1SC8U

Urokinase plasminogen activator b-chain-j435 complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTISLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords plasminogen activator, urokinase
publication title Design of novel and selective inhibitors of urokinase-type plasminogen activator with improved pharmacokinetic properties for use as antimetastatic agents
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2004-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sc8U02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sc8U01
1Y3WA 2B7DH 1LQDB 2VINA 3K6YA 1ZJDA 5EXMA 5GWZA 4I33A 4H4FA 1GHVH 5DP6A 1E38B 1F5LA 1IQHA 2KAIA 4XBBA 5LPEA 3KHVA 5ABWA 4YOJA 4DY7B 3SO3A 1V2JT 3RU4T 5T3HA 1QNJA 3BTHE 4IGDA 1ZSKA 1SQTA 3MNBA 1MZDA 4IN2A 5FHTA 1F0UA 4ZKNU 2OXSA 4GCHG 4X1SU 3P8GA 1UK4A 2A0QB 4CRCA 3BV9B 1TGTA 1EOLA 1BTXA 3U8OH 2RDLA 4ZXYH 4JZFH 1GI0A 1CO7E 2D1JA 2QV1A 2ZHWH 2XW9A 2ANWA 1A46H 1NU7B 4YESB 1V2WT 1F5RA 1GI3A 3OY6U 2ZP0H 4B75A 2LPRA 4JK6A 3H5CB 3GOVB 1IQFA 1ZJKA 1O31A 1AVGH 1TBQH 5B6OA 1TB6H 4AG2A 4GUXA 1DXPA 1KXEA 1YKTA 3RXBA 4TPYA 2ASUB 3Q3XA 2OQUA 3URDA 2Z3EA 3LJJA 3M7UA 1SGTA 1O3FA 1EAUA 1HJ8A 3P92A 1K1LA 3T28A 1FDPA 2AGEX 1BRBE 2Q1JA 5JYIA 1MTVA 4NZLA 1S85A 4FVBA 4BAQB 1KY9A 4GLYA 1ABJH 4XBDA 1CBWB 3HPTB 7ESTE 1ELDE 1AD8H 1GBHA 1O32A 5DGJA 3STIA 2Q6FA 4RN6A 3R3GB 4GHQA 2HWLB 5K7RA 2FYQA 4MPUA 2AMDA 1C2MA 4IC6A 5L30H 1LVBA 5A8ZA 4BAHB 2OBQA 3NPSA 4CREA 1UVTH 4HZHA 2J4IA 4HGCA 2CGAA 3W94A 5EXLA 1IHSH 1C5RA 1C1MA 1KTTB 1SGRE 2A5KA 2XRCA 3QN7A 5C5OA 1FY5A 1SLXB 3BG4C 4H6TA 1O2SA 4F4OC 3MNXA 5HMAA 3ZVCA 3TGKE 3B23B 4GAWA 2Y5GA 2ZQ2A 1SHHB 8LPRA 3RXQA 2YNAA 4IBLH 1T32A 2BDBA 3M3SA 2XBWA 4SGAE 5EOKA 4WMEA 1PYTC 1QR3E 1T31A 3VB4A 3CP7A 1O37A 1L0ZA 4ISHH 2J95A 3F68H 3SNAA 4KTCA 5BPEA 4AX9H 3TGJE 1HUTH 4K69A 1HV7A 1TNGA 3M61U 1AHTH 2Z3DA 3OY5U 1AQ7A 2W26A 2AMPA 5ETXA 1RJXB 3DA9B 1NRNH 2H6MA 4I7YH 2GDEH 2XWAA 3BG4B 1BHXF 1YPGH 5LH8A 3A8AA 4CRGA 2ZFSA 4ZHLU 3ATMA 1Q3XA 2Q6GA 2HGTH 3FFGA 2A45B 5DG6A 3PTBA 1EOJA 2O8MA 1ELCA 3GISB 4E7NA 1TNIA 1Z8GA 4NA8A 4DW2U 1C1OA 3KQDA 3SJ9A 4AB8A 1BOQA 3TNTA 2ANMH 3PLKA 1LHFH 3OX7U 2Y6TA 1QB1A 1LHGH 1DY8A 2VH6A 3MH7A 6LPRA 2C3SA 1M9UA 1P2JA 3MYWA 5DKMA 3TITA 1DDJA 3SGQE 3BN9A 1HAVB 3DFLA 4NWKA 4AFSA 3ODDA 3ZYEA 1BT7A 1RFNA 1WTHD 1HBTH 1MKWH 5L6NH 1Y3XA 2AIQA 2D8WA 3E0PB 1EJNA 2R3YA 1EJMA 4K60A 1C9PA 1MAYA 4MNYA 2QCYA 1H4WA 2ULLA 1EASA 1SOTA 2ZGHA 1EB2A 1C5NH 1A2CH 1BTPA 3NCLA 3M5NA 4X8VH 2A2QH 1C5PA 4NSYA 3KIDU 3OTJE 1HJAB 3QGJA 1SGFA 1O3JA 2VJ1A 2W5EA 1PPZA 1GCTB 3MMGA 5JPMH 2HALA 4K1EA 1AE8H 2Z3CA 1IQGA 1HDTH 1KLJH 1NRRH 1C5QA 2QYIA 2ZGJA 2VIOA 3K65B 1GVLA 2ZCHP 2NU1E 1QL9A 7GCHF 2ZFTA 1P9UA 2QN5T 1BQYA 3A7TA 3FZDA 1J16A 3GCOA 2BDYA 2AERH 3S9BA 3MH4A 2GX4A 1L1GA 1ORFA 3M5OA 2PSYA 2W7SA 1XUIA 1C4Y2 3MHWU 4ISIH 3VPKA 1BTHH 4Q80A 3LIWA 1O2VA 1WV7H 3GY4A 1GJ9B 1ESAA 1AUTC 3F1SB 2ZU4A 1G32B 1GHAG 1GHBG 1HYLA 3SI3H 3TK5A 1OKXA 3QUMP 1K1IA 3T27A 1C4U2 1UVOA 1O34A 1RD3B 1TGBA 1HPGA 3SV8A 1A3EH 3AW0A 4CH8B 1SGPE 1DT2A 2CHAB 5C67A 4I8LA 1PJPA 1QQUA 5F6MA 3SV9A 3P8OA 1VR1H 2V3OH 2PKSB 3SZNA 3SUEA 1YF4A 1J15A 3A89A 4O97A 1O5AB 2IOTA 5DP5A 1ZSLA 5DP7A 1Y3UA 1C2FA 4Y0ZE 4YM9A 4U32A 2NWNA 5AFYH 4UONA 3O8CA 2A1DB 4Y79A 2ZZUH 4D8NA 4J1YA 1G3CA 5JB8S 2B8OH 3A8DA 3LGWA 3MWIU 1DXWA 3MH6A 1E37B 1JIMA 4X6PA 3A80A 1PPFE 2DE9A 2J38A 4IC5A 3LPRA 3SV6A 1YPEH 2HLCA 3V12A 2EC9H 1DSUA 1Z8JB 1O3MA 5EG4A 4ZUHA 2ZU3A 3KGPA 4O3UA 2EEKA 2A4RA 3TVJB 1TA6A 4IN1A 4R0IA 1N8OC 5EXNA 1CA8B 2XTTB 1GHAF 1GHBF 3A83A 3T2NA 1QY6A 1O0DH 3QZQA 3S9CA 2P3FH 1FMGA 3EA8A 1IAUA 3RP2A 2BYAX 2HNTE 1CVWH 2PWXA 3TK9A 4FU9A 1GGDC 4JMYA 2J92A 2WPJS 3S9AA 2TGPZ 2HOBA 1O5DH 1V2VT 1SQOA 5CHAC 3K6ZA 2BHGA 1N8OB 2GV6A 3RMLH 2FI4E 4ZROA 1HXFH 4AFZA 5JDUB 4FUCA 1MAXA 4X1QU 3S7HB 3LONA 3V13A 3O8RA 2ESTE 1AFQB 2VIWA 1FIZA 3GY6A 1MCVA 1P2NA 3K9XB 1ELVA 3KCGH 1ZPBA 4XDEA 4OGXA 2Z6BD 2BQ6B 1V2PT 3A85A 3GY3A 1SLUB 2OC7A 1A0LA 1DPOA 1AY6H 3ZZ4A 3FANA 3RMOH 1ZGIA 3BEUA 2ZHEH 2A4GA 2XWBI 1WYKA 1K2I1 1GJ5H 1FXYA 3U98H 3NWUA 2BOKA 1EATA 2FS8A 1C1PA 1CGJE 2VIPA 1O2TA 4BANB 4ABBA 4XOJA 4A1XA 3U9AH 1F2SE 1MBMA 2BY7X 1L1NA 3AVZA 2ALVA 3RU4D 2ZGXH 3GCHB 3I77A 4JYVH 2CF8H 1KLIH 2C4FH 2P59A 1O2HA 4ISLA 1B0EA 1GBFA 2BD8A 3DHKH 1YC0A 4UE7H 5HXFA 2KAIB 4Q7ZA 1A1RA 1A5GH 4CRDA 1GJ7B 5A0BA 4NG9H 1BRCE 2XYAA 2FLBH 5LGOA 4MTBA 3PMAB 2ZDMA 3SNDA 1SGNE 2YNBA 1TQ0B 4Z6AH 1G36A 1TWXB 4X1NU 2ANYA 2G00A 2R3UA 2GVFA 4M7GA 2C8YB 3H7OA 4E7RG 4NA7A 1H1BA 4ABJA 1O2OA 4FUBA 8KME2 2Q6DA 3LGTA 2TIOA 1Z6EA 1DWEH 2QXJA 1DM4B 1GHXH 1HXEH 1MKXH 1EUFA 1SLWB 2ODQA 1LHDH 1ZGVA 2C8XB 2F9UA 4AGJA 1GI6A 2P3UB 1RRKA 1EAIA 1GMCG 2FOGA 4Y6DA 1O5GH 3CS7A 1YPHE 1ZMJA 1ZTKA 3P17H 1SOZA 2UUFB 1DITH 3SN8A 2TRMA 1TBZH 2OBOA 2TGAA 1C1SA 1XUGA 2I6QA 3TJNA 4FUIA 4DCDA 2UWOA 4AYVB 1QURH 2BY9X 3B9FH 2TPIZ 1L4DA 1ZPZA 5ESBA 3UOPA 2VNTA 1H8IH 4Y7AA 4D9RA 3MO6A 3HK6B 1ZRKA 1O3BA 2Z9GA 2P8OC 5A0CA 1C5UA 1P03A 1VCQA 2Y7ZA 4TWYA 1KSNA 1MTSA 1BITA 1EAXA 1TX8A 1GMDF 4Y8YA 3P6ZB 2JH0D 3ELAH 1NROH 1JRSA 1THSH 4TYDA 1GBDA 1RTFB 1XXDA 1V6DA 2GT7A 1K1MA 4XFQA 2RA0A 3E8LA 3PO1B 3F9GA 4Y8XA 3L6PA 1EXFA 4Y10E 4NIVA 1CHOG 1FNIA 3PB1E 1T8OA 3E91A 3TH4H 1C5OH 3SUDA 2QF0A 1C4V2 5CE1A 1RIWC 4FU7A 5DP3A 2FOCA 3NKKA 1O2IA 2GCTC 1MU6B 1T7CA 1CGIE 1H8DH 1SR5C 1GG6C 1GMCF 2VGCC 1UTLM 2BVXH 4O9VA 4E05H 2G8TA 2GTBA 3C27B 1HRTH 2ODYB 5A8YA 1FY4A 3BTGE 4ZKOU 1G37A 1QFKH 2C93B 3QZRA 3QLPH 1P11E 1AVXA 2BX3A 1NM6A 3ZVBA 1S5SA 3HKIB 1GBLA 2FOAA 2F91A 1SB1H 2K1QA 4H6SB 5C20A 1N1LA 1N6XA 3ZVGA 2WV4A 4NCYA 3QTVH 1XUJA 2VGCB 1C5SA 4HTCH 1CT0E 3SU6A 4MDSA 1OP8A 3T25A 2ZHDA 1UTOA 5LPRA 3E90B 2VWOA 3Q77A 1FI8A 5E0GA 1C1TA 3NXPA 8GCHG 1BDAA 1C1QA 4FVDA 2A7CA 1Z8RA 1FUJA 4X2VA 1WUNH 4B2BA 1CHGA 3T5FH 4UFGH 3RXDA 1TOCB 2WPHS 1KTSB 4X0WU 2XCFA 1C1UH 3SU2A 2ZC9H 1KIGH 3T26A 5L2ZH 2O9QA 1O2MA 3M7QA 1W8BH 3MU1A 1HAHH 1GI9B 4RKJB 3TPIZ 1IQMA 1MD8A 1BJUA 1BMAA 2BQ7B 2ZG0H 1LMWB 5BRRE 2SFAA 1GDUA 1ETSH 2BQWB 5PTPA 5FPTA 2BVRH 2Y5HA 3SNBA 1BB0B 1SFQB 3RC5A 4KTUA 1GPZA 3N7OA 1B0FA 1AVWA 1ZLRA 1O5FH 2OINA 1KDQA 1HFDA 1TX6A 2GCHG 5E0HA 1CBWC 1XM1A 3PWBA 2Z9JA 1NS3A 1BZXE 5E2OA 1D3TB 1YPKH 2FEQH 4NIXA 2ZF0H 1QB6A 1C2EA 4Y8ZA 1C5WB 5GDSH 9LPRA 5EODA 1UVUH 3P70B 1DE7H 1C2IA 2FPZA 3A7ZA 4IW4E 4VGCB 4X8TH 1A61H 4XE4A 2ANKH 2A7JA 2ZTXA 4CBOA 3EYDA 1NRPH 1UTKA 1Y5UT 3Q00A 1GJAB 1O2WA 1UCYH 4GCHF 1O36A 3SV2H 2FOMB 1QJ1B 1Y5BT 4X1RU 2FZZA 3LGIA 5FX5A 3BTME 4OS4A 4BTUB 4CRFA 1V2UT 1O3CA 3VB3A 1CA0B 2FI5E 4KP0A 1YPJH 4AN7A 1O2XA 1UMAH 4BXWA 3ZYDA 1O38A 3M5LA 2Y80A 3ZZ6A 1K28D 3PMHB 3PM3A 4O3TA 1LVYA 1HGTH 2PUQH 2ZU2A 1JIRA 3ZZAA 3VXEH 4ABDA 5JBCS 5A8XA 2XBXA 2OP9A 1S6HA 3LGYA 2GCHF 1SSXA 1ZTJA 4MPXA 3PWCA 4NA9H 3BSQA 1EPTA 1JBUH 1QCPA 2FESH 2BY6X 5JBBS 1T4UH 1GDNA 4ZH8A 4GVUA 1VCPA 2SGEE 5DP4A 5EGMA 2HPPH 3KQEA 2ZIQH 5FX6A 1Z8IB 2BDHA 4KELA 1TX7A 2FDAA 1DLEA 1UHBA 1N6YA 1V2QT 1XVMA 1J14A 1VITH 3RDZA 2CMYA 2OUAA 5F8XA 3PMBB 3PMJA 3O8BA 2BD3A 2B5TB 2WUCA 5FBEA 4OS2A 4DJZB 1W0YH 5EW1H 1DUAA 1TRNA 1GHYH 1O39A 4UD9H 3L33A 4Y0YE 3M7TA 2BD4A 5FAHA 1J17T 3TJOA 1GJBB 3M35A 3ZVDA 5K0HA 1MKWK 4NWLA 4X6MA 1F5KU 2JKHA 2ZGBH 1ZMNA 3I78A 1GI2A 1HJAC 3M37A 4ZHAA 2JETB 1V2RT 1LVOA 2ZHFH 1A0JA 1SGFG 5DK1A 1RTKA 1JXPA 1TONA 3GICB 4THNH 1GCTC 3ZZ5A 3SU4A 2FI3E 4FUFA 2OLGA 2F9BH 1P02A 3GYLB 1NN6A 4BTTB 1NFUA 1UTMA 1ARCA 1LPZB 1W2KH 2G55A 3BTFE 3LH1A 2OCVB 5I46H 2C8ZB 3ZVFA 1XKAC 1EZQA 1K9OE 1AB9B 1C5LH 4JZEH 2FWWA 4YTAA 1O3NA 4IS5A 3S0NA 4X6NA 4U2WA 3STJA 4A1TA 2RCEA 3GY2A 2PV9B 2SNWA 5A0AE 1O3AA 3PROA 4WY3A 2P95A 5SGAE 2IN2A 1GI5A 2PTNA 1BTYA 1JOUB 1TPSA 2PGBB 2RG3A 1W10U 1ACBE 1O30A 2BY8X 4MQAA 4UEHH 2PSXA 2BDAA 4UFDH 7KMEH 3RXFA 1P2IA 2XC0A 3UUZA 1T4VH 4LZ1H 1SG8B 1HIAB 4LXBH 4AFQA 1TPAE 3RXGA 5HYOA 4ZXXH 5A09A 5FXLA 5A2MH 1TPOA 3F9FA 4SGBE 5JBAS 1ZRBA 3BEFB 3ZZ7A 2CHAC 4I8GA 1HJ9A 4KGAA 1NESE 3LOXA 1T8LA 2ODPA 1S83A 2BDCA 3ZZBA 4ABAA 2ZHQH 4ZHMU 3KN2A 1GBAA 3E0NB 3JZ2B 1ELEE 1DWCH 1O3IA 5H4IB 2PKSC 1X7AC 2A7HA 4OS7A 4CH2B 1G30B 2OC8A 1MQ6A 3EA9A 1C1WH 4IMZA 1MD7A 1GI1A 2FMJA 1TFXA 1FY3A 1WQVH 2FOHA 1SGDE 2FYRA 3BTWE 2HPQH 3MU5A 2BDIA 3BTKE 3P8NA 5AVDA 3VGCB 1IQKA 2BMGB 2ILNA 3D62A 2W3IA 3HGNA 4DIIH 3A7VA 3OYPA 1SQAA 1MZAA 4NIWA 1TGNA 5EPNA 2STBE 2AGIX 1P8VC 3BTTE 1TMBH 1NTPA 3A86A 2FM2A 1FLEE 1SC8U 4BAKB 1ZSJA 1YM0A 3ATIA 1CQQA 1ZHMA 1D3QB 1P57B 4FUDA 1NRSH 4LZ4B 3GY8A 3UTUH 1XUKA 2EA3A 1OP2A 1TPPA 2Y7XA 1BMMH 1WQSA 1EQ9A 2GP9B 4X2XA 1G3DA 4CHAB 2B9LA 1XVOA 5FBIA 3M3TA 3GYMA 1C2KA 3ATLA 3ESTA 2XNIA 1B5GH 1YPMH 2FS9A 2ZDKA 2AEIH 3RXIA 1TMUH 2GD4B 4X8SH 3GDSA 1DWBH 1C5XB 4WMDA 3MO3A 1K1JA 4CRBA 2A4QA 1LVMA 1O3HA 5FCRA 3B8JA 1AFQC 2FOFA 1W7GH 2OQ5A 4PROA 4Q2KA 1INCA 2WPMS 3ITIA 2M5TA 2G4UA 1Z7KA 3PV4A 4DURA 2HRVA 1ZPCA 2VIDA 3RLYH 4YLUA 1WCZA 5FPSA 1CE5A 1EKBB 4DIHH 1QTFA 2AFQB 4WXVA 4FUJA 3SJIA 4X2YA 1AKSA 2BZAA 1P3CA 5JB9S 3UNSA 1ANDA 4I8JA 4X2WA 1KLTA 2THFB 1O3KA 1T8MA 1HCGA 1AWFH 2AMQA 3S7KB 1TAWA 2LNCA 4INHA 1E36B 3GCHC 2FTLE 2NU0E 5LPFA 1O3OA 3ZZCA 1GI4A 4TWWA 4Z0KA 1QHRB 1NFXA 1ZZZA 2O8WA 4I32A 3PYHA 1VITG 1G3EA 2H1UA 1BIOA 3VB6A 4XBCA 4NZQA 1OPHB 1YCPH 2PW8H 2WYJA 5DJ7A 4YT7H 2Y81A 4Q7XA 1PPGE 4I8KA 4MNXA 3RM2H 1W14U 5ESTE 4JCNA 1VCWA 1QL8A 1GJ8B 1SGQE 1DUEA 1KXDA 3URCA 1SGEE 4H42U 1ESTA 2NU3E 1BMNH 3ZZ9A 4BAMB 1THRH 4KTSA 6CHAB 1K22H 2ZU5A 3E16B 1MMJN 4MG3A 4D9QA 1P05A 1YGCH 1VJ9U 1AIXH 3D49H 4FUHA 1IOEA 1ZHPA 2FOBA 3UWIA 1C1VH 3A82A 3RXOA 2GT8A 5C1XA 1HAOH 1WAYB 3A8CA 1ELFA 2W3KA 3SNCA 3EAJA 1LO6A 1UVSH 3UOUA 2PUXB 3WY8A 3OU0A 1TGSZ 2ZEBA 4NSVA 1PPCE 4D7GA 1W11U 2A4OA 1NPMA 2BXTH 1Z6JH 2FTMA 1TYNA 1P2QA 1P9SA 3E1XB 5AFZH 2ZDAH 3QTOH 1VGCB 1FPHH 3Q76A 1VITF 4ZKSU 3A7YA 5C1UA 1OWEA 3FZZA 1E35B 4FU8A 4ISOA 2BLQA 4ABFA 1V3XA 1C5YB 2UWLA 1KDQB 2FOEA 1L1JA 3SQEE 2H2ZA 3PO1C 2XC5A 1UTNA 3V7TA 1DVAH 3QK1A 4MPWA 2BD5A 1ETTH 2FX6A 3RM0H 1C2LA 1W7XH 3VFEA 2TBSA 3UFAA 3UPEA 3M5MA 1BTWA 3GY5A 1NFWA 3T29A 2GZ9A 1BBRH 1EX3A 1A5HA 4KKDA 1MTNB 2IPHA 2EI8A 4ASHA 2AS9A 1RS0A 3PLPA 4TY7A 1EB1H 1QQ4A 5GCHG 4WH6A 2SNVA 3RXPA 1BCUH 2J34A 1O33A 1TA2A 1FIWA 2H9TH 1EP6A 2P93A 3HK3B 4A1VA 4GPGA 2G51A 4YOGA 5EW2H 5GPIB 1XXFA 2UUYA 4OS1A 3ZV8A 3F9HA 3LT3A 1WBGB 2ZO3H 1MH0A 2ZCKP 3LDXH 1UTQA 4Y11E 1AI8H 1QJ7B 3DFJA 3LU9B 1MTUA 1FY1A 3ZZ8A 1J9CH 1GBEA 1TQ7B 1QBVH 4UFEH 3R0FA 2G5NA 1H9IE 2PHBA 3RMMH 2R0KA 2SGAA 1WTGH 2AYWA 1TNHA 3SNEA 2BDGA 3RXMA 2V3HH 1GI7B 4K2YA 2SGDE 1EPTB 4GHTA 1GWAA 4QT8C 3UY9A 1BHXB 1O5CB 4MPVA 1O2KA 1NFYA 2BTCE 1QGFA 4INLA 1AO5A 1F92A 3TU7H 3TIUA 1NC6A 4WJG2 2STAE 5E2PA 1O2YA 5HM9A 1G2MA 1FAXA 1ANEA 4UDWH 2AGGX 2C90B 2Z9LA 3TJVA 1AE5A 1DOJA 1HAIH 3FP6E 1BTZA 3UWJH 2UUKB 2O8UA 2CXVA 1O3LA 1UHBB 5GCHF 6ESTA 1LTOA 2GDDA 1A7SA 5CMXH 2BLWA 3F9EA 1SFIA 1CSOE 1FV9A 1FPCH 3VB7A 2G4TA 4MLFB 5F8ZA 1S0RA 5T6DA 1CHOF 1QJ6B 1PYTD 2BX4A 2PTCE 3V3MA 1QBNA 4I8HA 3SI4H 3DUXH 4JZIA 1A3BH 2HNTF 1QRZA 1WSSH 3SHCH 1WOFA 3QGNB 1C2JA 4AZ2B 4FXGH 1ID5H 1Q31A 3LC5A 2YOLA 2BD7A 1V2OT 1MCTA 1GL0E 4ABEA 2Z94A 1EP5A 1NZQH 2VIQA 1P2OA 4Y7BA 2XBVA 5GJ4B 1O2UA 1BRUP 3BIUH 1S6FA 3QWCH 2PKAA 4RKOB 1PPHE 1FAKH 1UTJA 1Z71A 4JZDH 1ELBA 1ZR0A 3D65E 2GKVE 3F6UH 4B2CA 1MU8B 1JWTA 3TH2H 3KF2A 2VWNA 1YCPM 1C9TA 2Z7FE 4A92A 2O8LA 1JRTA 4VGCC 1GDQA 3UR9A 1B7XB 2H9HA 2BM2A 4MNVA 2QY0B 1A0HB 3MTYA 4DT7B 1GJDB 2WV5A 4CR5A 3UQVA 1FN6A 4I31A 2GZ7A 1G3BA 1F7ZA 2ZI2H 4O03A 3GY7A 1MBQA 4Y71A 3FAOA 1TIOA 3ZV9A 4K1SA 8GCHF 2FX4A 3AW1A 4WF8A 2EI7A 2XCNA 1CA0C 1GBMA 5C1YA 1TALA 1L4ZA 5HM2A 1BTUA 2PFEA 1UCYK 1E0FD 1LPGB 3BTDE 3UR6A 1OWJA 1IHTH 3SJ8A 1TE0A 2R2WU 4AGKA 3ODFA 4ABHA 1SHYA 1Q2WA 3UREA 3RXUA 3MFJA 3ZZDA 4B73A 2ZA5A 4AYYB 5F03A 1OWKA 2QC2A 2WINI 4RSPA 1HAZB 5TJXA 1DS2E 2CF9H 3L3TA 3S69A 1D6RA 4A7IB 3BIVH 1KXFA 4NFEA 3AAVA 3RMNH 4YZUA 2BD2A 1HNEE 2H9EH 3CS0A 1GMHG 3EQ0H 2PR3A 1HAGE 1GJ4H 3A87A 1BJVA 4JK5A 1LDTT 2XC4A 3LGVA 1THPB 1OWDA 1V2KT 1AU8A 1BA8B 1FY8E 3P95A 3SUGA 1KYNA 1OYTH 4K3JA 3KL6A 2G5VA 1P12E 3H7TA 4D7FA 1GI8B 4YLQH 1PFXC 3UIRA 1Y5AT 4Y76A 3MNCA 1PQ5A 4JYUH 4B74A 2UWPA 3BG8A 1TOMH 2Z9KA 2R0LA 3E6PH 3DT0H 2DE8A 4BTIB 5DPAA 2TGDA 1P01A 3TLOA 1TMTH 1LKAA 1W12U 2FIRH 2QXIA 1C1NA 1RTLA 2JETC 5C2ZA 1ANBA 2BD9A 1EZUC 3HKJB 1CU1A 1KXCA 3KQCA 3AASA 5TCAA 1BMLA 3FP7E 1C5VA 3U1IB 1UCYE 2QXHA 2WYGA 4AB9A 1UTPA 1GJ6A 1SBWA 1JMOH 5DP9A 1IQJA 1SGIB 1AB9C 3EGKH 1P10A 4NFFA 3RXCA 1D3DB 1XUFA 4J2YB 4D76A 1SPJA 1QA7A 3RUOA 5J4QA 1GMHF 1UJ1A 3U69H 4B71A 2SGPE 3TK6A 2G81E 2ZFPH 7GCHG 1DFPA 3RXVA 1IQEA 2I6SA 4K8YA 1BRAA 4OGYA 1AKSB 1O3EA 2ZPSA 2QA9E 5T6GA 1GCDA 1Y3VA 1P06A 1QA0A 3RXSA 1XUHA 1DY9A 1QRXA 2WPKS 4BXSA 1ZHRA 2FP7B 3RLWH 1O35A 2Z9IA 3SUFA 4INKA 1ABIH 1YPLH 4Q7YA 4ZAEA 3O8DA 1YBWA 2BY5X 1T8NA 5E8EH 5TCCA 3SOSA 2WPLS 1C5TA 1O2JA 1UVPA 2ZKSA 4F49A 5L2YH 4MVNA 1PQAA 2ZFQH 2W7UA 1YLDA 1P09A 3LJOA 5DP8A 1V2LT 4GSOA 2V6NA 3ZVAA 4ESTE 4CRAA 2C8WB 4DVAU 1S0QA 4NIYA 2VU8E 1DX5M 4R8TB 1L2EA 2J94A 2QXGA 3VGCC 5DO4H 2QIQA 3SU5A 1NO9H 2QAAA 1P3EA 1LCYA 1DANH 1F0TA 1HAXB 4WH8A 1SMFE 1OWHA 2HVXA 2G52A 2ZFRH 2JH6D 1OXGA 4ABIA 2FO9A 2ALPA 2FXRA 2F3CE 4YO9A 3BTEE 1EZSC 1AGJA 1ZOMA 1AN1E 4CBNA 4OS6A 5I25A 4U30A 3MOCA 4B2AA 3QX5H 4K5ZA 3AAUA 3U8TH 4CHAC 3IWMA 4XSKU 2GGVB 3DD2H 2P3TB 3Q3YA 1QBOA 1K1OA 5FPYA 3RC6A 3MU0A 3PLBA 2CN0H 2TGTA 3SGAE 4X6OA 2ZDVH 1C1RA 2F9OA 4NGAH 1O2GH 1OS8A 3A81A 2VIVA 1EZXC 1V2TT 4WWYA 1YYY1 3QO6A 2A2XH 6GCHG 2QGRA 4U01A 1KXBA 3SW2B 5FCKA 2R9PA 1C2HA 1LPKB 3A7WA 1A5IA 3MNSA 3PTNA 4BAOB 1ELGA 1GVZA 4WVPE 2GMTC 5IYTA 1WU1A 1H9LB 1D4PB 5GXPA 1S84A 1TABE 4LK4A 3E3TA 1W13U 3T62A 2F9NA 2Y82A 4ZKRU 1TRMA 3G01A 3D23A 1LQEA 1GL1A 1QIXB 2A31A 3MO9A 1AWHB 4DOQA 1O2LA 1MTWA 1SGCA 2BLVA 1FONA 1F0RA 4AOQA 1E34B 3V0XA 2AIPA 1O2NA 1D9IA 1QL7A 5F8TA 2GMTB 1GBKA 2WUBA 3TH3H 1J8AA 1GBCA 3HGPA 1IQIA 1HAYB 2NU4E 2F9VA 3LGUA 2HNTC 5T6FA 3ENSB 1PPEE 4JYTA 3C1KA 5AF9H 3QDZB 1EAWA 2ZQ1A 1Y8TA 1SGYE 1YP9A 5C3NA 3M3VA 1GBJA 1FZZA 2ZPQA 1DICA 1HLTH 3KEEA 3MU8A 2VWLA 4AFUA 6GCHF 2ZFFH 3A8BA 3SU3A 1GBTA 4MNWA 2PGQB 5EPYA 2ZECA 1HAVA 1O5EH 1S81A 2GV7A 1YCPK 6CHAC 3LH3A 4X8UH 1ANCA 1P0SH 4YOIA 4TY6A 4ZMAH 1VZQH 1OX1A 2UUJB 1OWIA 1F0SA 4FUGA 2OC1A 3K2UA 3P8FA 3GDUA 1NT1A 1PPBH 2OD3B 2A5AA 3MU4A 4DGJA 2CJIA 2ZDLA 4IMQA 5E0JA 2ZPRA 1ZYOA 1GGDB 8ESTE 2VWMA 1U6QA 1UK2A 1TNJA 3U8RH 1BUIA 3U1JB 1V2NT 3HATH 1AUJA 4HFPB 5CHAB 1MUEB 3RXAA 2FLRH 1C5ZB 1FQ3A 1O2PA 1SVPA 2D26C 2VVUA 1ELTA 4UFFH 7LPRA 3JZ1B 3SU0A 1TLDA 4AG1A 2DUCA 1P04A 3CENA 1IQNA 2SGQE 1OSSA 2A32A 1HIAA 2ZTYA 1VGCC 1PQ8A 4A6LA 1Z1JA 1K1NA 1IQLA 2XXLA 2BLOA 3I29A 1GBBA 1SLVB 2A5IA 3SU1A 1V2ST 1LKBA 1OYQA 1S82A 1UO6A 3GDVA 2ZGCA 1MKXK 3ATWA 2P94A 3TGIE 1AMHA 1GHZA 1TNKA 3SV7A 4AORA 3OSYA 2V35A 1OOKB 1O2ZA 2GZ8A 3EDXB 3A84A 5HGGA 2BZ6H 5EQRA 1GMDG 3RC4A 2PKAB 1W3CA 3TNSA 1O3DA 4JZ1A 4OS5A 1C2DA 4ABGA 5EQQA 5EU8A 1DLKB 1D6WA 1O3GA 5C5NA 3SJKA 1MTNC 5IDKA 3UNQA 4B1TA 3A7XA 2O8TA 3SQHE 3FVFB 3ZZ3A 2ZU1A 2WPIS 1LHEH 4X1PU 5EQSA 2ZCLP 1O5BB 1RGQA 3RXHA 4A5TS 1ZTLA 2D2DA 1HAPH 2FODA 3SBKA 3EE0B 1V2MT 1YPHC 3VXFH 1BBRK 5G4BA 3M36A 4DG4A 2QF3A 3GCTG 1W0ZU 2ZTZA 3VB5A 3GCNA 1HB0B 2SGFE 2P16A 4K8BA 1SI5H 3VEQB 2BOHB 3IITA 2PLXA 1C5MD 2OTVA 1ARBA 1TNLA 2ZDNA 2EI6A 1CT4E 5GIBA 5AHGH 1XKBC 4BOHA 2F9PA 2XBYA 2CV3A 1SL3A 2VVCA 4BNRA 1Y59T 5J4SA 2BB4A 3A88A 3SGBE 2V0BA 1LHCH 1P2KA 2J9NA 1ESBA 4YT6H 2ZNKH 1GJCB 1G9IE 1Z1IA 3RXRA 2BVSH 1EPTC 3BTQE 1P2MA 2VVVA 3RXLA 1ELAA 3ATKA 1NU9A 1DWDH 1XMNB 1MQ5A 1FJSA 3RXKA 3ZVEA 1CT2E 1TBRH 9ESTA 1K1PA 1UK3A 4CR9A 2B0FA 1D3PB 3EA7A 1GHWH 1AZ8A 3SHAH 1RXPA 2H5DA 2Y5FA 1GBIA 4ISNA 1FN8A 3UNRA 1K21H 1H9HE 1XX9A 2P8OB 2NU2E 2JH5D 1Y3YA 2ZWLH 3NUMA 3UQOA 4E06H 2RA3A 3TJUA 3GCTF 3RXTA 2VH0A 3IG6B 1AZZA 1EJAA 2R2MB 3KQBA 1AFEH 3MI4A 1DSTA 1QB9A 3BF6H 4B76A 3FP8E 3KNXA 1PQ7A 2OC0A 1TGCA 1BBRE 3RU4E 3Q3KA 1NY22 1OP0A 2IJOB 3BEIB 1G2LA 2BXUH 1O2RA 1A4WH 3W95A 3NZIA 3SORA 1GVKB 2H5CA 1C2GA 1RIWB 3LC3A 3NK8A 3RXJA 2VB0A 4K1TA 1VJAU 4WMFA 1ETRH 4TPIZ 2GCTB 3RXEA 4LOYH 1O3PB 1GG6B 1YLCA 2F83A 4HI3A 4WXIA 1KXAA 2J2UA 4FUEA 1ZMLA 1O2QA 1NRQH 5JBTA 1QRWA 3LKWA 3SJOA 1TRYA 3MH5A 1CGHA 2AH4X
chains in the Genus database with same CATH superfamily
1Y3WA 2B7DH 1LQDB 2VINA 3K6YA 1ZJDA 5EXMA 5GWZA 4I33A 4H4FA 1GHVH 5DP6A 1E38B 1F5LA 1IQHA 2KAIA 4XBBA 5LPEA 3KHVA 5ABWA 4YOJA 4DY7B 3SO3A 1V2JT 3RU4T 5T3HA 1QNJA 3BTHE 4IGDA 1ZSKA 1SQTA 3MNBA 1MZDA 4IN2A 5FHTA 4F55A 1F0UA 4ZKNU 4P02A 2OXSA 4GCHG 4X1SU 2XOKD 3P8GA 1UK4A 2A0QB 4CRCA 3BV9B 3WW7A 1TGTA 1EOLA 1BTXA 3U8OH 2RDLA 4ZXYH 4JZFH 1GI0A 1CO7E 2D1JA 2QV1A 2ZHWH 2XW9A 2ANWA 1A46H 3H09A 3W1EA 1NU7B 4YESB 1V2WT 1F5RA 1GI3A 3OY6U 2ZP0H 4B75A 2LPRA 4JK6A 3H5CB 3GOVB 1IQFA 1ZJKA 3F0PA 1O31A 1AVGH 1TBQH 5B6OA 1TB6H 4AG2A 4GUXA 1DXPA 1KXEA 1YKTA 3RXBA 4TPYA 2ASUB 3Q3XA 2OQUA 3URDA 2Z3EA 3LJJA 3M7UA 1SGTA 1O3FA 1EAUA 1HJ8A 3P92A 1K1LA 3T28A 1FDPA 2AGEX 1BRBE 2Q1JA 5JYIA 1MTVA 4NZLA 1S85A 4FVBA 4BAQB 1KY9A 4GLYA 1ABJH 4XBDA 1CBWB 3HPTB 7ESTE 1ELDE 2VBCA 1AD8H 1GBHA 1O32A 5DGJA 3STIA 2Q6FA 4RN6A 3R3GB 4GHQA 2HWLB 5K7RA 2FYQA 4MPUA 2AMDA 1C2MA 4IC6A 5L30H 1LVBA 5A8ZA 4BAHB 2OBQA 3NPSA 4CREA 1UVTH 4P00A 4HZHA 2J4IA 4HGCA 2CGAA 3FKSD 3W94A 5EXLA 1IHSH 1C5RA 1C1MA 1KTTB 4ASUD 1SGRE 2A5KA 2XRCA 3QN7A 5C5OA 1FY5A 1SLXB 3BG4C 4H6TA 1O2SA 4F4OC 3MNXA 5HMAA 3ZVCA 3TGKE 3B23B 4GAWA 2Y5GA 2ZQ2A 1SHHB 8LPRA 3RXQA 2YNAA 4IBLH 1T32A 2BDBA 3M3SA 2XBWA 4SGAE 5EOKA 4WMEA 1PYTC 1QR3E 1T31A 3VB4A 3CP7A 1O37A 1L0ZA 3DSGA 4ISHH 2J95A 3F68H 3SNAA 4KTCA 5BPEA 4AX9H 3TGJE 1HUTH 4K69A 1HV7A 1TNGA 3DSOA 3M61U 1AHTH 2Z3DA 3OY5U 1AQ7A 2W26A 2AMPA 5ETXA 1RJXB 3DA9B 1NRNH 2H6MA 4I7YH 2GDEH 2XWAA 3BG4B 1BHXF 1YPGH 5LH8A 3A8AA 4CRGA 2ZFSA 4ZHLU 3ATMA 1Q3XA 2Q6GA 2HGTH 3FFGA 2A45B 5DG6A 3UB0A 3PTBA 1EOJA 2O8MA 1ELCA 3GISB 4E7NA 1TNIA 1Z8GA 4NA8A 4DW2U 1C1OA 3KQDA 3SJ9A 4AB8A 1BOQA 3TNTA 2ANMH 1OHHD 3PLKA 1LHFH 3OX7U 1SQRA 2Y6TA 1QB1A 1LHGH 1DY8A 2VH6A 3MH7A 2YMSD 6LPRA 2C3SA 1M9UA 1P2JA 3MYWA 5DKMA 3TITA 1DDJA 3SGQE 3BN9A 1HAVB 3DFLA 4NWKA 4AFSA 3ODDA 3ZYEA 1BT7A 1RFNA 1WTHD 1HBTH 1MKWH 5L6NH 1Y3XA 2AIQA 2D8WA 3E0PB 1EJNA 2R3YA 1EJMA 4K60A 1C9PA 1MAYA 4MNYA 2QCYA 1H4WA 2ULLA 1EASA 5KGOA 1SOTA 2ZGHA 1EB2A 1C5NH 1A2CH 1BTPA 3NCLA 3M5NA 4X8VH 2A2QH 1C5PA 4NSYA 3KIDU 3OTJE 1HJAB 3QGJA 1SGFA 1O3JA 2VJ1A 2W5EA 1PPZA 1GCTB 3MMGA 5JPMH 2HALA 1FX0B 4K1EA 1AE8H 2Z3CA 1IQGA 1HDTH 1KLJH 1NRRH 1C5QA 2QYIA 2ZGJA 2VIOA 3K65B 1GVLA 5T1VA 2ZCHP 2NU1E 1QL9A 7GCHF 3OAAD 2ZFTA 1P9UA 2QN5T 1BQYA 3A7TA 3FZDA 1J16A 3GCOA 2BDYA 2AERH 3S9BA 3MH4A 2GX4A 1L1GA 1ORFA 3M5OA 2PSYA 2W7SA 1XUIA 1C4Y2 3MQKC 3MHWU 4ISIH 3VPKA 2J97A 1BTHH 4Q80A 1QZ8A 3LIWA 1O2VA 1WV7H 3GY4A 1GJ9B 1ESAA 1AUTC 3F1SB 2ZU4A 1G32B 1GHAG 1GHBG 1HYLA 3SI3H 3TK5A 1OKXA 3QUMP 1K1IA 3T27A 1C4U2 1UVOA 1COWD 1O34A 4XRNA 1RD3B 1TGBA 1HPGA 3SV8A 1A3EH 3AW0A 4CH8B 1SGPE 1DT2A 2CHAB 5C67A 4I8LA 1PJPA 1QQUA 5F6MA 3SV9A 3P8OA 1VR1H 2V3OH 2PKSB 3SZNA 3SUEA 1YF4A 1J15A 3A89A 4O97A 1O5AB 2IOTA 2K0QA 1ZSLA 5DP5A 5DP7A 1Y3UA 1C2FA 4Y0ZE 4YM9A 4U32A 2NWNA 5AFYH 4UONA 3O8CA 2A1DB 4Y79A 2ZZUH 4D8NA 4J1YA 1E1QD 1G3CA 5JB8S 2B8OH 3A8DA 3LGWA 3MWIU 1DXWA 3MH6A 1E37B 1JIMA 4X6PA 3A80A 1PPFE 2DE9A 2RDEA 2J38A 4IC5A 3LPRA 3SV6A 1YPEH 2HLCA 3V12A 2EC9H 2KFWA 1DSUA 1UW7A 1Z8JB 1O3MA 5EG4A 4ZUHA 2ZU3A 3KGPA 4O3UA 2EEKA 2A4RA 3TVJB 1TA6A 4IN1A 4R0IA 1N8OC 5EXNA 1CA8B 1YWUA 2XTTB 1GHAF 1GHBF 3A83A 3T2NA 1QY6A 1O0DH 3QZQA 3S9CA 2P3FH 1FMGA 3EA8A 1IAUA 3RP2A 2BYAX 2HNTE 1CVWH 2PWXA 3TK9A 4FU9A 1GGDC 4JMYA 2J92A 2WPJS 3S9AA 2TGPZ 2HOBA 1O5DH 1V2VT 1SQOA 4HG6A 5CHAC 3K6ZA 2BHGA 2QF5A 1N8OB 2GV6A 3RMLH 2FI4E 4ZROA 1HXFH 4AFZA 2JDID 3KYGA 5JDUB 4FUCA 1MAXA 4X1QU 3S7HB 3LONA 3V13A 3O8RA 2ESTE 1AFQB 2VIWA 1FIZA 2YMSB 3GY6A 1MCVA 1P2NA 3K9XB 1ELVA 2HVYB 3KCGH 1ZPBA 4XDEA 4OGXA 2Z6BD 2BQ6B 1V2PT 3A85A 3GY3A 1SLUB 2OC7A 1A0LA 1DPOA 1AY6H 3ZZ4A 3FANA 3RMOH 1ZGIA 3BEUA 2ZHEH 2A4GA 2XWBI 1WYKA 1K2I1 1GJ5H 1FXYA 3U98H 3NWUA 3ZIAD 2BOKA 1EATA 2FS8A 1C1PA 1CGJE 2VIPA 1O2TA 4BANB 4ABBA 4XOJA 4A1XA 3U9AH 1F2SE 1MBMA 2BY7X 1L1NA 3AVZA 2ALVA 4XD7D 3RU4D 2ZGXH 3GCHB 3I77A 4JYVH 2CF8H 1KLIH 2C4FH 2P59A 1O2HA 4ISLA 1B0EA 1GBFA 2BD8A 3DHKH 1YC0A 4UE7H 5HXFA 5C0TA 2KAIB 4FOUC 4Q7ZA 1A1RA 1A5GH 4CRDA 1GJ7B 5A0BA 4NG9H 1BRCE 2XYAA 2FLBH 5LGOA 4MTBA 3PMAB 2ZDMA 3SNDA 1SGNE 2YNBA 1TQ0B 4Z6AH 1G36A 1TWXB 4X1NU 2ANYA 2G00A 2R3UA 2GVFA 4M7GA 4M9FA 2C8YB 3H7OA 4E7RG 4NA7A 1H1BA 4ABJA 1W0KD 1O2OA 4FUBA 8KME2 2Q6DA 3LGTA 2TIOA 1Z6EA 1DWEH 4DT4A 2QXJA 1DM4B 1GHXH 1HXEH 1MKXH 1EUFA 1SLWB 2ODQA 1LHDH 1ZGVA 2C8XB 2F9UA 4AGJA 1GI6A 2P3UB 1RRKA 1EAIA 1GMCG 4TT3D 2FOGA 4Y6DA 1O5GH 3CS7A 1YPHE 4Z1MD 1ZMJA 1ZTKA 3P17H 1SOZA 2UUFB 1DITH 3SN8A 1S6LA 2TRMA 1TBZH 2OBOA 2TGAA 1C1SA 1XUGA 2I6QA 3TJNA 4FUIA 4DCDA 2UWOA 4AYVB 1QURH 2BY9X 3B9FH 2TPIZ 1L4DA 1ZPZA 5ESBA 3UOPA 2VNTA 1H8IH 4Y7AA 4D9RA 3MO6A 4YXWD 3HK6B 1ZRKA 3PRBA 1O3BA 2Z9GA 2P8OC 5A0CA 1C5UA 1P03A 1VCQA 2Y7ZA 4TWYA 3KYFA 1KSNA 1MTSA 1BITA 2WZQA 1EAXA 1TX8A 1GMDF 4Y8YA 3P6ZB 2JH0D 3ELAH 1NROH 1JRSA 1THSH 4TYDA 1GBDA 1RTFB 1XXDA 1V6DA 2GT7A 1K1MA 4XFQA 2RA0A 3E8LA 3PO1B 3F9GA 4Y8XA 3L6PA 1EXFA 4Y10E 5FL7D 4NIVA 1CHOG 1FNIA 3PB1E 1T8OA 3E91A 3TH4H 1C5OH 2W6JD 3SUDA 2QF0A 1C4V2 5CE1A 1RIWC 4FU7A 5DP3A 2FOCA 3F0OA 3PV5A 3NKKA 1O2IA 2GCTC 1MU6B 1T7CA 1CGIE 1H8DH 1SR5C 1GG6C 1GMCF 2VGCC 1UTLM 2BVXH 4O9VA 4E05H 2G8TA 2GTBA 3N7EA 5C17A 3C27B 1W0JD 1HRTH 5C0UA 2ODYB 5A8YA 1FY4A 3BTGE 1YY3A 4ZKOU 1G37A 1QFKH 2C93B 3OTPA 3QZRA 3FOAA 3QLPH 1P11E 1AVXA 2BX3A 1NM6A 3ZVBA 1S5SA 3HKIB 1GBLA 2FOAA 2F91A 1SB1H 2K1QA 4H6SB 5C20A 1N1LA 1N6XA 3ZVGA 2WV4A 4NCYA 3QTVH 1XUJA 2VGCB 1C5SA 4HTCH 1CT0E 3SU6A 4MDSA 1OP8A 3T25A 2ZHDA 1UTOA 5LPRA 3E90B 2EY4C 2VWOA 3Q77A 1FI8A 5E0GA 2K8IA 1C1TA 3NXPA 8GCHG 1BDAA 1C1QA 4FVDA 2A7CA 1Z8RA 1FUJA 4X2VA 1WUNH 4B2BA 1CHGA 3T5FH 4UFGH 3RXDA 1TOCB 2WPHS 1KTSB 4X0WU 2XCFA 1C1UH 3SU2A 2ZC9H 1KIGH 3T26A 5L2ZH 2O9QA 1O2MA 1E79D 3M7QA 1W8BH 3MU1A 1HAHH 1GI9B 2GJGA 4RKJB 3TPIZ 4Q63A 1IQMA 1MD8A 1BJUA 1BMAA 2BQ7B 2ZG0H 1LMWB 5BRRE 2SFAA 1GDUA 1ETSH 2BQWB 3KQ5A 5PTPA 1WDIA 2KCAA 5FPTA 2BVRH 2Y5HA 3SNBA 1BB0B 1SFQB 3RC5A 4KTUA 1GPZA 3N7OA 1B0FA 1AVWA 1ZLRA 1O5FH 1KDQA 2OINA 1HFDA 1TX6A 2GCHG 5E0HA 1CBWC 1XM1A 3PWBA 2Z9JA 1NS3A 3N99A 1BZXE 5E2OA 1D3TB 4ACBA 1YPKH 2FEQH 2W6ID 4NIXA 2ZF0H 1QB6A 1C2EA 4Y8ZA 1C5WB 5GDSH 9LPRA 5EODA 1UVUH 3P70B 1DE7H 1C2IA 2FPZA 3A7ZA 4IW4E 4VGCB 4X8TH 1A61H 3OFND 4XE4A 2ANKH 2A7JA 2ZTXA 4CBOA 3EYDA 1NRPH 1UTKA 1Y5UT 3Q00A 1GJAB 1O2WA 1UCYH 4GCHF 1O36A 3SV2H 2FOMB 1QJ1B 1Y5BT 3OEED 1YLNA 2FZZA 4X1RU 3LGIA 5FX5A 3BTME 4OS4A 4BTUB 4CRFA 1V2UT 1O3CA 2QE7D 3VB3A 1CA0B 2FI5E 4KP0A 1YPJH 4AN7A 1O2XA 1UMAH 4BXWA 3ZYDA 1O38A 3M5LA 2Y80A 3ZZ6A 1K28D 3PMHB 3PM3A 4O3TA 1LVYA 1HGTH 2PUQH 2ZU2A 2KCPA 1JIRA 3ZZAA 3VXEH 4ABDA 5JBCS 5A8XA 2XBXA 2OP9A 1S6HA 3LGYA 2GCHF 1SSXA 1ZTJA 4MPXA 3PWCA 4NA9H 3BSQA 1EPTA 1JBUH 1QCPA 2FESH 2BY6X 5JBBS 1T4UH 1GDNA 4ZH8A 4GVUA 1VCPA 2SGEE 5DP4A 5EGMA 2HPPH 3KQEA 2ZIQH 5FX6A 1Z8IB 4TSFD 2BDHA 4KELA 1TX7A 2FDAA 1DLEA 1UHBA 1N6YA 1V2QT 1XVMA 1J14A 1VITH 3RDZA 2CMYA 2OUAA 5F8XA 3PMBB 3PMJA 3O8BA 2BD3A 2B5TB 2WUCA 5FBEA 4OS2A 4DJZB 1W0YH 5EW1H 1DUAA 5F53A 1TRNA 1GHYH 1O39A 4UD9H 3L33A 4Y0YE 3M7TA 2BD4A 2KM0A 5FAHA 1J17T 3TJOA 1GJBB 3M35A 3ZVDA 5K0HA 1MKWK 4NWLA 4X6MA 3NRLA 1F5KU 2JKHA 2ZGBH 1ZMNA 3I78A 1GI2A 1HJAC 3M37A 4ZHAA 2JETB 1V2RT 1LVOA 2ZHFH 1A0JA 1SGFG 5DK1A 1RTKA 1JXPA 1TONA 3GICB 3EE7A 4THNH 1GCTC 3ZZ5A 3SU4A 2FI3E 4FUFA 2OLGA 2F9BH 1P02A 3GYLB 1NN6A 4BTTB 1NFUA 1UTMA 1ARCA 1LPZB 1W2KH 2G55A 3BTFE 3LH1A 2OCVB 5I46H 2C8ZB 3ZVFA 1SKYE 1XKAC 1EZQA 1K9OE 1AB9B 1C5LH 4JZEH 2WPDD 2FWWA 4YTAA 1O3NA 4IS5A 3S0NA 4X6NA 4U2WA 3STJA 4A1TA 2RCEA 3GY2A 2PV9B 4FETA 2SNWA 5A0AE 1O3AA 3PROA 4WY3A 2P95A 5SGAE 2IN2A 1GI5A 2PTNA 1BTYA 1JOUB 1TPSA 2PGBB 2RG3A 1W10U 1ACBE 1O30A 2BY8X 4MQAA 4UEHH 2PSXA 2BDAA 4UFDH 7KMEH 3RXFA 1P2IA 2XC0A 3UUZA 1T4VH 4LZ1H 1SG8B 1HIAB 4LXBH 4AFQA 3U28C 1TPAE 3RXGA 5HYOA 4ZXXH 5A09A 5FXLA 5A2MH 1TPOA 3F9FA 3FN8A 4SGBE 5JBAS 1ZRBA 3BEFB 3ZZ7A 2CHAC 4I8GA 1HJ9A 4KGAA 1NESE 5DSFA 2L6OA 3LOXA 1T8LA 2ODPA 1S83A 2BDCA 3ZZBA 4ABAA 2ZHQH 4ZHMU 3KN2A 1GBAA 3E0NB 3JZ2B 1ELEE 1DWCH 1O3IA 5H4IB 2PKSC 1X7AC 2A7HA 4OS7A 4CH2B 1G30B 2OC8A 1MQ6A 3EA9A 1C1WH 4IMZA 1MD7A 1GI1A 2FMJA 1TFXA 1FY3A 1WQVH 2FOHA 1SGDE 2FYRA 3BTWE 2HPQH 3MU5A 2BDIA 3BTKE 3P8NA 5AVDA 3VGCB 1IQKA 2BMGB 2ILNA 3D62A 2W3IA 3HGNA 4DIIH 3A7VA 3OYPA 1SQAA 1MZAA 4NIWA 1TGNA 5EPNA 5DN6D 2STBE 2AGIX 5EJLA 1P8VC 2HLDD 3BTTE 1TMBH 1NTPA 3A86A 2FM2A 1FLEE 1SC8U 4BAKB 1ZSJA 1YM0A 3ATIA 1CQQA 1ZHMA 1D3QB 1P57B 4FUDA 1NRSH 4LZ4B 3GY8A 3UTUH 1XUKA 2EA3A 1OP2A 1TPPA 2Y7XA 1BMMH 1WQSA 1EQ9A 2GP9B 4X2XA 1G3DA 2KX4A 4CHAB 2B9LA 1XVOA 5FBIA 3M3TA 3GYMA 1C2KA 3ATLA 3ESTA 2XNIA 1B5GH 2PP6A 1YPMH 2FS9A 2ZDKA 2AEIH 3RXIA 1TMUH 2GD4B 4X8SH 3GDSA 2EQNA 1DWBH 1C5XB 4WMDA 3MO3A 1K1JA 4CRBA 2A4QA 1LVMA 1O3HA 5FCRA 3B8JA 1AFQC 2FOFA 1W7GH 2YMSC 2OQ5A 4PROA 4Q2KA 1INCA 2WPMS 3ITIA 2M5TA 2G4UA 1Z7KA 3PV4A 4DURA 2HRVA 1ZPCA 2VIDA 3RLYH 5C94A 4YLUA 1WCZA 5FPSA 1WXRA 1CE5A 1EKBB 4DIHH 1QTFA 2CK3D 2AFQB 4WXVA 4FUJA 3SJIA 4X2YA 1AKSA 2BZAA 1P3CA 5JB9S 3UNSA 1ANDA 4I8JA 4X2WA 1KLTA 2THFB 1O3KA 1T8MA 3CNRA 1HCGA 1AWFH 2AMQA 3S7KB 1TAWA 2LNCA 4INHA 1E36B 3GCHC 2FTLE 2NU0E 5LPFA 1O3OA 3ZZCA 1GI4A 4TWWA 4Z0KA 1QHRB 1NFXA 3AK5A 1ZZZA 2O8WA 4I32A 3PYHA 3OEHD 1VITG 1G3EA 2H1UA 1BIOA 3VB6A 4XBCA 4NZQA 1OPHB 1YCPH 2PW8H 2WYJA 5DJ7A 4YT7H 2Y81A 4Q7XA 1PPGE 4I8KA 4MNXA 2OK5A 3RM2H 1W14U 5ESTE 4JCNA 1VCWA 3DCLA 1QL8A 1GJ8B 1SGQE 1DUEA 1KXDA 3URCA 1SGEE 4H42U 1ESTA 2NU3E 1BMNH 3ZZ9A 4BAMB 1THRH 4KTSA 6CHAB 1K22H 4I86A 2J98A 2ZU5A 3E16B 1MMJN 3F2HA 4MG3A 4D9QA 1P05A 1YGCH 1VJ9U 1AIXH 3D49H 4FUHA 1IOEA 1ZHPA 2FOBA 3UWIA 1C1VH 3A82A 3RXOA 2GT8A 5C1XA 1HAOH 1WAYB 3A8CA 1ELFA 2W3KA 3SNCA 3EAJA 1LO6A 1UVSH 2KCOA 2JIZD 3UOUA 2PUXB 3WY8A 3OU0A 1TGSZ 3PV2A 2ZEBA 4NSVA 1PPCE 4D7GA 1EFRD 1W11U 5EJZA 2A4OA 1NPMA 2BXTH 1Z6JH 2FTMA 1TYNA 1P2QA 1P9SA 3E1XB 5AFZH 2ZDAH 3QTOH 1VGCB 1FPHH 3Q76A 1VITF 2KZ4A 4ZKSU 3A7YA 5C1UA 1OWEA 3FZZA 3F3BA 1E35B 4FU8A 4ISOA 2BLQA 4ABFA 1V3XA 1C5YB 2UWLA 1KDQB 2FOEA 1L1JA 3SQEE 2H2ZA 3PO1C 2XC5A 1UTNA 3V7TA 1DVAH 3QK1A 4MPWA 2BD5A 1ETTH 2FX6A 3RM0H 1C2LA 1W7XH 3VFEA 2TBSA 3UFAA 3UPEA 3M5MA 1BTWA 3GY5A 1NFWA 3T29A 2GZ9A 1BBRH 1EX3A 1A5HA 4KKDA 1MTNB 2IPHA 2EI8A 4ASHA 2AS9A 1RS0A 3PLPA 4TY7A 1EB1H 1QQ4A 5GCHG 4WH6A 2SNVA 3RXPA 1BCUH 2J34A 1O33A 1TA2A 1FIWA 2H9TH 1EP6A 2P93A 3HK3B 4A1VA 4GPGA 2G51A 4YOGA 5EW2H 5GPIB 1XXFA 2UUYA 4OS1A 3ZV8A 3F9HA 3LT3A 1WBGB 2ZO3H 3DSPA 3WWFA 1MH0A 2ZCKP 3LDXH 1UTQA 4Y11E 1AI8H 1QJ7B 5KEDA 3DFJA 3LU9B 1MTUA 1FY1A 3ZZ8A 1J9CH 1GBEA 1TQ7B 1QBVH 4UFEH 3R0FA 2G5NA 1H9IE 3VG8A 2PHBA 3RMMH 2R0KA 2SGAA 1WTGH 2AYWA 5HIYA 1H8HD 1TNHA 3SNEA 2BDGA 3RXMA 2V3HH 1GI7B 4K2YA 2SGDE 1EPTB 4GHTA 1GWAA 4QT8C 3UY9A 1BHXB 1O5CB 4MPVA 1O2KA 1NFYA 2BTCE 1QGFA 4INLA 1AO5A 1F92A 3TU7H 3TIUA 1NC6A 4WJG2 2STAE 1NBMD 5E2PA 1O2YA 5HM9A 1G2MA 1FAXA 1ANEA 4UDWH 2AGGX 2C90B 2Z9LA 3TJVA 1AE5A 1DOJA 1HAIH 3FP6E 1BTZA 2M2AA 3UWJH 2UUKB 2O8UA 2CXVA 1O3LA 1UHBB 5GCHF 6ESTA 1LTOA 2GDDA 1A7SA 5CMXH 2BLWA 3F9EA 1SFIA 1CSOE 1FV9A 1FPCH 3VB7A 2G4TA 2LELA 4MLFB 2AHME 5F8ZA 1S0RA 5T6DA 3WWBA 1CHOF 1QJ6B 1PYTD 2BX4A 2PTCE 3V3MA 1QBNA 4I8HA 3SI4H 3DUXH 4JZIA 1A3BH 2HNTF 1QRZA 1WSSH 3SHCH 1WOFA 3QGNB 1C2JA 2J5UA 4AZ2B 4FXGH 1ID5H 2WHXA 1Q31A 3LC5A 2YOLA 2BD7A 1V2OT 1MCTA 1GL0E 4ABEA 2Z94A 1EP5A 1NZQH 2VIQA 1P2OA 4Y7BA 2XBVA 5GJ4B 1O2UA 1BRUP 3BIUH 1S6FA 3QWCH 2PKAA 4RKOB 1PPHE 1FAKH 1UTJA 1Z71A 4JZDH 1ELBA 1ZR0A 3D65E 2GKVE 3F6UH 4B2CA 1MU8B 1JWTA 3TH2H 3KF2A 2VWNA 1YCPM 1C9TA 2Z7FE 4A92A 2O8LA 1JRTA 4VGCC 1GDQA 3UR9A 1B7XB 2H9HA 2BM2A 4MNVA 2QY0B 1A0HB 3MTYA 4DT7B 1GJDB 2WV5A 4CR5A 3UQVA 1FN6A 4I31A 2GZ7A 1G3BA 2WV9A 1F7ZA 2ZI2H 4O03A 3GY7A 1MBQA 4AC9A 4Y71A 3FAOA 2V7QD 1TIOA 3ZV9A 4K1SA 8GCHF 2FX4A 3AW1A 4WF8A 2EI7A 2XCNA 1CA0C 1GBMA 5C1YA 1TALA 1L4ZA 5HM2A 1BTUA 2PFEA 3N7DA 1UCYK 1E0FD 1LPGB 3BTDE 3UR6A 4ACAA 1OWJA 1IHTH 3SJ8A 1TE0A 2R2WU 4AGKA 3ODFA 1MABB 4ABHA 1SHYA 1Q2WA 3UREA 3RXUA 5B6LA 3MFJA 3ZZDA 4B73A 2ZA5A 4AYYB 3F2FA 5F03A 1OWKA 2QC2A 2WINI 4RSPA 1HAZB 5TJXA 1DS2E 2CF9H 3L3TA 3S69A 1D6RA 4A7IB 3BIVH 1KXFA 4NFEA 3AAVA 3RMNH 4YZUA 2BD2A 1HNEE 2H9EH 3CS0A 1GMHG 3EQ0H 2PR3A 1NBME 1HAGE 2L74A 1GJ4H 3A87A 1BJVA 4JK5A 1LDTT 2XC4A 3LGVA 1THPB 1OWDA 1V2KT 1AU8A 1BA8B 1FY8E 3P95A 3SUGA 1KYNA 1OYTH 3GS9A 4K3JA 3KL6A 2G5VA 1P12E 3H7TA 4D7FA 1GI8B 4YLQH 1PFXC 3UIRA 5KECA 1Y5AT 4Y76A 3MNCA 1PQ5A 4JYUH 4B74A 2UWPA 3BG8A 1TOMH 2Z9KA 2R0LA 3E6PH 3DT0H 2DE8A 4BTIB 5DPAA 2TGDA 1P01A 3TLOA 1TMTH 1LKAA 1W12U 2FIRH 2QXIA 1C1NA 1RTLA 2JETC 5C2ZA 1ANBA 2BD9A 1EZUC 3HKJB 1CU1A 1KXCA 5IK2D 3KQCA 3AASA 5TCAA 5CDFE 1BMLA 3FP7E 1C5VA 3U1IB 1UCYE 2QXHA 2WYGA 4AB9A 5HIZA 1UTPA 2IJD1 1GJ6A 1SBWA 1JMOH 1KMHB 1IQJA 1SGIB 5DP9A 1AB9C 3EGKH 1P10A 4NFFA 3RXCA 1D3DB 1XUFA 2F43B 4J2YB 4D76A 1SPJA 1QA7A 3RUOA 5J4QA 1GMHF 1UJ1A 3U69H 4B71A 2SGPE 3TK6A 2G81E 3SYJA 2ZFPH 7GCHG 1DFPA 3RXVA 1IQEA 2I6SA 4K8YA 1BRAA 4OGYA 1AKSB 1O3EA 2ZPSA 2QA9E 5T6GA 1GCDA 1Y3VA 1P06A 1QA0A 4RT0A 3RXSA 1XUHA 1DY9A 1QRXA 2WPKS 4BXSA 1ZHRA 2FP7B 3RLWH 1O35A 2Z9IA 5GNDA 3SUFA 4INKA 1ABIH 1YPLH 4Q7YA 4ZAEA 5CHBA 3O8DA 1YBWA 2BY5X 1T8NA 5E8EH 5TCCA 3SOSA 2WPLS 1C5TA 1O2JA 1UVPA 2ZKSA 4F49A 5L2YH 4MVNA 1PQAA 2ZFQH 2W7UA 2V3MA 1YLDA 1P09A 3F2GA 3LJOA 5DP8A 4OM9A 2QF4A 1V2LT 4GSOA 2V6NA 3ZVAA 4ESTE 4CRAA 2C8WB 4DVAU 1S0QA 4NIYA 2VU8E 1DX5M 4R8TB 2JJ1D 1L2EA 2J94A 2QXGA 3VGCC 5DO4H 2QIQA 3SU5A 1NO9H 2QAAA 1P3EA 1LCYA 1DANH 1F0TA 1HAXB 3FO8D 4WH8A 1SMFE 1OWHA 2J98B 2HVXA 1BMFD 4F48B 2G52A 2ZFRH 2JH6D 1OXGA 4ABIA 2FO9A 2ALPA 2FXRA 2F3CE 4YO9A 3BTEE 1EZSC 1AGJA 1ZOMA 1AN1E 4CBNA 4OS6A 5I25A 4U30A 3MOCA 4B2AA 3UAIC 3QX5H 4K5ZA 3AAUA 3OE7D 3U8TH 4CHAC 3IWMA 4XSKU 2GGVB 3DD2H 2P3TB 3Q3YA 1QBOA 1K1OA 5FPYA 3RC6A 3MU0A 3PLBA 2CN0H 2TGTA 3SGAE 4X6OA 2ZDVH 1C1RA 2F9OA 4NGAH 1O2GH 1OS8A 3A81A 2VIVA 1EZXC 1V2TT 4WWYA 1YYY1 3QO6A 2A2XH 6GCHG 2QGRA 4U01A 1KXBA 3SW2B 5FCKA 2R9PA 1C2HA 1LPKB 3A7WA 1A5IA 3MNSA 3PTNA 4BAOB 1ELGA 1GVZA 4WVPE 2GMTC 5IYTA 1WU1A 1H9LB 1D4PB 5GXPA 1S84A 1TABE 4LK4A 3E3TA 1W13U 3T62A 2F9NA 2Y82A 4ZKRU 1TRMA 3G01A 3D23A 1LQEA 1GL1A 1QIXB 2A31A 3MO9A 1AWHB 4DOQA 1O2LA 1MTWA 1SGCA 2BLVA 1FONA 1F0RA 4AOQA 4ZCNA 1E34B 3V0XA 2AIPA 1O2NA 1D9IA 1QL7A 5F8TA 5EJ1A 2GMTB 1GBKA 2WUBA 3TH3H 1J8AA 1GBCA 3HGPA 1IQIA 1HAYB 2F9VA 2NU4E 3LGUA 2HNTC 5T6FA 3ENSB 1PPEE 4JYTA 2XNDD 3C1KA 5AF9H 3QDZB 1EAWA 2ZQ1A 1Y8TA 1SGYE 1YP9A 5C3NA 3M3VA 1GBJA 1FZZA 2ZPQA 1DICA 1HLTH 2IPQX 3KEEA 2VWLA 3MU8A 4AFUA 6GCHF 2ZFFH 3A8BA 4RI0A 3SU3A 1GBTA 4MNWA 2PGQB 5EPYA 2ZECA 1HAVA 1O5EH 1S81A 2GV7A 1YCPK 6CHAC 3LH3A 4X8UH 1ANCA 1P0SH 4YOIA 4TY6A 4ZMAH 1VZQH 1OX1A 2UUJB 1OWIA 1F0SA 4FUGA 2OC1A 3K2UA 3P8FA 3GDUA 1NT1A 1PPBH 2OD3B 2A5AA 3MU4A 4DGJA 2CJIA 2ZDLA 4IMQA 5E0JA 2ZPRA 1ZYOA 1GGDB 8ESTE 2VWMA 1U6QA 1UK2A 1TNJA 3U8RH 1BUIA 3U1JB 1V2NT 3HATH 1AUJA 4HFPB 5CHAB 1MUEB 3RXAA 2FLRH 1C5ZB 1FQ3A 1O2PA 1SVPA 2D26C 2VVUA 1E1RD 1ELTA 4UFFH 7LPRA 3JZ1B 3SU0A 1TLDA 4AG1A 2DUCA 1P04A 3CENA 1IQNA 2JJ2D 2SGQE 1OSSA 2A32A 1HIAA 2ZTYA 1VGCC 1PQ8A 4A6LA 2KCYA 1Z1JA 4Q4LA 1K1NA 1IQLA 2XXLA 2BLOA 3I29A 1GBBA 1SLVB 2A5IA 3SU1A 1V2ST 1LKBA 1OYQA 1S82A 1UO6A 3GDVA 2ZGCA 1MKXK 3ATWA 2P94A 1VKYA 3TGIE 1AMHA 1GHZA 1TNKA 3SV7A 4AORA 3OSYA 2V35A 1OOKB 1O2ZA 2GZ8A 3EDXB 3A84A 5HGGA 2BZ6H 5EQRA 5HKKD 1GMDG 3RC4A 2PKAB 1W3CA 3TNSA 1O3DA 4JZ1A 4OS5A 1C2DA 4ABGA 5EQQA 5EU8A 1DLKB 1D6WA 1O3GA 5C5NA 3SJKA 1MTNC 5IDKA 2WSSD 3UNQA 4B1TA 3A7XA 2O8TA 3SQHE 3FVFB 2KR7A 3ZZ3A 2ZU1A 4B6FA 2WPIS 1LHEH 4X1PU 5EQSA 2ZCLP 1O5BB 1RGQA 3RXHA 4A5TS 1ZTLA 2D2DA 1HAPH 2FODA 3SBKA 3EE0B 1V2MT 1YPHC 3VXFH 1BBRK 5G4BA 3M36A 4DG4A 2QF3A 3GCTG 1W0ZU 2ZTZA 3VB5A 3GCNA 1HB0B 2SGFE 2P16A 2F4LA 4K8BA 1SI5H 3VEQB 2BOHB 3IITA 2PLXA 2LP6A 1C5MD 2OTVA 1ARBA 1TNLA 2ZDNA 2EI6A 1CT4E 5GIBA 5AHGH 1XKBC 4BOHA 2F9PA 2XBYA 3SZEA 2CV3A 1SL3A 2VVCA 4BNRA 1Y59T 5J4SA 2BB4A 3A88A 3SGBE 2V0BA 1LHCH 1P2KA 2J9NA 5EIYA 1ESBA 4YT6H 2ZNKH 1GJCB 1G9IE 1Z1IA 3RXRA 2BVSH 1EPTC 3BTQE 1P2MA 2VVVA 3RXLA 1ELAA 3ATKA 1NU9A 1DWDH 1XMNB 1MQ5A 1FJSA 4B6EA 4RT1A 3RXKA 3ZVEA 1K0HA 1CT2E 1TBRH 9ESTA 1K1PA 3PRDA 1UK3A 4CR9A 2B0FA 1D3PB 3EA7A 1GHWH 1AZ8A 3SHAH 1RXPA 2H5DA 2Y5FA 1GBIA 4ISNA 1FN8A 3UNRA 1K21H 1H9HE 1XX9A 1H8ED 2NU2E 2P8OB 2JH5D 1Y3YA 2RFKC 2ZWLH 3NUMA 3UQOA 4E06H 2RA3A 3TJUA 3GCTF 3RXTA 2VH0A 3IG6B 1AZZA 1EJAA 2R2MB 3KQBA 1AFEH 3MI4A 1DSTA 1QB9A 3BF6H 4B76A 3FP8E 3KNXA 1PQ7A 1TGCA 2OC0A 1BBRE 3RU4E 3Q3KA 1NY22 1OP0A 2IJOB 3BEIB 1G2LA 2BXUH 1O2RA 1A4WH 3W95A 3NZIA 3SORA 1GVKB 2H5CA 1C2GA 1RIWB 3LC3A 3NK8A 3RXJA 2VB0A 4K1TA 1VJAU 4WMFA 1ETRH 4TPIZ 2GCTB 3RXEA 4LOYH 1O3PB 1GG6B 1YLCA 2F83A 4HI3A 4WXIA 1KXAA 2J2UA 4FUEA 1ZMLA 1O2QA 1NRQH 5JBTA 1QRWA 3LKWA 3SJOA 1TRYA 3MH5A 1CGHA 2AH4X
chains in the Genus database with same CATH topology
1Y3WA 2B7DH 1LQDB 2VINA 3K6YA 1ZJDA 5EXMA 5GWZA 4I33A 4H4FA 1GHVH 5DP6A 1E38B 1F5LA 1IQHA 2KAIA 4XBBA 5LPEA 3KHVA 5ABWA 4YOJA 4DY7B 3SO3A 1V2JT 3RU4T 5T3HA 1QNJA 3BTHE 4IGDA 1ZSKA 1SQTA 3MNBA 1MZDA 4IN2A 5FHTA 1F0UA 4ZKNU 2OXSA 4GCHG 4X1SU 3P8GA 1UK4A 2A0QB 4CRCA 3BV9B 1TGTA 1EOLA 1BTXA 3U8OH 2RDLA 4ZXYH 4JZFH 1GI0A 1CO7E 2D1JA 2QV1A 2ZHWH 2XW9A 2ANWA 1A46H 1NU7B 4YESB 1V2WT 1F5RA 1GI3A 3OY6U 2ZP0H 4B75A 2LPRA 4JK6A 3H5CB 3GOVB 1IQFA 1ZJKA 1O31A 1AVGH 1TBQH 5B6OA 1TB6H 4AG2A 4GUXA 1DXPA 1KXEA 1YKTA 3RXBA 4TPYA 2ASUB 3Q3XA 2OQUA 3URDA 2Z3EA 3LJJA 3M7UA 1SGTA 1O3FA 1EAUA 1HJ8A 3P92A 1K1LA 3T28A 1FDPA 2AGEX 1BRBE 2Q1JA 5JYIA 1MTVA 4NZLA 1S85A 4FVBA 4BAQB 1KY9A 4GLYA 1ABJH 4XBDA 1CBWB 3HPTB 7ESTE 1ELDE 1AD8H 1GBHA 1O32A 5DGJA 3STIA 2Q6FA 4RN6A 3R3GB 4GHQA 2HWLB 5K7RA 2FYQA 4MPUA 2AMDA 1C2MA 4IC6A 5L30H 1LVBA 5A8ZA 4BAHB 2OBQA 3NPSA 4CREA 1UVTH 4HZHA 2J4IA 4HGCA 2CGAA 3W94A 5EXLA 1IHSH 1C5RA 1C1MA 1KTTB 1SGRE 2A5KA 2XRCA 3QN7A 5C5OA 1FY5A 1SLXB 3BG4C 4H6TA 1O2SA 4F4OC 3MNXA 5HMAA 3ZVCA 3TGKE 3B23B 4GAWA 2Y5GA 2ZQ2A 1SHHB 8LPRA 3RXQA 2YNAA 4IBLH 1T32A 2BDBA 3M3SA 2XBWA 4SGAE 5EOKA 4WMEA 1PYTC 1QR3E 1T31A 3VB4A 3CP7A 1O37A 1L0ZA 4ISHH 2J95A 3F68H 3SNAA 4KTCA 5BPEA 4AX9H 3TGJE 1HUTH 4K69A 1HV7A 1TNGA 3M61U 1AHTH 2Z3DA 3OY5U 1AQ7A 2W26A 2AMPA 5ETXA 1RJXB 3DA9B 1NRNH 2H6MA 4I7YH 2GDEH 2XWAA 3BG4B 1BHXF 1YPGH 5LH8A 3A8AA 4CRGA 2ZFSA 4ZHLU 3ATMA 1Q3XA 2Q6GA 2HGTH 3FFGA 2A45B 5DG6A 3PTBA 1EOJA 2O8MA 1ELCA 3GISB 4E7NA 1TNIA 1Z8GA 4NA8A 4DW2U 1C1OA 3KQDA 3SJ9A 4AB8A 1BOQA 3TNTA 2ANMH 3PLKA 1LHFH 3OX7U 2Y6TA 1QB1A 1LHGH 1DY8A 2VH6A 3MH7A 6LPRA 2C3SA 1M9UA 1P2JA 3MYWA 5DKMA 3TITA 1DDJA 3SGQE 3BN9A 1HAVB 3DFLA 4NWKA 4AFSA 3ODDA 3ZYEA 1BT7A 1RFNA 1WTHD 1HBTH 1MKWH 5L6NH 1Y3XA 2AIQA 2D8WA 3E0PB 1EJNA 2R3YA 1EJMA 4K60A 1C9PA 1MAYA 4MNYA 2QCYA 1H4WA 2ULLA 1EASA 1SOTA 2ZGHA 1EB2A 1C5NH 1A2CH 1BTPA 3NCLA 3M5NA 4X8VH 2A2QH 1C5PA 4NSYA 3KIDU 3OTJE 1HJAB 3QGJA 1SGFA 1O3JA 2VJ1A 2W5EA 1PPZA 1GCTB 3MMGA 5JPMH 2HALA 4K1EA 1AE8H 2Z3CA 1IQGA 1HDTH 1KLJH 1NRRH 1C5QA 2QYIA 2ZGJA 2VIOA 3K65B 1GVLA 2ZCHP 2NU1E 1QL9A 7GCHF 2ZFTA 1P9UA 2QN5T 1BQYA 3A7TA 3FZDA 1J16A 3GCOA 2BDYA 2AERH 3S9BA 3MH4A 2GX4A 1L1GA 1ORFA 3M5OA 2PSYA 2W7SA 1XUIA 1C4Y2 3MHWU 4ISIH 3VPKA 1BTHH 4Q80A 3LIWA 1O2VA 1WV7H 3GY4A 1GJ9B 1ESAA 1AUTC 3F1SB 2ZU4A 1G32B 1GHAG 1GHBG 1HYLA 3SI3H 3TK5A 1OKXA 3QUMP 1K1IA 3T27A 1C4U2 1UVOA 1O34A 1RD3B 1TGBA 1HPGA 3SV8A 1A3EH 3AW0A 4CH8B 1SGPE 1DT2A 2CHAB 5C67A 4I8LA 1PJPA 1QQUA 5F6MA 3SV9A 3P8OA 1VR1H 2V3OH 2PKSB 3SZNA 3SUEA 1YF4A 1J15A 3A89A 4O97A 1O5AB 2IOTA 5DP5A 1ZSLA 5DP7A 1Y3UA 1C2FA 4Y0ZE 4YM9A 4U32A 2NWNA 5AFYH 4UONA 3O8CA 2A1DB 4Y79A 2ZZUH 4D8NA 4J1YA 1G3CA 5JB8S 2B8OH 3A8DA 3LGWA 3MWIU 1DXWA 3MH6A 1E37B 1JIMA 4X6PA 3A80A 1PPFE 2DE9A 2J38A 4IC5A 3LPRA 3SV6A 1YPEH 2HLCA 3V12A 2EC9H 1DSUA 1Z8JB 1O3MA 5EG4A 4ZUHA 2ZU3A 3KGPA 4O3UA 2EEKA 2A4RA 3TVJB 1TA6A 4IN1A 4R0IA 1N8OC 5EXNA 1CA8B 2XTTB 1GHAF 1GHBF 3A83A 3T2NA 1QY6A 1O0DH 3QZQA 3S9CA 2P3FH 1FMGA 3EA8A 1IAUA 3RP2A 2BYAX 2HNTE 1CVWH 2PWXA 3TK9A 4FU9A 1GGDC 4JMYA 2J92A 2WPJS 3S9AA 2TGPZ 2HOBA 1O5DH 1V2VT 1SQOA 5CHAC 3K6ZA 2BHGA 1N8OB 2GV6A 3RMLH 2FI4E 4ZROA 1HXFH 4AFZA 5JDUB 4FUCA 1MAXA 4X1QU 3S7HB 3LONA 3V13A 3O8RA 2ESTE 1AFQB 2VIWA 1FIZA 3GY6A 1MCVA 1P2NA 3K9XB 1ELVA 3KCGH 1ZPBA 4XDEA 4OGXA 2Z6BD 2BQ6B 1V2PT 3A85A 3GY3A 1SLUB 2OC7A 1A0LA 1DPOA 1AY6H 3ZZ4A 3FANA 3RMOH 1ZGIA 3BEUA 2ZHEH 2A4GA 2XWBI 1WYKA 1K2I1 1GJ5H 1FXYA 3U98H 3NWUA 2BOKA 1EATA 2FS8A 1C1PA 1CGJE 2VIPA 1O2TA 4BANB 4ABBA 4XOJA 4A1XA 3U9AH 1F2SE 1MBMA 2BY7X 1L1NA 3AVZA 2ALVA 3RU4D 2ZGXH 3GCHB 3I77A 4JYVH 2CF8H 1KLIH 2C4FH 2P59A 1O2HA 4ISLA 1B0EA 1GBFA 2BD8A 3DHKH 1YC0A 4UE7H 5HXFA 2KAIB 4Q7ZA 1A1RA 1A5GH 4CRDA 1GJ7B 5A0BA 4NG9H 1BRCE 2XYAA 2FLBH 5LGOA 4MTBA 3PMAB 2ZDMA 3SNDA 1SGNE 2YNBA 1TQ0B 4Z6AH 1G36A 1TWXB 4X1NU 2ANYA 2G00A 2R3UA 2GVFA 4M7GA 2C8YB 3H7OA 4E7RG 4NA7A 1H1BA 4ABJA 1O2OA 4FUBA 8KME2 2Q6DA 3LGTA 2TIOA 1Z6EA 1DWEH 2QXJA 1DM4B 1GHXH 1HXEH 1MKXH 1EUFA 1SLWB 2ODQA 1LHDH 1ZGVA 2C8XB 2F9UA 4AGJA 1GI6A 2P3UB 1RRKA 1EAIA 1GMCG 2FOGA 4Y6DA 1O5GH 3CS7A 1YPHE 1ZMJA 1ZTKA 3P17H 1SOZA 2UUFB 1DITH 3SN8A 2TRMA 1TBZH 2OBOA 2TGAA 1C1SA 1XUGA 2I6QA 3TJNA 4FUIA 4DCDA 2UWOA 4AYVB 1QURH 2BY9X 3B9FH 2TPIZ 1L4DA 1ZPZA 5ESBA 3UOPA 2VNTA 1H8IH 4Y7AA 4D9RA 3MO6A 3HK6B 1ZRKA 1O3BA 2Z9GA 2P8OC 5A0CA 1C5UA 1P03A 1VCQA 2Y7ZA 4TWYA 1KSNA 1MTSA 1BITA 1EAXA 1TX8A 1GMDF 4Y8YA 3P6ZB 2JH0D 3ELAH 1NROH 1JRSA 1THSH 4TYDA 1GBDA 1RTFB 1XXDA 1V6DA 2GT7A 1K1MA 4XFQA 2RA0A 3E8LA 3PO1B 3F9GA 4Y8XA 3L6PA 1EXFA 4Y10E 4NIVA 1CHOG 1FNIA 3PB1E 1T8OA 3E91A 3TH4H 1C5OH 3SUDA 2QF0A 1C4V2 5CE1A 1RIWC 4FU7A 5DP3A 2FOCA 3NKKA 1O2IA 2GCTC 1MU6B 1T7CA 1CGIE 1H8DH 1SR5C 1GG6C 1GMCF 2VGCC 1UTLM 2BVXH 4O9VA 4E05H 2G8TA 2GTBA 3C27B 1HRTH 2ODYB 5A8YA 1FY4A 3BTGE 4ZKOU 1G37A 1QFKH 2C93B 3QZRA 3QLPH 1P11E 1AVXA 2BX3A 1NM6A 3ZVBA 1S5SA 3HKIB 1GBLA 2FOAA 2F91A 1SB1H 2K1QA 4H6SB 5C20A 1N1LA 1N6XA 3ZVGA 2WV4A 4NCYA 3QTVH 1XUJA 2VGCB 1C5SA 4HTCH 1CT0E 3SU6A 4MDSA 1OP8A 3T25A 2ZHDA 1UTOA 5LPRA 3E90B 2VWOA 3Q77A 1FI8A 5E0GA 1C1TA 3NXPA 8GCHG 1BDAA 1C1QA 4FVDA 2A7CA 1Z8RA 1FUJA 4X2VA 1WUNH 4B2BA 1CHGA 3T5FH 4UFGH 3RXDA 1TOCB 2WPHS 1KTSB 4X0WU 2XCFA 1C1UH 3SU2A 2ZC9H 1KIGH 3T26A 5L2ZH 2O9QA 1O2MA 3M7QA 1W8BH 3MU1A 1HAHH 1GI9B 4RKJB 3TPIZ 1IQMA 1MD8A 1BJUA 1BMAA 2BQ7B 2ZG0H 1LMWB 5BRRE 2SFAA 1GDUA 1ETSH 2BQWB 5PTPA 5FPTA 2BVRH 2Y5HA 3SNBA 1BB0B 1SFQB 3RC5A 4KTUA 1GPZA 3N7OA 1B0FA 1AVWA 1ZLRA 1O5FH 2OINA 1KDQA 1HFDA 1TX6A 2GCHG 5E0HA 1CBWC 1XM1A 3PWBA 2Z9JA 1NS3A 1BZXE 5E2OA 1D3TB 1YPKH 2FEQH 4NIXA 2ZF0H 1QB6A 1C2EA 4Y8ZA 1C5WB 5GDSH 9LPRA 5EODA 1UVUH 3P70B 1DE7H 1C2IA 2FPZA 3A7ZA 4IW4E 4VGCB 4X8TH 1A61H 4XE4A 2ANKH 2A7JA 2ZTXA 4CBOA 3EYDA 1NRPH 1UTKA 1Y5UT 3Q00A 1GJAB 1O2WA 1UCYH 4GCHF 1O36A 3SV2H 2FOMB 1QJ1B 1Y5BT 4X1RU 2FZZA 3LGIA 5FX5A 3BTME 4OS4A 4BTUB 4CRFA 1V2UT 1O3CA 3VB3A 1CA0B 2FI5E 4KP0A 1YPJH 4AN7A 1O2XA 1UMAH 4BXWA 3ZYDA 1O38A 3M5LA 2Y80A 3ZZ6A 1K28D 3PMHB 3PM3A 4O3TA 1LVYA 1HGTH 2PUQH 2ZU2A 1JIRA 3ZZAA 3VXEH 4ABDA 5JBCS 5A8XA 2XBXA 2OP9A 1S6HA 3LGYA 2GCHF 1SSXA 1ZTJA 4MPXA 3PWCA 4NA9H 3BSQA 1EPTA 1JBUH 1QCPA 2FESH 2BY6X 5JBBS 1T4UH 1GDNA 4ZH8A 4GVUA 1VCPA 2SGEE 5DP4A 5EGMA 2HPPH 3KQEA 2ZIQH 5FX6A 1Z8IB 2BDHA 4KELA 1TX7A 2FDAA 1DLEA 1UHBA 1N6YA 1V2QT 1XVMA 1J14A 1VITH 3RDZA 2CMYA 2OUAA 5F8XA 3PMBB 3PMJA 3O8BA 2BD3A 2B5TB 2WUCA 5FBEA 4OS2A 4DJZB 1W0YH 5EW1H 1DUAA 1TRNA 1GHYH 1O39A 4UD9H 3L33A 4Y0YE 3M7TA 2BD4A 5FAHA 1J17T 3TJOA 1GJBB 3M35A 3ZVDA 5K0HA 1MKWK 4NWLA 4X6MA 1F5KU 2JKHA 2ZGBH 1ZMNA 3I78A 1GI2A 1HJAC 3M37A 4ZHAA 2JETB 1V2RT 1LVOA 2ZHFH 1A0JA 1SGFG 5DK1A 1RTKA 1JXPA 1TONA 3GICB 4THNH 1GCTC 3ZZ5A 3SU4A 2FI3E 4FUFA 2OLGA 2F9BH 1P02A 3GYLB 1NN6A 4BTTB 1NFUA 1UTMA 1ARCA 1LPZB 1W2KH 2G55A 3BTFE 3LH1A 2OCVB 5I46H 2C8ZB 3ZVFA 1XKAC 1EZQA 1K9OE 1AB9B 1C5LH 4JZEH 2FWWA 4YTAA 1O3NA 4IS5A 3S0NA 4X6NA 4U2WA 3STJA 4A1TA 2RCEA 3GY2A 2PV9B 2SNWA 5A0AE 1O3AA 3PROA 4WY3A 2P95A 5SGAE 2IN2A 1GI5A 2PTNA 1BTYA 1JOUB 1TPSA 2PGBB 2RG3A 1W10U 1ACBE 1O30A 2BY8X 4MQAA 4UEHH 2PSXA 2BDAA 4UFDH 7KMEH 3RXFA 1P2IA 2XC0A 3UUZA 1T4VH 4LZ1H 1SG8B 1HIAB 4LXBH 4AFQA 1TPAE 3RXGA 5HYOA 4ZXXH 5A09A 5FXLA 5A2MH 1TPOA 3F9FA 4SGBE 5JBAS 1ZRBA 3BEFB 3ZZ7A 2CHAC 4I8GA 1HJ9A 4KGAA 1NESE 3LOXA 1T8LA 2ODPA 1S83A 2BDCA 3ZZBA 4ABAA 2ZHQH 4ZHMU 3KN2A 1GBAA 3E0NB 3JZ2B 1ELEE 1DWCH 1O3IA 5H4IB 2PKSC 1X7AC 2A7HA 4OS7A 4CH2B 1G30B 2OC8A 1MQ6A 3EA9A 1C1WH 4IMZA 1MD7A 1GI1A 2FMJA 1TFXA 1FY3A 1WQVH 2FOHA 1SGDE 2FYRA 3BTWE 2HPQH 3MU5A 2BDIA 3BTKE 3P8NA 5AVDA 3VGCB 1IQKA 2BMGB 2ILNA 3D62A 2W3IA 3HGNA 4DIIH 3A7VA 3OYPA 1SQAA 1MZAA 4NIWA 1TGNA 5EPNA 2STBE 2AGIX 1P8VC 3BTTE 1TMBH 1NTPA 3A86A 2FM2A 1FLEE 1SC8U 4BAKB 1ZSJA 1YM0A 3ATIA 1CQQA 1ZHMA 1D3QB 1P57B 4FUDA 1NRSH 4LZ4B 3GY8A 3UTUH 1XUKA 2EA3A 1OP2A 1TPPA 2Y7XA 1BMMH 1WQSA 1EQ9A 2GP9B 4X2XA 1G3DA 4CHAB