSD 1O5AB 1GI7B 5ESBA 4XDEA 1F2SE 1OWIA 1V2ST 4Z1MD 1ELCA 2BYAX 1MU8B 1SGFA 3UR9A 3VGCC 5A8XA 2W6ID 2YMSB 2VWNA 2B9LA 2VVCA 1BTXA 1GBDA 1IQKA 4MQAA 4AFQA 1C2HA 2ANWA 4FU9A 2NWNA 3D62A 4GCHF 1BQYA 3F2GA 4A7IB 2PHBA 4NSYA 3U8TH 1VKYA 3MU5A 2AYWA 1KXAA 5T3HA 1TMUH 1KY9A 1O2MA 1HRTH 1O2JA 1YBWA 2HALA 5F53A 6LPRA 3ATIA 1SVPA 1IHSH 4DGJA 1HJ8A 1OWKA 1W7XH 4HG6A 3UUZA 2WYGA 2G8TA 2XYAA 1LVOA 4FETA 2VVVA 1E1RD 4Q2KA 4NZLA 3A8BA 3F0PA 2TIOA 3GYLB 1O2PA 3A83A 1GI5A 5C1YA 1OKXA 1W3CA 1IQEA 4JCNA 2Y7XA 3TK5A 2XBXA 4ISIH 3SJ9A 2R2MB 1N8OC 2Y5GA 5A0AE 2QIQA 4DURA 2LP6A 2ZU4A 1E1QD 1ZTJA 3DSPA 1GMDG 1Y3WA 1W2KH 3MWIU 1CT4E 1E79D 1LKAA 3BTDE 1GDQA 2ZU5A 1W8BH 2GX4A 5HM9A 4NIYA 2CMYA 2ALVA 2BMGB 3GY8A 1RIWB 4Y6DA 4FUJA 5HGGA 2KAIB 1EZQA 4H42U 1Y5UT 1AFQC 1A0HB 1AU8A 1G30B 2EC9H 5F8ZA 1ELDE 2FM2A 4WXVA 1GBJA 3LH1A 1G32B 2QN5T 3SU5A 1PQAA 4RSPA 1MD7A 4X0WU 1T8MA 1WSSH 1FUJA 2BD8A 2BVSH 3LPRA 4NFFA 3QN7A 4LZ4B 1IQLA 3NXPA 5EJZA 3GCHB 1E38B 2WV5A 2FX4A 3RXOA 3MI4A 1O3DA 2WPDD 1Q2WA 2XOKD 2HVXA 3A81A 3P17H 4XSKU 2KCYA 3D65E 1A61H 1NFXA 1CHOG 2BD4A 3OEHD 4DG4A 1EKBB 5F6MA 4GHTA 2Z3CA 1ZZZA 4FXGH 1SB1H 3TJNA 7GCHG 2BQWB 4E7RG 3OAAD 2BLWA 3E8LA 2FWWA 3VXFH 2J4IA 3U28C 5C20A 4K1TA 2BQ7B 1AN1E 2AIPA 5ESTE 1S6HA 1FY5A 3RXDA 1SQRA 5EG4A 4MLFB 1C2FA 4B2CA 4XE4A 4B6EA 1O36A 5C5NA 4BXWA 3FN8A 2FYRA 2J9NA 3DT0H 1QJ1B 1E35B 4FU7A 1V2JT 1K22H 1EP5A 2OCVB 2THFB 4WWYA 1DICA 1BRBE 1GWAA 5DP5A 2C8ZB 2ZU1A 3E91A 1GJ8B 1HXEH 3W1EA 1ANDA 1TE0A 2ZFQH 2ZC9H 1V3XA 5E0JA 2FMJA 1GBFA 1D3DB 3QZQA 4M9FA 1BTHH 1GHAF 2ZDLA 1QJ6B 3RDZA 1W0KD 5EQQA 1DOJA 4CH2B 5IYTA 2J98A 4NG9H 3IG6B 1UHBB 3MU0A 1W0JD 3TH4H 1GI9B 3LU9B 3MH5A 4I8LA 1ELTA 1Y59T 2A5AA 4IMQA 2PKSB 3T29A 3A89A 3SQHE 2VIQA 5C0TA 1HAGE 1C9PA 1DPOA 3ZZCA 1S0QA 1AVXA 4NZQA 1KSNA 1DUAA 1Y3XA 2GDEH 2V35A 2KZ4A 3QGNB 4YO9A 1TPPA 5A2MH 3I29A 3N7DA 1CSOE 1PQ8A 3TJVA 4YLUA 1BT7A 1MABB 4IN2A 1KMHB 3M5LA 1YPMH 1DUEA 3EE7A 4NGAH 4JYTA 2KCPA 1QNJA 5TCAA 1GG6C 4Z0KA 1DLKB 3PMAB 3Q00A 2ANMH 4GPGA 2SGFE 1ESAA 4HZHA 3SO3A 3BG4C 2BD5A 3HGNA 1ETTH 1NRSH 3SYJA 5A0BA 1KTTB 1QB6A 1RTLA 1VITF 2YOLA 1QL9A 1PYTC 2BD7A 4ZHMU 4NFEA 2LNCA 4IC6A 4BTTB 5EXMA 1P03A 4OGYA 4KTUA 4X1PU 3NRLA 4CBNA 4NA7A 2GMTB 2ZNKH 3SGAE 2F9BH 2K0QA 3CNRA 5F03A 3KQEA 3EAJA 2FOMB 1BBRE 4CRFA 1SMFE 1TBRH 1OX1A 4ASUD 1EJNA 1FN8A 1YWUA 2QF0A 1FZZA 2AFQB 4K1EA 1B5GH 2AHME 2D26C 2QF3A 4YOJA 1F92A 4U2WA 4FUHA 4Z6AH 2RFKC 1TPAE 1BOQA 3OTPA 1HAVB 3TITA 1Z8GA 2PKAB 3KQ5A 2STAE 4YTAA 3SJ8A 2EA3A 2BOHB 1MTWA 2QXHA 4AGJA 1FQ3A 3PWCA 3ZVEA 1THRH 1F7ZA 2PSYA 1C2MA 1GHBG 3TIUA 4Y7BA 4UFGH 5EQSA 2CXVA 2CHAC 3RMLH 3KQCA 4FVBA 4U32A 2IJOB 1BMAA 1O2LA 3K6YA 3BIUH 3LC5A 1OHHD 2V7QD 2ZECA 1SFIA 2QF4A 3K9XB 1BMNH 3TJUA 2C4FH 1O3AA 4ZXXH 3NK8A 2VWOA 1GDNA 2FOHA 1CHGA 1QJ7B 1ZHMA 1P2MA 3UB0A 5GCHG 1P2QA 5JBAS 1O3FA 1SGQE 2FOFA 4E06H 1FX0B 2AMQA 1UTKA 5K0HA 1AMHA 1EPTA 2SNVA 3VB7A 1MUEB 5FX6A 1FNIA 5BPEA 7KMEH 2V3MA 4CRCA 1T7CA 4ABJA 3QZRA 1XUIA 3S9AA 4ABHA 2Z9GA 3SV8A 1E0FD 2DE8A 2SNWA 2VWLA 4FUBA 3PV4A 4AG1A 3GY5A 1GMDF 3PO1B 1N6XA 2R0KA 2ZQ1A 4BAMB 5EIYA 1P09A 1UK3A 5T6FA 1JIMA 5CHAC 2WYJA 1TIOA 1O3BA 5C1XA 1ZGVA 3PV2A 2AIQA 1GCTB 5JBBS 2CJIA 3SORA 2QXJA 3LGWA 2XC0A 3Q3YA 4CH8B 4ABFA 3A7WA 3ZVCA 1BBRK 2GDDA 2F4LA 2FXRA 3DSGA 3MO9A 1SOTA 1OWHA 1SGYE 1SGDE 1JXPA 1C4U2 2W7SA 5EODA 3F2FA 1XKBC 1ZSLA 2FOAA 1GL1A 1ETRH 4FUEA 1K1NA 4ZKOU 1QA7A 4X6NA 3E3TA 2V6NA 5CMXH 3TGKE 3GISB 1SPJA 3FAOA 1P02A 2GCTC 3SZEA 5I25A 4B1TA 4UE7H 1OPHB 3RXBA 1MKXK 1C1VH 1CHOF 2Y5FA 1CQQA 3EQ0H 2SGAA 1P10A 4Q63A 3SJIA 1BJVA 2XBYA 3PRBA 3RM0H 1AHTH 2GZ7A 1YPKH 4D7GA 1C5TA 1O3EA 3AAUA 2BD3A 3OTJE 2VB0A 7GCHF 4NA9H 2ZFFH 3T5FH 4O03A 2HPQH 1XUFA 3M7TA 1MH0A 4WF8A 5FPTA 2BY7X 1TFXA 2BDYA 1DWCH 1YPLH 2FDAA 1PPFE 1FJSA 1JRTA 1KLJH 1GMCG 3AVZA 3VXEH 1FIWA 1WUNH 2XC4A 2XBWA 4OGXA 7LPRA 4ZUHA 1GHYH 8LPRA 1QQ4A 1S6FA 1OWJA 1XUHA 3SU4A 3M3TA 2A5KA 3P8FA 1VJAU 3T27A 1NC6A 1O5EH 5IDKA 1O34A 2FOCA 1ZMNA 2FTLE 4H4FA 1LHCH 2TGTA 1FAKH 1O3JA 1VCPA 2PFEA 2Y82A 3E90B 1SQAA 1AB9B 2QE7D 3M7UA 2PSXA 1SLWB 2P3FH 2EEKA 2WSSD 4B75A 1EOLA 1IQIA 2BVRH 1SBWA 2FOEA 3RXQA 1TQ0B 1NZQH 2BM2A 2FX6A 2ZCHP 5C17A 4NCYA 5LPFA 2Q6FA 3AK5A 2XWBI 1GJ4H 3LGYA 4LZ1H 3PLKA 1LDTT 2ZTZA 3O8DA 2JIZD 5GJ4B 4K3JA 1Y3YA 2LELA 6ESTA 2D2DA 2BDBA 3DCLA 1GI2A 1KDQA 1GJDB 2P59A 4X8VH 2OC8A 2BY9X 3RXJA 2ZG0H 2H5DA 3BTWE 5DPAA 4KKDA 4XRNA 1QBNA 1L1JA 1YCPH 2ZGBH 1LHEH 4UFDH 1TAWA 2BXUH 4ZCNA 2TGPZ 2TBSA 3A82A 1C2DA 2ZDNA 3NZIA 1JWTA 1G2MA 1S6LA 2UWPA 4INHA 3RXPA 3MFJA 3A87A 1THPB 1EXFA 2ZDKA 4KP0A 1F5KU 4Y0ZE 3ZZ9A 3A7TA 1T4UH 3ZV9A 4YT6H 2ODQA 2C3SA 3UFAA 1KXFA 4ABIA 1NRRH 1GHXH 4NIWA 1CA0B 4H6TA 2SGPE 1TONA 1AZZA 1O3PB 1U6QA 3VFEA 3RXEA 3L33A 1HNEE 1GCDA 3LC3A 5DP7A 2OQUA 1NO9H 1X7AC 4GHQA 3SBKA 5CHBA 1BMMH 1C5LH 1P04A 2AMDA 2PGQB 2UWOA 2VIPA 1NTPA 1WTGH 1H4WA 3SQEE 5LGOA 2J95A 1SGFG 1N8OB 4AFZA 3R0FA 3GCNA 2QXGA 2BDGA 3ZV8A 3L3TA 3NUMA 1QR3E 3ELAH 1SGPE 2PTNA 3RXSA 1PQ5A 3SJKA 3RXRA 2HVYB 2A4RA 1HAZB 1V2LT
chains in the Genus database with same CATH topology
1GHBF 2SGQE 3Q3KA 3QLPH 4BOHA 1L0ZA 2BDHA 1O2IA 2GCHF 3U1JB 1DY9A 3C1KA 1GI6A 3RUOA 5JPMH 4B74A 1Z1JA 2JH6D 3EA9A 2K1QA 2P93A 4MNXA 1KIGH 3UWIA 5JB8S 4M7GA 5GCHF 4TYDA 2AGEX 1FXYA 5EW1H 3TH3H 2UUYA 3GOVB 5DP8A 1V2VT 3MNBA 1QRZA 4BAQB 2G4TA 4E05H 3NCLA 1TPSA 1FONA 1TOCB 5JBTA 2ZGHA 1TRYA 1IQFA 1Q31A 1UCYK 2UUJB 3OY5U 1B7XB 1HAXB 5L6NH 1XVOA 1IQGA 2FLBH 3U98H 3S69A 3PMBB 5I46H 1SSXA 1O5CB 2BD2A 1SGTA 3GY7A 1ZOMA 2NU4E 4AB8A 8GCHG 3SU1A 2Z9LA 3SNAA 1C4V2 5HXFA 1PPHE 1ZJKA 3OSYA 2HOBA 1Z8IB 2ANKH 1NFUA 2BY5X 1BBRH 3SW2B 1O3NA 3SU3A 1LQDB 3SI3H 2ZU3A 1L4ZA 1MQ5A 1BRAA 4TWWA 1ID5H 6CHAB 3UR6A 1W0YH 1BTPA 2BY6X 3A85A 5HMAA 2B5TB 2CF8H 3ZVGA 1WQSA 5EPNA 3TPIZ 2GT7A 2HWLB 3E1XB 4Y71A 2VH0A 1C1MA 3KL6A 3V0XA 1F0TA 3RC6A 3A84A 2ZWLH 1LPKB 3BTHE 1EZUC 1P0SH 1MCVA 1TX7A 3O8RA 3OU0A 3QGJA 1ELGA 1GJ9B 1GJ6A 4I8KA 1TPOA 3BF6H 1OS8A 1P12E 2QYIA 3HKJB 1O2YA 1C5VA 1GPZA 1V2KT 2BDCA 1C5MD 2QXIA 1C2LA 2A4OA 6GCHG 3KNXA 1HAIH 1IQJA 3A8CA 5FBEA 2IOTA 4CRBA 2VGCC 3UTUH 1RFNA 5TCCA 1SR5C 3DD2H 2AGGX 1DFPA 3RMMH 1LHGH 2GT8A 1SL3A 2BD9A 3EE0B 1B0EA 2JKHA 4YLQH 3Q77A 4LK4A 1ZMJA 3ODDA 1DITH 3CS0A 4MPUA 5FPYA 1V2RT 2P3UB 3BTEE 2BDAA 1GMCF 2H1UA 1CBWB 1HIAB 1ZHRA 3P8NA 1GJ7B 2PR3A 1AKSB 1EUFA 1RJXB 1J8AA 3TGJE 1FY3A 4J2YB 4Y11E 3V7TA 2QAAA 3ZZ3A 1GG6B 1XXFA 1C5XB 2VNTA 2VH6A 5JB9S 5GWZA 2A2XH 1SGRE 3BG4B 2NU2E 3E6PH 4BAKB 3PYHA 3QUMP 2ULLA 1O2SA 2AEIH 1O2HA 1XUKA 3F9EA 2J34A 4ISLA 2VIDA 4JZDH 1AO5A 1O2TA 3T25A 4B73A 1NESE 1Y8TA 1ANCA 1ABJH 5C3NA 2R0LA 2YNAA 1OWDA 3URCA 2UWLA 2F91A 1ZHPA 2ODYB 3EYDA 4XBDA 2A45B 5LPEA 5ETXA 1GBLA 4X8TH 2ILNA 3B8JA 2RG3A 2I6SA 4I8JA 4K2YA 1QBVH 4PROA 3RLWH 1TGCA 4GLYA 4U01A 1O38A 2ZTYA 1GBHA 4INLA 4NIVA 2OQ5A 1NRQH 5J4SA 1EP6A 1EOJA 1YPGH 4MNWA 4VGCC 1MTNB 5E8EH 5DKMA 3K65B 3ZVDA 1WV7H 4X8SH 2GZ8A 4XBCA 1BHXF 1HFDA 1SGNE 4DT7B 3F9GA 1Z6JH 1AY6H 1QGFA 1Y3UA 2XCFA 2P16A 2LPRA 1J17T 1F5RA 4ABBA 4WY3A 1GGDB 2ZFSA 2CHAB 1AUJA 1VGCC 5FPSA 4DY7B 2O8UA 1H8IH 1IHTH 1MKWH 1OP2A 1UTNA 4ZAEA 1ZRKA 3M5OA 1YF4A 1HJ9A 1J15A 2AMPA 4Q7XA 1O35A 1UVOA 2FP7B 1CE5A 1JRSA 4ABAA 2JH0D 5EU8A 1HYLA 2ZI2H 1L1NA 1DVAH 2FZZA 3CS7A 1FY8E 4F4OC 1QB9A 3ZZ4A 1OWEA 1P3CA 3KQBA 2WPHS 3OX7U 3ATMA 1LO6A 2OD3B 1Q3XA 1QBOA 2FI4E 3LDXH 3DFLA 4Q7ZA 3UQVA 1MD8A 4JK6A 2FLRH 1O5DH 3MNCA 1QCPA 1PQ7A 1VCWA 7ESTE 1T8NA 2HNTC 3ZYEA 1M9UA 5EQRA 1EASA 3QK1A 4FUCA 5A8YA 1YLCA 4OS1A 4CHAC 1EATA 2SGEE 3SUDA 3UOPA 2XCNA 4LXBH 4D76A 1RTFB 2XBVA 2GV7A 3UWJH 5DP3A 1GMHG 4AOQA 3MH4A 3HKIB 1EX3A 2RDLA 1YPJH 2O9QA 1H8DH 2FO9A 4Q7YA 3M61U 1LHDH 4WJG2 2G55A 3MOCA 1SOZA 2PWXA 1AZ8A 3TLOA 3DFJA 4WMFA 2OINA 1WQVH 1ZPZA 1GBCA 1P2JA 4J1YA 4ZH8A 1JMOH 1FMGA 1VR1H 4LOYH 2SGDE 2OTVA 5AFYH 1P2OA 2GCTB 1O32A 2J94A 3HGPA 1UK4A 2JH5D 3W94A 1EPTC 1G3BA 1T32A 1B0FA 4X2YA 1H9IE 4WMEA 2OC7A 2GKVE 2ZHDA 4MPXA 4FUDA 8GCHF 2STBE 3E0PB 4CREA 3VB3A 2ZA5A 3KN2A 3QX5H 2A4QA 2OXSA 4OS2A 1PPBH 3T28A 4Y7AA 1T4VH 2BLVA 1LPZB 2ZU2A 4DVAU 1HV7A 3RC5A 4OS5A 2BLQA 1HAPH 4ZHLU 8KME2 3QTOH 4CR5A 1BTZA 3G01A 3H7OA 2GP9B 1TNIA 1O33A 1THSH 3ITIA 3U8OH 1D3TB 1HAHH 3SNEA 1XXDA 4WMDA 1FI8A 1C5UA 3PTBA 3RM2H 1O2UA 3KHVA 1QURH 2BX4A 5FXLA 1O2KA 2WINI 1WAYB 2GCHG 2P95A 3SUEA 5L30H 2RA3A 3VB5A 3M3VA 1MTSA 3K2UA 1TB6H 1PPEE 2W3IA 3M35A 4IC5A 4Y0YE 1G9IE 4HGCA 1DE7H 1RTKA 2FODA 3SHCH 6GCHF 1FLEE 3QTVH 1GJBB 1J16A 2KAIA 3FFGA 2G52A 2OC0A 4R8TB 1AD8H 3A7VA 1SHYA 3FP6E 1ARBA 1GBMA 1KLTA 1LTOA 2O8MA 4JK5A 4YOGA 4X8UH 3Q76A 1HAOH 2C93B 1DT2A 1O3CA 3V13A 1C2JA 1EZXC 1UTOA 1MAXA 1K1JA 1GJCB 2BTCE 4Q80A 1XKAC 3UNSA 1Z8JB 1A2CH 2B0FA 2FS9A 4FUFA 1K21H 1C1RA 3F6UH 1HXFH 4Y76A 3HK6B 2ZP0H 3M36A 1ELFA 2BDIA 3UREA 1DDJA 2A0QB 2A7HA 2FI3E 4AZ2B 1EZSC 2PKSC 5C1UA 4GSOA 1BHXB 3C27B 3P70B 2ZKSA 1YPEH 3O8BA 2EI7A 1TBQH 4DOQA 4O3UA 1UTQA 1DS2E 2FYQA 1C5NH 1ZGIA 1S84A 1WOFA 5HM2A 1YKTA 1P01A 1LVBA 4AB9A 1YM0A 5EPYA 1FPHH 2HGTH 1XVMA 1IAUA 3N7OA 4XFQA 5CE1A 2TRMA 4WVPE 4XOJA 2FIRH 2ZTXA 1S81A 2VINA 4UONA 1Z6EA 1S85A 3RXVA 3BG8A 1IOEA 1DM4B 4FUIA 1CGJE 1C5SA 2VIOA 2O8WA 1NU7B 1DWDH 1ZR0A 3ZVAA 4O97A 1W14U 3FZDA 1OSSA 1A0LA 2Y6TA 4ZROA 1ZMLA 4B2BA 1L2EA 1UHBA 1CA8B 2QY0B 1DX5M 3CENA 5EOKA 3VPKA 4ZKSU 1ELAA 4IS5A 3S7HB 5JDUB 3BN9A 3SV7A 2B8OH 2XC5A 3SJOA 3GY6A 1OP0A 2WPKS 3SV6A 1TX8A 1TOMH 3NPSA 1ZTLA 3O8CA 3OYPA 1HJAC 2HPPH 1UK2A 3T62A 2SFAA 5DO4H 1IQNA 2F9VA 2GZ9A 1GHVH 1GBAA 4A5TS 1ANBA 1W12U 1C5PA 2HNTF 1Z1IA 1KYNA 3FVFB 3HPTB 1P05A 4NWLA 2BXTH 1VZQH 1K1PA 1ELBA 3BTGE 5T6DA 2CF9H 9ESTA 3A8DA 3RXGA 1QY6A 1LPGB 2QA9E 2A31A 4H6SB 4BTUB 1PFXC 4UD9H 2DE9A 4ZHAA 2Y7ZA 3RU4E 3QWCH 2AS9A 3M5MA 3VGCB 2GVFA 2BOKA 1UCYE 2G81E 4AFUA 2TGDA 2QV1A 1AVWA 2VWMA 2P3TB 2RA0A 4UFFH 3NKKA 1O2ZA 3F9FA 1GMHF 2ZCKP 2WV4A 1KXDA 1NN6A 3SOSA 1P57B 2TPIZ 3DUXH 1HAVA 1A5GH 3ESTA 3PWBA 1K28D 2O8TA 3PO1C 1HCGA 3H5CB 1FIZA 3LGTA 3ZZ6A 4IMZA 1BTUA 1QB1A 1TNLA 1GCTC 2XXLA 2Z3EA 3PMHB 2NU3E 2XTTB 4CR9A 1AUTC 3A86A 2H2ZA 2OBQA 2VGCB 2ANYA 2FESH 1C1SA 1C1TA 4TPYA 2H9HA 2ZGJA 1LVYA 2BVXH 1A4WH 1T31A 3ZZBA 4FU8A 4AG2A 4DCDA 2R9PA 1TGBA 3STJA 1C2GA 1F5LA 1V2WT 1XMNB 3PMJA 4OS7A 4X6MA 5AF9H 2R3UA 3EA7A 1N6YA 1P9SA 4KTCA 2CGAA 1MU6B 3S9BA 2GTBA 1E36B 3UQOA 1BA8B 1TRMA 3BV9B 3M7QA 5FCRA 4IBLH 5LPRA 4O9VA 4UDWH 1ZPBA 2PTCE 2WPMS 1C1WH 1QA0A 1RS0A 3H7TA 1ESBA 1EAWA 5EXNA 1PPCE 1V2QT 4SGBE 4F49A 3TGIE 1AFQB 3FP8E 3P6ZB 4JZEH 4WH8A 1NS3A 2P8OC 1S83A 2HRVA 5DP9A 4YOIA 2V3OH 3RXFA 3MU8A 1TGSZ 3FP7E 1W0ZU 1HGTH 2VIVA 3TH2H 1AE5A 1O3IA 2ZFRH 1H1BA 3SNCA 3MU1A 1DSUA 3ATWA 2H6MA 1AGJA 3BTFE 1H9LB 3RXLA 3T2NA 4A1XA 3S9CA 1V2PT 4X1RU 1NFYA 3T26A 1D3PB 2PUXB 3SU0A 2Q6GA 3PLBA 1UO6A 3GY4A 1P2NA 2EI8A 4K8BA 2FOBA 2P94A 1SQOA 2BHGA 2JETC 3KF2A 3LGIA 5A09A 3EA8A 2QGRA 4D7FA 5FCKA 4O3TA 3P92A 1TYNA 1O3MA 1AIXH 5GIBA 1ZYOA 5GXPA 2Z9KA 1TWXB 1BCUH 3UNQA 1NU9A 4K60A 3SNBA 1F0RA 1ACBE 1SQTA 2M5TA 1VGCB 4JZFH 1LCYA 1NROH 1ZJDA 2ZPSA 4CRDA 1O2GH 2V3HH 1CU1A 2A7JA 5E0HA 1MMJN 3SGBE 1EAIA 4CRAA 4A1TA 2FTMA 1G37A 1ORFA 1UVPA 2H5CA 3E16B 4NA8A 2A4GA 3LGVA 3FANA 3RU4D 2RCEA 4HFPB 1MKXH 1VITH 3FZZA 1MZAA 5B6OA 2F9OA 1TNHA 1F0SA 1NRPH 3ATKA 1P3EA 1A5IA 1FN6A 1O2QA 1G2LA 1Z71A 1A1RA 5FAHA 5GPIB 1GVLA 2CN0H 2ZFTA 1CA0C 4JMYA 4NSVA 1TA2A 3MH6A 2PGBB 5BRRE 1GL0E 1SLUB 5DP6A 1CT2E 4B71A 3MNXA 1GBTA 4BAOB 2C8XB 1A7SA 1OP8A 1OOKB 2ZGCA 3RLYH 2QCYA 1NM6A 4CHAB 4IN1A 3SZNA 4X2XA 2Z9IA 2IPHA 2BY8X 1CVWH 2BB4A 1FDPA 3R3GB 2R3YA 1MQ6A 4A6LA 2OBOA 2W7UA 4JZIA 1GI1A 1O2VA 4SGAE 3P95A 4INKA 1PYTD 3I77A 1Z7KA 3RXCA 4AYYB 4Y79A 2OC1A 1W11U 1OXGA 3BIVH 3ZZ7A 1XX9A 1A46H 5AFZH 3SN8A 1JBUH 3SV2H 3BTME 3A88A 1TNKA 3E0NB 3MNSA 3MYWA 5EW2H 4ZKRU 3GCTF 4MNYA 3TJOA 3GY3A 1TX6A 1UTJA 1ZTKA 1H9HE 1LMWB 4HTCH 2ALPA 3LGUA 3RMOH 1EPTB 3IITA 2D1JA 1BRUP 4D9QA 3BTQE 4TPIZ 1P8VC 2V0BA 1O3GA 3W95A 3A7YA 3Q3XA 5AVDA 1WTHD 3A8AA 4YESB 2AERH 1IQHA 1GBKA 1LQEA 4MPVA 5AHGH 2A2QH 1A3EH 2A5IA 4Y8ZA 2C8YB 4IGDA 1GHZA 1KXCA 2ZHWH 3GYMA 5DK1A 3ZYDA 1UMAH 2PUQH 1XUGA 1D4PB 4B2AA 1NRNH 1BITA 1JIRA 1UVUH 3RXIA 1QRWA 3ZVBA 2ESTE 1HBTH 3RXHA 1C5ZB 1SLXB 2WUBA 5TJXA 3ZZ8A 1Y5BT 3QDZB 1FY1A 1GI4A 4IW4E 3S7KB 1GDUA 3L6PA 2AH4X 4X6PA 3V12A 3RXAA 2FI5E 2ZO3H 3SI4H 1A3BH 1GJ5H 1UJ1A 2F83A 2ODPA 4JYVH 4X2WA 2ZPQA 3PM3A 1J14A 1K1OA 3JZ2B 3RC4A 3STIA 1E37B 2J92A 1BRCE 3K6ZA 3RXMA 6CHAC 2XRCA 2Z9JA 4K8YA 5A0CA 2ZDAH 4MVNA 4THNH 2GD4B 2Y81A 5DP4A 1SG8B 4MG3A 4AFSA 5H4IB 5DG6A 3MU4A 5E2PA 1G36A 1AQ7A 3SU6A 1EQ9A 5PTPA 8ESTE 4GVUA 5CHAB 1D6WA 4WXIA 2C90B 2ZEBA 3BEIB 3P8OA 1W10U 1BIOA 3QO6A 3MMGA 2F9NA 3KEEA 2AGIX 2ZPRA 1MTUA 2R2WU 4ABEA 4I31A 3EDXB 2W5EA 2FS8A 4KTSA 1SGIB 5C2ZA 4RN6A 3RXUA 4MDSA 4DW2U 1T8OA 1KTSB 1SFQB 3URDA 1BB0B 1CBWC 1CT0E 1PPGE 1UCYH 1ZRBA 1XM1A 1K1LA 4MPWA 4DIIH 4RKJB 1TLDA 3F68H 4ABDA 2A32A 3EGKH 3A80A 3B9FH 5K7RA 1YCPK 1OYTH 1KXEA 3SHAH 3VB6A 1HLTH 1VCQA 2Y5HA 3TNSA 3GY2A 1RD3B 1BJUA 1ELVA 1GBIA 1RIWC 3P8GA 1W7GH 1LVMA 2OUAA 4TY7A 2VU8E 4JYUH 4BAHB 2Z7FE 4X1QU 4ZXYH 3SV9A 2ASUB 1Y5AT 1MBMA 1KDQB 2TGAA 4I8GA 1SGCA 3GICB 3F1SB 4U30A</