1QNJA

The structure of native porcine pancreatic elastase at atomic resolution (1.1 a)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase (serine protease)
molecule keywords ELASTASE
publication title Atomic Resolution Structure of Native Porcine Pancreatic Elastase at 1.1 A
pubmed doi rcsb
total genus 58
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1999-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qnjA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qnjA01
4Y11E 1FJSA 1A7SA 2VGCC 1MTWA 1LHEH 3LJOA 4NFFA 3VB6A 1EZXC 4RN6A 3SU5A 4FXGH 2FOFA 2XXLA 4DJZB 1C9TA 1K1NA 4XBBA 1P2JA 1T4UH 2B0FA 2UWOA 4D8NA 1MD7A 1A3EH 2SGQE 2Q6DA 2AIPA 1AVGH 1FDPA 1KDQA 4XOJA 1ESBA 3TITA 5C3NA 4A92A 4U30A 1WV7H 3V3MA 1O3JA 3M36A 3TIUA 1E34B 1NO9H 1S85A 2BMGB 2P16A 4UE7H 3PMHB 2R0KA 1O3GA 1C2IA 1ELFA 4X8SH 1FUJA 1Z6EA 1ZYOA 3SGAE 3UY9A 3IG6B 1GDNA 1NRNH 4ABDA 4Y8XA 1WTGH 1D6RA 5E0JA 1S6HA 1GDQA 1H9HE 5L2ZH 2EI8A 1CU1A 1YLDA 3ZVFA 1LVBA 3BTQE 3KQEA 1VGCC 5BRRE 4E7RG 2G51A 1Y5UT 1Z7KA 4GUXA 1W3CA 2GV7A 1G37A 3NWUA 3GDUA 4ISIH 1SVPA 1DWDH 1GMHG 1XUGA 4AFZA 4UONA 2FX4A 2CXVA 1HV7A 4K1EA 2XRCA 2C3SA 1O2YA 2RCEA 5ABWA 2GV6A 4YT7H 1WU1A 2VVUA 4DY7B 1AIXH 1DWCH 1TOMH 1GJDB 2OQ5A 5JB8S 1BA8B 1SOTA 1BTPA 3A7ZA 4FU8A 3P70B 4B2CA 2AMQA 4DGJA 1GJAB 1Y3VA 1M9UA 1KXAA 4U01A 2D26C 1SL3A 2HGTH 1FY3A 1FONA 2AEIH 2A45B 4X1QU 2RDLA 1T8OA 1AUJA 1P0SH 1GJ8B 1LPZB 1DXPA 4JYUH 3VXEH 1GMCG 2BVSH 1CA0C 4YTAA 3RU4T 3GOVB 2YNAA 1OWJA 2FI4E 2ZDKA 6GCHG 1BZXE 1YLCA 2QYIA 2VNTA 2ZTZA 3T62A 4AB8A 3U8TH 1O3FA 1FI8A 1ZTJA 1O2QA 2STAE 1EAUA 3BEIB 2ZCLP 1O36A 3LKWA 1GVZA 4LZ4B 4XE4A 1OP0A 1CT0E 1C2FA 3IITA 4RSPA 4O97A 1HBTH 1ZLRA 3PWBA 2HALA 4K5ZA 1XUKA 1ELBA 1BQYA 3TLOA 4CHAC 1MTNC 1ZGVA 3ZVDA 1O2UA 1CBWB 1ZHRA 4NFEA 4BAKB 2VWLA 1IQGA 4Q2KA 1HAVB 4D7FA 4PROA 1VITH 2FOMB 4X2YA 5JB9S 1BTWA 3QK1A 5HYOA 5E2OA 4ZKOU 1A5IA 1FXYA 3HK3B 3A85A 2XC5A 1ARBA 1L2EA 2ANYA 1UMAH 5E8EH 2ZPQA 1SMFE 1ZTLA 1EJAA 1QBVH 3BG4C 1F0SA 2A5IA 3M7TA 1CE5A 4Y6DA 1BMNH 3MWIU 2AFQB 3E3TA 2ZA5A 2AERH 1IHTH 1A2CH 4NA7A 3TVJB 2FOGA 4FUFA 2BB4A 1PPHE 3PROA 4J1YA 3U69H 4YM9A 1C2LA 2TRMA 1DLKB 4E05H 1QCPA 1C5ZB 1D3TB 2J38A 2C8WB 1GBMA 1DLEA 3U98H 3ZZCA 3SU3A 1GBDA 3M37A 1GHAG 1O5BB 3VGCC 4I8JA 3I77A 5GPIB 1GHBG 1WQVH 4E7NA 1WQSA 5EPYA 3UWIA 3TH4H 1GI9B 2A5KA 3RXQA 2BQ6B 1HB0B 2XBVA 3BTME 3GISB 3EGKH 1AGJA 2Z94A 1C1NA 2HOBA 1C5TA 2ZF0H 2AMPA 2AMDA 1HAPH 1A0LA 1P2IA 1L1JA 2HNTE 2UUJB 4K3JA 1W7GH 3T29A 2VIPA 2Z3EA 2Z9IA 3T5FH 5A2MH 1CGIE 1O30A 3ZZ6A 3NKKA 4UFGH 1YP9A 1ZTKA 1DY8A 1LHGH 1OP2A 2JKHA 3E16B 4BAHB 3LC3A 1TPPA 1NROH 3HGPA 4U2WA 1RFNA 3LJJA 2BQ7B 4X1RU 5FXLA 3RXKA 4IN2A 1FY8E 2P94A 2J4IA 1C1OA 1H9IE 5C1YA 4THNH 1UK2A 1C1MA 3ZVBA 4X1SU 2DUCA 2ZGXH 3UNRA 1SLXB 1CHGA 1TPOA 1DUEA 2HNTF 2IOTA 1RTKA 1AFEH 4KELA 3ZVEA 1CHOF 5DG6A 3SU4A 3M5NA 2FYQA 2K1QA 1TABE 1TFXA 1O3BA 4H6TA 1NTPA 1DM4B 2BDGA 3RC5A 1FAXA 4AYVB 1O3MA 2GD4B 2ZP0H 1V2WT 2FOBA 1SLWB 5FHTA 5LH8A 1EASA 1HAHH 1WTHD 3GY5A 3P95A 1J15A 2FTMA 1QRWA 1DSUA 1TNHA 2XC4A 3ZZ3A 2OBQA 4B2BA 1A61H 1ID5H 2AIQA 4INHA 2PWXA 4R8TB 2G5NA 4AGJA 2TIOA 4MQAA 1FY4A 1Z71A 2QIQA 1ZHPA 2V3HH 2FOAA 2ZFTA 3MNXA 3RXPA 1BBRE 1Y3YA 2PKSC 2Z6BD 1YCPH 4TPIZ 3ZVGA 1TGBA 3OU0A 1MH0A 2F9OA 1VJAU 1DVAH 4MVNA 4AGKA 2B9LA 1Z6JH 2FXRA 3BEFB 4KGAA 4WY3A 3MU0A 2TGAA 1F7ZA 1GVLA 2FOEA 1Z8JB 2Y81A 4Y7AA 3UREA 3T28A 5I46H 4FUBA 3FFGA 5A09A 1HJAB 3D65E 4BOHA 3F6UH 1J16A 1BRUP 3A82A 4NWLA 3SV7A 5J4SA 3GY6A 1D3PB 4ZAEA 1UTMA 3VB5A 2EI6A 1EP6A 3UOPA 3VEQB 3ATWA 4MPVA 1AO5A 2ALVA 1O5EH 5L30H 5AHGH 2XYAA 2AGEX 1GI1A 3LT3A 5AFZH 5GCHG 1PJPA 2ZPSA 3STIA 1V2OT 5F6MA 2ZDLA 3GCHB 1FPCH 1O39A 3UUZA 1TMBH 4BAQB 2ZFSA 2XBYA 8ESTE 2HVXA 2GDDA 3TJUA 1JOUB 2ZHDA 1INCA 4AORA 3SV6A 1GHVH 1MBQA 3LPRA 2BX3A 5A8YA 3M5MA 3T2NA 1B7XB 1UTPA 1D4PB 4BAMB 3VB7A 3STJA 4YT6H 1E35B 1O3HA 4IBLH 4I31A 5A0AE 1V2PT 3SBKA 2BLWA 1SHYA 1SGPE 1J17T 1QL8A 4D76A 2OXSA 1CSOE 2FIRH 2VIWA 3FAOA 2LPRA 4AN7A 2TGPZ 2CHAC 3QZRA 1MAXA 1WAYB 3SQHE 1SSXA 3A88A 3QO6A 4CR5A 1ZJKA 3QTOH 5H4IB 2OTVA 1T8LA 1O38A 1LPGB 2ZHEH 2O8LA 1YF4A 4D9RA 1W11U 1ETTH 3ITIA 2BY9X 1ETSH 2BZ6H 2P8OC 2VIVA 3MO3A 1FIWA 1AN1E 1P9SA 1OWIA 1SGFG 4ABBA 2HWLB 1MMJN 1P2KA 1TGSZ 4CBOA 1K1OA 1ZMJA 2BDHA 2BVXH 1GHBF 4AYYB 1K21H 1C4Y2 3UQVA 2TGDA 2ZQ2A 1HXFH 4FUIA 4JYVH 2XNIA 4WJG2 2GMTB 2NU3E 4GAWA 2FYRA 1YPGH 1DFPA 2J95A 5FBEA 4CRBA 5LGOA 1TONA 1TQ0B 3GY2A 4HFPB 1N6XA 1N8OC 1EAXA 3ZZ5A 5DP9A 4A1TA 2R3UA 3UNSA 1TE0A 1JWTA 4MTBA 1TGNA 2ZFPH 2STBE 3Q3KA 1TBZH 2FPZA 4KP0A 2XBXA 4ZHAA 3RMLH 2B8OH 1NN6A 2ZCHP 3EA9A 1W14U 2FDAA 2PTNA 1FN8A 2VVVA 1IQHA 2XC0A 3SQEE 3SJ8A 3K6YA 3KL6A 4XFQA 3GDVA 1XMNB 3SNCA 4OS6A 1MTUA 1HGTH 5A0BA 1ZMNA 5PTPA 2A4GA 3LGWA 4OGXA 3BTEE 3C1KA 2FOCA 5F03A 2NU1E 1KXFA 1XVOA 4BXWA 4B74A 1EX3A 3LONA 3PLBA 3ZYEA 3CS0A 1EZUC 3MOCA 1YPHC 1QGFA 2ALPA 2ZI2H 2P3TB 1MU6B 1SOZA 1FY5A 1GBFA 1AKSB 1CQQA 4YOJA 1P11E 4BXSA 1O2ZA 1KLTA 1QB1A 2DE8A 3CP7A 4X1PU 2C93B 5SGAE 1SC8U 2JETC 3Q00A 3K6ZA 2TBSA 5ETXA 5T3HA 1MTVA 1W12U 3AW1A 3SUFA 1BOQA 2BY7X 2SGPE 1LDTT 2G4TA 1FMGA 3F1SB 1T4VH 1E0FD 2BD7A 1O2NA 2WV5A 2AS9A 1GL1A 1OPHB 2ANMH 1TGCA 3N7OA 3KQCA 3BIUH 3JZ2B 3FP6E 2FP7B 1O2JA 3TJNA 3AASA 2OC1A 3FVFB 4DIHH 1ZPZA 1AWHB 2R2WU 4YLQH 5GCHF 3RXFA 2ZQ1A 1G3EA 4FUEA 1AKSA 1C5QA 2I6SA 1EZQA 3O8BA 1KLJH 3SZNA 3ZYDA 1GCTC 5LPEA 1TX7A 1JMOH 1O2RA 1NESE 4IMZA 3HPTB 1BTHH 1UTLM 1GGDC 5AVDA 4BTTB 2HPPH 3B9FH 1V2KT 3S9AA 1O2OA 4HGCA 2ZU4A 1VZQH 2PW8H 5EG4A 4NWKA 1SGYE 3PMAB 2BHGA 1HCGA 1EPTB 4O03A 1ZRKA 3S9CA 1W2KH 1DXWA 2JH0D 3UQOA 1T7CA 2DE9A 1D6WA 1SPJA 3E0NB 5EW1H 2PGQB 1TPSA 1GG6B 1O3IA 8GCHF 2VH6A 1EJMA 1G2LA 1V2MT 1ELTA 3PB1E 4KTCA 1KYNA 2QC2A 3F9EA 3BF6H 3P8NA 5F8XA 1O2GH 1Y5BT 3V7TA 3MH4A 1UCYE 2BD4A 1A3BH 2W26A 3K65B 7LPRA 3W95A 2NWNA 2H2ZA 2G00A 3A8BA 4RKJB 1N1LA 3KCGH 1AI8H 1B0FA 1MTNB 1QJ6B 1OWHA 1DOJA 1SHHB 1C5UA 2SFAA 3P8OA 3P8GA 1EKBB 2ZNKH 2FLRH 1GI4A 3RDZA 3A8DA 1QIXB 3SV9A 1KTSB 2VWMA 1P3CA 4IC6A 1C2HA 3B8JA 5L6NH 3GCTF 3LGYA 1CGHA 1NY22 3MH6A 3BTHE 5C67A 1G2MA 1YGCH 3NXPA 2RA0A 1CHOG 2R2MB 3ZZBA 7KMEH 4FUHA 1O3EA 3PTBA 1RS0A 2PLXA 3A86A 2F3CE 1C2DA 1AB9C 1ZSJA 1AE8H 5TJXA 1GHWH 3SU2A 1AVXA 1O37A 1GCDA 3P92A 1LO6A 3B23B 2BD5A 2ZU5A 1FNIA 1PPZA 1C1VH 1SQOA 4BAOB 4HI3A 4ABJA 4WXIA 2AGIX 3SORA 3ODFA 5JBBS 4GLYA 5C1UA 1B5GH 1TA2A 2A1DB 4A7IB 3GY7A 1EOLA 1ETRH 1GJBB 4IC5A 2F83A 3RXOA 1O3CA 2F9UA 1UCYK 5ESBA 4IGDA 1PYTC 1OYTH 4FUDA 3FP7E 3SUGA 1P2QA 4ABHA 2P3UB 5EXMA 2CJIA 3R0FA 1OS8A 1W0YH 3TK9A 4E06H 2QA9E 3FP8E 2BOKA 1UHBB 3PYHA 1PYTD 4UFEH 3SHAH 2BX4A 1C5RA 3LH3A 3TNSA 3GY4A 2TGTA 6CHAB 3ZZ9A 3MU8A 1EOJA 2ZCKP 4A1VA 5C5OA 4MPWA 4MPXA 1B0EA 1Y8TA 1HAZB 1QRZA 2GCTC 1F0UA 3M3VA 1G3DA 3RC4A 3LDXH 4LZ1H 1GJ7B 4KKDA 1Z1IA 1F5LA 4VGCB 3KN2A 1SI5H 4ABAA 9LPRA 1O32A 1P2OA 1GJ4H 4YZUA 1IAUA 2BZAA 2RA3A 2OBOA 2G8TA 7ESTE 1UVSH 1Y5AT 4NIWA 4ISNA 4MNWA 2ZC9H 1JIRA 3T27A 1UTKA 1ZHMA 2BD2A 4X2WA 2ZFRH 4I33A 1IQFA 1C2KA 2A4QA 1MQ5A 1MU8B 3H7TA 1ZMLA 1L1NA 2ZHQH 1KIGH 3JZ1B 3RM0H 1C1RA 1IQLA 2GZ8A 1J9CH 4B2AA 1C5VA 1TYNA 2Z9LA 4NZQA 5A8XA 2Y5GA 5CHAB 1EATA 4MNVA 2SGFE 1HXEH 3U1IB 1GBHA 4K8BA 4ZKRU 1J14A 2BD9A 1ZPBA 3UFAA 2BDAA 3UTUH 1NC6A 1P01A 1FZZA 4ZMAH 3SJ9A 4FUGA 3ZVAA 4HZHA 1AU8A 1V2VT 1A4WH 1O2WA 2QXHA 1ESTA 4ZHLU 3RMNH 2ZEBA 1T8NA 1Z8RA 1O2TA 3HATH 3Q3YA 1QHRB 1HAVA 4YESB 2ANWA 5EQSA 1C1QA 2AH4X 1DX5M 3SV8A 2ULLA 1Y3UA 5EOKA 4I8LA 4D9QA 1LVMA 1W0ZU 1BTXA 3A7WA 3MH7A 1MKXK 1LCYA 1QB9A 2CMYA 1C2GA 5FPTA 1BB0B 5HM2A 5FX6A 1MAYA 3DFJA 4H4FA 4IS5A 1O5CB 3OX7U 1SFIA 4Q7ZA 5DGJA 1CA8B 4ABEA 3DFLA 1NS3A 1LTOA 1QJ1B 5FX5A 1TNLA 2QF3A 3BEUA 2W7UA 3HKJB 1QL9A 3KEEA 3G01A 2UWPA 2CHAB 2PHBA 4X6PA 2BXTH 4HTCH 1ABJH 1HUTH 1UVUH 1GI7B 1IQNA 2VINA 3L6PA 2WV4A 4IMQA 1HNEE 1KXEA 2FMJA 1Q31A 3NZIA 5C1XA 1ZR0A 3NPSA 1TRYA 2O8UA 4X8UH 3OY6U 3D23A 3V13A 1TWXB 4CRGA 2G4UA 2SGAA 2A32A 4OS5A 3SJOA 3VB4A 5HM9A 1YPHE 2H5CA 1C2EA 1OP8A 2IN2A 1C4U2 4X8VH 1MZDA 2F91A 4D7GA 1JIMA 2QF0A 4DT7B 4JCNA 4OS4A 3TJOA 1QB6A 1GHYH 1TGTA 2WUCA 1OXGA 5DP5A 4DW2U 3PMJA 2GZ7A 1BT7A 2H9TH 3BTDE 3M7UA 5LPRA 3RM2H 1C1SA 1CBWC 5DKMA 4WMEA 5HXFA 1G3CA 1HJ8A 2UUFB 1YYY1 2I6QA 4J2YB 2WYGA 4IN1A 3QX5H 1RJXB 2NU2E 2GCHF 1VJ9U 3PLKA 1P02A 1EUFA 4MDSA 1V6DA 1ANEA 1GJ6A 1DUAA 1UK4A 1BTZA 1WSSH 1L1GA 1CVWH 1NRPH 4INKA 1ELCA 1V2TT 4CREA 1H1BA 1C9PA 3TH3H 2V3OH 1AFQB 1HAYB 1S0QA 4AX9H 3BTTE 4ZHMU 1HIAB 1A5GH 4AG1A 5DJ7A 1O3PB 1AMHA 1BHXF 2G5VA 1W10U 1EXFA 2WPIS 3PM3A 1FIZA 3GICB 4O3TA 4A5TS 2Y6TA 4Q7YA 4GVUA 1RIWB 1ZJDA 2Y7ZA 2OUAA 1S83A 2SGDE 1NRSH 3RXEA 2G55A 1JBUH 4OS7A 1LHCH 2ZGCA 1DY9A 4B1TA 2R3YA 1E37B 8KME2 1MTSA 1DWBH 1S82A 3KQDA 1AUTC 1ARCA 5GXPA 2Z9KA 1GBKA 3MH5A 5DPAA 4ZXYH 3K2UA 5A0CA 2PKAB 3A7XA 3K9XB 4OS1A 1ZSLA 2CN0H 5EU8A 3RXCA 8GCHG 2FWWA 4LOYH 2B5TB 5HMAA 2PR3A 3MHWU 4WWYA 4GCHF 4AFSA 1NM6A 4I32A 4NG9H 2BM2A 1VCQA 1VITF 3KF2A 6ESTA 3M5OA 5GJ4B 4CR9A 1K2I1 3TNTA 3TK5A 1ESAA 2H9HA 3RMOH 3ZVCA 2SNWA 3V0XA 1QL7A 1JRSA 2BLOA 3TH2H 1BUIA 3EQ0H 1GI5A 2QCYA 3AVZA 5E0HA 1AHTH 1G36A 2R0LA 1ORFA 4R0IA 3TPIZ 3NUMA 5T6FA 2OCVB 1TLDA 1FQ3A 1BRCE 3VB3A 5K0HA 4H6SB 1F92A 1MBMA 1X7AC 3GCTG 2PFEA 1P2NA 4UEHH 1K22H 2QGRA 4WH6A 4ESTE 1F0TA 3S0NA 3KQBA 1NT1A 4ZXXH 3ZV8A 5IDKA 2P95A 4X6MA 3ZZDA 2Z7FE 1DWEH 2ZU2A 1V2NT 3E91A 1PPFE 1GL0E 1THRH 2ZKSA 3CS7A 4B71A 3M61U 2QXIA 3AAUA 1AY6H 1IQEA 2H6MA 3QDZB 2Y82A 1HJ9A 3E90B 2PUQH 3Q77A 1PQAA 4DOQA 2JH5D 3URCA 1P05A 5FCKA 1OOKB 2RG3A 1C5YB 2KAIB 3VXFH 3A83A 4X2VA 1GI3A 1KLIH 5TCCA 2ZU3A 2LNCA 2FODA 1D3DB 1J8AA 1HAIH 4Z0KA 5CMXH 2ZDMA 2ILNA 2VGCB 2J2UA 1XXFA 2VJ1A 2FI3E 3QUMP 4WMFA 2THFB 1Q2WA 2ZDNA 5BPEA 2SGEE 3BSQA 5EGMA 2PUXB 4OS2A 1XKAC 2XCNA 1RD3B 1O2VA 1YBWA 1O33A 3RXIA 4NSVA 1ZGIA 1FPHH 2H5DA 1C2JA 1XUHA 4U32A 3GCHC 4NZLA 1LHFH 2HRVA 1NRQH 1SLUB 2O8TA 3UR6A 1BMAA 3S69A 2Z3CA 4ZROA 2BD8A 1FLEE 1SGCA 1MZAA 2ODQA 4ISHH 4XDEA 1KTTB 3LH1A 4BANB 5FAHA 1YCPM 1EAWA 2F9PA 3SJKA 2OC8A 7GCHF 4Y76A 4ABGA 1TNJA 3LGTA 2GGVB 1WCZA 3TGIE 1VGCB 1ZSKA 1V2QT 1GI0A 3O8DA 1GBBA 2BY5X 1G32B 2XCFA 3E1XB 1F2SE 2A31A 1HYLA 2XW9A 1QQUA 2HPQH 1QTFA 1JXPA 3A7TA 5ESTE 2F9NA 4TPYA 4CRCA 4DIIH 5F8TA 1JRTA 1C5PA 2C4FH 1XUJA 2F9VA 3V12A 1NFYA 1O2HA 4Y0ZE 1P04A 1GVKB 1MCTA 4MNXA 1G3BA 1S81A 3FZDA 1YPMH 4UDWH 3ZZ7A 1AWFH 2J34A 1T8MA 2A4OA 3EE0B 1GI6A 1D9IA 1GBTA 5JBAS 4Y8ZA 5GIBA 1ABIH 1UJ1A 4WF8A 3HKIB 1TMUH 1RGQA 4RKOB 4CH8B 4DG4A 1KY9A 2WYJA 1W13U 3W94A 3WY8A 5JPMH 2GMTC 1SLVB 3A80A 1YCPK 3ESTA 1CA0B 1O34A 1U6QA 4K60A 1GBEA 3HGNA 4UD9H 1NFXA 4XBDA 4ZKSU 1RTLA 2FESH 1C5NH 2ZTXA 3BN9A 1TRMA 2W5EA 3GYMA 1SG8B 4CRDA 2QXJA 4JZ1A 3QWCH 4YO9A 1O2KA 4Y79A 4A1XA 1HLTH 1YM0A 4CHAB 2M5TA 2YOLA 3D62A 1ANDA 1SGEE 5DP3A 3TGJE 3MU4A 1A0HB 1ANCA 1C4V2 2BDIA 2Q6GA 1H8DH 1E38B 1H4WA 1IQIA 2C8XB 5FCRA 1DS2E 3GY3A 1OKXA 1GJCB 3LU9B 4B75A 1S5SA 2G52A 3MMGA 1SBWA 4IW4E 3PMBB 1SGDE 5I25A 1EPTA 5AF9H 4XSKU 2G81E 1NPMA 1RTFB 4WMDA 2ZHWH 3BG4B 4I8KA 1QFKH 1HAGE 3SNEA 3SUEA 1PPBH 3OY5U 3FANA 2BDBA 1P03A 2BVRH 2V6NA 3SGBE 4QT8C 1WOFA 1QY6A 3SI3H 3RUOA 1MCVA 2Y5FA 2A7HA 3RXAA 2Z9JA 4MPUA 3QGNB 1TB6H 5HGGA 1ACBE 2ZO3H 3U8RH 5E0GA 3DHKH 4NGAH 2A2QH 3VGCB 4AG2A 3S7KB 2ANKH 3PLPA 4NSYA 1RXPA 2P3FH 4Y8YA 1VCPA 2VWOA 5DO4H 3RLWH 1XXDA 1PQ5A 3F68H 3MYWA 1SGQE 4AZ2B 1DE7H 4FVDA 1KXBA 1QNJA 1TQ7B 3PO1C 3I78A 1P57B 4INLA 3DUXH 3U1JB 1SGTA 2ZFFH 1SQTA 2O8MA 1GJ5H 3MO6A 4ABFA 1GHZA 4WXVA 1QQ4A 4LXBH 1DPOA 1LMWB 3E6PH 1O3AA 3P8FA 2C8YB 3MNCA 5EPNA 1QA7A 2FO9A 4YLUA 2FOHA 2GCHG 1F5RA 3U9AH 5J4QA 5IYTA 4X1NU 3RXJA 3SO3A 1BBRH 3RXDA 1K1JA 3MNSA 3SV2H 5E2PA 5T6GA 2BY8X 4M7GA 1E36B 3AW0A 2F9BH 1MUEB 1YC0A 2J9NA 1SGFA 1OWDA 2ZTYA 1BJUA 5C2ZA 5B6OA 3GCOA 4JZIA 3QGJA 2ZU1A 2QAAA 3DD2H 3UWJH 3QLPH 1C2MA 1C1PA 2GDEH 3MO9A 2ZGJA 1EPTC 2OQUA 4MLFB 3URDA 1TOCB 1CGJE 5A8ZA 4NA9H 4GSOA 1ELVA 2QV1A 4K2YA 1KXDA 5AFYH 2ZGHA 3A8CA 1GG6C 1NZQH 2XWBI 5G4BA 1BIOA 3GY8A 1LVYA 1BMMH 4Y10E 1F0RA 1OWEA 1QR3E 2BDYA 3BTKE 1LVOA 1P12E 5JDUB 1LHDH 2GT7A 5DP7A 1AVWA 4KTUA 2PKSB 1L0ZA 2H9EH 4F4OC 1UHBA 1QBNA 3GCNA 4YOGA 3LOXA 8LPRA 5JBCS 1BRAA 3SNDA 5C5NA 4GCHG 1G30B 1K9OE 1OWKA 4TYDA 1VITG 3S7HB 4FUJA 1GBAA 1BDAA 1GHXH 3S9BA 3M3TA 1O5FH 1NU9A 3M35A 2QN5T 2QY0B 3MU1A 1Q3XA 3ODDA 2Z3DA 4NIYA 1O5DH 5LPFA 1FN6A 2NU4E 3BTWE 1IQKA 1QRXA 4CRFA 3RXUA 2XBWA 2C8ZB 3O8RA 1THPB 4BNRA 3MI4A 1H8IH 1UTOA 2UUKB 4O9VA 3OTJE 4OGYA 3RXMA 3ATMA 3BV9B 3ELAH 4JMYA 3RMMH 1K1IA 3PTNA 3UR9A 3QZQA 4Y71A 3VFEA 2A5AA 1F5KU 1P10A 1C1UH 1YKTA 3RXHA 4TY6A 1HFDA 3RXGA 5CE1A 1Z1JA 3M5LA 1MQ6A 1W8BH 3UOUA 1TBRH 1GI8B 3T25A 4MNYA 1IHSH 1EB2A 1TX6A 3ATLA 4DVAU 3A84A 1MKWH 2Q1JA 3TJVA 9ESTA 1EP5A 1P8VC 1DITH 2VIQA 2B7DH 2OINA 4NCYA 1PPGE 1GBCA 2FS8A 4B76A 3A7VA 1V3XA 1DSTA 1O2IA 2GTBA 4GPGA 4XBCA 2YNBA 1ZPCA 2FS9A 1DT2A 4NIXA 1EQ9A 1PPEE 2ZWLH 1AZ8A 5DP6A 1XVMA 2EA3A 1TPAE 1Z8GA 1G9IE 2GX4A 3LGUA 4TY7A 4ZKNU 4F49A 3PWCA 5JBTA 1P3EA 1IQMA 1V2UT 1SGNE 1TALA 3BIVH 1TBQH 4Y7BA 4SGAE 3Q3XA 6CHAC 5JYIA 5EXNA 2FTLE 3RXRA 2A4RA 4DCDA 1ZOMA 3QN7A 2P8OB 2Y80A 4ZH8A 3SOSA 4ISOA 3T26A 3L33A 4NA8A 4K8YA 3MFJA 4X0WU 4JZFH 3U8OH 1T32A 2CF8H 1V2RT 3KHVA 1A1RA 1O2LA 4VGCC 1KSNA 3KGPA 1LQEA 3BG8A 1DDJA 4FU9A 5K7RA 2PGBB 4CRAA 4O3UA 3ZZAA 1TRNA 2OC0A 2UWLA 1N8OB 3SGQE 2W3IA 2BQWB 7GCHG 2BYAX 1KXCA 1NFUA 3BTGE 1LPKB 1P9UA 1WUNH 1GMHF 4Q80A 1PQ7A 2ODPA 5DP8A 3EDXB 3SJIA 3EA7A 2W7SA 1GWAA 1UO6A 3SN8A 2EEKA 1TNGA 2Z9GA 1GJ9B 2GT8A 4AB9A 2D2DA 1N6YA 1UK3A 1BTYA 2JH6D 1AQ7A 1WYKA 3RXSA 2OP9A 1UTNA 4DURA 1TNIA 3RXLA 5CHAC 3O8CA 3A7YA 3MNBA 1GBIA 2FEQH 1ELEE 3QTVH 4TWYA 5C20A 1GMDG 1C5WB 1NFWA 3GDSA 3SNAA 1O2SA 5GWZA 1UVTH 3E8LA 4ZUHA 3VPKA 3ATKA 1YPKH 1GMCF 1XM1A 2V35A 2VIOA 1S6FA 3H5CB 4SGBE 3NCLA 1L4DA 6GCHF 1UVPA 1QJ7B 1BTUA 2IPHA 2D1JA 4JZEH 1EZSC 2VWNA 6LPRA 4GHTA 2BDCA 5L2YH 2ZDVH 1P2MA 3TU7H 2R9PA 2AGGX 2OLGA 4I8HA 3F9FA 1ELGA 2JETB 4K1SA 2VVCA 2BLQA 4WH8A 4GHQA 4I7YH 4JZDH 3LGIA 1VCWA 1BHXB 1SGRE 4KTSA 1HAOH 1BITA 5GDSH 1QBOA 1Y3WA 3RU4E 2ZPRA 3A81A 1TNKA 1HIAA 1NU7B 2C90B 3BTFE 5F8ZA 3SU6A 1Y3XA 1YPJH 1BBRK 1V2LT 3RP2A 1C5SA 1VR1H 1Z8IB 2FM2A 2PSYA 4BTIB 1HRTH 1IOEA 4FVBA 1FY1A 1GBJA 1O2MA 5FBIA 1XUFA 3SUDA 3A89A 1GI2A 3SNBA 3FZZA 4FU7A 4TWWA 4K1TA 3RXVA 4CBNA 2V0BA 5EODA 1UCYH 1O2XA 1SR5C 1BMLA 3TGKE 2A7CA 1HAXB 4JK6A 1GCTB 3MTYA 1C5LH 1TIOA 1H9LB 3D49H 2ZECA 5TCAA 3UNQA 1OSSA 5EQRA 2BTCE 2ZHFH 2ZIQH 1ZZZA 2PKAA 4I8GA 3OYPA 1GHAF 1GGDB 1TMTH 5DP4A 1O31A 1S0RA 1C1TA 1AZZA 3DT0H 2WPKS 3DA9B 1EAIA 4BTUB 1MD8A 3EAJA 2WPHS 2GVFA 3RXTA 2SNVA 2HNTC 3P17H 1A5HA 2EI7A 1EB1H 3IWMA 1YPEH 3C27B 2EC9H 4H42U 4AOQA 4Z6AH 3A87A 1O3OA 1XUIA 2OC7A 2VH0A 3ATIA 2ZFQH 2TPIZ 1BRBE 2CGAA 3H7OA 2Y5HA 2WPJS 1CT2E 3RLYH 1HDTH 1P06A 2Q6FA 2IJOB 3M7QA 1HJAC 4LK4A 3E0PB 1SFQB 2BOHB 1EJNA 2FI5E 3SU0A 1K1LA 1QURH 2O9QA 3OSYA 3NK8A 4B73A 2VU8E 1DICA 4X6NA 2CF9H 3RC6A 1AE5A 3SI4H 3UIRA 1UTJA 2WPMS 5FPSA 3ZZ8A 2WPLS 1AFQC 4A6LA 3GYLB 2PSXA 3Q76A 2GP9B 4JK5A 3RXBA 1BCUH 3SU1A 2BLVA 4WVPE 5EW2H 1C5MD 4YOIA 3AAVA 5DK1A 2UUYA 2J94A 1IQJA 1L4ZA 2GZ9A 1O0DH 1A0JA 3M3SA 2BXUH 2BY6X 2FZZA 2OD3B 1RIWC 3ZV9A 1O5GH 4Q7XA 3LIWA 2D8WA 4CH2B 2ODYB 2ASUB 1O3DA 1UTQA 2KAIA 4UFFH 1AB9B 2PV9B 3L3TA 3SW2B 1SB1H 2VB0A 1LKBA 3R3GB 1OYQA 2ZDAH 1MKWK 1W7XH 2P59A 1O3LA 3ENSB 1WBGB 1LKAA 1QA0A 4FUCA 2FX6A 4JYTA 4K69A 3CENA 1FAKH 1PPCE 1THSH 4ISLA 3F9GA 4UFDH 2ZZUH 1Y59T 1RRKA 1O3KA 3UPEA 3I29A 1XKBC 2ZG0H 1C1WH 2A2XH 3PO1B 3LC5A 1ZRBA 4AFQA 1GMDF 4ABIA 1MKXH 3HK6B 1C5OH 3KNXA 2PTCE 3ZZ4A 2J92A 4X8TH 1ANBA 2NU0E 1A46H 2AYWA 1UVOA 1LQDB 3F9HA 2ESTE 2XTTB 1S84A 2VIDA 2GKVE 2A7JA 2P93A 3MU5A 1HPGA 3P6ZB 1V2ST 2CV3A 1CO7E 2WINI 2H1UA 2Y7XA 4NIVA 1OX1A 1SQAA 1FV9A 1CT4E 1ELDE 1GPZA 5EXLA 1K28D 1GDUA 5EQQA 2QXGA 3LGVA 3TK6A 4MG3A 1O35A 1KDQB 3A8AA 1V2JT 1YPLH 1K1PA 1PQ8A 2GCTB 2W3KA 1TAWA 1DANH 2XWAA 3KIDU 2A0QB 2O8WA 1T31A 1D3QB 1O3NA 2HLCA 1C5XB 1P09A 3SHCH 4X2XA 4Y0YE 2WUBA 5FPYA 1TX8A 4AFUA 2BD3A 5T6DA 4ASHA 2FLBH 3PV4A 1PFXC 1XX9A 1K1MA 1AD8H 1TA6A 1NRRH 1GBLA 3RU4D 1ELAA 1O2PA 1BJVA 3EYDA 4X6OA 1SGIB 2ZGBH 1O5AB 3EA8A
chains in the Genus database with same CATH superfamily
4Y11E 1FJSA 1A7SA 2VGCC 1MTWA 1LHEH 3LJOA 4NFFA 5C0TA 3VB6A 1EZXC 4RN6A 3SU5A 4FXGH 2FOFA 2XXLA 4DJZB 1C9TA 1K1NA 4XBBA 1P2JA 1T4UH 2B0FA 2UWOA 4D8NA 1MD7A 1A3EH 2SGQE 2Q6DA 2AIPA 1AVGH 1FDPA 1KDQA 2QF4A 4XOJA 1ESBA 3U28C 3TITA 5C3NA 4A92A 4U30A 1WV7H 3V3MA 1O3JA 3M36A 3TIUA 1E34B 1NO9H 1S85A 2BMGB 2P16A 4UE7H 3PMHB 2R0KA 1O3GA 1C2IA 1ELFA 4X8SH 1FUJA 1Z6EA 1ZYOA 3SGAE 3UY9A 3IG6B 1GDNA 1NRNH 4ABDA 4Y8XA 1WTGH 1D6RA 5E0JA 1S6HA 1GDQA 1H9HE 5L2ZH 2EI8A 1CU1A 1YLDA 3ZVFA 1LVBA 3BTQE 3KQEA 1VGCC 5BRRE 4E7RG 2G51A 1Y5UT 1Z7KA 4GUXA 1W3CA 2GV7A 1G37A 2WZQA 3NWUA 3GDUA 4ISIH 1SVPA 1DWDH 1GMHG 1XUGA 4AFZA 4UONA 2FX4A 2CXVA 1HV7A 4K1EA 2XRCA 2C3SA 1O2YA 2RCEA 2IPQX 5ABWA 2GV6A 4YT7H 1WU1A 2VVUA 4DY7B 1AIXH 3KQ5A 1DWCH 1TOMH 1GJDB 2OQ5A 5JB8S 1BA8B 1SOTA 1BTPA 3A7ZA 4FU8A 3P70B 4B2CA 2AMQA 4DGJA 5IK2D 1GJAB 1Y3VA 1M9UA 1KXAA 4U01A 2D26C 1SL3A 2HGTH 1FY3A 1FONA 2AEIH 2YMSC 2A45B 4X1QU 2RDLA 1T8OA 1AUJA 1P0SH 1GJ8B 1LPZB 1DXPA 4JYUH 3VXEH 1GMCG 2BVSH 1CA0C 4YTAA 3RU4T 3GOVB 2YNAA 5CHBA 1OWJA 2FI4E 2ZDKA 6GCHG 1BZXE 1YLCA 2QYIA 2VNTA 2ZTZA 3T62A 4AB8A 2YMSD 3U8TH 1O3FA 1FI8A 1ZTJA 1O2QA 2STAE 1EAUA 3BEIB 2ZCLP 1O36A 3LKWA 1GVZA 4LZ4B 4XE4A 1OP0A 1CT0E 1C2FA 3IITA 4RSPA 4O97A 1HBTH 1ZLRA 3PWBA 2HALA 2QE7D 4K5ZA 1XUKA 1ELBA 1BQYA 3TLOA 4CHAC 1MTNC 1ZGVA 3ZVDA 1O2UA 1CBWB 1ZHRA 4NFEA 3F0OA 2VWLA 1IQGA 4Q2KA 3UNQA 4BAKB 1HAVB 4D7FA 2JIZD 4PROA 1VITH 2FOMB 4X2YA 5JB9S 1BTWA 3QK1A 5HYOA 5E2OA 4ZKOU 1A5IA 1FXYA 3EE7A 3HK3B 3A85A 2XC5A 1ARBA 1L2EA 2ANYA 1UMAH 5E8EH 2ZPQA 1SMFE 1ZTLA 1EJAA 1QBVH 3BG4C 1F0SA 2A5IA 3M7TA 1CE5A 4Y6DA 1BMNH 3MWIU 2AFQB 2CK3D 3E3TA 2ZA5A 2AERH 1IHTH 1A2CH 4NA7A 3TVJB 2FOGA 4FUFA 4DT4A 5T1VA 2BB4A 1WXRA 1PPHE 3PROA 4J1YA 3U69H 4YM9A 1C2LA 2TRMA 1DLKB 4E05H 1QCPA 1C5ZB 1D3TB 2J38A 2C8WB 1GBMA 1DLEA 3U98H 3ZZCA 3SU3A 1GBDA 3M37A 1GHAG 1O5BB 3VGCC 4I8JA 3I77A 5GPIB 1GHBG 1WQVH 4E7NA 1WQSA 5EPYA 3UWIA 3TH4H 1GI9B 2A5KA 3RXQA 2BQ6B 1HB0B 2XBVA 3BTME 3GISB 3EGKH 1AGJA 2Z94A 1C1NA 2HOBA 1C5TA 2ZF0H 2AMPA 2AMDA 1HAPH 1A0LA 1P2IA 1L1JA 2HNTE 2UUJB 4K3JA 1W7GH 3T29A 2VIPA 2Z3EA 2Z9IA 3T5FH 5A2MH 1CGIE 1O30A 3ZZ6A 3NKKA 4UFGH 1YP9A 1ZTKA 1DY8A 1LHGH 1OP2A 2JKHA 3E16B 4BAHB 3LC3A 1TPPA 1NROH 3HGPA 2KM0A 4U2WA 1RFNA 3LJJA 2BQ7B 4X1RU 5FXLA 3RXKA 4IN2A 1FY8E 2P94A 2J4IA 1C1OA 1H9IE 5C1YA 4THNH 1UK2A 1C1MA 3ZVBA 4X1SU 2KCOA 2DUCA 2ZGXH 3UNRA 1SLXB 1CHGA 1TPOA 1DUEA 2HNTF 3FO8D 2IOTA 1RTKA 1AFEH 4KELA 3ZVEA 1CHOF 5DG6A 3SU4A 3M5NA 2FYQA 2K1QA 1TABE 1TFXA 1O3BA 4H6TA 1NTPA 1DM4B 2BDGA 3RC5A 1FAXA 4AYVB 1O3MA 2GD4B 2ZP0H 1V2WT 2FOBA 1SLWB 5FHTA 5LH8A 3OEED 1EASA 1HAHH 1WTHD 3GY5A 3P95A 1J15A 2FTMA 1QRWA 1DSUA 1TNHA 2XC4A 3ZZ3A 2OBQA 4B2BA 1A61H 1ID5H 2AIQA 4INHA 2PWXA 4R8TB 2G5NA 3SYJA 2TIOA 4AGJA 4MQAA 1FY4A 1Z71A 2QIQA 1ZHPA 2V3HH 2FOAA 3H09A 2ZFTA 3MNXA 3RXPA 1BBRE 1Y3YA 2PKSC 2Z6BD 1YCPH 4TPIZ 3ZVGA 1TGBA 3OU0A 1MH0A 2F9OA 1VJAU 1DVAH 4MVNA 4AGKA 2RFKC 2B9LA 1Z6JH 2FXRA 3BEFB 4KGAA 4WY3A 3MU0A 2TGAA 1F7ZA 1GVLA 2FOEA 1Z8JB 2Y81A 4Y7AA 3UREA 3T28A 5I46H 2EY4C 4FUBA 3FFGA 2F43B 5A09A 1HJAB 3D65E 4BOHA 3F6UH 1J16A 1BRUP 3A82A 4NWLA 3SV7A 5J4SA 3GY6A 1D3PB 4ZAEA 1UTMA 3VB5A 2J98A 4P00A 2EI6A 1EP6A 3CNRA 3UOPA 3VEQB 3ATWA 4MPVA 1AO5A 2ALVA 1O5EH 2XNDD 5L30H 5AHGH 2XYAA 1W0KD 2AGEX 1GI1A 3LT3A 5AFZH 5GCHG 1PJPA 2ZPSA 3STIA 1V2OT 5F6MA 2ZDLA 3GCHB 1FPCH 1O39A 3UUZA 1TMBH 4BAQB 2ZFSA 2XBYA 8ESTE 2HVXA 2GDDA 3TJUA 1JOUB 2ZHDA 5EJ1A 1INCA 4AORA 3SV6A 1GHVH 1MBQA 3LPRA 2BX3A 5A8YA 3M5MA 5GNDA 3T2NA 2W6JD 1B7XB 1UTPA 1D4PB 4BAMB 3VB7A 3STJA 4YT6H 1E35B 1O3HA 4IBLH 4I31A 5A0AE 1V2PT 3SBKA 2BLWA 1SHYA 1SGPE 1J17T 1QL8A 4D76A 2OXSA 1CSOE 2FIRH 2VIWA 3FAOA 2LPRA 4AN7A 2TGPZ 2CHAC 3QZRA 1MAXA 1WAYB 3SQHE 1SSXA 3A88A 3QO6A 4CR5A 1ZJKA 3QTOH 5H4IB 5HKKD 2OTVA 3PRBA 1T8LA 1O38A 2WHXA 1LPGB 2ZHEH 2O8LA 4OM9A 1YF4A 4D9RA 1W11U 1ETTH 2J5UA 3ITIA 2BY9X 1ETSH 2BZ6H 2P8OC 2VIVA 3MO3A 1FIWA 3OTPA 1AN1E 1P9SA 1OWIA 1SGFG 4ABBA 2HWLB 1MMJN 1P2KA 1TGSZ 4CBOA 1K1OA 1ZMJA 2BDHA 2BVXH 5DN6D 1GHBF 4AYYB 1K21H 1C4Y2 3UQVA 2TGDA 2ZQ2A 1HXFH 4FUIA 4JYVH 2XNIA 4WJG2 2GMTB 2KR7A 2NU3E 4GAWA 2FYRA 1YPGH 1DFPA 2J95A 5FBEA 4CRBA 5LGOA 1TONA 1TQ0B 3GY2A 4HFPB 1N6XA 1N8OC 1EAXA 3ZZ5A 5DP9A 4A1TA 2R3UA 3UNSA 1TE0A 1JWTA 4MTBA 1TGNA 2ZFPH 2STBE 3Q3KA 1TBZH 2FPZA 4KP0A 2XBXA 4ZHAA 3RMLH 2B8OH 3DSOA 3PV5A 1NN6A 2ZCHP 3EA9A 1W14U 2FDAA 2PTNA 1FN8A 2VVVA 1IQHA 2XC0A 3SQEE 3SJ8A 3K6YA 3KL6A 4XFQA 3GDVA 1XMNB 3SNCA 4OS6A 1MTUA 1HGTH 5A0BA 1ZMNA 5PTPA 2A4GA 3LGWA 4OGXA 3BTEE 3C1KA 2FOCA 5F03A 2NU1E 1KXFA 1XVOA 4BXWA 4B74A 1EX3A 3LONA 3PLBA 3ZYEA 3CS0A 1EZUC 3MOCA 1YPHC 1QGFA 2ALPA 2ZI2H 2P3TB 1MU6B 1SOZA 3WWFA 1FY5A 1GBFA 1AKSB 1CQQA 4YOJA 1P11E 2GJGA 4BXSA 1O2ZA 1KLTA 1QB1A 2DE8A 3CP7A 4X1PU 2K8IA 2C93B 5SGAE 1SC8U 2V7QD 2JETC 3Q00A 3K6ZA 2TBSA 5ETXA 5T3HA 1MTVA 1W12U 3AW1A 3SUFA 1BOQA 2BY7X 2XOKD 1COWD 2SGPE 1LDTT 2G4TA 1FMGA 3F1SB 1T4VH 1E0FD 2BD7A 1O2NA 2WV5A 2AS9A 1GL1A 1OPHB 2ANMH 1TGCA 3N7OA 3KQCA 3BIUH 3JZ2B 3FP6E 2FP7B 1O2JA 3TJNA 3AASA 2OC1A 3FVFB 4DIHH 1ZPZA 1AWHB 2R2WU 4YLQH 5GCHF 1H8ED 3RXFA 2ZQ1A 1G3EA 3KYFA 4FUEA 1AKSA 1C5QA 2I6SA 1EZQA 3O8BA 1KLJH 3SZNA 3ZYDA 1GCTC 5LPEA 1TX7A 1JMOH 1O2RA 1NESE 4IMZA 3HPTB 1BTHH 1UTLM 1GGDC 5AVDA 4BTTB 3N7EA 2HPPH 3B9FH 1V2KT 3S9AA 1O2OA 4HGCA 5KGOA 2YMSB 2ZU4A 1VZQH 2PW8H 5EG4A 4NWKA 1SGYE 3PMAB 2BHGA 1HCGA 1EPTB 3GS9A 4O03A 1ZRKA 3S9CA 1W2KH 1DXWA 2JH0D 3UQOA 1T7CA 2DE9A 1D6WA 1SPJA 3E0NB 5EW1H 2PGQB 1TPSA 1GG6B 1O3IA 8GCHF 2VH6A 1EJMA 1G2LA 1V2MT 1ELTA 3PB1E 4KTCA 1KYNA 2QC2A 3F9EA 3BF6H 3P8NA 5F8XA 1O2GH 1Y5BT 3V7TA 3MH4A 1UCYE 2BD4A 1A3BH 2W26A 3K65B 7LPRA 3W95A 2NWNA 2H2ZA 2G00A 3A8BA 4RKJB 1N1LA 3KCGH 1AI8H 1B0FA 1MTNB 1QJ6B 1OWHA 1DOJA 1SHHB 1C5UA 2SFAA 3P8OA 5C94A 3P8GA 1EKBB 2ZNKH 2FLRH 1GI4A 3RDZA 3A8DA 1QIXB 3SV9A 1KTSB 2VWMA 1P3CA 4IC6A 1C2HA 3B8JA 4B6FA 5L6NH 3GCTF 3F0PA 3LGYA 1CGHA 1NY22 3MH6A 3BTHE 5C67A 1G2MA 1YGCH 3NXPA 2RA0A 1CHOG 2R2MB 3ZZBA 7KMEH 4FUHA 1O3EA 3PTBA 1RS0A 2PLXA 3A86A 2F3CE 1C2DA 1AB9C 1ZSJA 1AE8H 5TJXA 1GHWH 3SU2A 1AVXA 1O37A 1GCDA 3P92A 1LO6A 3B23B 2BD5A 2ZU5A 1FNIA 1PPZA 1C1VH 1SQOA 4BAOB 4HI3A 4ABJA 4WXIA 2AGIX 3SORA 3ODFA 1MABB 5JBBS 4GLYA 5C1UA 1B5GH 1TA2A 2A1DB 4A7IB 3GY7A 1EOLA 1ETRH 1GJBB 4IC5A 2F83A 3RXOA 1O3CA 2F9UA 1UCYK 5ESBA 4IGDA 1PYTC 1OYTH 2KFWA 4FUDA 3FP7E 3SUGA 1P2QA 4ABHA 2P3UB 5EXMA 5EJZA 2CJIA 3R0FA 1OS8A 1W0YH 3TK9A 4E06H 2QA9E 3FP8E 4M9FA 3FOAA 2BOKA 1UHBB 3PYHA 1PYTD 4UFEH 3SHAH 2BX4A 3FKSD 1C5RA 3LH3A 3TNSA 3GY4A 2TGTA 2EQNA 6CHAB 3ZZ9A 3MU8A 3W1EA 1EOJA 2ZCKP 4HG6A 4A1VA 5C5OA 4MPWA 4MPXA 1B0EA 1Y8TA 1HAZB 1QRZA 2GCTC 1F0UA 3M3VA 1G3DA 3RC4A 3LDXH 4LZ1H 1GJ7B 4KKDA 1Z1IA 1F5LA 4VGCB 3KN2A 1SI5H 4ABAA 9LPRA 1O32A 1P2OA 1GJ4H 4YZUA 1IAUA 2BZAA 2RA3A 2OBOA 2G8TA 7ESTE 1UVSH 1Y5AT 4NIWA 4ISNA 4MNWA 2ZC9H 1JIRA 3T27A 1UTKA 1ZHMA 2BD2A 2IJD1 4X2WA 2ZFRH 5F53A 4I33A 1IQFA 1C2KA 2A4QA 1MQ5A 1MU8B 3H7TA 1ZMLA 1L1NA 2ZHQH 1KIGH 1EFRD 2RDEA 3JZ1B 3RM0H 1C1RA 1IQLA 2GZ8A 1J9CH 4B2AA 1C5VA 1TYNA 2Z9LA 4NZQA 5A8XA 2Y5GA 5CHAB 1EATA 4MNVA 2SGFE 3MQKC 1HXEH 3U1IB 3OEHD 1GBHA 4K8BA 4ZKRU 1J14A 2BD9A 1ZPBA 3UFAA 2BDAA 3UTUH 1NC6A 1P01A 1FZZA 4ZMAH 3SJ9A 4FUGA 3ZVAA 4HZHA 1AU8A 1V2VT 1A4WH 1O2WA 2QXHA 1ESTA 4ZHLU 3RMNH 2ZEBA 1T8NA 1Z8RA 1O2TA 3HATH 3Q3YA 1QHRB 1HAVA 4YESB 2ANWA 5EQSA 1C1QA 2AH4X 1DX5M 3SV8A 2ULLA 1Y3UA 4RT1A 5EOKA 4I8LA 4D9QA 1LVMA 1W0ZU 1BTXA 3A7WA 2VBCA 3MH7A 1K0HA 1MKXK 1LCYA 1QB9A 2CMYA 2PP6A 1C2GA 5FPTA 1BB0B 5HM2A 5FX6A 4AC9A 1MAYA 3DFJA 4H4FA 4IS5A 1O5CB 3OX7U 1SFIA 4Q7ZA 5DGJA 1CA8B 4ABEA 3DFLA 2QF5A 1NS3A 1LTOA 1QJ1B 5FX5A 1TNLA 2QF3A 3BEUA 2W7UA 3HKJB 1QL9A 3KEEA 3G01A 2UWPA 2CHAB 2PHBA 4X6PA 2BXTH 4HTCH 1ABJH 1HUTH 1UVUH 1GI7B 1IQNA 2VINA 3L6PA 2WV4A 4IMQA 1HNEE 1KXEA 2FMJA 1Q31A 3NZIA 5C1XA 1ZR0A 3NPSA 1TRYA 2O8UA 4X8UH 3OY6U 3D23A 3V13A 1TWXB 4CRGA 2G4UA 2SGAA 2A32A 4OS5A 3SJOA 3VB4A 5HM9A 1YPHE 2H5CA 1C2EA 1OP8A 2IN2A 1C4U2 2JJ2D 4X8VH 1MZDA 2F91A 4D7GA 1JIMA 2QF0A 4DT7B 4JCNA 4OS4A 3TJOA 1QB6A 1GHYH 1TGTA 2WUCA 1OXGA 5DP5A 4DW2U 3PMJA 2GZ7A 1BT7A 2H9TH 3BTDE 3M7UA 5LPRA 3RM2H 1C1SA 4Q4LA 1CBWC 5DKMA 4WMEA 5HXFA 2F4LA 1G3CA 1HJ8A 2UUFB 5FL7D 1YYY1 2I6QA 4J2YB 2WYGA 4IN1A 3QX5H 1RJXB 2NU2E 2GCHF 1VJ9U 3PLKA 3PRDA 1P02A 1EUFA 4MDSA 1V6DA 1ANEA 1GJ6A 4F48B 1DUAA 1UK4A 1BTZA 1WSSH 1L1GA 1CVWH 1NRPH 4INKA 1ELCA 1V2TT 4CREA 1H1BA 1C9PA 3TH3H 2V3OH 1AFQB 1HAYB 3UB0A 1S0QA 4AX9H 3BTTE 4ZHMU 1HIAB 1A5GH 4AG1A 5DJ7A 1O3PB 1AMHA 1BHXF 2KCYA 2G5VA 2LELA 1W10U 1EXFA 2WPIS 3PM3A 1FIZA 3GICB 4O3TA 4A5TS 2Y6TA 4Q7YA 4GVUA 3NRLA 1RIWB 1ZJDA 2Y7ZA 2OUAA 1S83A 2SGDE 1NRSH 3RXEA 2G55A 1JBUH 4OS7A 1LHCH 2ZGCA 1DY9A 4B1TA 2R3YA 1E37B 8KME2 1MTSA 1DWBH 1S82A 3KQDA 1AUTC 1ARCA 5GXPA 2Z9KA 1GBKA 3MH5A 5DPAA 4ZXYH 3K2UA 5A0CA 2PKAB 3A7XA 3K9XB 4OS1A 1ZSLA 2CN0H 5EU8A 3RXCA 8GCHG 2FWWA 4LOYH 2B5TB 5HMAA 2PR3A 2L74A 3MHWU 4WWYA 4GCHF 4AFSA 1NM6A 4I32A 4NG9H 2BM2A 1VCQA 1VITF 3KF2A 6ESTA 3M5OA 5GJ4B 4CR9A 1K2I1 3TNTA 3TK5A 1ESAA 2H9HA 3RMOH 3ZVCA 2SNWA 5HIZA 3V0XA 1QL7A 1JRSA 2BLOA 3TH2H 1BUIA 1SKYE 3EQ0H 1GI5A 2QCYA 3AVZA 5E0HA 1AHTH 1G36A 2R0LA 1ORFA 4R0IA 3TPIZ 3NUMA 5T6FA 2OCVB 1TLDA 1FQ3A 1BRCE 5CDFE 2J97A 3VB3A 5K0HA 4H6SB 1F92A 1MBMA 3F2FA 1X7AC 3GCTG 2PFEA 1P2NA 4UEHH 1K22H 2QGRA 4WH6A 4ESTE 1F0TA 3S0NA 3KQBA 1NT1A 4ZXXH 3ZV8A 5IDKA 2P95A 4X6MA 3ZZDA 2Z7FE 3AK5A 1DWEH 2ZU2A 1V2NT 3E91A 1PPFE 2JJ1D 1GL0E 1THRH 2ZKSA 3CS7A 4B71A 3M61U 2QXIA 3AAUA 2KCPA 1AY6H 1IQEA 2H6MA 3QDZB 2Y82A 1HJ9A 3E90B 2PUQH 3Q77A 1PQAA 4DOQA 2JH5D 3URCA 1P05A 5FCKA 1OOKB 2RG3A 1C5YB 2KAIB 3VXFH 3A83A 4X2VA 1GI3A 1KLIH 3KYGA 5TCCA 2ZU3A 2LNCA 2FODA 1D3DB 1J8AA 1HAIH 4Z0KA 5CMXH 2ZDMA 2ILNA 2VGCB 2J2UA 1XXFA 2VJ1A 2FI3E 3QUMP 4WMFA 2THFB 1Q2WA 2ZDNA 4TSFD 5EJLA 5BPEA 2SGEE 3BSQA 5EGMA 2PUXB 3F3BA 4OS2A 1XKAC 2XCNA 1RD3B 1O2VA 1YBWA 1O33A 3RXIA 4NSVA 1ZGIA 1FPHH 2H5DA 1C2JA 1XUHA 4U32A 3GCHC 3N99A 4NZLA 1LHFH 2HRVA 1NRQH 1SLUB 2O8TA 3UR6A 1BMAA 3S69A 2Z3CA 4ZROA 3FN8A 2BD8A 1FLEE 1SGCA 1MZAA 2ODQA 4ISHH 4XDEA 1H8HD 1KTTB 3LH1A 4BANB 5FAHA 1YCPM 1EAWA 2F9PA 4XRNA 3SJKA 2OC8A 7GCHF 4Y76A 4ABGA 1TNJA 3LGTA 2GGVB 1WCZA 3OFND 3TGIE 1VGCB 1ZSKA 1V2QT 1GI0A 3O8DA 1GBBA 2BY5X 1G32B 2XCFA 3E1XB 1F2SE 2A31A 1HYLA 2XW9A 1QQUA 2HPQH 1QTFA 1JXPA 3A7TA 4RT0A 5ESTE 2F9NA 4TPYA 4CRCA 4DIIH 5F8TA 4RI0A 1JRTA 1C5PA 2C4FH 1XUJA 2F9VA 3V12A 1NFYA 1O2HA 4Y0ZE 1P04A 1GVKB 1MCTA 4MNXA 1G3BA 1S81A 3FZDA 1YPMH 4UDWH 3ZZ7A 1AWFH 2J34A 1T8MA 2A4OA 3EE0B 1GI6A 4P02A 1D9IA 1GBTA 5JBAS 4Y8ZA 5GIBA 1ABIH 1UJ1A 4WF8A 3HKIB 1TMUH 1RGQA 4RKOB 4CH8B 5EIYA 4DG4A 1KY9A 2WYJA 1W13U 3W94A 3WY8A 2JDID 5JPMH 2GMTC 1SLVB 3F2GA 3A80A 3WWBA 4FOUC 1YCPK 3ESTA 1CA0B 1O34A 1U6QA 4K60A 1GBEA 3HGNA 4UD9H 1NFXA 4XBDA 4ZKSU 1RTLA 2FESH 1C5NH 2ZTXA 3BN9A 5DSFA 3WW7A 1TRMA 2W5EA 3GYMA 4Z1MD 1SG8B 4CRDA 2QXJA 4JZ1A 3QWCH 4YO9A 1O2KA 4Y79A 4A1XA 1HLTH 1YM0A 4CHAB 2M5TA 1YY3A 2YOLA 3D62A 1ANDA 1SGEE 5DP3A 3TGJE 3MU4A 5HIYA 1A0HB 1ANCA 1C4V2 2BDIA 2Q6GA 1H8DH 1E38B 1H4WA 1IQIA 3OAAD 2C8XB 5FCRA 1DS2E 3GY3A 1OKXA 1GJCB 3LU9B 4B75A 1S5SA 2G52A 3MMGA 1SBWA 4IW4E 3PMBB 1SGDE 5I25A 1EPTA 5AF9H 4XSKU 2G81E 1NPMA 1YLNA 1RTFB 4WMDA 2ZHWH 3BG4B 4I8KA 1QFKH 1HAGE 3SNEA 5B6LA 3SUEA 1PPBH 3OY5U 3FANA 2BDBA 1P03A 2BVRH 2V6NA 3SGBE 4QT8C 1WOFA 1QY6A 3SI3H 3RUOA 1MCVA 2Y5FA 2A7HA 3RXAA 2Z9JA 4MPUA 3QGNB 1TB6H 5HGGA 1ACBE 2ZO3H 3U8RH 5E0GA 3DHKH 4NGAH 2A2QH 3VGCB 4AG2A 3S7KB 2ANKH 3PLPA 4NSYA 1RXPA 2P3FH 4Y8YA 1VCPA 2VWOA 5DO4H 3RLWH 1XXDA 1PQ5A 3F68H 3MYWA 1SGQE 4AZ2B 1DE7H 5C17A 4FVDA 1KXBA 1QNJA 1TQ7B 3PO1C 3I78A 1P57B 4INLA 3DUXH 3U1JB 1SGTA 2ZFFH 1SQTA 2O8MA 1GJ5H 3MO6A 4ABFA 1GHZA 4WXVA 1QQ4A 4LXBH 1DPOA 1LMWB 3E6PH 1O3AA 3P8FA 2C8YB 3MNCA 5EPNA 1QA7A 2FO9A 4YLUA 2FOHA 2GCHG 1F5RA 3U9AH 5J4QA 5IYTA 4X1NU 3RXJA 3SO3A 1BBRH 1VKYA 3RXDA 1K1JA 3MNSA 3SV2H 5E2PA 5T6GA 2BY8X 4M7GA 1E36B 3AW0A 2F9BH 1MUEB 1YC0A 2J9NA 1SGFA 1OWDA 2ZTYA 1BJUA 5C2ZA 5B6OA 3GCOA 4JZIA 3QGJA 2ZU1A 2QAAA 3DD2H 3N7DA 3UWJH 3QLPH 1E1QD 1C2MA 1C1PA 2GDEH 3MO9A 2ZGJA 1EPTC 2OQUA 1FX0B 4MLFB 3URDA 1TOCB 1CGJE 5A8ZA 4NA9H 4GSOA 1ELVA 2QV1A 4K2YA 1KXDA 5AFYH 2ZGHA 3A8CA 1GG6C 1NZQH 2XWBI 5G4BA 1BIOA 3GY8A 1LVYA 1BMMH 4ZCNA 4Y10E 1F0RA 1OWEA 1QR3E 2BDYA 3BTKE 1LVOA 1P12E 5JDUB 1LHDH 2GT7A 5DP7A 1AVWA 4KTUA 2PKSB 1L0ZA 2H9EH 2W6ID 4F4OC 1UHBA 1QBNA 3GCNA 4YOGA 3LOXA 8LPRA 5JBCS 4I86A 1BRAA 3SNDA 5C5NA 4GCHG 1G30B 1K9OE 1OWKA 4TYDA 1VITG 1SQRA 3S7HB 4FUJA 2AHME 1KMHB 4ACAA 1GBAA 1BDAA 1GHXH 3S9BA 3M3TA 3UAIC 1O5FH 1NU9A 3M35A 2QN5T 1BMFD 2QY0B 3MU1A 1Q3XA 4TT3D 3ODDA 2Z3DA 4NIYA 1O5DH 5LPFA 1FN6A 2NU4E 3BTWE 1IQKA 1QRXA 4CRFA 3RXUA 2XBWA 2C8ZB 4YXWD 3O8RA 1THPB 4BNRA 3MI4A 1H8IH 1UTOA 2UUKB 4O9VA 3OTJE 4OGYA 3RXMA 3ATMA 3BV9B 3ELAH 4JMYA 3RMMH 1K1IA 2V3MA 3PTNA 3UR9A 3QZQA 4Y71A 3VFEA 2L6OA 2WPDD 2A5AA 1F5KU 1P10A 1C1UH 1NBME 1YKTA 3RXHA 4TY6A 1HFDA 3RXGA 5CE1A 1Z1JA 3M5LA 1MQ6A 1W8BH 3UOUA 1TBRH 1GI8B 3T25A 4MNYA 3DSPA 1IHSH 1EB2A 1TX6A 3ATLA 4DVAU 3A84A 1MKWH 2Q1JA 3TJVA 9ESTA 1EP5A 1P8VC 1DITH 2VIQA 2B7DH 2OINA 4NCYA 1PPGE 1S6LA 1GBCA 2FS8A 4B76A 3A7VA 1V3XA 1DSTA 1O2IA 2GTBA 4GPGA 4XBCA 2YNBA 1ZPCA 2FS9A 1DT2A 4NIXA 1EQ9A 1PPEE 2ZWLH 1AZ8A 1E79D 5DP6A 1XVMA 2EA3A 1TPAE 1Z8GA 1G9IE 1WDIA 2GX4A 3LGUA 4TY7A 4ZKNU 4F49A 3PWCA 5JBTA 1P3EA 1IQMA 1V2UT 1SGNE 1TALA 3BIVH 1TBQH 4Y7BA 4SGAE 3Q3XA 6CHAC 5JYIA 5EXNA 2FTLE 3RXRA 2A4RA 4DCDA 1ZOMA 3QN7A 2P8OB 2Y80A 4ZH8A 3SOSA 3OE7D 4ISOA 3T26A 3L33A 4NA8A 4K8YA 1W0JD 3MFJA 4X0WU 4JZFH 3U8OH 1T32A 2CF8H 2J98B 1V2RT 3KHVA 1A1RA 1O2LA 4VGCC 1KSNA 3KGPA 5KECA 1LQEA 3BG8A 1DDJA 4FU9A 5K7RA 2PGBB 4CRAA 4O3UA 3ZZAA 1TRNA 2OC0A 2UWLA 1N8OB 3SGQE 2W3IA 2BQWB 7GCHG 2BYAX 1KXCA 1NFUA 5KEDA 3BTGE 1LPKB 1P9UA 1WUNH 1GMHF 4Q80A 2KX4A 1PQ7A 2ODPA 5DP8A 3EDXB 3SJIA 3EA7A 2W7SA 1GWAA 1UO6A 3SN8A 2EEKA 1TNGA 2Z9GA 1GJ9B 2GT8A 4FETA 4AB9A 2D2DA 1N6YA 4ASUD 1UK3A 1BTYA 2JH6D 3ZIAD 1AQ7A 1WYKA 3RXSA 2HVYB 2OP9A 1UTNA 4DURA 1TNIA 3RXLA 5CHAC 3O8CA 3A7YA 3MNBA 1GBIA 2FEQH 1ELEE 3QTVH 4TWYA 5C20A 1GMDG 1C5WB 1NFWA 3GDSA 3SNAA 1O2SA 5C0UA 5GWZA 1UVTH 3E8LA 1UW7A 4ZUHA 3VPKA 3ATKA 1YPKH 1GMCF 1XM1A 2V35A 2VIOA 1S6FA 3H5CB 4SGBE 3NCLA 1L4DA 6GCHF 1UVPA 1QJ7B 1BTUA 1OHHD 2IPHA 2D1JA 4JZEH 1EZSC 2VWNA 6LPRA 4GHTA 2BDCA 5L2YH 2ZDVH 1P2MA 3TU7H 2R9PA 2AGGX 2OLGA 4I8HA 3F9FA 1ELGA 2JETB 4K1SA 2VVCA 2BLQA 4WH8A 4GHQA 4I7YH 4JZDH 3LGIA 1VCWA 1BHXB 1SGRE 4KTSA 1HAOH 4Q63A 1BITA 5GDSH 1QBOA 1Y3WA 3RU4E 2ZPRA 3A81A 1TNKA 1HIAA 1NU7B 2C90B 3BTFE 5F8ZA 3SU6A 4ACBA 1Y3XA 1YPJH 1BBRK 1V2LT 3RP2A 1C5SA 1VR1H 1Z8IB 2FM2A 2PSYA 4BTIB 1HRTH 1IOEA 4FVBA 1FY1A 1GBJA 1O2MA 5FBIA 1XUFA 3SUDA 3A89A 1GI2A 3SNBA 3FZZA 4FU7A 4TWWA 4K1TA 3RXVA 4CBNA 2V0BA 5EODA 1UCYH 1O2XA 1SR5C 1BMLA 3TGKE 2LP6A 2A7CA 1HAXB 4B6EA 4JK6A 1YWUA 1GCTB 3MTYA 1C5LH 1TIOA 1H9LB 3D49H 2ZECA 3PV2A 5TCAA 1OSSA 5EQRA 2BTCE 2ZHFH 2ZIQH 1ZZZA 2PKAA 4I8GA 3OYPA 1GHAF 1GGDB 1TMTH 5DP4A 1O31A 1S0RA 1C1TA 1AZZA 3DT0H 2WPKS 3DA9B 1EAIA 4BTUB 1MD8A 3EAJA 2WPHS 2GVFA 4XD7D 3RXTA 2SNVA 2HNTC 3P17H 1NBMD 1A5HA 2EI7A 1EB1H 3IWMA 1YPEH 3C27B 2EC9H 4H42U 4AOQA 4Z6AH 3A87A 1O3OA 1XUIA 2OC7A 2VH0A 3ATIA 2ZFQH 2TPIZ 2KZ4A 1BRBE 2CGAA 3H7OA 2Y5HA 3DCLA 2WPJS 1CT2E 3RLYH 1HDTH 1P06A 2Q6FA 2IJOB 3M7QA 1HJAC 4LK4A 3E0PB 1SFQB 2BOHB 1EJNA 2FI5E 3SU0A 1K1LA 1QURH 2O9QA 3OSYA 3NK8A 4B73A 2VU8E 1DICA 4X6NA 2CF9H 3RC6A 2WV9A 3VG8A 1AE5A 3SI4H 3UIRA 1UTJA 2WPMS 5FPSA 3ZZ8A 2WPLS 1AFQC 4A6LA 3GYLB 2PSXA 3Q76A 2GP9B 4JK5A 3RXBA 1BCUH 3SU1A 2BLVA 4WVPE 5EW2H 1C5MD 2K0QA 4YOIA 3AAVA 5DK1A 2UUYA 2J94A 1IQJA 1L4ZA 2GZ9A 1O0DH 1A0JA 2OK5A 2HLDD 3M3SA 2BXUH 2BY6X 2FZZA 2OD3B 1RIWC 3ZV9A 1O5GH 4Q7XA 3LIWA 4F55A 2D8WA 4CH2B 2ODYB 2WSSD 2ASUB 1O3DA 1UTQA 2KAIA 4UFFH 1AB9B 3SZEA 2PV9B 3L3TA 3SW2B 1SB1H 2VB0A 1LKBA 2KCAA 3R3GB 1OYQA 2ZDAH 1MKWK 1W7XH 2P59A 1O3LA 3ENSB 1WBGB 1LKAA 1QA0A 4FUCA 2FX6A 4JYTA 4K69A 3CENA 1FAKH 1PPCE 1THSH 4ISLA 3F9GA 3F2HA 4UFDH 2ZZUH 1Y59T 1RRKA 1O3KA 3UPEA 3I29A 1XKBC 2ZG0H 1C1WH 2A2XH 3PO1B 3LC5A 1ZRBA 4AFQA 1GMDF 4ABIA 1MKXH 3EA8A 3HK6B 1C5OH 3KNXA 2PTCE 3ZZ4A 2J92A 4X8TH 1ANBA 2NU0E 1A46H 2AYWA 1UVOA 1LQDB 3F9HA 2ESTE 2XTTB 1S84A 2VIDA 2GKVE 2A7JA 2P93A 3MU5A 1HPGA 3P6ZB 1V2ST 2CV3A 1CO7E 2WINI 2H1UA 2Y7XA 4NIVA 1OX1A 1SQAA 1FV9A 1CT4E 1ELDE 1E1RD 1GPZA 5EXLA 1K28D 1GDUA 5EQQA 2QXGA 3LGVA 3TK6A 4MG3A 1O35A 1KDQB 3A8AA 1V2JT 1YPLH 1K1PA 1PQ8A 2GCTB 2W3KA 1TAWA 1DANH 2XWAA 3KIDU 2A0QB 2O8WA 1T31A 1D3QB 1O3NA 2HLCA 1C5XB 1P09A 3SHCH 3DSGA 4X2XA 2M2AA 4Y0YE 2WUBA 5FPYA 1TX8A 4AFUA 2BD3A 5T6DA 4ASHA 2FLBH 3PV4A 1PFXC 1XX9A 1K1MA 1AD8H 1TA6A 1NRRH 1GBLA 3RU4D 1ELAA 1O2PA 1BJVA 3EYDA 4X6OA 1SGIB 2ZGBH 1O5AB 1QZ8A
chains in the Genus database with same CATH topology
4Y11E 1FJSA 1A7SA 2VGCC 1MTWA 1LHEH 3LJOA 4NFFA 3VB6A 1EZXC 4RN6A 3SU5A 4FXGH 2FOFA 2XXLA 4DJZB 1C9TA 1K1NA 4XBBA 1P2JA 1T4UH 2B0FA 2UWOA 4D8NA 1MD7A 1A3EH 2SGQE 2Q6DA 2AIPA 1AVGH 1FDPA 1KDQA 4XOJA 1ESBA 3TITA 5C3NA 4A92A 4U30A 1WV7H 3V3MA 1O3JA 3M36A 3TIUA 1E34B 1NO9H 1S85A 2BMGB 2P16A 4UE7H 3PMHB 2R0KA 1O3GA 1C2IA 1ELFA 4X8SH 1FUJA 1Z6EA 1ZYOA 3SGAE 3UY9A 3IG6B 1GDNA 1NRNH 4ABDA 4Y8XA 1WTGH 1D6RA 5E0JA 1S6HA 1GDQA 1H9HE 5L2ZH 2EI8A 1CU1A 1YLDA 3ZVFA 1LVBA 3BTQE 3KQEA 1VGCC 5BRRE 4E7RG 2G51A 1Y5UT 1Z7KA 4GUXA 1W3CA 2GV7A 1G37A 3NWUA 3GDUA 4ISIH 1SVPA 1DWDH 1GMHG 1XUGA 4AFZA 4UONA 2FX4A 2CXVA 1HV7A 4K1EA 2XRCA 2C3SA 1O2YA 2RCEA 5ABWA 2GV6A 4YT7H 1WU1A 2VVUA 4DY7B 1AIXH 1DWCH 1TOMH 1GJDB 2OQ5A 5JB8S 1BA8B 1SOTA 1BTPA 3A7ZA 4FU8A 3P70B 4B2CA 2AMQA 4DGJA 1GJAB 1Y3VA 1M9UA 1KXAA 4U01A 2D26C 1SL3A 2HGTH 1FY3A 1FONA 2AEIH 2A45B 4X1QU 2RDLA 1T8OA 1AUJA 1P0SH 1GJ8B 1LPZB 1DXPA 4JYUH 3VXEH 1GMCG 2BVSH 1CA0C 4YTAA 3RU4T 3GOVB 2YNAA 1OWJA 2FI4E 2ZDKA 6GCHG 1BZXE 1YLCA 2QYIA 2VNTA 2ZTZA 3T62A 4AB8A 3U8TH 1O3FA 1FI8A 1ZTJA 1O2QA 2STAE 1EAUA 3BEIB 2ZCLP 1O36A 3LKWA 1GVZA 4LZ4B 4XE4A 1OP0A 1CT0E 1C2FA 3IITA 4RSPA 4O97A 1HBTH 1ZLRA 3PWBA 2HALA 4K5ZA 1XUKA 1ELBA 1BQYA 3TLOA 4CHAC 1MTNC 1ZGVA 3ZVDA 1O2UA 1CBWB 1ZHRA 4NFEA 4BAKB 2VWLA 1IQGA 4Q2KA 1HAVB 4D7FA 4PROA 1VITH 2FOMB 4X2YA 5JB9S 1BTWA 3QK1A 5HYOA 5E2OA 4ZKOU 1A5IA 1FXYA 3HK3B 3A85A 2XC5A 1ARBA 1L2EA 2ANYA 1UMAH 5E8EH 2ZPQA 1SMFE 1ZTLA 1EJAA 1QBVH 3BG4C 1F0SA 2A5IA 3M7TA 1CE5A 4Y6DA 1BMNH 3MWIU 2AFQB 3E3TA 2ZA5A 2AERH 1IHTH 1A2CH 4NA7A 3TVJB 2FOGA 4FUFA 2BB4A 1PPHE 3PROA 4J1YA 3U69H 4YM9A 1C2LA 2TRMA 1DLKB 4E05H 1QCPA 1C5ZB 1D3TB 2J38A 2C8WB 1GBMA 1DLEA 3U98H 3ZZCA 3SU3A 1GBDA 3M37A 1GHAG 1O5BB 3VGCC 4I8JA 3I77A 5GPIB 1GHBG 1WQVH 4E7NA 1WQSA 5EPYA 3UWIA 3TH4H 1GI9B 2A5KA 3RXQA 2BQ6B 1HB0B 2XBVA 3BTME 3GISB 3EGKH 1AGJA 2Z94A 1C1NA 2HOBA 1C5TA 2ZF0H 2AMPA 2AMDA 1HAPH 1A0LA 1P2IA 1L1JA 2HNTE 2UUJB 4K3JA 1W7GH 3T29A 2VIPA 2Z3EA 2Z9IA 3T5FH 5A2MH 1CGIE 1O30A 3ZZ6A 3NKKA 4UFGH 1YP9A 1ZTKA 1DY8A 1LHGH 1OP2A 2JKHA 3E16B 4BAHB 3LC3A 1TPPA 1NROH 3HGPA 4U2WA 1RFNA 3LJJA 2BQ7B 4X1RU 5FXLA 3RXKA 4IN2A 1FY8E 2P94A 2J4IA 1C1OA 1H9IE 5C1YA 4THNH 1UK2A 1C1MA 3ZVBA 4X1SU 2DUCA 2ZGXH 3UNRA 1SLXB 1CHGA 1TPOA 1DUEA 2HNTF 2IOTA 1RTKA 1AFEH 4KELA 3ZVEA 1CHOF 5DG6A 3SU4A 3M5NA 2FYQA 2K1QA 1TABE 1TFXA 1O3BA 4H6TA 1NTPA 1DM4B 2BDGA 3RC5A 1FAXA 4AYVB 1O3MA 2GD4B 2ZP0H 1V2WT 2FOBA 1SLWB 5FHTA 5LH8A 1EASA 1HAHH 1WTHD 3GY5A 3P95A 1J15A 2FTMA 1QRWA 1DSUA 1TNHA 2XC4A 3ZZ3A 2OBQA 4B2BA 1A61H 1ID5H 2AIQA 4INHA 2PWXA 4R8TB 2G5NA 4AGJA 2TIOA 4MQAA 1FY4A 1Z71A 2QIQA 1ZHPA 2V3HH 2FOAA 2ZFTA 3MNXA 3RXPA 1BBRE 1Y3YA 2PKSC 2Z6BD 1YCPH 4TPIZ 3ZVGA 1TGBA 3OU0A 1MH0A 2F9OA 1VJAU 1DVAH 4MVNA 4AGKA 2B9LA 1Z6JH 2FXRA 3BEFB 4KGAA 4WY3A 3MU0A 2TGAA 1F7ZA 1GVLA 2FOEA 1Z8JB 2Y81A 4Y7AA 3UREA 3T28A 5I46H 4FUBA 3FFGA 5A09A 1HJAB 3D65E 4BOHA 3F6UH 1J16A 1BRUP 3A82A 4NWLA 3SV7A 5J4SA 3GY6A 1D3PB 4ZAEA 1UTMA 3VB5A 2EI6A 1EP6A 3UOPA 3VEQB 3ATWA 4MPVA 1AO5A 2ALVA 1O5EH 5L30H 5AHGH 2XYAA 2AGEX 1GI1A 3LT3A 5AFZH 5GCHG 1PJPA 2ZPSA 3STIA 1V2OT 5F6MA 2ZDLA 3GCHB 1FPCH 1O39A 3UUZA 1TMBH 4BAQB 2ZFSA 2XBYA 8ESTE 2HVXA 2GDDA 3TJUA 1JOUB 2ZHDA 1INCA 4AORA 3SV6A 1GHVH 1MBQA 3LPRA 2BX3A 5A8YA 3M5MA 3T2NA 1B7XB 1UTPA 1D4PB 4BAMB 3VB7A 3STJA 4YT6H 1E35B 1O3HA 4IBLH 4I31A 5A0AE 1V2PT 3SBKA 2BLWA 1SHYA 1SGPE 1J17T 1QL8A 4D76A 2OXSA 1CSOE 2FIRH 2VIWA 3FAOA 2LPRA 4AN7A 2TGPZ 2CHAC 3QZRA 1MAXA 1WAYB 3SQHE 1SSXA 3A88A 3QO6A 4CR5A 1ZJKA 3QTOH 5H4IB 2OTVA 1T8LA 1O38A 1LPGB 2ZHEH 2O8LA 1YF4A 4D9RA 1W11U 1ETTH 3ITIA 2BY9X 1ETSH 2BZ6H 2P8OC 2VIVA 3MO3A 1FIWA 1AN1E 1P9SA 1OWIA 1SGFG 4ABBA 2HWLB 1MMJN 1P2KA 1TGSZ 4CBOA 1K1OA 1ZMJA 2BDHA 2BVXH 1GHBF 4AYYB 1K21H 1C4Y2 3UQVA 2TGDA 2ZQ2A 1HXFH 4FUIA 4JYVH 2XNIA 4WJG2 2GMTB 2NU3E 4GAWA 2FYRA 1YPGH 1DFPA 2J95A 5FBEA 4CRBA 5LGOA 1TONA 1TQ0B 3GY2A 4HFPB 1N6XA 1N8OC 1EAXA 3ZZ5A 5DP9A 4A1TA 2R3UA 3UNSA 1TE0A 1JWTA 4MTBA 1TGNA 2ZFPH 2STBE 3Q3KA 1TBZH 2FPZA 4KP0A 2XBXA 4ZHAA 3RMLH 2B8OH 1NN6A 2ZCHP 3EA9A 1W14U 2FDAA 2PTNA 1FN8A 2VVVA 1IQHA 2XC0A 3SQEE 3SJ8A 3K6YA 3KL6A 4XFQA 3GDVA 1XMNB 3SNCA 4OS6A 1MTUA 1HGTH 5A0BA 1ZMNA 5PTPA 2A4GA 3LGWA 4OGXA 3BTEE 3C1KA 2FOCA 5F03A 2NU1E 1KXFA 1XVOA 4BXWA 4B74A 1EX3A 3LONA 3PLBA 3ZYEA 3CS0A 1EZUC 3MOCA 1YPHC 1QGFA 2ALPA 2ZI2H 2P3TB 1MU6B 1SOZA 1FY5A 1GBFA 1AKSB 1CQQA 4YOJA 1P11E 4BXSA 1O2ZA 1KLTA 1QB1A 2DE8A 3CP7A 4X1PU 2C93B 5SGAE 1SC8U 2JETC 3Q00A 3K6ZA 2TBSA 5ETXA 5T3HA 1MTVA 1W12U 3AW1A 3SUFA 1BOQA 2BY7X 2SGPE 1LDTT 2G4TA 1FMGA 3F1SB 1T4VH 1E0FD 2BD7A 1O2NA 2WV5A 2AS9A 1GL1A 1OPHB 2ANMH 1TGCA 3N7OA 3KQCA 3BIUH 3JZ2B 3FP6E 2FP7B 1O2JA 3TJNA 3AASA 2OC1A 3FVFB 4DIHH 1ZPZA 1AWHB 2R2WU 4YLQH 5GCHF 3RXFA 2ZQ1A 1G3EA 4FUEA 1AKSA 1C5QA 2I6SA 1EZQA 3O8BA 1KLJH 3SZNA 3ZYDA 1GCTC 5LPEA 1TX7A 1JMOH 1O2RA 1NESE 4IMZA 3HPTB 1BTHH 1UTLM 1GGDC 5AVDA 4BTTB 2HPPH 3B9FH 1V2KT 3S9AA 1O2OA 4HGCA 2ZU4A 1VZQH 2PW8H 5EG4A 4NWKA 1SGYE 3PMAB 2BHGA 1HCGA 1EPTB 4O03A 1ZRKA 3S9CA 1W2KH 1DXWA 2JH0D 3UQOA 1T7CA 2DE9A 1D6WA 1SPJA 3E0NB 5EW1H 2PGQB 1TPSA 1GG6B 1O3IA 8GCHF 2VH6A 1EJMA 1G2LA 1V2MT 1ELTA 3PB1E 4KTCA 1KYNA 2QC2A 3F9EA 3BF6H 3P8NA 5F8XA 1O2GH 1Y5BT 3V7TA 3MH4A 1UCYE 2BD4A 1A3BH 2W26A 3K65B 7LPRA 3W95A 2NWNA 2H2ZA 2G00A 3A8BA 4RKJB 1N1LA 3KCGH 1AI8H 1B0FA 1MTNB 1QJ6B 1OWHA 1DOJA 1SHHB 1C5UA 2SFAA 3P8OA 3P8GA 1EKBB 2ZNKH 2FLRH 1GI4A 3RDZA 3A8DA 1QIXB 3SV9A 1KTSB 2VWMA 1P3CA 4IC6A 1C2HA 3B8JA 5L6NH 3GCTF 3LGYA 1CGHA 1NY22 3MH6A 3BTHE 5C67A 1G2MA 1YGCH 3NXPA 2RA0A 1CHOG 2R2MB 3ZZBA 7KMEH 4FUHA 1O3EA 3PTBA 1RS0A 2PLXA 3A86A 2F3CE 1C2DA 1AB9C 1ZSJA 1AE8H 5TJXA 1GHWH 3SU2A 1AVXA 1O37A 1GCDA 3P92A 1LO6A 3B23B 2BD5A 2ZU5A 1FNIA 1PPZA 1C1VH 1SQOA 4BAOB 4HI3A 4ABJA 4WXIA 2AGIX 3SORA 3ODFA 5JBBS 4GLYA 5C1UA 1B5GH 1TA2A 2A1DB 4A7IB 3GY7A 1EOLA 1ETRH 1GJBB 4IC5A 2F83A 3RXOA 1O3CA 2F9UA 1UCYK 5ESBA 4IGDA 1PYTC 1OYTH 4FUDA 3FP7E 3SUGA 1P2QA 4ABHA 2P3UB 5EXMA 2CJIA 3R0FA 1OS8A 1W0YH 3TK9A 4E06H 2QA9E 3FP8E 2BOKA 1UHBB 3PYHA 1PYTD 4UFEH 3SHAH 2BX4A 1C5RA 3LH3A 3TNSA 3GY4A 2TGTA 6CHAB 3ZZ9A 3MU8A 1EOJA 2ZCKP 4A1VA 5C5OA 4MPWA 4MPXA 1B0EA 1Y8TA 1HAZB 1QRZA 2GCTC 1F0UA 3M3VA 1G3DA 3RC4A 3LDXH 4LZ1H 1GJ7B 4KKDA 1Z1IA 1F5LA 4VGCB 3KN2A 1SI5H 4ABAA 9LPRA 1O32A 1P2OA 1GJ4H 4YZUA 1IAUA 2BZAA 2RA3A 2OBOA 2G8TA 7ESTE 1UVSH 1Y5AT 4NIWA 4ISNA 4MNWA 2ZC9H 1JIRA 3T27A 1UTKA 1ZHMA 2BD2A 4X2WA 2ZFRH 4I33A 1IQFA 1C2KA 2A4QA 1MQ5A 1MU8B 3H7TA 1ZMLA 1L1NA 2ZHQH 1KIGH 3JZ1B 3RM0H 1C1RA 1IQLA 2GZ8A 1J9CH 4B2AA 1C5VA 1TYNA 2Z9LA 4NZQA 5A8XA 2Y5GA 5CHAB 1EATA 4MNVA 2SGFE 1HXEH 3U1IB 1GBHA 4K8BA 4ZKRU 1J14A 2BD9A 1ZPBA 3UFAA 2BDAA 3UTUH 1NC6A 1P01A 1FZZA 4ZMAH 3SJ9A 4FUGA 3ZVAA 4HZHA 1AU8A 1V2VT 1A4WH 1O2WA 2QXHA 1ESTA 4ZHLU 3RMNH 2ZEBA 1T8NA 1Z8RA 1O2TA 3HATH 3Q3YA 1QHRB 1HAVA 4YESB 2ANWA 5EQSA 1C1QA 2AH4X 1DX5M 3SV8A 2ULLA 1Y3UA 5EOKA 4I8LA 4D9QA 1LVMA 1W0ZU 1BTXA 3A7WA 3MH7A 1MKXK 1LCYA 1QB9A 2CMYA 1C2GA 5FPTA 1BB0B 5HM2A 5FX6A 1MAYA 3DFJA 4H4FA 4IS5A 1O5CB 3OX7U 1SFIA 4Q7ZA 5DGJA 1CA8B 4ABEA 3DFLA 1NS3A 1LTOA 1QJ1B 5FX5A 1TNLA 2QF3A 3BEUA 2W7UA 3HKJB 1QL9A 3KEEA 3G01A 2UWPA 2CHAB 2PHBA 4X6PA 2BXTH 4HTCH 1ABJH 1HUTH 1UVUH 1GI7B 1IQNA 2VINA 3L6PA 2WV4A 4IMQA 1HNEE 1KXEA 2FMJA 1Q31A 3NZIA 5C1XA 1ZR0A 3NPSA 1TRYA 2O8UA 4X8UH 3OY6U 3D23A 3V13A 1TWXB 4CRGA 2G4UA 2SGAA 2A32A 4OS5A 3SJOA 3VB4A 5HM9A 1YPHE 2H5CA 1C2EA 1OP8A 2IN2A 1C4U2 4X8VH 1MZDA 2F91A 4D7GA 1JIMA 2QF0A 4DT7B 4JCNA 4OS4A 3TJOA 1QB6A 1GHYH 1TGTA 2WUCA 1OXGA 5DP5A 4DW2U 3PMJA 2GZ7A 1BT7A 2H9TH 3BTDE 3M7UA 5LPRA 3RM2H 1C1SA 1CBWC 5DKMA 4WMEA 5HXFA 1G3CA 1HJ8A 2UUFB 1YYY1 2I6QA 4J2YB 2WYGA 4IN1A 3QX5H 1RJXB 2NU2E 2GCHF 1VJ9U 3PLKA 1P02A 1EUFA 4MDSA 1V6DA 1ANEA 1GJ6A 1DUAA 1UK4A 1BTZA 1WSSH 1L1GA 1CVWH 1NRPH 4INKA 1ELCA 1V2TT 4CREA 1H1BA 1C9PA 3TH3H 2V3OH 1AFQB 1HAYB 1S0QA 4AX9H 3BTTE 4ZHMU 1HIAB 1A5GH 4AG1A 5DJ7A 1O3PB 1AMHA 1BHXF <