1KDQA

Crystal structure analysis of the mutant s189d rat chymotrypsin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
130
structure length
130
Chain Sequence
b'VNGEDAIPGSWPWQVSLQDKTGFHFCGGSLISEDWVVTAAHCGVKTSDVVVAGEFDQGSDEENIQVLKIAQVFKNPKFNMFTVRNDITLLKLATPAQFSETVSAVSLPNVDDDFPPGTVCATTGWGKTKY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHYMOTRYPSIN B, B CHAIN
publication title Three Dimensional Structures of S189D Chymotrypsin and D189S Trypsin Mutants: The Effect of Polarity at Site 189 on a Protease-specific Stabilization of the Substrate-binding Site
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 14
structure length 130
sequence length 130
ec nomenclature ec 3.4.21.1: Chymotrypsin.
pdb deposition date 2001-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1kdqA00
1NS3A 2KAIB 3T5FH 1C1RA 3NPSA 1ORFA 1RTKA 3JZ2B 1C2EA 4FUDA 2UUFB 1KLIH 4KP0A 3RXFA 4YOJA 2XBVA 3A83A 1EOJA 1JIMA 1TONA 2BD9A 1UK3A 2ZHEH 3RXTA 1ZMLA 2Z6BD 1GBJA 3OTJE 5T3HA 3TJVA 1P03A 4SGAE 8GCHF 1VCWA 1C2GA 3SU6A 2QF0A 2GV7A 1T8LA 2NU4E 2Z3EA 3C27B 5C3NA 4F4OC 5JPMH 2ILNA 2XXLA 3VPKA 5TJXA 2FIRH 1SGNE 2AMQA 2AIPA 1GI0A 1ZHPA 1TRNA 1K9OE 3UNSA 1ZTJA 1BMMH 2P3UB 1UMAH 1ABJH 1GI8B 1FIZA 2Y81A 4GHQA 4OS5A 1VITF 1SSXA 4DVAU 4ZKOU 3ZZAA 4R8TB 4DT7B 1A3BH 2C4FH 3L6PA 3A7ZA 2VINA 2GCTC 1PQAA 3PB1E 1GBFA 1A0LA 4FU7A 2ZGHA 2UUKB 4VGCB 1OWEA 3MTYA 5FX6A 5H4IB 1E0FD 5A2MH 1C5QA 4TY7A 1SFQB 1C4V2 1XMNB 2QA9E 1ESBA 1SGCA 1BDAA 3Q00A 2ZQ2A 4X2WA 3MMGA 1INCA 2ZDVH 4ZHAA 4YOGA 3M5MA 1B5GH 4BXSA 2W26A 1V2WT 2GD4B 1EKBB 5DPAA 1F0UA 4CBOA 1UTJA 1MBMA 4Y7AA 1P2IA 1WU1A 3M35A 4DY7B 3VGCC 1J15A 4CHAC 1A2CH 3F1SB 3ZVEA 1D3TB 3GCNA 2XW9A 2WINI 4OS7A 1MTUA 4XE4A 2QAAA 1O2PA 4CR9A 4ISHH 2H1UA 3R0FA 1GHBF 3DHKH 1BHXB 4WMDA 1QJ1B 1PPHE 1UVOA 3RXVA 1FLEE 4RKOB 5FCRA 1C1OA 1Z7KA 1UTPA 2J38A 4AGJA 3F68H 1Q31A 1NFWA 3HKIB 7KMEH 1WV7H 3I77A 5LH8A 1F0SA 2VIDA 1TOCB 1L0ZA 1GDNA 2QXHA 2Z9LA 3LONA 1O3KA 1OOKB 3GCHB 4DG4A 1QRWA 1GG6C 1RD3B 1KXBA 1ZPCA 3K9XB 1ARBA 4AN7A 4CREA 3VB7A 3TVJB 1O2IA 1YC0A 3UUZA 1SL3A 4ZROA 2UWLA 2JETC 3AAUA 4YOIA 1P10A 1MTNB 1F92A 1KXFA 1L4DA 1CE5A 3SU3A 1HNEE 1BRAA 1O2NA 1YPHC 4I32A 1TBQH 2GTBA 3RXMA 4AB8A 1S82A 2V3HH 1DUEA 3MH5A 1O5BB 4XDEA 1SGTA 3UR6A 3NCLA 1KYNA 2P16A 2OC8A 5L6NH 1SGQE 1W0ZU 2V0BA 2VIWA 3LGVA 4TPYA 2BB4A 2O8UA 1L1NA 1P0SH 2ALPA 1TNGA 1V2JT 2G5VA 2D2DA 1HAPH 2FPZA 1S6FA 2OUAA 5EPNA 2C8YB 5JB9S 2ANYA 1V2NT 3BTFE 1LVBA 3BEIB 4B76A 3QN7A 3SUDA 2SGPE 1IQGA 1SGDE 2A5KA 1C1VH 1EUFA 2F9VA 3D23A 3SORA 1GBMA 3HGNA 2ZFQH 3ZZ8A 5GWZA 3H7TA 3HK3B 2ZP0H 3T29A 3OY6U 5C5NA 1K1JA 1KTTB 1ETTH 2NU2E 2IN2A 5L30H 4Y76A 3O8BA 2FOMB 2XC4A 3W94A 1GCTC 1F5KU 3PLKA 2GDDA 5AHGH 3H7OA 1TOMH 4OS1A 2XC0A 1TGNA 1C2LA 1VR1H 2ULLA 3MU5A 1KIGH 2WPKS 2ZHWH 2BMGB 2A0QB 3S0NA 2QYIA 3U9AH 1SB1H 1XUHA 1BTHH 3TK6A 2BQ6B 3MNXA 4DJZB 4HI3A 1AQ7A 2BXTH 2R2WU 2QXJA 3LT3A 2AS9A 1V2UT 2XCFA 1CA0C 2AEIH 2H6MA 2XRCA 3E6PH 1DX5M 1LVYA 4WXVA 1C5XB 5FXLA 3FZZA 4B2AA 1TNJA 2UUJB 1QJ6B 1WUNH 3FZDA 1O2MA 3AVZA 2GKVE 1OWJA 4BANB 1DWCH 4D9RA 3QK1A 4YO9A 1BQYA 2XCNA 1HAVB 3MHWU 4NA8A 3BTME 2EA3A 3ZVDA 1FY1A 4X8UH 1DLKB 1A5GH 1A5IA 1PFXC 5EXMA 1SGYE 3SGQE 1QTFA 1ZYOA 5EW1H 3SU0A 1EAWA 3TGJE 3UTUH 4MDSA 1XVMA 4A6LA 1O5AB 1ZHRA 3HATH 4WVPE 1LKAA 1W10U 1HJAC 1N6XA 4ZAEA 3NWUA 1E37B 2RCEA 4IMZA 1W3CA 2PSYA 3FP8E 1DUAA 1KDQB 1O37A 2CGAA 4A92A 2F91A 3BG4C 5EXNA 2OINA 3ZZCA 2FS8A 1BMNH 3P8NA 1C5OH 4O97A 1DWBH 4UFGH 1TAWA 1O2ZA 1AFEH 1OSSA 1A46H 1T8NA 4GLYA 3MFJA 1BBRH 1AKSB 1TMBH 1GJDB 1J8AA 5B6OA 1IQLA 4X2XA 1C2KA 4FUFA 2JKHA 2VIVA 3C1KA 1ACBE 2ZCHP 5A0AE 3LJJA 1JXPA 1K1NA 4FUIA 3FANA 2Z94A 1NU7B 4H6TA 2IOTA 2SGEE 1SGEE 3A87A 2ZHDA 5A0BA 1L1JA 1NRSH 2ZECA 1ANBA 3RLYH 1UK2A 1C5VA 1H4WA 3B8JA 2BY5X 1BMAA 1FNIA 2LNCA 1CT4E 1JRSA 2PKSB 3BTGE 3URDA 2FESH 2BDCA 1SLVB 4ZHMU 5ETXA 3EA7A 4DURA 3M7UA 1BITA 1FQ3A 3RXPA 4AYYB 3MU0A 4JZFH 1C1WH 1SHHB 2GMTB 2ZF0H 2ZFTA 1Z8RA 3BTEE 2QF3A 1SVPA 1SGRE 1MAYA 4Y7BA 2G5NA 2BQWB 2CMYA 1UTMA 2F9BH 2C8XB 1O3PB 1GMDG 5JBTA 4GVUA 1KLJH 4UFEH 2AGGX 2FZZA 2TBSA 2SNWA 2GT7A 4BTUB 5T6DA 1GJ6A 1P2MA 1QA7A 4FVDA 4LZ1H 1O3CA 3PM3A 1C5LH 5FX5A 1PPGE 3M5OA 2ZNKH 2BY9X 1EATA 1GI6A 2QCYA 4NIXA 4B75A 5LPRA 3TGKE 5GXPA 1A7SA 1HV7A 1KLTA 2A7CA 3W95A 4XFQA 7GCHF 3LC3A 2THFB 2D26C 5FPTA 3T25A 1MTWA 3BTHE 3URCA 2J92A 1C5SA 1ETRH 1GDQA 1O2LA 2PUXB 4I7YH 5E0JA 5AFYH 1TNHA 3Q3XA 3SNEA 1DWDH 2Y7XA 1T31A 1U6QA 1ZGVA 1BBRE 1LHDH 1P2NA 3BN9A 2H9TH 1O3GA 1O3DA 2Z9KA 3Q3YA 3A86A 3RC6A 1A1RA 1XUJA 3VXFH 1FI8A 1WSSH 1HJ9A 1EXFA 3RXUA 1CGJE 2F3CE 1SPJA 2AGEX 2PGBB 5GIBA 1SQAA 2HPPH 1EAUA 1Z8JB 1QB9A 2SFAA 1K1LA 2SGAA 1V2LT 3FFGA 2ZO3H 1AWFH 3LKWA 1LPKB 1Z71A 2H5CA 1O2SA 3BSQA 2JH0D 1W14U 6CHAC 1NRNH 4X6PA 1DT2A 3ZYDA 1YLCA 2ZFSA 1O3BA 3OYPA 3ZVBA 3P8FA 1FAXA 1O32A 4YZUA 2BZ6H 5EXLA 3M7TA 2ANMH 1V3XA 2PW8H 2F9UA 3ESTA 2F83A 3UOUA 1QA0A 7LPRA 4JZ1A 5TCAA 3BTKE 1OP2A 1GJAB 3HPTB 2ZPRA 4YM9A 2G81E 1HYLA 3RLWH 3N7OA 1MTSA 2Q6DA 4CRCA 1ZHMA 4NA7A 1C2FA 4X2YA 4Y8YA 5C5OA 4A1VA 2BD5A 2F9OA 1EP6A 1NU9A 4MG3A 2BQ7B 1EAIA 3RXHA 1GBEA 2O8MA 4I8HA 2QN5T 2Q6FA 3VGCB 1Q2WA 1BRUP 2A7JA 1ZZZA 1SBWA 3DA9B 3DFLA 4E06H 2WUBA 2TIOA 1C1SA 2G4UA 4D7GA 1YPEH 1O5EH 3RXRA 5DP3A 2W5EA 2GX4A 3Q76A 5I25A 1EZSC 1PPBH 3MO9A 2ODPA 1S84A 1NFXA 1IQFA 2BLVA 3LJOA 3UWIA 1O3FA 2BD4A 1ABIH 1GVZA 1XUIA 3TNSA 4TPIZ 1GHXH 1HAYB 1DXPA 1QQUA 1DXWA 2R2MB 2B9LA 3CS7A 1Y5BT 2BZAA 1P11E 2XNIA 3F9GA 1O5DH 1XVOA 3SGAE 1V2QT 1TGSZ 5A8ZA 1CBWC 2A4RA 5L2ZH 3A89A 3RXQA 1O35A 1WAYB 1O3NA 1NRPH 1LCYA 1GG6B 4NIYA 3ZVFA 4ZMAH 3LOXA 2Y80A 2FI4E 3GDUA 2ZFFH 2BD7A 1EPTA 4FXGH 3NUMA 2C8WB 5HMAA 4FUEA 1VJ9U 1GGDC 3LH1A 1XXFA 3SO3A 2WPLS 4NA9H 3FAOA 5E0HA 3RXAA 3SQHE 1HXFH 2XBWA 4D9QA 4YLQH 6GCHG 1OWIA 1GI4A 2VGCB 1MBQA 1BTZA 1PPCE 3S7KB 1NFYA 1C5MD 2ANKH 3V0XA 2A4OA 2CN0H 1THPB 2ZU1A 4IN2A 5J4SA 2XWAA 1O2JA 1VCQA 4IN1A 1ZOMA 2P8OB 1IHSH 2A2XH 2SGQE 4MNWA 3UNRA 1TGTA 4KKDA 2FYRA 2BDIA 4TWYA 6ESTA 3DD2H 1OPHB 2BHGA 4NIWA 1LHEH 3SV2H 1E34B 3RP2A 1T32A 1OYTH 2OP9A 3DT0H 1BMLA 4B2BA 1YPJH 2EI8A 3IWMA 4I8JA 2PLXA 1HFDA 4D76A 1ZPZA 1DY9A 1O3MA 1ELFA 2OTVA 1DLEA 1O3OA 2ZHFH 1QGFA 1RRKA 2J95A 1S6HA 1MKXK 2C3SA 1S5SA 1RXPA 4A1XA 1GBCA 2P94A 1QL9A 2FP7B 1TPSA 2Y5GA 1NRQH 2A1DB 5LPEA 4GCHF 2BD8A 4ZXYH 4IGDA 4ZHLU 2KAIA 2HNTE 5K0HA 1H9IE 2FOGA 4MTBA 1GL0E 1QBVH 4NSVA 2EI7A 5LPFA 3O8DA 1KXAA 1IOEA 2WPHS 1LPGB 1ZMJA 1K22H 3SU4A 4ABAA 1TE0A 1QURH 2XBYA 1GCTB 3HGPA 2ZZUH 1ESTA 3A81A 3EA8A 2ZDAH 3M5NA 8ESTE 2PSXA 2F9PA 3LGYA 2BY8X 1QR3E 1X7AC 2OD3B 2FYQA 1BJVA 3D49H 4LOYH 3U8RH 2BXUH 1ZJDA 1C2MA 3PWBA 1UO6A 3ZV9A 3KQBA 3A8AA 1ESAA 1UHBB 4D8NA 4WY3A 3A84A 2ZI2H 1ZR0A 5JBAS 2VB0A 4NCYA 5FPYA 3SJ8A 3ZZBA 1GMCG 2Q1JA 3IG6B 3SV8A 2O8WA 4CR5A 1ELGA 3ZV8A 1CA0B 3KGPA 1D3PB 1UTQA 2GDEH 1TPPA 1GL1A 2SGFE 1SG8B 1KY9A 1BA8B 1YCPH 3FP7E 5GCHG 3QO6A 1ETSH 3T28A 1OX1A 4KTCA 4X6NA 2FX4A 5F8XA 1YBWA 1UVTH 4ABGA 1FONA 5PTPA 4Z6AH 4ABHA 3EDXB 4JK5A 3EAJA 4ZUHA 1QL7A 3CP7A 3GCTG 2QY0B 4X1SU 1GMHG 3DUXH 4OS2A 1V2TT 1MKWH 1GHAG 5DKMA 1PPEE 1MUEB 1TABE 1QY6A 1W0YH 4MPWA 1GVKB 2CHAC 4BNRA 3E0PB 2ZU4A 2GGVB 2FEQH 4X8TH 1CU1A 3P92A 1Y3VA 1C1QA 1DOJA 3OU0A 4K8BA 3WY8A 3LU9B 2ZHQH 4XSKU 3GY2A 3E90B 1C2DA 1BUIA 2ZDNA 3K65B 2ZIQH 4DW2U 4XBCA 2VIOA 2AMDA 1ZSJA 2UWPA 1HDTH 2B5TB 3HKJB 1C9PA 3M3TA 4JYTA 5JB8S 2FS9A 5C1UA 3GY6A 2K1QA 1K1OA 1A5HA 3ATKA 1YLDA 1OWHA 4K1EA 1HAOH 3KQCA 1E38B 3SU5A 1SMFE 3KHVA 1WQSA 5EG4A 4CRDA 2DUCA 1G37A 1O3AA 3LGUA 1AE5A 2CF8H 1EASA 3BTTE 2VJ1A 1TPOA 3PWCA 1A3EH 1P06A 2D8WA 2QXGA 1Z8GA 1T4VH 2RG3A 2WPIS 3L33A 4ABFA 1IQIA 3STIA 4AFUA 1FUJA 1L2EA 3P8GA 1JWTA 1O2UA 1RJXB 2PUQH 3MWIU 3SN8A 1CHGA 2ZGXH 5C20A 3T26A 1ANEA 1GBAA 3D65E 2FX6A 1AGJA 1GBLA 3EQ0H 3I78A 4I8LA 3A8DA 4SGBE 1WOFA 4Q7YA 2QXIA 4AZ2B 2VH6A 5JBCS 3SV6A 2R0LA 1GI1A 3RXCA 3VB6A 2ZCKP 3CENA 9ESTA 1E35B 5FHTA 1AI8H 3GY4A 4XOJA 5EU8A 3OX7U 1HIAB 4KGAA 3TK5A 4O3TA 1QQ4A 1D3DB 5GPIB 3P70B 2V35A 1WCZA 3U1JB 3E3TA 2ZC9H 2BYAX 3R3GB 1G32B 3TH2H 1DWEH 1UTKA 1YYY1 3SW2B 3UPEA 2A5IA 3Q3KA 2P93A 3D62A 2BDYA 3QTOH 4TY6A 5EODA 4M7GA 4DOQA 2FTLE 1KXDA 1C1UH 1UTOA 2GCHG 1D3QB 2I6QA 1C2IA 3M37A 3NZIA 2D1JA 2FOBA 4AFSA 1AFQB 2OC7A 4WWYA 1GHWH 3KEEA 2H9EH 4E05H 1P2OA 1TA6A 3A7XA 3K2UA 1LKBA 2W7UA 2GP9B 1K28D 1NTPA 1O2WA 2A45B 2A4QA 2ZDKA 3EE0B 2FOCA 1QL8A 1FY3A 5DP5A 4U01A 3UREA 3RXSA 2VIPA 1AN1E 4Q80A 1VGCC 4VGCC 1FIWA 1OWDA 2PFEA 4JK6A 1Y8TA 1IQMA 3QWCH 5F03A 3SNAA 4UFDH 3LGTA 1O3IA 3S9CA 4K8YA 4X8SH 3U8OH 8GCHG 3RU4D 1YM0A 4JZDH 1EQ9A 3ENSB 2JH5D 1O38A 5E8EH 1CGIE 3MU8A 5CE1A 2G8TA 1VITG 1N1LA 3PROA 3UQOA 3ZZ4A 4JYUH 1O2QA 1C1NA 1SQTA 4NG9H 1AUTC 2G52A 1C4Y2 1P12E 2BLWA 4B1TA 1PYTC 1Z6JH 4Y6DA 1A0JA 1BCUH 2GV6A 3GCOA 2CXVA 1ELTA 3TLOA 1O3HA 1DM4B 4HZHA 2PKAB 3SNBA 4DGJA 3T27A 1FDPA 1HAVA 2G55A 1F0RA 1P2JA 3LDXH 2W3KA 5C67A 1QIXB 3V7TA 1C5ZB 1DANH 1YPKH 4ASHA 3GY8A 1VITH 1SC8U 3K6ZA 4O03A 2ZPQA 1AO5A 3MOCA 3BIVH 1YKTA 4UFFH 4NFEA 4H6SB 2Y6TA 5LGOA 3KCGH 1AU8A 3T62A 4AG1A 4X1RU 3PTNA 3NKKA 5FPSA 5HGGA 1YP9A 3RU4T 3SUGA 3TPIZ 3EYDA 1LHFH 1C1TA 3GCHC 3SOSA 1KDQA 3PMJA 4IS5A 3A7TA 3LC5A 3I29A 1T8MA 2Z3CA 4NFFA 1C1PA 2FI3E 4B74A 3M7QA 1CHOF 1AY6H 1YPLH 2UUYA 1HPGA 3KL6A 1C5WB 1AKSA 3UY9A 1P2KA 2OC0A 1SLWB 1A4WH 1OP8A 1ARCA 1GHBG 1DFPA 1H8DH 2ZGCA 4CRGA 1CT0E 1RIWB 5AFZH 4J1YA 1QRZA 3KIDU 1AB9C 2OBQA 3MNSA 2YNAA 5ESTE 4PROA 1JMOH 4X1QU 1EZXC 1E36B 1GVLA 3U69H 4WH6A 5AF9H 1D6WA 3TIUA 4Q7ZA 2M5TA 4TWWA 4UONA 1TNIA 2BLQA 1FPCH 1SOTA 1J9CH 3SBKA 1BRBE 4X8VH 3STJA 2QGRA 1GGDB 1VJAU 1G2LA 3ATLA 4R0IA 3ZZDA 1FY4A 1GJCB 1O2GH 2R3UA 1G3BA 4FUCA 5CHAB 4HGCA 3TU7H 1FMGA 2SNVA 2XWBI 4ISNA 5DG6A 1KSNA 2VU8E 3VXEH 5A0CA 4FU8A 2DE8A 1TIOA 2BX3A 4DCDA 2A2QH 4MNVA 1SGFG 1UTLM 1ZTKA 4H42U 3BTQE 1EJAA 4ZKNU 2VWNA 5T6GA 4Z0KA 2O8LA 1K21H 4TYDA 3AW0A 1P09A 5BPEA 4H4FA 1UCYH 1XUGA 2VNTA 5JDUB 4ZH8A 2BM2A 1WTGH 1ELAA 1QB6A 3LGIA 3TH4H 3H5CB 4BTTB 2Q6GA 1BHXF 1ZGIA 1AHTH 3M61U 3RXJA 3M3VA 1ELDE 3A7VA 3MO3A 3AAVA 2AERH 4BAQB 2V3OH 1CGHA 1H9HE 1ZSKA 2OBOA 3U98H 5ESBA 1GBTA 3V3MA 1W8BH 1MMJN 1HBTH 1KTSB 3RMMH 4LZ4B 1TQ0B 2WYJA 4MVNA 2FO9A 4K2YA 1XM1A 5GDSH 5BRRE 2ZGJA 1IAUA 3SI3H 1BBRK 1SHYA 4KELA 1CSOE 5HM2A 1RFNA 1GJ7B 1MCTA 5F8TA 2BDBA 1FN6A 3MYWA 1LDTT 1NM6A 5G4BA 2FWWA 3P6ZB 1F7ZA 2GCTB 1AIXH 1TX8A 5EQSA 1Y3WA 2ZU5A 1V2KT 1QCPA 1BIOA 2PGQB 4MPVA 3SUFA 2B8OH 2ZU3A 1XKAC 5I46H 3SJOA 1F2SE 3V12A 3A85A 1OS8A 2AH4X 1HCGA 1O31A 1SOZA 3RM2H 3M36A 1CVWH 3TJNA 3CS0A 1PYTD 4UEHH 3BEUA 4ZKSU 2RA0A 1YGCH 1GI5A 1V2OT 1O2RA 2CJIA 2FOAA 3ZZ6A 4I8GA 1VCPA 1WYKA 1NROH 1FJSA 2VH0A 3GY3A 1XUFA 2WPJS 1EZQA 2STAE 1MQ6A 1NT1A 1RTFB 3BTDE 4K60A 4O9VA 5EGMA 1RGQA 4CHAB 2ODYB 1H9LB 3ZZ7A 3B23B 1JRTA 1V2ST 3SHAH 1ZPBA 4AYVB 1F5LA 3U1IB 3RM0H 1O30A 2O9QA 4GHTA 4WXIA 2BX4A 3BTWE 1UCYE 3RUOA 2FI5E 2OQ5A 1BJUA 4U32A 1V2VT 1PQ8A 4ISLA 1WBGB 1O3LA 3IITA 3M5LA 2CHAB 1PQ5A 5C2ZA 2HOBA 1C5RA 1TFXA 1EB1H 3KQDA 1DSTA 5AVDA 4ESTE 1C5NH 1SGPE 1GBKA 1TGBA 2P3TB 4XBDA 1Y3UA 2NU1E 2BTCE 2PKSC 1TALA 1W12U 2AGIX 2QV1A 4E7RG 2GMTC 2AMPA 2JETB 1W7XH 4BAHB 3FP6E 1IQKA 1O2TA 5CMXH 2AIQA 1HJ8A 3KQEA 2NU0E 1YCPM 4WH8A 1GJ8B 3VB5A 1HUTH 2BDAA 1MCVA 5FAHA 3A80A 1NO9H 3GYMA 2ZU2A 4RN6A 4BXWA 2FLBH 1GI3A 1L1GA 3RC4A 1ZRKA 1P04A 1YPGH 3RDZA 2PHBA 1G9IE 4Y8ZA 5DP7A 2VWOA 4IBLH 2EEKA 1CT2E 1SLUB 1HAXB 1HLTH 2FDAA 1P05A 2WUCA 3AASA 1SGIB 1GJBB 2BDHA 4MNXA 2H2ZA 5SGAE 2BOKA 1TWXB 1ELEE 4INKA 1O5GH 2EC9H 1OKXA 1Z6EA 5JBBS 3ZZ9A 1IQNA 4FUJA 3JZ1B 5ABWA 1UVSH 4LXBH 3RMLH 4GAWA 1ANCA 2ZTYA 4K69A 3RC5A 3SQEE 1HRTH 2FOFA 2ZGBH 2NU3E 4KTSA 2Y5FA 1JOUB 1O39A 1UK4A 2P59A 5IYTA 1M9UA 1EJNA 1G30B 1MAXA 4BAOB 5DGJA 2A4GA 4K1SA 4AX9H 2GT8A 3UIRA 4NWLA 1FZZA 5DP4A 5FBEA 2ZEBA 2C93B 4QT8C 2VVCA 1ELCA 1XUKA 5C1YA 1BB0B 2STBE 2FLRH 2ZWLH 3A8CA 1ZTLA 3P95A 1YPHE 3A8BA 4NZQA 7GCHG 3UR9A 3B9FH 4MPUA 3V13A 4AFZA 1A0HB 5F6MA 1MZDA 1P57B 5A8XA 2GZ7A 4DIHH 1GBIA 1BTPA 1LQEA 1K1PA 2XTTB 4FVBA 5EOKA 1MH0A 2ZG0H 8LPRA 1VGCB 3PMBB 4I31A 4MLFB 1O2VA 2V6NA 3T2NA 2QC2A 2ANWA 1GDUA 3ODFA 3VB3A 4Y10E 1P3EA 1TQ7B 2R3YA 1FY8E 4Y0YE 1UHBA 2BD3A 1TYNA 2Y7ZA 1ID5H 2ZKSA 2SGDE 2EI6A 1O2XA 4ABIA 1N8OC 1P9UA 2W7SA 1IQEA 1QBNA 2OCVB 4XBBA 2OC1A 1SLXB 3RMOH 3QX5H 2G51A 1VZQH 1Y3XA 3ELAH 3F6UH 1ZJKA 3F9FA 2Z7FE 2A31A 1H1BA 1LMWB 4K5ZA 2NWNA 4JCNA 1HJAB 4A7IB 4BAKB 4BOHA 2FOEA 1BTUA 2IJOB 3SNDA 3GICB 1O33A 1EP5A 4IMQA 3MO6A 2CF9H 1EPTC 3BG4B 1B0EA 3QUMP 3PO1C 3LPRA 1Z8IB 5DP6A 3M3SA 5EW2H 2A5AA 3VFEA 1BTXA 2J9NA 5FCKA 2XC5A 3GY7A 1K1IA 4MNYA 1GHZA 2PR3A 5J4QA 1EZUC 4THNH 4YESB 4ZKRU 3QDZB 4INHA 2HNTC 1HAIH 4GUXA 1GMDF 2GVFA 1V6DA 4IC6A 3RXDA 2ASUB 4AB9A 1FN8A 1TPAE 4OGXA 2W3IA 1HAHH 2BD2A 1GBBA 1MD7A 5DK1A 4O3UA 5DO4H 1O2OA 4I8KA 1FPHH 1DVAH 1Y59T 1GBHA 1P3CA 1OYQA 1L4ZA 1J14A 2VGCC 1MZAA 3MH4A 1TA2A 1GHVH 2GZ9A 5EQRA 4MQAA 2FOHA 1AB9B 1TX6A 2VVVA 4OS4A 2P95A 1P01A 1GJ9B 4B71A 4Y71A 5DJ7A 1Z1IA 1SI5H 2P8OC 3GDVA 1C2JA 3E16B 1DITH 3ZVAA 3O8CA 4K3JA 1PQ7A 1BTWA 1ZMNA 4Q7XA 4OGYA 2FM2A 2BLOA 1GJ4H 1N6YA 8KME2 3DFJA 1XX9A 3AW1A 3S9AA 3VB4A 1KXEA 3MU1A 6LPRA 4OS6A 4CBNA 1GWAA 1K2I1 1PPFE 1S85A 4WMEA 1RS0A 4WF8A 1G3DA 1YCPK 2ESTE 1DS2E 2Z9GA 1O34A 2UWOA 1UVPA 2VWLA 3QZQA 2BVSH 1QNJA 4FUBA 3E8LA 1S83A 1HIAA 2FTMA 2YNBA 2TGPZ 1BZXE 4F49A 1MU8B 4CRBA 1O3JA 1QBOA 3ITIA 4HTCH 1MKWK 2BY6X 3S9BA 3MH7A 2AYWA 5IDKA 1MU6B 4BTIB 1O5CB 4GSOA 1UJ1A 3ZVCA 2DE9A 3GY5A 3Q77A 4X2VA 2ALVA 4CRFA 4ABDA 1HXEH 1CO7E 3HK6B 1Y3YA 3RMNH 2CV3A 1NN6A 4YTAA 1IHTH 4NIVA 1V2RT 2ZDMA 5HM9A 2HNTF 1WTHD 3PV4A 3K6YA 2ZQ1A 2ZFPH 1THSH 1AUJA 4YT7H 4NGAH 3TJUA 3PMAB 3MNBA 1C5TA 3TH3H 1H8IH 2C8ZB 2I6SA 1DDJA 2Y82A 1O3EA 4GCHG 1DICA 3ZZ3A 5C1XA 4BAMB 5HYOA 1QHRB 3UFAA 3SI4H 3UOPA 3TITA 1BTYA 1P02A 3U8TH 6CHAB 1T4UH 2VVUA 3LGWA 3BV9B 5TCCA 1LTOA 2OLGA 3G01A 1TNKA 1YPMH 2J2UA 2YOLA 3A7YA 3EA9A 4AOQA 1NFUA 1OXGA 1ZLRA 2VWMA 1O36A 4ABEA 1EJMA 2PTNA 4IW4E 1NZQH 4B73A 3LIWA 4I33A 3PYHA 1MTVA 1BRCE 3ATIA 3A88A 5EPYA 1Y5AT 2QIQA 5A8YA 1THRH 1SR5C 2R9PA 3P17H 1KXCA 4X6OA 4WJG2 1B0FA 1J17T 1TMUH 1UTNA 5FBIA 1XKBC 3E0NB 1JIRA 1LHCH 4INLA 4UDWH 1FAKH 4CH8B 1UVUH 2FMJA 3SUEA 2HGTH 1C5PA 2H9HA 4AFQA 2PKAA 2J4IA 1MD8A 4X1PU 1GCDA 6GCHF 4ISOA 1W2KH 2GZ8A 3GOVB 3NK8A 1G2MA 1NY22 4JZIA 1DPOA 4CRAA 1NPMA 2VIQA 4ABJA 2B7DH 2Y5HA 3GDSA 5DP8A 2ZDLA 1MTNC 3F9EA 4Y11E 3NXPA 3UNQA 1O2KA 3SV9A 1EB2A 5K7RA 1PJPA 2ODQA 1GI2A 3QGJA 1T8OA 1CBWB 2RA3A 2TGTA 4FU9A 1AVXA 1F5RA 3MNCA 1NESE 5E0GA 1P9SA 2IPHA 1BT7A 1TX7A 4NZLA 2ZFRH 1G3CA 1QFKH 2G00A 9LPRA 4YLUA 1S0RA 2WV5A 4DIIH 3BG8A 3VEQB 3QGNB 1PPZA 1QJ7B 1ELVA 4AG2A 2JH6D 3SJIA 1O2YA 2ZTZA 3P8OA 1DY8A 2Z3DA 3MI4A 1ELBA 2OXSA 3BEFB 1Z1JA 2WYGA 1GBDA 1G3EA 1MQ5A 1ZSLA 4RSPA 1W13U 1TMTH 4A5TS 2O8TA 1GI9B 1EAXA 3SV7A 2A32A 1Y5UT 2ZTXA 1DSUA 1QB1A 3ZZ5A 2Z9JA 1AZ8A 2F9NA 2WV4A 2TRMA 1QRXA 5L2YH 1W7GH 1AFQC 2P3FH 4AORA 1G36A 1NC6A 7ESTE 3ATWA 1D9IA 1TRYA 4UE7H 3RXBA 1GMCF 1ZRBA 2HLCA 5A09A 3EGKH 3BIUH 2J94A 2FODA 3KN2A 4HFPB 3PLBA 1YF4A 1GHYH 1F0TA 1LQDB 3TJOA 2BY7X 2AFQB 5E2OA 5GCHF 1C5UA 5GJ4B 3F9HA 2H5DA 3ZYEA 2LPRA 4GPGA 4JZEH 3RXKA 2PV9B 2BOHB 3FVFB 1OWKA 1C5YB 5F8ZA 3UWJH 1GI7B 1S81A 4WMFA 3GCTF 1GMHF 3UQVA 3RXLA 1TNLA 1C2HA 4Q2KA 1SGFA 3ATMA 1GHAF 5T6FA 3S7HB 3SGBE 5DP9A 1SFIA 3PLPA 1A61H 1J16A 4Y8XA 1LO6A 1TGCA 1V2MT 5JYIA 2ZPSA 4ABBA 5EQQA 4LK4A 1O5FH 4D7FA 5HXFA 4U2WA 2PTCE 3QZRA 2G4TA 4ZXXH 1BOQA 1EOLA 1V2PT 1MKXH 2XBXA 3SJKA 2C90B 1GJ5H 3SJ9A 4B2CA 4YT6H 4Y0ZE 4U30A 4KTUA 1AVGH 1P8VC 2J34A 1HAZB 3SU1A 1N8OB 1C9TA 1CA8B 1IQHA 3LH3A 1OP0A 3RXGA 1T7CA 1ANDA 1LVOA 3RXEA 1O0DH 1AZZA 3TGIE 1LHGH 1D6RA 1XXDA 2Z9IA 3S69A 4FUGA 3QTVH 3BF6H 4UD9H 4AGKA 1IQJA 2A7HA 1DE7H 2B0FA 2HALA 1UCYK 4Y79A 3PTBA 1Q3XA 2HWLB 2HRVA 4X1NU 3SNCA 1FY5A 1EPTB 3KNXA 3PO1B 4X0WU 2TGDA 4IC5A 1FXYA 3QLPH 1AD8H 1CQQA 3SU2A 2HPQH 3L3TA 1RIWC 4K1TA 3OY5U 1EX3A 4JMYA 2ZA5A 2TPIZ 1HGTH 1D4PB 4A1TA 4NSYA 4CH2B 2BVXH 1TLDA 1HAGE 3MH6A 1W11U 3OSYA 1AVWA 1C4U2 4J2YB 1AMHA 1P2QA 2BDGA 1LPZB 4NWKA 3RXOA 3E91A 3E1XB 4MPXA 3SHCH 3A7WA 1HB0B 1FV9A 1JBUH 3RU4E 1RTLA 2HVXA 1K1MA 1TB6H 5CHAC 2GCHF 1TBRH 1AE8H 2RDLA 4FUHA 4RKJB 1O2HA 4JYVH 1CHOG 4E7NA 3KF2A 1GPZA 2WPMS 2ZCLP 3PMHB 2FXRA 2PWXA 3A82A 1LVMA 1SQOA 5E2PA 3SZNA 1TBZH 4X6MA 2XYAA 3TNTA 1AWHB 2TGAA 4ISIH 1TRMA 1B7XB 3TK9A 3RXIA 2OQUA 3ODDA 2R0KA 1WQVH 3O8RA 2BVRH 1C1MA 3GYLB 3MU4A 1S0QA 3GISB 3ZVGA 1NRRH
chains in the Genus database with same CATH superfamily
1NS3A 2KAIB 3T5FH 1C1RA 3NPSA 1ORFA 1RTKA 3JZ2B 1C2EA 4FUDA 2UUFB 1KLIH 4KP0A 3RXFA 4YOJA 2XBVA 3A83A 1EOJA 1JIMA 1TONA 2BD9A 1UK3A 2ZHEH 3RXTA 1ZMLA 2Z6BD 3SYJA 1GBJA 3OTJE 5T3HA 3TJVA 1P03A 3OE7D 4SGAE 8GCHF 1VCWA 1C2GA 3SU6A 2QF0A 2GV7A 1T8LA 2NU4E 2Z3EA 3C27B 5C3NA 4F4OC 5JPMH 2ILNA 2XXLA 3VPKA 5TJXA 2FIRH 1SGNE 2AMQA 2AIPA 1GI0A 1ZHPA 1TRNA 1K9OE 3UNSA 1ZTJA 1BMMH 2P3UB 1UMAH 1ABJH 1GI8B 1FIZA 2Y81A 4GHQA 4OS5A 1VITF 1SSXA 3F2GA 4DVAU 4ZKOU 5DN6D 3ZZAA 4R8TB 4DT7B 1A3BH 2C4FH 3L6PA 3A7ZA 2VINA 2GCTC 1PQAA 3PB1E 1GBFA 1A0LA 2LP6A 4FU7A 2ZGHA 2UUKB 4VGCB 1OWEA 3MTYA 5FX6A 5H4IB 1E0FD 5A2MH 2RDEA 2OK5A 1C5QA 4TY7A 1SFQB 1C4V2 1XMNB 2QA9E 1ESBA 1SGCA 1BDAA 3Q00A 2ZQ2A 4X2WA 3MMGA 2AHME 1INCA 2ZDVH 4ZHAA 4YOGA 3M5MA 1B5GH 4BXSA 2W26A 1V2WT 2GD4B 1EKBB 5DPAA 1F0UA 2K0QA 4CBOA 1UTJA 1MBMA 4Y7AA 1P2IA 1WU1A 3M35A 4DY7B 3VGCC 1J15A 4CHAC 1A2CH 3F1SB 3ZVEA 1D3TB 3GCNA 2XW9A 2WINI 4OS7A 1MTUA 4XE4A 2QAAA 1O2PA 4CR9A 4ISHH 2H1UA 3R0FA 1GHBF 3DHKH 1BHXB 4WMDA 1QJ1B 1PPHE 1UVOA 3RXVA 1FLEE 4RKOB 5FCRA 1C1OA 1Z7KA 2IJD1 3F0OA 1UTPA 2J38A 4AGJA 3F68H 1Q31A 1NFWA 3HKIB 7KMEH 5KGOA 1WV7H 3I77A 5LH8A 1F0SA 2VIDA 1TOCB 1L0ZA 1GDNA 2QXHA 2Z9LA 3LONA 1O3KA 1OOKB 3GCHB 4DG4A 1QRWA 1GG6C 1RD3B 2L74A 1KXBA 1ZPCA 3K9XB 1ARBA 4AN7A 4CREA 1VKYA 3OEHD 3VB7A 3TVJB 1O2IA 1YC0A 1H8ED 3UUZA 1SL3A 3FKSD 4ZROA 3ZIAD 2UWLA 2JETC 3AAUA 4YOIA 1P10A 2HVYB 1MTNB 1YY3A 1F92A 1KXFA 1L4DA 1CE5A 3SU3A 1HNEE 1BRAA 1O2NA 1YPHC 1YLNA 4I32A 1TBQH 2GTBA 3RXMA 4AB8A 1S82A 2V3HH 1DUEA 3MH5A 1O5BB 4XDEA 1SGTA 3UR6A 3NCLA 1KYNA 2P16A 2OC8A 3PRBA 1SGQE 5L6NH 1W0ZU 2V0BA 2VIWA 3LGVA 4TPYA 2BB4A 2O8UA 5GNDA 1L1NA 1P0SH 2ALPA 1TNGA 1V2JT 1COWD 2D2DA 2G5VA 2FPZA 1S6FA 2OUAA 5EPNA 2C8YB 1HAPH 5JB9S 2ANYA 1V2NT 3BTFE 1LVBA 3BEIB 4B76A 3QN7A 3SUDA 2SGPE 1IQGA 1SGDE 2A5KA 4P02A 1C1VH 1EUFA 2F9VA 3D23A 3SORA 1GBMA 3HGNA 2ZFQH 3ZZ8A 5GWZA 3H7TA 3HK3B 2ZP0H 3T29A 3OY6U 5C5NA 1K1JA 1KTTB 2YMSB 3WWFA 1ETTH 2NU2E 2IN2A 5L30H 4Y76A 3O8BA 2FOMB 2RFKC 2XC4A 3W94A 1GCTC 1F5KU 3PLKA 2GDDA 4AC9A 5AHGH 3H7OA 1TOMH 4OS1A 2XC0A 3KYFA 1TGNA 1C2LA 1VR1H 2ULLA 3MU5A 1KIGH 3EE7A 2WPKS 2ZHWH 2BMGB 2A0QB 3S0NA 2QYIA 3U9AH 1SB1H 1XUHA 1BTHH 3TK6A 2BQ6B 3MNXA 4DJZB 4HI3A 1AQ7A 2BXTH 2R2WU 2QXJA 3LT3A 2AS9A 1V2UT 2XCFA 1CA0C 2AEIH 2H6MA 2XRCA 3E6PH 1DX5M 1LVYA 4WXVA 1C5XB 5FXLA 3FZZA 4B2AA 1TNJA 2UUJB 1QJ6B 1WUNH 3FZDA 1O2MA 3AVZA 2GKVE 1OWJA 4BANB 1DWCH 4D9RA 3QK1A 4YO9A 1BQYA 2XCNA 1HAVB 3MHWU 4NA8A 3BTME 2EA3A 3ZVDA 1FY1A 4X8UH 1DLKB 1A5GH 1A5IA 1PFXC 5EXMA 1SGYE 3SGQE 1QTFA 1ZYOA 5EW1H 3SU0A 1EAWA 3TGJE 3UTUH 4MDSA 1XVMA 4A6LA 1O5AB 1ZHRA 3HATH 4WVPE 1LKAA 1W10U 1HJAC 1N6XA 4ZAEA 3NWUA 1E37B 2RCEA 4IMZA 1W3CA 2PSYA 3FP8E 1DUAA 1KDQB 1O37A 2CGAA 4A92A 2F91A 3BG4C 5EXNA 2OINA 3ZZCA 2FS8A 1BMNH 3P8NA 1C5OH 4O97A 1DWBH 4UFGH 1TAWA 1O2ZA 1AFEH 3SZEA 1OSSA 1A46H 1T8NA 4GLYA 3MFJA 1BBRH 1AKSB 1TMBH 1GJDB 1J8AA 5B6OA 1IQLA 4X2XA 1E1QD 1C2KA 4FUFA 2JKHA 2VIVA 3C1KA 1ACBE 2ZCHP 5A0AE 3LJJA 1JXPA 1K1NA 4FUIA 3FANA 2Z94A 1NU7B 2QE7D 4H6TA 2IOTA 2SGEE 1SGEE 3A87A 2ZHDA 5A0BA 1L1JA 1NRSH 2ZECA 1ANBA 3RLYH 1UK2A 1C5VA 1H4WA 3B8JA 2BY5X 1BMAA 1FNIA 2LNCA 1CT4E 4F48B 1JRSA 2PKSB 3BTGE 3URDA 2FESH 2BDCA 1SLVB 3N99A 4ZHMU 5ETXA 3EA7A 2JIZD 4DURA 3M7UA 1BITA 1FQ3A 3RXPA 4AYYB 3MU0A 4JZFH 1C1WH 1SHHB 2GMTB 2ZF0H 2ZFTA 1Z8RA 3BTEE 2QF3A 1SVPA 1SGRE 1MAYA 4Y7BA 2G5NA 2BQWB 2CMYA 1UTMA 2F9BH 5FL7D 1BMFD 1O3PB 2C8XB 1GMDG 5JBTA 4GVUA 1KLJH 4UFEH 2AGGX 2FZZA 2TBSA 2SNWA 3OEED 2GT7A 4BTUB 5T6DA 1GJ6A 1P2MA 1QA7A 4FVDA 4LZ1H 1O3CA 3PM3A 1C5LH 5FX5A 1PPGE 3M5OA 2ZNKH 2BY9X 1EATA 1GI6A 2QCYA 4NIXA 4B75A 5LPRA 3TGKE 5GXPA 1A7SA 1HV7A 1KLTA 2A7CA 3W95A 4XFQA 7GCHF 3LC3A 2THFB 2D26C 5FPTA 3T25A 1MTWA 3BTHE 3URCA 2J92A 1C5SA 1ETRH 1GDQA 1O2LA 2PUXB 4I7YH 5E0JA 5AFYH 1TNHA 3Q3XA 3SNEA 1DWDH 2Y7XA 1T31A 3DCLA 1U6QA 1ZGVA 1BBRE 1LHDH 5C0UA 1P2NA 3BN9A 2H9TH 1O3GA 1O3DA 2Z9KA 3Q3YA 3A86A 2KM0A 3RC6A 1A1RA 1XUJA 3VXFH 1FI8A 1WSSH 1HJ9A 1EXFA 3RXUA 1NBMD 4ZCNA 1CGJE 2F3CE 1SPJA 2AGEX 2PGBB 4TSFD 5GIBA 1SQAA 2HPPH 1EAUA 1Z8JB 1QB9A 2SFAA 1K1LA 2SGAA 4B6FA 1V2LT 3FFGA 3H09A 2ZO3H 1AWFH 3LKWA 1LPKB 3PRDA 1Z71A 2H5CA 1O2SA 3BSQA 2JH0D 1W14U 6CHAC 1NRNH 4X6PA 1DT2A 3ZYDA 1YLCA 2ZFSA 1O3BA 3OYPA 5C17A 3ZVBA 3P8FA 1FAXA 1O32A 4YZUA 2BZ6H 5EXLA 3M7TA 2ANMH 1V3XA 2PW8H 2F9UA 3ESTA 2F83A 3UOUA 1QA0A 7LPRA 4JZ1A 5F53A 5TCAA 3BTKE 1OP2A 1GJAB 3HPTB 2ZPRA 4YM9A 2G81E 1HYLA 3RLWH 3N7OA 1MTSA 2Q6DA 4CRCA 5C94A 1ZHMA 4NA7A 1C2FA 4X2YA 4Y8YA 5C5OA 4I86A 2BD5A 2F9OA 1EP6A 1NU9A 4A1VA 4MG3A 2BQ7B 1EAIA 3RXHA 1GBEA 2O8MA 4I8HA 2QN5T 2Q6FA 3VGCB 1Q2WA 1BRUP 2A7JA 1ZZZA 1SBWA 3DA9B 3DFLA 4E06H 2WUBA 2TIOA 1C1SA 2G4UA 4D7GA 1YPEH 1O5EH 3RXRA 5DP3A 2W5EA 2GX4A 2XOKD 3Q76A 5I25A 1EZSC 1PPBH 3MO9A 2ODPA 1S84A 1NFXA 1IQFA 2BLVA 3LJOA 3UWIA 1O3FA 2BD4A 1ABIH 1GVZA 1XUIA 3TNSA 5KEDA 4TPIZ 1GHXH 1HAYB 1DXPA 1QQUA 1DXWA 2R2MB 2B9LA 4RT0A 3CS7A 1Y5BT 2BZAA 1P11E 2XNIA 3F9GA 1O5DH 1XVOA 3SGAE 1V2QT 1TGSZ 5A8ZA 1CBWC 2A4RA 5L2ZH 3A89A 3RXQA 1O35A 1WAYB 1O3NA 1NRPH 1LCYA 1GG6B 4NIYA 3ZVFA 4ZMAH 3LOXA 2Y80A 2FI4E 3GDUA 2ZFFH 2BD7A 1EPTA 4FXGH 3NUMA 2C8WB 5HMAA 4FUEA 1VJ9U 1GGDC 3LH1A 1XXFA 3SO3A 2WPLS 4NA9H 3FAOA 5E0HA 3RXAA 3SQHE 2KCAA 1HXFH 5CDFE 2XBWA 4D9QA 4YLQH 6GCHG 1OWIA 1GI4A 2VGCB 1MBQA 1BTZA 1PPCE 3S7KB 1NFYA 1C5MD 2ANKH 3V0XA 2A4OA 2CN0H 1THPB 2ZU1A 4IN2A 5J4SA 2XWAA 1O2JA 1VCQA 4IN1A 1ZOMA 2P8OB 1IHSH 2A2XH 2SGQE 4MNWA 3UNRA 1TGTA 4KKDA 2FYRA 2BDIA 4TWYA 6ESTA 3DD2H 1OPHB 2BHGA 4NIWA 1LHEH 3SV2H 1E34B 3RP2A 1T32A 1OYTH 2OP9A 3DT0H 1BMLA 4B2BA 1YPJH 2EI8A 3IWMA 4I8JA 2PLXA 1HFDA 4D76A 1ZPZA 1DY9A 1O3MA 1ELFA 2OTVA 1DLEA 1O3OA 2YMSD 2ZHFH 1QGFA 1RRKA 2J95A 1S6HA 1MKXK 2C3SA 1S5SA 1RXPA 4A1XA 1GBCA 2P94A 1QL9A 2FP7B 5EJZA 1TPSA 2Y5GA 1NRQH 2A1DB 5LPEA 4GCHF 2BD8A 4ZXYH 4IGDA 4ZHLU 2KAIA 2HNTE 5K0HA 1H9IE 3N7EA 2FOGA 1QZ8A 4MTBA 1GL0E 1QBVH 4NSVA 2EI7A 5LPFA 3O8DA 1KXAA 1IOEA 2WPHS 1LPGB 1ZMJA 1K22H 3SU4A 4ABAA 1TE0A 1QURH 2XBYA 1GCTB 3HGPA 2ZZUH 4Q63A 1ESTA 3A81A 3EA8A 2ZDAH 3M5NA 8ESTE 2PSXA 2F9PA 3LGYA 2BY8X 1QR3E 1X7AC 2FYQA 2OD3B 1BJVA 3D49H 4LOYH 3U8RH 2BXUH 1ZJDA 1C2MA 3PWBA 1UO6A 3ZV9A 3KQBA 3A8AA 1ESAA 1UHBB 4D8NA 4WY3A 3A84A 2ZI2H 1ZR0A 5JBAS 2VB0A 4NCYA 5FPYA 3SJ8A 3ZZBA 1GMCG 2Q1JA 3IG6B 3SV8A 2O8WA 4CR5A 1ELGA 3ZV8A 1CA0B 3MQKC 3KGPA 1D3PB 1UTQA 2GDEH 1TPPA 1GL1A 2SGFE 4FETA 1SG8B 1KY9A 1BA8B 1YCPH 3FP7E 5GCHG 3QO6A 1ETSH 3T28A 1OX1A 4KTCA 4X6NA 2FX4A 3N7DA 5F8XA 1YBWA 1UVTH 4ABGA 1FONA 5PTPA 1K0HA 4Z6AH 4ABHA 3EDXB 4JK5A 3EAJA 4ZUHA 1QL7A 3CP7A 3GCTG 2QY0B 4X1SU 1GMHG 3DUXH 4OS2A 1V2TT 1MKWH 1GHAG 5DKMA 1PPEE 1MUEB 1TABE 1QY6A 1W0YH 4MPWA 1GVKB 3FOAA 2CHAC 4BNRA 3E0PB 2ZU4A 2GGVB 2FEQH 4X8TH 1CU1A 3P92A 1Y3VA 1C1QA 1DOJA 3OU0A 4K8BA 3WY8A 3LU9B 2ZHQH 4XSKU 3GY2A 3E90B 1C2DA 1BUIA 2ZDNA 3K65B 2ZIQH 4DW2U 4XBCA 2VIOA 2AMDA 1ZSJA 2UWPA 1HDTH 2B5TB 3HKJB 1C9PA 3M3TA 4JYTA 5JB8S 2FS9A 5C1UA 3GY6A 4ACAA 2K1QA 1K1OA 1A5HA 3ATKA 1YLDA 3PV5A 1OWHA 4K1EA 1HAOH 3KQCA 1E38B 3SU5A 1SMFE 3KHVA 1WQSA 5EG4A 4CRDA 2DUCA 1YWUA 1G37A 1O3AA 3LGUA 4Q4LA 1AE5A 2CF8H 1EASA 3BTTE 2VJ1A 1TPOA 3PWCA 1A3EH 1P06A 2D8WA 2QXGA 1Z8GA 1T4VH 2RG3A 2WPIS 3L33A 4ABFA 1IQIA 3STIA 4AFUA 1FUJA 1L2EA 3P8GA 1JWTA 1O2UA 1RJXB 2PUQH 3MWIU 3SN8A 1CHGA 2ZGXH 5C20A 3T26A 1ANEA 1GBAA 3D65E 2FX6A 1AGJA 1GBLA 3EQ0H 3I78A 4I8LA 3A8DA 4SGBE 1WOFA 4Q7YA 2QXIA 4AZ2B 2VH6A 5JBCS 3WWBA 2R0LA 3SV6A 1GI1A 3RXCA 3VB6A 2ZCKP 3CENA 9ESTA 1E35B 5FHTA 1AI8H 3GY4A 4XOJA 5EU8A 3OX7U 1HIAB 4KGAA 3TK5A 4O3TA 1QQ4A 1D3DB 5GPIB 3P70B 2V35A 1WCZA 3U1JB 3E3TA 2ZC9H 2BYAX 3R3GB 1G32B 3TH2H 1DWEH 1UTKA 1YYY1 3SW2B 3UPEA 2A5IA 3Q3KA 2P93A 3D62A 2BDYA 3QTOH 4TY6A 5EODA 4M7GA 4DOQA 2FTLE 1KXDA 1C1UH 1UTOA 2GCHG 1D3QB 2I6QA 1C2IA 3M37A 3NZIA 2D1JA 2FOBA 4AFSA 1AFQB 2OC7A 4WWYA 1GHWH 3KEEA 2H9EH 4E05H 1P2OA 1TA6A 3A7XA 3K2UA 1LKBA 2W7UA 2XNDD 2GP9B 1K28D 1NTPA 1O2WA 2A45B 2A4QA 2ZDKA 3EE0B 2FOCA 2WSSD 1QL8A 1FY3A 5DP5A 4U01A 3UREA 3RXSA 2VIPA 1AN1E 2KCPA 1WXRA 4Q80A 1VGCC 4VGCC 1EFRD 1FIWA 1OWDA 2PFEA 2W6ID 4JK6A 1Y8TA 1IQMA 3QWCH 5F03A 3SNAA 4UFDH 3LGTA 1O3IA 5DSFA 3S9CA 4K8YA 4X8SH 3U8OH 8GCHG 3RU4D 1YM0A 1WDIA 4JZDH 1EQ9A 3ENSB 2JH5D 1O38A 5E8EH 1CGIE 3MU8A 5CE1A 2G8TA 1VITG 1N1LA 3PROA 3UQOA 3ZZ4A 4JYUH 1O2QA 1C1NA 1SQTA 4NG9H 1AUTC 2G52A 1C4Y2 1P12E 2BLWA 3F2HA 4B1TA 5EIYA 1PYTC 1Z6JH 4Y6DA 1A0JA 1BCUH 2GV6A 3GCOA 2CXVA 1ELTA 3TLOA 1O3HA 1DM4B 4HZHA 2PKAB 3SNBA 4DGJA 1MABB 5B6LA 3T27A 1FDPA 1HAVA 2G55A 1F0RA 1P2JA 3LDXH 2W3KA 5C67A 1QIXB 3V7TA 1C5ZB 1DANH 1YPKH 4ASHA 4M9FA 3GY8A 1VITH 1SC8U 3K6ZA 4O03A 2ZPQA 1AO5A 3MOCA 3BIVH 1YKTA 4UFFH 4NFEA 4H6SB 2Y6TA 2F4LA 5LGOA 3KCGH 1AU8A 3T62A 4AG1A 4X1RU 3PTNA 3NKKA 5FPSA 5HGGA 1YP9A 3RU4T 3SUGA 3TPIZ 3EYDA 1LHFH 1C1TA 3GCHC 3SOSA 1KDQA 3PMJA 4IS5A 3A7TA 3LC5A 3I29A 1T8MA 2Z3CA 4NFFA 1C1PA 2FI3E 4B74A 3M7QA 1CHOF 1AY6H 1YPLH 2UUYA 1HPGA 3KL6A 1C5WB 1AKSA 3UY9A 1P2KA 2OC0A 1SLWB 1A4WH 1OP8A 1ARCA 1GHBG 1DFPA 1H8DH 2ZGCA 3NRLA 4CRGA 1CT0E 1RIWB 5AFZH 4J1YA 1QRZA 3KIDU 1AB9C 2OBQA 3MNSA 2YNAA 5ESTE 4PROA 1JMOH 4X1QU 1EZXC 1E36B 1GVLA 3U69H 4WH6A 5AF9H 1D6WA 3TIUA 4Q7ZA 2M5TA 4TWWA 4UONA 1TNIA 2BLQA 1FPCH 1SOTA 2KCYA 1J9CH 2VBCA 3SBKA 1BRBE 4X8VH 3STJA 2QGRA 1GGDB 1VJAU 4Z1MD 1G2LA 3ATLA 4R0IA 3ZZDA 1FY4A 3FO8D 1GJCB 1O2GH 2R3UA 1G3BA 4FUCA 5CHAB 4HGCA 3TU7H 1FMGA 2SNVA 2XWBI 4ISNA 5DG6A 1KSNA 2VU8E 3VXEH 5A0CA 4FU8A 2DE8A 4P00A 1TIOA 2BX3A 4DCDA 2A2QH 4MNVA 1SGFG 1UTLM 1ZTKA 4H42U 3BTQE 1EJAA 4F55A 4ZKNU 2VWNA 5T6GA 4Z0KA 2O8LA 1K21H 4TYDA 3AW0A 1P09A 5HIZA 5BPEA 4H4FA 1UCYH 1XUGA 2VNTA 3WW7A 5JDUB 5T1VA 4ZH8A 2BM2A 1WTGH 1ELAA 1QB6A 3LGIA 3TH4H 3H5CB 2YMSC 4BTTB 2Q6GA 1BHXF 1ZGIA 2JDID 1AHTH 3M61U 3RXJA 3M3VA 1ELDE 3A7VA 3MO3A 3AAVA 2AERH 4BAQB 2V3OH 1CGHA 1H9HE 1ZSKA 2OBOA 3U98H 5ESBA 3OTPA 1GBTA 3V3MA 1W8BH 1MMJN 1HBTH 1KTSB 3RMMH 4LZ4B 1TQ0B 2WYJA 4MVNA 2FO9A 4K2YA 1XM1A 5GDSH 5BRRE 2ZGJA 1IAUA 3SI3H 1BBRK 1SHYA 4KELA 3U28C 1CSOE 5HM2A 1RFNA 1GJ7B 1MCTA 5F8TA 2BDBA 1FN6A 3MYWA 1LDTT 1NM6A 3DSOA 5G4BA 2FWWA 3P6ZB 1F7ZA 2GCTB 1AIXH 1TX8A 5EQSA 1Y3WA 2KR7A 2ZU5A 1V2KT 1QCPA 1BIOA 2PGQB 4MPVA 3SUFA 2B8OH 2ZU3A 1XKAC 5I46H 3SJOA 1F2SE 3V12A 4ACBA 3A85A 1OS8A 2AH4X 1HCGA 1O31A 1SOZA 3RM2H 3M36A 1CVWH 3TJNA 3CS0A 1PYTD 4UEHH 3BEUA 4ZKSU 2RA0A 1YGCH 1GI5A 1V2OT 1O2RA 2CJIA 2FOAA 3ZZ6A 4I8GA 1VCPA 1WYKA 1NROH 3PV2A 1FJSA 2VH0A 3GY3A 1XUFA 2WPJS 1EZQA 2STAE 1MQ6A 1NT1A 1RTFB 3BTDE 4K60A 4O9VA 5EGMA 1RGQA 4CHAB 2ODYB 1H9LB 3ZZ7A 3B23B 1JRTA 1V2ST 3SHAH 1ZPBA 4AYVB 1F5LA 3U1IB 3RM0H 1O30A 2O9QA 4GHTA 4WXIA 2BX4A 3BTWE 1UCYE 3RUOA 2FI5E 2OQ5A 1BJUA 4U32A 1V2VT 4HG6A 1PQ8A 4ISLA 1WBGB 1O3LA 3IITA 3M5LA 2CHAB 1PQ5A 5C2ZA 2HOBA 1C5RA 1TFXA 1EB1H 3KQDA 1DSTA 2J98B 5AVDA 4ESTE 1C5NH 1SGPE 1GBKA 1TGBA 2P3TB 2CK3D 4XBDA 1Y3UA 2NU1E 2BTCE 2IPQX 2PKSC 1TALA 1W12U 1SKYE 3W1EA 2AGIX 2KCOA 2QV1A 4E7RG 2GMTC 2AMPA 2JETB 1OHHD 1W7XH 4B6EA 4BAHB 3FP6E 1IQKA 1O2TA 3GS9A 2AIQA 5CMXH 2KFWA 1HJ8A 3KQEA 2NU0E 1YCPM 4WH8A 1GJ8B 3VB5A 1HUTH 2BDAA 1MCVA 5FAHA 3A80A 1NO9H 3GYMA 2ZU2A 4RN6A 4YXWD 4BXWA 2FLBH 1GI3A 1L1GA 2PP6A 3RC4A 1ZRKA 1P04A 1YPGH 3RDZA 2PHBA 1G9IE 4Y8ZA 5DP7A 2VWOA 4IBLH 2JJ1D 2EEKA 1CT2E 1SLUB 1HAXB 1HLTH 2FDAA 1P05A 2WUCA 3AASA 1SGIB 1GJBB 2BDHA 4MNXA 2H2ZA 5SGAE 2BOKA 1TWXB 1ELEE 4INKA 1O5GH 2EC9H 1OKXA 1Z6EA 5JBBS 3ZZ9A 1IQNA 2HLDD 4FUJA 3JZ1B 5ABWA 1UVSH 4LXBH 3RMLH 4GAWA 1ANCA 2ZTYA 4K69A 2WV9A 3RC5A 3SQEE 1HRTH 2FOFA 2ZGBH 2NU3E 4KTSA 2Y5FA 1JOUB 1O39A 1UK4A 2P59A 5IYTA 1M9UA 1EJNA 1G30B 1MAXA 4BAOB 5DGJA 2A4GA 4K1SA 4AX9H 2GT8A 3UIRA 3AK5A 4NWLA 1FZZA 5DP4A 5FBEA 2ZEBA 2C93B 4QT8C 2VVCA 1ELCA 1XUKA 5C1YA 1BB0B 2STBE 2FLRH 2ZWLH 3A8CA 1ZTLA 3P95A 1YPHE 3A8BA 4NZQA 7GCHG 3UR9A 3B9FH 4MPUA 3V13A 4AFZA 1A0HB 5F6MA 1MZDA 1P57B 5A8XA 2GZ7A 2V3MA 4OM9A 4DIHH 1GBIA 1BTPA 1LQEA 1K1PA 2XTTB 4FVBA 5EOKA 1MH0A 2ZG0H 8LPRA 1VGCB 5EJLA 3PMBB 2WZQA 4I31A 4MLFB 1O2VA 2V6NA 3UAIC 3T2NA 2QC2A 2ANWA 1GDUA 3ODFA 2WPDD 3VB3A 4Y10E 1P3EA 1TQ7B 2R3YA 1FY8E 4Y0YE 1UHBA 2BD3A 1TYNA 2Y7ZA 1ID5H 2ZKSA 2SGDE 2EI6A 1O2XA 4ABIA 1N8OC 1P9UA 2W7SA 1IQEA 1QBNA 2OCVB 4XBBA 2KX4A 2OC1A 2LELA 1SLXB 3RMOH 3QX5H 2G51A 1VZQH 1Y3XA 3ELAH 3F6UH 1ZJKA 3F9FA 2Z7FE 2A31A 1H1BA 1LMWB 2J5UA 4K5ZA 2NWNA 4JCNA 1HJAB 4A7IB 4BAKB 4BOHA 2FOEA 1BTUA 2IJOB 3SNDA 3GICB 1O33A 1EP5A 4IMQA 3MO6A 2CF9H 1EPTC 2EQNA 3BG4B 1B0EA 3QUMP 3PO1C 3LPRA 1Z8IB 5DP6A 3M3SA 5EW2H 2A5AA 3VFEA 1BTXA 2J9NA 5FCKA 2XC5A 3GY7A 1K1IA 4MNYA 1GHZA 2PR3A 5J4QA 4DT4A 1EZUC 4THNH 4YESB 4ZKRU 3QDZB 4INHA 2HNTC 1HAIH 4GUXA 1GMDF 2GVFA 1V6DA 4IC6A 3RXDA 2ASUB 4AB9A 1FN8A 1TPAE 4OGXA 2W3IA 1HAHH 2BD2A 1GBBA 1MD7A 3KYGA 5DK1A 2F43B 4O3UA 5DO4H 1O2OA 4I8KA 1FPHH 1NBME 1DVAH 1Y59T 1GBHA 1P3CA 1OYQA 1L4ZA 1J14A 2VGCC 1MZAA 3MH4A 1TA2A 1GHVH 2GZ9A 5EQRA 4MQAA 5KECA 2FOHA 1AB9B 1FX0B 1TX6A 2VVVA 4OS4A 2P95A 1P01A 1GJ9B 4B71A 4Y71A 5DJ7A 1Z1IA 1SI5H 2P8OC 3GDVA 1C2JA 3E16B 1DITH 3ZVAA 3O8CA 1H8HD 4K3JA 1PQ7A 1BTWA 1ZMNA 4Q7XA 4OGYA 2FM2A 2BLOA 1GJ4H 1N6YA 8KME2 3DFJA 1XX9A 3AW1A 3S9AA 3VB4A 1KXEA 3MU1A 6LPRA 4OS6A 4CBNA 1GWAA 1K2I1 1PPFE 1S85A 4WMEA 1RS0A 4WF8A 1G3DA 1YCPK 2ESTE 1DS2E 2Z9GA 1O34A 2UWOA 1UVPA 2VWLA 3QZQA 2BVSH 1QNJA 4FUBA 3E8LA 1S83A 1HIAA 2FTMA 2YNBA 2TGPZ 1BZXE 4F49A 1MU8B 4CRBA 1O3JA 1QBOA 3ITIA 4HTCH 1MKWK 2BY6X 3S9BA 3MH7A 2AYWA 5IDKA 1MU6B 4BTIB 1O5CB 4GSOA 1UJ1A 3ZVCA 2DE9A 3GY5A 3Q77A 4X2VA 2ALVA 4CRFA 3F3BA 4ABDA 1HXEH 1CO7E 3KQ5A 3F0PA 3HK6B 1Y3YA 3RMNH 2CV3A 1NN6A 4YTAA 1IHTH 4NIVA 1V2RT 2ZDMA 5HM9A 2HNTF 1WTHD 3PV4A 3K6YA 2ZQ1A 2ZFPH 1THSH 1AUJA 4YT7H 4NGAH 3TJUA 3PMAB 3MNBA 1C5TA 3TH3H 1H8IH 2C8ZB 2I6SA 1DDJA 2Y82A 1O3EA 4GCHG 1DICA 3ZZ3A 1S6LA 2K8IA 5C1XA 4BAMB 5HYOA 1QHRB 3UFAA 3SI4H 3UOPA 3TITA 1BTYA 1P02A 3U8TH 6CHAB 5HKKD 1T4UH 2VVUA 3LGWA 3BV9B 5TCCA 1LTOA 2OLGA 2JJ2D 3G01A 1TNKA 1YPMH 2J2UA 2YOLA 3A7YA 3EA9A 4AOQA 1NFUA 1OXGA 1ZLRA 2VWMA 1O36A 4ABEA 1EJMA 2PTNA 4IW4E 1NZQH 1E1RD 4B73A 3LIWA 4I33A 3PYHA 1MTVA 1BRCE 3ATIA 3A88A 5EPYA 1Y5AT 2QIQA 5A8YA 1THRH 4RI0A 1SR5C 2R9PA 3P17H 1KXCA 4X6OA 4WJG2 1KMHB 1B0FA 1J17T 1TMUH 1UTNA 5FBIA 1XKBC 3E0NB 1JIRA 1LHCH 4INLA 4UDWH 1FAKH 4CH8B 1UVUH 2FMJA 3SUEA 2HGTH 1C5PA 2QF5A 2H9HA 4AFQA 2PKAA 2J4IA 1MD8A 4X1PU 1GCDA 6GCHF 4ISOA 1W2KH 2GZ8A 3GOVB 1E79D 3NK8A 3CNRA 1G2MA 1NY22 4JZIA 1DPOA 4CRAA 1NPMA 2VIQA 4ABJA 2B7DH 2Y5HA 3GDSA 5DP8A 2ZDLA 1MTNC 3F9EA 4Y11E 3NXPA 3UNQA 1O2KA 3SV9A 1EB2A 1W0JD 5K7RA 1UW7A 1PJPA 2ODQA 1GI2A 2GJGA 2L6OA 3QGJA 1T8OA 1CBWB 2RA3A 2TGTA 4FU9A 1AVXA 1F5RA 3MNCA 1NESE 5E0GA 1P9SA 2IPHA 1BT7A 1TX7A 2W6JD 4NZLA 2ZFRH 1G3CA 2WHXA 2J97A 1QFKH 3OFND 2G00A 9LPRA 4YLUA 1S0RA 2WV5A 4DIIH 3BG8A 3VEQB 3QGNB 1PPZA 3FN8A 1QJ7B 1ELVA 4AG2A 2JH6D 3SJIA 1O2YA 2ZTZA 3P8OA 1DY8A 2Z3DA 3MI4A 1ELBA 2OXSA 3BEFB 1Z1JA 2WYGA 1GBDA 1G3EA 1MQ5A 1ZSLA 4RSPA 1W13U 1TMTH 4A5TS 2O8TA 1GI9B 1EAXA 3SV7A 2A32A 1Y5UT 2ZTXA 1DSUA 1SQRA 1QB1A 3ZZ5A 2Z9JA 1AZ8A 2F9NA 2WV4A 3VG8A 2TRMA 1QRXA 5L2YH 2KZ4A 1W7GH 1AFQC 2P3FH 4AORA 1G36A 1NC6A 7ESTE 3ATWA 1D9IA 1TRYA 4RT1A 4UE7H 3RXBA 1GMCF 5IK2D 3UB0A 1ZRBA 2HLCA 5A09A 3EGKH 3BIUH 2J94A 4XD7D 2FODA 3KN2A 4HFPB 3PLBA 3DSGA 1YF4A 1GHYH 1F0TA 1LQDB 3TJOA 2BY7X 2AFQB 5E2OA 5GCHF 1C5UA 5GJ4B 3OAAD 3F9HA 2H5DA 3ZYEA 2LPRA 4GPGA 4JZEH 3RXKA 2PV9B 2BOHB 3FVFB 1OWKA 1C5YB 5F8ZA 3UWJH 1GI7B 1S81A 4WMFA 3GCTF 1GMHF 3UQVA 3RXLA 1TNLA 1C2HA 4Q2KA 1SGFA 3ATMA 1GHAF 5T6FA 3S7HB 3SGBE 5DP9A 1SFIA 3PLPA 1A61H 1J16A 4Y8XA 1LO6A 1TGCA 1V2MT 5JYIA 2ZPSA 5CHBA 4ABBA 5EQQA 4LK4A 1O5FH 4D7FA 5HXFA 4FOUC 4U2WA 2PTCE 3QZRA 2G4TA 4ZXXH 1BOQA 1EOLA 1V2PT 1MKXH 5EJ1A 2XBXA 2EY4C 2C90B 1GJ5H 4TT3D 3SJ9A 3SJKA 4B2CA 4YT6H 4ASUD 4Y0ZE 4U30A 4KTUA 1AVGH 1P8VC 2J34A 1HAZB 3SU1A 1N8OB 1C9TA 1CA8B 1IQHA 3LH3A 1OP0A 3RXGA 1T7CA 1ANDA 1LVOA 3RXEA 1O0DH 1AZZA 3TGIE 1LHGH 1D6RA 1XXDA 2Z9IA 3S69A 4FUGA 3QTVH 3BF6H 4UD9H 4AGKA 1IQJA 2A7HA 1DE7H 2B0FA 2HALA 1UCYK 4Y79A 3PTBA 1Q3XA 2HWLB 2HRVA 4X1NU 3SNCA 1FY5A 1EPTB 3KNXA 3PO1B 4X0WU 2TGDA 4IC5A 1FXYA 3QLPH 1AD8H 1CQQA 3SU2A 2HPQH 3L3TA 1RIWC 4K1TA 3OY5U 1EX3A 4JMYA 2ZA5A 2TPIZ 1HGTH 1D4PB 4A1TA 4NSYA 4CH2B 2BVXH 1TLDA 1HAGE 2M2AA 3MH6A 1W11U 1W0KD 3OSYA 2J98A 1AVWA 1C4U2 4J2YB 1AMHA 1P2QA 2BDGA 1LPZB 4NWKA 3RXOA 3E91A 3E1XB 4MPXA 3SHCH 3A7WA 1HB0B 5HIYA 2QF4A 4XRNA 1FV9A 5C0TA 1JBUH 3RU4E 1RTLA 2HVXA 1K1MA 1TB6H 5CHAC 2GCHF 1TBRH 1AE8H 2RDLA 4FUHA 4RKJB 2V7QD 1O2HA 4JYVH 3F2FA 1CHOG 4E7NA 3KF2A 1GPZA 2WPMS 2ZCLP 3PMHB 2FXRA 2PWXA 3A82A 1LVMA 1SQOA 5E2PA 3SZNA 1TBZH 4X6MA 2XYAA 3TNTA 1AWHB 2TGAA 4ISIH 1TRMA 1B7XB 3TK9A 3RXIA 2OQUA 3ODDA 2R0KA 1WQVH 3O8RA 2BVRH 1C1MA 3GYLB 3DSPA 3MU4A 1S0QA 3GISB 3ZVGA 1NRRH
chains in the Genus database with same CATH topology
1NS3A 2KAIB 3T5FH 1C1RA 3NPSA 1ORFA 1RTKA 3JZ2B 1C2EA 4FUDA 2UUFB 1KLIH 4KP0A 3RXFA 4YOJA 2XBVA 3A83A 1EOJA 1JIMA 1TONA 2BD9A 1UK3A 2ZHEH 3RXTA 1ZMLA 2Z6BD 1GBJA 3OTJE 5T3HA 3TJVA 1P03A 4SGAE 8GCHF 1VCWA 1C2GA 3SU6A 2QF0A 2GV7A 1T8LA 2NU4E 2Z3EA 3C27B 5C3NA 4F4OC 5JPMH 2ILNA 2XXLA 3VPKA 5TJXA 2FIRH 1SGNE 2AMQA 2AIPA 1GI0A 1ZHPA 1TRNA 1K9OE 3UNSA 1ZTJA 1BMMH 2P3UB 1UMAH 1ABJH 1GI8B 1FIZA 2Y81A 4GHQA 4OS5A 1VITF 1SSXA 4DVAU 4ZKOU 3ZZAA 4R8TB 4DT7B 1A3BH 2C4FH 3L6PA 3A7ZA 2VINA 2GCTC 1PQAA 3PB1E 1GBFA 1A0LA 4FU7A 2ZGHA 2UUKB 4VGCB 1OWEA 3MTYA 5FX6A 5H4IB 1E0FD 5A2MH 1C5QA 4TY7A 1SFQB 1C4V2 1XMNB 2QA9E 1ESBA 1SGCA 1BDAA 3Q00A 2ZQ2A 4X2WA 3MMGA 1INCA 2ZDVH 4ZHAA 4YOGA 3M5MA 1B5GH 4BXSA 2W26A 1V2WT 2GD4B 1EKBB 5DPAA 1F0UA 4CBOA 1UTJA 1MBMA 4Y7AA 1P2IA 1WU1A 3M35A 4DY7B 3VGCC 1J15A 4CHAC 1A2CH 3F1SB 3ZVEA 1D3TB 3GCNA 2XW9A 2WINI 4OS7A 1MTUA 4XE4A 2QAAA 1O2PA 4CR9A 4ISHH 2H1UA 3R0FA 1GHBF 3DHKH 1BHXB 4WMDA 1QJ1B 1PPHE 1UVOA 3RXVA 1FLEE 4RKOB 5FCRA 1C1OA 1Z7KA 1UTPA 2J38A 4AGJA 3F68H 1Q31A 1NFWA 3HKIB 7KMEH 1WV7H 3I77A 5LH8A 1F0SA 2VIDA 1TOCB 1L0ZA 1GDNA 2QXHA 2Z9LA 3LONA 1O3KA 1OOKB 3GCHB 4DG4A 1QRWA 1GG6C 1RD3B 1KXBA 1ZPCA 3K9XB 1ARBA 4AN7A 4CREA 3VB7A 3TVJB 1O2IA 1YC0A 3UUZA 1SL3A 4ZROA 2UWLA 2JETC 3AAUA 4YOIA 1P10A 1MTNB 1F92A 1KXFA 1L4DA 1CE5A 3SU3A 1HNEE 1BRAA 1O2NA 1YPHC 4I32A 1TBQH 2GTBA 3RXMA 4AB8A 1S82A 2V3HH 1DUEA 3MH5A 1O5BB 4XDEA 1SGTA 3UR6A 3NCLA 1KYNA 2P16A 2OC8A 5L6NH 1SGQE 1W0ZU 2V0BA 2VIWA 3LGVA 4TPYA 2BB4A 2O8UA 1L1NA 1P0SH 2ALPA 1TNGA 1V2JT 2G5VA 2D2DA 1HAPH 2FPZA 1S6FA 2OUAA 5EPNA 2C8YB 5JB9S 2ANYA 1V2NT 3BTFE 1LVBA 3BEIB 4B76A 3QN7A 3SUDA 2SGPE 1IQGA 1SGDE 2A5KA 1C1VH 1EUFA 2F9VA 3D23A 3SORA 1GBMA 3HGNA 2ZFQH 3ZZ8A 5GWZA 3H7TA 3HK3B 2ZP0H 3T29A 3OY6U 5C5NA 1K1JA 1KTTB 1ETTH 2NU2E 2IN2A 5L30H 4Y76A 3O8BA 2FOMB 2XC4A 3W94A 1GCTC 1F5KU 3PLKA 2GDDA 5AHGH 3H7OA 1TOMH 4OS1A 2XC0A 1TGNA 1C2LA 1VR1H 2ULLA 3MU5A 1KIGH 2WPKS 2ZHWH 2BMGB 2A0QB 3S0NA 2QYIA 3U9AH 1SB1H 1XUHA 1BTHH 3TK6A 2BQ6B 3MNXA 4DJZB 4HI3A 1AQ7A 2BXTH 2R2WU 2QXJA 3LT3A 2AS9A 1V2UT 2XCFA 1CA0C 2AEIH 2H6MA 2XRCA 3E6PH 1DX5M 1LVYA 4WXVA 1C5XB 5FXLA 3FZZA 4B2AA 1TNJA 2UUJB 1QJ6B 1WUNH 3FZDA 1O2MA 3AVZA 2GKVE 1OWJA 4BANB 1DWCH 4D9RA 3QK1A 4YO9A 1BQYA 2XCNA 1HAVB 3MHWU 4NA8A 3BTME 2EA3A 3ZVDA 1FY1A 4X8UH 1DLKB 1A5GH 1A5IA 1PFXC 5EXMA 1SGYE 3SGQE 1QTFA 1ZYOA 5EW1H 3SU0A 1EAWA 3TGJE 3UTUH 4MDSA 1XVMA 4A6LA 1O5AB 1ZHRA 3HATH 4WVPE 1LKAA 1W10U 1HJAC 1N6XA 4ZAEA 3NWUA 1E37B 2RCEA 4IMZA 1W3CA 2PSYA 3FP8E 1DUAA 1KDQB 1O37A 2CGAA 4A92A 2F91A 3BG4C 5EXNA 2OINA 3ZZCA 2FS8A 1BMNH 3P8NA 1C5OH 4O97A 1DWBH 4UFGH 1TAWA 1O2ZA 1AFEH 1OSSA 1A46H 1T8NA 4GLYA 3MFJA 1BBRH 1AKSB 1TMBH 1GJDB 1J8AA 5B6OA 1IQLA 4X2XA 1C2KA 4FUFA 2JKHA 2VIVA 3C1KA 1ACBE 2ZCHP 5A0AE 3LJJA 1JXPA 1K1NA 4FUIA 3FANA 2Z94A 1NU7B 4H6TA 2IOTA 2SGEE 1SGEE 3A87A 2ZHDA 5A0BA 1L1JA 1NRSH 2ZECA 1ANBA 3RLYH 1UK2A 1C5VA 1H4WA 3B8JA 2BY5X 1BMAA 1FNIA 2LNCA 1CT4E 1JRSA 2PKSB 3BTGE 3URDA 2FESH 2BDCA 1SLVB 4ZHMU 5ETXA 3EA7A 4DURA 3M7UA 1BITA 1FQ3A 3RXPA 4AYYB 3MU0A 4JZFH 1C1WH 1SHHB 2GMTB 2ZF0H 2ZFTA 1Z8RA 3BTEE 2QF3A 1SVPA 1SGRE 1MAYA 4Y7BA 2G5NA 2BQWB 2CMYA 1UTMA 2F9BH 2C8XB 1O3PB 1GMDG 5JBTA 4GVUA 1KLJH 4UFEH 2AGGX 2FZZA 2TBSA 2SNWA 2GT7A 4BTUB 5T6DA 1GJ6A 1P2MA 1QA7A 4FVDA 4LZ1H 1O3CA 3PM3A 1C5LH 5FX5A 1PPGE 3M5OA 2ZNKH 2BY9X 1EATA 1GI6A 2QCYA 4NIXA 4B75A 5LPRA 3TGKE 5GXPA 1A7SA 1HV7A 1KLTA 2A7CA 3W95A 4XFQA 7GCHF 3LC3A 2THFB 2D26C 5FPTA 3T25A 1MTWA 3BTHE 3URCA 2J92A 1C5SA 1ETRH 1GDQA 1O2LA 2PUXB 4I7YH 5E0JA 5AFYH 1TNHA 3Q3XA 3SNEA 1DWDH 2Y7XA 1T31A 1U6QA 1ZGVA 1BBRE 1LHDH 1P2NA 3BN9A 2H9TH 1O3GA 1O3DA 2Z9KA 3Q3YA 3A86A 3RC6A 1A1RA 1XUJA 3VXFH 1FI8A 1WSSH 1HJ9A 1EXFA 3RXUA 1CGJE 2F3CE 1SPJA 2AGEX 2PGBB 5GIBA 1SQAA 2HPPH 1EAUA 1Z8JB 1QB9A 2SFAA 1K1LA 2SGAA 1V2LT 3FFGA 2ZO3H 1AWFH 3LKWA 1LPKB 1Z71A 2H5CA 1O2SA 3BSQA 2JH0D 1W14U 6CHAC 1NRNH 4X6PA 1DT2A 3ZYDA 1YLCA 2ZFSA 1O3BA 3OYPA 3ZVBA 3P8FA 1FAXA 1O32A 4YZUA 2BZ6H 5EXLA 3M7TA 2ANMH 1V3XA 2PW8H 2F9UA 3ESTA 2F83A 3UOUA 1QA0A 7LPRA 4JZ1A 5TCAA 3BTKE 1OP2A 1GJAB 3HPTB 2ZPRA 4YM9A 2G81E 1HYLA 3RLWH 3N7OA 1MTSA 2Q6DA 4CRCA 1ZHMA 4NA7A 1C2FA 4X2YA 4Y8YA 5C5OA 4A1VA 2BD5A 2F9OA 1EP6A 1NU9A 4MG3A 2BQ7B 1EAIA 3RXHA 1GBEA 2O8MA 4I8HA 2QN5T 2Q6FA 3VGCB 1Q2WA 1BRUP 2A7JA 1ZZZA 1SBWA 3DA9B 3DFLA 4E06H 2WUBA 2TIOA 1C1SA 2G4UA 4D7GA 1YPEH 1O5EH 3RXRA 5DP3A 2W5EA 2GX4A 3Q76A 5I25A 1EZSC 1PPBH 3MO9A 2ODPA 1S84A 1NFXA 1IQFA 2BLVA 3LJOA 3UWIA 1O3FA 2BD4A 1ABIH 1GVZA 1XUIA 3TNSA 4TPIZ 1GHXH 1HAYB 1DXPA 1QQUA 1DXWA 2R2MB 2B9LA 3CS7A 1Y5BT 2BZAA 1P11E 2XNIA 3F9GA 1O5DH 1XVOA 3SGAE 1V2QT 1TGSZ 5A8ZA 1CBWC 2A4RA 5L2ZH 3A89A 3RXQA 1O35A 1WAYB 1O3NA 1NRPH 1LCYA 1GG6B 4NIYA 3ZVFA 4ZMAH 3LOXA 2Y80A 2FI4E 3GDUA 2ZFFH 2BD7A 1EPTA 4FXGH 3NUMA 2C8WB 5HMAA 4FUEA 1VJ9U 1GGDC 3LH1A 1XXFA 3SO3A 2WPLS 4NA9H 3FAOA 5E0HA 3RXAA 3SQHE 1HXFH 2XBWA 4D9QA 4YLQH 6GCHG 1OWIA 1GI4A 2VGCB 1MBQA 1BTZA 1PPCE 3S7KB 1NFYA 1C5MD 2ANKH 3V0XA 2A4OA 2CN0H 1THPB 2ZU1A 4IN2A 5J4SA 2XWAA 1O2JA 1VCQA 4IN1A 1ZOMA 2P8OB 1IHSH 2A2XH 2SGQE 4MNWA 3UNRA 1TGTA 4KKDA 2FYRA 2BDIA 4TWYA 6ESTA 3DD2H 1OPHB 2BHGA 4NIWA 1LHEH 3SV2H 1E34B 3RP2A 1T32A 1OYTH 2OP9A 3DT0H 1BMLA 4B2BA 1YPJH 2EI8A 3IWMA 4I8JA 2PLXA 1HFDA 4D76A 1ZPZA 1DY9A 1O3MA 1ELFA 2OTVA 1DLEA 1O3OA 2ZHFH 1QGFA 1RRKA 2J95A 1S6HA 1MKXK 2C3SA 1S5SA 1RXPA 4A1XA 1GBCA 2P94A 1QL9A 2FP7B 1TPSA 2Y5GA 1NRQH 2A1DB 5LPEA 4GCHF 2BD8A 4ZXYH 4IGDA 4ZHLU 2KAIA 2HNTE 5K0HA 1H9IE 2FOGA 4MTBA 1GL0E 1QBVH 4NSVA 2EI7A 5LPFA 3O8DA 1KXAA 1IOEA 2WPHS 1LPGB 1ZMJA 1K22H 3SU4A 4ABAA 1TE0A 1QURH 2XBYA 1GCTB 3HGPA 2ZZUH 1ESTA 3A81A 3EA8A 2ZDAH 3M5NA 8ESTE 2PSXA 2F9PA 3LGYA 2BY8X 1QR3E 1X7AC 2OD3B 2FYQA 1BJVA 3D49H 4LOYH 3U8RH 2BXUH 1ZJDA 1C2MA 3PWBA 1UO6A 3ZV9A 3KQBA 3A8AA 1ESAA 1UHBB 4D8NA 4WY3A 3A84A 2ZI2H 1ZR0A 5JBAS 2VB0A 4NCYA 5FPYA 3SJ8A 3ZZBA 1GMCG 2Q1JA 3IG6B 3SV8A 2O8WA 4CR5A 1ELGA 3ZV8A 1CA0B 3KGPA 1D3PB 1UTQA 2GDEH 1TPPA 1GL1A 2SGFE 1SG8B 1KY9A 1BA8B 1YCPH 3FP7E 5GCHG 3QO6A 1ETSH 3T28A 1OX1A 4KTCA 4X6NA 2FX4A 5F8XA 1YBWA 1UVTH 4ABGA 1FONA 5PTPA 4Z6AH 4ABHA 3EDXB 4JK5A 3EAJA 4ZUHA 1QL7A 3CP7A 3GCTG 2QY0B 4X1SU 1GMHG 3DUXH 4OS2A 1V2TT 1MKWH 1GHAG 5DKMA 1PPEE 1MUEB 1TABE 1QY6A 1W0YH 4MPWA 1GVKB 2CHAC 4BNRA 3E0PB 2ZU4A 2GGVB 2FEQH 4X8TH 1CU1A 3P92A 1Y3VA 1C1QA 1DOJA 3OU0A 4K8BA 3WY8A 3LU9B 2ZHQH 4XSKU 3GY2A 3E90B 1C2DA 1BUIA 2ZDNA 3K65B 2ZIQH 4DW2U 4XBCA 2VIOA 2AMDA 1ZSJA 2UWPA 1HDTH 2B5TB 3HKJB 1C9PA 3M3TA 4JYTA 5JB8S 2FS9A 5C1UA 3GY6A 2K1QA 1K1OA 1A5HA 3ATKA 1YLDA 1OWHA 4K1EA 1HAOH 3KQCA 1E38B 3SU5A 1SMFE 3KHVA 1WQSA 5EG4A 4CRDA 2DUCA 1G37A 1O3AA 3LGUA 1AE5A 2CF8H 1EASA 3BTTE 2VJ1A 1TPOA 3PWCA 1A3EH 1P06A 2D8WA 2QXGA 1Z8GA 1T4VH 2RG3A 2WPIS 3L33A 4ABFA 1IQIA 3STIA 4AFUA 1FUJA 1L2EA 3P8GA 1JWTA 1O2UA 1RJXB 2PUQH 3MWIU 3SN8A 1CHGA 2ZGXH 5C20A 3T26A 1ANEA 1GBAA 3D65E 2FX6A 1AGJA 1GBLA 3EQ0H 3I78A 4I8LA 3A8DA 4SGBE 1WOFA 4Q7YA 2QXIA 4AZ2B 2VH6A 5JBCS 3SV6A 2R0LA 1GI1A 3RXCA 3VB6A 2ZCKP 3CENA 9ESTA 1E35B 5FHTA 1AI8H 3GY4A 4XOJA 5EU8A 3OX7U 1HIAB 4KGAA 3TK5A 4O3TA 1QQ4A 1D3DB 5GPIB 3P70B 2V35A 1WCZA 3U1JB 3E3TA 2ZC9H 2BYAX 3R3GB 1G32B 3TH2H 1DWEH 1UTKA 1YYY1 3SW2B 3UPEA 2A5IA 3Q3KA 2P93A 3D62A 2BDYA 3QTOH 4TY6A 5EODA 4M7GA 4DOQA 2FTLE 1KXDA 1C1UH 1UTOA 2GCHG 1D3QB 2I6QA 1C2IA 3M37A 3NZIA 2D1JA 2FOBA 4AFSA 1AFQB 2OC7A 4WWYA 1GHWH 3KEEA 2H9EH 4E05H 1P2OA 1TA6A 3A7XA 3K2UA 1LKBA 2W7UA 2GP9B 1K28D 1NTPA 1O2WA 2A45B 2A4QA 2ZDKA 3EE0B 2FOCA 1QL8A 1FY3A 5DP5A 4U01A 3UREA 3RXSA 2VIPA 1AN1E 4Q80A 1VGCC 4VGCC 1FIWA 1OWDA 2PFEA 4JK6A 1Y8TA 1IQMA 3QWCH 5F03A 3SNAA 4UFDH 3LGTA 1O3IA 3S9CA 4K8YA 4X8SH 3U8OH 8GCHG 3RU4D 1YM0A 4JZDH 1EQ9A 3ENSB 2JH5D 1O38A 5E8EH 1CGIE 3MU8A 5CE1A 2G8TA 1VITG 1N1LA 3PROA 3UQOA 3ZZ4A 4JYUH 1O2QA 1C1NA 1SQTA 4NG9H 1AUTC 2G52A 1C4Y2 1P12E 2BLWA 4B1TA 1PYTC 1Z6JH 4Y6DA 1A0JA 1BCUH 2GV6A 3GCOA 2CXVA 1ELTA 3TLOA 1O3HA 1DM4B 4HZHA 2PKAB 3SNBA 4DGJA 3T27A 1FDPA 1HAVA<