1QNJA

The structure of native porcine pancreatic elastase at atomic resolution (1.1 a)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic Resolution Structure of Native Porcine Pancreatic Elastase at 1.1 A
pubmed doi rcsb
molecule tags Hydrolase (serine protease)
molecule keywords ELASTASE
total genus 58
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1999-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qnjA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qnjA01
3U8RH 5TJXA 3RP2A 1F2SE 4UFGH 3GISB 3PLBA 1Z8IB 5DP7A 5E0JA 2OD3B 3TJUA 1NRNH 3RM0H 1VJ9U 1K28D 2FEQH 5E2PA 4NA8A 2J34A 5G4BA 3GY8A 4OS7A 5HXFA 1JRTA 2GDEH 5GPIB 2A4QA 3TK9A 1MU6B 3BTDE 5FPSA 6CHAB 1SLXB 4IBLH 1SG8B 1ANEA 8GCHG 2H9TH 2SGEE 1Y59T 1O33A 3CS7A 2R9PA 2AYWA 1ELDE 2HVXA 1FPCH 3MO9A 1B0EA 4E05H 1NRPH 1A5GH 1YCPM 3EYDA 2GTBA 4JZEH 3ZZBA 1V2PT 1LQDB 1AY6H 3A8BA 1G30B 1SLWB 1SGNE 2AGIX 3B9FH 2VVVA 2BY5X 1GGDB 1GBMA 3M37A 3ZYEA 2ZHDA 1CSOE 1QFKH 4GAWA 1C2HA 3MNCA 1ELAA 1SGFA 2WUBA 2ZGCA 1OWHA 5JB8S 2NU1E 4IMQA 3M36A 2P59A 4LZ1H 2TGAA 3MWIU 4SGAE 3RMNH 2A4RA 4NIXA 2OBQA 2V3HH 2B7DH 1SGCA 1RGQA 1OP0A 1XMNB 1MD7A 1MAXA 1WQVH 3RU4D 2IPHA 1MQ5A 2PTNA 2BD2A 3GCNA 1FIWA 1P04A 1GJ4H 1O5GH 2A0QB 1QJ6B 2XYAA 4YOIA 4YTAA 1OYQA 1BITA 1KLIH 5CHAC 1LHFH 4ZXYH 3QN7A 2W3KA 4NWKA 3GY7A 1B5GH 1EJMA 3E1XB 4E7RG 3O8DA 2FYRA 4Y79A 1EAUA 1UTMA 2XRCA 1CA0B 1GMDF 1DSUA 4O3TA 2ZTZA 1SLVB 1L1JA 2ZGXH 1VCWA 4ISOA 3P8FA 2R2WU 2QGRA 1MTVA 1ZJKA 1TQ7B 2RDLA 1DLEA 2B8OH 1TPPA 3K9XB 2FO9A 2TGPZ 2BYAX 2ILNA 1ETSH 1QQUA 1PQAA 2B5TB 2Z3DA 3UIRA 4ZROA 3L3TA 1VJAU 1KTTB 1DLKB 1T7CA 3ITIA 2FODA 2BVRH 1TALA 4B2CA 4X1SU 2BTCE 2IJOB 1CO7E 1CHGA 1Y3UA 3K6YA 4AGKA 4U30A 2H2ZA 1MQ6A 2XC4A 4D7GA 2W5EA 7LPRA 3KN2A 1QA0A 6GCHG 5A8XA 4H6TA 4YZUA 2ASUB 1UK3A 1LCYA 3OTJE 3URCA 1OWIA 4A1VA 2UWOA 1TRMA 2QXHA 2JETC 3RXJA 2CMYA 2WPMS 2AERH 2AS9A 2A45B 1UVPA 3LKWA 4ZHLU 9LPRA 1WCZA 4X8UH 2FLBH 3TPIZ 2A2QH 1EPTA 5F8TA 4AFSA 1O3AA 1FAKH 2BMGB 1F7ZA 3SZNA 1CA8B 1UO6A 5DJ7A 1IHSH 1K2I1 4IW4E 1EZXC 5DP8A 3M5NA 4BAMB 1GMCF 2CGAA 2ZTYA 1ACBE 1GHBF 4ABIA 1D6WA 1ZPCA 2VJ1A 2QIQA 1AB9B 1HXEH 4AOQA 3A87A 4XBBA 3EGKH 1XVMA 1HB0B 3SOSA 4OGYA 4IGDA 1W8BH 2PSYA 2FOAA 3DUXH 2FWWA 1FY3A 1HAXB 1P2KA 1RIWB 1CE5A 1IQEA 1LHDH 1MU8B 1AUTC 4XBDA 1GG6B 3SV8A 4CRFA 1QBOA 4DIHH 2ZPQA 4D9RA 3SU3A 4DCDA 4FU8A 1E0FD 1BRCE 1P3CA 2P3TB 1C2GA 1BDAA 1AFQC 1KXEA 1YLDA 1E37B 1O2TA 1HAZB 1P2IA 1YGCH 3ZVEA 1ELVA 3SBKA 5GCHG 5HYOA 2AIPA 2BY9X 1AN1E 1C5XB 1DT2A 3IWMA 1O3NA 1ZSJA 1WQSA 2WINI 2ZDAH 3RXKA 2VIVA 1B7XB 1GMHF 2Q6FA 2P16A 2SGFE 1GCTB 2O8WA 3UFAA 3VXFH 1EUFA 3KEEA 3F9FA 1QIXB 1EAXA 3RMLH 4X2WA 1EZUC 5ETXA 3AASA 3ZZ5A 1BRBE 1GJ7B 1C1VH 1ETRH 1V3XA 1BUIA 2ZF0H 1FY4A 1V2WT 1C1MA 1S5SA 3VB4A 1P09A 1V2UT 3F1SB 4F4OC 3U69H 1C5VA 3MH5A 4X6OA 3M7TA 1VITF 4LK4A 2OTVA 1V2TT 1YBWA 4H4FA 1QRZA 4ABEA 1HYLA 4UFFH 3RU4E 2ALVA 2ZP0H 1LO6A 1DS2E 1O2KA 3ATLA 5LPEA 2PFEA 1HPGA 2J2UA 1KXAA 5A0AE 1EZQA 4X8TH 5BPEA 1V2RT 5IDKA 1QGFA 4U2WA 1O2RA 3RXCA 4H6SB 1GMDG 1Z7KA 4Y6DA 5GCHF 3QGJA 2Y82A 1Z8RA 1ARCA 2WYGA 5AF9H 3O8BA 5JYIA 3HGNA 2XNIA 1SVPA 2P95A 4FVBA 2XC5A 3ATMA 1NFYA 1C1PA 4MNVA 4R0IA 2ZU5A 4U01A 2CHAB 3GCTG 1TPSA 2HNTE 3M7UA 2Z9KA 3KQBA 1YPHC 3A88A 4NG9H 3RLWH 1A2CH 1A4WH 1O5DH 1TYNA 1YPHE 1AGJA 3GOVB 4AYVB 5F03A 4CH2B 4KTUA 1VGCC 3UWIA 1DPOA 1TGBA 3OSYA 2Q1JA 1TQ0B 4UFEH 2Z9LA 2C8WB 1FI8A 1GBJA 2RA0A 2O8TA 2F9OA 1UJ1A 3ZZ9A 4TPIZ 1GDQA 1TOMH 1OPHB 1OP8A 3RXUA 1A3BH 1G3CA 7GCHF 2XW9A 4X1QU 3V3MA 3NWUA 3MU0A 4BXWA 2R3YA 2P3UB 4KTCA 3TK6A 1O38A 4MNXA 1BT7A 2O8UA 1MTWA 3LPRA 3UWJH 5FBEA 3RC5A 1Y3XA 2HALA 1THRH 1SGPE 2BXTH 3ZZCA 1MAYA 1MTUA 1DE7H 3SNEA 5F6MA 1RTKA 1TE0A 3M7QA 4K1EA 3T28A 1PJPA 1BA8B 1BCUH 3BTEE 1A61H 1SL3A 2PR3A 3QDZB 1ZMNA 3QZRA 1ABIH 1GHAF 1SC8U 4J1YA 3KCGH 2AGEX 1F5RA 3M35A 3BEIB 3OU0A 1BB0B 1Z6EA 3ZZ3A 2V3OH 4XOJA 3BSQA 3D49H 1A46H 1TMTH 4UONA 3GCTF 1W0ZU 2BDCA 2YNAA 4AZ2B 1S81A 1W14U 1P8VC 3LJJA 1QURH 3UQVA 2OXSA 5C67A 2QC2A 3A8DA 3SNDA 1P3EA 2FI3E 5SGAE 1NROH 2DE9A 3Q3KA 1QB9A 1PQ8A 1Y3WA 2F9UA 2PV9B 1IQMA 4K1TA 1Y5UT 4X2XA 2BY8X 2STBE 4B74A 1HGTH 2PHBA 4FUJA 1Y3YA 3AW0A 5LPRA 1IOEA 3I77A 3RXSA 4NCYA 1T8NA 1CU1A 5TCAA 2ZFTA 4B76A 3NPSA 2V35A 3SQEE 1J15A 7KMEH 6ESTA 3EE0B 2Y80A 5C3NA 1SHYA 1IQFA 4Y8XA 1HAVA 2HPPH 1O3BA 2GCTC 4NIWA 1A0JA 3PTBA 5TCCA 1KTSB 2OC8A 2B0FA 2QYIA 1CHOF 1OP2A 3PWCA 1NESE 1UTKA 4JK5A 1J17T 1PPZA 3FP6E 3GCHC 4TY6A 2GZ9A 2ZGBH 2FTLE 2FOEA 1V2LT 4BTUB 1K9OE 1IQJA 1SGDE 3E91A 1IQKA 1GHZA 4O3UA 4MTBA 4NZQA 3GDUA 1N1LA 4X6PA 1D6RA 2GMTC 3FZDA 1GJCB 3SJ8A 1NY22 1AIXH 4A6LA 3ZZ8A 1D9IA 3GDSA 1AZ8A 4GCHG 4ZH8A 1CGJE 1S84A 2ZU3A 4DURA 3N7OA 1EKBB 3SJ9A 1AO5A 3LJOA 4Y0ZE 2VH6A 2ZDKA 1G2MA 4KTSA 1HFDA 3RXAA 4CR5A 3SU4A 4DVAU 2H9EH 3E16B 1D3DB 3SO3A 2J94A 4O9VA 1IQHA 1TMBH 2Y5FA 2F9BH 3EA7A 1MKXK 1YCPK 3LH3A 2ZGJA 1GI9B 5DO4H 1BBRE 3F9HA 1D3PB 1O5EH 5GWZA 1P2NA 1NM6A 1FY1A 1NFXA 1W2KH 2HNTF 4Y7AA 2Y6TA 3BTME 1O2HA 1UMAH 2ODQA 4DG4A 3A84A 3NZIA 3Q00A 4K60A 4I8JA 1CQQA 1BMAA 3ZZ6A 3SGAE 1BIOA 1GDUA 3RXGA 2FOBA 2GT7A 1VR1H 1Z1JA 1KLTA 1WBGB 5EW1H 1BTYA 3S7KB 4ZKOU 7ESTE 2BX3A 1AI8H 2ZGHA 3U1IB 4B73A 1MCTA 4BTTB 2D2DA 3FZZA 1C5OH 4SGBE 1P06A 1T4VH 3ZZ7A 1C5PA 4K5ZA 2BDGA 3BN9A 3GDVA 4YOGA 3QO6A 3RLYH 3RXHA 2LNCA 3SNCA 1TA2A 3BTHE 1W13U 2BZ6H 1SGYE 1LVBA 3SN8A 1XKAC 4UDWH 3RXFA 3LGWA 5FCKA 1O2GH 1N8OC 1Y3VA 1T32A 1OOKB 1UVSH 1S6HA 1Y5AT 4VGCC 3SV2H 2CHAC 1DWEH 1AHTH 3ZZDA 3ODDA 1YM0A 4ZAEA 1VITH 1XUGA 1AB9C 2ZIQH 3I29A 2TGTA 1O39A 3GCOA 1TRNA 3SV9A 2WPKS 1NZQH 5AHGH 1MH0A 1C5QA 1KY9A 1P2QA 2F83A 2EA3A 4IC5A 4CR9A 2SFAA 1SR5C 4CRGA 1C1SA 2C4FH 1AE5A 3ATIA 5C2ZA 4GLYA 3BEFB 1UTOA 3MYWA 5L2ZH 3SU1A 1AWHB 4ISNA 4ZUHA 3LONA 2ALPA 4ASHA 1SI5H 1OWEA 2PKSC 3SI4H 1SBWA 1ZHPA 3PO1B 1L4DA 2DE8A 5HM9A 1THPB 1ELGA 1DITH 3TU7H 4JCNA 4PROA 5T6DA 1S82A 2BDHA 2FI5E 1GI2A 1O2JA 1YLCA 2UUKB 1C5WB 1EPTC 3STIA 1K1NA 4I8KA 4JYTA 4M7GA 2GP9B 5ESBA 4DGJA 1O5BB 3SJOA 5A0BA 2QY0B 3ZZ4A 1DUAA 2F9VA 2G5VA 4FU9A 5H4IB 2VIOA 1JRSA 2H5DA 2VWNA 1P2JA 1O2ZA 1D3QB 3A7WA 5AFYH 3ZVAA 1GJBB 1GHYH 1GBLA 2G4UA 5DK1A 2SNVA 1Q31A 1SPJA 5F8XA 1F92A 4FVDA 1QHRB 1ELFA 1Y5BT 2ZPRA 2AFQB 5T3HA 3PM3A 3UUZA 3TJVA 2Q6DA 3ZYDA 3T25A 2O8LA 1TGSZ 3A81A 1O5AB 1YPMH 1H4WA 3ODFA 2C8XB 3PTNA 2ZA5A 4WVPE 4H42U 3GYMA 1UHBA 2PSXA 1W10U 2D26C 2J4IA 5L2YH 3ZZAA 2ZFPH 1O2NA 2NU4E 5EQRA 2A4OA 1GBHA 4WMDA 1FY8E 2R0KA 5AFZH 1G3BA 1G9IE 3TNSA 4WH8A 1KDQB 3M3TA 2FDAA 3SW2B 2WPLS 5EXMA 3A82A 3SNAA 3A86A 1MKWK 1SGRE 2Y7ZA 1LHEH 4ABFA 1BBRK 2A5IA 3QTVH 5E0GA 1KSNA 3OY5U 3UR6A 1G32B 5L30H 2JH6D 2GD4B 1SGQE 1XX9A 1SB1H 1QJ7B 1ZGVA 1GJ8B 1EATA 3SU2A 2C8YB 2HRVA 2ULLA 1BTWA 4JK6A 2SGPE 4A5TS 2AIQA 1DWDH 4TY7A 3TNTA 4ABHA 1C5SA 1UTPA 1W3CA 2CV3A 1UVOA 1GBEA 1FMGA 5DPAA 2WV5A 3QWCH 2ZC9H 2R2MB 1C9TA 1GI7B 4AG2A 4Q7XA 1BJUA 1HCGA 4Y7BA 1GDNA 3HGPA 1AVGH 1W7GH 2ZDNA 4O97A 3K65B 1TBZH 1MTNC 1A5HA 4MPXA 4BAKB 6GCHF 2FOHA 1O2XA 3JZ2B 1H1BA 2XBXA 3FAOA 5FPTA 3U9AH 1IQLA 1P03A 4YESB 3KQCA 1JIMA 4GPGA 3VPKA 2A31A 2TPIZ 3SI3H 3F9EA 2A7HA 1TNGA 1HJ9A 1LVMA 1G3DA 3DA9B 3MO3A 3QLPH 4BAOB 3BTFE 1AKSB 3UOPA 4WF8A 4I33A 1ZLRA 2OUAA 1WTHD 3SGBE 1K22H 2ZDVH 1EPTB 4INLA 1AFEH 2D8WA 1TNJA 4VGCB 4XDEA 6LPRA 2OQUA 5FAHA 3ZVGA 1NRRH 2AMPA 4K3JA 4JYUH 4K8YA 4AORA 3ZVFA 3P6ZB 5J4QA 2VNTA 4TWWA 1ETTH 1AVWA 2FTMA 3A7XA 2CF8H 1OS8A 4F49A 2A5AA 3P8NA 4MPVA 4Y0YE 1FLEE 1FIZA 1V2ST 3TJOA 1F0UA 1PYTC 2Y7XA 4ABAA 3B23B 1BRAA 3LGTA 4AG1A 2GDDA 3RXQA 1YC0A 1ZHRA 1PPHE 3BTQE 1CT4E 1LQEA 4KKDA 1EJNA 2Z3EA 3GICB 4E7NA 2SNWA 5K0HA 1P2MA 4LZ4B 1DWBH 3PROA 1EASA 1S85A 4BTIB 1XUFA 5HGGA 2EC9H 1JIRA 3LC3A 2W7SA 1V2OT 1GGDC 1SOTA 3TIUA 1Z8GA 1C4V2 5A09A 3M61U 1WUNH 1MD8A 4XSKU 3TJNA 1RTFB 2ANWA 2ZFQH 1Z1IA 3K6ZA 1TGCA 4ZXXH 1FJSA 1Z6JH 1C5TA 2JH0D 1W12U 1ZJDA 2AGGX 2FESH 4DY7B 1O2YA 1O32A 1EB2A 1C4Y2 2BD3A 1DY9A 1C1OA 2ZCHP 2H1UA 1H9IE 1SGIB 3R0FA 1BRUP 5FBIA 5GJ4B 1C2KA 7GCHG 1P0SH 1GI8B 2ZZUH 2ZHQH 2BQWB 3BTTE 2BVSH 2WPJS 1LKAA 4ISIH 1F5KU 4GVUA 1YKTA 1ZPBA 1ANBA 2CF9H 1FQ3A 3AW1A 1ELTA 2PKSB 3VGCC 3A85A 1L4ZA 1HAIH 4WMFA 2BLQA 1P9UA 3SNBA 2W7UA 4Q7ZA 4MDSA 2VWOA 5EQQA 3RXPA 1C2LA 1YP9A 4AFQA 5FX6A 1N6XA 1HRTH 3EAJA 1KIGH 1JMOH 3MFJA 3DFLA 2ZU4A 2SGDE 4AN7A 1PQ7A 1HDTH 2OC0A 1PPCE 4R8TB 1MTSA 3K2UA 4U32A 1PPBH 1SOZA 3U98H 2PLXA 4A1XA 3BIUH 1TX7A 1PQ5A 2VWLA 3SU5A 3DD2H 1IQIA 4Q80A 1O2SA 3Q77A 3FP7E 4IN1A 4AYYB 1ANDA 2WPHS 1XM1A 2XBWA 3PV4A 1RD3B 1WOFA 3MU8A 2Y81A 1LDTT 4AGJA 1ABJH 1K1PA 1UVUH 3HK6B 4CRCA 1P12E 3RC4A 4CHAC 1SQTA 2EI6A 2QF3A 1O2LA 1TGNA 3P92A 2ZU2A 4B75A 1CGHA 3RUOA 2VGCC 1G2LA 5FHTA 1QL8A 1GHXH 2QAAA 4GHTA 1BZXE 1C5RA 1BHXF 4D8NA 4DT7B 2O8MA 3T5FH 1DFPA 3T27A 1UTLM 3RU4T 3QK1A 1ZR0A 1HJAB 2OQ5A 4TPYA 1C2FA 2P93A 2XC0A 1TNKA 1O2MA 1SQAA 5JB9S 1FY5A 2C8ZB 2G4TA 3RXRA 4KP0A 1TB6H 3M3VA 1OYTH 4ABDA 3TGIE 1U6QA 4ABJA 1GJ9B 1TWXB 3PLKA 1ANCA 1EJAA 1FUJA 1ZYOA 4WWYA 2V0BA 1O3HA 1NS3A 1TPAE 4LOYH 4D9QA 1ESBA 3FP8E 1HXFH 3UR9A 3ESTA 4ZHMU 3RXOA 4CRAA 1BQYA 2VIDA 1FXYA 3TH2H 2VINA 2ZDLA 1HNEE 1GI3A 1XVOA 3S7HB 2BDIA 4TYDA 1DOJA 3GY6A 1HJ8A 2J95A 1XUHA 3A89A 4MNWA 5FX5A 4YLQH 1MZDA 1FN8A 5CE1A 4B71A 3L33A 1ZGIA 2C90B 2FLRH 4BAQB 1MKXH 1YCPH 1T8MA 3I78A 3U1JB 3VXEH 2VVCA 1AVXA 1O31A 4FUIA 1JXPA 2AH4X 2ZWLH 3PMAB 1CT0E 4Y76A 1MKWH 5T6FA 4RKOB 1LPZB 2AMDA 1HAGE 1AFQB 2XBYA 2BLWA 2ODPA 4A92A 4YT7H 1WYKA 2BDAA 1DX5M 1GJ6A 1GL1A 1LPGB 1MUEB 3Q3YA 2GX4A 1ESAA 1KXFA 3RC6A 1UCYE 1ZSLA 1VCPA 3VFEA 1MTNB 3LT3A 3GYLB 2BDYA 5JBTA 3RXBA 1JBUH 1O3OA 1OKXA 3VB6A 3B8JA 3S69A 1FDPA 2ZFSA 1P57B 1O3EA 2P94A 3PMHB 3DFJA 1L2EA 1QNJA 4X1PU 2R3UA 3S9BA 3MO6A 3E90B 3G01A 1GVKB 4JZFH 2FS9A 3SUGA 1SFIA 3MTYA 5LGOA 2XCFA 3KF2A 2BY6X 3BTKE 3MHWU 1GBAA 1D4PB 1PPFE 1HAHH 1C4U2 1O3KA 1XUKA 3L6PA 4FUCA 5JBAS 1G3EA 2GZ8A 1YPKH 1J8AA 4FUBA 1FN6A 1O0DH 3UNRA 5EXLA 1HAVB 1E36B 1W11U 2GCHG 3NUMA 3AAVA 4FUDA 3KNXA 3SV6A 3GCHB 1O2QA 3LGYA 4X6MA 3OX7U 3MOCA 4DW2U 1QRXA 4MPUA 5EPNA 2ZDMA 1GPZA 3HATH 3M3SA 3T26A 1TIOA 1H9HE 2J38A 1Q3XA 1ZTJA 2GT8A 4Y10E 2ZNKH 5HM2A 2WYJA 1LKBA 3TH4H 3QTOH 4ABBA 5DKMA 4YLUA 3LGVA 4D7FA 2Z9IA 3VEQB 3VB3A 1O3GA 1ZMJA 2ZEBA 3EQ0H 4X1RU 2OLGA 1O2WA 1HLTH 3GY2A 4XFQA 1TA6A 2FI4E 4CREA 2WUCA 1GJDB 2ZQ2A 1EXFA 5F8ZA 4O03A 2UUFB 1VGCB 3MU5A 1O36A 2BOKA 3TK5A 1TGTA 1V2KT 1PPGE 4Y11E 2JETB 3MNXA 2FX6A 1JOUB 4NFFA 2J9NA 1YPLH 2Z9GA 4FXGH 4NWLA 2Q6GA 1A1RA 1DUEA 2NU0E 3ZVBA 3SJKA 3BTGE 4JYVH 4KELA 1GI1A 4JZDH 1O2OA 4JMYA 2G51A 4JZ1A 5I46H 2BX4A 4WH6A 3RXIA 1O35A 1Q2WA 1O2UA 1TMUH 2A7JA 1UK2A 2FS8A 4Y71A 1GMHG 1ZPZA 1SQOA 2EI7A 1QRWA 1QBNA 1HUTH 2HWLB 1NFUA 1T8OA 5FPYA 1KXBA 2PWXA 2BD5A 3E0NB 1S83A 1X7AC 2LPRA 3MH7A 3S0NA 2G8TA 2PGBB 1TFXA 2VIQA 3Q76A 1WSSH 3H7TA 3GY3A 3FFGA 5A0CA 2P8OC 1VCQA 1O3IA 3BG4C 4DIIH 4OS1A 5GDSH 3ZVCA 4I8GA 3P8GA 2HLCA 2Z6BD 1O3MA 4IMZA 4B2BA 1GBCA 3ZVDA 3PLPA 1T4UH 2FM2A 4MQAA 4BAHB 2QV1A 2ANMH 2AEIH 1XXDA 1O3FA 2BD9A 3ZV9A 2IOTA 2PKAA 4IC6A 3UTUH 2C93B 3MH4A 5DP4A 3S9CA 5E0HA 4UFDH 3BTWE 3RDZA 3VB5A 1V2QT 2UUJB 1N8OB 1BTUA 4E06H 1QB6A 1P10A 2FYQA 2YNBA 1MBMA 3UNQA 1KXDA 4ISHH 4NZLA 4I8HA 1ORFA 1TX8A 1VITG 2HOBA 1L1GA 3M5LA 5DP3A 3RXTA 1ZTKA 1C9PA 1ARBA 1LHGH 2BDBA 2A1DB 2Y5GA 3RXLA 1INCA 1BOQA 2PTCE 4X0WU 4CHAB 1UTQA 2I6SA 1PYTD 3WY8A 4OGXA 4K1SA 4WXIA 1IQGA 1Z8JB 1NN6A 1YYY1 1ZRBA 1V2VT 1GI5A 3SHAH 2OCVB 1S6FA 2SGAA 4AB9A 1E35B 2ZU1A 3BG8A 4YOJA 5LPFA 4FU7A 1F0TA 3FVFB 3TLOA 1XKBC 1XUIA 2FOFA 5EODA 2RA3A 1ZRKA 3OY6U 2P8OB 2HPQH 1LPKB 1HJAC 1AQ7A 4X6NA 3UOUA 4MPWA 4WY3A 1TNLA 1QY6A 2GV7A 1L1NA 1EQ9A 1UVTH 2PW8H 5JBBS 1MCVA 4TWYA 2G00A 4NSYA 2QF0A 5DP9A 3LGIA 2AMQA 4K2YA 1QCPA 4Y8ZA 3ELAH 3H5CB 1PFXC 5DP6A 4BNRA 3P8OA 5E2OA 4X8VH 3RXVA 5EGMA 1TX6A 4Y8YA 1TNHA 2OBOA 1DDJA 3QZQA 1TABE 1DSTA 1KXCA 1AU8A 1SFQB 4INKA 2FIRH 2ZCKP 4ZKSU 1EOJA 5A8YA 1O2PA 2NWNA 3A80A 1TNIA 1Z71A 3CS0A 4X8SH 1CBWC 1W7XH 1RJXB 3DHKH 3V13A 1TRYA 3UNSA 3ENSB 1C1TA 1O5FH 1ZSKA 4JZIA 2QN5T 1THSH 4CBNA 3BV9B 2GCHF 3LC5A 2BQ6B 4B2AA 1P05A 3RMMH 2Y5HA 2VU8E 1AKSA 2XWBI 1KLJH 4THNH 2GKVE 1LMWB 3TVJB 1CT2E 5A8ZA 1QBVH 1KDQA 3KIDU 4AFZA 2VIWA 2F9PA 1SGTA 2PUXB 4UD9H 1GBFA 3SORA 1K21H 3T62A 1GHAG 3HK3B 1AWFH 5C1XA 1SMFE 3W95A 8GCHF 1C1NA 2XXLA 1QA7A 2UWPA 1V2MT 4CH8B 5J4SA 1BHXB 2ZKSA 1C2DA 1DXWA 4HFPB 4K8BA 5EG4A 1K1LA 2WV4A 3IG6B 4MVNA 1C5NH 3D23A 3P70B 1C2MA 3A7ZA 1TOCB 3SV7A 1S0QA 8KME2 1KYNA 5JBCS 1C1QA 4NSVA 1NC6A 1XUJA 3SGQE 1XXFA 1FONA 4OS4A 1V2NT 1RFNA 1QTFA 2EEKA 5BRRE 1HIAB 4MNYA 1OX1A 2KAIA 1QR3E 4QT8C 1GCDA 3E8LA 4AX9H 5FCRA 2NU2E 2PGQB 2FMJA 3R3GB 2ZFFH 4YT6H 1LVYA 1RS0A 1C5MD 1GBIA 4I32A 5CMXH 4FUFA 5IYTA 3PYHA 1L0ZA 3PO1C 3T2NA 4NIVA 1WAYB 1GI4A 2BD7A 4ZKRU 4YO9A 2GV6A 3M5OA 2VGCB 3OYPA 4UEHH 1QL7A 1NPMA 4A7IB 1GJ5H 2M5TA 2F91A 1LTOA 1BMMH 2G81E 1C5YB 1JWTA 1DXPA 5DGJA 1K1OA 2ZQ1A 1CA0C 1ID5H 2VIPA 2XBVA 3SUEA 1HBTH 3U8OH 4ISLA 1O2VA 2HGTH 2ODYB 5LH8A 3BIVH 1YPGH 3A7YA 1P01A 1O3LA 4NGAH 4HI3A 4ZKNU 2GCTB 4ESTE 1K1MA 1S0RA 2XTTB 3NXPA 1YPEH 1RRKA 1M9UA 3GY5A 2TBSA 1J16A 3LIWA 3QX5H 1Y8TA 1K1JA 5EW2H 2K1QA 4B1TA 1O3JA 1ESTA 1DY8A 5EPYA 5A2MH 1PPEE 2QXGA 3MNSA 3QGNB 4CBOA 1UCYH 3T29A 1HAYB 3W94A 1SHHB 3ATWA 3RMOH 4NA7A 1F0RA 4NIYA 2A7CA 3HPTB 1C1WH 1UK4A 2VVUA 5C5OA 6CHAC 1A0LA 2JH5D 2UWLA 1CGIE 2XWAA 1GBTA 1EP6A 1GBKA 3PMBB 1NRSH 3CP7A 3V7TA 4HGCA 4A1TA 2BXUH 1ELCA 1EX3A 4IN2A 1ZOMA 1WU1A 1GL0E 1GWAA 3A7VA 1A7SA 2GMTB 2YOLA 1A0HB 2BQ7B 2PUQH 3MU1A 1EP5A 3KGPA 3VGCB 3TITA 3RXMA 2OC7A 2BHGA 2UUYA 2ZECA 2FPZA 1H8DH 2QA9E 1GMCG 3F68H 2ANKH 1GI6A 3F9GA 1FV9A 2TGDA 8LPRA 1A5IA 2ZO3H 3C1KA 4NA9H 1IHTH 1W0YH 5C20A 2OC1A 3O8RA 4MLFB 1GBDA 2ZI2H 4INHA 2BLOA 2FOGA 3S9AA 3JZ1B 1HV7A 1TBRH 3D65E 1O5CB 3P17H 4RKJB 1GHBG 2ZFRH 4BXSA 1NO9H 3U8TH 1QL9A 2ZCLP 3Q3XA 1H8IH 3FANA 3D62A 3LOXA 4X2YA 1UCYK 3UY9A 2QXIA 1GHWH 1G37A 2ANYA 3P95A 1DWCH 1F5LA 1OWJA 2Z3CA 2I6QA 5C1UA 2H6MA 5ESTE 1EOLA 1TAWA 2G55A 2ESTE 5K7RA 1H9LB 2BB4A 4BANB 1QB1A 1C5ZB 4XE4A 1OWKA 5C1YA 2CXVA 2ZPSA 3VB7A 4AFUA 2A2XH 2TIOA 3MMGA 1GVLA 3MI4A 3KHVA 1E38B 2RCEA 1NU7B 3PMJA 2A32A 3MH6A 4XBCA 2THFB 2GZ7A 4GUXA 2XCNA 5T6GA 1SGFG 2BVXH 1O3CA 4ZHAA 2SGQE 1CVWH 1UTJA 4UE7H 4X1NU 3UPEA 1HAOH 1SGEE 3RXEA 1AZZA 3SU6A 3PWBA 4OS5A 2A5KA 1IQNA 5B6OA 2F9NA 2W26A 2GVFA 3TGKE 4ABGA 1V2JT 2FX4A 1SSXA 1P9SA 1TPOA 2BZAA 4FUGA 1BMLA 4Z6AH 1HAPH 3AAUA 4D76A 1TONA 2H9HA 2BOHB 4HZHA 3LDXH 2P3FH 1OSSA 4BOHA 1B0FA 2B9LA 2NU3E 3MNBA 4GHQA 1NFWA 2OINA 3EA8A 3ZV8A 3LU9B 2W3IA 8ESTE 1ZMLA 5L6NH 5DP5A 1BMNH 1GHVH 1LHCH 4LXBH 4AB8A 3MU4A 5GIBA 1GVZA 2DUCA 3BG4B 5AVDA 1ZTLA 3BEUA 1C1UH 1BTZA 1BJVA 5EU8A 1FZZA 1TLDA 2FOMB 2HNTC 5EXNA 4GSOA 2EI8A 1T31A 1C2JA 5JDUB 4DOQA 1N6YA 5PTPA 1T8LA 3NK8A 1WTGH 1RXPA 3LGUA 3E6PH 1SLUB 1MBQA 3SU0A 1P02A 5I25A 1MMJN 1P2OA 4WXVA 1IAUA 1UTNA 1YPJH 2VWMA 5FXLA 9ESTA 1FNIA 3RXDA 2OP9A 3A8AA 5GXPA 3ATKA 1BBRH 2JKHA 3AVZA 2WPIS 3O8CA 1K1IA 1BTXA 3IITA 4DJZB 5JPMH 3NCLA 4ZMAH 4I7YH 1A3EH 1C5LH 2RG3A 3A8CA 5CHAB 1QJ1B 3LH1A 3C27B 1DVAH 2FP7B 1EB1H 1DM4B 1J9CH 1O34A 1NT1A 1RTLA 1GCTC 1P11E 2VH0A 1RIWC 4I8LA 1OWDA 3KL6A 2BLVA 1MZAA 1CHOG 4J2YB 4RSPA 2Z9JA 2ZHWH 4CRDA 1LVOA 1O2IA 1BTHH 5HMAA 1C5UA 2Z7FE 2CJIA 4WJG2 3SHCH 2ZG0H 5C5NA 3HKJB 2PKAB 1C1RA 1C2IA 2VB0A 2Z94A 3RM2H 3SJIA 1QQ4A 3CENA 3F6UH 3STJA 2F3CE 1AUJA 2BY7X 3M5MA 1NU9A 3DT0H 1ZZZA 2FXRA 3V12A 3SUFA 3EDXB 1F0SA 1AD8H 3A7TA 2GGVB 3KQDA 3UREA 3PB1E 1HIAA 4RN6A 5EOKA 1WV7H 4GCHF 5EQSA 1V6DA 1G36A 1GBBA 2A4GA 4X2VA 1NTPA 1E34B 4NFEA 2G52A 3EA9A 1VZQH 3TGJE 3URDA 2STAE 1O3DA 2FOCA 2KAIB 2BD8A 2G5NA 4Q7YA 4WMEA 2BM2A 4CRBA 2V6NA 3E3TA 1FAXA 1TBQH 2O9QA 4K69A 3NKKA 1EAIA 2D1JA 5E8EH 3BF6H 1C2EA 4Z0KA 4Q2KA 2QCYA 1AE8H 1GG6C 2ZHEH 1ELEE 1BTPA 4MG3A 5ABWA 1YF4A 3A83A 1FPHH 1UHBB 3H7OA 1GI0A 3HKIB 4OS6A 4FUEA 5DG6A 1GJAB 3KQEA 2J92A 2CN0H 3SQHE 4OS2A 1AMHA 1D3TB 3GY4A 2QXJA 1O30A 2IN2A 1O3PB 1OXGA 2ZHFH 3UQOA 2H5CA 3V0XA 4IS5A 4HTCH 1ELBA 4FUHA 4YM9A 2BD4A 1ZHMA 2C3SA 1CBWB 2TRMA 1NRQH 1J14A 1EAWA 4I31A 1DICA 1DANH 2ZTXA 3QUMP 2FZZA 2R0LA 3E0PB 1EZSC 4KGAA 3TH3H 3SUDA 1O37A
chains in the Genus database with same CATH superfamily
3U8RH 4OM9A 5TJXA 3RP2A 1F2SE 4UFGH 3GISB 3PLBA 1Z8IB 5DP7A 5E0JA 2OD3B 3TJUA 1NRNH 3RM0H 1VJ9U 1K28D 2FEQH 5E2PA 4NA8A 2J34A 5G4BA 3GY8A 4OS7A 5HXFA 1JRTA 2GDEH 5GPIB 2A4QA 3TK9A 1MU6B 3BTDE 5FPSA 6CHAB 1SLXB 4IBLH 1SG8B 1ANEA 8GCHG 2H9TH 2SGEE 1Y59T 1O33A 3CS7A 2R9PA 2AYWA 1ELDE 2HVXA 1FPCH 3MO9A 1B0EA 4E05H 1NRPH 1A5GH 1YCPM 3EYDA 2GTBA 4JZEH 3ZZBA 1V2PT 1LQDB 1AY6H 3A8BA 1G30B 1SLWB 1SGNE 2AGIX 3B9FH 2VVVA 2BY5X 1GGDB 1GBMA 3M37A 3ZYEA 2ZHDA 2L74A 1CSOE 1QFKH 4GAWA 1SQRA 1C2HA 3MNCA 1ELAA 1SGFA 2WUBA 2ZGCA 1OWHA 5JB8S 2NU1E 4IMQA 3M36A 2P59A 4LZ1H 5C0UA 2TGAA 3MWIU 4SGAE 3RMNH 2A4RA 4NIXA 2OBQA 5KECA 2QE7D 2B7DH 2V3HH 1SGCA 1RGQA 1OP0A 1XMNB 1MD7A 1MAXA 1WQVH 3RU4D 2IPHA 1MQ5A 2PTNA 2BD2A 3GCNA 1FIWA 1P04A 1GJ4H 1O5GH 2A0QB 1QJ6B 2XYAA 3FKSD 4YOIA 2GJGA 4YTAA 1OYQA 1BITA 1KLIH 5CHAC 1LHFH 4ZXYH 3QN7A 2W3KA 4NWKA 3GY7A 1B5GH 1EJMA 3E1XB 4E7RG 3O8DA 2FYRA 4Y79A 2RFKC 1EAUA 1UTMA 2XRCA 1CA0B 1GMDF 2AHME 1DSUA 4O3TA 2ZTZA 1YWUA 1SLVB 1L1JA 2ZGXH 1VCWA 4ISOA 3P8FA 2R2WU 2QGRA 2XOKD 1MTVA 1ZJKA 1TQ7B 2RDLA 1DLEA 2B8OH 2KCYA 1TPPA 3K9XB 2FO9A 2TGPZ 2BYAX 2ILNA 1ETSH 1QQUA 1PQAA 2B5TB 2Z3DA 3UIRA 5KEDA 4ZROA 3L3TA 2K0QA 1VJAU 1KTTB 1DLKB 1T7CA 3ITIA 2FODA 2BVRH 1TALA 4B2CA 1W0KD 4X1SU 2BTCE 2IJOB 1CO7E 1CHGA 1Y3UA 3K6YA 4AGKA 4U30A 2H2ZA 1MQ6A 1WDIA 2XC4A 4D7GA 4P02A 2W5EA 7LPRA 3KN2A 1QA0A 6GCHG 5A8XA 4H6TA 4YZUA 2ASUB 1UK3A 1LCYA 3OAAD 3OTJE 3URCA 5DN6D 1OWIA 4A1VA 2UWOA 1TRMA 2QXHA 2JETC 3RXJA 2CMYA 2WPMS 2AERH 2AS9A 2A45B 1UVPA 3OTPA 3LKWA 4ZHLU 9LPRA 2KCAA 1WCZA 4X8UH 2FLBH 3TPIZ 5EJZA 2A2QH 1EPTA 5F8TA 4AFSA 1BMFD 1O3AA 1FAKH 2BMGB 1F7ZA 3SZNA 1CA8B 1UO6A 5DJ7A 1IHSH 1K2I1 4IW4E 1EZXC 2V3MA 3M5NA 5DP8A 4BAMB 1GMCF 2JIZD 2CGAA 2ZTYA 1ACBE 1GHBF 3UB0A 4ABIA 1D6WA 1ZPCA 2VJ1A 2QIQA 1AB9B 1HXEH 4AOQA 3A87A 4XBBA 3EGKH 1XVMA 2PP6A 1HB0B 3SOSA 4OGYA 4IGDA 1W8BH 2PSYA 2FOAA 5C94A 3DUXH 2FWWA 5HKKD 1FY3A 1HAXB 1P2KA 1RIWB 1CE5A 1IQEA 1LHDH 1MU8B 1AUTC 4XBDA 1GG6B 3SV8A 4CRFA 1QBOA 4DIHH 2ZPQA 4D9RA 3SU3A 4DCDA 4FU8A 1E0FD 1BRCE 1P3CA 2P3TB 1C2GA 1BDAA 1AFQC 1E1RD 1KXEA 1YLDA 1E37B 1O2TA 1HAZB 1P2IA 1YGCH 3ZVEA 1ELVA 3SBKA 5GCHG 5HYOA 2AIPA 2BY9X 1AN1E 1C5XB 1DT2A 3IWMA 3OFND 1O3NA 1ZSJA 1WQSA 2WINI 2ZDAH 3RXKA 2VIVA 1B7XB 2WV9A 1GMHF 2Q6FA 3F2HA 2P16A 2SGFE 1GCTB 4TSFD 2O8WA 3UFAA 3VXFH 1EUFA 3KEEA 3F9FA 1QIXB 1EAXA 3RMLH 4X2WA 1EZUC 5ETXA 3AASA 3ZZ5A 1BRBE 1GJ7B 1C1VH 1ETRH 1V3XA 2KZ4A 1BUIA 2ZF0H 1FY4A 1V2WT 1C1MA 1S5SA 5FL7D 3VB4A 1P09A 1V2UT 3F1SB 4F4OC 3U69H 1C5VA 3MH5A 4X6OA 3M7TA 1VITF 4LK4A 2OTVA 1V2TT 1YBWA 4H4FA 1QRZA 4ABEA 1HYLA 2EQNA 4UFFH 3RU4E 2ALVA 2ZP0H 1LO6A 1DS2E 1O2KA 3ATLA 5LPEA 3UAIC 2PFEA 5C17A 1HPGA 2J2UA 1KXAA 5A0AE 1EZQA 4X8TH 5BPEA 1V2RT 5IDKA 1QGFA 4U2WA 1O2RA 3RXCA 4H6SB 1GMDG 1Z7KA 4Y6DA 5GCHF 3QGJA 2Y82A 1Z8RA 1ARCA 2WYGA 5AF9H 3O8BA 5JYIA 3HGNA 2XNIA 1SVPA 2P95A 4FVBA 2XC5A 3ATMA 1NFYA 1C1PA 4MNVA 4R0IA 2ZU5A 4U01A 2CHAB 3GCTG 1TPSA 2HNTE 3M7UA 2Z9KA 3KQBA 1YPHC 3A88A 4NG9H 3RLWH 2YMSC 1A2CH 1A4WH 1O5DH 1TYNA 1YPHE 1AGJA 2J97A 3GOVB 4AYVB 5F03A 5GNDA 4CH2B 4KTUA 1VGCC 3UWIA 1DPOA 1TGBA 3OSYA 2Q1JA 1TQ0B 4UFEH 2Z9LA 2C8WB 1FI8A 1GBJA 2RA0A 2O8TA 2F9OA 1UJ1A 3ZZ9A 4TPIZ 1GDQA 1TOMH 1OPHB 1OP8A 3RXUA 1A3BH 1G3CA 7GCHF 2XW9A 4X1QU 3V3MA 3NWUA 3MU0A 4BXWA 2R3YA 2P3UB 4KTCA 3TK6A 1O38A 4MNXA 1BT7A 2O8UA 1MTWA 3LPRA 3UWJH 5FBEA 3RC5A 1Y3XA 2HALA 1THRH 1SGPE 2BXTH 3ZZCA 5KGOA 1MAYA 1MTUA 1DE7H 3SNEA 5F6MA 1RTKA 1TE0A 4F48B 3M7QA 4K1EA 3T28A 1PJPA 1BA8B 1BCUH 3BTEE 1A61H 1SL3A 2PR3A 3QDZB 1ZMNA 3QZRA 1ABIH 1GHAF 1SC8U 4J1YA 3KCGH 2AGEX 1F5RA 3M35A 3BEIB 3OU0A 1BB0B 1Z6EA 3ZZ3A 2V3OH 4XOJA 3BSQA 3D49H 1A46H 1TMTH 4UONA 3GCTF 1W0ZU 2BDCA 2YNAA 4AZ2B 1S81A 1W14U 1OHHD 1P8VC 1QURH 3LJJA 3UQVA 2OXSA 5C67A 2QC2A 3A8DA 3SNDA 1P3EA 2FI3E 5SGAE 2QF5A 1NROH 2DE9A 3Q3KA 1QB9A 1PQ8A 1Y3WA 2F9UA 2PV9B 1IQMA 4K1TA 1Y5UT 4X2XA 2BY8X 2STBE 4B74A 1HGTH 1KMHB 2PHBA 4FUJA 1Y3YA 3AW0A 1NBMD 5LPRA 1IOEA 3I77A 3RXSA 4NCYA 1T8NA 4ACBA 1CU1A 5TCAA 2ZFTA 4B76A 3NPSA 2V35A 3SQEE 1J15A 7KMEH 6ESTA 3EE0B 2Y80A 5C3NA 1SHYA 1IQFA 3VG8A 4Y8XA 1HAVA 2HPPH 1O3BA 2GCTC 4NIWA 1A0JA 3PTBA 5TCCA 1KTSB 2OC8A 2B0FA 2QYIA 1CHOF 1OP2A 3PWCA 1NESE 1UTKA 4JK5A 1J17T 1PPZA 2LELA 3FP6E 4ASUD 3GCHC 4TY6A 2GZ9A 2ZGBH 2FTLE 2FOEA 1QZ8A 1V2LT 4BTUB 1K9OE 1IQJA 1SGDE 3E91A 1IQKA 1GHZA 4O3UA 4MTBA 4NZQA 3GDUA 4Q4LA 1N1LA 4X6PA 1D6RA 2GMTC 4FOUC 3FZDA 1GJCB 3SJ8A 1NY22 1AIXH 4Q63A 4A6LA 3ZZ8A 1D9IA 3GDSA 1AZ8A 4GCHG 2V7QD 4ZH8A 1CGJE 1S84A 4B6FA 2ZU3A 4DURA 3N7OA 1EKBB 3SJ9A 1AO5A 3LJOA 4Y0ZE 2VH6A 2ZDKA 1G2MA 4KTSA 1HFDA 3RXAA 4CR5A 3SU4A 4DVAU 2H9EH 3E16B 1D3DB 5F53A 3SO3A 2J94A 4O9VA 5B6LA 1IQHA 1TMBH 2Y5FA 2F9BH 3EA7A 1MKXK 1YCPK 3LH3A 2ZGJA 1GI9B 5DO4H 1BBRE 3F9HA 1D3PB 1O5EH 5GWZA 1P2NA 1NM6A 1FY1A 1NFXA 1W2KH 2HNTF 4Y7AA 3MQKC 2Y6TA 3BTME 1O2HA 1UMAH 2ODQA 4DG4A 3A84A 3NZIA 3Q00A 4K60A 4I8JA 1CQQA 1BMAA 4RT0A 3SGAE 3ZZ6A 1BIOA 1GDUA 3RXGA 2FOBA 2GT7A 1VR1H 1Z1JA 1KLTA 1WBGB 5EW1H 1BTYA 2KR7A 3S7KB 4ZKOU 7ESTE 2BX3A 1AI8H 2ZGHA 3U1IB 4B73A 1MCTA 4BTTB 2D2DA 3FZZA 1C5OH 4SGBE 1P06A 1T4VH 3ZZ7A 1C5PA 4K5ZA 2BDGA 3BN9A 3GDVA 4YOGA 3QO6A 3RLYH 3RXHA 2LNCA 3SNCA 1TA2A 3BTHE 1W13U 2BZ6H 1SGYE 1LVBA 3SN8A 1XKAC 4UDWH 3RXFA 3LGWA 5FCKA 4M9FA 1O2GH 1MABB 1N8OC 1Y3VA 1T32A 1OOKB 1UVSH 1S6HA 1Y5AT 4VGCC 3SV2H 2CHAC 1DWEH 1AHTH 3ZZDA 3ODDA 1YM0A 4ZAEA 1VITH 1XUGA 1AB9C 2ZIQH 3I29A 2TGTA 1O39A 3GCOA 1TRNA 3SV9A 2WPKS 1NZQH 5AHGH 1MH0A 1C5QA 1KY9A 1P2QA 2F83A 2EA3A 4IC5A 4CR9A 2SFAA 1SR5C 4CRGA 1C1SA 2C4FH 1AE5A 3ATIA 5C2ZA 4GLYA 3BEFB 1UTOA 3MYWA 5L2ZH 3SU1A 1AWHB 4ISNA 4ZUHA 3LONA 2ALPA 4ASHA 1SI5H 1OWEA 2PKSC 3SI4H 4YXWD 1SBWA 1ZHPA 3PO1B 1L4DA 2DE8A 5HM9A 5C0TA 1THPB 1ELGA 1DITH 3TU7H 4JCNA 4PROA 3WWBA 5T6DA 1S82A 2BDHA 2FI5E 1GI2A 1O2JA 1YLCA 2UUKB 1C5WB 1EPTC 3STIA 1K1NA 4I8KA 4JYTA 4M7GA 2GP9B 5ESBA 4DGJA 1O5BB 3SJOA 5A0BA 2QY0B 3ZZ4A 1DUAA 3DSPA 2F9VA 2G5VA 4FU9A 5H4IB 2VIOA 1JRSA 2H5DA 2VWNA 1P2JA 1O2ZA 1D3QB 3A7WA 5AFYH 3ZVAA 1GJBB 1GHYH 1GBLA 2G4UA 5DK1A 1K0HA 2SNVA 1Q31A 1SPJA 5F8XA 1F92A 4FVDA 1QHRB 1ELFA 1Y5BT 2ZPRA 3PRDA 2AFQB 5T3HA 3PM3A 3UUZA 3TJVA 2Q6DA 3ZYDA 3T25A 2O8LA 1TGSZ 3A81A 1O5AB 1YPMH 1H4WA 3ODFA 2C8XB 3PTNA 2ZA5A 4WVPE 4H42U 3GYMA 1UHBA 2PSXA 2CK3D 4FETA 1W10U 2D26C 2J4IA 5L2YH 3ZZAA 2ZFPH 1O2NA 2NU4E 5EQRA 4XD7D 2A4OA 1GBHA 4WMDA 1FY8E 2R0KA 5AFZH 1G3BA 1G9IE 3TNSA 5IK2D 2KX4A 4WH8A 1KDQB 3M3TA 2FDAA 3SW2B 2WPLS 5EXMA 3A82A 3SNAA 3A86A 2WPDD 1MKWK 1SGRE 2Y7ZA 1LHEH 3OE7D 4ABFA 1BBRK 3F2GA 2A5IA 3QTVH 2KCOA 5E0GA 1KSNA 3OY5U 3UR6A 1G32B 5DSFA 5L30H 2JH6D 2GD4B 3F3BA 1SGQE 1XX9A 1SB1H 1QJ7B 1ZGVA 1GJ8B 1EATA 3SU2A 3PV2A 2C8YB 2JDID 2HRVA 2ULLA 1BTWA 4JK6A 3H09A 2SGPE 4A5TS 2AIQA 1DWDH 4TY7A 3TNTA 4ABHA 1C5SA 1UTPA 1W3CA 2CV3A 1UVOA 1GBEA 1FMGA 5DPAA 2WV5A 3QWCH 2ZC9H 2R2MB 1C9TA 1GI7B 4AG2A 4Q7XA 1BJUA 1HCGA 4Y7BA 1GDNA 3HGPA 1AVGH 1W7GH 2ZDNA 4O97A 3K65B 1TBZH 1MTNC 1A5HA 4MPXA 4BAKB 6GCHF 2FOHA 1O2XA 3JZ2B 1H1BA 2XBXA 3FAOA 5FPTA 3U9AH 1IQLA 1P03A 4YESB 3KQCA 1JIMA 4GPGA 3VPKA 2A31A 2TPIZ 3SI3H 3F9EA 2A7HA 1TNGA 1HJ9A 1LVMA 1G3DA 3DA9B 3MO3A 3QLPH 4BAOB 3BTFE 1AKSB 3UOPA 4WF8A 4I33A 1ZLRA 2OUAA 1H8HD 1WTHD 3SGBE 1K22H 2ZDVH 1EPTB 4INLA 1AFEH 2D8WA 1TNJA 4VGCB 4XDEA 6LPRA 2OQUA 5FAHA 3ZVGA 1NRRH 2AMPA 4K3JA 4JYUH 4K8YA 4AORA 3ZVFA 3P6ZB 5J4QA 2VNTA 4TWWA 1ETTH 1AVWA 2FTMA 3A7XA 2CF8H 1OS8A 4F49A 2A5AA 3P8NA 4MPVA 4Y0YE 1FLEE 1FIZA 1V2ST 3TJOA 1F0UA 1PYTC 2Y7XA 4ABAA 3B23B 1BRAA 3LGTA 4AG1A 2GDDA 3RXQA 1YC0A 3WWFA 1ZHRA 1PPHE 3BTQE 1CT4E 1LQEA 4KKDA 1EJNA 2Z3EA 3GICB 4E7NA 2SNWA 5K0HA 1P2MA 4LZ4B 1DWBH 3PROA 1EASA 1S85A 4BTIB 1XUFA 5HGGA 2EC9H 1JIRA 3LC3A 2W7SA 1V2OT 3FOAA 1GGDC 1SOTA 3TIUA 1Z8GA 1C4V2 5A09A 3M61U 1WUNH 1MD8A 4XSKU 3TJNA 1RTFB 2ANWA 2ZFQH 1Z1IA 3K6ZA 3WW7A 1TGCA 4ZXXH 1FJSA 1Z6JH 1C5TA 2JH0D 1W12U 1ZJDA 2AGGX 2FESH 4DY7B 1O2YA 1O32A 1EB2A 3FO8D 1C4Y2 2BD3A 1DY9A 1C1OA 2ZCHP 2H1UA 1H9IE 1SGIB 3R0FA 1BRUP 1UW7A 5FBIA 1C2KA 5GJ4B 7GCHG 1P0SH 1GI8B 2ZZUH 2ZHQH 2BQWB 3BTTE 2BVSH 2WPJS 1LKAA 4ISIH 1F5KU 4GVUA 1YKTA 1ZPBA 1ANBA 2CF9H 1FQ3A 3AW1A 1ELTA 2PKSB 3VGCC 3A85A 1L4ZA 1HAIH 4WMFA 2BLQA 1P9UA 3SNBA 2W7UA 4Q7ZA 4MDSA 2VWOA 5EQQA 3RXPA 1C2LA 1YP9A 4AFQA 5FX6A 1N6XA 1HRTH 3EAJA 1KIGH 1JMOH 3MFJA 3DFLA 2ZU4A 2SGDE 4AN7A 1PQ7A 1HDTH 2OC0A 3SZEA 1PPCE 4R8TB 1MTSA 3K2UA 4U32A 5HIZA 1PPBH 1SOZA 3U98H 2PLXA 4A1XA 3BIUH 1TX7A 1PQ5A 2VWLA 3SU5A 3DD2H 1IQIA 2JJ2D 4Q80A 1O2SA 1E1QD 3Q77A 3FP7E 4IN1A 4AYYB 1ANDA 2WPHS 1XM1A 2XBWA 3PV4A 1RD3B 1WOFA 2LP6A 3MU8A 2Y81A 1LDTT 4AGJA 1ABJH 1K1PA 1UVUH 3HK6B 4CRCA 2J5UA 1P12E 3RC4A 4CHAC 1SQTA 2EI6A 2QF3A 1O2LA 1TGNA 3P92A 2ZU2A 2KCPA 4B75A 1CGHA 3RUOA 2VGCC 1G2LA 5FHTA 2JJ1D 1QL8A 1GHXH 2QAAA 4GHTA 1BZXE 1C5RA 1BHXF 4D8NA 4DT7B 2O8MA 3T5FH 1DFPA 2IPQX 3T27A 1UTLM 3RU4T 3QK1A 1ZR0A 1HJAB 2OQ5A 4TPYA 1C2FA 2P93A 2XC0A 1TNKA 1O2MA 1SQAA 5JB9S 1FY5A 2C8ZB 2G4TA 3RXRA 4KP0A 1TB6H 3M3VA 1OYTH 4ABDA 3TGIE 1U6QA 4ABJA 1GJ9B 1TWXB 3PLKA 1ANCA 1EJAA 1FUJA 1ZYOA 4WWYA 2V0BA 1O3HA 1NS3A 1TPAE 4LOYH 4D9QA 1ESBA 1YLNA 3FP8E 1HXFH 3UR9A 3ESTA 4ZHMU 3RXOA 4CRAA 1BQYA 3N7DA 2VIDA 1FXYA 3TH2H 2VINA 2XNDD 2ZDLA 1HNEE 1GI3A 1XVOA 1FX0B 3S7HB 2BDIA 4TYDA 1DOJA 3GY6A 1HJ8A 2J95A 1XUHA 3A89A 4MNWA 5FX5A 4YLQH 1MZDA 1S6LA 1FN8A 5CE1A 4B71A 3L33A 1ZGIA 2C90B 2FLRH 4BAQB 1MKXH 1YCPH 1T8MA 3I78A 3U1JB 3VXEH 2VVCA 1AVXA 1O31A 4FUIA 1JXPA 2AH4X 2ZWLH 3PMAB 1CT0E 4Y76A 1MKWH 5T6FA 4RKOB 1LPZB 2AMDA 1HAGE 1AFQB 2XBYA 2BLWA 2ODPA 4A92A 4YT7H 1WYKA 2BDAA 1DX5M 1GJ6A 1GL1A 1LPGB 1MUEB 3Q3YA 2GX4A 1ESAA 1KXFA 3RC6A 1UCYE 1ZSLA 1VCPA 3VFEA 2YMSD 1MTNB 3LT3A 3GYLB 2BDYA 5JBTA 3RXBA 1JBUH 1O3OA 1OKXA 3VB6A 3B8JA 3S69A 3PRBA 1FDPA 2ZFSA 1P57B 1O3EA 2P94A 3PMHB 3DFJA 1EFRD 1L2EA 1QNJA 4X1PU 2R3UA 3S9BA 3MO6A 3E90B 3G01A 1GVKB 4JZFH 2FS9A 3SUGA 1SFIA 3MTYA 2KFWA 5LGOA 2XCFA 3KF2A 2BY6X 3BTKE 3MHWU 1GBAA 1D4PB 1PPFE 1HAHH 1C4U2 1O3KA 1XUKA 2WZQA 3L6PA 4FUCA 5JBAS 1G3EA 2GZ8A 1YPKH 1J8AA 4FUBA 1FN6A 1O0DH 3UNRA 5EXLA 1HAVB 1E36B 1W11U 2GCHG 3NUMA 3AAVA 4FUDA 3KNXA 3SV6A 3U28C 3GCHB 1O2QA 3LGYA 4X6MA 3OX7U 3MOCA 4DW2U 1QRXA 4MPUA 5EPNA 2ZDMA 3N7EA 1GPZA 3HATH 3M3SA 3T26A 1TIOA 1H9HE 2J38A 1Q3XA 1ZTJA 2GT8A 2J98B 4Y10E 2ZNKH 5HM2A 2WYJA 1LKBA 3TH4H 3QTOH 5EJLA 4ABBA 5DKMA 4YLUA 3LGVA 4D7FA 2Z9IA 3VEQB 3VB3A 1O3GA 1ZMJA 2ZEBA 3EQ0H 4X1RU 2OLGA 1O2WA 1HLTH 3GY2A 4XFQA 1TA6A 2FI4E 4CREA 2WUCA 1GJDB 2ZQ2A 1EXFA 5F8ZA 4O03A 2UUFB 1VGCB 3MU5A 1O36A 2BOKA 3TK5A 1TGTA 1V2KT 1PPGE 4Y11E 2JETB 3MNXA 2FX6A 1JOUB 4NFFA 2J9NA 1YPLH 2YMSB 2Z9GA 4FXGH 4NWLA 2Q6GA 1A1RA 4RT1A 1DUEA 2NU0E 2HLDD 3ZVBA 3SJKA 3BTGE 4JYVH 4KELA 1GI1A 4JZDH 1O2OA 4JMYA 2G51A 4JZ1A 5I46H 2BX4A 4WH6A 3RXIA 1O35A 1Q2WA 1O2UA 1TMUH 2A7JA 1UK2A 2FS8A 4Y71A 1GMHG 1ZPZA 1SQOA 2EI7A 1QRWA 1QBNA 1HUTH 2HWLB 1NFUA 3F0OA 1T8OA 5FPYA 1KXBA 2PWXA 2BD5A 3E0NB 1S83A 1X7AC 2LPRA 3MH7A 3S0NA 2G8TA 2PGBB 1TFXA 2VIQA 3Q76A 1WSSH 3H7TA 3GY3A 3FFGA 5A0CA 2P8OC 1VCQA 1O3IA 3BG4C 4DIIH 4OS1A 5GDSH 3ZVCA 4I8GA 3P8GA 2HLCA 2Z6BD 2KM0A 1O3MA 4IMZA 4B2BA 1GBCA 3ZVDA 3PLPA 5HIYA 1T4UH 2FM2A 4MQAA 4BAHB 2QV1A 2ANMH 2AEIH 1XXDA 1O3FA 2BD9A 3ZV9A 2IOTA 2PKAA 4IC6A 3UTUH 2C93B 3MH4A 5DP4A 3S9CA 5E0HA 4UFDH 3BTWE 3RDZA 2F4LA 3VB5A 1V2QT 2UUJB 1N8OB 1BTUA 4E06H 1QB6A 1P10A 2FYQA 2YNBA 1MBMA 3UNQA 1KXDA 4ISHH 4NZLA 4I8HA 1ORFA 1TX8A 1VITG 2HOBA 1L1GA 3M5LA 5DP3A 3RXTA 1ZTKA 1C9PA 1ARBA 1LHGH 2BDBA 2A1DB 2Y5GA 3RXLA 1INCA 1BOQA 2PTCE 4X0WU 4CHAB 1UTQA 2I6SA 1PYTD 3WY8A 4OGXA 4K1SA 4WXIA 1IQGA 1Z8JB 3DSGA 1NN6A 1YYY1 1ZRBA 1V2VT 1GI5A 2W6JD 3SHAH 2OCVB 1S6FA 2SGAA 4AB9A 1E35B 2ZU1A 3BG8A 4YOJA 5LPFA 4FU7A 1F0TA 3FVFB 3TLOA 1XKBC 1XUIA 2FOFA 5EODA 2RA3A 1ZRKA 3OY6U 2P8OB 2HPQH 1LPKB 1HJAC 1AQ7A 4X6NA 3UOUA 4MPWA 4WY3A 1TNLA 1QY6A 2GV7A 1L1NA 1EQ9A 1UVTH 2PW8H 5JBBS 1MCVA 4TWYA 2G00A 4NSYA 2QF0A 5DP9A 3LGIA 2AMQA 4K2YA 1QCPA 4Y8ZA 3ELAH 3H5CB 1PFXC 5DP6A 4BNRA 3P8OA 5E2OA 4X8VH 3RXVA 3KYFA 5EGMA 1TX6A 4Y8YA 1TNHA 2OBOA 4P00A 1DDJA 3QZQA 1TABE 1DSTA 1KXCA 5EIYA 1AU8A 1SFQB 4INKA 2FIRH 2ZCKP 4ZKSU 1EOJA 5A8YA 2IJD1 1O2PA 2NWNA 3A80A 1TNIA 1Z71A 1COWD 3CS0A 1H8ED 1CBWC 1W7XH 4X8SH 1RJXB 3DHKH 3CNRA 3V13A 1TRYA 3UNSA 3ENSB 1C1TA 1O5FH 1ZSKA 3F2FA 4JZIA 2QN5T 1THSH 4CBNA 3BV9B 2GCHF 3LC5A 2BQ6B 4B2AA 1P05A 3RMMH 2Y5HA 2VU8E 1AKSA 2XWBI 1KLJH 4THNH 2GKVE 1LMWB 3TVJB 1CT2E 5A8ZA 1QBVH 1KDQA 3KIDU 4AFZA 2VIWA 2F9PA 1SGTA 2PUXB 4UD9H 1GBFA 3SORA 1K21H 3T62A 1GHAG 3HK3B 1AWFH 2M2AA 5C1XA 1SMFE 3W95A 8GCHF 1C1NA 2XXLA 1QA7A 2UWPA 1V2MT 4CH8B 5J4SA 1BHXB 2ZKSA 1C2DA 1DXWA 2J98A 4HFPB 4K8BA 5EG4A 1K1LA 2WV4A 3IG6B 4MVNA 1C5NH 3D23A 3P70B 1C2MA 3A7ZA 3DCLA 1TOCB 3SV7A 1S0QA 8KME2 1KYNA 5JBCS 1C1QA 4NSVA 1NC6A 1XUJA 3SGQE 1XXFA 1FONA 4OS4A 1V2NT 1RFNA 1QTFA 2EEKA 5BRRE 4ZCNA 1HIAB 4MNYA 1OX1A 2KAIA 1QR3E 4QT8C 1GCDA 3E8LA 4AX9H 5FCRA 2NU2E 2PGQB 2FMJA 3R3GB 2ZFFH 4YT6H 1LVYA 1RS0A 1C5MD 1GBIA 3ZIAD 4I32A 5CMXH 4FUFA 5IYTA 3PYHA 1L0ZA 3PO1C 3T2NA 4NIVA 1WAYB 1GI4A 2BD7A 4ZKRU 4YO9A 2GV6A 3M5OA 2VGCB 3OYPA 4UEHH 1QL7A 1NPMA 4A7IB 1GJ5H 2M5TA 2F91A 1LTOA 1BMMH 2G81E 2L6OA 1C5YB 1JWTA 1DXPA 5DGJA 1K1OA 2ZQ1A 1CA0C 1ID5H 2VIPA 2XBVA 3SUEA 1YY3A 1HBTH 3U8OH 4ISLA 1O2VA 2HGTH 2ODYB 3PV5A 5LH8A 3BIVH 1YPGH 3A7YA 1P01A 1O3LA 4NGAH 4HI3A 4ZKNU 2GCTB 4ESTE 1K1MA 1S0RA 2XTTB 3NXPA 1YPEH 1RRKA 1M9UA 3GY5A 2TBSA 1J16A 3LIWA 3QX5H 1Y8TA 1K1JA 5EW2H 2K1QA 5EJ1A 4B6EA 4B1TA 1O3JA 1ESTA 1DY8A 5EPYA 5A2MH 1PPEE 2QXGA 3MNSA 3QGNB 4CBOA 1UCYH 3T29A 1HAYB 3W94A 1SHHB 2W6ID 3ATWA 3RMOH 4NA7A 1F0RA 4NIYA 2A7CA 3HPTB 1C1WH 1UK4A 2VVUA 5C5OA 6CHAC 1A0LA 2JH5D 2UWLA 1CGIE 2XWAA 1GBTA 3GS9A 1EP6A 1GBKA 3PMBB 1NRSH 3CP7A 3V7TA 4HGCA 2OK5A 4A1TA 2BXUH 1ELCA 1EX3A 4IN2A 1ZOMA 1WU1A 1GL0E 1GWAA 3A7VA 1A7SA 2GMTB 2YOLA 1A0HB 2WSSD 2BQ7B 2PUQH 3MU1A 1EP5A 3KGPA 3VGCB 3TITA 3RXMA 4XRNA 2OC7A 2BHGA 2UUYA 2ZECA 2FPZA 1H8DH 2QA9E 1GMCG 2VBCA 3F68H 2ANKH 1GI6A 3F9GA 1FV9A 2TGDA 8LPRA 1A5IA 2ZO3H 3C1KA 4NA9H 1IHTH 1W0YH 5C20A 2OC1A 3O8RA 4HG6A 4MLFB 1GBDA 2ZI2H 4INHA 2BLOA 2FOGA 3S9AA 3JZ1B 1E79D 1HV7A 1TBRH 3D65E 1O5CB 3P17H 4RKJB 1GHBG 2ZFRH 3OEED 4BXSA 1NO9H 3U8TH 1QL9A 2ZCLP 3Q3XA 1H8IH 3FANA 3D62A 3LOXA 4X2YA 1UCYK 3SYJA 3UY9A 2QXIA 1GHWH 2QF4A 1G37A 2ANYA 3OEHD 3P95A 1DWCH 1F5LA 1OWJA 2Z3CA 2I6QA 3NRLA 5C1UA 2H6MA 5ESTE 1EOLA 1TAWA 2G55A 2ESTE 5K7RA 1H9LB 2BB4A 4BANB 1QB1A 4F55A 1C5ZB 4XE4A 1OWKA 5C1YA 2CXVA 2ZPSA 3VB7A 4AFUA 2A2XH 2TIOA 3MMGA 1GVLA 3MI4A 3KHVA 1E38B 2RCEA 1NU7B 3PMJA 2A32A 3MH6A 4XBCA 2THFB 2GZ7A 3EE7A 4GUXA 2F43B 2XCNA 5T6GA 1SGFG 2BVXH 1O3CA 4ZHAA 2SGQE 2WHXA 1CVWH 1W0JD 1UTJA 4UE7H 4X1NU 3UPEA 1HAOH 1SGEE 3RXEA 1AZZA 3N99A 3SU6A 3PWBA 4OS5A 2A5KA 1IQNA 5B6OA 2F9NA 2W26A 2GVFA 5CHBA 3TGKE 4ABGA 1V2JT 2FX4A 1SSXA 1P9SA 1TPOA 2BZAA 3FN8A 1BMLA 3KYGA 4FUGA 4Z6AH 3AAUA 2HVYB 4D76A 1TONA 2H9HA 2BOHB 4HZHA 3LDXH 2P3FH 1OSSA 4BOHA 1B0FA 2B9LA 2NU3E 3MNBA 4GHQA 1NFWA 2OINA 3EA8A 3ZV8A 3LU9B 2W3IA 5CDFE 2RDEA 8ESTE 1ZMLA 5L6NH 5DP5A 1BMNH 1GHVH 1LHCH 4LXBH 4AB8A 3MU4A 5GIBA 1GVZA 2DUCA 3BG4B 5AVDA 1ZTLA 3BEUA 1C1UH 1BTZA 1BJVA 5EU8A 1FZZA 1TLDA 2FOMB 2HNTC 5EXNA 4GSOA 2EI8A 1T31A 1C2JA 5JDUB 4DOQA 1N6YA 5PTPA 1T8LA 3NK8A 1WTGH 1RXPA 3LGUA 3E6PH 1SLUB 1MBQA 3SU0A 1P02A 5I25A 1MMJN 1P2OA 3DSOA 4WXVA 1IAUA 1UTNA 1YPJH 2VWMA 5FXLA 9ESTA 1FNIA 3RXDA 2OP9A 3A8AA 5GXPA 3ATKA 1BBRH 2JKHA 3AVZA 2WPIS 3O8CA 1SKYE 1K1IA 1BTXA 3IITA 4DJZB 5JPMH 3NCLA 4ZMAH 3KQ5A 1WXRA 4I7YH 1A3EH 1C5LH 2RG3A 3A8CA 5CHAB 1QJ1B 3LH1A 3C27B 1DVAH 1VKYA 2FP7B 1EB1H 1DM4B 1J9CH 1O34A 1NT1A 1RTLA 1GCTC 1P11E 2VH0A 1RIWC 4I8LA 1OWDA 3KL6A 2BLVA 1MZAA 1CHOG 2EY4C 4J2YB 4RSPA 2Z9JA 2ZHWH 4CRDA 1LVOA 1O2IA 1BTHH 5HMAA 1C5UA 2Z7FE 2CJIA 4WJG2 3SHCH 2ZG0H 5C5NA 4I86A 3HKJB 2PKAB 1C1RA 1C2IA 2VB0A 2Z94A 3RM2H 3SJIA 3W1EA 1QQ4A 3AK5A 3CENA 3F6UH 3STJA 2F3CE 1HAPH 1AUJA 2BY7X 3M5MA 1NU9A 3DT0H 4ACAA 1ZZZA 2FXRA 3V12A 3SUFA 3EDXB 1F0SA 1AD8H 3A7TA 2GGVB 3KQDA 3UREA 3PB1E 1HIAA 4RN6A 5EOKA 1WV7H 4GCHF 5EQSA 1V6DA 1G36A 1NBME 1GBBA 2A4GA 4X2VA 1NTPA 4AC9A 1E34B 4NFEA 4DT4A 2G52A 3EA9A 1VZQH 3TGJE 3URDA 2STAE 1O3DA 2FOCA 2KAIB 2BD8A 2G5NA 4Q7YA 4WMEA 2BM2A 4CRBA 2V6NA 3E3TA 1FAXA 1TBQH 2O9QA 4K69A 3NKKA 1EAIA 2D1JA 5E8EH 3BF6H 1C2EA 4Z0KA 4Q2KA 2QCYA 1AE8H 1GG6C 2ZHEH 1ELEE 1BTPA 4MG3A 5ABWA 1YF4A 3A83A 1FPHH 1UHBB 3H7OA 1GI0A 3HKIB 4OS6A 4FUEA 5DG6A 1GJAB 3KQEA 2J92A 3F0PA 2CN0H 5T1VA 3SQHE 4OS2A 1AMHA 1D3TB 3GY4A 4Z1MD 2QXJA 1O30A 2IN2A 1O3PB 1OXGA 2ZHFH 3UQOA 2H5CA 3V0XA 4IS5A 4HTCH 1ELBA 4FUHA 4YM9A 2BD4A 1ZHMA 2C3SA 1CBWB 2TRMA 1NRQH 1J14A 1EAWA 4I31A 1DICA 1DANH 2ZTXA 3QUMP 2FZZA 2K8IA 4RI0A 2R0LA 4TT3D 3E0PB 1EZSC 4KGAA 3TH3H 3SUDA 1O37A
chains in the Genus database with same CATH topology
3U8RH 5TJXA 3RP2A 1F2SE 4UFGH 3GISB 3PLBA 1Z8IB 5DP7A 5E0JA 2OD3B 3TJUA 1NRNH 3RM0H 1VJ9U 1K28D 2FEQH 5E2PA 4NA8A 2J34A 5G4BA 3GY8A 4OS7A 5HXFA 1JRTA 2GDEH 5GPIB 2A4QA 3TK9A 1MU6B 3BTDE 5FPSA 6CHAB 1SLXB 4IBLH 1SG8B 1ANEA 8GCHG 2H9TH 2SGEE 1Y59T 1O33A 3CS7A 2R9PA 2AYWA 1ELDE 2HVXA 1FPCH 3MO9A 1B0EA 4E05H 1NRPH 1A5GH 1YCPM 3EYDA 2GTBA 4JZEH 3ZZBA 1V2PT 1LQDB 1AY6H 3A8BA 1G30B 1SLWB 1SGNE 2AGIX 3B9FH 2VVVA 2BY5X 1GGDB 1GBMA 3M37A 3ZYEA 2ZHDA 1CSOE 1QFKH 4GAWA 1C2HA 3MNCA 1ELAA 1SGFA 2WUBA 2ZGCA 1OWHA 5JB8S 2NU1E 4IMQA 3M36A 2P59A 4LZ1H 2TGAA 3MWIU 4SGAE 3RMNH 2A4RA 4NIXA 2OBQA 2V3HH 2B7DH 1SGCA 1RGQA 1OP0A 1XMNB 1MD7A 1MAXA 1WQVH 3RU4D 2IPHA 1MQ5A 2PTNA 2BD2A 3GCNA 1FIWA 1P04A 1GJ4H 1O5GH 2A0QB 1QJ6B 2XYAA 4YOIA 4YTAA 1OYQA 1BITA 1KLIH 5CHAC 1LHFH 4ZXYH 3QN7A 2W3KA 4NWKA 3GY7A 1B5GH 1EJMA 3E1XB 4E7RG 3O8DA 2FYRA 4Y79A 1EAUA 1UTMA 2XRCA 1CA0B 1GMDF 1DSUA 4O3TA 2ZTZA 1SLVB 1L1JA 2ZGXH 1VCWA 4ISOA 3P8FA 2R2WU 2QGRA 1MTVA 1ZJKA 1TQ7B 2RDLA 1DLEA 2B8OH 1TPPA 3K9XB 2FO9A 2TGPZ 2BYAX 2ILNA 1ETSH 1QQUA 1PQAA 2B5TB 2Z3DA 3UIRA 4ZROA 3L3TA 1VJAU 1KTTB 1DLKB 1T7CA 3ITIA 2FODA 2BVRH 1TALA 4B2CA 4X1SU 2BTCE 2IJOB 1CO7E 1CHGA 1Y3UA 3K6YA 4AGKA 4U30A 2H2ZA 1MQ6A 2XC4A 4D7GA 2W5EA 7LPRA 3KN2A 1QA0A 6GCHG 5A8XA 4H6TA 4YZUA 2ASUB 1UK3A 1LCYA 3OTJE 3URCA 1OWIA 4A1VA 2UWOA 1TRMA 2QXHA 2JETC 3RXJA 2CMYA 2WPMS 2AERH 2AS9A 2A45B 1UVPA 3LKWA 4ZHLU 9LPRA 1WCZA 4X8UH 2FLBH 3TPIZ 2A2QH 1EPTA 5F8TA 4AFSA 1O3AA 1FAKH 2BMGB 1F7ZA 3SZNA 1CA8B 1UO6A 5DJ7A 1IHSH 1K2I1 4IW4E 1EZXC 5DP8A 3M5NA 4BAMB 1GMCF 2CGAA 2ZTYA 1ACBE 1GHBF 4ABIA 1D6WA 1ZPCA 2VJ1A 2QIQA 1AB9B 1HXEH 4AOQA 3A87A 4XBBA 3EGKH 1XVMA 1HB0B 3SOSA 4OGYA 4IGDA 1W8BH 2PSYA 2FOAA 3DUXH 2FWWA 1FY3A 1HAXB 1P2KA 1RIWB 1CE5A 1IQEA 1LHDH 1MU8B 1AUTC 4XBDA 1GG6B 3SV8A 4CRFA 1QBOA 4DIHH 2ZPQA 4D9RA 3SU3A 4DCDA 4FU8A 1E0FD 1BRCE 1P3CA 2P3TB 1C2GA 1BDAA 1AFQC 1KXEA 1YLDA 1E37B 1O2TA 1HAZB 1P2IA 1YGCH 3ZVEA 1ELVA 3SBKA 5GCHG 5HYOA 2AIPA 2BY9X 1AN1E 1C5XB 1DT2A 3IWMA 1O3NA 1ZSJA 1WQSA 2WINI 2ZDAH 3RXKA 2VIVA 1B7XB 1GMHF 2Q6FA 2P16A 2SGFE 1GCTB 2O8WA 3UFAA 3VXFH 1EUFA 3KEEA 3F9FA 1QIXB 1EAXA 3RMLH 4X2WA 1EZUC 5ETXA 3AASA 3ZZ5A 1BRBE 1GJ7B 1C1VH 1ETRH 1V3XA 1BUIA 2ZF0H 1FY4A 1V2WT 1C1MA 1S5SA 3VB4A 1P09A 1V2UT 3F1SB 4F4OC 3U69H 1C5VA 3MH5A 4X6OA 3M7TA 1VITF 4LK4A 2OTVA 1V2TT 1YBWA 4H4FA 1QRZA 4ABEA 1HYLA 4UFFH 3RU4E 2ALVA 2ZP0H 1LO6A 1DS2E 1O2KA 3ATLA 5LPEA 2PFEA 1HPGA 2J2UA 1KXAA 5A0AE 1EZQA 4X8TH 5BPEA 1V2RT 5IDKA 1QGFA 4U2WA 1O2RA 3RXCA 4H6SB 1GMDG 1Z7KA 4Y6DA 5GCHF 3QGJA 2Y82A 1Z8RA 1ARCA 2WYGA 5AF9H 3O8BA 5JYIA 3HGNA 2XNIA 1SVPA 2P95A 4FVBA 2XC5A 3ATMA 1NFYA 1C1PA 4MNVA 4R0IA 2ZU5A 4U01A 2CHAB 3GCTG 1TPSA 2HNTE 3M7UA 2Z9KA 3KQBA 1YPHC 3A88A 4NG9H 3RLWH 1A2CH 1A4WH 1O5DH 1TYNA 1YPHE 1AGJA 3GOVB 4AYVB 5F03A 4CH2B 4KTUA 1VGCC 3UWIA 1DPOA 1TGBA 3OSYA 2Q1JA 1TQ0B 4UFEH 2Z9LA 2C8WB 1FI8A 1GBJA 2RA0A 2O8TA 2F9OA 1UJ1A 3ZZ9A 4TPIZ 1GDQA 1TOMH 1OPHB 1OP8A 3RXUA 1A3BH 1G3CA 7GCHF 2XW9A 4X1QU 3V3MA 3NWUA 3MU0A 4BXWA 2R3YA 2P3UB 4KTCA 3TK6A 1O38A 4MNXA 1BT7A 2O8UA 1MTWA 3LPRA 3UWJH 5FBEA 3RC5A 1Y3XA 2HALA 1THRH 1SGPE 2BXTH 3ZZCA 1MAYA 1MTUA 1DE7H 3SNEA 5F6MA 1RTKA 1TE0A 3M7QA 4K1EA 3T28A 1PJPA 1BA8B 1BCUH 3BTEE 1A61H 1SL3A 2PR3A 3QDZB 1ZMNA 3QZRA 1ABIH 1GHAF 1SC8U 4J1YA 3KCGH 2AGEX 1F5RA 3M35A 3BEIB 3OU0A 1BB0B 1Z6EA 3ZZ3A 2V3OH 4XOJA 3BSQA 3D49H 1A46H 1TMTH 4UONA 3GCTF 1W0ZU 2BDCA 2YNAA 4AZ2B 1S81A 1W14U 1P8VC 3LJJA 1QURH 3UQVA 2OXSA 5C67A 2QC2A 3A8DA 3SNDA 1P3EA 2FI3E 5SGAE 1NROH 2DE9A 3Q3KA 1QB9A 1PQ8A 1Y3WA 2F9UA 2PV9B 1IQMA 4K1TA 1Y5UT 4X2XA 2BY8X 2STBE 4B74A 1HGTH 2PHBA 4FUJA 1Y3YA 3AW0A 5LPRA 1IOEA 3I77A 3RXSA 4NCYA 1T8NA 1CU1A 5TCAA 2ZFTA 4B76A 3NPSA 2V35A 3SQEE 1J15A 7KMEH 6ESTA 3EE0B 2Y80A 5C3NA 1SHYA 1IQFA 4Y8XA 1HAVA 2HPPH 1O3BA 2GCTC 4NIWA 1A0JA 3PTBA 5TCCA 1KTSB 2OC8A 2B0FA 2QYIA 1CHOF 1OP2A 3PWCA 1NESE 1UTKA 4JK5A 1J17T 1PPZA 3FP6E 3GCHC 4TY6A 2GZ9A 2ZGBH 2FTLE 2FOEA 1V2LT 4BTUB 1K9OE 1IQJA 1SGDE 3E91A 1IQKA 1GHZA 4O3UA 4MTBA 4NZQA 3GDUA 1N1LA 4X6PA 1D6RA 2GMTC 3FZDA 1GJCB 3SJ8A 1NY22 1AIXH 4A6LA 3ZZ8A 1D9IA 3GDSA 1AZ8A 4GCHG 4ZH8A 1CGJE 1S84A 2ZU3A 4DURA 3N7OA 1EKBB 3SJ9A 1AO5A 3LJOA 4Y0ZE 2VH6A 2ZDKA 1G2MA 4KTSA 1HFDA 3RXAA 4CR5A 3SU4A 4DVAU 2H9EH 3E16B 1D3DB 3SO3A 2J94A 4O9VA 1IQHA 1TMBH 2Y5FA 2F9BH 3EA7A 1MKXK 1YCPK 3LH3A 2ZGJA 1GI9B 5DO4H 1BBRE 3F9HA 1D3PB 1O5EH 5GWZA 1P2NA 1NM6A 1FY1A 1NFXA 1W2KH 2HNTF 4Y7AA 2Y6TA 3BTME 1O2HA 1UMAH 2ODQA 4DG4A 3A84A 3NZIA 3Q00A 4K60A 4I8JA 1CQQA 1BMAA 3ZZ6A 3SGAE 1BIOA 1GDUA 3RXGA 2FOBA 2GT7A 1VR1H 1Z1JA 1KLTA 1WBGB 5EW1H 1BTYA 3S7KB 4ZKOU 7ESTE 2BX3A 1AI8H 2ZGHA 3U1IB 4B73A 1MCTA 4BTTB 2D2DA 3FZZA 1C5OH 4SGBE 1P06A 1T4VH 3ZZ7A 1C5PA 4K5ZA 2BDGA 3BN9A 3GDVA 4YOGA 3QO6A 3RLYH 3RXHA 2LNCA 3SNCA 1TA2A 3BTHE 1W13U 2BZ6H 1SGYE 1LVBA 3SN8A 1XKAC 4UDWH 3RXFA 3LGWA 5FCKA 1O2GH 1N8OC 1Y3VA 1T32A 1OOKB 1UVSH 1S6HA 1Y5AT 4VGCC 3SV2H 2CHAC 1DWEH 1AHTH 3ZZDA 3ODDA 1YM0A 4ZAEA 1VITH 1XUGA 1AB9C 2ZIQH 3I29A 2TGTA 1O39A 3GCOA 1TRNA 3SV9A 2WPKS 1NZQH 5AHGH 1MH0A 1C5QA 1KY9A 1P2QA 2F83A 2EA3A 4IC5A 4CR9A 2SFAA 1SR5C 4CRGA 1C1SA 2C4FH 1AE5A 3ATIA 5C2ZA 4GLYA 3BEFB 1UTOA 3MYWA 5L2ZH 3SU1A 1AWHB 4ISNA 4ZUHA 3LONA 2ALPA 4ASHA 1SI5H 1OWEA 2PKSC 3SI4H 1SBWA 1ZHPA 3PO1B 1L4DA 2DE8A 5HM9A 1THPB 1ELGA 1DITH 3TU7H 4JCNA 4PROA 5T6DA 1S82A 2BDHA 2FI5E 1GI2A 1O2JA 1YLCA 2UUKB 1C5WB 1EPTC 3STIA 1K1NA 4I8KA 4JYTA 4M7GA 2GP9B 5ESBA 4DGJA 1O5BB 3SJOA 5A0BA 2QY0B 3ZZ4A 1DUAA 2F9VA 2G5VA 4FU9A 5H4IB 2VIOA 1JRSA 2H5DA 2VWNA 1P2JA 1O2ZA 1D3QB 3A7WA 5AFYH 3ZVAA 1GJBB 1GHYH 1GBLA 2G4UA 5DK1A 2SNVA 1Q31A 1SPJA 5F8XA 1F92A 4FVDA 1QHRB 1ELFA 1Y5BT 2ZPRA 2AFQB 5T3HA 3PM3A 3UUZA 3TJVA 2Q6DA 3ZYDA 3T25A 2O8LA 1TGSZ 3A81A 1O5AB 1YPMH 1H4WA 3ODFA 2C8XB 3PTNA 2ZA5A 4WVPE 4H42U 3GYMA 1UHBA 2PSXA 1W10U 2D26C 2J4IA 5L2YH 3ZZAA 2ZFPH 1O2NA 2NU4E 5EQRA 2A4OA 1GBHA 4WMDA 1FY8E 2R0KA 5AFZH 1G3BA 1G9IE 3TNSA 4WH8A 1KDQB 3M3TA 2FDAA 3SW2B 2WPLS 5EXMA 3A82A 3SNAA 3A86A 1MKWK 1SGRE 2Y7ZA 1LHEH 4ABFA 1BBRK 2A5IA 3QTVH 5E0GA 1KSNA 3OY5U 3UR6A 1G32B 5L30H 2JH6D 2GD4B 1SGQE 1XX9A 1SB1H 1QJ7B 1ZGVA 1GJ8B 1EATA 3SU2A 2C8YB 2HRVA 2ULLA 1BTWA 4JK6A 2SGPE 4A5TS 2AIQA 1DWDH 4TY7A 3TNTA 4ABHA 1C5SA 1UTPA 1W3CA 2CV3A 1UVOA 1GBEA 1FMGA 5DPAA 2WV5A 3QWCH 2ZC9H 2R2MB 1C9TA 1GI7B 4AG2A 4Q7XA 1BJUA 1HCGA 4Y7BA 1GDNA 3HGPA 1AVGH 1W7GH 2ZDNA 4O97A 3K65B 1TBZH 1MTNC 1A5HA 4MPXA 4BAKB 6GCHF 2FOHA 1O2XA 3JZ2B 1H1BA 2XBXA 3FAOA 5FPTA 3U9AH 1IQLA 1P03A 4YESB 3KQCA 1JIMA 4GPGA 3VPKA 2A31A 2TPIZ 3SI3H 3F9EA 2A7HA 1TNGA 1HJ9A 1LVMA 1G3DA 3DA9B 3MO3A 3QLPH 4BAOB 3BTFE 1AKSB 3UOPA 4WF8A 4I33A 1ZLRA 2OUAA 1WTHD 3SGBE 1K22H 2ZDVH 1EPTB 4INLA 1AFEH 2D8WA 1TNJA 4VGCB 4XDEA 6LPRA 2OQUA 5FAHA 3ZVGA 1NRRH 2AMPA 4K3JA 4JYUH 4K8YA 4AORA 3ZVFA 3P6ZB 5J4QA 2VNTA 4TWWA 1ETTH 1AVWA 2FTMA 3A7XA 2CF8H 1OS8A 4F49A 2A5AA 3P8NA 4MPVA 4Y0YE 1FLEE 1FIZA 1V2ST 3TJOA 1F0UA 1PYTC 2Y7XA 4ABAA 3B23B 1BRAA 3LGTA 4AG1A 2GDDA 3RXQA 1YC0A 1ZHRA 1PPHE 3BTQE 1CT4E 1LQEA 4KKDA 1EJNA 2Z3EA 3GICB 4E7NA 2SNWA 5K0HA 1P2MA 4LZ4B 1DWBH 3PROA 1EASA 1S85A 4BTIB 1XUFA 5HGGA 2EC9H 1JIRA 3LC3A 2W7SA 1V2OT 1GGDC 1SOTA 3TIUA 1Z8GA 1C4V2 5A09A 3M61U 1WUNH 1MD8A 4XSKU 3TJNA 1RTFB 2ANWA 2ZFQH 1Z1IA 3K6ZA 1TGCA 4ZXXH 1FJSA 1Z6JH 1C5TA 2JH0D 1W12U 1ZJDA 2AGGX 2FESH 4DY7B 1O2YA 1O32A 1EB2A 1C4Y2 2BD3A 1DY9A 1C1OA 2ZCHP 2H1UA 1H9IE 1SGIB 3R0FA 1BRUP 5FBIA 5GJ4B 1C2KA 7GCHG 1P0SH 1GI8B 2ZZUH 2ZHQH 2BQWB 3BTTE 2BVSH 2WPJS 1LKAA 4ISIH 1F5KU 4GVUA 1YKTA 1ZPBA 1ANBA 2CF9H 1FQ3A 3AW1A 1ELTA 2PKSB 3VGCC 3A85A 1L4ZA 1HAIH 4WMFA 2BLQA 1P9UA 3SNBA 2W7UA 4Q7ZA 4MDSA 2VWOA 5EQQA 3RXPA 1C2LA 1YP9A 4AFQA 5FX6A 1N6XA 1HRTH 3EAJA 1KIGH 1JMOH 3MFJA 3DFLA 2ZU4A 2SGDE 4AN7A 1PQ7A 1HDTH 2OC0A 1PPCE 4R8TB 1MTSA 3K2UA 4U32A 1PPBH 1SOZA 3U98H 2PLXA 4A1XA 3BIUH 1TX7A 1PQ5A 2VWLA 3SU5A 3DD2H 1IQIA 4Q80A 1O2SA 3Q77A 3FP7E 4IN1A 4AYYB 1ANDA 2WPHS 1XM1A 2XBWA 3PV4A 1RD3B