1QNJA

The structure of native porcine pancreatic elastase at atomic resolution (1.1 a)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic Resolution Structure of Native Porcine Pancreatic Elastase at 1.1 A
pubmed doi rcsb
molecule tags Hydrolase (serine protease)
molecule keywords ELASTASE
total genus 58
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1999-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qnjA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qnjA01
4FVDA 1F0RA 5F8ZA 2ZFTA 2VVUA 4DW2U 1H9IE 1LCYA 5FXLA 4THNH 5LH8A 4NG9H 4Y8YA 4TWWA 3SNCA 4INLA 2HPPH 2HOBA 3F6UH 1MCVA 1OSSA 1C1VH 4IN2A 1BCUH 3AASA 5EXMA 1NRRH 4X6NA 2FOAA 2BDBA 3TK6A 1V2QT 3BF6H 3O8DA 2AERH 1BDAA 1NFWA 3TPIZ 1O2LA 2QY0B 2FS9A 2IOTA 1O3BA 1XUFA 9LPRA 3A8DA 1SGFG 2TIOA 1WBGB 2CHAC 1SLUB 3LGUA 1AMHA 3P8GA 1O5FH 3UIRA 1DT2A 1GVKB 1NFXA 1OWEA 1ARCA 1G32B 4BOHA 1A3BH 3LH3A 1OWHA 5HXFA 3RM0H 1MAYA 3M5OA 4ISOA 2ZDKA 2GCHG 2XW9A 1HV7A 2A2XH 3QX5H 4OS6A 1O35A 3S0NA 1BTWA 3PB1E 5DG6A 1ZPZA 1W10U 1C5LH 5EU8A 1QA7A 4A6LA 4GHTA 5GXPA 3QWCH 1C5XB 1SGRE 2P3UB 1FJSA 1A3EH 1EP5A 1T8NA 1FY3A 5FX6A 3BEUA 1SGTA 4U30A 4BANB 4ZAEA 5DK1A 1ESBA 4DURA 4X2YA 3EE0B 5E0HA 1O0DH 1UHBA 3V0XA 2PKAB 3S9BA 1SGDE 1NO9H 3SN8A 5F03A 1EJMA 1HPGA 2A4RA 1YKTA 1LHGH 5DPAA 2BD7A 3SU4A 1DSUA 1HAZB 1MUEB 5JPMH 1HAYB 1RS0A 4X6OA 4DJZB 2FI4E 2A5IA 4WMFA 3ZVFA 5A8YA 1HDTH 4NIYA 4AGKA 4AOQA 1F5LA 2KAIA 4D9QA 1H1BA 2JETC 1GG6B 1GHYH 2W5EA 1TRMA 3UUZA 1GGDB 2YNBA 2BLVA 4D76A 1BTYA 4Q7ZA 4WWYA 2O8MA 2QC2A 2XBXA 1SGFA 5EXNA 5L30H 4SGBE 1SVPA 2TBSA 3Q00A 2ZKSA 1DDJA 3ZZ3A 1KXDA 1K1MA 5A8ZA 1SG8B 3FAOA 1PPHE 1Z8JB 4FUJA 2UWLA 1C1UH 1YF4A 1J17T 2G4UA 1GBDA 4H6SB 4X8UH 3GCTG 1MTVA 1PPFE 2BB4A 1N8OC 2QXGA 5DJ7A 3LGTA 2Z9JA 4I8JA 1C5VA 1GHBG 1O37A 3P8FA 4INKA 4NFFA 1A0LA 4LK4A 3VGCC 4XOJA 3UFAA 3HGPA 4OS2A 5C1UA 2PGBB 3MNCA 1J15A 4JYTA 2A4OA 2ZI2H 3E16B 4KGAA 2BLQA 4WXIA 3N7OA 1Z1IA 3TH2H 6GCHG 1BMAA 2ZU1A 1A5IA 1BJVA 1GJCB 1P8VC 2AYWA 2PWXA 1NY22 1GMHG 1QBNA 3F9EA 1LHFH 3SORA 2A7CA 2WPKS 2WINI 3JZ2B 2V0BA 3GY4A 4AN7A 3U1JB 7ESTE 1GBHA 4XBDA 1AB9B 4RKJB 2GVFA 4ASHA 2VINA 1O3FA 3SOSA 1GJ4H 2UUYA 1EQ9A 1CT4E 1KLTA 2WV5A 1O2HA 1FONA 3QGJA 2BDGA 1UTJA 1SHHB 3PM3A 3A82A 2FI5E 2F9PA 2OC8A 1HJAB 4DG4A 2BM2A 1QFKH 1EOJA 3VB5A 1C9PA 2VWNA 1NT1A 3MH6A 3A7VA 5A2MH 1ELGA 5F6MA 2BXUH 1D4PB 3NPSA 1ZHPA 5C1YA 2JH0D 1YPEH 1G2MA 2IPHA 3LC3A 1GI7B 3Q3KA 4K1SA 1P9SA 2C4FH 2ZU2A 3GY8A 2TGTA 2PUXB 1ELDE 2NU1E 3V3MA 4OS4A 1TGSZ 1EX3A 2D26C 2FI3E 1U6QA 1SMFE 1O2IA 3LGIA 2UWPA 3RMNH 4OS5A 3H7OA 4FUEA 5DP3A 5AFYH 4AYVB 1O2YA 5JDUB 5C5NA 2Y7XA 4AB8A 2BZ6H 1DX5M 2BZAA 4FU8A 1UTMA 3RXSA 1GI4A 3B9FH 3OY5U 1E37B 2WV4A 5F8TA 2Y5FA 1C1NA 4FUIA 4Y76A 1C1TA 3CP7A 3C1KA 4FUFA 3A81A 3A7TA 1V3XA 1K1JA 1L4DA 1MD8A 1OWJA 1YYY1 1O3KA 2ODYB 2ZPSA 2ZDVH 1YPHC 5GIBA 3SJIA 1S6HA 4CH8B 1RJXB 2RA0A 1QURH 3T5FH 4ZKOU 4CRBA 4NA9H 1IQNA 4JZDH 4CR9A 2FOEA 3RXBA 5AFZH 3BTGE 1GHZA 4H6TA 2FESH 4FUCA 3TK9A 2CN0H 4GLYA 1TQ0B 1BITA 5GCHF 1QRZA 3T28A 2O9QA 3VB4A 3HK6B 3E8LA 1GI9B 1L2EA 2UWOA 1GI8B 1GJ8B 3BTWE 4BNRA 1Z8IB 2VIQA 1UJ1A 3SV9A 3A8AA 1AKSA 1O34A 2QXIA 1GMDG 2G8TA 4E7RG 2R9PA 3D23A 2GDEH 2GCTB 3PTNA 3ELAH 3P92A 1M9UA 4Q7XA 1GHAF 2H5CA 4D7FA 4A1VA 1NFUA 1C1RA 4NFEA 3SZNA 4I8LA 2BX4A 4NGAH 2ZFFH 1TBRH 3EAJA 4YESB 1C2EA 3TIUA 1G9IE 4Y79A 1KXCA 4IBLH 3U9AH 1BHXB 4SGAE 1AB9C 1ZOMA 1BTHH 5IYTA 3A7WA 2BY7X 1A2CH 1XKBC 1J9CH 1PYTD 1W11U 3SU6A 2A0QB 2ZP0H 5L6NH 1LPKB 2EI7A 1GJDB 3AAVA 5EGMA 1UMAH 2ZQ2A 1P9UA 2NU0E 1AD8H 1VJ9U 3GY3A 2OC1A 2PTCE 2QGRA 2PLXA 1C5OH 1TX7A 1OOKB 1NTPA 2FOBA 5JBBS 1MQ5A 1V2OT 1JWTA 3EA8A 2G55A 1O2QA 1YLCA 2ZU3A 1FIZA 4MPUA 2FEQH 1SLXB 5LGOA 1UTKA 1MKWK 1CHOG 4CREA 1SGYE 1W0YH 1OWKA 2QAAA 3FANA 4YT6H 1O2GH 2IJOB 7GCHF 1NU9A 3Q76A 2VIVA 1GI5A 5AVDA 3ZZ5A 1J14A 2WPMS 4Y8ZA 3RU4D 1Z8GA 1N1LA 2AIQA 3FP6E 1UTNA 3MMGA 4O3TA 1C1MA 3FZZA 2PR3A 4I8HA 3D49H 4K1TA 1HXFH 2XBWA 2FX6A 2THFB 3E3TA 1F7ZA 3A84A 1GBBA 4RN6A 3S7HB 1A4WH 3MU4A 2ZFPH 3RXUA 3QK1A 1W0ZU 4BAQB 3RXAA 1LVOA 1O5CB 4ZHLU 3SU1A 4B2BA 3BSQA 1OP0A 2Y80A 2J38A 1L1NA 3UQVA 4NA7A 2F9UA 4X0WU 1GL1A 3NUMA 1CQQA 1GCTB 1K1NA 4MDSA 1C5WB 1TQ7B 4Q2KA 1KDQA 2BVSH 1V2JT 1VCQA 1IQMA 5K7RA 2QF3A 5JBCS 4NA8A 1EAXA 1BTPA 1WYKA 3GISB 1WQVH 1NRPH 2BDCA 4CRGA 2BY6X 1S83A 2BOKA 5DP6A 1AVGH 2F9VA 1HFDA 1RTKA 1YPKH 1W2KH 1HAVB 5E2PA 5CE1A 3MH4A 1BOQA 5EG4A 2Z7FE 1HAHH 3ZVDA 5AF9H 3STIA 1O2UA 3LOXA 1TNJA 4X2VA 4Z0KA 4ABGA 5A0BA 4K69A 2B0FA 3MNSA 2BMGB 3PMBB 5TCCA 3QTOH 1BRCE 3T27A 1EASA 2OXSA 3SUEA 3ODFA 1S0QA 3A86A 1F92A 1O32A 4BTUB 3VPKA 3SV6A 1Z71A 2PFEA 3ATLA 5EXLA 2ZG0H 1FPHH 2F83A 3SU5A 3URCA 3QLPH 1E0FD 1XX9A 3TJNA 1EZUC 5A0CA 2SGAA 5FCRA 2ZCHP 1V2ST 1K1PA 1XUGA 3C27B 4O9VA 3T2NA 3GCHB 3F9HA 1D3DB 3A7YA 1MD7A 3P8OA 4HTCH 3T25A 1C5SA 3RXGA 5BPEA 5TCAA 1QJ1B 1Z8RA 1ZSLA 1LTOA 1CU1A 5DP8A 5C3NA 2BY9X 1GDUA 1D3QB 3E91A 2ZU5A 1LVMA 3DT0H 4OS7A 7LPRA 1TA6A 4X1QU 1QL9A 1NM6A 1JRSA 4Y71A 1LMWB 1TLDA 4ZMAH 4ZKNU 1CA0C 1AU8A 2OINA 1CA0B 1TFXA 2QCYA 4ABIA 4NSYA 4NZLA 1AWFH 3STJA 3SNEA 1ZMJA 2PW8H 3HKJB 1GMHF 4RKOB 1J8AA 4TWYA 3ESTA 1O3IA 2O8TA 1XXFA 3RXCA 1SQOA 1KTSB 2A7HA 1DLEA 3MO9A 1BIOA 4DCDA 4MNVA 3PWCA 1YPJH 4DIHH 1HXEH 2FPZA 3AAUA 1GBCA 8KME2 1PPCE 1WAYB 1ARBA 3SNBA 2ZF0H 4DY7B 4HZHA 4FUDA 3GY6A 2P8OC 4ZROA 1LHEH 5A8XA 4JZFH 1O2TA 2J95A 3S69A 4FXGH 3HGNA 3GCHC 1DUAA 3OX7U 5CHAB 2GX4A 4A92A 1UTOA 2J34A 4MPVA 1C4V2 5GDSH 3DFJA 1P12E 3KF2A 1BA8B 1XUKA 3ZVGA 3ZYDA 1GDQA 2SGFE 1GCDA 1GL0E 1MTUA 4ABJA 2GDDA 1OKXA 1X7AC 1C2LA 1T4UH 1OYQA 5I46H 2C90B 2CXVA 2FOFA 1W7XH 1DITH 1MQ6A 2VVVA 3SUDA 2QF0A 1AFQB 1C2DA 2J9NA 3PLBA 1XM1A 3R0FA 3OTJE 1SQAA 1FMGA 3TGIE 2GZ7A 1Y3VA 2OTVA 3M35A 1YPHE 1EPTB 1HRTH 2Y6TA 2XCNA 4YOIA 1HJ9A 3LU9B 1UVTH 1Z7KA 2ZWLH 3NWUA 1TPPA 2XC0A 1ETRH 4MLFB 4D9RA 3TNSA 1T4VH 1ABIH 2XTTB 1GHBF 2ZCKP 1TYNA 5EQRA 1BB0B 3URDA 1GJ9B 1QBOA 3BIVH 2BD3A 3RP2A 5ESTE 8GCHG 1MKXK 1HIAA 1GBAA 3ATIA 3MH7A 5EQQA 5A09A 5AHGH 2NU3E 4HGCA 2FTLE 1EZXC 2WYJA 6CHAB 1FN6A 3EDXB 1DWBH 3SV7A 2ULLA 3GY7A 1DSTA 5FCKA 2W3IA 1SC8U 1D3TB 3UOUA 2ZFRH 1MCTA 3SO3A 3MNBA 4GPGA 2OQ5A 4NWLA 4JCNA 1TX8A 2H1UA 1HBTH 3LGWA 1AGJA 1C2KA 2C3SA 3EA7A 5FPSA 1WU1A 2SGDE 1JMOH 2GGVB 3OYPA 3UR9A 1S82A 3IWMA 2BD5A 4GSOA 2BY8X 3D65E 1EXFA 1ZLRA 4X2XA 1RTLA 1Y5UT 1WTHD 1GJ6A 1KDQB 1A61H 3MYWA 2ZTYA 2G81E 2BQ6B 3ODDA 1HLTH 2A32A 2ZPRA 3T62A 1BMMH 2C8ZB 1YLDA 1FXYA 2ZPQA 1ZJKA 1XUIA 1O30A 1EAUA 3L33A 2WPIS 2H5DA 4MTBA 1F0TA 1CT0E 3NZIA 1ELAA 4INHA 2GMTB 3MU5A 4Z6AH 2RDLA 4UFGH 3UNSA 1C1OA 1GBEA 3DHKH 2QXJA 4DGJA 2XBVA 3CS7A 5T6FA 1TNLA 2CF9H 2Z9GA 1MKWH 1ZGVA 4FVBA 1IOEA 3SQEE 3RXDA 1IQIA 1JXPA 3ZVBA 2FODA 1BRBE 1BZXE 4K1EA 2O8UA 1FUJA 4K2YA 1HAPH 2R3UA 1UVUH 4JZEH 1A1RA 3BTFE 3GDUA 3VB6A 3GDVA 4ISIH 1LKAA 2GD4B 3NKKA 1THSH 2ZQ1A 2ZTZA 3Q3YA 5K0HA 2ZHDA 4YM9A 3RXOA 1KLJH 3E0NB 1A5HA 2Z9KA 1PJPA 4J2YB 4CRAA 1LO6A 1LPZB 2WPLS 3ZVAA 5GCHG 1P2OA 4LOYH 3VB7A 3VEQB 1GWAA 2GCTC 2ZGBH 2VH0A 2C8WB 2Z3CA 2AGGX 1CBWB 1TBQH 1MTSA 4ZHMU 1Y3UA 1CGIE 3O8CA 1F0UA 1E35B 2GT8A 3ZZ8A 3ZVEA 1QCPA 3BTHE 1P04A 3IG6B 2PTNA 2ZGXH 3UNRA 3TK5A 4NCYA 3RXTA 3MU1A 1O2WA 1MBQA 2PKSC 3MH5A 3SUFA 4YZUA 5HGGA 1GCTC 2ZIQH 1K1IA 2VU8E 3BV9B 4PROA 1GVLA 2AFQB 2BD8A 2BHGA 8ESTE 2ZGJA 4CHAB 4JMYA 1GI1A 1G3BA 5BRRE 4GUXA 1YPGH 3RC6A 4YTAA 1JRTA 1BHXF 5CHAC 1SFIA 1K22H 1VCWA 2PSYA 4Q7YA 1P3CA 4BAHB 2OUAA 1QR3E 3E1XB 1AZ8A 3BG8A 2LNCA 4AG1A 1RD3B 2M5TA 3HATH 3GCTF 1FQ3A 1Z6JH 2P3FH 3DA9B 1O5GH 4GCHG 2GTBA 2RA3A 1IQLA 4ESTE 1ZZZA 4KELA 1GBMA 5JBTA 3O8RA 1ANDA 4E05H 1OX1A 1FN8A 2J4IA 5E0GA 3GY2A 2HALA 1TABE 2SGEE 2ANYA 1BBRH 1SLWB 1ID5H 1RFNA 1KSNA 5EW1H 1BMLA 3SJKA 2BTCE 3HKIB 1C1QA 5G4BA 1EJNA 5JYIA 1P0SH 1A46H 4U32A 1V2PT 1C1SA 7KMEH 4IS5A 5GJ4B 2FP7B 1C5QA 1AIXH 1XUJA 1L0ZA 1TOCB 2RCEA 1QRXA 1E34B 1NZQH 1NS3A 3UY9A 2PV9B 3TITA 5C2ZA 3BTEE 1HIAB 3KCGH 3KNXA 2Q6DA 1Q3XA 4OS1A 1YCPK 2G5VA 1QIXB 3GY5A 1ZPBA 1P2IA 3BN9A 1MMJN 2W7SA 1AI8H 2P94A 1GMCF 4LXBH 1TWXB 2QIQA 2AMDA 2XRCA 1HB0B 1O2SA 1O36A 5J4SA 3RXJA 1TOMH 1IQEA 2QV1A 3GDSA 4AB9A 1ZTJA 3P6ZB 1V2RT 4WVPE 1ORFA 2BD2A 4I31A 1OYTH 4XFQA 2GZ9A 1TGCA 1FY4A 1G2LA 2AIPA 1SR5C 5T3HA 1VITF 1PQ7A 1O2MA 1C2GA 3SNDA 1QBVH 2G5NA 5TJXA 2WPHS 4O3UA 1S5SA 1GJBB 1P2MA 1W7GH 4ISNA 1CE5A 1DY9A 4Y0ZE 1DANH 3MOCA 2W3KA 4XBBA 1ZSKA 1WQSA 3PMHB 1YPMH 1PPZA 1BTUA 1HNEE 4H4FA 4XDEA 1EATA 2JETB 2G52A 4KTCA 5A0AE 1CT2E 2VWMA 3F9FA 3HK3B 1MAXA 3IITA 4IMQA 3RU4E 1H9HE 1O3LA 3MU8A 3M7UA 5C20A 1FY5A 2PUQH 1FV9A 4B71A 1LVYA 2K1QA 2FIRH 3KL6A 1O38A 1O3NA 2TGDA 4GVUA 2ZHEH 4UD9H 4FU9A 4X1SU 1D3PB 1C4U2 4O97A 5EPYA 4CRCA 2OCVB 3U8RH 3DUXH 3AVZA 2QN5T 1XKAC 2J2UA 3ENSB 3RMMH 4BTTB 1LQEA 5J4QA 4YT7H 4NSVA 3GYLB 3VXFH 1O5BB 1BUIA 1AO5A 2G4TA 1V2LT 1S85A 1INCA 4O03A 1NPMA 1QJ6B 1S6FA 2PKAA 3K9XB 3SGQE 2ZDAH 2ANKH 4K5ZA 1C5ZB 3BIUH 2F91A 5EOKA 4B1TA 1A5GH 3K2UA 3M37A 3W95A 3ZZ4A 2BLWA 2ZDMA 4CR5A 4IC6A 1W13U 1VR1H 1N6XA 1O2ZA 2NU2E 4LZ1H 1QHRB 1H9LB 3RXQA 4ZXXH 3BTME 2EC9H 5DGJA 1ZHMA 4BXSA 1TMUH 1CA8B 3MI4A 2ALPA 3BTQE 5EW2H 1O3JA 1O2RA 1TMBH 1ZR0A 4FU7A 4Y8XA 1SB1H 3S7KB 2QYIA 3L6PA 3PLKA 1T8MA 1V2WT 4FUBA 1O3CA 2WYGA 2BD4A 2PGQB 1BT7A 1AE5A 4WH8A 3U69H 5SGAE 1MZAA 5FX5A 1WSSH 1JIRA 4I32A 1O5DH 2Z6BD 1CGHA 1W12U 1O3EA 1Y3XA 3RXIA 1ZGIA 1SGQE 1CVWH 3UQOA 2WPJS 4GAWA 1FDPA 3RDZA 3MFJA 3RXEA 1EPTA 4F49A 1P02A 1ESTA 4CRFA 3ZV8A 4WH6A 1ELTA 4X1PU 2FXRA 3TNTA 1QQ4A 5F8XA 1SGNE 3UTUH 1QB9A 2P59A 1AE8H 1MU6B 1UK4A 1T32A 1H8DH 2ZDLA 2CMYA 3BTDE 1NRSH 2XWBI 1SL3A 4JYVH 2STAE 2Y7ZA 5GPIB 1KXBA 1P06A 5IDKA 1TNGA 3A89A 3OU0A 3VB3A 1ZMNA 3E90B 3ZZ6A 1FI8A 4I8KA 3BEIB 1ABJH 1EOLA 4KKDA 1BTXA 2J92A 2BLOA 1GMCG 4IGDA 4FUHA 1GI2A 8LPRA 4E06H 2FOGA 3L3TA 4B2CA 2ZC9H 1P09A 2VH6A 3K6YA 4IW4E 1O39A 1UVPA 2D1JA 1EKBB 3LDXH 1C1WH 2ILNA 1O3DA 2GV6A 4ABEA 2P8OB 1QB1A 3UWJH 1IQKA 3E6PH 1C5TA 2A5KA 1PQAA 2ZDNA 3RM2H 1CHOF 3LKWA 3PLPA 2AGEX 3F68H 6CHAC 4D8NA 3M5MA 5E8EH 3CS0A 1ELBA 2SNVA 2W7UA 1G30B 2A45B 1P57B 1XXDA 1HAXB 1V2VT 1BJUA 3NCLA 3PMJA 3TLOA 4IMZA 4ZUHA 2AGIX 4BAKB 2B5TB 2B8OH 4X6PA 2FYQA 1BTZA 1TNIA 1E36B 4YLUA 2ZHWH 3RXLA 1O3PB 2B9LA 1NU7B 1Y3WA 1UCYE 2A7JA 1GBLA 1O33A 4NIWA 2WUBA 4WY3A 1AN1E 1QGFA 1AY6H 1CBWC 1K1LA 2H9TH 3GYMA 3A7XA 3M3SA 4JK6A 4A1TA 1C5YB 1SGPE 5DKMA 1RRKA 2WUCA 4U01A 4MVNA 3SHAH 3U98H 3NK8A 4IC5A 3HPTB 3A85A 1GBJA 4ABHA 2HRVA 1UVSH 5L2ZH 1GG6C 1A0HB 1H4WA 5FAHA 1K21H 2Y82A 1MTNB 3RLYH 3F9GA 3KQCA 1P3EA 3UNQA 4AFQA 3BTKE 1QL7A 1IHTH 4JK5A 1Q2WA 3VXEH 3I29A 3ZZ9A 1SHYA 1OXGA 3MTYA 3A8CA 1TRYA 2XNIA 3A87A 3UOPA 4BXWA 3Q77A 3I77A 1T31A 1GJ7B 1SGEE 1HAGE 1FIWA 3SGBE 3B8JA 1SGIB 1A0JA 2FWWA 4AX9H 1TAWA 1TPSA 1HAIH 3V7TA 1RTFB 1GHAG 1QRWA 2JH5D 2BVRH 3VFEA 2Y81A 1N8OB 4KTUA 1C2HA 3SUGA 1ANCA 2TRMA 3RU4T 1H8IH 1FLEE 1EAIA 1CSOE 1AUJA 1TE0A 4RSPA 2F9NA 1MTNC 2H6MA 2UUJB 5ESBA 1O31A 3ZZBA 1UK2A 1GI0A 1GI3A 1VCPA 1GMDF 3UREA 3ZZ7A 1GI6A 2GV7A 1B5GH 1B7XB 1KXAA 1OP8A 1ELVA 2FYRA 1O2XA 5DP7A 4Y0YE 1P05A 1O3MA 1GJ5H 2VIOA 2BDHA 4X8SH 1YBWA 4HI3A 3KQBA 4UFFH 2C8YB 2P3TB 4ABFA 2H9HA 3P17H 2C93B 3SI3H 1F5KU 1DS2E 1ELFA 3KN2A 1O2KA 2SNWA 3SNAA 2VGCC 2VGCB 1C2MA 3RLWH 3M3VA 4B76A 1YP9A 1SFQB 3D62A 3JZ1B 3M5LA 1AFEH 1UCYK 2HGTH 2VIDA 2RG3A 2FLRH 5LPRA 1ETTH 1UTQA 4A7IB 1VGCC 2ZTXA 2ZEBA 4Y6DA 4F4OC 2TGAA 1UTPA 2HNTE 1FAXA 2AH4X 1P2KA 1WCZA 3B23B 2VVCA 2KAIB 3TGJE 4ZH8A 1IQJA 2FO9A 1YCPM 1DE7H 2AMQA 1V2UT 1OS8A 2ZECA 2BDIA 3A80A 2UUKB 2HVXA 3TJVA 2G00A 2XBYA 1EPTC 5JB8S 1NFYA 2GKVE 2AS9A 3ZZAA 4AFZA 2VWOA 2FLBH 1L1JA 1C2IA 1ELCA 1TGTA 1FY8E 4JZ1A 1D9IA 4H42U 1PYTC 4XE4A 4ABAA 2ESTE 4TPIZ 1SBWA 4X8TH 3SQHE 2CGAA 1RIWB 1XMNB 1HUTH 5C5OA 3DD2H 2Q6FA 3PROA 2PKSB 3BEFB 2HPQH 3EQ0H 1D6WA 5DO4H 2FOHA 2BD9A 1SSXA 1LQDB 1TRNA 3RMOH 5FBIA 1OWIA 1HAVA 4UONA 2C8XB 1KTTB 1WOFA 1HJ8A 4ZKSU 3U1IB 3TVJB 3T29A 4YOGA 1AWHB 1THRH 3LGVA 1BMNH 1DUEA 1F5RA 2ODQA 4B2AA 4LZ4B 2Z94A 3W94A 3P95A 1JBUH 1XVOA 3GICB 3FP7E 1C5NH 2XC5A 4AYYB 4ZHAA 2V3OH 1ZTKA 4CBOA 2VIWA 2OP9A 1O5EH 1HGTH 2YNAA 4R8TB 3U8TH 2D2DA 6GCHF 1GHVH 1ZSJA 1GDNA 2DE9A 1TPAE 2XWAA 1YGCH 1V2TT 2LPRA 3QN7A 2D8WA 4Y10E 1IQGA 2Z9IA 1O2OA 1JIMA 1TPOA 1DICA 2FOMB 1GBIA 4ISLA 3SV8A 3A88A 3PWBA 5HMAA 2R0LA 1RXPA 3SI4H 2EEKA 2R0KA 1L4ZA 2V6NA 3PMAB 2CJIA 5FHTA 2GMTC 1HJAC 1W14U 1GGDC 1MBMA 3A8BA 3P8NA 3KHVA 1UCYH 3M5NA 2FM2A 3MO6A 3TGKE 2FOCA 3Q3XA 1QL8A 3NXPA 4CBNA 1QY6A 2QXHA 1UK3A 1TMTH 4Y11E 2HWLB 3A83A 3LPRA 1ZJDA 4DVAU 1O2NA 3SJOA 3H7TA 3TH3H 1KXFA 3LGYA 2FDAA 2I6QA 2ZZUH 2V3HH 1IHSH 4CHAC 1ELEE 2VIPA 4ABDA 2ANWA 1FY1A 3RUOA 2SGQE 3MHWU 3QO6A 1C5MD 1Z6EA 1LVBA 1WUNH 1AZZA 2FS8A 1T8LA 1MH0A 4MPXA 1NROH 2OC0A 2AMPA 4MNWA 3M7TA 2A1DB 1LHDH 3A7ZA 4WMEA 3K65B 4I8GA 1DOJA 1C5RA 4CH2B 2ZCLP 1GPZA 2F9OA 4BAOB 1IQHA 2H2ZA 2EI6A 2O8WA 4OGYA 1N6YA 3BG4C 2HNTF 4A1XA 7GCHG 3S9AA 2FX4A 1SLVB 2Q1JA 2PHBA 4TY6A 1CHGA 1F0SA 4K60A 1PFXC 4X2WA 1AVWA 1G3EA 4XBCA 5GWZA 1DFPA 1ZMLA 3ATWA 4YO9A 3TH4H 2ZU4A 2ZFSA 1C2FA 3SHCH 4BTIB 1HCGA 3AW0A 4QT8C 5FPTA 2BX3A 3MNXA 1C2JA 1DXWA 1AUTC 3EA9A 2P16A 5H4IB 1P01A 2GT7A 2OBOA 1NRNH 1JOUB 3P70B 5HM2A 3EYDA 1OWDA 3FP8E 2H9EH 3U8OH 1TONA 5DP5A 1WV7H 1O3AA 1K9OE 3MO3A 4KP0A 1ETSH 1EP6A 4B74A 2ASUB 2FZZA 1SPJA 2TPIZ 3LONA 1V2KT 5ETXA 3UPEA 2CV3A 1GJAB 3RXVA 3BTTE 1ANEA 3TJUA 3ATMA 1DLKB 1NRQH 3KGPA 4DIIH 5JBAS 1AKSB 4FUGA 1C9TA 2AEIH 4MNXA 4UFEH 5L2YH 1KLIH 2CF8H 2V35A 3K6ZA 1AHTH 4Y7BA 1E38B 1ANBA 1EAWA 3MU0A 4M7GA 3DFLA 2OQUA 2A2QH 1TGNA 1LKBA 4WMDA 2BOHB 1GHWH 2HNTC 3FVFB 4ISHH 4A5TS 3KEEA 1S84A 2DUCA 8GCHF 1TGBA 3AW1A 1C1PA 1FPCH 1Y5AT 2VNTA 2ZNKH 1CO7E 1FNIA 1ZYOA 2OBQA 3QGNB 2B7DH 2CHAB 2BQWB 4WF8A 1CGJE 3MWIU 4DOQA 2ZO3H 3F1SB 4I33A 4WXVA 5LPEA 1ZPCA 1XUHA 4TYDA 1TA2A 3R3GB 2ZHQH 1P10A 5E0JA 2ANMH 5B6OA 1KYNA 3GOVB 3ZZCA 3ZZDA 4IN1A 1DM4B 1FZZA 1ACBE 4X8VH 2FTMA 3M36A 3M7QA 4AZ2B 5E2OA 4AFUA 4K8BA 2GCHF 1P11E 2EI8A 4AFSA 4B75A 5HM9A 1RGQA 2SGPE 2FMJA 1EUFA 3ATKA 3M61U 3T26A 3TJOA 4HFPB 3PYHA 2A4GA 3RMLH 3KQDA 1O3GA 3RXMA 4GHQA 3VGCB 3UWIA 1YM0A 1KY9A 2VB0A 3RXFA 1F2SE 2NU4E 1O2PA 3QUMP 1IAUA 3SV2H 1KXEA 1XVMA 2P95A 4U2WA 4X1RU 3LJJA 1BRUP 4JZIA 1QA0A 1THPB 1MU8B 1DY8A 2VJ1A 5FPYA 1TBZH 5JB9S 1SQTA 1Z1JA 4X1NU 1ZRBA 1BRAA 1IQFA 1TALA 1B0EA 2GZ8A 4R0IA 2STBE 5EPNA 2ZGCA 4UFDH 1AFQC 1GVZA 1NC6A 2Y5GA 4WJG2 3SJ9A 3SU0A 2BVXH 2EA3A 1BBRK 4TY7A 4AORA 1OP2A 3SJ8A 2YOLA 6ESTA 3LJOA 2BQ7B 3WY8A 4CRDA 1B0FA 2OLGA 1DPOA 1QJ7B 1G37A 2A5AA 1GBFA 1TNKA 5DP4A 3RXRA 5C1XA 5T6GA 1T7CA 1YC0A 2Z3DA 1FAKH 2JKHA 3PTBA 1SI5H 3OSYA 1C5UA 5ABWA 1PQ8A 4TPYA 3PV4A 3RXKA 1LHCH 2I6SA 5T6DA 1C5PA 4UEHH 6LPRA 5C67A 4E7NA 3LIWA 1UTLM 1QNJA 3ZYEA 1G36A 5CMXH 1NN6A 3QZQA 3QDZB 3RXHA 3KIDU 1K2I1 1OPHB 1SOTA 4UDWH 1J16A 4YLQH 1MTWA 1YPLH 2XXLA 1HYLA 1PPEE 3E0PB 3V13A 3TU7H 1S0RA 2ZHFH 3G01A 3FFGA 3LH1A 1V2MT 4Y7AA 9ESTA 3SBKA 3LT3A 1TNHA 1Q31A 1L1GA 1G3CA 1TX6A 5I25A 2Z3EA 1ESAA 1UHBB 4NIXA 4ZXYH 4D7GA 1Y59T 4GCHF 5PTPA 2O8LA 2IN2A 3FZDA 1MKXH 1GHXH 2BXTH 2XYAA 2JH6D 4J1YA 2HLCA 1O5AB 1BBRE 3ITIA 1O3OA 2A4QA 2XC4A 3EGKH 1SGCA 1ZRKA 1P03A 1P2JA 2BDAA 4BAMB 2OC7A 4VGCC 1KIGH 1S81A 4VGCB 3RC5A 1VITH 2ZA5A 3PO1B 4DT7B 1A7SA 1SOZA 2XCFA 1W8BH 1VZQH 1G3DA 2BYAX 5EODA 3SW2B 1P2NA 1UO6A 3I78A 3OY6U 1QQUA 1DXPA 3CENA 2Q6GA 1QB6A 1EZQA 3SU2A 5FBEA 2NWNA 2G51A 3O8BA 2OD3B 1TIOA 1O3HA 1MZDA 3M3TA 1C4Y2 2P93A 5HYOA 1AQ7A 2A31A 1W3CA 1EJAA 3H5CB 3SU3A 1BQYA 2UUFB 3LC5A 1GBTA 4JYUH 1QTFA 4MNYA 4MG3A 3V12A 1P2QA 1DVAH 2Z9LA 5EQSA 3KQEA 2BDYA 2ZFQH 1DWDH 1EZSC 3S9CA 3UR6A 1PPGE 3PO1C 2TGPZ 4NWKA 4YOJA 2VWLA 4AGJA 2GP9B 2SFAA 2J94A 1EB1H 1RIWC 1D6RA 1AVXA 1LPGB 1UVOA 1EB2A 3BG4B 4NIVA 1PQ5A 1V2NT 2QA9E 3ZV9A 4K3JA 3RXPA 1NESE 1HAOH 2F9BH 4ABBA 2F3CE 3RC4A 2R2WU 2Y5HA 2R2MB 3ZVCA 2DE8A 4B73A 1VJAU 4K8YA 4I7YH 4Q80A 4XSKU 1K28D 1YCPH 2R3YA 1V6DA 5DP9A 4NZQA 4KTSA 1GBKA 1VITG 4UE7H 1TB6H 2ZGHA 1Y8TA 1LDTT 4X6MA 1DWEH 4MQAA 1PPBH 4AG2A 2ALVA 1Y5BT 2PSXA 1T8OA 1O2JA 1Y3YA 1K1OA 3QTVH 3SGAE 2BY5X 3GCOA 4OGXA 1WTGH 2W26A 3QZRA 1VGCB 1DWCH 2ODPA 1ZHRA 1O2VA 3GCNA 4MPWA 4ZKRU 1ZTLA 5LPFA
chains in the Genus database with same CATH superfamily
4FVDA 1F0RA 5F8ZA 2ZFTA 2VVUA 4DW2U 1H9IE 1LCYA 5FXLA 4THNH 5LH8A 4NG9H 4Y8YA 4TWWA 3SNCA 4INLA 2HPPH 2HOBA 3F6UH 1MCVA 1OSSA 1C1VH 4IN2A 1BCUH 3AASA 5EXMA 2KX4A 1NRRH 4X6NA 2FOAA 2BDBA 3TK6A 1V2QT 3BF6H 3O8DA 2AERH 1BDAA 1NFWA 3TPIZ 1O2LA 2QY0B 2FS9A 2IOTA 1O3BA 1XUFA 9LPRA 3A8DA 1SGFG 2TIOA 1WBGB 2CHAC 1SLUB 3LGUA 1AMHA 3P8GA 5C0TA 1O5FH 3UIRA 1DT2A 1GVKB 1NFXA 1OWEA 1ARCA 1G32B 4BOHA 1A3BH 3LH3A 1OWHA 5HXFA 3RM0H 1MAYA 3M5OA 4ISOA 2ZDKA 2GCHG 2XW9A 5KGOA 1HV7A 2A2XH 3OEED 3QX5H 4OS6A 1O35A 3S0NA 1BTWA 3PB1E 5DG6A 1ZPZA 1W10U 1C5LH 1UW7A 5EU8A 1QA7A 4A6LA 4GHTA 5GXPA 3QWCH 1C5XB 1SGRE 2P3UB 1FJSA 1A3EH 1EP5A 1T8NA 1FY3A 5FX6A 3BEUA 2WZQA 1SGTA 4U30A 4BANB 4ZAEA 5DK1A 1ESBA 4DURA 4X2YA 3EE0B 5E0HA 1O0DH 1UHBA 3V0XA 2PKAB 3S9BA 1SGDE 1NO9H 3SN8A 5F03A 1EJMA 5FL7D 1HPGA 2A4RA 1YKTA 1LHGH 5DPAA 2BD7A 3SU4A 1DSUA 1HAZB 1MUEB 5JPMH 1HAYB 1RS0A 4X6OA 4DJZB 2FI4E 2A5IA 4WMFA 3ZVFA 5A8YA 1HDTH 4NIYA 4AGKA 4AOQA 1F5LA 2KAIA 4D9QA 1H1BA 2JETC 1GG6B 1GHYH 2W5EA 1TRMA 3UUZA 1GGDB 2YNBA 2BLVA 4D76A 1BTYA 4Q7ZA 4WWYA 2O8MA 2QC2A 2XBXA 1SGFA 5EXNA 5L30H 4SGBE 1SVPA 2TBSA 3Q00A 2ZKSA 1DDJA 3ZZ3A 2J98A 1KXDA 1K1MA 5A8ZA 1SG8B 3FAOA 1PPHE 4Q63A 4F48B 1Z8JB 2HVYB 4FUJA 2UWLA 1C1UH 1YF4A 1J17T 2G4UA 1GBDA 4H6SB 4X8UH 3GCTG 1MTVA 1PPFE 2BB4A 1N8OC 2QXGA 5DJ7A 3LGTA 2Z9JA 4I8JA 3FKSD 1C5VA 1GHBG 1O37A 3P8FA 4INKA 4NFFA 1A0LA 4LK4A 3VGCC 3NRLA 4XOJA 3UFAA 3HGPA 4OS2A 5C1UA 2PGBB 3MNCA 1J15A 4JYTA 2A4OA 2ZI2H 3E16B 4KGAA 2BLQA 4WXIA 3N7OA 1Z1IA 3TH2H 6GCHG 1BMAA 2ZU1A 1A5IA 1BJVA 1GJCB 1P8VC 2AYWA 2PWXA 1NY22 1GMHG 1QBNA 3F9EA 1LHFH 5GNDA 3SORA 2A7CA 2WPKS 2K8IA 2WINI 3JZ2B 2V0BA 3GY4A 4AN7A 3U1JB 7ESTE 1GBHA 4XBDA 3SYJA 1AB9B 4RKJB 2GVFA 4ASHA 2VINA 1O3FA 4B6FA 3SOSA 1GJ4H 2UUYA 1EQ9A 1CT4E 1KLTA 2WV5A 1O2HA 1FONA 3QGJA 2BDGA 1UTJA 1SHHB 3PM3A 3A82A 2V7QD 2FI5E 2F9PA 2OC8A 1HJAB 4DG4A 2BM2A 1QFKH 1EOJA 3VB5A 1C9PA 2VWNA 1NT1A 3MH6A 3A7VA 5A2MH 1ELGA 5F6MA 2BXUH 1D4PB 3PV5A 3NPSA 1ZHPA 5C1YA 2JH0D 1YPEH 1G2MA 2IPHA 3LC3A 1GI7B 3Q3KA 4K1SA 1P9SA 2C4FH 2ZU2A 3GY8A 2TGTA 2PUXB 1ELDE 2NU1E 3V3MA 4OS4A 1TGSZ 1EX3A 2D26C 2FI3E 1U6QA 1SMFE 1O2IA 3LGIA 2UWPA 3RMNH 4OS5A 3H7OA 4FUEA 5DP3A 5AFYH 4AYVB 1O2YA 5JDUB 5C5NA 2Y7XA 4AB8A 2BZ6H 1DX5M 2BZAA 4FU8A 1K0HA 1UTMA 3RXSA 1GI4A 3B9FH 3OY5U 4XRNA 1E37B 2WV4A 5F8TA 2Y5FA 1C1NA 4FUIA 4Y76A 1C1TA 3CP7A 3C1KA 4TT3D 4FUFA 3A81A 3A7TA 1V3XA 1K1JA 4I86A 1L4DA 1MD8A 1OWJA 1YYY1 1O3KA 2ODYB 3GS9A 2ZPSA 2ZDVH 1YPHC 5GIBA 3SJIA 1S6HA 4CH8B 3F2GA 1RJXB 2RA0A 1EFRD 1QURH 3T5FH 4ZKOU 4CRBA 4YXWD 4NA9H 1IQNA 4JZDH 4CR9A 2FOEA 3RXBA 5AFZH 3BTGE 1GHZA 4H6TA 2FESH 4FUCA 3TK9A 2CN0H 4DT4A 4GLYA 1TQ0B 1BITA 5GCHF 1QRZA 3T28A 2O9QA 3VB4A 4FETA 3HK6B 3E8LA 1GI9B 1L2EA 2UWOA 1GI8B 1GJ8B 3BTWE 4BNRA 1Z8IB 2VIQA 1UJ1A 3SV9A 3A8AA 1AKSA 1O34A 2QXIA 1GMDG 2G8TA 4E7RG 2R9PA 3D23A 2GDEH 2GCTB 3PTNA 3ELAH 3P92A 1M9UA 4Q7XA 1GHAF 2H5CA 4D7FA 4A1VA 1NFUA 1C1RA 4NFEA 3SZNA 4I8LA 2BX4A 4NGAH 2ZFFH 1TBRH 3EAJA 4YESB 5HIZA 1C2EA 3TIUA 1G9IE 4Y79A 1KXCA 4IBLH 3U9AH 1BHXB 4SGAE 3AK5A 1AB9C 2J5UA 1ZOMA 1BTHH 5IYTA 3A7WA 2BY7X 1A2CH 1XKBC 1J9CH 1PYTD 1W11U 3SU6A 5EJZA 2A0QB 2ZP0H 5L6NH 1LPKB 2EI7A 1GJDB 1WXRA 3AAVA 5EGMA 1UMAH 2ZQ2A 1P9UA 2NU0E 1AD8H 1VJ9U 2KCYA 2OC1A 3GY3A 2PTCE 2QGRA 4XD7D 2PLXA 1C5OH 1TX7A 1OOKB 1NTPA 2FOBA 5JBBS 1MQ5A 1V2OT 1JWTA 3EA8A 2G55A 1O2QA 1YLCA 2ZU3A 1FIZA 4MPUA 2FEQH 1SLXB 5LGOA 1UTKA 1MKWK 1CHOG 4CREA 1YY3A 1SGYE 1W0YH 1OWKA 2QAAA 3FANA 4YT6H 1O2GH 2IJOB 7GCHF 1NU9A 3Q76A 2VIVA 1GI5A 5AVDA 3ZZ5A 1J14A 2WPMS 4Y8ZA 3RU4D 1Z8GA 1N1LA 2AIQA 3FP6E 1UTNA 3MMGA 4O3TA 1C1MA 3FZZA 2PR3A 4I8HA 3D49H 4K1TA 1HXFH 2XBWA 2THFB 2FX6A 3E3TA 1F7ZA 3A84A 1GBBA 4RN6A 3S7HB 1A4WH 3MU4A 2ZFPH 3RXUA 3QK1A 1W0ZU 4BAQB 3RXAA 1LVOA 1O5CB 3OEHD 3SU1A 4B2BA 4ZHLU 3BSQA 1OP0A 2Y80A 2J38A 1L1NA 3UQVA 4NA7A 2F9UA 4X0WU 1GL1A 3NUMA 1CQQA 1GCTB 1K1NA 4MDSA 1C5WB 1TQ7B 4Q2KA 1KDQA 2BVSH 1V2JT 1VCQA 1IQMA 5K7RA 2QF3A 5JBCS 4NA8A 1EAXA 1BTPA 1WYKA 3GISB 1WQVH 1NRPH 2BDCA 4CRGA 2BY6X 1S83A 2BOKA 3KYFA 5DP6A 1AVGH 2F9VA 1HFDA 1H8HD 1RTKA 1YPKH 1W2KH 1HAVB 5E2PA 5CE1A 3MH4A 1BOQA 5EG4A 3F0PA 2Z7FE 1HAHH 3ZVDA 5AF9H 2YMSB 3STIA 1O2UA 3LOXA 1TNJA 4X2VA 4Z0KA 4ABGA 5A0BA 4K69A 2B0FA 3MNSA 2BMGB 3PMBB 5TCCA 3QTOH 1BRCE 3T27A 1EASA 2OXSA 3SUEA 3ODFA 1S0QA 3A86A 1F92A 1O32A 4BTUB 3VPKA 3SV6A 1Z71A 2PFEA 3ATLA 5EXLA 2ZG0H 1FPHH 2F83A 3SU5A 3URCA 3QLPH 1E0FD 1XX9A 3TJNA 1EZUC 5A0CA 2SGAA 3PRBA 5FCRA 2ZCHP 1V2ST 1K1PA 1XUGA 3C27B 4O9VA 3T2NA 4ASUD 3GCHB 3F9HA 1D3DB 3A7YA 1MD7A 3P8OA 4HTCH 3T25A 1C5SA 3UB0A 3RXGA 5BPEA 5TCAA 1QJ1B 1Z8RA 1ZSLA 1LTOA 1CU1A 5DP8A 5C3NA 2BY9X 1GDUA 1D3QB 3E91A 2ZU5A 1LVMA 3DT0H 4OS7A 7LPRA 1TA6A 2IJD1 4X1QU 1QL9A 1NM6A 1JRSA 4Y71A 1LMWB 1TLDA 4ZMAH 4ZKNU 1CA0C 1AU8A 2OINA 1CA0B 1TFXA 2M2AA 1E1RD 2QCYA 4ABIA 4NSYA 4NZLA 1AWFH 3STJA 3SNEA 1ZMJA 2PW8H 3HKJB 1GMHF 4RKOB 2RFKC 1J8AA 4TWYA 3ESTA 1O3IA 2O8TA 1XXFA 3DCLA 2VBCA 3RXCA 1SQOA 1KTSB 2A7HA 3ZIAD 1DLEA 3MO9A 1BIOA 4DCDA 4MNVA 3PWCA 1YPJH 4DIHH 1HXEH 2FPZA 3AAUA 1GBCA 8KME2 1PPCE 1WAYB 1ARBA 3SNBA 2ZF0H 4DY7B 4HZHA 4FUDA 3GY6A 2P8OC 4ZROA 1LHEH 5A8XA 4JZFH 1O2TA 2J95A 3S69A 5EJ1A 4FXGH 3HGNA 3GCHC 1DUAA 3OX7U 5CHAB 2GX4A 4A92A 1UTOA 2J34A 4MPVA 1C4V2 5GDSH 3DFJA 1P12E 3KF2A 1BA8B 1XUKA 3ZVGA 3ZYDA 1GDQA 2SGFE 1GCDA 1GL0E 1MTUA 4ABJA 2GDDA 1OKXA 1X7AC 1YLNA 1C2LA 1WDIA 1T4UH 1OYQA 5I46H 2C90B 2CXVA 2FOFA 1W7XH 1DITH 1MQ6A 2VVVA 3SUDA 2QF0A 1AFQB 1C2DA 2J9NA 3PLBA 1XM1A 3R0FA 3OTJE 1SQAA 3UAIC 1FMGA 3TGIE 2GZ7A 1Y3VA 2OTVA 3M35A 1YPHE 2YMSC 1EPTB 1HRTH 2Y6TA 2XCNA 4YOIA 1HJ9A 3LU9B 1UVTH 1Z7KA 2ZWLH 3NWUA 1TPPA 2XC0A 1ETRH 4MLFB 4D9RA 3TNSA 1T4VH 1ABIH 2XTTB 1GHBF 2ZCKP 1TYNA 5EQRA 1BB0B 3URDA 1GJ9B 1QBOA 3BIVH 2BD3A 3RP2A 5ESTE 8GCHG 1MKXK 1HIAA 1GBAA 3ATIA 3MH7A 5EQQA 5A09A 5AHGH 2NU3E 4HGCA 2FTLE 1EZXC 2WYJA 6CHAB 1FN6A 3EDXB 1DWBH 3SV7A 2ULLA 3GY7A 4AC9A 1DSTA 5FCKA 2W3IA 1SC8U 1D3TB 3UOUA 2ZFRH 3OAAD 1MCTA 3SO3A 3MNBA 4GPGA 2OQ5A 4NWLA 4JCNA 1TX8A 2H1UA 1HBTH 3LGWA 1AGJA 1C2KA 2C3SA 3EA7A 5FPSA 2K0QA 1WU1A 2SGDE 1JMOH 2J98B 2GGVB 3OYPA 3UR9A 1S82A 3IWMA 2BD5A 4GSOA 2BY8X 3D65E 1EXFA 3PV2A 1ZLRA 4X2XA 1RTLA 1Y5UT 1WTHD 1GJ6A 5HKKD 1KDQB 1VKYA 1A61H 3MYWA 2ZTYA 2G81E 2BQ6B 3ODDA 1YWUA 1HLTH 2A32A 2ZPRA 3T62A 1BMMH 2C8ZB 2J97A 1YLDA 1FXYA 2ZPQA 1ZJKA 1XUIA 1O30A 1EAUA 3L33A 2WPIS 2H5DA 4MTBA 1F0TA 1CT0E 3NZIA 1ELAA 4INHA 2GMTB 3MU5A 2LP6A 4Z6AH 2RDLA 4UFGH 3UNSA 1C1OA 1GBEA 3DHKH 2QXJA 4DGJA 3DSOA 2XBVA 3CS7A 5T6FA 1TNLA 2CF9H 2Z9GA 1MKWH 1ZGVA 4FVBA 1IOEA 3SQEE 3RXDA 1IQIA 1JXPA 5KEDA 3ZVBA 2FODA 1BRBE 1BZXE 2JJ2D 4K1EA 2O8UA 1FUJA 4K2YA 1HAPH 2R3UA 1UVUH 4JZEH 1A1RA 3BTFE 3GDUA 3VB6A 3GDVA 4ISIH 1LKAA 2GD4B 3NKKA 1THSH 2ZQ1A 2ZTZA 3Q3YA 5K0HA 2ZHDA 4YM9A 3RXOA 1KLJH 3E0NB 1A5HA 2Z9KA 1PJPA 4J2YB 4CRAA 1LO6A 1LPZB 2WPLS 3W1EA 3ZVAA 5GCHG 1P2OA 4LOYH 3VB7A 3VEQB 1GWAA 2GCTC 2ZGBH 3F2FA 2VH0A 2C8WB 2Z3CA 2AGGX 2HLDD 1CBWB 1TBQH 2W6JD 1MTSA 4ZHMU 1Y3UA 1CGIE 3O8CA 1F0UA 1E35B 2GT8A 3ZZ8A 3ZVEA 1QCPA 3BTHE 1P04A 3IG6B 2PTNA 2ZGXH 3UNRA 3TK5A 4NCYA 3RXTA 3MU1A 1O2WA 1MBQA 2PKSC 3MH5A 3SUFA 4YZUA 5HGGA 2WSSD 1GCTC 2ZIQH 1K1IA 2VU8E 3BV9B 3N99A 4PROA 1GVLA 2AFQB 2BD8A 2BHGA 8ESTE 2ZGJA 4CHAB 4JMYA 1GI1A 1G3BA 5BRRE 4RI0A 4GUXA 1YPGH 3RC6A 4YTAA 1JRTA 1BHXF 5CHAC 1SFIA 1K22H 1VCWA 2V3MA 2PSYA 4Q7YA 1P3CA 4BAHB 2OUAA 1QR3E 3E1XB 1AZ8A 3BG8A 2LNCA 4TSFD 1RD3B 4AG1A 2M5TA 3HATH 3GCTF 1FQ3A 1Z6JH 2P3FH 1MABB 3DA9B 1O5GH 4GCHG 2GTBA 2RA3A 1IQLA 4ESTE 3KYGA 1ZZZA 4KELA 1GBMA 5JBTA 3O8RA 1ANDA 4E05H 1OX1A 1FN8A 2J4IA 5E0GA 3GY2A 2HALA 1TABE 2SGEE 2ANYA 2JJ1D 1BBRH 1SLWB 1ID5H 1RFNA 1KSNA 5EW1H 1BMLA 3SJKA 2BTCE 3HKIB 1C1QA 5G4BA 1EJNA 5JYIA 1P0SH 1A46H 4U32A 1V2PT 1C1SA 7KMEH 4RT0A 4IS5A 1H8ED 5GJ4B 2L74A 3DSGA 2FP7B 2KCAA 1C5QA 5KECA 1AIXH 1XUJA 1L0ZA 1TOCB 2RCEA 1QRXA 1E34B 1NZQH 1NS3A 3UY9A 2PV9B 3TITA 2OK5A 5C2ZA 3BTEE 1HIAB 3KCGH 3KNXA 2Q6DA 1Q3XA 4OS1A 1YCPK 2G5VA 1QIXB 3GY5A 1ZPBA 1P2IA 3BN9A 1MMJN 2W7SA 1AI8H 2P94A 1GMCF 4LXBH 1TWXB 2QIQA 2AMDA 2XRCA 3FN8A 1HB0B 1O2SA 1O36A 5J4SA 3RXJA 1TOMH 1IQEA 2QV1A 3GDSA 4AB9A 1ZTJA 3P6ZB 1V2RT 4WVPE 1ORFA 2BD2A 4I31A 1OYTH 4XFQA 2GZ9A 1TGCA 1FY4A 1G2LA 2AIPA 1SR5C 5T3HA 1VITF 1PQ7A 1COWD 1O2MA 3F2HA 1C2GA 3SNDA 1QBVH 2G5NA 5TJXA 2WPHS 2KR7A 4O3UA 1S5SA 1GJBB 1P2MA 1W7GH 4ISNA 1CE5A 1DY9A 4Y0ZE 1DANH 3F0OA 2W3KA 3MOCA 4XBBA 1ZSKA 1WQSA 3PMHB 1YPMH 3CNRA 1PPZA 1BTUA 1HNEE 4H4FA 4XDEA 1EATA 2JETB 2G52A 4KTCA 5A0AE 1CT2E 2VWMA 3F9FA 3HK3B 1MAXA 3IITA 4IMQA 3RU4E 1H9HE 4Z1MD 1O3LA 3H09A 3MU8A 3M7UA 3SZEA 5C20A 1FY5A 2PUQH 1FV9A 2AHME 1LVYA 4B71A 2K1QA 2FIRH 3KL6A 1O38A 1O3NA 2TGDA 4GVUA 2ZHEH 4UD9H 4FU9A 4X1SU 2EQNA 1D3PB 1C4U2 4O97A 5EPYA 4CRCA 2OCVB 1SKYE 3U8RH 3DUXH 3AVZA 2QN5T 1XKAC 2J2UA 3ENSB 3RMMH 4BTTB 1LQEA 5J4QA 5IK2D 4YT7H 4NSVA 3GYLB 3VXFH 1O5BB 1BUIA 1AO5A 2G4TA 1V2LT 1S85A 1INCA 4O03A 1NPMA 4P00A 1QJ6B 1S6FA 2PKAA 3K9XB 3SGQE 2ZDAH 2ANKH 4K5ZA 1C5ZB 3BIUH 2F91A 5EOKA 4B1TA 1A5GH 3K2UA 3M37A 3W95A 3ZZ4A 2BLWA 2ZDMA 4CR5A 4IC6A 1W13U 1VR1H 1N6XA 1O2ZA 3OE7D 2NU2E 3WWBA 1QHRB 1H9LB 3RXQA 4LZ1H 4ZXXH 3BTME 2EC9H 5DGJA 1ZHMA 4BXSA 1TMUH 1CA8B 3MI4A 2ALPA 3BTQE 5EW2H 3U28C 1O3JA 1O2RA 1TMBH 1ZR0A 3N7DA 4FU7A 1SB1H 4Y8XA 3S7KB 2QYIA 3L6PA 3PLKA 1T8MA 1V2WT 4FUBA 1O3CA 2WYGA 2BD4A 2PGQB 1BT7A 1AE5A 4WH8A 3U69H 5SGAE 1MZAA 5FX5A 1WSSH 1JIRA 4I32A 1O5DH 2Z6BD 1CGHA 1W12U 1O3EA 1Y3XA 3RXIA 1ZGIA 1SGQE 1CVWH 3UQOA 2WPJS 4GAWA 1FDPA 3RDZA 3MFJA 3RXEA 1EPTA 4F49A 1P02A 1ESTA 4CRFA 3ZV8A 4WH6A 1ELTA 4X1PU 2FXRA 3TNTA 1QQ4A 5F8XA 1SGNE 3UTUH 1QB9A 2P59A 1AE8H 1MU6B 1UK4A 1T32A 1H8DH 2ZDLA 2CMYA 3BTDE 1NRSH 1SL3A 2XWBI 4JYVH 2STAE 2Y7ZA 5DSFA 5GPIB 1KXBA 1P06A 5IDKA 2F43B 1TNGA 3A89A 3OU0A 3VB3A 1ZMNA 3E90B 3ZZ6A 1FI8A 4I8KA 3BEIB 1ABJH 1EOLA 3WWFA 4KKDA 1BTXA 2J92A 2BLOA 2QF4A 1GMCG 4IGDA 4FUHA 1GI2A 8LPRA 4E06H 2FOGA 3L3TA 4B2CA 2ZC9H 1P09A 2VH6A 3K6YA 2L6OA 4IW4E 1O39A 1UVPA 2D1JA 5CHBA 1EKBB 3LDXH 1C1WH 2ILNA 1O3DA 2GV6A 4ABEA 2P8OB 1QB1A 3UWJH 1IQKA 3E6PH 1C5TA 2A5KA 1PQAA 2ZDNA 3RM2H 1CHOF 3LKWA 3PLPA 2AGEX 3F68H 6CHAC 4D8NA 3M5MA 5E8EH 3CS0A 1ELBA 2SNVA 2W7UA 1G30B 2A45B 1P57B 1XXDA 1HAXB 1V2VT 1BJUA 3NCLA 3PMJA 3TLOA 4IMZA 4ZUHA 2AGIX 4BAKB 2B5TB 2B8OH 4X6PA 2FYQA 1BTZA 1TNIA 1E36B 1E79D 4YLUA 2ZHWH 3RXLA 1O3PB 2B9LA 2PP6A 1NU7B 1Y3WA 1UCYE 2A7JA 1GBLA 1O33A 4NIWA 2WUBA 4WY3A 1AN1E 1QGFA 1AY6H 1CBWC 1K1LA 2H9TH 3GYMA 5DN6D 5CDFE 3A7XA 3M3SA 4JK6A 4A1TA 1C5YB 1SGPE 5DKMA 4B6EA 4ACAA 1RRKA 2WUCA 4U01A 4MVNA 3SHAH 3U98H 3NK8A 4IC5A 3HPTB 3A85A 1GBJA 4ABHA 2JDID 2HRVA 1UVSH 5L2ZH 1GG6C 1A0HB 1H4WA 5FAHA 1K21H 2Y82A 1MTNB 3RLYH 3F9GA 3KQCA 1P3EA 3UNQA 4AFQA 3BTKE 1QL7A 2CK3D 1IHTH 4JK5A 1Q2WA 3VXEH 3I29A 3ZZ9A 3VG8A 1SHYA 1OXGA 3MTYA 3A8CA 1TRYA 2XNIA 3A87A 3UOPA 4BXWA 3Q77A 3I77A 1T31A 1GJ7B 1SGEE 1HAGE 1FIWA 3SGBE 3B8JA 2FWWA 1SGIB 1A0JA 4AX9H 1TAWA 4RT1A 1TPSA 1HAIH 3V7TA 1RTFB 1GHAG 1QRWA 5C0UA 2JH5D 2BVRH 3VFEA 2Y81A 1N8OB 4KTUA 1C2HA 4ZCNA 3SUGA 1ANCA 2TRMA 3RU4T 1H8IH 1FLEE 1EAIA 1CSOE 1AUJA 1TE0A 4RSPA 2F9NA 1MTNC 2H6MA 2UUJB 5ESBA 1O31A 3ZZBA 1UK2A 1GI0A 1GI3A 1VCPA 1GMDF 3UREA 3ZZ7A 1GI6A 2GV7A 1B5GH 1B7XB 1KXAA 1OP8A 1ELVA 2FYRA 4M9FA 1O2XA 1KMHB 5DP7A 4Y0YE 1P05A 1O3MA 1GJ5H 2VIOA 2BDHA 4X8SH 1YBWA 4HI3A 3KQBA 4UFFH 2C8YB 2P3TB 4ABFA 2H9HA 3P17H 2C93B 3SI3H 1F5KU 5T1VA 3MQKC 1DS2E 1ELFA 3KN2A 1O2KA 2SNWA 3SNAA 2VGCC 2VGCB 1C2MA 3RLWH 4Q4LA 3M3VA 4B76A 1YP9A 1SFQB 3D62A 3JZ1B 3M5LA 1AFEH 1UCYK 2HGTH 2VIDA 3FO8D 2RG3A 2FLRH 5LPRA 1ETTH 1UTQA 4A7IB 1VGCC 2ZTXA 2ZEBA 4Y6DA 4F4OC 2TGAA 1UTPA 2HNTE 1FAXA 2AH4X 1P2KA 1WCZA 3B23B 2VVCA 2KAIB 3TGJE 4ZH8A 1IQJA 2FO9A 1YCPM 1DE7H 2AMQA 1V2UT 1OS8A 2ZECA 2BDIA 3A80A 2UUKB 2HVXA 2QE7D 3TJVA 2G00A 2XBYA 1FX0B 1EPTC 5JB8S 1NFYA 2GKVE 2AS9A 3ZZAA 4AFZA 2VWOA 2FLBH 1L1JA 1C2IA 1ELCA 1TGTA 1FY8E 4JZ1A 1D9IA 4H42U 1PYTC 4XE4A 4ABAA 2ESTE 4TPIZ 1SBWA 4X8TH 3SQHE 2CGAA 1RIWB 1XMNB 1HUTH 5C5OA 2KFWA 3DD2H 2Q6FA 3PROA 2PKSB 3BEFB 2HPQH 3EQ0H 1D6WA 5DO4H 2FOHA 2BD9A 2KCPA 1SSXA 1LQDB 1TRNA 3RMOH 5FBIA 3N7EA 1OWIA 1HAVA 4UONA 2C8XB 1KTTB 1WOFA 1HJ8A 4ZKSU 3U1IB 3TVJB 3T29A 4YOGA 1AWHB 1THRH 3LGVA 2QF5A 1BMNH 2KCOA 1DUEA 1F5RA 2ODQA 4B2AA 4LZ4B 2Z94A 3W94A 3P95A 1SQRA 1JBUH 1XVOA 5HIYA 3GICB 3FP7E 1C5NH 2XC5A 4AYYB 4ZHAA 2V3OH 1ZTKA 4CBOA 2VIWA 2OP9A 5C17A 1O5EH 1HGTH 2YNAA 4R8TB 3U8TH 2D2DA 6GCHF 1GHVH 1ZSJA 1GDNA 2DE9A 1TPAE 2XWAA 1YGCH 1V2TT 2LPRA 3QN7A 2D8WA 4OM9A 4Y10E 1IQGA 2Z9IA 1O2OA 1JIMA 1TPOA 1DICA 2FOMB 1GBIA 3EE7A 4ISLA 3SV8A 3A88A 3PWBA 5HMAA 2R0LA 1RXPA 3SI4H 2EEKA 2R0KA 1L4ZA 2V6NA 3PMAB 2CJIA 5FHTA 2GMTC 1HJAC 1W14U 1GGDC 1MBMA 3A8BA 3P8NA 3KHVA 1UCYH 3M5NA 2FM2A 3MO6A 3TGKE 2FOCA 3Q3XA 1QL8A 3NXPA 4CBNA 1QY6A 2QXHA 1UK3A 1TMTH 4Y11E 2HWLB 3A83A 3LPRA 1ZJDA 4DVAU 1O2NA 3SJOA 3H7TA 3TH3H 1KXFA 3LGYA 2FDAA 2I6QA 2ZZUH 2V3HH 1IHSH 4CHAC 1ELEE 2VIPA 4ABDA 4ACBA 2ANWA 1FY1A 3RUOA 2SGQE 3MHWU 3QO6A 1C5MD 1Z6EA 1LVBA 1WUNH 1AZZA 2FS8A 1T8LA 2GJGA 1MH0A 4MPXA 1NROH 2OC0A 2AMPA 4MNWA 3M7TA 2A1DB 1LHDH 3A7ZA 4WMEA 3K65B 4I8GA 1DOJA 1C5RA 4CH2B 2ZCLP 2RDEA 1GPZA 2F9OA 4BAOB 1IQHA 2H2ZA 2EI6A 2O8WA 4OGYA 1N6YA 3BG4C 2HNTF 1W0KD 4A1XA 7GCHG 3S9AA 2FX4A 3DSPA 1SLVB 2Q1JA 2PHBA 2YMSD 4TY6A 1CHGA 1F0SA 4K60A 1PFXC 4X2WA 1AVWA 2KM0A 1G3EA 2WV9A 4XBCA 5GWZA 1DFPA 1ZMLA 3ATWA 4YO9A 3TH4H 2ZU4A 2ZFSA 1C2FA 3SHCH 4BTIB 1HCGA 3AW0A 4QT8C 5FPTA 2BX3A 3MNXA 1C2JA 1DXWA 1AUTC 3EA9A 2P16A 5H4IB 1P01A 2GT7A 2OBOA 1NRNH 1JOUB 3P70B 5HM2A 3F3BA 3EYDA 1OWDA 3FP8E 2H9EH 3U8OH 1TONA 5DP5A 2IPQX 1WV7H 1O3AA 3WW7A 1K9OE 3MO3A 4KP0A 1ETSH 1EP6A 4B74A 2ASUB 2FZZA 1SPJA 2TPIZ 3LONA 1V2KT 5ETXA 3UPEA 2CV3A 1GJAB 3RXVA 3BTTE 1ANEA 3KQ5A 3TJUA 3ATMA 1DLKB 1NRQH 3KGPA 4DIIH 5JBAS 1E1QD 1AKSB 4FUGA 1C9TA 2AEIH 4MNXA 4UFEH 2XNDD 5L2YH 1KLIH 2CF8H 2V35A 3K6ZA 1AHTH 4Y7BA 1E38B 1ANBA 1EAWA 3MU0A 4M7GA 3DFLA 2OQUA 2A2QH 1TGNA 1LKBA 4WMDA 2BOHB 1GHWH 2HNTC 3FVFB 4ISHH 4A5TS 5B6LA 3KEEA 1S84A 2DUCA 8GCHF 1TGBA 3AW1A 1C1PA 1FPCH 1Y5AT 2VNTA 2ZNKH 1CO7E 1FNIA 1ZYOA 2OBQA 3QGNB 2B7DH 2CHAB 2BQWB 4WF8A 1CGJE 3MWIU 2EY4C 4DOQA 2ZO3H 3F1SB 4I33A 4WXVA 5LPEA 1ZPCA 1XUHA 3OFND 4TYDA 1TA2A 3R3GB 2ZHQH 1P10A 5E0JA 2ANMH 5B6OA 1KYNA 3GOVB 3ZZCA 3ZZDA 4IN1A 1DM4B 1FZZA 1ACBE 4X8VH 2FTMA 3M36A 3M7QA 4AZ2B 5E2OA 4AFUA 4K8BA 2GCHF 1P11E 2EI8A 4AFSA 4B75A 5HM9A 1RGQA 2SGPE 2FMJA 1EUFA 3ATKA 3M61U 3T26A 3TJOA 4HFPB 3PYHA 2A4GA 3RMLH 3KQDA 1O3GA 3RXMA 4GHQA 3VGCB 3UWIA 1YM0A 1KY9A 2VB0A 3RXFA 1F2SE 2NU4E 1O2PA 3QUMP 1IAUA 3SV2H 1KXEA 1XVMA 2P95A 4U2WA 1BMFD 4X1RU 3LJJA 1BRUP 4JZIA 1QA0A 1THPB 1MU8B 1DY8A 2VJ1A 5FPYA 1TBZH 5JB9S 1SQTA 1Z1JA 4X1NU 1OHHD 1ZRBA 1BRAA 1IQFA 1TALA 1B0EA 2GZ8A 4R0IA 1NBMD 2STBE 2XOKD 5C94A 5EPNA 2ZGCA 4UFDH 1AFQC 1GVZA 1NC6A 2Y5GA 4FOUC 4WJG2 3SJ9A 3SU0A 2BVXH 2EA3A 1BBRK 2W6ID 4TY7A 4AORA 1OP2A 3SJ8A 2YOLA 6ESTA 3LJOA 2BQ7B 3WY8A 4CRDA 1B0FA 2OLGA 1DPOA 1QJ7B 1G37A 2A5AA 1GBFA 1TNKA 5DP4A 3RXRA 5C1XA 5T6GA 1T7CA 1YC0A 2Z3DA 1FAKH 1S6LA 2JKHA 1SI5H 3PTBA 3OSYA 1C5UA 5ABWA 1PQ8A 4TPYA 3PV4A 3RXKA 1LHCH 2WPDD 2I6SA 5T6DA 1C5PA 4UEHH 6LPRA 5C67A 4E7NA 3LIWA 1QZ8A 1UTLM 1QNJA 3ZYEA 1G36A 5CMXH 1NN6A 3QZQA 4F55A 3QDZB 3RXHA 3KIDU 1K2I1 1OPHB 1SOTA 4UDWH 1J16A 4YLQH 1MTWA 1YPLH 2XXLA 1HYLA 1PPEE 3E0PB 3V13A 3TU7H 1S0RA 2ZHFH 3G01A 3FFGA 3LH1A 1V2MT 4Y7AA 9ESTA 3SBKA 3LT3A 1TNHA 1Q31A 1L1GA 1G3CA 2F4LA 1TX6A 4P02A 5I25A 2Z3EA 1ESAA 1UHBB 4NIXA 4ZXYH 3FOAA 4D7GA 1Y59T 4GCHF 5PTPA 2O8LA 2IN2A 3FZDA 1MKXH 1NBME 1GHXH 2BXTH 2XYAA 1W0JD 2JH6D 2LELA 4J1YA 2HLCA 1O5AB 1BBRE 3ITIA 1O3OA 2A4QA 2XC4A 3EGKH 1SGCA 1ZRKA 1P03A 1P2JA 2BDAA 4BAMB 3OTPA 2OC7A 4VGCC 1KIGH 1S81A 4VGCB 3RC5A 1VITH 2ZA5A 3PO1B 4DT7B 1A7SA 1SOZA 2XCFA 1W8BH 1VZQH 3PRDA 1G3DA 2BYAX 5EODA 3SW2B 1P2NA 1UO6A 3I78A 3OY6U 1QQUA 1DXPA 3CENA 2Q6GA 1QB6A 1EZQA 3SU2A 5FBEA 2NWNA 2G51A 3O8BA 2OD3B 1TIOA 1O3HA 1MZDA 3M3TA 1C4Y2 2P93A 5EJLA 5HYOA 1AQ7A 2A31A 1W3CA 1EJAA 3H5CB 3SU3A 1BQYA 2UUFB 3LC5A 1GBTA 4JYUH 1QTFA 4MNYA 4MG3A 3V12A 1P2QA 1DVAH 2JIZD 2Z9LA 5EQSA 3KQEA 2BDYA 2ZFQH 1DWDH 1EZSC 3S9CA 3UR6A 1PPGE 3PO1C 2TGPZ 4NWKA 4YOJA 2VWLA 4AGJA 2GP9B 2SFAA 2J94A 1EB1H 1RIWC 1D6RA 1AVXA 1LPGB 1UVOA 1EB2A 3BG4B 4NIVA 1PQ5A 1V2NT 2QA9E 3ZV9A 4K3JA 3RXPA 1NESE 1HAOH 2F9BH 5F53A 4ABBA 2F3CE 3RC4A 2R2WU 2R2MB 2Y5HA 3ZVCA 2DE8A 4B73A 1VJAU 4K8YA 4I7YH 4Q80A 4XSKU 1K28D 2KZ4A 1YCPH 2R3YA 1V6DA 5DP9A 4NZQA 4KTSA 1GBKA 1VITG 4HG6A 4UE7H 2WHXA 1TB6H 2ZGHA 1Y8TA 1LDTT 4X6MA 1DWEH 4MQAA 1PPBH 4AG2A 2ALVA 1Y5BT 2PSXA 1T8OA 1O2JA 1Y3YA 1K1OA 3QTVH 3SGAE 2BY5X 3GCOA 4OGXA 1WTGH 5EIYA 2W26A 3QZRA 1VGCB 1DWCH 2ODPA 1ZHRA 1O2VA 3GCNA 4MPWA 4ZKRU 1ZTLA 5LPFA
chains in the Genus database with same CATH topology
4FVDA 1F0RA 5F8ZA 2ZFTA 2VVUA 4DW2U 1H9IE 1LCYA 5FXLA 4THNH 5LH8A 4NG9H 4Y8YA 4TWWA 3SNCA 4INLA 2HPPH 2HOBA 3F6UH 1MCVA 1OSSA 1C1VH 4IN2A 1BCUH 3AASA 5EXMA 1NRRH 4X6NA 2FOAA 2BDBA 3TK6A 1V2QT 3BF6H 3O8DA 2AERH 1BDAA 1NFWA 3TPIZ 1O2LA 2QY0B 2FS9A 2IOTA 1O3BA 1XUFA 9LPRA 3A8DA 1SGFG 2TIOA 1WBGB 2CHAC 1SLUB 3LGUA 1AMHA 3P8GA 1O5FH 3UIRA 1DT2A 1GVKB 1NFXA 1OWEA 1ARCA 1G32B 4BOHA 1A3BH 3LH3A 1OWHA 5HXFA 3RM0H 1MAYA 3M5OA 4ISOA 2ZDKA 2GCHG 2XW9A 1HV7A 2A2XH 3QX5H 4OS6A 1O35A 3S0NA 1BTWA 3PB1E 5DG6A 1ZPZA 1W10U 1C5LH 5EU8A 1QA7A 4A6LA 4GHTA 5GXPA 3QWCH 1C5XB 1SGRE 2P3UB 1FJSA 1A3EH 1EP5A 1T8NA 1FY3A 5FX6A 3BEUA 1SGTA 4U30A 4BANB 4ZAEA 5DK1A 1ESBA 4DURA 4X2YA 3EE0B 5E0HA 1O0DH 1UHBA 3V0XA 2PKAB 3S9BA 1SGDE 1NO9H 3SN8A 5F03A 1EJMA 1HPGA 2A4RA 1YKTA 1LHGH 5DPAA 2BD7A 3SU4A 1DSUA 1HAZB 1MUEB 5JPMH 1HAYB 1RS0A 4X6OA 4DJZB 2FI4E 2A5IA 4WMFA 3ZVFA 5A8YA 1HDTH 4NIYA 4AGKA 4AOQA 1F5LA 2KAIA 4D9QA 1H1BA 2JETC 1GG6B 1GHYH 2W5EA 1TRMA 3UUZA 1GGDB 2YNBA 2BLVA 4D76A 1BTYA 4Q7ZA 4WWYA 2O8MA 2QC2A 2XBXA 1SGFA 5EXNA 5L30H 4SGBE 1SVPA 2TBSA 3Q00A 2ZKSA 1DDJA 3ZZ3A 1KXDA 1K1MA 5A8ZA 1SG8B 3FAOA 1PPHE 1Z8JB 4FUJA 2UWLA 1C1UH 1YF4A 1J17T 2G4UA 1GBDA 4H6SB 4X8UH 3GCTG 1MTVA 1PPFE 2BB4A 1N8OC 2QXGA 5DJ7A 3LGTA 2Z9JA 4I8JA 1C5VA 1GHBG 1O37A 3P8FA 4INKA 4NFFA 1A0LA 4LK4A 3VGCC 4XOJA 3UFAA 3HGPA 4OS2A 5C1UA 2PGBB 3MNCA 1J15A 4JYTA 2A4OA 2ZI2H 3E16B 4KGAA 2BLQA 4WXIA 3N7OA 1Z1IA 3TH2H 6GCHG 1BMAA 2ZU1A 1A5IA 1BJVA 1GJCB 1P8VC 2AYWA 2PWXA 1NY22 1GMHG 1QBNA 3F9EA 1LHFH 3SORA 2A7CA 2WPKS 2WINI 3JZ2B 2V0BA 3GY4A 4AN7A 3U1JB 7ESTE 1GBHA 4XBDA 1AB9B 4RKJB 2GVFA 4ASHA 2VINA 1O3FA 3SOSA 1GJ4H 2UUYA 1EQ9A 1CT4E 1KLTA 2WV5A 1O2HA 1FONA 3QGJA 2BDGA 1UTJA 1SHHB 3PM3A 3A82A 2FI5E 2F9PA 2OC8A 1HJAB 4DG4A 2BM2A 1QFKH 1EOJA 3VB5A 1C9PA 2VWNA 1NT1A 3MH6A 3A7VA 5A2MH 1ELGA 5F6MA 2BXUH 1D4PB 3NPSA 1ZHPA 5C1YA 2JH0D 1YPEH 1G2MA 2IPHA 3LC3A 1GI7B 3Q3KA 4K1SA 1P9SA 2C4FH 2ZU2A 3GY8A 2TGTA 2PUXB 1ELDE 2NU1E 3V3MA 4OS4A 1TGSZ 1EX3A 2D26C 2FI3E 1U6QA 1SMFE 1O2IA 3LGIA 2UWPA 3RMNH 4OS5A 3H7OA 4FUEA 5DP3A 5AFYH 4AYVB 1O2YA 5JDUB 5C5NA 2Y7XA 4AB8A 2BZ6H 1DX5M 2BZAA 4FU8A 1UTMA 3RXSA 1GI4A 3B9FH 3OY5U 1E37B 2WV4A 5F8TA 2Y5FA 1C1NA 4FUIA 4Y76A 1C1TA 3CP7A 3C1KA 4FUFA 3A81A 3A7TA 1V3XA 1K1JA 1L4DA 1MD8A 1OWJA 1YYY1 1O3KA 2ODYB 2ZPSA 2ZDVH 1YPHC 5GIBA 3SJIA 1S6HA 4CH8B 1RJXB 2RA0A 1QURH 3T5FH 4ZKOU 4CRBA 4NA9H 1IQNA 4JZDH 4CR9A 2FOEA 3RXBA 5AFZH 3BTGE 1GHZA 4H6TA 2FESH 4FUCA 3TK9A 2CN0H 4GLYA 1TQ0B 1BITA 5GCHF 1QRZA 3T28A 2O9QA 3VB4A 3HK6B 3E8LA 1GI9B 1L2EA 2UWOA 1GI8B 1GJ8B 3BTWE 4BNRA 1Z8IB 2VIQA 1UJ1A 3SV9A 3A8AA 1AKSA 1O34A 2QXIA 1GMDG 2G8TA 4E7RG 2R9PA 3D23A 2GDEH 2GCTB 3PTNA 3ELAH 3P92A 1M9UA 4Q7XA 1GHAF 2H5CA 4D7FA 4A1VA 1NFUA 1C1RA 4NFEA 3SZNA 4I8LA 2BX4A 4NGAH 2ZFFH 1TBRH 3EAJA 4YESB 1C2EA 3TIUA 1G9IE 4Y79A 1KXCA 4IBLH 3U9AH 1BHXB 4SGAE 1AB9C 1ZOMA 1BTHH 5IYTA 3A7WA 2BY7X 1A2CH 1XKBC 1J9CH 1PYTD 1W11U 3SU6A 2A0QB 2ZP0H 5L6NH 1LPKB 2EI7A 1GJDB 3AAVA 5EGMA 1UMAH 2ZQ2A 1P9UA 2NU0E 1AD8H 1VJ9U 3GY3A 2OC1A 2PTCE 2QGRA 2PLXA 1C5OH 1TX7A 1OOKB 1NTPA 2FOBA 5JBBS 1MQ5A 1V2OT 1JWTA 3EA8A 2G55A 1O2QA 1YLCA 2ZU3A 1FIZA 4MPUA 2FEQH 1SLXB 5LGOA 1UTKA 1MKWK 1CHOG 4CREA 1SGYE 1W0YH 1OWKA 2QAAA 3FANA 4YT6H 1O2GH 2IJOB 7GCHF 1NU9A 3Q76A 2VIVA 1GI5A 5AVDA 3ZZ5A 1J14A 2WPMS 4Y8ZA 3RU4D 1Z8GA 1N1LA 2AIQA 3FP6E 1UTNA 3MMGA 4O3TA 1C1MA 3FZZA 2PR3A 4I8HA 3D49H 4K1TA 1HXFH 2XBWA 2FX6A 2THFB 3E3TA 1F7ZA 3A84A 1GBBA 4RN6A 3S7HB 1A4WH 3MU4A 2ZFPH 3RXUA 3QK1A 1W0ZU 4BAQB 3RXAA 1LVOA 1O5CB 4ZHLU 3SU1A 4B2BA 3BSQA 1OP0A 2Y80A 2J38A 1L1NA 3UQVA 4NA7A 2F9UA 4X0WU 1GL1A 3NUMA 1CQQA 1GCTB 1K1NA 4MDSA 1C5WB 1TQ7B 4Q2KA 1KDQA 2BVSH 1V2JT 1VCQA 1IQMA 5K7RA 2QF3A 5JBCS 4NA8A 1EAXA 1BTPA 1WYKA 3GISB 1WQVH 1NRPH 2BDCA 4CRGA 2BY6X 1S83A 2BOKA 5DP6A 1AVGH 2F9VA 1HFDA 1RTKA 1YPKH 1W2KH 1HAVB 5E2PA 5CE1A 3MH4A 1BOQA 5EG4A 2Z7FE 1HAHH 3ZVDA 5AF9H 3STIA 1O2UA 3LOXA 1TNJA 4X2VA 4Z0KA 4ABGA 5A0BA 4K69A 2B0FA 3MNSA 2BMGB 3PMBB 5TCCA 3QTOH 1BRCE 3T27A 1EASA 2OXSA 3SUEA 3ODFA 1S0QA 3A86A 1F92A 1O32A 4BTUB 3VPKA 3SV6A 1Z71A 2PFEA 3ATLA 5EXLA 2ZG0H 1FPHH 2F83A 3SU5A 3URCA 3QLPH 1E0FD 1XX9A 3TJNA 1EZUC 5A0CA 2SGAA 5FCRA 2ZCHP 1V2ST 1K1PA 1XUGA 3C27B 4O9VA 3T2NA 3GCHB 3F9HA 1D3DB 3A7YA 1MD7A 3P8OA 4HTCH 3T25A 1C5SA 3RXGA 5BPEA 5TCAA 1QJ1B 1Z8RA 1ZSLA 1LTOA 1CU1A 5DP8A 5C3NA 2BY9X 1GDUA 1D3QB 3E91A 2ZU5A 1LVMA 3DT0H 4OS7A 7LPRA 1TA6A 4X1QU 1QL9A 1NM6A 1JRSA 4Y71A 1LMWB 1TLDA 4ZMAH 4ZKNU 1CA0C 1AU8A 2OINA 1CA0B 1TFXA 2QCYA 4ABIA 4NSYA 4NZLA 1AWFH 3STJA 3SNEA 1ZMJA 2PW8H 3HKJB 1GMHF 4RKOB 1J8AA 4TWYA 3ESTA 1O3IA 2O8TA 1XXFA 3RXCA 1SQOA 1KTSB 2A7HA 1DLEA 3MO9A 1BIOA 4DCDA 4MNVA 3PWCA 1YPJH 4DIHH 1HXEH 2FPZA 3AAUA 1GBCA 8KME2 1PPCE 1WAYB 1ARBA 3SNBA 2ZF0H 4DY7B 4HZHA 4FUDA 3GY6A 2P8OC 4ZROA 1LHEH 5A8XA 4JZFH 1O2TA 2J95A 3S69A 4FXGH 3HGNA 3GCHC 1DUAA 3OX7U 5CHAB 2GX4A 4A92A 1UTOA 2J34A 4MPVA 1C4V2 5GDSH 3DFJA 1P12E 3KF2A 1BA8B 1XUKA 3ZVGA 3ZYDA 1GDQA 2SGFE 1GCDA 1GL0E 1MTUA 4ABJA 2GDDA 1OKXA 1X7AC 1C2LA 1T4UH 1OYQA 5I46H 2C90B 2CXVA 2FOFA 1W7XH 1DITH 1MQ6A 2VVVA 3SUDA 2QF0A 1AFQB 1C2DA 2J9NA 3PLBA 1XM1A 3R0FA 3OTJE 1SQAA 1FMGA 3TGIE 2GZ7A 1Y3VA 2OTVA 3M35A 1YPHE 1EPTB 1HRTH 2Y6TA 2XCNA 4YOIA 1HJ9A 3LU9B 1UVTH 1Z7KA 2ZWLH 3NWUA 1TPPA 2XC0A 1ETRH 4MLFB 4D9RA 3TNSA 1T4VH 1ABIH 2XTTB 1GHBF 2ZCKP 1TYNA 5EQRA 1BB0B 3URDA 1GJ9B 1QBOA 3BIVH 2BD3A 3RP2A 5ESTE 8GCHG 1MKXK 1HIAA 1GBAA 3ATIA 3MH7A 5EQQA 5A09A 5AHGH 2NU3E 4HGCA 2FTLE 1EZXC 2WYJA 6CHAB 1FN6A 3EDXB 1DWBH 3SV7A 2ULLA 3GY7A 1DSTA 5FCKA 2W3IA 1SC8U 1D3TB 3UOUA 2ZFRH 1MCTA 3SO3A 3MNBA 4GPGA 2OQ5A 4NWLA 4JCNA 1TX8A 2H1UA 1HBTH 3LGWA 1AGJA 1C2KA 2C3SA 3EA7A 5FPSA 1WU1A 2SGDE 1JMOH 2GGVB 3OYPA 3UR9A 1S82A 3IWMA 2BD5A 4GSOA 2BY8X 3D65E 1EXFA 1ZLRA 4X2XA 1RTLA 1Y5UT 1WTHD 1GJ6A 1KDQB 1A61H 3MYWA 2ZTYA 2G81E 2BQ6B 3ODDA 1HLTH 2A32A 2ZPRA 3T62A 1BMMH 2C8ZB 1YLDA 1FXYA 2ZPQA 1ZJKA 1XUIA 1O30A 1EAUA 3L33A 2WPIS 2H5DA 4MTBA 1F0TA 1CT0E 3NZIA 1ELAA 4INHA 2GMTB 3MU5A 4Z6AH 2RDLA 4UFGH 3UNSA 1C1OA 1GBEA 3DHKH 2QXJA 4DGJA 2XBVA 3CS7A 5T6FA 1TNLA 2CF9H 2Z9GA 1MKWH 1ZGVA 4FVBA 1IOEA 3SQEE 3RXDA 1IQIA 1JXPA 3ZVBA 2FODA 1BRBE 1BZXE 4K1EA 2O8UA 1FUJA 4K2YA 1HAPH 2R3UA 1UVUH 4JZEH 1A1RA 3BTFE 3GDUA 3VB6A 3GDVA 4ISIH 1LKAA 2GD4B 3NKKA 1THSH 2ZQ1A 2ZTZA 3Q3YA 5K0HA 2ZHDA 4YM9A 3RXOA 1KLJH 3E0NB 1A5HA 2Z9KA 1PJPA 4J2YB 4CRAA 1LO6A 1LPZB 2WPLS 3ZVAA 5GCHG 1P2OA 4LOYH 3VB7A 3VEQB 1GWAA 2GCTC 2ZGBH 2VH0A 2C8WB 2Z3CA 2AGGX 1CBWB 1TBQH 1MTSA 4ZHMU 1Y3UA 1CGIE 3O8CA 1F0UA 1E35B 2GT8A 3ZZ8A 3ZVEA 1QCPA 3BTHE 1P04A 3IG6B 2PTNA 2ZGXH 3UNRA 3TK5A 4NCYA 3RXTA 3MU1A 1O2WA 1MBQA 2PKSC 3MH5A 3SUFA 4YZUA 5HGGA 1GCTC 2ZIQH 1K1IA 2VU8E 3BV9B 4PROA 1GVLA 2AFQB 2BD8A 2BHGA 8ESTE 2ZGJA 4CHAB 4JMYA 1GI1A 1G3BA 5BRRE 4GUXA 1YPGH 3RC6A 4YTAA 1JRTA 1BHXF 5CHAC 1SFIA 1K22H 1VCWA 2PSYA 4Q7YA 1P3CA 4BAHB 2OUAA 1QR3E 3E1XB 1AZ8A 3BG8A 2LNCA 4AG1A 1RD3B 2M5TA 3HATH 3GCTF 1FQ3A 1Z6JH 2P3FH 3DA9B 1O5GH 4GCHG 2GTBA 2RA3A 1IQLA 4ESTE 1ZZZA 4KELA 1GBMA 5JBTA 3O8RA 1ANDA 4E05H 1OX1A 1FN8A 2J4IA 5E0GA 3GY2A 2HALA 1TABE 2SGEE 2ANYA 1BBRH 1SLWB 1ID5H 1RFNA 1KSNA 5EW1H 1BMLA 3SJKA 2BTCE 3HKIB 1C1QA 5G4BA 1EJNA 5JYIA 1P0SH 1A46H 4U32A 1V2PT 1C1SA 7KMEH 4IS5A 5GJ4B 2FP7B 1C5QA 1AIXH 1XUJA 1L0ZA 1TOCB 2RCEA 1QRXA 1E34B 1NZQH 1NS3A 3UY9A 2PV9B 3TITA 5C2ZA 3BTEE 1HIAB 3KCGH 3KNXA 2Q6DA 1Q3XA 4OS1A 1YCPK 2G5VA 1QIXB 3GY5A 1ZPBA 1P2IA 3BN9A 1MMJN 2W7SA 1AI8H 2P94A 1GMCF 4LXBH 1TWXB 2QIQA 2AMDA 2XRCA 1HB0B 1O2SA 1O36A 5J4SA 3RXJA 1TOMH 1IQEA 2QV1A 3GDSA 4AB9A 1ZTJA 3P6ZB 1V2RT 4WVPE 1ORFA 2BD2A 4I31A 1OYTH 4XFQA 2GZ9A 1TGCA 1FY4A 1G2LA 2AIPA 1SR5C 5T3HA 1VITF 1PQ7A 1O2MA 1C2GA 3SNDA 1QBVH 2G5NA 5TJXA 2WPHS 4O3UA 1S5SA 1GJBB 1P2MA 1W7GH 4ISNA 1CE5A 1DY9A 4Y0ZE 1DANH 3MOCA 2W3KA 4XBBA 1ZSKA 1WQSA 3PMHB 1YPMH 1PPZA 1BTUA 1HNEE 4H4FA 4XDEA 1EATA 2JETB 2G52A 4KTCA 5A0AE 1CT2E 2VWMA 3F9FA 3HK3B 1MAXA 3IITA