1QNJA

The structure of native porcine pancreatic elastase at atomic resolution (1.1 a)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
240
structure length
240
Chain Sequence
b'VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ELASTASE
publication title Atomic Resolution Structure of Native Porcine Pancreatic Elastase at 1.1 A
pubmed doi rcsb
molecule tags Hydrolase (serine protease)
total genus 58
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1999-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qnjA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qnjA01
1LPKB 4OS4A 2YOLA 4XOJA 1O35A 2A2QH 2XBXA 3KIDU 4CRAA 1AFEH 1X7AC 4THNH 2H9TH 1XMNB 3RDZA 3S7HB 1FNIA 1DWCH 4U2WA 4XBBA 1LQDB 3T2NA 1HJAC 2Y5FA 2QV1A 3STJA 3ATIA 5K0HA 4FUEA 2HNTC 1PYTC 1AVGH 4ABFA 4NA9H 2OC7A 4I8HA 1SL3A 1Y59T 4JK6A 1FY8E 1TIOA 2BDYA 4NIYA 1MTUA 1K1LA 3RXHA 1P10A 1TX7A 2GP9B 2A5AA 3ZZ3A 2PWXA 2XW9A 4B75A 2A1DB 1UK4A 2GCTB 2H9EH 3NZIA 2FM2A 1A61H 1P9UA 1V2PT 1L4ZA 2Z3CA 2B9LA 1SOZA 1P02A 4IS5A 4YLQH 4ISLA 1BZXE 5DP9A 5JBTA 2BOHB 4INKA 3MU8A 1EQ9A 2FO9A 3VB7A 4X6PA 3BF6H 1SGQE 1FY3A 1QGFA 1GMCG 1ZSJA 3A80A 4KELA 2NU1E 1TNJA 2ZU3A 2VWOA 4B1TA 4GPGA 1S0RA 2GCTC 1YPLH 1P12E 3MNXA 2O9QA 6GCHF 1BMMH 4SGAE 4R0IA 3SU1A 2QXHA 1FI8A 1V2UT 1Y3VA 1SI5H 1D3QB 3MU0A 2ZWLH 1AHTH 1MBQA 3BTWE 1SOTA 3T28A 2TGPZ 1BUIA 2TGAA 4XSKU 4MNWA 2H5DA 5T3HA 3GY4A 3RP2A 4I8JA 2A7JA 3ATLA 2IN2A 1EAUA 1DX5M 2HPQH 4Y71A 1ETSH 1SGFG 3OSYA 1F0UA 2FXRA 3LH1A 3OU0A 1XKAC 1B7XB 2ZP0H 1N8OC 4UEHH 7LPRA 1FAXA 5E0GA 3T25A 4NWLA 2G55A 4IC6A 1C2JA 1O2TA 2BLWA 2FDAA 1AE5A 1TGCA 2NWNA 3SI3H 3E91A 2Q6DA 2F9BH 3RUOA 1RRKA 2YNAA 3SQHE 3A7WA 4I8LA 2BHGA 1KXCA 3F9EA 2V35A 3A8BA 1IHTH 1NM6A 1W2KH 3S9CA 1AD8H 4BOHA 8LPRA 1HAYB 1HFDA 1GI6A 1L1NA 1PPCE 1DLKB 1GDQA 2Y5HA 3SU6A 1GMHG 4JYTA 1MCTA 1W11U 1ZGVA 1A5HA 5JYIA 2ZDNA 4DIIH 4ZKNU 2Q6GA 3TJUA 1A3EH 1MCVA 4UFEH 1G36A 4JK5A 1GBAA 1GJ5H 1WQSA 3MNBA 2ZC9H 3UREA 1GJ7B 1S84A 2IJOB 1TPOA 1QA7A 2A4RA 1SQAA 2G51A 1SGCA 1K1IA 1TRYA 4I8GA 4XE4A 4CRCA 1C4V2 2AMDA 3PV4A 5TCCA 5C1UA 3R3GB 5JB8S 4MG3A 3RU4D 2ZQ2A 3AVZA 3ELAH 3MMGA 4YO9A 2GV7A 1DANH 1AUTC 4K8BA 2HVXA 1FN8A 3NCLA 3EYDA 5F6MA 5J4SA 3SJ9A 1GI9B 3UWJH 3SGQE 2XWBI 4NSYA 2ZECA 5EXNA 3UWIA 1G2LA 4ISOA 3U9AH 1DT2A 2PFEA 2C93B 1ZMJA 1MTNC 3BTGE 3M5MA 1EB2A 1XUFA 1ZRKA 2VGCC 1FN6A 3KEEA 3SU4A 1O5AB 2OP9A 1TE0A 1PJPA 2KAIA 1W12U 1V2JT 1ESBA 2Z9LA 3PMAB 1C4Y2 1GI8B 1VCWA 1GI0A 1UTJA 1ESTA 4MVNA 1DSUA 1C5XB 3IITA 1OPHB 3KQBA 1ANDA 1YPGH 1GMCF 1EJNA 4JYUH 4JZFH 1DSTA 2GMTB 2ZHDA 1QIXB 1O3EA 1JRTA 2BVRH 1EZXC 4OS1A 1OKXA 1PYTD 1CHOG 2B7DH 1P2NA 5EG4A 3S0NA 1C1SA 1TNLA 2FX4A 2QF3A 5GPIB 3UPEA 1AWHB 3W94A 3BG4B 3M7QA 2ZPQA 1W0ZU 4JZDH 4X1RU 1P3EA 2A5IA 5T6DA 4CH8B 1GI1A 2BZ6H 4FU8A 3SJOA 1D3DB 1AFQB 5LPRA 3KHVA 2GMTC 1D6WA 1BHXF 1AB9B 5F8TA 3DD2H 4PROA 2W3KA 3KGPA 4D9QA 2BMGB 4GHTA 3LGWA 5EXLA 3GYLB 2B5TB 1ZOMA 1C2GA 3UOPA 3ODDA 3BTME 1XVOA 1QNJA 1QL7A 2XC5A 3NWUA 1O3MA 3BTKE 3HKIB 3T27A 2WPHS 4D76A 3BG4C 1WOFA 3H7TA 2Z3DA 4HZHA 1F5LA 1TRMA 1P05A 1N1LA 4Q7XA 1NPMA 2J9NA 3URDA 1V2RT 1EJMA 1NROH 2PR3A 2Q6FA 3SZNA 2AFQB 1SGYE 5A8ZA 1AFQC 1GMHF 2QF0A 2LPRA 1WYKA 5AVDA 1BRBE 2CGAA 1O2ZA 4DT7B 1AB9C 1OX1A 2O8WA 2ZPRA 2OBQA 3NKKA 4AYYB 1Z7KA 2QCYA 4XDEA 3OYPA 1J8AA 1Z1IA 3ATKA 1O2NA 4JMYA 3SV9A 1ELAA 2EI7A 1B5GH 1O3IA 2V6NA 1YLCA 3ZVFA 3BIUH 4AFZA 5FX5A 3TU7H 2O8MA 5L2ZH 2UUYA 1W8BH 3LJJA 4AFUA 2GVFA 2QXJA 5EQQA 3STIA 5EOKA 3RXJA 2QXGA 1SMFE 1CGIE 1AU8A 1Q2WA 4Y76A 1RTLA 2AIQA 4MQAA 4FU9A 3UY9A 1KDQB 1KXFA 1A0JA 3AASA 4CREA 2ZEBA 4K1EA 1HBTH 1KXDA 1KTSB 1VZQH 1SG8B 2CMYA 3IWMA 1QJ6B 3A8AA 1QHRB 2XC4A 3RXLA 2CF8H 2GZ8A 2FZZA 3F6UH 1SPJA 5FXLA 1ZPCA 1ZLRA 5DP6A 4DJZB 1J9CH 1BBRE 2P94A 1JXPA 1UMAH 4U01A 1ZJDA 3RC4A 1O2GH 3Q3YA 5CE1A 1P0SH 3B23B 2XBYA 3LU9B 4TY6A 1PPGE 2WUCA 1GI5A 2BDHA 3CS7A 2HGTH 4I8KA 1S85A 1O2JA 1CT2E 1AI8H 3RXUA 3ITIA 4D7FA 1DWDH 2ZHFH 1GBKA 3BV9B 3FAOA 1UHBA 2O8TA 5J4QA 1SGPE 1ELFA 2QYIA 1NU9A 4YT7H 4OGXA 1O2XA 1L0ZA 1C1VH 4H42U 1QBVH 2GCHG 3DFLA 3TH4H 1ZPBA 3ZYEA 3P92A 4GHQA 1VR1H 1K9OE 4E06H 3PROA 4ZMAH 1XUGA 3QO6A 1ZSKA 3WY8A 1CHOF 1G2MA 1VCQA 4AB9A 4E05H 4BXWA 1EOLA 3QLPH 3B9FH 3PLPA 1W7XH 1GHYH 2BDCA 2RG3A 6CHAB 4LZ1H 3A7YA 2FX6A 1P9SA 2ANYA 1S5SA 2A5KA 1V2OT 3A8CA 1VCPA 3RU4E 2AH4X 3PMBB 3M61U 4K3JA 2O8UA 2G5VA 1C5LH 2FEQH 4UONA 3GCNA 3LJOA 1E0FD 1WU1A 3I78A 5A8YA 1CBWB 1TGSZ 1F5RA 2ZU5A 5EGMA 2PGQB 3SU0A 1O39A 4YOIA 2ODQA 4ABEA 3E0PB 6CHAC 2UUKB 2ZF0H 1BBRK 1LVMA 1QY6A 2ZU1A 1EUFA 2A32A 5EQSA 1BRUP 1MH0A 4Y7BA 1W3CA 4FU7A 1HIAA 1BDAA 3L33A 1F0TA 1G3CA 1KY9A 2PSXA 3HK6B 4MTBA 4ABBA 3ENSB 1K2I1 5L6NH 2C8YB 4X1PU 1CBWC 3OX7U 2A0QB 3EA9A 3T62A 1KSNA 2BDBA 1O2QA 2R2WU 3K6ZA 3A7VA 2VNTA 1C1QA 3GDVA 4Y10E 1RTKA 4X2XA 3RXGA 1THRH 2C8WB 1NO9H 2P8OC 1FDPA 4MNYA 5JDUB 1IQHA 1O3DA 3TGKE 1D3TB 1H9IE 5DP8A 4X2VA 5HM9A 2BDGA 3Q00A 1O2UA 3A87A 3QUMP 5EW1H 3RM0H 1BITA 1C5ZB 2RA3A 8ESTE 2BVSH 2RCEA 3RMMH 4TWWA 2GDDA 1O5DH 1UCYE 3CP7A 6GCHG 4UDWH 5FCRA 1S81A 4H6TA 5E2OA 3TVJB 1GG6B 4NCYA 2Y6TA 1YLDA 3EAJA 1PQ5A 5C1YA 5CHAB 2AIPA 1Z8GA 4B2AA 8GCHF 1DITH 1O3NA 1KIGH 1BBRH 5GCHG 1UTMA 1TB6H 2FOHA 4ABHA 4DCDA 4I31A 2PHBA 1ZGIA 1BTUA 1CT4E 4NWKA 1DPOA 1HAVA 3IG6B 4AB8A 3FFGA 3MTYA 5AFYH 1E37B 2G4UA 4M7GA 1GG6C 3M7UA 1QRZA 1TPPA 1DM4B 3PLBA 1T8OA 3VB4A 4HTCH 1MZAA 3L6PA 4ABIA 1PPEE 1MU8B 4CHAB 3V3MA 3RXPA 5HYOA 1SLVB 1HLTH 2GCHF 2FYRA 5C2ZA 4Q80A 1G32B 1LDTT 1Z6EA 2SNVA 3KF2A 3UR6A 1Y5BT 1P3CA 2BLVA 5SGAE 1HV7A 2VU8E 1BRAA 2OC0A 3S69A 1CGHA 2F9UA 3ZVDA 3VB6A 1Z8JB 7GCHF 3D23A 1QTFA 3GCOA 4OS7A 3H5CB 2BD5A 1LKBA 3ZZ5A 1O2HA 1QBNA 1UO6A 2SGDE 2THFB 3LGYA 5JB9S 4MNXA 3P17H 4U30A 2ZG0H 1A46H 1ARCA 1BQYA 1NT1A 1UCYK 2EEKA 2ILNA 2PW8H 4Y8ZA 1AY6H 1CGJE 1LVBA 1A5GH 3RLYH 1S0QA 5I46H 1A3BH 1XUIA 1MKXK 3A83A 4AFQA 3A88A 3RMNH 3RXVA 4MPWA 1ANCA 1GBFA 2UUFB 2AYWA 5FX6A 2AMQA 2P59A 3E0NB 2Z9GA 2ZFRH 1Y3XA 2QA9E 1FPCH 1Z1JA 2ZO3H 3BTDE 2UWPA 2ZZUH 3A84A 1EB1H 1GBCA 5DO4H 2UUJB 1HRTH 2SGEE 6ESTA 1YPHE 3RMOH 2FOMB 4K2YA 5LPFA 1SLXB 2VVCA 4B2CA 3GCHB 1P04A 1EZQA 1TGTA 1GI4A 1YC0A 1EPTB 3SNEA 1H9LB 2PUXB 3QZRA 3E16B 4UD9H 2J34A 1P57B 1TA6A 1YPMH 2M5TA 2PTCE 4NIVA 4MLFB 3VEQB 3NPSA 3UNSA 2RA0A 1A0LA 1ZTLA 1RGQA 1C2DA 3O8CA 1CQQA 2QGRA 5HMAA 1TABE 3SV8A 1UCYH 1QB9A 1JMOH 1GVKB 4B74A 3GCHC 2I6QA 4ISNA 1RIWB 1MQ6A 1EPTC 4GLYA 2GV6A 1NY22 4X2YA 1OWDA 1MKXH 1WCZA 2V0BA 3LONA 3PMJA 2BY5X 5GCHF 1GBJA 1GPZA 5L30H 1UVSH 3RXDA 1P01A 5C5OA 4BAKB 4INHA 3OY5U 1B0EA 4YOJA 2PV9B 4ISHH 2FTMA 1QURH 2VIQA 3TIUA 2TBSA 3LGUA 3SU5A 2B8OH 5HM2A 5DJ7A 2BXTH 1AKSA 1T8NA 1UHBB 1NRPH 1THSH 2Y81A 3SUEA 3PM3A 1RIWC 4CBOA 1Z8IB 3MU1A 5F03A 1WSSH 4Q7ZA 1ESAA 1TGNA 2XNIA 4GAWA 1SHYA 1QRXA 2GGVB 3A81A 1UTLM 1O2YA 3TNTA 3S7KB 4Y6DA 3GOVB 1D4PB 2BZAA 4TPYA 4U32A 1Y3WA 5DP3A 1WV7H 2ZDAH 1C5UA 1HGTH 1BTPA 1T32A 4ZKRU 4A1VA 1H9HE 4BAOB 1DOJA 2ULLA 4X6MA 5H4IB 2VIWA 1U6QA 4NIWA 1S6FA 2XCFA 2P3TB 3MH5A 2LNCA 1V2VT 3E6PH 3GDSA 5EXMA 1A5IA 2NU4E 1V6DA 4MPUA 2ZFSA 1NC6A 4JYVH 3BEUA 3LGVA 2SGFE 3Q77A 2A7HA 4GCHG 2Y7XA 1TQ0B 4WF8A 1O2SA 1GBTA 4X6OA 1Q31A 3ZZ7A 4MPVA 5EODA 4Y0YE 1DUEA 2R2MB 1A2CH 4J1YA 1A0HB 3BTQE 2OBOA 4Y79A 5E0HA 1BTWA 4ABDA 1MTVA 4ASHA 1ELBA 1GHBF 2FP7B 4IN2A 1HIAB 4K5ZA 1BHXB 3K2UA 1OYTH 1A4WH 4DW2U 1FIWA 4WH8A 1LKAA 1MUEB 4ZHMU 3BEIB 1NFXA 2C8XB 2PKAB 2WPJS 4IGDA 2J92A 1MU6B 1KXAA 2GKVE 1V2LT 1DLEA 1GBMA 2P93A 1J14A 1C4U2 4F49A 4X1QU 3QK1A 4SGBE 3BN9A 4OS6A 1K1OA 4KP0A 1SGEE 1UVUH 2ZDMA 2BOKA 2FPZA 3TJVA 2BD3A 1SFIA 5AFZH 2FOGA 4DIHH 1G3BA 1AN1E 2K1QA 5FCKA 1KLJH 1HAIH 1AQ7A 2FOBA 2V3HH 3QX5H 1J17T 1TALA 2ZI2H 5DG6A 1QBOA 3P70B 5FAHA 3ZVBA 4XBDA 3MYWA 3U69H 3O8RA 5E0JA 2C4FH 3RM2H 2NU3E 1GJ9B 2D26C 2FIRH 2Z9KA 3TK9A 1H8IH 1XXFA 2DUCA 1V2WT 3FZZA 1OWEA 1WAYB 4AX9H 1ZZZA 1F5KU 2F91A 1M9UA 4X8UH 1GHAG 1GJDB 1HDTH 1LMWB 1O3BA 3RXBA 1GVLA 1IQIA 3BTTE 1BOQA 2UWLA 1P2MA 3VB3A 3RC6A 3PB1E 3VXEH 1QA0A 3KNXA 3KQCA 5E8EH 1C1RA 2VVVA 1JIRA 3KN2A 3SW2B 1LQEA 3MH6A 1ZRBA 1HYLA 2H9HA 5DP7A 5C5NA 2XYAA 2SGAA 1G3EA 5HXFA 1SSXA 1SGNE 1YM0A 1EJAA 2Y80A 4I7YH 4FUGA 1GI7B 1PPZA 1THPB 2A31A 5CMXH 1C9TA 1IQMA 1UTKA 4MNVA 1O2PA 1QB6A 3SU3A 3SV7A 3QTOH 1XVMA 2Y5GA 2FOFA 1HJ8A 5ESBA 2XC0A 1O3CA 1Z6JH 5HGGA 2R3YA 2Q1JA 1KTTB 2D8WA 2PLXA 4BAHB 2NU0E 9LPRA 3RXMA 1TNHA 5GIBA 2ZTZA 2TGDA 1YPKH 1HAZB 4NGAH 4ZHLU 1T7CA 3S9AA 4JZEH 2FLBH 1C2HA 1WTHD 1FAKH 1MQ5A 5G4BA 3DHKH 1AZZA 1QJ7B 1UTOA 3ESTA 2ZDKA 1C5WB 1D6RA 3HGNA 1YPEH 4Y7AA 4B76A 1O3OA 5EQRA 4GCHF 1ZTJA 2F9VA 3HKJB 1P03A 1JWTA 3LT3A 3Q3KA 1DFPA 1O37A 4X1SU 1MZDA 1EAXA 2WYJA 4HFPB 3K65B 2EI8A 3E3TA 4AN7A 3JZ2B 1GBLA 8KME2 1OWKA 4R8TB 1FY5A 2PSYA 4Y8XA 4YTAA 3GY2A 1LO6A 1O3GA 4GSOA 5PTPA 4WXVA 4YLUA 1ZTKA 4FUHA 1Y5UT 4WH6A 3UNRA 1ID5H 1FUJA 1IQFA 2P3FH 3SV2H 3FVFB 3LOXA 4O3UA 3SU2A 8GCHG 4Z0KA 1TNIA 4WWYA 1BA8B 2AGEX 2FWWA 2ZU2A 1QCPA 3P8FA 1E34B 3P8NA 3QTVH 2OLGA 3A82A 4I32A 3GISB 1TMUH 1JBUH 1C5QA 3MH7A 1F2SE 3O8DA 5EPYA 4ZHAA 4H6SB 2H2ZA 4XBCA 1NFYA 3V0XA 1EAWA 2FI4E 3MHWU 2XRCA 1P2IA 1ABIH 4ZKOU 5ABWA 1QJ1B 1BTXA 1FONA 1ZSLA 1RD3B 3A7TA 1FPHH 3SJIA 4X6NA 5ETXA 3MFJA 5A2MH 1LVOA 2CHAB 4E7NA 1Y5AT 5FPYA 5LPEA 1ELGA 1MKWK 1XX9A 1YGCH 1GJ4H 1K1PA 1HAGE 3DFJA 3U1IB 1C2MA 1W10U 4MPXA 2P95A 5DK1A 2ZFTA 4AORA 2W7SA 1G37A 1OSSA 1C1UH 1B0FA 3ZZBA 7GCHG 1GHAF 2BDIA 3KL6A 1ZMNA 2WV5A 2VIPA 2DE9A 1PQ7A 4TYDA 1LHFH 2ZHWH 1K1JA 3RXSA 2FMJA 3QWCH 3E1XB 1FLEE 1AVWA 1TONA 2CHAC 4OGYA 4K1TA 2BD2A 3LPRA 2FLRH 1SGIB 1DXPA 4DGJA 1EZSC 4OS2A 1NTPA 3SI4H 1S6HA 1UVOA 5TJXA 3TGJE 1DY9A 1ZHMA 4Y11E 3QGNB 1C1OA 4IC5A 1O0DH 1BMNH 2IOTA 2ANKH 1V2NT 1E38B 1O3AA 1DWEH 1C1PA 1UTQA 2AMPA 3Q3XA 1GJBB 1G30B 2GZ9A 1E35B 4CR5A 2G81E 2JH0D 2FS9A 2Z7FE 1GJAB 3BIVH 1MKWH 1W13U 1ACBE 1IQJA 1SGFA 3A8DA 1FZZA 1O3LA 5C3NA 3ATMA 2H1UA 1O2WA 1GBIA 2VIVA 4B2BA 3ZZAA 2XCNA 3UQVA 3MH4A 2CXVA 1TX6A 2ZCHP 3KCGH 3NK8A 2HNTE 1AZ8A 4CRDA 2ZA5A 2DE8A 1ZHRA 2BD9A 1C5SA 3G01A 4UFDH 7ESTE 1V3XA 2J95A 4O3TA 1IOEA 2ZHQH 3GY5A 4YOGA 4ZKSU 1NRSH 5A0AE 1SQOA 3DA9B 1OS8A 2J4IA 5AHGH 1SHHB 1SGTA 1A7SA 1V2MT 3M5NA 1RJXB 3E8LA 5BRRE 3RXEA 2BB4A 4WVPE 3ATWA 3F1SB 1BJVA 2SGQE 3NXPA 3EA7A 4AGJA 3M3VA 1IQKA 2XWAA 2HOBA 3DUXH 1TQ7B 1LHEH 1TOMH 3TH3H 1DY8A 1O36A 1GJ6A 2C8ZB 2KAIB 2ZCKP 1GJCB 3UFAA 1TFXA 2BTCE 2G5NA 2WPKS 1HAHH 2ZDVH 1CA0B 1N6XA 1JIMA 4INLA 3C1KA 1QR3E 5CHAC 3SQEE 4NG9H 2PTNA 1H4WA 5E2PA 5GXPA 2TPIZ 2HRVA 4UFGH 1O2KA 1GCDA 3PLKA 3VXFH 1BT7A 1O32A 3SUFA 4AOQA 1SFQB 1GCTB 3C27B 1EKBB 3AW1A 1TNKA 3CS0A 4KKDA 3I77A 2ALPA 5DPAA 3Q76A 1SLUB 1KXBA 2F9PA 4K1SA 1C5TA 2VVUA 1FV9A 2OUAA 3U1JB 4K60A 1CA0C 5GDSH 1YKTA 3ODFA 5A0CA 5L2YH 1CU1A 2R3UA 2H6MA 2SFAA 4WMDA 4CHAC 3BSQA 4FVDA 1C1MA 1VITG 4FUDA 3ZZDA 1GCTC 1S83A 4DOQA 3R0FA 1GI2A 2FI5E 1LVYA 2ZFFH 3PWCA 3PO1B 1YPJH 1GI3A 4AGKA 2VH6A 1GDUA 5C20A 2Z3EA 2BY7X 3P8OA 1BMLA 3V13A 1DWBH 4TPIZ 2EA3A 1TGBA 3PTBA 5EPNA 1KLTA 4B73A 1O5CB 1NN6A 1F92A 3FANA 1NU7B 1YCPH 2ESTE 1IAUA 1GHBG 1OP8A 4J2YB 1O2OA 1UTPA 4A6LA 2EI6A 1GBHA 4X8TH 3SNBA 4WMFA 3URCA 1K22H 3SN8A 1BIOA 1TA2A 2AGGX 1C5PA 2WPIS 3GICB 4I33A 2GT8A 1KDQA 3PO1C 2UWOA 5FBEA 1GBBA 3TK6A 2P16A 1TAWA 3LDXH 4NFFA 2R0KA 2FESH 1C2KA 1P8VC 5DP5A 2AEIH 1T31A 4RN6A 1NRQH 1GHXH 1MD7A 2SNWA 2WUBA 1OWIA 3V7TA 4A1XA 1LHCH 1PPBH 3P8GA 1C2EA 1GBDA 1NFUA 2BY6X 3GY7A 2Z9JA 3M3SA 2BQWB 1EAIA 1HB0B 4VGCB 1N6YA 2VH0A 5A09A 3UOUA 2A2XH 3SNDA 2BLQA 4BNRA 1NFWA 3BTHE 1TYNA 3LC3A 1E36B 1PQAA 1HCGA 1NRNH 4YM9A 1QB1A 1VJ9U 3LH3A 4YT6H 2A4QA 2IPHA 3SGAE 5JBAS 7KMEH 1DXWA 2ZPSA 2R0LA 1KYNA 2NU2E 3RMLH 1HAPH 1AUJA 3QZQA 1MD8A 1C5VA 1K21H 1ETRH 1N8OB 2FS8A 2SGPE 1CSOE 1Y8TA 2HNTF 1LCYA 2HLCA 3F9GA 1P2QA 1NZQH 4X8VH 3RXKA 4VGCC 3MU5A 1Z8RA 3HK3B 2HALA 1RXPA 4IMQA 1TBZH 3FP8E 1DICA 3JZ1B 3ZZ9A 3UTUH 3EE0B 4JCNA 3OY6U 2BQ7B 1VITH 1T8MA 4UE7H 1YCPM 4BAMB 5FHTA 5IDKA 3RXIA 1WUNH 2AS9A 4RKJB 2OC1A 3SO3A 3ZVEA 1NRRH 3HATH 3RXAA 3A7ZA 3MI4A 4NA7A 3GY3A 4X2WA 2G8TA 4A7IB 3MU4A 3EGKH 2D2DA 3A86A 1PPHE 3ZYDA 2Z9IA 1EZUC 2BX4A 4FUJA 4TWYA 5JBBS 1L1JA 2B0FA 3GY8A 4IBLH 1XM1A 3TH2H 4OS5A 1T4UH 1A1RA 2FOAA 2OTVA 1ANBA 3ZZCA 1O3KA 3SUDA 3RXOA 3U98H 1IQGA 4F4OC 2RDLA 3SJKA 4IMZA 2QC2A 1GGDB 4FVBA 1TPSA 2ZGBH 2OQUA 3PYHA 2W7UA 1VITF 4HGCA 4DG4A 1XUKA 1O5FH 2BD8A 1BTYA 4X0WU 2BD4A 4Q2KA 5LH8A 1O5EH 2QXIA 2F3CE 1MMJN 2VB0A 2ZNKH 3M7TA 4K8YA 2CN0H 5I25A 1YF4A 2PKSB 1TMBH 5JPMH 4A5TS 1NS3A 1RTFB 2GDEH 1GHWH 2A7CA 2QAAA 2A4GA 1OP0A 3ZVCA 3EQ0H 2WINI 1YPHC 4KTCA 1GGDC 1P06A 1O2MA 1KXEA 1F0SA 4FUFA 2CV3A 1GDNA 2Y7ZA 4GUXA 1L2EA 1BTHH 3S9BA 2OXSA 1ZYOA 1MTNB 1JOUB 1PPFE 3MO6A 2VGCB 2XBVA 2ZQ1A 4K69A 2F83A 3BTFE 1ZPZA 4E7RG 3SV6A 3N7OA 2JH5D 1SBWA 2PKSC 2TGTA 1UJ1A 2R9PA 3RLWH 3GY6A 3TPIZ 4AG1A 4ZROA 1QRWA 1PQ8A 3GYMA 3FP7E 2ZFQH 4JZIA 5C1XA 2EC9H 1RFNA 1TNGA 3MNSA 3BEFB 4ZUHA 1ELVA 4CR9A 1O2VA 1QQUA 2ALVA 1QQ4A 3EA8A 1GHZA 2VIOA 1EP5A 1ABJH 4YESB 1FY1A 1DE7H 1OOKB 3UNQA 3RXQA 2WV4A 1WBGB 1F0RA 2ZFPH 4AG2A 4Z6AH 3SHAH 3A89A 4D8NA 2VWMA 1LPZB 3U8TH 2VJ1A 4Y8YA 3MO3A 2ZGJA 5AF9H 3T5FH 3VB5A 1L4DA 1BCUH 3ZVGA 1Z71A 5DKMA 3SBKA 1VJAU 2BDAA 4RKOB 1Q3XA 2BM2A 3MNCA 3RXTA 2VIDA 2ZGCA 1O3HA 3FZDA 1G3DA 4BTTB 2G52A 4ABAA 3SORA 1ZMLA 5FPTA 1ZHPA 4LZ4B 1C9PA 1ELDE 4XFQA 1FQ3A 3M35A 2ODYB 5F8ZA 4LK4A 1YP9A 2BVXH 1HAVB 2OD3B 1TMTH 3AAUA 1QFKH 4O97A 4RSPA 2ANMH 4KGAA 2WYGA 3GDUA 1J15A 1J16A 3SNAA 3TGIE 2F9OA 2STAE 3VGCB 6LPRA 1XUHA 1BRCE 5TCAA 2Z6BD 2JH6D 2BY8X 1OWJA 5F8XA 4WY3A 1BTZA 1UK2A 4FUBA 2J94A 2GZ7A 1C5NH 1O5GH 4IW4E 3RXFA 9ESTA 3SOSA 1TWXB 5A8XA 1EASA 1P2OA 2OINA 3SNCA 2STBE 4LOYH 4Y0ZE 1AVXA 3VGCC 2ANWA 3UUZA 1O30A 1ANEA 3P95A 4QT8C 1HAXB 1UK3A 2G4TA 1O31A 4D7GA 1MTSA 2XTTB 2VWNA 1OP2A 3P6ZB 1ETTH 1ZR0A 2ZCLP 1O3FA 2C3SA 3F9FA 4ISIH 3F68H 1O2LA 4FUIA 3VFEA 2V3OH 2ZU4A 2GT7A 1GJ8B 2XBWA 1P11E 1GVZA 3MO9A 2CJIA 1T8LA 1BB0B 3RC5A 5T6FA 3UQOA 1FY4A 3QN7A 3RU4T 1CA8B 2GTBA 1FMGA 2ODPA 3SUGA 1EPTA 1IQNA 1XXDA 2OCVB 3LKWA 4ZXYH 3TLOA 5T6GA 1HJ9A 1EOJA 1HUTH 3DT0H 1P2KA 2FOCA 5C67A 5JBCS 3GCTG 1C5YB 3MOCA 3M37A 2ZKSA 1AIXH 1GBEA 2QIQA 2AGIX 3M36A 2TIOA 3KQDA 1C1NA 1O3PB 1AE8H 4ZH8A 2FODA 1SVPA 1AGJA 1C2FA 1GMDG 1CE5A 4NA8A 3O8BA 2PUQH 1FIZA 1WTGH 4D9RA 3SHCH 1H8DH 2FOEA 2BX3A 1SB1H 5ESTE 2WPMS 1TLDA 4TY7A 5GWZA 1FJSA 5LGOA 1KLIH 1XKBC 3LC5A 2HWLB 4IN1A 4GVUA 4LXBH 1O33A 1P2JA 5BPEA 1V2KT 3TK5A 2BD7A 3AW0A 1TPAE 4NIXA 2QY0B 1S82A 1ELEE 2PGBB 3ZZ8A 3RXCA 3VPKA 2G00A 3ZZ6A 3TJOA 2ZTYA 3PWBA 3T26A 1OYQA 3U8OH 2QN5T 3HGPA 3D49H 3UIRA 4FXGH 4MDSA 4WJG2 4CH2B 2AERH 1V2QT 3F9HA 2ZHEH 1H1BA 2CF9H 4CRFA 1SR5C 3B8JA 1FXYA 3RXRA 2VINA 1HPGA 1QL9A 2F9NA 2ZGHA 4O03A 1ELCA 3L3TA 1Y3YA 1T4VH 4ZXXH 1C5MD 1ELTA 1SLWB 3UR9A 3V12A 3OTJE 4O9VA 3D65E 1AKSB 3SGBE 4FUCA 2W26A 1QL8A 3TJNA 4NSVA 1K1MA 4NZLA 4H4FA 1C2LA 3MWIU 1SGRE 3TITA 3TNSA 3ZZ4A 1TOCB 1AMHA 4NZQA 4DY7B 1LPGB 4CBNA 3BTEE 4BANB 1L1GA 1UVPA 1EX3A 1C1WH 1HXEH 2WPLS 1D9IA 2FTLE 3BG8A 4AZ2B 1HXFH 1O5BB 2TRMA 2H5CA 2ZGXH 4CRBA 4AYVB 1WQVH 1PFXC 2P8OB 1C2IA 1O2IA 5FPSA 2JKHA 4ESTE 1JRSA 4B71A 5EU8A 1D3PB 3LGIA 4A92A 1RS0A 4BTIB 2P3UB 2GD4B 2XXLA 5B6OA 2Y82A 4DURA 1TX8A 1YYY1 2PKAA 1CHGA 1W7GH 1LHDH 2J2UA 2ASUB 3D62A 2BYAX 1GWAA 1C5OH 3M3TA 4BTUB 1W0YH 3H7OA 4UFFH 4DVAU 1CO7E 3A85A 1F7ZA 1NESE 1OXGA 1LTOA 3PTNA 3W95A 2JETB 2OQ5A 1HNEE 1G9IE 2OC8A 1K1NA 4WXIA 5IYTA 3CENA 4A1TA 1DVAH 2VWLA 5FBIA 3HPTB 4YZUA 1EATA 1Y3UA 1VGCB 5GJ4B 3GCTF 2A45B 1C5RA 1ARBA 1EP6A 2I6SA 1AO5A 4ZAEA 3K9XB 1UVTH 5A0BA 4WMEA 4ABGA 3LIWA 1INCA 3ZVAA 1SC8U 1TBQH 3QGJA 3QDZB 4JZ1A 2GX4A 1C1TA 3T29A 1IQEA 1YCPK 1GMDF 4X1NU 2JETC 2A4OA 3EDXB 3M5OA 1V2ST 1UTNA 3PMHB 1OWHA 5K7RA 4ABJA 1HAOH 3FP6E 1BJUA 2ZIQH 1MAYA 1DDJA 5DP4A 1VGCC 2J38A 3M5LA 1V2TT 1O2RA 4AFSA 1CT0E 1TRNA 4KTSA 5EW2H 3I29A 1GL1A 5DGJA 4Q7YA 1SGDE 2C90B 1O34A 1MAXA 3ZV8A 1CVWH 1GL0E 1XUJA 4BAQB 2ZTXA 3A7XA 1YBWA 1EXFA 3LGTA 1IQLA 1DUAA 1P09A 4CRGA 3AAVA 3ZV9A 2ZDLA 3NUMA 3KQEA 1O3JA 3E90B 2BQ6B 1DS2E 4BXSA 2BXUH 4KTUA 1BMAA 2W5EA 1ORFA 1O38A 2BLOA 1SQTA 1GHVH 4NFEA 2FYQA 1W14U 1HJAB 3SJ8A 2W3IA 2Z94A 2FI3E 1AWFH 2HPPH 1IHSH 1TBRH 2YNBA 4HI3A 1K28D 1LHGH 1ZJKA 4X8SH 1MBMA 1MTWA 2O8LA 2BY9X 3K6YA 3U8RH 2D1JA
chains in the Genus database with same CATH superfamily
1LPKB 4OS4A 2YOLA 4XOJA 2VBCA 1O35A 2A2QH 2XBXA 3KIDU 4CRAA 1AFEH 1X7AC 4THNH 2H9TH 1XMNB 3RDZA 3S7HB 1FNIA 1DWCH 4U2WA 4XBBA 1LQDB 3T2NA 1HJAC 2Y5FA 2QV1A 3STJA 3ATIA 5K0HA 4ASUD 4FUEA 2HNTC 1PYTC 1AVGH 4ABFA 4NA9H 2OC7A 4I8HA 1SL3A 1Y59T 4JK6A 1FY8E 5CHBA 1TIOA 2BDYA 4NIYA 1MTUA 1K1LA 3RXHA 1P10A 1TX7A 2GP9B 2A5AA 3ZZ3A 2PWXA 2XW9A 4B75A 2A1DB 1UK4A 2GCTB 2H9EH 3NZIA 2KFWA 2FM2A 1A61H 1P9UA 1V2PT 1L4ZA 2Z3CA 2B9LA 1SOZA 1P02A 4IS5A 4YLQH 4ISLA 5C94A 1BZXE 5DP9A 5JBTA 2BOHB 4INKA 3MU8A 1EQ9A 2FO9A 3VB7A 4X6PA 3BF6H 1SGQE 1FY3A 1QGFA 1GMCG 1ZSJA 3A80A 4KELA 3DSPA 2IPQX 2NU1E 1TNJA 2ZU3A 2VWOA 3OE7D 4B1TA 4GPGA 1S0RA 2GCTC 1YPLH 1P12E 3MNXA 2O9QA 6GCHF 1BMMH 4SGAE 4R0IA 3SU1A 2QXHA 1FI8A 1V2UT 1Y3VA 1SI5H 1D3QB 3MU0A 2ZWLH 1AHTH 1MBQA 3BTWE 1SOTA 3T28A 2TGPZ 1BUIA 2TGAA 4XSKU 4MNWA 2H5DA 5T3HA 3GY4A 3RP2A 4I8JA 2A7JA 3ATLA 2IN2A 1EAUA 1DX5M 2HPQH 4Y71A 1ETSH 1SGFG 3OSYA 1F0UA 2FXRA 3LH1A 3OU0A 1XKAC 1B7XB 2ZP0H 1N8OC 4UEHH 7LPRA 1FAXA 3KYGA 5E0GA 3T25A 5HIZA 4NWLA 2G55A 4IC6A 1C2JA 1O2TA 2BLWA 2FDAA 1AE5A 1TGCA 2NWNA 3SI3H 3E91A 2Q6DA 2F9BH 3RUOA 4ACBA 1RRKA 2YNAA 3SQHE 3A7WA 4I8LA 2BHGA 1KXCA 3EE7A 3F9EA 2V35A 1YWUA 3A8BA 1IHTH 1NM6A 1W2KH 3S9CA 1AD8H 4BOHA 8LPRA 1HAYB 1HFDA 1GI6A 1L1NA 1PPCE 1DLKB 1GDQA 2Y5HA 3SU6A 1GMHG 4JYTA 1MCTA 1W11U 1ZGVA 1A5HA 5JYIA 2ZDNA 4DIIH 4ZKNU 2Q6GA 3TJUA 1A3EH 1MCVA 4UFEH 1G36A 2J98B 4JK5A 1GBAA 1GJ5H 1WQSA 5KEDA 3MNBA 1SKYE 2ZC9H 3UREA 1GJ7B 1S84A 2IJOB 1TPOA 1QA7A 2A4RA 1SQAA 5EIYA 2G51A 1SGCA 1K1IA 1TRYA 2YMSB 4I8GA 4XE4A 1C4V2 2AMDA 4CRCA 3PV4A 5TCCA 5C1UA 3R3GB 5JB8S 4MG3A 3RU4D 2ZQ2A 3AVZA 3ELAH 3MMGA 4YO9A 2GV7A 1DANH 1AUTC 4K8BA 2HVXA 1FN8A 3NCLA 3EYDA 5FL7D 5F6MA 5J4SA 3SJ9A 1FX0B 1GI9B 3KYFA 3UWJH 3SGQE 2XWBI 4NSYA 2ZECA 5EXNA 3UWIA 1G2LA 4ISOA 2YMSC 1QZ8A 3U9AH 1DT2A 2PFEA 2C93B 1ZMJA 1MTNC 3BTGE 3M5MA 1EB2A 1XUFA 1ZRKA 2VGCC 1FN6A 3KEEA 3SU4A 1O5AB 2OP9A 1TE0A 1PJPA 2KAIA 1W12U 1V2JT 1ESBA 2Z9LA 3PMAB 1C4Y2 1GI8B 1VCWA 1GI0A 1UTJA 3U28C 1ESTA 4MVNA 3ZIAD 1DSUA 1C5XB 3IITA 1OPHB 3KQBA 1ANDA 1YPGH 1GMCF 1EJNA 4JYUH 4JZFH 1DSTA 2GMTB 2ZHDA 1QIXB 1O3EA 1JRTA 2BVRH 1EZXC 4OS1A 1OKXA 1PYTD 5C0TA 1CHOG 2B7DH 1P2NA 5EG4A 3S0NA 1C1SA 1TNLA 2FX4A 2QF3A 5GPIB 3UPEA 1AWHB 3W94A 1COWD 3BG4B 3M7QA 2ZPQA 1W0ZU 4JZDH 4X1RU 1P3EA 2A5IA 5T6DA 4CH8B 1GI1A 2BZ6H 4FU8A 3SJOA 1D3DB 1EFRD 1AFQB 5LPRA 3KHVA 2GMTC 1D6WA 3SYJA 1BHXF 1AB9B 5F8TA 3DD2H 4PROA 2W3KA 3KGPA 4D9QA 2BMGB 4GHTA 3LGWA 5EXLA 3GYLB 2B5TB 1ZOMA 1C2GA 3UOPA 3ODDA 3BTME 1XVOA 1QNJA 1QL7A 2XC5A 3NWUA 1O3MA 3BTKE 3HKIB 3T27A 2WPHS 4D76A 3BG4C 1WOFA 1H8ED 3H7TA 2Z3DA 4HZHA 3DCLA 1F5LA 1TRMA 1P05A 1N1LA 4Q7XA 1NPMA 2J9NA 3URDA 3WWFA 3FKSD 1V2RT 1EJMA 1NROH 2PR3A 2Q6FA 3SZNA 2AFQB 1SGYE 5A8ZA 4FETA 1AFQC 1GMHF 2QF0A 2LPRA 1WYKA 5AVDA 1BRBE 2CGAA 1O2ZA 4DT7B 1AB9C 1OX1A 2O8WA 1BMFD 2OBQA 2ZPRA 3NKKA 4AYYB 1E79D 1Z7KA 2QCYA 4XDEA 3OYPA 1J8AA 1Z1IA 3ATKA 1O2NA 4JMYA 3SV9A 1ELAA 2EI7A 1B5GH 1O3IA 2V6NA 1YLCA 3ZVFA 3BIUH 4AFZA 5FX5A 3TU7H 2O8MA 5L2ZH 3F2HA 2UUYA 1W8BH 3LJJA 4AFUA 2GVFA 2QXJA 5EQQA 5F53A 3STIA 5EOKA 3RXJA 2QXGA 1SMFE 1CGIE 1AU8A 1Q2WA 4Y76A 1RTLA 2AIQA 4MQAA 4FU9A 3UY9A 1KDQB 1KXFA 1A0JA 3AASA 5EJZA 4RT1A 4CREA 2ZEBA 4K1EA 1HBTH 2EY4C 1KXDA 1KTSB 1VZQH 1SG8B 2CMYA 3IWMA 1QJ6B 3A8AA 1QHRB 2XC4A 3RXLA 2CF8H 2GZ8A 2FZZA 3F6UH 1SPJA 4M9FA 5FXLA 1ZPCA 1ZLRA 5DP6A 4DJZB 1J9CH 1BBRE 2P94A 1JXPA 1UMAH 4U01A 1ZJDA 3RC4A 1O2GH 3Q3YA 5CE1A 1P0SH 3B23B 2XBYA 3LU9B 4TY6A 2F4LA 1PPGE 2WUCA 1GI5A 2BDHA 3CS7A 2HGTH 4I8KA 1S85A 1O2JA 1CT2E 1AI8H 3RXUA 3ITIA 4D7FA 1DWDH 2ZHFH 1GBKA 3BV9B 3FAOA 1UHBA 2O8TA 5J4QA 1SGPE 1MABB 3OFND 2WV9A 1ELFA 2J97A 2QYIA 1NU9A 4YT7H 4OGXA 1O2XA 1E1RD 1L0ZA 1C1VH 4H42U 1KMHB 1QBVH 2GCHG 3DFLA 1SQRA 3TH4H 1ZPBA 3ZYEA 3P92A 4GHQA 1VR1H 1K9OE 4E06H 3PROA 4ZMAH 1XUGA 3QO6A 1ZSKA 3WY8A 1CHOF 1G2MA 1VCQA 4OM9A 4AB9A 4E05H 4BXWA 1EOLA 3QLPH 3B9FH 3PLPA 1W7XH 1GHYH 2BDCA 2RG3A 6CHAB 4LZ1H 3A7YA 2FX6A 2YMSD 1P9SA 2ANYA 1S5SA 2A5KA 2F43B 1V2OT 3A8CA 1VCPA 3RU4E 2AH4X 3PMBB 3M61U 4K3JA 2O8UA 2G5VA 1C5LH 4B6FA 2FEQH 4UONA 3GCNA 3LJOA 1E0FD 1WU1A 3I78A 5A8YA 1CBWB 1TGSZ 1F5RA 2ZU5A 5EGMA 2JDID 2PGQB 3SU0A 1O39A 4YOIA 2ODQA 4ABEA 3E0PB 6CHAC 2UUKB 2ZF0H 4ZCNA 1BBRK 1LVMA 1QY6A 2ZU1A 1EUFA 2A32A 5EQSA 1BRUP 1MH0A 4Y7BA 1W3CA 4FU7A 1HIAA 1BDAA 3L33A 1F0TA 1G3CA 1KY9A 1S6LA 2PSXA 3HK6B 4MTBA 4ABBA 3ENSB 1K2I1 5L6NH 5DN6D 2C8YB 4X1PU 1CBWC 3OX7U 2A0QB 3EA9A 3T62A 1KSNA 2BDBA 1O2QA 2R2WU 3K6ZA 3A7VA 2VNTA 1C1QA 3GDVA 4Y10E 1RTKA 2L74A 4X2XA 3RXGA 1THRH 2C8WB 1NO9H 2P8OC 1FDPA 4MNYA 5JDUB 1IQHA 1O3DA 5GNDA 3TGKE 1D3TB 1H9IE 5DP8A 4X2VA 5HM9A 2BDGA 3Q00A 3H09A 1O2UA 3A87A 3QUMP 1YY3A 5EW1H 3RM0H 1BITA 1C5ZB 2RA3A 8ESTE 2BVSH 2RCEA 3RMMH 4TWWA 2GDDA 1O5DH 1UCYE 3CP7A 6GCHG 4UDWH 5FCRA 1S81A 4H6TA 5E2OA 3TVJB 1GG6B 4NCYA 5C0UA 2Y6TA 1YLDA 3EAJA 1PQ5A 4P00A 5C1YA 5CHAB 2AIPA 1Z8GA 4B2AA 8GCHF 1DITH 1O3NA 2J5UA 2KCYA 1KIGH 1BBRH 5GCHG 1UTMA 1TB6H 2AHME 2FOHA 4ABHA 4DCDA 4I31A 2PHBA 1ZGIA 1BTUA 1CT4E 4NWKA 1DPOA 4P02A 1HAVA 3IG6B 4AB8A 3FFGA 3MTYA 2OK5A 5AFYH 1E37B 2G4UA 4M7GA 1GG6C 3M7UA 1QRZA 1TPPA 1DM4B 3PLBA 1T8OA 3VB4A 4HTCH 1MZAA 3L6PA 2CK3D 3FOAA 4ABIA 1PPEE 1MU8B 4CHAB 3V3MA 3RXPA 5HYOA 1SLVB 1HLTH 2RFKC 2GCHF 2FYRA 5C2ZA 4Q80A 1G32B 1LDTT 1Z6EA 2SNVA 3KF2A 3UR6A 2KCPA 1Y5BT 1P3CA 2BLVA 5SGAE 1HV7A 2VU8E 1BRAA 2OC0A 3S69A 1CGHA 2F9UA 3ZVDA 3VB6A 1Z8JB 7GCHF 3D23A 1QTFA 3GCOA 4OS7A 3H5CB 2BD5A 1LKBA 3ZZ5A 1O2HA 1QBNA 1UO6A 2SGDE 3PRDA 2THFB 3LGYA 5JB9S 4MNXA 3P17H 4U30A 2ZG0H 1A46H 1ARCA 1BQYA 1NT1A 1UCYK 2EEKA 2ILNA 2PW8H 4Y8ZA 1AY6H 1CGJE 1LVBA 1A5GH 1YLNA 3F2GA 3RLYH 1S0QA 5I46H 1A3BH 1XUIA 2KCOA 1MKXK 3A83A 4AFQA 3A88A 3RMNH 3RXVA 4MPWA 1ANCA 1GBFA 2UUFB 2AYWA 5FX6A 3F3BA 2V7QD 2WZQA 2AMQA 2P59A 3E0NB 2Z9GA 2ZFRH 1Y3XA 2QA9E 1FPCH 1Z1JA 2ZO3H 3BTDE 2UWPA 2ZZUH 3A84A 1EB1H 1GBCA 5DO4H 2UUJB 1HRTH 2SGEE 6ESTA 1YPHE 3RMOH 2FOMB 4K2YA 5LPFA 1SLXB 2VVCA 4B2CA 3GCHB 1P04A 1EZQA 1TGTA 1GI4A 1YC0A 1EPTB 3SNEA 1H9LB 2PUXB 3QZRA 3E16B 4UD9H 2J34A 1P57B 1TA6A 1YPMH 2M5TA 2PTCE 4NIVA 4MLFB 3VEQB 3NPSA 3UNSA 2RA0A 1A0LA 1ZTLA 1RGQA 1C2DA 3O8CA 1CQQA 2QGRA 5HMAA 1TABE 3SV8A 1UCYH 1QB9A 1JMOH 1GVKB 4B74A 2K8IA 3GCHC 2I6QA 4ISNA 1RIWB 1MQ6A 1EPTC 4GLYA 2GV6A 1NY22 4X2YA 1OWDA 1MKXH 1WCZA 2V0BA 3LONA 3PMJA 2BY5X 5GCHF 1GBJA 1GPZA 5L30H 1UVSH 3RXDA 1P01A 5C5OA 4BAKB 4INHA 3OY5U 1B0EA 4YOJA 2PV9B 2W6JD 4ISHH 2FTMA 1QURH 2VIQA 3TIUA 2TBSA 3LGUA 3SU5A 2B8OH 5HM2A 5DJ7A 2BXTH 1AKSA 1T8NA 1UHBB 1NRPH 1THSH 2Y81A 3SUEA 3PM3A 1RIWC 1OHHD 4CBOA 1Z8IB 3MU1A 5F03A 1WSSH 4Q7ZA 1ESAA 1TGNA 2XNIA 4GAWA 1SHYA 2KCAA 3F0PA 1QRXA 2GGVB 3A81A 1UTLM 1O2YA 3TNTA 3S7KB 4Y6DA 3GOVB 1D4PB 2BZAA 4TPYA 2HLDD 4U32A 1Y3WA 5DP3A 1WV7H 2ZDAH 1C5UA 1HGTH 1BTPA 1T32A 4ZKRU 3F0OA 4A1VA 4F48B 1H9HE 4BAOB 1DOJA 2ULLA 4X6MA 5H4IB 2VIWA 1U6QA 4NIWA 1S6FA 2XCFA 2P3TB 3MH5A 2LNCA 1V2VT 3E6PH 3GDSA 5EXMA 1A5IA 2NU4E 1V6DA 4MPUA 2ZFSA 1NC6A 4JYVH 3BEUA 3LGVA 2SGFE 3Q77A 2A7HA 4GCHG 2Y7XA 1TQ0B 4WF8A 1O2SA 1GBTA 4X6OA 1Q31A 3ZZ7A 4MPVA 5EODA 1NBME 4Y0YE 1DUEA 2R2MB 1A2CH 4J1YA 1A0HB 3BTQE 2OBOA 4Y79A 5E0HA 1BTWA 4ABDA 1MTVA 4ASHA 1ELBA 1GHBF 2FP7B 4IN2A 1HIAB 4K5ZA 3SZEA 1BHXB 3K2UA 1OYTH 1A4WH 4DW2U 1FIWA 4WH8A 1LKAA 1MUEB 4ZHMU 3BEIB 1NFXA 2C8XB 2PKAB 2WPJS 4IGDA 2J92A 1MU6B 3MQKC 1KXAA 2GKVE 1V2LT 1DLEA 1GBMA 2P93A 1J14A 1C4U2 4F49A 4X1QU 3QK1A 4SGBE 3BN9A 4OS6A 1K1OA 4KP0A 1SGEE 1UVUH 2ZDMA 2BOKA 4XRNA 2FPZA 3TJVA 2BD3A 5KECA 1SFIA 5AFZH 2FOGA 4DIHH 1G3BA 1AN1E 1K0HA 2K1QA 5FCKA 1KLJH 1HAIH 1AQ7A 4RI0A 2FOBA 2V3HH 3QX5H 1J17T 1TALA 2ZI2H 5DG6A 1QBOA 3P70B 5FAHA 3ZVBA 4XBDA 3MYWA 3U69H 3O8RA 5E0JA 2C4FH 3RM2H 2NU3E 1GJ9B 2D26C 2FIRH 2Z9KA 3TK9A 1H8IH 1XXFA 2DUCA 1V2WT 3FZZA 1OWEA 1WAYB 4AX9H 1ZZZA 3N99A 1F5KU 2F91A 1M9UA 4X8UH 1GHAG 1GJDB 1HDTH 1LMWB 1O3BA 3RXBA 1GVLA 1IQIA 3BTTE 1BOQA 2UWLA 1P2MA 3VB3A 3RC6A 3PB1E 3VXEH 1QA0A 3KNXA 3KQCA 5E8EH 1C1RA 2VVVA 1JIRA 3KN2A 3SW2B 1LQEA 3MH6A 1ZRBA 1HYLA 2H9HA 5DP7A 3VG8A 5C5NA 1WDIA 2XYAA 2SGAA 1G3EA 5HXFA 1SSXA 1SGNE 4YXWD 1YM0A 1EJAA 2Y80A 2RDEA 4I7YH 4FUGA 1GI7B 1PPZA 1THPB 2A31A 3OAAD 5CMXH 1C9TA 1IQMA 1UTKA 4MNVA 1O2PA 1QB6A 3SU3A 3SV7A 3QTOH 1XVMA 2Y5GA 2FOFA 1HJ8A 5ESBA 3N7DA 2XC0A 1O3CA 1Z6JH 5HGGA 2R3YA 2Q1JA 1KTTB 2D8WA 2PLXA 4BAHB 2NU0E 9LPRA 3RXMA 1TNHA 4FOUC 5GIBA 2ZTZA 2TGDA 1YPKH 1HAZB 4NGAH 4ZHLU 1T7CA 3S9AA 4JZEH 2FLBH 1C2HA 1WTHD 1FAKH 1MQ5A 5G4BA 3DHKH 1AZZA 1QJ7B 1UTOA 3ESTA 2ZDKA 1C5WB 1D6RA 3HGNA 1YPEH 4Y7AA 4B76A 1O3OA 5EQRA 4GCHF 1ZTJA 2F9VA 3HKJB 2V3MA 1P03A 1JWTA 3LT3A 3Q3KA 1DFPA 1O37A 4X1SU 2QF4A 1MZDA 1EAXA 2WYJA 4HFPB 3K65B 2EI8A 3E3TA 4AN7A 3JZ2B 1GBLA 8KME2 1OWKA 4DT4A 1WXRA 4R8TB 1FY5A 2PSYA 4Y8XA 4YTAA 3GY2A 1LO6A 1O3GA 4GSOA 5PTPA 4WXVA 4YLUA 1ZTKA 4FUHA 1Y5UT 4WH6A 3UNRA 1ID5H 1FUJA 1IQFA 2P3FH 3SV2H 3FVFB 3LOXA 4O3UA 3SU2A 8GCHG 4Z0KA 1TNIA 4WWYA 1BA8B 2AGEX 2FWWA 2ZU2A 1QCPA 3P8FA 1E34B 3P8NA 3QTVH 2OLGA 3A82A 4I32A 3GISB 1TMUH 1JBUH 1C5QA 3MH7A 1F2SE 3O8DA 5EPYA 4ZHAA 4H6SB 2H2ZA 4XBCA 1NFYA 3V0XA 1EAWA 2FI4E 3MHWU 2XRCA 1P2IA 1ABIH 4ZKOU 5ABWA 1QJ1B 1BTXA 1FONA 1ZSLA 1RD3B 3A7TA 1FPHH 3SJIA 4X6NA 5ETXA 3MFJA 5A2MH 1LVOA 2CHAB 4E7NA 1Y5AT 5FPYA 5LPEA 1ELGA 1MKWK 1XX9A 1YGCH 1GJ4H 1K1PA 1HAGE 3DFJA 4I86A 3U1IB 1C2MA 1W10U 4MPXA 2P95A 5DK1A 2L6OA 2ZFTA 4AORA 2W7SA 1G37A 1OSSA 1C1UH 1B0FA 3ZZBA 1W0JD 7GCHG 1GHAF 2BDIA 3KL6A 1ZMNA 2WV5A 2VIPA 2DE9A 1PQ7A 4TYDA 1LHFH 2ZHWH 1K1JA 3RXSA 3DSOA 2FMJA 3QWCH 3E1XB 1FLEE 1AVWA 1TONA 2CHAC 4OGYA 4K1TA 2BD2A 3LPRA 2FLRH 1SGIB 1DXPA 4DGJA 1EZSC 4OS2A 1NTPA 3SI4H 1S6HA 1UVOA 2J98A 5TJXA 3TGJE 1VKYA 1DY9A 1ZHMA 4Y11E 3QGNB 1C1OA 4IC5A 1O0DH 1BMNH 2IOTA 2ANKH 1V2NT 1E38B 1O3AA 1DWEH 2XOKD 1C1PA 1UTQA 2AMPA 3Q3XA 1GJBB 1G30B 2GZ9A 1E35B 4CR5A 2G81E 2JH0D 2FS9A 2Z7FE 1GJAB 3BIVH 1MKWH 1W13U 1ACBE 1IQJA 1SGFA 3A8DA 1FZZA 1O3LA 5C3NA 3ATMA 2H1UA 1O2WA 1GBIA 2VIVA 4B2BA 3ZZAA 2XCNA 3UQVA 3MH4A 2CXVA 1TX6A 2ZCHP 4XD7D 3KCGH 2KZ4A 3OTPA 3NK8A 2HNTE 1AZ8A 4CRDA 2ZA5A 2DE8A 1ZHRA 2BD9A 1C5SA 5KGOA 3G01A 4UFDH 7ESTE 1V3XA 2J95A 4O3TA 1IOEA 2ZHQH 3GY5A 4YOGA 4ZKSU 1NRSH 5A0AE 1SQOA 3DA9B 1OS8A 2J4IA 5AHGH 1SHHB 1SGTA 1A7SA 1V2MT 3M5NA 1RJXB 3E8LA 3OEED 5BRRE 3RXEA 2BB4A 2KM0A 4WVPE 3ATWA 3F1SB 1E1QD 1BJVA 2SGQE 3NXPA 3EA7A 4AGJA 3M3VA 2EQNA 1IQKA 2XWAA 2HOBA 3DUXH 1TQ7B 1LHEH 1TOMH 3TH3H 1DY8A 1O36A 1GJ6A 2C8ZB 2KAIB 2ZCKP 1GJCB 3UFAA 1TFXA 2BTCE 2G5NA 2WPKS 1HAHH 2ZDVH 1CA0B 1N6XA 1JIMA 4INLA 3C1KA 1QR3E 5CHAC 3SQEE 4NG9H 2PTNA 1H4WA 5E2PA 5GXPA 2TPIZ 2HRVA 4UFGH 1O2KA 1GCDA 3PLKA 3VXFH 1BT7A 1O32A 3SUFA 4AOQA 1SFQB 1GCTB 3C27B 1EKBB 3AW1A 1TNKA 3CS0A 4KKDA 3I77A 2ALPA 5DPAA 3Q76A 1SLUB 1KXBA 2F9PA 4K1SA 1C5TA 2VVUA 1FV9A 2OUAA 3U1JB 4K60A 2IJD1 1CA0C 5GDSH 4F55A 1YKTA 3ODFA 5A0CA 5L2YH 5EJ1A 1CU1A 2R3UA 2H6MA 2SFAA 4WMDA 4CHAC 3BSQA 4FVDA 1C1MA 1VITG 4FUDA 3ZZDA 1GCTC 1S83A 4DOQA 3R0FA 1GI2A 2FI5E 1LVYA 2ZFFH 3PWCA 3PO1B 1YPJH 1GI3A 4AGKA 2VH6A 1GDUA 5C20A 2Z3EA 2BY7X 3DSGA 3P8OA 1BMLA 3V13A 1DWBH 4TPIZ 2EA3A 1TGBA 3PTBA 5EPNA 1KLTA 4B73A 1O5CB 1NN6A 1F92A 3FANA 1NU7B 1YCPH 2ESTE 5DSFA 1IAUA 1GHBG 1OP8A 4J2YB 5CDFE 1O2OA 1UTPA 4A6LA 2EI6A 1GBHA 4TT3D 4X8TH 3SNBA 4WMFA 3URCA 1K22H 3SN8A 1BIOA 1TA2A 2AGGX 1C5PA 2WPIS 3GICB 4I33A 2GT8A 1KDQA 3PO1C 2UWOA 5FBEA 1GBBA 3TK6A 2P16A 1TAWA 3LDXH 4NFFA 2R0KA 2FESH 3GS9A 1C2KA 1P8VC 5DP5A 2QE7D 2AEIH 1T31A 4RN6A 1NRQH 1GHXH 3FO8D 1MD7A 2SNWA 2WUBA 1OWIA 3V7TA 4A1XA 1LHCH 1PPBH 3P8GA 1C2EA 1GBDA 1NFUA 2BY6X 3GY7A 2Z9JA 3M3SA 2BQWB 1EAIA 1HB0B 4VGCB 1N6YA 2VH0A 5A09A 3UOUA 2A2XH 3SNDA 2BLQA 4BNRA 1NFWA 3BTHE 1TYNA 3LC3A 1E36B 1PQAA 1HCGA 1NRNH 4YM9A 1QB1A 1VJ9U 3LH3A 4YT6H 2A4QA 2IPHA 3SGAE 5JBAS 7KMEH 1DXWA 2GJGA 2ZPSA 2R0LA 1KYNA 2NU2E 3RMLH 1HAPH 1AUJA 3QZQA 1MD8A 1C5VA 1K21H 1ETRH 1N8OB 2FS8A 2SGPE 1CSOE 1Y8TA 2HNTF 1LCYA 2HLCA 3F9GA 1P2QA 1NZQH 4X8VH 3RXKA 4VGCC 3MU5A 1Z8RA 3HK3B 3PRBA 2HALA 1RXPA 4IMQA 1TBZH 3FP8E 1DICA 3JZ1B 3ZZ9A 3UTUH 3EE0B 3PV5A 4JCNA 3OY6U 2BQ7B 1VITH 1T8MA 4UE7H 1YCPM 4BAMB 5FHTA 5IDKA 3RXIA 1WUNH 2AS9A 4RKJB 2OC1A 3SO3A 3ZVEA 1NRRH 3HATH 3RXAA 3A7ZA 3MI4A 4NA7A 3GY3A 3UAIC 2WSSD 4X2WA 2G8TA 4A7IB 3MU4A 3EGKH 2LELA 2D2DA 3A86A 1PPHE 3ZYDA 2Z9IA 1EZUC 2BX4A 4FUJA 4TWYA 5JBBS 1L1JA 2B0FA 3GY8A 4IBLH 1XM1A 3TH2H 4OS5A 1T4UH 1A1RA 2FOAA 2OTVA 1ANBA 3ZZCA 1O3KA 3SUDA 3RXOA 3U98H 1IQGA 4F4OC 2RDLA 3SJKA 2JJ2D 4IMZA 2LP6A 2QC2A 1GGDB 4FVBA 3FN8A 1TPSA 4Q63A 2ZGBH 2OQUA 3PYHA 2W7UA 1VITF 4HGCA 4DG4A 1XUKA 1O5FH 2BD8A 1BTYA 4X0WU 2BD4A 4Q2KA 5LH8A 1O5EH 2QXIA 2F3CE 3F2FA 1MMJN 2VB0A 2ZNKH 3M7TA 4K8YA 2CN0H 5I25A 1YF4A 2PKSB 1TMBH 5JPMH 4A5TS 1NS3A 1RTFB 2GDEH 1GHWH 2A7CA 2QAAA 2A4GA 1OP0A 3ZVCA 3EQ0H 2WINI 1YPHC 4KTCA 1GGDC 1P06A 1O2MA 1KXEA 1F0SA 4FUFA 2CV3A 1GDNA 2Y7ZA 4GUXA 1L2EA 1BTHH 3S9BA 2OXSA 1ZYOA 3OEHD 1MTNB 1JOUB 1PPFE 3MO6A 2VGCB 5HIYA 2XBVA 2ZQ1A 4K69A 2F83A 3BTFE 1ZPZA 4E7RG 3SV6A 3N7OA 2JH5D 1SBWA 2PKSC 2TGTA 1UJ1A 2R9PA 3RLWH 3GY6A 3NRLA 3TPIZ 4AG1A 4ZROA 1QRWA 1PQ8A 3GYMA 3FP7E 2ZFQH 4JZIA 5C1XA 2EC9H 1RFNA 2KX4A 1TNGA 3MNSA 3BEFB 4ZUHA 1ELVA 4CR9A 1O2VA 1QQUA 2ALVA 1QQ4A 3EA8A 1GHZA 2VIOA 1EP5A 1ABJH 4YESB 5T1VA 1FY1A 1DE7H 1OOKB 3UNQA 5IK2D 3RXQA 2WV4A 1WBGB 1F0RA 2ZFPH 4AG2A 4Z6AH 3SHAH 3A89A 4D8NA 2VWMA 1LPZB 3U8TH 2VJ1A 4Y8YA 3MO3A 2ZGJA 5AF9H 3T5FH 3VB5A 1L4DA 1BCUH 3ZVGA 1Z71A 5DKMA 3SBKA 1VJAU 2BDAA 4RKOB 1Q3XA 2BM2A 3MNCA 3RXTA 2VIDA 2ZGCA 1O3HA 3FZDA 1G3DA 4BTTB 2G52A 4ABAA 3SORA 1ZMLA 5FPTA 1ZHPA 4LZ4B 1C9PA 1ELDE 4XFQA 1FQ3A 3M35A 2ODYB 5F8ZA 4LK4A 1YP9A 2BVXH 1HAVB 2OD3B 1TMTH 3AAUA 1QFKH 4O97A 4RSPA 2ANMH 4KGAA 2WYGA 3GDUA 1J15A 1J16A 3SNAA 2WPDD 3TGIE 2F9OA 2STAE 3VGCB 6LPRA 1XUHA 1BRCE 5TCAA 2Z6BD 2JH6D 2BY8X 1OWJA 5F8XA 4WY3A 1BTZA 1UK2A 4FUBA 2J94A 2GZ7A 1C5NH 1O5GH 4IW4E 3RXFA 9ESTA 3SOSA 1TWXB 2JIZD 5A8XA 1EASA 1P2OA 2OINA 3SNCA 2STBE 4LOYH 4Y0ZE 1AVXA 3VGCC 2ANWA 3UUZA 5EJLA 1O30A 1ANEA 3P95A 4QT8C 1HAXB 1UK3A 2G4TA 1O31A 4D7GA 1MTSA 2QF5A 2XTTB 2VWNA 1OP2A 3P6ZB 1ETTH 1ZR0A 2ZCLP 1O3FA 2C3SA 3F9FA 4ISIH 3F68H 1O2LA 4FUIA 3VFEA 2V3OH 2ZU4A 2GT7A 1GJ8B 2XBWA 1P11E 1GVZA 3MO9A 2CJIA 1T8LA 1BB0B 3WWBA 3RC5A 3UB0A 5T6FA 3UQOA 1FY4A 3QN7A 3RU4T 1CA8B 2GTBA 1FMGA 2ODPA 3SUGA 1EPTA 1IQNA 1XXDA 2OCVB 3LKWA 4ZXYH 3TLOA 2XNDD 5T6GA 1HJ9A 1EOJA 2KR7A 5C17A 1HUTH 3DT0H 1P2KA 2FOCA 5C67A 5JBCS 3GCTG 1C5YB 3MOCA 3M37A 2ZKSA 1AIXH 1GBEA 2QIQA 2AGIX 3M36A 2TIOA 3KQDA 4RT0A 1C1NA 1O3PB 1AE8H 4ZH8A 2FODA 1SVPA 1AGJA 1C2FA 1GMDG 1CE5A 4NA8A 3O8BA 2PUQH 4ACAA 1FIZA 1WTGH 4D9RA 3SHCH 1H8DH 2FOEA 2BX3A 1SB1H 5ESTE 2WPMS 1TLDA 4TY7A 5GWZA 1FJSA 5LGOA 1KLIH 1XKBC 3LC5A 2HWLB 4IN1A 4GVUA 4LXBH 1O33A 1P2JA 5BPEA 1V2KT 3TK5A 2BD7A 3AW0A 1TPAE 4NIXA 2QY0B 1S82A 1ELEE 2K0QA 2PGBB 3ZZ8A 3RXCA 3VPKA 2G00A 3ZZ6A 3TJOA 2ZTYA 3PWBA 3T26A 1OYQA 3U8OH 2QN5T 3WW7A 3HGPA 3D49H 3UIRA 4FXGH 4MDSA 4WJG2 4CH2B 3AK5A 2AERH 1V2QT 3F9HA 2ZHEH 1H1BA 2CF9H 4CRFA 1SR5C 3B8JA 1FXYA 3RXRA 2VINA 1HPGA 1QL9A 2F9NA 2ZGHA 4O03A 1ELCA 3L3TA 1Y3YA 1T4VH 4ZXXH 1C5MD 1ELTA 1SLWB 3UR9A 3V12A 3OTJE 4O9VA 3D65E 1AKSB 3SGBE 4FUCA 2W26A 1QL8A 3TJNA 4NSVA 1K1MA 4NZLA 4H4FA 1C2LA 3MWIU 1SGRE 3TITA 3TNSA 3ZZ4A 1TOCB 1AMHA 4NZQA 4DY7B 1H8HD 1LPGB 4CBNA 3BTEE 4BANB 1L1GA 1UVPA 1EX3A 1C1WH 1HXEH 2WPLS 1D9IA 2FTLE 3BG8A 4AZ2B 1HXFH 1O5BB 2TRMA 2H5CA 2HVYB 4B6EA 2ZGXH 4CRBA 4AYVB 1WQVH 1W0KD 1PFXC 2P8OB 1C2IA 1O2IA 5FPSA 2JKHA 4ESTE 1JRSA 4B71A 5EU8A 1D3PB 3LGIA 4Z1MD 4A92A 1RS0A 4BTIB 5HKKD 2P3UB 2GD4B 2XXLA 5B6OA 2Y82A 4DURA 1TX8A 1YYY1 2PKAA 1CHGA 1W7GH 1LHDH 2J2UA 2ASUB 3D62A 2BYAX 1GWAA 1C5OH 3M3TA 4BTUB 1W0YH 3H7OA 4UFFH 2M2AA 4DVAU 4TSFD 1CO7E 3A85A 1F7ZA 1NESE 1OXGA 1LTOA 3PTNA 3W95A 2JETB 4AC9A 2OQ5A 1HNEE 1G9IE 2OC8A 1K1NA 4WXIA 5B6LA 5IYTA 3CENA 4A1TA 1DVAH 2VWLA 5FBIA 3HPTB 4YZUA 1EATA 1Y3UA 3W1EA 1UW7A 1VGCB 5GJ4B 3GCTF 2A45B 1C5RA 1ARBA 1EP6A 2I6SA 1AO5A 4ZAEA 3K9XB 1UVTH 5A0BA 4WMEA 4ABGA 3LIWA 1INCA 3ZVAA 1SC8U 1TBQH 3QGJA 3QDZB 4JZ1A 2GX4A 1C1TA 1NBMD 3T29A 1IQEA 1YCPK 3PV2A 1GMDF 4X1NU 2JETC 2A4OA 3EDXB 3M5OA 1V2ST 1UTNA 3PMHB 1OWHA 3CNRA 5K7RA 4ABJA 1HAOH 3FP6E 3KQ5A 1BJUA 2ZIQH 1MAYA 2JJ1D 1DDJA 5DP4A 1VGCC 3N7EA 2J38A 3M5LA 1V2TT 1O2RA 2PP6A 4AFSA 1CT0E 1TRNA 4KTSA 5EW2H 3I29A 1GL1A 5DGJA 4Q7YA 2W6ID 1SGDE 2C90B 1O34A 1MAXA 3ZV8A 1CVWH 1GL0E 1XUJA 4BAQB 2ZTXA 3A7XA 1YBWA 1EXFA 3LGTA 1IQLA 1DUAA 1P09A 4CRGA 3AAVA 3ZV9A 2ZDLA 3NUMA 3KQEA 1O3JA 3E90B 2BQ6B 1DS2E 4BXSA 2BXUH 4KTUA 1BMAA 2WHXA 2W5EA 1ORFA 1O38A 2BLOA 1SQTA 1GHVH 4NFEA 2FYQA 1W14U 1HJAB 3SJ8A 4Q4LA 2W3IA 2Z94A 2FI3E 1AWFH 2HPPH 1IHSH 1TBRH 2YNBA 4HI3A 4HG6A 1K28D 1LHGH 1ZJKA 4X8SH 1MBMA 1MTWA 2O8LA 2BY9X 3K6YA 3U8RH 2D1JA
chains in the Genus database with same CATH topology
1LPKB 4OS4A 2YOLA 4XOJA 1O35A 2A2QH 2XBXA 3KIDU 4CRAA 1AFEH 1X7AC 4THNH 2H9TH 1XMNB 3RDZA 3S7HB 1FNIA 1DWCH 4U2WA 4XBBA 1LQDB 3T2NA 1HJAC 2Y5FA 2QV1A 3STJA 3ATIA 5K0HA 4FUEA 2HNTC 1PYTC 1AVGH 4ABFA 4NA9H 2OC7A 4I8HA 1SL3A 1Y59T 4JK6A 1FY8E 1TIOA 2BDYA 4NIYA 1MTUA 1K1LA 3RXHA 1P10A 1TX7A 2GP9B 2A5AA 3ZZ3A 2PWXA 2XW9A 4B75A 2A1DB 1UK4A 2GCTB 2H9EH 3NZIA 2FM2A 1A61H 1P9UA 1V2PT 1L4ZA 2Z3CA 2B9LA 1SOZA 1P02A 4IS5A 4YLQH 4ISLA 1BZXE 5DP9A 5JBTA 2BOHB 4INKA 3MU8A 1EQ9A 2FO9A 3VB7A 4X6PA 3BF6H 1SGQE 1FY3A 1QGFA 1GMCG 1ZSJA 3A80A 4KELA 2NU1E 1TNJA 2ZU3A 2VWOA 4B1TA 4GPGA 1S0RA 2GCTC 1YPLH 1P12E 3MNXA 2O9QA 6GCHF 1BMMH 4SGAE 4R0IA 3SU1A 2QXHA 1FI8A 1V2UT 1Y3VA 1SI5H 1D3QB 3MU0A 2ZWLH 1AHTH 1MBQA 3BTWE 1SOTA 3T28A 2TGPZ 1BUIA 2TGAA 4XSKU 4MNWA 2H5DA 5T3HA 3GY4A 3RP2A 4I8JA 2A7JA 3ATLA 2IN2A 1EAUA 1DX5M 2HPQH 4Y71A 1ETSH 1SGFG 3OSYA 1F0UA 2FXRA 3LH1A 3OU0A 1XKAC 1B7XB 2ZP0H 1N8OC 4UEHH 7LPRA 1FAXA 5E0GA 3T25A 4NWLA 2G55A 4IC6A 1C2JA 1O2TA 2BLWA 2FDAA 1AE5A 1TGCA 2NWNA 3SI3H 3E91A 2Q6DA 2F9BH 3RUOA 1RRKA 2YNAA 3SQHE 3A7WA 4I8LA 2BHGA 1KXCA 3F9EA 2V35A 3A8BA 1IHTH 1NM6A 1W2KH 3S9CA 1AD8H 4BOHA 8LPRA 1HAYB 1HFDA 1GI6A 1L1NA 1PPCE 1DLKB 1GDQA 2Y5HA 3SU6A 1GMHG 4JYTA 1MCTA 1W11U 1ZGVA 1A5HA 5JYIA 2ZDNA 4DIIH 4ZKNU 2Q6GA 3TJUA 1A3EH 1MCVA 4UFEH 1G36A 4JK5A 1GBAA 1GJ5H 1WQSA 3MNBA 2ZC9H 3UREA 1GJ7B 1S84A 2IJOB 1TPOA 1QA7A 2A4RA 1SQAA 2G51A 1SGCA 1K1IA 1TRYA 4I8GA 4XE4A 4CRCA 1C4V2 2AMDA 3PV4A 5TCCA 5C1UA 3R3GB 5JB8S 4MG3A 3RU4D 2ZQ2A 3AVZA 3ELAH 3MMGA 4YO9A 2GV7A 1DANH 1AUTC 4K8BA 2HVXA 1FN8A 3NCLA 3EYDA 5F6MA 5J4SA 3SJ9A 1GI9B 3UWJH 3SGQE 2XWBI 4NSYA 2ZECA 5EXNA 3UWIA 1G2LA 4ISOA 3U9AH 1DT2A 2PFEA 2C93B 1ZMJA 1MTNC 3BTGE 3M5MA 1EB2A 1XUFA 1ZRKA 2VGCC 1FN6A 3KEEA 3SU4A 1O5AB 2OP9A 1TE0A 1PJPA 2KAIA 1W12U 1V2JT 1ESBA 2Z9LA 3PMAB 1C4Y2 1GI8B 1VCWA 1GI0A 1UTJA 1ESTA 4MVNA 1DSUA 1C5XB 3IITA 1OPHB 3KQBA 1ANDA 1YPGH 1GMCF 1EJNA 4JYUH 4JZFH 1DSTA 2GMTB 2ZHDA 1QIXB 1O3EA 1JRTA 2BVRH 1EZXC 4OS1A 1OKXA 1PYTD 1CHOG 2B7DH 1P2NA 5EG4A 3S0NA 1C1SA 1TNLA 2FX4A 2QF3A 5GPIB 3UPEA 1AWHB 3W94A 3BG4B 3M7QA 2ZPQA 1W0ZU 4JZDH 4X1RU 1P3EA 2A5IA 5T6DA 4CH8B 1GI1A 2BZ6H 4FU8A 3SJOA 1D3DB 1AFQB 5LPRA 3KHVA 2GMTC 1D6WA 1BHXF 1AB9B 5F8TA 3DD2H 4PROA 2W3KA 3KGPA 4D9QA 2BMGB 4GHTA 3LGWA 5EXLA 3GYLB 2B5TB 1ZOMA 1C2GA 3UOPA 3ODDA 3BTME 1XVOA 1QNJA 1QL7A 2XC5A 3NWUA 1O3MA 3BTKE 3HKIB 3T27A 2WPHS 4D76A 3BG4C 1WOFA 3H7TA 2Z3DA 4HZHA 1F5LA 1TRMA 1P05A 1N1LA 4Q7XA 1NPMA 2J9NA 3URDA 1V2RT 1EJMA 1NROH 2PR3A 2Q6FA 3SZNA 2AFQB 1SGYE 5A8ZA 1AFQC 1GMHF 2QF0A 2LPRA 1WYKA 5AVDA 1BRBE 2CGAA 1O2ZA 4DT7B 1AB9C 1OX1A 2O8WA 2ZPRA 2OBQA 3NKKA 4AYYB 1Z7KA 2QCYA 4XDEA 3OYPA 1J8AA 1Z1IA 3ATKA 1O2NA 4JMYA 3SV9A 1ELAA 2EI7A 1B5GH 1O3IA 2V6NA 1YLCA 3ZVFA 3BIUH 4AFZA 5FX5A 3TU7H 2O8MA 5L2ZH 2UUYA 1W8BH 3LJJA 4AFUA 2GVFA 2QXJA 5EQQA 3STIA 5EOKA 3RXJA 2QXGA 1SMFE 1CGIE 1AU8A 1Q2WA 4Y76A 1RTLA 2AIQA 4MQAA 4FU9A 3UY9A 1KDQB 1KXFA 1A0JA 3AASA 4CREA 2ZEBA 4K1EA 1HBTH 1KXDA 1KTSB 1VZQH 1SG8B 2CMYA 3IWMA 1QJ6B 3A8AA 1QHRB 2XC4A 3RXLA 2CF8H 2GZ8A 2FZZA 3F6UH 1SPJA 5FXLA 1ZPCA 1ZLRA 5DP6A 4DJZB 1J9CH 1BBRE 2P94A 1JXPA 1UMAH 4U01A 1ZJDA 3RC4A 1O2GH 3Q3YA 5CE1A 1P0SH 3B23B 2XBYA 3LU9B 4TY6A 1PPGE 2WUCA 1GI5A 2BDHA 3CS7A 2HGTH 4I8KA 1S85A 1O2JA 1CT2E 1AI8H 3RXUA 3ITIA 4D7FA 1DWDH 2ZHFH 1GBKA 3BV9B 3FAOA 1UHBA 2O8TA 5J4QA 1SGPE 1ELFA 2QYIA 1NU9A 4YT7H 4OGXA 1O2XA 1L0ZA 1C1VH 4H42U 1QBVH 2GCHG 3DFLA 3TH4H 1ZPBA 3ZYEA 3P92A 4GHQA 1VR1H 1K9OE 4E06H 3PROA 4ZMAH 1XUGA 3QO6A 1ZSKA 3WY8A 1CHOF 1G2MA 1VCQA 4AB9A 4E05H 4BXWA 1EOLA 3QLPH 3B9FH 3PLPA 1W7XH 1GHYH 2BDCA 2RG3A 6CHAB 4LZ1H 3A7YA 2FX6A 1P9SA 2ANYA 1S5SA 2A5KA 1V2OT 3A8CA 1VCPA 3RU4E 2AH4X 3PMBB 3M61U 4K3JA 2O8UA 2G5VA 1C5LH 2FEQH 4UONA 3GCNA 3LJOA 1E0FD 1WU1A 3I78A 5A8YA 1CBWB 1TGSZ 1F5RA 2ZU5A 5EGMA 2PGQB 3SU0A 1O39A 4YOIA 2ODQA 4ABEA 3E0PB 6CHAC 2UUKB 2ZF0H 1BBRK 1LVMA 1QY6A 2ZU1A 1EUFA 2A32A 5EQSA 1BRUP 1MH0A 4Y7BA 1W3CA 4FU7A 1HIAA 1BDAA 3L33A 1F0TA 1G3CA 1KY9A 2PSXA 3HK6B 4MTBA 4ABBA 3ENSB 1K2I1 5L6NH 2C8YB 4X1PU 1CBWC 3OX7U 2A0QB 3EA9A 3T62A 1KSNA 2BDBA 1O2QA 2R2WU 3K6ZA 3A7VA 2VNTA 1C1QA 3GDVA 4Y10E 1RTKA 4X2XA 3RXGA 1THRH 2C8WB 1NO9H 2P8OC 1FDPA 4MNYA 5JDUB 1IQHA 1O3DA 3TGKE 1D3TB 1H9IE 5DP8A 4X2VA 5HM9A 2BDGA 3Q00A 1O2UA 3A87A 3QUMP 5EW1H 3RM0H 1BITA 1C5ZB 2RA3A 8ESTE 2BVSH 2RCEA 3RMMH 4TWWA 2GDDA 1O5DH 1UCYE 3CP7A 6GCHG 4UDWH 5FCRA 1S81A 4H6TA 5E2OA 3TVJB 1GG6B 4NCYA 2Y6TA 1YLDA 3EAJA 1PQ5A 5C1YA 5CHAB 2AIPA 1Z8GA 4B2AA 8GCHF 1DITH 1O3NA 1KIGH 1BBRH 5GCHG 1UTMA 1TB6H 2FOHA 4ABHA 4DCDA 4I31A 2PHBA 1ZGIA 1BTUA 1CT4E 4NWKA 1DPOA 1HAVA 3IG6B 4AB8A 3FFGA 3MTYA 5AFYH 1E37B 2G4UA 4M7GA 1GG6C 3M7UA 1QRZA 1TPPA 1DM4B 3PLBA 1T8OA 3VB4A 4HTCH 1MZAA 3L6PA 4ABIA 1PPEE 1MU8B 4CHAB 3V3MA 3RXPA 5HYOA 1SLVB 1HLTH 2GCHF 2FYRA 5C2ZA 4Q80A 1G32B 1LDTT 1Z6EA 2SNVA 3KF2A 3UR6A 1Y5BT 1P3CA 2BLVA 5SGAE 1HV7A 2VU8E 1BRAA 2OC0A 3S69A 1CGHA 2F9UA 3ZVDA 3VB6A 1Z8JB 7GCHF 3D23A 1QTFA 3GCOA 4OS7A 3H5CB 2BD5A 1LKBA 3ZZ5A 1O2HA 1QBNA 1UO6A 2SGDE 2THFB 3LGYA 5JB9S 4MNXA 3P17H 4U30A 2ZG0H 1A46H 1ARCA 1BQYA 1NT1A 1UCYK 2EEKA 2ILNA 2PW8H 4Y8ZA 1AY6H 1CGJE 1LVBA 1A5GH 3RLYH 1S0QA 5I46H 1A3BH 1XUIA 1MKXK 3A83A 4AFQA 3A88A 3RMNH 3RXVA 4MPWA 1ANCA 1GBFA 2UUFB 2AYWA 5FX6A 2AMQA 2P59A 3E0NB 2Z9GA 2ZFRH 1Y3XA 2QA9E 1FPCH 1Z1JA 2ZO3H 3BTDE 2UWPA 2ZZUH 3A84A 1EB1H 1GBCA 5DO4H 2UUJB 1HRTH 2SGEE 6ESTA 1YPHE 3RMOH 2FOMB 4K2YA 5LPFA 1SLXB 2VVCA 4B2CA 3GCHB 1P04A 1EZQA 1TGTA 1GI4A 1YC0A 1EPTB 3SNEA 1H9LB 2PUXB 3QZRA 3E16B 4UD9H 2J34A 1P57B 1TA6A 1YPMH 2M5TA 2PTCE 4NIVA 4MLFB 3VEQB 3NPSA 3UNSA 2RA0A 1A0LA 1ZTLA 1RGQA 1C2DA 3O8CA 1CQQA 2QGRA 5HMAA 1TABE 3SV8A 1UCYH 1QB9A 1JMOH 1GVKB 4B74A 3GCHC 2I6QA 4ISNA 1RIWB 1MQ6A 1EPTC 4GLYA 2GV6A 1NY22 4X2YA 1OWDA 1MKXH 1WCZA 2V0BA 3LONA 3PMJA 2BY5X 5GCHF 1GBJA 1GPZA 5L30H 1UVSH 3RXDA 1P01A 5C5OA 4BAKB 4INHA 3OY5U 1B0EA 4YOJA 2PV9B 4ISHH 2FTMA 1QURH 2VIQA 3TIUA 2TBSA 3LGUA 3SU5A 2B8OH 5HM2A 5DJ7A 2BXTH 1AKSA 1T8NA 1UHBB 1NRPH 1THSH 2Y81A 3SUEA 3PM3A 1RIWC 4CBOA 1Z8IB 3MU1A 5F03A 1WSSH 4Q7ZA 1ESAA 1TGNA 2XNIA 4GAWA 1SHYA 1QRXA 2GGVB 3A81A 1UTLM 1O2YA 3TNTA 3S7KB 4Y6DA 3GOVB 1D4PB 2BZAA 4TPYA 4U32A 1Y3WA 5DP3A 1WV7H 2ZDAH 1C5UA 1HGTH 1BTPA 1T32A 4ZKRU 4A1VA 1H9HE 4BAOB 1DOJA 2ULLA 4X6MA 5H4IB 2VIWA 1U6QA 4NIWA 1S6FA 2XCFA 2P3TB 3MH5A 2LNCA 1V2VT 3E6PH 3GDSA 5EXMA 1A5IA 2NU4E 1V6DA 4MPUA 2ZFSA 1NC6A 4JYVH 3BEUA 3LGVA 2SGFE 3Q77A 2A7HA 4GCHG 2Y7XA 1TQ0B 4WF8A 1O2SA 1GBTA 4X6OA 1Q31A 3ZZ7A 4MPVA 5EODA 4Y0YE 1DUEA 2R2MB 1A2CH 4J1YA 1A0HB 3BTQE 2OBOA 4Y79A 5E0HA 1BTWA 4ABDA 1MTVA 4ASHA 1ELBA 1GHBF 2FP7B 4IN2A 1HIAB 4K5ZA 1BHXB 3K2UA 1OYTH 1A4WH 4DW2U 1FIWA 4WH8A 1LKAA 1MUEB 4ZHMU 3BEIB 1NFXA 2C8XB 2PKAB 2WPJS 4IGDA 2J92A 1MU6B 1KXAA 2GKVE 1V2LT 1DLEA 1GBMA 2P93A 1J14A 1C4U2 4F49A 4X1QU 3QK1A 4SGBE 3BN9A 4OS6A 1K1OA 4KP0A 1SGEE 1UVUH 2ZDMA 2BOKA 2FPZA 3TJVA 2BD3A 1SFIA 5AFZH 2FOGA 4DIHH 1G3BA 1AN1E 2K1QA 5FCKA 1KLJH 1HAIH 1AQ7A 2FOBA 2V3HH 3QX5H 1J17T 1TALA 2ZI2H 5DG6A 1QBOA 3P70B 5FAHA 3ZVBA 4XBDA 3MYWA 3U69H 3O8RA 5E0JA 2C4FH 3RM2H 2NU3E 1GJ9B 2D26C 2FIRH 2Z9KA 3TK9A 1H8IH 1XXFA 2DUCA 1V2WT 3FZZA 1OWEA 1WAYB 4AX9H 1ZZZA 1F5KU 2F91A 1M9UA 4X8UH 1GHAG 1GJDB 1HDTH 1LMWB 1O3BA 3RXBA 1GVLA 1IQIA 3BTTE 1BOQA 2UWLA 1P2MA 3VB3A 3RC6A 3PB1E 3VXEH 1QA0A 3KNXA 3KQCA 5E8EH 1C1RA 2VVVA 1JIRA 3KN2A 3SW2B 1LQEA 3MH6A 1ZRBA 1HYLA 2H9HA 5DP7A 5C5NA 2XYAA 2SGAA 1G3EA 5HXFA 1SSXA 1SGNE 1YM0A 1EJAA 2Y80A 4I7YH 4FUGA 1GI7B 1PPZA 1THPB 2A31A 5CMXH 1C9TA 1IQMA 1UTKA 4MNVA 1O2PA 1QB6A 3SU3A 3SV7A 3QTOH 1XVMA 2Y5GA 2FOFA 1HJ8A 5ESBA 2XC0A 1O3CA 1Z6JH 5HGGA 2R3YA 2Q1JA 1KTTB 2D8WA 2PLXA 4BAHB 2NU0E 9LPRA 3RXMA 1TNHA 5GIBA 2ZTZA 2TGDA 1YPKH 1HAZB 4NGAH 4ZHLU 1T7CA 3S9AA 4JZEH 2FLBH 1C2HA 1WTHD 1FAKH 1MQ5A 5G4BA 3DHKH 1AZZA 1QJ7B 1UTOA 3ESTA 2ZDKA 1C5WB 1D6RA 3HGNA 1YPEH 4Y7AA 4B76A 1O3OA 5EQRA 4GCHF 1ZTJA 2F9VA 3HKJB 1P03A 1JWTA 3LT3A