3OYPA

Hcv ns3/4a in complex with ligand 3
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
174
structure length
174
Chain Sequence
PITAYSQQTRGLLGCIITSLTGRDKNQVDGEVQVLSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWPAPPGARSMTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHVVGIFRAAVCTRGVAKAVDFIPVESM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine protease NS3
publication title Selective irreversible inhibition of a protease by targeting a noncatalytic cysteine.
pubmed doi rcsb
source organism Hepatitis c virus (isolate japanese)
molecule tags Hydrolase/hydrolase inhibitor
total genus 38
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3oypA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3oypA01
2Y81A 4RKJB 1JRTA 1GWAA 3HKJB 4TYDA 1K1OA 4UFFH 2ANMH 1UHBB 3SUGA 4FU9A 3PYHA 1KDQA 1TALA 2ODQA 2F9UA 3MU4A 1C1SA 5F03A 2NU4E 1Q2WA 3KN2A 3PM3A 5DP3A 4ESTE 1C5PA 1C5OH 2BD4A 3M5OA 1O0DH 2HLCA 3FZDA 2R3YA 2PHBA 3P95A 5JB8S 1CA8B 2BMGB 1GI4A 3H7TA 3UWIA 3A7XA 1SGYE 3RXDA 4IN1A 2FXRA 1Y3VA 2BDYA 3SV8A 5BRRE 5FCKA 1P8VC 2OK5A 1GI3A 2BD2A 2BXTH 2PLXA 1V2RT 1P3CA 5EW2H 3MWIU 3TJNA 1ETRH 3SGAE 3UPEA 4MG3A 4CBNA 1BT7A 1GBAA 2UUYA 3MNXA 2PWXA 3HKIB 2FOGA 3KF2A 5DJ7A 2GD4B 2GKVE 3QK1A 3DT0H 1NN6A 4QT8C 1YF4A 4D7GA 5F6MA 1T31A 2QXIA 3TGKE 4BAMB 1EJAA 1CT2E 4Y8XA 1GVKB 2D26C 1EOJA 1MCTA 2XC5A 4ISOA 2OD3B 2TPIZ 2Z7FE 1D4PB 1UVTH 2Q6FA 3A8CA 3RXAA 1AFQB 2ZDKA 3OTPA 1A1RA 1GI8B 2Z3CA 5AF9H 1F0TA 3E3TA 1SI5H 1UK3A 4CRCA 4ZH8A 3V3MA 2FODA 4B74A 4B6FA 1H9IE 1O3JA 1XUHA 4GCHG 3OSYA 1NFWA 3TITA 1BMLA 3FP7E 4ZKNU 1O5CB 3VB5A 2NWNA 2BDGA 3BTKE 1E37B 1O3CA 1GBHA 3GICB 4MDSA 3RLWH 4CRFA 3PLBA 1GDQA 1ZPCA 4X8TH 2W5EA 2VB0A 2CMYA 4ZROA 3SNDA 2G4TA 1IHTH 2AGIX 3NWUA 5EW1H 2ZGBH 1GDUA 1YPLH 2VVVA 1P04A 1GI9B 5ESTE 1GL1A 1TNIA 3SU3A 3LIWA 1ZJDA 4A92A 4D9QA 1V2QT 3HK6B 3TIUA 1GJDB 1QJ6B 1BZXE 3W94A 1SL3A 2ZCHP 5DP7A 5FXLA 3MTYA 1BBRE 1IQKA 3P17H 2YNAA 1F5LA 5C1XA 1DY9A 4A6LA 4E06H 3TPIZ 2JH5D 2GZ8A 3H09A 3VB3A 4LK4A 2FS8A 3B9FH 4X8SH 1WYKA 2TGDA 2VVCA 3EA8A 1AFQC 1BHXF 1TA6A 4J2YB 4UDWH 1AU8A 1UO6A 4RN6A 4Y7BA 3UR6A 1W0ZU 4AORA 4JZFH 2BY5X 1DPOA 1INCA 3EYDA 2W3KA 1NFYA 2EI7A 3PMJA 3PWBA 3GY4A 3LT3A 1ZGVA 3Q3KA 4XSKU 1OP0A 3Q76A 1XUGA 4WJG2 4FUHA 3EAJA 2AYWA 1HAGE 3EA9A 1O31A 1C5VA 4MPWA 3SUDA 1NC6A 3K65B 4Y11E 1QQUA 2FWWA 1UVPA 4IBLH 5L2YH 1AMHA 1UTMA 1D3DB 4U32A 3ODFA 5DP9A 5F8XA 2IPHA 1E34B 1QB1A 3BTEE 1O30A 4O9VA 1MTNB 4O3UA 5FPYA 4DY7B 1MTUA 1JBUH 2CF9H 2PUQH 3E91A 1TAWA 4ABHA 4BTTB 1MTWA 2WV5A 4B6EA 1TNHA 2SGFE 4AN7A 4TPIZ 4YT6H 3P8FA 2YOLA 2FZZA 3KQBA 2GT7A 3L3TA 4RSPA 1EP6A 3VXEH 1TQ7B 2A5KA 3LGWA 1HPGA 7GCHF 2IN2A 3DHKH 3TK9A 4FVDA 3RXBA 5FPSA 1ZYOA 1GBLA 1WV7H 1GGDB 2WYGA 3SGQE 3E0NB 1T8LA 1DSUA 2BVRH 3LGYA 1O2GH 1HAPH 1AI8H 1RJXB 1D3QB 1LPGB 1ANEA 2FYQA 1E0FD 2VIPA 1QQ4A 4YLQH 4DOQA 1PQAA 2XWBI 4YESB 1D6RA 2DE9A 4ABEA 2PSYA 3P70B 1V2UT 1SGQE 3LPRA 2Y7XA 3U9AH 1MU8B 1ETTH 1GJ4H 2ZU2A 4NA7A 3ZZBA 1HIAB 1SOTA 2VGCC 2SNVA 1RFNA 1TNLA 4UD9H 3GCTF 4NA9H 1PFXC 1Y3UA 6ESTA 4NSYA 3RM0H 2R0KA 3V13A 3P92A 1C1TA 2BLVA 1C4Y2 3SU0A 4A5TS 1BIOA 3SGBE 1YCPH 4AFZA 1CO7E 1CA0B 5H4IB 1DOJA 1RTKA 2EEKA 3LOXA 3PROA 1GJBB 1P2IA 2GMTC 4ABBA 2DUCA 2ALPA 1YLDA 4DURA 3M61U 1GI6A 2R2MB 2P94A 4JZEH 3T27A 1FONA 5A0BA 4X2YA 2HNTF 4WF8A 3U8TH 1S0RA 1PPBH 3BG4C 3BTWE 1XX9A 4Y6DA 1L0ZA 3U69H 2HWLB 1N1LA 2XTTB 4XFQA 3E8LA 2EI8A 4CBOA 3QDZB 1TRNA 2TRMA 4IGDA 1IQNA 1OWJA 3U1IB 3SU1A 1AGJA 3RXEA 1Y3YA 1C1UH 1GHAF 3SJKA 1DUEA 5GIBA 2C3SA 1Y5UT 3A87A 2AMDA 4AX9H 3FP6E 1EASA 2C90B 4A1TA 2WPKS 2FOMB 2F9NA 1XM1A 3PO1C 3SU5A 3F6UH 1WOFA 1A3BH 1TB6H 3LC5A 1EZQA 1BA8B 1YP9A 2AIPA 2QF3A 4SGBE 1GL0E 1L1JA 2FS9A 2ZDVH 4B73A 3RXGA 1GI2A 1HAZB 1VGCC 1MKWH 1CBWC 1KXAA 3VB4A 1O37A 2C8YB 3AASA 1S82A 1DXPA 1K22H 4UFDH 4NA8A 1ELGA 1OPHB 4MQAA 4WH6A 3ELAH 1G3CA 1BMMH 4JK6A 2ZP0H 6LPRA 1N6XA 3IG6B 1ELVA 1ANDA 2O8TA 4FUBA 4U30A 3VPKA 3W95A 3GCNA 1SG8B 4WMDA 1FI8A 2ZPQA 2VIWA 3SV6A 3HGNA 2J95A 3MO3A 4AB8A 2W3IA 1WQSA 4TY7A 5PTPA 1IAUA 1NM6A 1THRH 1KTTB 3RU4D 1ORFA 1AFEH 3A7YA 1PPCE 1B5GH 1NFXA 4CRGA 1MBMA 3LKWA 2UWOA 4KTUA 3RXRA 1FNIA 4DT7B 1TNKA 3DUXH 2B8OH 2FEQH 1J14A 5HM2A 3BF6H 3MO9A 2AMPA 3I77A 1C5XB 1AE5A 4K5ZA 4BNRA 5A0CA 1V2OT 2OQUA 3ATIA 2QAAA 4CHAC 5AVDA 1P10A 3M7TA 3TJUA 1UMAH 1G32B 1SGCA 1ZTLA 3M7QA 2THFB 4AFSA 1V6DA 2PGBB 1MTVA 2W7SA 1NS3A 3TNSA 4JZIA 1GI5A 2ZG0H 3S7HB 2ODPA 2HVXA 2CHAC 3MOCA 3ZVDA 1P09A 8LPRA 3SU6A 4IC5A 1C1VH 3O8BA 2WV9A 4WMFA 4OM9A 5C1YA 1O39A 3RM2H 2ZQ2A 4KGAA 1B0FA 3DFJA 3GDVA 3CS0A 4X6PA 3ZZDA 2OXSA 1ELTA 1AQ7A 2G00A 3M36A 3SV9A 1C2DA 2PKSC 4AB9A 2FPZA 4H42U 4FUFA 5EGMA 1GI7B 1CVWH 3QO6A 1Q3XA 1P2JA 3M37A 1BRCE 1HYLA 2QN5T 1FLEE 3BEIB 4TWYA 5A8YA 1AHTH 1O2XA 6GCHF 1FY8E 1CGJE 3PV5A 3UWJH 1SMFE 2FTMA 1EPTB 1THSH 1SC8U 3ZZ4A 3QGNB 4D8NA 4ABJA 1DSTA 1A3EH 2O8LA 3MU5A 3RMOH 5GJ4B 2PTCE 3TU7H 1FIWA 1Y3WA 4FU7A 1P3EA 3RXOA 2FLRH 2F9OA 3QZQA 4VGCC 3GY2A 2BLOA 2ZFRH 3FP8E 1VCWA 2LPRA 2JH0D 1C9TA 3A7ZA 5C2ZA 4B76A 1ETSH 1ABJH 8GCHG 1N8OC 3P8OA 2ZWLH 1HAIH 1HNEE 1ZRBA 2Y7ZA 3C1KA 2VJ1A 5EXLA 1O3KA 1SB1H 4I8GA 1V2LT 1KLJH 3S0NA 3TGJE 5LPRA 2D1JA 4UE7H 2SGPE 1OX1A 2ZGCA 1TOMH 1NT1A 4TWWA 1J9CH 4X6MA 1EAUA 1SHHB 1DXWA 1C2GA 1NRSH 1Y5AT 1T7CA 2P95A 1J15A 4AOQA 1LPKB 1CHOG 3VB7A 4CRBA 4MNWA 5TCAA 4ABDA 1W0YH 1JIMA 1TOCB 2FI4E 2YNBA 2GCHG 2OLGA 1QB6A 2Y80A 1T4VH 3OY6U 1WUNH 3E1XB 1KIGH 3EQ0H 1NU9A 2CF8H 2ZEBA 1LVOA 2VIVA 1WQVH 2OTVA 1KLTA 2HOBA 4OS6A 5ESBA 1OOKB 3KQCA 4R0IA 1HUTH 2FI5E 1ZSLA 4K2YA 1F0UA 2HNTE 2GDDA 3ZVBA 2BLWA 2GT8A 1MBQA 1VITH 1AN1E 1BDAA 1A5HA 2FOFA 3SV2H 5L6NH 1QL9A 2RCEA 1K1PA 1GBIA 1ELBA 2ZFPH 4BTUB 1LKAA 3LGVA 1XUIA 1TX8A 3ZVCA 3PLKA 4FUGA 1SPJA 4FUJA 3ZZ6A 4IC6A 4WWYA 4CH2B 1ELAA 2QCYA 3F68H 3OTJE 1GBBA 1O32A 3OYPA 3TGIE 3D62A 2TBSA 3RXSA 1UCYH 1O3MA 3BSQA 5A8ZA 1N6YA 5JBTA 4YLUA 1EZXC 2G55A 5J4SA 1ZSJA 4FXGH 4DIIH 2H5CA 3A80A 5AHGH 5DGJA 1B0EA 2ANYA 3FAOA 3BTTE 1O3AA 1KXEA 1P57B 3ZZ3A 4OS4A 2P3TB 3M5LA 5EPNA 1SGIB 2ILNA 3V0XA 1UK4A 5CMXH 1ZOMA 4H6SB 1PPEE 4GSOA 3D23A 1O2KA 2BDIA 4IW4E 1NZQH 1VITG 1WCZA 1YPGH 2KAIA 5JPMH 1ZPBA 3V7TA 1O3GA 1SLUB 1LVYA 1CE5A 1DWCH 3SUFA 4MLFB 2BY9X 1UTLM 1W7GH 3M35A 2OCVB 1YCPM 1L2EA 1XUJA 3S7KB 3BTME 2IJD1 2SGDE 1GG6B 4TY6A 4OS5A 1MTSA 1VCQA 1BRUP 2ZNKH 1OKXA 1Q31A 3KHVA 3SOSA 4M7GA 1GMCG 3A85A 5E0HA 1HAVA 2PR3A 1P01A 2Z9GA 4ISIH 5EPYA 2IJOB 2P8OC 2PV9B 3IWMA 1K1NA 1P9SA 1AB9B 4Y0YE 3UUZA 4Y79A 1BRBE 1O2TA 1E36B 3UNSA 1GHVH 2VH0A 2SGEE 1Z1JA 3SBKA 5GXPA 5HGGA 1MKXH 3PLPA 2I6SA 3ATMA 2OC0A 4R8TB 1Z7KA 1HBTH 4DIHH 2ZDLA 1AZ8A 1O2IA 3A88A 3SU4A 1QCPA 4X1NU 1P12E 4Q2KA 1XUFA 1TGBA 3TH3H 1MQ5A 5E0GA 4Z6AH 1YYY1 1EJNA 2BXUH 2BOHB 1GBFA 3B8JA 4Q7YA 2SGAA 2UUJB 5ETXA 1TMBH 1XKAC 4I31A 1P2OA 4K1SA 2H9EH 3SV7A 3JZ1B 4LZ4B 1A61H 1GG6C 1O2SA 4HTCH 3RUOA 2ZO3H 3SJ8A 3SU2A 2VBCA 1A46H 1BBRH 1QIXB 3A7TA 3PMAB 4FUDA 4WMEA 2ZGHA 1DX5M 1LHGH 4BAKB 4MPVA 3UQVA 5E0JA 2SFAA 3SNCA 1GJ5H 3I78A 2O9QA 4I8KA 1O2OA 1NFUA 1CQQA 3F9EA 3WY8A 2ZF0H 1NU7B 2J9NA 1LVMA 2PFEA 1QRXA 4X2VA 2VH6A 1RIWB 3ZZAA 4WY3A 3NCLA 4GUXA 2WPIS 1GVLA 5GDSH 1TBQH 1AB9C 4GPGA 1V2ST 3GISB 1DLEA 1LHCH 1EPTA 1VCPA 3FFGA 2WHXA 1PPGE 1C1WH 3VGCB 1ZHPA 2TGTA 4Q7ZA 2GGVB 3M5MA 1TMUH 2Y5GA 1CGIE 1BTUA 1J8AA 1EB1H 1SLXB 1W3CA 2AH4X 3HGPA 3T25A 1RXPA 3B23B 4UFGH 1LTOA 1ELCA 2XCFA 4K8YA 2BHGA 1BITA 1O3PB 1MAXA 3RXTA 4ZXXH 4AG2A 1C5NH 2OBQA 1B7XB 2EA3A 3UREA 4YTAA 1A0HB 1IQIA 1F5RA 1GBMA 5GCHF 2XRCA 1GMDG 2ZCLP 1DVAH 2XYAA 1ID5H 1TBRH 1NPMA 1PYTD 1YM0A 4KELA 1T8MA 2VIDA 1RIWC 4MTBA 5C1UA 1O2WA 1QGFA 1NROH 4Y8ZA 4YOGA 1ZLRA 4IN2A 1FY3A 4GHQA 1TE0A 2H6MA 3SQEE 2F91A 5E8EH 3ENSB 1ZMNA 4HI3A 3ZV8A 1RTLA 2QYIA 4F49A 2K1QA 3MNCA 2GZ7A 1WBGB 1XXDA 2F9PA 2XBXA 5FX6A 2RDLA 1C5YB 1S83A 1FN8A 1YPHC 1GJ9B 2ZECA 3MYWA 2W26A 1O5DH 2HGTH 1QURH 3KL6A 1BCUH 2Z9KA 1DICA 1A0JA 1JMOH 1HAYB 1O3OA 9LPRA 4INKA 2A32A 3SORA 4NIWA 3VB6A 1L4ZA 2OUAA 1A4WH 1BQYA 3RP2A 2A7HA 2ZI2H 4FUCA 4X8UH 1F5KU 1EB2A 2HPQH 4ZXYH 5DK1A 4U2WA 3IITA 1TGCA 4ZKRU 2D8WA 1X7AC 4LXBH 2TGPZ 1MTNC 1ZHRA 1GMHF 2FOBA 1GDNA 2P59A 1SGDE 3A8BA 2V0BA 3RXCA 4BXSA 1YKTA 3ZZ5A 1GHXH 1NY22 1W8BH 4O97A 1GJ8B 2R3UA 5FX5A 5GWZA 3URCA 1AVGH 1G36A 3P8NA 1U6QA 3QUMP 3T29A 1VZQH 2BYAX 1W14U 2XNIA 1MQ6A 1C5LH 1BJVA 1HJ9A 2ZU3A 2JKHA 2ZCKP 2QXJA 3A7WA 3TH4H 5C67A 1GGDC 1UVSH 3EA7A 1P06A 1C5TA 2H1UA 1ANBA 1Z6EA 2OP9A 3GYMA 3E6PH 1GHBF 1ZGIA 2OC7A 5CE1A 5B6LA 3M3TA 2AFQB 2BTCE 2BD5A 3K9XB 4NIVA 3O8DA 2KAIB 2BQWB 2XWAA 4HZHA 4Y8YA 2VWMA 1E38B 3UQOA 2A2XH 1YLCA 3EDXB 2ASUB 2RG3A 4X6NA 2ODYB 1IQHA 3UOUA 1DLKB 3AW1A 1V2VT 3SJOA 1TMTH 3ZZ7A 1SR5C 7LPRA 2QIQA 3TJVA 1ZR0A 2JETB 6CHAB 2A4GA 3H5CB 1KXFA 4GAWA 2WPLS 4OS7A 1HJ8A 3MU1A 5T6DA 1HAVB 1TA2A 3SO3A 2Z9IA 4X0WU 1TLDA 1M9UA 2G52A 2NU2E 4ABIA 2ZHDA 3RMLH 1OYQA 3TJOA 1CSOE 2FOHA 1CA0C 2ANKH 1W13U 2SGQE 2V3OH 3E0PB 4NCYA 2G81E 3ZYEA 4MNYA 1ZJKA 2Q6DA 4O03A 4Q7XA 1GBJA 5GPIB 4ABGA 1H8DH 1IQMA 2CJIA 4JYVH 2BVSH 3S9BA 3HATH 1O2UA 2A2QH 4NZQA 3SHCH 3ZZCA 1GMCF 2AGGX 2WPMS 1C5QA 4JCNA 3TNTA 1GBDA 1V2PT 2BM2A 2P93A 1WTHD 1P05A 4FVBA 3UNRA 1AY6H 3A89A 1YGCH 5CHAB 1C5WB 1BHXB 1D9IA 1VJ9U 1FAKH 1HB0B 4ZHLU 1PJPA 2VVUA 1LKBA 1W10U 1AZZA 2UWLA 4B2BA 2GDEH 4BAHB 1JIRA 1O5BB 1ABIH 1OSSA 2XCNA 1O3NA 3F9HA 1C2JA 2AMQA 2BZ6H 5JBAS 3MU8A 3UIRA 3A8DA 3ZVGA 1FQ3A 1C1RA 4Y71A 1P03A 1SQOA 1SGTA 3ZVAA 2JETC 1DY8A 1DT2A 2GCTB 4UFEH 1QBNA 1H9LB 2R0LA 3CS7A 4GCHF 3SZNA 4FU8A 5EU8A 4ASHA 1TPPA 4NWKA 1YCPK 1PQ7A 3BIVH 5DPAA 1KY9A 4K8BA 1G3EA 1H4WA 2ZKSA 3RXVA 3ATLA 3MH6A 1GBTA 1TGSZ 3ATWA 3HK3B 4BAOB 2BY6X 1TONA 2D2DA 4ISLA 4JZ1A 4UEHH 3VXFH 4X1PU 4X2WA 4B1TA 4ZUHA 1O5AB 1GBEA 2XW9A 1BB0B 4LOYH 1P11E 2AEIH 1LHFH 3RXHA 2A5AA 2VWOA 1RRKA 5JDUB 5DP4A 1A2CH 4THNH 3NZIA 5CHAC 3O8CA 3P6ZB 3O8RA 2CXVA 1OYTH 4GHTA 4ZHAA 5DP8A 1GJ7B 1O5FH 3LH1A 5DP6A 5IYTA 5JBCS 3M5NA 1TGNA 3VFEA 1DS2E 1MD8A 4Q80A 2ZDNA 1PQ8A 5FBIA 8ESTE 4RI0A 2FTLE 1TPSA 1J16A 3V12A 1EX3A 1O3FA 1TNJA 4A7IB 3DD2H 1A0LA 1O2VA 1O3LA 3H7OA 3R0FA 4IS5A 3NK8A 3ZZ9A 1MKWK 1DFPA 1C2IA 3TVJB 2ALVA 2ZIQH 1C5RA 1P2MA 2FOAA 1IQFA 3MNSA 1TPOA 4CRDA 7GCHG 3RMNH 1AVWA 1LVBA 4JYTA 3RXPA 4DJZB 2ZHWH 5FPTA 4E7RG 2BD9A 4OGYA 1FUJA 1FY1A 3GCHB 1NRRH 1F7ZA 1C2EA 4ZMAH 1EZUC 1K2I1 3GY7A 1TIOA 1C1OA 2Z94A 1P02A 1UTJA 2A4RA 3U8OH 3NPSA 1W11U 2FOEA 2B7DH 1EPTC 3UOPA 4ABAA 3JZ2B 1K28D 2CGAA 5T6GA 2A1DB 2ANWA 1JXPA 3ZVEA 3RXJA 1MMJN 1O2HA 1OWDA 1HRTH 1CT0E 3GCTG 4DGJA 1KXDA 5C3NA 1BTHH 1FY5A 1SSXA 2PW8H 4B71A 1HAOH 1ESBA 4AFQA 1Y5BT 1QR3E 2O8MA 5FHTA 4AZ2B 1FPHH 4K1EA 1GJ6A 1S85A 2A7CA 3UNQA 2PSXA 3PV2A 2UUFB 3PMHB 2G8TA 4CR9A 1GHYH 2I6QA 2XC0A 1L1NA 2XXLA 1FV9A 1O3BA 1O2YA 1D6WA 1H9HE 1UTNA 2FDAA 3K6YA 2PUXB 3RXUA 2FM2A 1TX6A 3LJJA 5J4QA 2FMJA 2NU1E 2J4IA 2XC4A 1JWTA 1Y59T 1ESAA 3L6PA 1UTQA 2H9HA 1RTFB 2QY0B 2VWNA 2ZA5A 3Q77A 4FUIA 2ZDMA 5F8TA 1RD3B 2VIQA 2Z9JA 3AW0A 2FX6A 1K1MA 1P0SH 2Q6GA 5GNDA 1ZTKA 2IOTA 5IDKA 1GHAG 1P2KA 5E2OA 1TNGA 4X1SU 2Q1JA 2B0FA 1ZSKA 2NU3E 4YOIA 3LH3A 1EUFA 2FX4A 4BXWA 1BTZA 4ZAEA 1OWHA 4XE4A 1G9IE 4KKDA 2XBVA 3M3VA 3BG8A 3N7OA 4XOJA 3RXKA 2QXHA 3A86A 5G4BA 1FXYA 1GCTB 1TQ0B 2PTNA 1SBWA 1ZHMA 1DM4B 1RGQA 1L4DA 2ZFSA 4B2AA 1W7XH 3TLOA 2GTBA 4K1TA 2Z3EA 1YPKH 3EGKH 4A1VA 2FLBH 2QGRA 2VWLA 7ESTE 3MHWU 4BTIB 2WYJA 2FOCA 3A8AA 1QB9A 1EKBB 1YPMH 5EXMA 1F0RA 2ZU4A 3PB1E 1PPZA 2AGEX 3ZYDA 4NIXA 1VJAU 2QXGA 5LPFA 5JYIA 1T8OA 5BPEA 1NESE 3RXQA 2WUBA 3MU0A 3HPTB 1PYTC 1O36A 3Q00A 2NU0E 3ATKA 5K7RA 4B2CA 1KXCA 1LPZB 4Y0ZE 1O34A 2EC9H 4YM9A 3AAUA 3S69A 2STAE 1C4U2 1C4V2 2BX3A 1C2KA 1ZZZA 3RU4T 5L2ZH 1QJ1B 3SI4H 1G2MA 1IQEA 3MFJA 1O2ZA 1P2QA 1C1MA 1ESTA 1SGEE 4K3JA 1QY6A 2ZTXA 1C2LA 4INLA 2GVFA 3LC3A 3BTQE 1UVOA 1TABE 1OWKA 3S9AA 2B5TB 2BVXH 1MCVA 1HAHH 2A7JA 1QL8A 2CN0H 4K60A 5DO4H 1GCTC 1UTPA 5A8XA 2ESTE 3SUEA 4D76A 1CGHA 4BAQB 3LU9B 3LJOA 3MNBA 5EQRA 1LCYA 3U1JB 2WPHS 2F4LA 5FAHA 4RKOB 2G51A 4ABFA 1O3HA 2ZGJA 2O8WA 1DITH 1O35A 2ZU1A 1A5IA 1HV7A 3D65E 1BTPA 2FP7B 2ULLA 1TYNA 3L33A 1F92A 1UCYK 1QA7A 5AFZH 1SVPA 2BQ7B 1UTKA 4JK5A 2FYRA 4YZUA 2XBYA 1DWDH 2H2ZA 3KQDA 1MZAA 1IQGA 2WV4A 1HFDA 6GCHG 4X1QU 1MH0A 5L30H 1Y8TA 5A2MH 3R3GB 4X6OA 1F2SE 1JRSA 1BTXA 4OS1A 1BUIA 3RMMH 4AGJA 4Y10E 1FZZA 5T1VA 1TGTA 1AUTC 4CREA 1Z8JB 4GVUA 5EQSA 3RC4A 3SJ9A 4U01A 4MPXA 1C1PA 2WUCA 2J38A 1MAYA 2BDCA 2CV3A 1EQ9A 1G30B 3KNXA 2ZPRA 1V2NT 1IHSH 3SI3H 1SHYA 1HXFH 3KIDU 4TPYA 1EAXA 1O2PA 3RU4E 5DG6A 2A5IA 1SFIA 4NZLA 4Z0KA 1BRAA 1QRWA 4AG1A 2G4UA 2ZFQH 2GV7A 2GZ9A 1O2MA 1ZMJA 1ZMLA 3ESTA 1LHDH 1YPHE 2FIRH 1TPAE 3OY5U 5JBBS 5B6OA 3BEFB 3T2NA 1THPB 3QZRA 3MMGA 9ESTA 3DA9B 3BN9A 3F9GA 1QA0A 2VGCB 1OP2A 3G01A 4I8LA 1O2NA 2GP9B 4CH8B 2QV1A 8KME2 2BDAA 1YBWA 1UVUH 1FPCH 4I33A 1BTYA 1QBVH 1O3EA 4NSVA 4PROA 1OWEA 1HAXB 3PWCA 2TIOA 3SNBA 4NWLA 4ZKOU 1KYNA 1ZPZA 1XXFA 1SQAA 1TRMA 1FN6A 4IMQA 2J92A 1GI1A 8GCHF 4DCDA 1MKXK 1ANCA 1DUAA 3D49H 2F9VA 2BB4A 3VGCC 1C2FA 1G3BA 1O2QA 2GMTB 2ZQ1A 2O8UA 2ZHQH 1NRNH 3SZEA 1K1JA 2B9LA 3TH2H 5C5OA 1OS8A 2BD7A 2ZTYA 1CT4E 1MZDA 3SW2B 4BANB 2OINA 1S6HA 3BG4B 1J17T 2Y6TA 1SGFA 2G5NA 4YO9A 1TRYA 3QX5H 1CHOF 2ZGXH 1AVXA 3GDSA 3CENA 1MD7A 3MO6A 4CRAA 1P9UA 1SLVB 1QBOA 2GCHF 3STIA 1HLTH 3SJIA 4X8VH 5F8ZA 2AIQA 3K6ZA 1C1NA 1BBRK 2HPPH 1MUEB 2PKAB 3P8GA 1DANH 5EXNA 1GVZA 1SGPE 3FZZA 3PO1B 1LQDB 2V6NA 2P3UB 3RDZA 7KMEH 2HRVA 3ZZ8A 4NIYA 1H8IH 2RA3A 3LDXH 3SN8A 2FESH 2JH6D 1V2TT 1KTSB 1D3PB 1ZTJA 3QWCH 4MPUA 2BY8X 1YPJH 5EODA 1PPFE 2BZAA 4MVNA 2Z3DA 1VGCB 4M9FA 3MI4A 3UR9A 1CBWB 1ARBA 1D3TB 1C2MA 2VINA 3QN7A 1LO6A 1GI0A 1K9OE 2H5DA 4XDEA 2VIOA 4OS2A 3T26A 4FUEA 1EP5A 5TCCA 2C93B 1OXGA 2Z6BD 3A84A 1RS0A 1T32A 1O3IA 5T3HA 2ZZUH 2GX4A 1ZRKA 5HM9A 1AKSB 1UK2A 4ISNA 5A0AE 2H9TH 1QRZA 1SQTA 2ZHFH 1K21H 1ARCA 4KTCA 4X2XA 1UHBA 3RC6A 2BX4A 1BOQA 3LGIA 2ZPSA 3OX7U 1FDPA 3RLYH 3U98H 1FY4A 3U8RH 3MH5A 2BDHA 1EZSC 1Z8IB 1QNJA 4O3TA 2OQ5A 3TK5A 1ACBE 4JYUH 4CHAB 1GHWH 4HFPB 3A7VA 1KDQB 1WU1A 2STBE 3C27B 3KQEA 3ITIA 1C9PA 1VITF 1O3DA 3BV9B 4I8JA 5EQQA 2G5VA 2P16A 1XKBC 3QGJA 3PMBB 2A4QA 3TK6A 1C1QA 4SGAE 2CHAB 1F0SA 3RXMA 4WXVA 3GY8A 2VU8E 4KP0A 2LNCA 4YT7H 2BOKA 1FMGA 1DWBH 3CP7A 1XUKA 1C2HA 5T6FA 3SNAA 1LQEA 4AGKA 5JB9S 2C4FH 1MU6B 5HMAA 1NO9H 3MH7A 2C8ZB 2OC8A 4JMYA 1HGTH 2OC1A 3F9FA 1O5GH 4F4OC 1L1GA 3AVZA 1T8NA 5LGOA 2PKSB 1S84A 1BMAA 1G3DA 1Z8RA 5DKMA 2WPJS 1AO5A 1KSNA 1W12U 4WH8A 1PPHE 1EXFA 3GYLB 2ZFFH 4XBDA 1E35B 1IQLA 5LH8A 1C5ZB 3NXPA 3UTUH 4WXIA 3FANA 1HCGA 3UY9A 5I25A 2QF0A 2J34A 2BD8A 1KLIH 1V3XA 2BY7X 1SGRE 1C5UA 1K1LA 4IMZA 4D9RA 2P3FH 3NKKA 4I7YH 3BTHE 4E7NA 3KCGH 1WSSH 2XBWA 3E16B 4AYVB 3UFAA 1ELFA 2WINI 1WTGH 1XVMA 2RA0A 1UJ1A 1Z6JH 1EOLA 5DP5A 1O38A 1ELDE 6CHAC 3E90B 1XMNB 4VGCB 2EI6A 2UWPA 3EE0B 3K2UA 4X1RU 2BDBA 2J94A 5AFYH 4MNXA 3KGPA 1TWXB 1N8OB 3GY6A 4I8HA 3BEUA 1SGNE 4AYYB 4BOHA 3RXFA 1FAXA 2QC2A 2A31A 1QTFA 3BIUH 1HJAB 1QFKH 4K69A 5C20A 4ZHMU 1VR1H 3I29A 1GBCA 5LPEA 3A82A 1Y3XA 1BTWA 1V2WT 3SHAH 2F3CE 1OWIA 5A09A 4HGCA 3SQHE 1PQ5A 4DG4A 3QTVH 4NG9H 1OP8A 2UUKB 3RXLA 2A4OA 2ZU5A 1KXBA 1IQJA 4NGAH 4AFUA 4Y76A 1HXEH 1Z1IA 1NRPH 5GCHG 2R9PA 4UONA 4MNVA 5C5NA 1IOEA 4E05H 5ABWA 1LMWB 2A45B 3GCOA 5HXFA 3KEEA 3LONA 2Y82A 2ZDAH 3AK5A 3Q3XA 2FI3E 4KTSA 1YPEH 1S81A 1S6FA 3T5FH 3PTNA 4A1XA 2J2UA 5FCRA 2W7UA 1DDJA 2GCTC 2TGAA 1GHZA 1V2JT 1NTPA 3AAVA 1GPZA 1QL7A 1AUJA 4GLYA 4Y7AA 1H1BA 1Z8GA 3URDA 1O2JA 1DWEH 2R2WU 1HJAC 1QJ7B 3DFLA 4INHA 3RC5A 1O2RA 4H6TA 3RXIA 2FO9A 1XVOA 1Z71A 3Q3YA 2V3HH 1NRQH 2PGQB 3FVFB 3LGTA 1JOUB 1C5MD 1CHGA 2Y5FA 2VNTA 1HDTH 1GMDF 5HYOA 1FIZA 1EAIA 1WXRA 1BMNH 1P2NA 1TFXA 1GJAB 2C8XB 3M3SA 2BQ6B 1QHRB 3GDUA 2M5TA 3PV4A 3GOVB 3GY3A 5FBEA 4XBCA 1YC0A 3SYJA 1TBZH 2DE8A 4J1YA 4OGXA 1G37A 1LHEH 1S5SA 4B75A 2PKAA 2AERH 2C8WB 2A0QB 3T62A 3QTOH 1V2MT 4H4FA 2BLQA 3A83A 1GMHG 4ZKSU 4I32A 3T28A 1C5SA 1O5EH 3BTFE 5TJXA 1A5GH 3M7UA 1UTOA 1A7SA 1S0QA 1AD8H 1GJCB 1HIAA 4LZ1H 1O2LA 2HALA 3F1SB 5EG4A 1EAWA 3ZV9A 4ISHH 1V2KT 1DE7H 2F9BH 1AWHB 1W2KH 1K1IA 3MH4A 2Z9LA 2BD3A 3VEQB 3GY5A 3A81A 4CR5A 2ZHEH 3BTGE 3ZVFA 1AIXH 1SOZA 4DVAU 1SLWB 2AS9A 1GHBG 2P8OB 4DW2U 5K0HA 1EATA 1EJMA 1AWFH 1FJSA 3GCHC 4NFFA 5SGAE 3BTDE 3LGUA 2SNWA 2Y5HA 1SGFG 4NFEA 5E2PA 2OBOA 1CU1A 2ZTZA 1ELEE 1AKSA 1TX7A 1AE8H 3S9CA 4JZDH 2HNTC 4D7FA 3NUMA 4WVPE 3ODDA 3PTBA 2ZC9H 3STJA 1SFQB 4XBBA 3OU0A 1UCYE 3QLPH 5I46H 2WZQA 1LDTT 3SNEA 1GCDA 5EOKA 2F83A 1GBKA 1BJUA 2V35A 2GV6A 1WAYB 2QA9E 1T4UH 4YOJA 1O33A 1G2LA 2ZFTA
chains in the Genus database with same CATH superfamily
5C0UA 2Y81A 4RKJB 1JRTA 1GWAA 4P02A 3HKJB 3NRLA 4TYDA 1K1OA 4UFFH 2ANMH 1UHBB 3SUGA 4FU9A 3PYHA 1KDQA 1TALA 2ODQA 1K0HA 2F9UA 3MU4A 1C1SA 5F03A 2NU4E 1Q2WA 3KN2A 3PM3A 5DP3A 4ESTE 1C5PA 1C5OH 2BD4A 3M5OA 1O0DH 2HLCA 3FZDA 2R3YA 1BMFD 3F0PA 2PHBA 3P95A 5JB8S 2KFWA 3EE7A 1CA8B 2BMGB 1GI4A 3H7TA 3UWIA 3A7XA 1SGYE 3RXDA 4IN1A 2FXRA 1Y3VA 2BDYA 3SV8A 5BRRE 5FCKA 1P8VC 2OK5A 1GI3A 2BD2A 2BXTH 2PLXA 1V2RT 1P3CA 5EW2H 3MWIU 3TJNA 1ETRH 3SGAE 3UPEA 4MG3A 4CBNA 1BT7A 1GBAA 2UUYA 3MNXA 2PWXA 1E1RD 3HKIB 2FOGA 3KF2A 5DJ7A 2JIZD 2GD4B 2GKVE 3QK1A 3DT0H 1NN6A 1WDIA 1YF4A 4QT8C 4D7GA 5F6MA 1T31A 2QXIA 3TGKE 4BAMB 1EJAA 1CT2E 4Y8XA 1KMHB 1GVKB 2D26C 1EOJA 1MCTA 3FKSD 2XC5A 4ISOA 2OD3B 2TPIZ 5FL7D 2Z7FE 1D4PB 1UVTH 2Q6FA 3A8CA 3VG8A 2JDID 3RXAA 1AFQB 2ZDKA 3OTPA 1A1RA 1GI8B 2Z3CA 5AF9H 1F0TA 3E3TA 1SI5H 5DN6D 1UK3A 4CRCA 4ZH8A 3V3MA 2FODA 4B6FA 4B74A 1H9IE 1O3JA 1XUHA 4GCHG 3OSYA 1NFWA 3TITA 1BMLA 3FP7E 4ZKNU 1O5CB 3VB5A 2NWNA 2BDGA 3BTKE 1E37B 1O3CA 1GBHA 2J98A 3GICB 4MDSA 3RLWH 4CRFA 3PLBA 1GDQA 1ZPCA 4X8TH 2W5EA 2VB0A 2CMYA 2RFKC 4ZROA 3SNDA 2G4TA 1IHTH 2AGIX 3NWUA 5EW1H 2ZGBH 1GDUA 1YPLH 2VVVA 1P04A 1GI9B 5ESTE 1GL1A 1TNIA 3SU3A 3LIWA 1ZJDA 4A92A 4D9QA 1V2QT 3HK6B 3TIUA 1GJDB 4Z1MD 1QJ6B 5IK2D 1BZXE 3W94A 1SL3A 2ZCHP 5DP7A 2YMSC 5FXLA 3MTYA 1BBRE 1IQKA 3P17H 2YNAA 1F5LA 5C1XA 1DY9A 4A6LA 4E06H 3TPIZ 2JH5D 2GZ8A 3H09A 3VB3A 4LK4A 2FS8A 3B9FH 4X8SH 1WYKA 2TGDA 2VVCA 3EA8A 1AFQC 1BHXF 1TA6A 4J2YB 4UDWH 1AU8A 1UO6A 4RN6A 4Y7BA 3UR6A 1W0ZU 4FETA 4AORA 4JZFH 2BY5X 1DPOA 1INCA 3EYDA 2W3KA 1NFYA 2EI7A 3PMJA 3PWBA 3GY4A 3LT3A 1ZGVA 3Q3KA 4XSKU 1OP0A 3Q76A 1XUGA 2L6OA 4FUHA 4WJG2 3EAJA 2AYWA 1HAGE 3EA9A 1O31A 1C5VA 4MPWA 3SUDA 1NC6A 3K65B 4Y11E 1QQUA 2FWWA 1UVPA 4IBLH 5L2YH 1AMHA 1UTMA 1D3DB 4U32A 3ODFA 5DP9A 5F8XA 2IPHA 1E34B 1QB1A 3BTEE 1O30A 4O9VA 1MTNB 4O3UA 5FPYA 4DY7B 1MTUA 1JBUH 2CF9H 2PUQH 3E91A 1TAWA 4ABHA 4BTTB 1MTWA 2WV5A 4B6EA 1TNHA 2SGFE 4AN7A 4TPIZ 4YT6H 3P8FA 2YOLA 2FZZA 3KQBA 2GT7A 3L3TA 4RSPA 1EP6A 3VXEH 2KM0A 1TQ7B 2A5KA 3LGWA 1HPGA 7GCHF 2IN2A 3DHKH 2CK3D 3TK9A 4FVDA 3RXBA 5FPSA 1ZYOA 1GBLA 1WV7H 1GGDB 2WYGA 3SGQE 3E0NB 1T8LA 1DSUA 2BVRH 3LGYA 1O2GH 1HAPH 1AI8H 1RJXB 1D3QB 1LPGB 1ANEA 2FYQA 1E0FD 2VIPA 1QQ4A 4YLQH 4DOQA 1PQAA 2XWBI 4YESB 1D6RA 2DE9A 4ABEA 2PSYA 3P70B 1V2UT 1SGQE 3LPRA 2Y7XA 3U9AH 1MU8B 1ETTH 1GJ4H 2ZU2A 4NA7A 3ZZBA 4Q63A 1HIAB 1SOTA 2VGCC 2SNVA 1RFNA 1TNLA 2KCAA 4UD9H 3GCTF 4NA9H 3N99A 1PFXC 1Y3UA 6ESTA 4NSYA 1S6LA 3RM0H 2R0KA 3V13A 3P92A 1C1TA 2BLVA 1C4Y2 3SU0A 4A5TS 2GJGA 1BIOA 3SGBE 1YCPH 4AFZA 1CO7E 1CA0B 5H4IB 1DOJA 1RTKA 2EEKA 3LOXA 3PROA 1GJBB 1P2IA 2GMTC 4ABBA 2DUCA 2ALPA 1YLDA 4DURA 3M61U 1GI6A 2R2MB 2P94A 4JZEH 3T27A 1FONA 5A0BA 4X2YA 2HNTF 4WF8A 3U8TH 1S0RA 1PPBH 3BG4C 3BTWE 1OHHD 1XX9A 4Y6DA 1L0ZA 3U69H 2HWLB 1N1LA 2XTTB 4XFQA 3E8LA 2EI8A 4CBOA 3QDZB 1TRNA 2TRMA 4IGDA 1IQNA 1OWJA 3U1IB 1UW7A 3SU1A 1AGJA 1W0JD 3RXEA 1Y3YA 1C1UH 1GHAF 3SJKA 1DUEA 5GIBA 3DSGA 2C3SA 1Y5UT 3A87A 2AMDA 4AX9H 3FP6E 1EASA 2C90B 4A1TA 2WPKS 2FOMB 2F9NA 1XM1A 3PO1C 3SU5A 3F6UH 1WOFA 2JJ1D 1A3BH 1TB6H 3LC5A 1EZQA 1BA8B 2RDEA 1YP9A 2AIPA 2QF3A 4SGBE 1GL0E 1L1JA 2FS9A 2ZDVH 4B73A 3RXGA 1GI2A 1HAZB 1VGCC 5EJZA 1MKWH 1CBWC 1KXAA 3VB4A 1O37A 2C8YB 3AASA 1S82A 1DXPA 1K22H 4UFDH 4NA8A 1ELGA 1OPHB 4MQAA 4WH6A 3ELAH 1G3CA 1BMMH 4JK6A 2ZP0H 6LPRA 1N6XA 3IG6B 1ELVA 1ANDA 2O8TA 4FUBA 4U30A 3VPKA 3W95A 3GCNA 1SG8B 4WMDA 1FI8A 2ZPQA 2VIWA 3SV6A 3HGNA 2J95A 3MO3A 4AB8A 2W3IA 1WQSA 4TY7A 2LP6A 5PTPA 1IAUA 1NM6A 1THRH 1KTTB 3RU4D 5CHBA 1ORFA 1AFEH 3A7YA 1PPCE 1B5GH 1NFXA 3WWFA 1MBMA 3LKWA 4CRGA 2UWOA 4KTUA 3RXRA 1FNIA 4DT7B 1TNKA 3DUXH 2B8OH 2FEQH 1J14A 5HM2A 3BF6H 3MO9A 2AMPA 3I77A 1C5XB 1AE5A 4K5ZA 4BNRA 5A0CA 1V2OT 2OQUA 3ATIA 2QAAA 4CHAC 5AVDA 1P10A 3M7TA 3TJUA 1UMAH 1G32B 1SGCA 1ZTLA 3M7QA 2THFB 4AFSA 1V6DA 2PGBB 1MTVA 2W7SA 1NS3A 3TNSA 2J98B 4JZIA 1GI5A 2ZG0H 3S7HB 4RT0A 2ODPA 2HVXA 2CHAC 3MOCA 3ZVDA 1P09A 1E79D 8LPRA 4F48B 3SU6A 4IC5A 1C1VH 3O8BA 2WV9A 4WMFA 4OM9A 5C1YA 1O39A 3RM2H 2ZQ2A 4KGAA 1B0FA 3DFJA 3GDVA 3CS0A 4X6PA 3ZZDA 2OXSA 1ELTA 1AQ7A 2G00A 3M36A 3SV9A 1C2DA 2PKSC 4AB9A 2FPZA 4H42U 4FUFA 5EGMA 1GI7B 1CVWH 3QO6A 1Q3XA 3OEED 1EFRD 1P2JA 3FO8D 1BRCE 3M37A 1HYLA 2QN5T 1FLEE 3BEIB 4TWYA 5A8YA 1AHTH 1O2XA 3PV5A 1FY8E 1CGJE 6GCHF 3UWJH 4HG6A 1SMFE 2FTMA 1EPTB 1THSH 1SC8U 3ZZ4A 3QGNB 4D8NA 4ABJA 1DSTA 1A3EH 2O8LA 3MU5A 3RMOH 3DSOA 2QF5A 5GJ4B 2PTCE 3TU7H 1FIWA 1Y3WA 4FU7A 1P3EA 3RXOA 2FLRH 2F9OA 3QZQA 4VGCC 3GY2A 2BLOA 2ZFRH 3FP8E 1VCWA 2LPRA 2JH0D 1C9TA 3A7ZA 5C2ZA 4B76A 1ETSH 1ABJH 8GCHG 1N8OC 3P8OA 3F2HA 2ZWLH 1HAIH 1HNEE 1ZRBA 2Y7ZA 3C1KA 2VJ1A 5EXLA 1O3KA 1SB1H 4I8GA 1V2LT 1KLJH 3S0NA 3TGJE 5LPRA 2D1JA 4UE7H 2SGPE 1OX1A 2ZGCA 1TOMH 1NT1A 4TWWA 1J9CH 4X6MA 1EAUA 1SHHB 1DXWA 1C2GA 1NRSH 1Y5AT 1T7CA 2P95A 1J15A 4AOQA 1LPKB 1CHOG 1COWD 3VB7A 4CRBA 4MNWA 5TCAA 4ABDA 1W0YH 1JIMA 1TOCB 2FI4E 2YNBA 2GCHG 2OLGA 1QB6A 2Y80A 1T4VH 3OY6U 1WUNH 3E1XB 1KIGH 3EQ0H 1NU9A 2CF8H 2ZEBA 1LVOA 2VIVA 1WQVH 2OTVA 1KLTA 2HOBA 4OS6A 5ESBA 1OOKB 3KQCA 4R0IA 1HUTH 2FI5E 1ZSLA 4K2YA 1F0UA 2HNTE 2GDDA 3ZVBA 2KCYA 2BLWA 2GT8A 1MBQA 1VITH 1AN1E 1BDAA 1A5HA 2FOFA 3SV2H 5L6NH 1QL9A 2RCEA 5KEDA 1K1PA 1GBIA 1ELBA 2ZFPH 4BTUB 1LKAA 3LGVA 1XUIA 1TX8A 3ZVCA 3PLKA 4FUGA 1SPJA 4FUJA 3ZZ6A 4IC6A 4WWYA 4CH2B 1ELAA 2JJ2D 2QCYA 3F68H 1GBBA 1O32A 3OTJE 3OYPA 3TGIE 3D62A 2TBSA 3RXSA 1UCYH 1O3MA 3BSQA 5A8ZA 1N6YA 3FOAA 5JBTA 4YLUA 1EZXC 2G55A 5J4SA 1ZSJA 4FXGH 4DIIH 2H5CA 3A80A 5AHGH 5DGJA 1B0EA 2ANYA 3FAOA 3BTTE 1O3AA 1KXEA 1P57B 3ZZ3A 4OS4A 2P3TB 3M5LA 5EPNA 1SGIB 2ILNA 3V0XA 1UK4A 5CMXH 1ZOMA 4H6SB 3OAAD 1PPEE 4GSOA 3D23A 1O2KA 2BDIA 4IW4E 1NZQH 1VITG 1WCZA 1YPGH 2KAIA 5JPMH 1ZPBA 3V7TA 2M2AA 1O3GA 1SLUB 1LVYA 1CE5A 1DWCH 3SUFA 4MLFB 2BY9X 1UTLM 1W7GH 3M35A 2OCVB 1YCPM 1L2EA 1XUJA 3S7KB 2IJD1 3BTME 2SGDE 1GG6B 4TY6A 4OS5A 1MTSA 1VCQA 1BRUP 2ZNKH 1OKXA 1Q31A 3KHVA 3SOSA 4M7GA 1GMCG 3A85A 5E0HA 1HAVA 2PR3A 1P01A 2Z9GA 4ISIH 5EPYA 2IJOB 2P8OC 2PV9B 3IWMA 1K1NA 5DSFA 2KZ4A 1P9SA 1AB9B 4Y0YE 3UUZA 4Y79A 1BRBE 1O2TA 1E36B 3UNSA 1GHVH 2VH0A 2SGEE 1Z1JA 3SBKA 5GXPA 5HGGA 1MKXH 3PLPA 2I6SA 3ATMA 2OC0A 4R8TB 1Z7KA 1HBTH 4DIHH 2ZDLA 1AZ8A 1O2IA 3A88A 3SU4A 1QCPA 4X1NU 1P12E 4Q2KA 1XUFA 1TGBA 3TH3H 1MQ5A 5E0GA 4Z6AH 1YYY1 1EJNA 2BXUH 2BOHB 1GBFA 3B8JA 4Q7YA 1NBMD 2SGAA 2UUJB 5ETXA 1TMBH 1XKAC 4I31A 1P2OA 4K1SA 2H9EH 3SV7A 3JZ1B 4LZ4B 1A61H 1GG6C 1O2SA 4HTCH 3RUOA 2ZO3H 3SJ8A 3SU2A 2VBCA 1A46H 1BBRH 1QIXB 3A7TA 3PMAB 4FUDA 4WMEA 2ZGHA 1DX5M 1LHGH 3F2GA 4BAKB 4MPVA 3UQVA 5E0JA 2SFAA 3SNCA 1GJ5H 3I78A 2O9QA 4I8KA 1O2OA 1NFUA 3GS9A 1CQQA 3F9EA 3WY8A 2ZF0H 1NU7B 2J9NA 1LVMA 2PFEA 1QRXA 4X2VA 2VH6A 1RIWB 2W6JD 4WY3A 3ZZAA 4TT3D 3NCLA 4GUXA 2WPIS 1GVLA 5GDSH 1TBQH 5HKKD 1AB9C 4GPGA 4P00A 1V2ST 3GISB 1DLEA 1LHCH 1EPTA 1VCPA 3FFGA 2WHXA 1PPGE 1C1WH 3VGCB 1ZHPA 2TGTA 4Q7ZA 2GGVB 3M5MA 1TMUH 2Y5GA 1CGIE 1BTUA 1J8AA 1EB1H 1SLXB 1W3CA 2AH4X 3HGPA 3T25A 1RXPA 3B23B 4UFGH 1LTOA 1ELCA 2XCFA 4K8YA 2BHGA 1BITA 1O3PB 1MAXA 3RXTA 4ZXXH 2K8IA 4AG2A 1C5NH 4FOUC 2OBQA 1B7XB 2EA3A 3UREA 4YTAA 1A0HB 1IQIA 1F5RA 1GBMA 5GCHF 2XRCA 1GMDG 2ZCLP 1DVAH 2XYAA 1ID5H 1TBRH 1NPMA 1PYTD 1YM0A 2V3MA 4KELA 1T8MA 2VIDA 1RIWC 4MTBA 5C1UA 1O2WA 4ZCNA 1QGFA 1NROH 4Y8ZA 4YOGA 1ZLRA 4IN2A 1FY3A 4GHQA 1TE0A 2H6MA 3SQEE 2F91A 2IPQX 5E8EH 3ENSB 1ZMNA 4HI3A 3ZV8A 1RTLA 2QYIA 2W6ID 4F49A 5EJ1A 2K1QA 3MNCA 2GZ7A 4XD7D 1WBGB 1XXDA 2F9PA 2XBXA 5FX6A 2RDLA 1C5YB 1S83A 1FN8A 1YPHC 1GJ9B 2ZECA 3MYWA 2W26A 1O5DH 2HGTH 1QURH 3KL6A 1BCUH 2Z9KA 1DICA 1A0JA 1JMOH 1HAYB 1O3OA 9LPRA 4INKA 2A32A 3SORA 4NIWA 3VB6A 1L4ZA 2OUAA 3CNRA 1A4WH 1BQYA 3RP2A 2A7HA 2ZI2H 4FUCA 4X8UH 1F5KU 1EB2A 2HPQH 4ZXYH 5DK1A 4U2WA 3IITA 1TGCA 4ZKRU 2D8WA 1X7AC 4LXBH 2TGPZ 1MTNC 1ZHRA 1GMHF 2FOBA 1GDNA 2P59A 1SGDE 3A8BA 2V0BA 3RXCA 4BXSA 1YKTA 3ZZ5A 1GHXH 1NY22 1W8BH 4O97A 1GJ8B 2R3UA 5FX5A 5GWZA 3URCA 1AVGH 1G36A 3P8NA 1U6QA 3QUMP 3T29A 1VZQH 2AHME 2BYAX 1W14U 2XNIA 1MQ6A 1C5LH 1BJVA 1HJ9A 2ZU3A 3KYFA 2JKHA 2ZCKP 2QXJA 3A7WA 3TH4H 5C67A 1GGDC 1UVSH 3EA7A 1P06A 1C5TA 2H1UA 1ANBA 1YLNA 1Z6EA 2OP9A 3E6PH 1GHBF 3GYMA 1ZGIA 2OC7A 5CE1A 5B6LA 3M3TA 2AFQB 2BTCE 2BD5A 3K9XB 4NIVA 3O8DA 2KAIB 2BQWB 2XWAA 4HZHA 4Y8YA 2VWMA 1E38B 3UQOA 2HLDD 2A2XH 1YLCA 3EDXB 1SKYE 2ASUB 2RG3A 2HVYB 4X6NA 2ODYB 1IQHA 3UOUA 1DLKB 3AW1A 1V2VT 3SJOA 1TMTH 3ZZ7A 1SR5C 7LPRA 4TSFD 2QIQA 3TJVA 1ZR0A 2KR7A 2JETB 6CHAB 2A4GA 3H5CB 1KXFA 4GAWA 2WPLS 4OS7A 1HJ8A 3MU1A 5T6DA 1HAVB 1TA2A 3SO3A 2Z9IA 4X0WU 1TLDA 1M9UA 2G52A 2NU2E 4ABIA 2ZHDA 3RMLH 1OYQA 3TJOA 1CSOE 2FOHA 1CA0C 1FX0B 1W13U 2ANKH 2SGQE 2V3OH 3E0PB 2G81E 4NCYA 3ZYEA 2QF4A 4MNYA 1ZJKA 2Q6DA 4O03A 4Q7XA 1GBJA 5GPIB 4ABGA 1H8DH 1IQMA 2CJIA 4JYVH 2BVSH 3S9BA 3HATH 1O2UA 2A2QH 4NZQA 3SHCH 1QZ8A 3ZZCA 1GMCF 2AGGX 2WPMS 5HIYA 1C5QA 4JCNA 3TNTA 1GBDA 1V2PT 2BM2A 2P93A 1WTHD 1P05A 4FVBA 3UNRA 1AY6H 3A89A 1YGCH 5CHAB 1C5WB 1BHXB 1D9IA 1VJ9U 1FAKH 2QE7D 1HB0B 4ZHLU 1PJPA 2VVUA 1LKBA 1W10U 1AZZA 2UWLA 4B2BA 2GDEH 4BAHB 1JIRA 5C0TA 1O5BB 1ABIH 1OSSA 2XCNA 1O3NA 3F9HA 1C2JA 2AMQA 2BZ6H 5JBAS 2WSSD 3MU8A 3UIRA 3A8DA 3ZVGA 1FQ3A 1C1RA 4Y71A 1P03A 1SQOA 1SGTA 3ZVAA 2JETC 1DY8A 1DT2A 2GCTB 4UFEH 1QBNA 1H9LB 2R0LA 3CS7A 4GCHF 3SZNA 4FU8A 5EU8A 4ASHA 1TPPA 4NWKA 1YCPK 1PQ7A 3BIVH 5DPAA 1KY9A 4K8BA 1G3EA 1H4WA 2ZKSA 3RXVA 3ATLA 3MH6A 1E1QD 1GBTA 1TGSZ 3ATWA 3HK3B 4BAOB 2BY6X 1TONA 2D2DA 4ISLA 4Q4LA 4JZ1A 4UEHH 3VXFH 4X1PU 4X2WA 4B1TA 2XOKD 4ZUHA 1O5AB 1GBEA 2XW9A 3WW7A 1BB0B 4LOYH 1P11E 2AEIH 1LHFH 3RXHA 2A5AA 2VWOA 1RRKA 5JDUB 5DP4A 1A2CH 4THNH 3NZIA 5CHAC 3O8CA 3P6ZB 3O8RA 2CXVA 1OYTH 4GHTA 4ZHAA 5DP8A 1GJ7B 1O5FH 3LH1A 5DP6A 5IYTA 5JBCS 3M5NA 1TGNA 3VFEA 1DS2E 1MD8A 4Q80A 2ZDNA 3DCLA 1PQ8A 5FBIA 8ESTE 4RI0A 2FTLE 1TPSA 1J16A 3V12A 1EX3A 1O3FA 1TNJA 4A7IB 3DD2H 1YY3A 1A0LA 1O2VA 1O3LA 3H7OA 3R0FA 4IS5A 3NK8A 3ZZ9A 1MKWK 1DFPA 1C2IA 3TVJB 2ALVA 2ZIQH 1C5RA 1P2MA 3PRBA 2FOAA 1IQFA 3MNSA 1TPOA 4CRDA 7GCHG 3RMNH 1AVWA 1LVBA 4JYTA 3RXPA 4DJZB 2EY4C 2ZHWH 5FPTA 4E7RG 2BD9A 4OGYA 1FUJA 4ACAA 1FY1A 3GCHB 1NRRH 1F7ZA 1C2EA 4ZMAH 1EZUC 1K2I1 3GY7A 1TIOA 1C1OA 2Z94A 1P02A 3N7EA 1UTJA 2A4RA 3U8OH 3NPSA 1W11U 2FOEA 3F3BA 2B7DH 1EPTC 3UOPA 4ABAA 3JZ2B 1K28D 2CGAA 5T6GA 2A1DB 2ANWA 1JXPA 3ZVEA 3RXJA 1MMJN 1O2HA 1OWDA 1VKYA 1HRTH 1CT0E 3GCTG 4DGJA 1KXDA 5C3NA 1BTHH 1FY5A 1SSXA 2PW8H 4B71A 1HAOH 3F0OA 1ESBA 4AFQA 1Y5BT 1QR3E 2O8MA 5FHTA 4AZ2B 1FPHH 4K1EA 1GJ6A 1S85A 2A7CA 3UNQA 2PSXA 3PV2A 2UUFB 3PMHB 2G8TA 4CR9A 1GHYH 2I6QA 2XC0A 1L1NA 2XXLA 3ZIAD 1FV9A 1O3BA 1O2YA 1D6WA 1H9HE 1UTNA 2FDAA 3K6YA 1H8HD 2PUXB 3RXUA 2FM2A 1TX6A 3LJJA 5J4QA 2FMJA 2NU1E 2J4IA 2XC4A 1JWTA 1Y59T 1ESAA 3L6PA 1UTQA 2H9HA 1RTFB 2QY0B 2VWNA 2ZA5A 3Q77A 4FUIA 2ZDMA 5F8TA 1RD3B 5HIZA 2VIQA 2Z9JA 3AW0A 2FX6A 1K1MA 1P0SH 4I86A 2Q6GA 5GNDA 1ZTKA 2IOTA 2V7QD 5IDKA 1GHAG 1P2KA 5E2OA 1TNGA 4X1SU 2Q1JA 2B0FA 1ZSKA 2NU3E 4YOIA 3LH3A 1EUFA 2FX4A 4BXWA 1BTZA 4ZAEA 1OWHA 4XE4A 1G9IE 5C17A 4KKDA 2XBVA 3M3VA 3BG8A 3N7OA 4XOJA 3RXKA 2QXHA 3A86A 5G4BA 1FXYA 1GCTB 1TQ0B 2PTNA 1SBWA 3U28C 1ZHMA 1DM4B 1RGQA 1L4DA 2ZFSA 4B2AA 1W7XH 3TLOA 2GTBA 4K1TA 2XNDD 2Z3EA 1YPKH 3EGKH 4A1VA 2FLBH 2QGRA 2VWLA 7ESTE 3MHWU 4BTIB 2WYJA 2FOCA 3A8AA 1QB9A 1EKBB 1YPMH 4DT4A 5EXMA 1F0RA 2ZU4A 3PB1E 1PPZA 2AGEX 3ZYDA 4NIXA 1VJAU 2QXGA 3KYGA 5LPFA 5JYIA 1T8OA 5BPEA 1NESE 3RXQA 2WUBA 3MU0A 3HPTB 1PYTC 1O36A 3Q00A 2NU0E 3ATKA 5K7RA 4B2CA 1KXCA 1LPZB 1SQRA 4Y0ZE 1O34A 2EC9H 4YM9A 3AAUA 3S69A 2STAE 1C4U2 1C4V2 2BX3A 1C2KA 2YMSB 1ZZZA 3RU4T 5L2ZH 1QJ1B 1W0KD 3SI4H 1G2MA 1IQEA 3MFJA 1O2ZA 1P2QA 1C1MA 1ESTA 5F53A 1SGEE 4K3JA 1QY6A 2ZTXA 1C2LA 4INLA 2GVFA 3LC3A 2J5UA 3BTQE 1UVOA 1TABE 1OWKA 3S9AA 2B5TB 2BVXH 1MCVA 1HAHH 2J97A 2A7JA 1QL8A 2CN0H 4K60A 3MQKC 5DO4H 1GCTC 1H8ED 1UTPA 5A8XA 2ESTE 3SUEA 4D76A 1CGHA 4BAQB 3LU9B 3LJOA 3MNBA 5EQRA 1LCYA 3U1JB 2WPHS 2F4LA 4ACBA 5FAHA 4RKOB 2G51A 4ABFA 1O3HA 2ZGJA 2O8WA 1DITH 3FN8A 1O35A 2ZU1A 1A5IA 1HV7A 3D65E 1BTPA 2FP7B 2ULLA 1TYNA 3L33A 1F92A 1UCYK 1QA7A 5AFZH 1SVPA 2BQ7B 1UTKA 4JK5A 3UB0A 2FYRA 4YZUA 2XBYA 1DWDH 2H2ZA 3KQDA 1MZAA 1IQGA 2WV4A 1HFDA 6GCHG 4X1QU 1MH0A 5L30H 1Y8TA 5A2MH 3R3GB 4X6OA 1F2SE 1JRSA 1BTXA 4OS1A 1BUIA 3RMMH 4AGJA 4Y10E 1FZZA 2K0QA 5T1VA 1TGTA 1AUTC 4CREA 1Z8JB 4GVUA 5EQSA 4XRNA 3RC4A 3SJ9A 4U01A 4MPXA 1C1PA 2WUCA 2J38A 1MAYA 2BDCA 2CV3A 1EQ9A 1G30B 3KNXA 2ZPRA 1V2NT 1IHSH 3SI3H 1SHYA 1HXFH 3KIDU 4TPYA 1EAXA 1O2PA 3RU4E 5DG6A 2A5IA 1SFIA 4NZLA 4Z0KA 1BRAA 1QRWA 4AG1A 2G4UA 2ZFQH 2GV7A 2GZ9A 1O2MA 1ZMJA 1ZMLA 3ESTA 1LHDH 1YPHE 2FIRH 1TPAE 3OY5U 5JBBS 4F55A 5B6OA 3BEFB 3T2NA 1THPB 3QZRA 3MMGA 9ESTA 3DA9B 3BN9A 3F9GA 1QA0A 3PRDA 2VGCB 1OP2A 3G01A 4I8LA 2F43B 1O2NA 2GP9B 4CH8B 2QV1A 8KME2 2BDAA 1YBWA 1UVUH 1FPCH 4I33A 1BTYA 1QBVH 1O3EA 4NSVA 4PROA 1OWEA 2KCOA 3OFND 1HAXB 3PWCA 2TIOA 3SNBA 4NWLA 4ZKOU 1KYNA 1ZPZA 1XXFA 1SQAA 1TRMA 1FN6A 4IMQA 2J92A 1GI1A 8GCHF 4DCDA 3W1EA 5C94A 1MKXK 1ANCA 1DUAA 3D49H 2F9VA 2BB4A 3VGCC 1C2FA 1G3BA 1O2QA 2GMTB 2ZQ1A 2O8UA 2ZHQH 1NRNH 3SZEA 1K1JA 2B9LA 3TH2H 5C5OA 1OS8A 2BD7A 2EQNA 2ZTYA 1CT4E 1MZDA 3SW2B 4BANB 2OINA 1S6HA 3BG4B 1J17T 2Y6TA 1MABB 1SGFA 2G5NA 4YO9A 1TRYA 3QX5H 1CHOF 2ZGXH 1AVXA 3GDSA 3CENA 1MD7A 3MO6A 4CRAA 2PP6A 1P9UA 2LELA 1SLVB 1QBOA 2GCHF 3STIA 1HLTH 3SJIA 4X8VH 5F8ZA 2AIQA 3K6ZA 1C1NA 1BBRK 2HPPH 1MUEB 2PKAB 2KCPA 3P8GA 1DANH 5EXNA 1GVZA 1SGPE 3FZZA 3PO1B 1LQDB 2V6NA 2P3UB 3RDZA 7KMEH 2HRVA 3ZZ8A 4NIYA 1H8IH 2RA3A 3LDXH 3SN8A 2FESH 2JH6D 1V2TT 1KTSB 3N7DA 1D3PB 1ZTJA 3QWCH 4MPUA 2BY8X 1YPJH 5EODA 1PPFE 2BZAA 4MVNA 2Z3DA 1VGCB 4M9FA 3F2FA 3MI4A 3UR9A 1CBWB 1ARBA 1D3TB 1C2MA 2VINA 3QN7A 5KGOA 1LO6A 1GI0A 2YMSD 1K9OE 2H5DA 4XDEA 2VIOA 4OS2A 3T26A 4FUEA 1EP5A 5TCCA 2C93B 1OXGA 2L74A 2Z6BD 3A84A 1RS0A 1T32A 1O3IA 5T3HA 2ZZUH 2GX4A 1ZRKA 5HM9A 1AKSB 1UK2A 4ISNA 5A0AE 2H9TH 1QRZA 1SQTA 2ZHFH 3DSPA 1K21H 1ARCA 4KTCA 4X2XA 1UHBA 3RC6A 2BX4A 1BOQA 3LGIA 2ZPSA 3OX7U 1FDPA 3RLYH 3U98H 1FY4A 3U8RH 3MH5A 2BDHA 1EZSC 1Z8IB 1QNJA 4O3TA 2OQ5A 3TK5A 1ACBE 4JYUH 4CHAB 1GHWH 4HFPB 3A7VA 1KDQB 1WU1A 2STBE 3C27B 3KQEA 3ITIA 1C9PA 1VITF 1O3DA 3BV9B 4I8JA 5EQQA 2G5VA 2P16A 3OEHD 1XKBC 3QGJA 3PMBB 2A4QA 3TK6A 1C1QA 4SGAE 2CHAB 1F0SA 3RXMA 4WXVA 3GY8A 2VU8E 4KP0A 5CDFE 2LNCA 4YT7H 2BOKA 1FMGA 3OE7D 1DWBH 3CP7A 1XUKA 1C2HA 5T6FA 3SNAA 1LQEA 4AGKA 5JB9S 2C4FH 1MU6B 5HMAA 1NO9H 3MH7A 2C8ZB 2OC8A 4JMYA 1HGTH 2OC1A 3F9FA 1O5GH 4F4OC 1L1GA 3AVZA 1T8NA 5LGOA 2PKSB 1S84A 1BMAA 1G3DA 1Z8RA 5DKMA 2WPJS 1AO5A 1KSNA 1W12U 4WH8A 1PPHE 1EXFA 3GYLB 2ZFFH 4XBDA 1E35B 1IQLA 5LH8A 1C5ZB 3NXPA 3UTUH 2KX4A 4WXIA 3FANA 1HCGA 3UY9A 5I25A 2QF0A 2J34A 2BD8A 1KLIH 1V3XA 2BY7X 1SGRE 1C5UA 1K1LA 4IMZA 4D9RA 2P3FH 3NKKA 4I7YH 3BTHE 4E7NA 3KCGH 1WSSH 2XBWA 3E16B 4AYVB 3UFAA 1ELFA 2WINI 1WTGH 1XVMA 1YWUA 1UJ1A 2RA0A 1Z6JH 1EOLA 5DP5A 1O38A 1ELDE 6CHAC 3E90B 1XMNB 4VGCB 2EI6A 2UWPA 3EE0B 3K2UA 4X1RU 2BDBA 2J94A 5AFYH 4MNXA 3KGPA 1TWXB 1N8OB 3GY6A 4I8HA 3BEUA 1SGNE 4AYYB 4BOHA 3RXFA 1FAXA 2QC2A 2A31A 1QTFA 3BIUH 1HJAB 1QFKH 3KQ5A 4K69A 5C20A 4ZHMU 1VR1H 3I29A 1GBCA 5LPEA 3A82A 1Y3XA 1BTWA 1V2WT 3SHAH 2F3CE 1OWIA 5A09A 2WPDD 4HGCA 5EJLA 3SQHE 1PQ5A 4DG4A 3QTVH 4NG9H 1OP8A 2UUKB 3RXLA 2A4OA 2ZU5A 1KXBA 1IQJA 4ASUD 4NGAH 4AFUA 4Y76A 1HXEH 1Z1IA 1NRPH 5GCHG 2R9PA 4UONA 4MNVA 5C5NA 1IOEA 4E05H 5ABWA 4AC9A 1LMWB 2A45B 3GCOA 5HXFA 3KEEA 3LONA 2Y82A 2ZDAH 3AK5A 3Q3XA 2FI3E 4KTSA 1YPEH 1S81A 1S6FA 3T5FH 3PTNA 4A1XA 1NBME 2J2UA 5FCRA 2W7UA 1DDJA 2GCTC 2TGAA 1GHZA 1V2JT 1NTPA 3AAVA 1GPZA 1QL7A 1AUJA 4GLYA 4Y7AA 1H1BA 1Z8GA 3URDA 1O2JA 1DWEH 2R2WU 1HJAC 1QJ7B 3DFLA 4INHA 3RC5A 1O2RA 4H6TA 3RXIA 2FO9A 1XVOA 1Z71A 3Q3YA 2V3HH 1NRQH 2PGQB 3FVFB 3LGTA 1JOUB 1C5MD 1CHGA 5EIYA 4RT1A 2Y5FA 2VNTA 1HDTH 1GMDF 5HYOA 1FIZA 1EAIA 1WXRA 1BMNH 1P2NA 1TFXA 1GJAB 2C8XB 3M3SA 2BQ6B 1QHRB 3GDUA 2M5TA 3UAIC 3PV4A 3GOVB 3GY3A 5FBEA 4XBCA 1YC0A 3SYJA 1TBZH 2DE8A 4J1YA 4OGXA 1G37A 1LHEH 1S5SA 4B75A 2AERH 2PKAA 2C8WB 2A0QB 3T62A 3QTOH 1V2MT 4H4FA 2BLQA 3A83A 1GMHG 4ZKSU 4I32A 3T28A 1C5SA 1O5EH 3WWBA 3BTFE 5TJXA 1A5GH 3M7UA 1UTOA 1A7SA 1S0QA 1AD8H 1GJCB 1HIAA 4LZ1H 1O2LA 2HALA 3F1SB 5EG4A 5KECA 1EAWA 3ZV9A 4ISHH 1V2KT 1DE7H 2F9BH 1AWHB 1W2KH 1K1IA 3MH4A 2Z9LA 2BD3A 3VEQB 3GY5A 3A81A 4CR5A 2ZHEH 3BTGE 3ZVFA 1AIXH 1SOZA 4DVAU 1SLWB 2AS9A 1GHBG 2P8OB 4DW2U 5K0HA 1EATA 1EJMA 1AWFH 1FJSA 3GCHC 4NFFA 4YXWD 5SGAE 3BTDE 3LGUA 2SNWA 2Y5HA 1SGFG 4NFEA 5E2PA 2OBOA 1CU1A 2ZTZA 1ELEE 1AKSA 1TX7A 1AE8H 3S9CA 4JZDH 2HNTC 4D7FA 3NUMA 4WVPE 3ODDA 3PTBA 2ZC9H 3STJA 1SFQB 4XBBA 3OU0A 1UCYE 3QLPH 2WZQA 5I46H 1LDTT 3SNEA 1GCDA 5EOKA 2F83A 1GBKA 1BJUA 2V35A 2GV6A 1WAYB 2QA9E 1T4UH 4YOJA 1O33A 1G2LA 2ZFTA
chains in the Genus database with same CATH topology
5C0UA 2Y81A 4RKJB 1JRTA 1GWAA 3HKJB 3NRLA 4TYDA 1K1OA 4UFFH 2ANMH 1UHBB 3SUGA 4FU9A 3PYHA 1KDQA 1TALA 2ODQA 2F9UA 3MU4A 1C1SA 5F03A 2NU4E 1Q2WA 3KN2A 3PM3A 5DP3A 4ESTE 1C5PA 1C5OH 2BD4A 3M5OA 1O0DH 2HLCA 3FZDA 2R3YA 1BMFD 3F0PA 2PHBA 3P95A 5JB8S 2KFWA 1CA8B 2BMGB 1GI4A 3H7TA 3UWIA 3A7XA 1SGYE 3RXDA 4IN1A 2FXRA 1Y3VA 2BDYA 3SV8A 5BRRE 5FCKA 1P8VC 2OK5A 1GI3A 2BD2A 2BXTH 2PLXA 1V2RT 1P3CA 5EW2H 3MWIU 3TJNA 1ETRH 3SGAE 3UPEA 4MG3A 4CBNA 1BT7A 1GBAA 2UUYA 3MNXA 2PWXA 1E1RD 3HKIB 2FOGA 3KF2A 5DJ7A 2JIZD 2GD4B 2GKVE 3QK1A 3DT0H 1NN6A 4QT8C 1YF4A 4D7GA 5F6MA 1T31A 2QXIA 3TGKE 4BAMB 1EJAA 1CT2E 4Y8XA 1KMHB 1GVKB 2D26C 1EOJA 1MCTA 3FKSD 2XC5A 4ISOA 2OD3B 2TPIZ 5FL7D 2Z7FE 1D4PB 1UVTH 2Q6FA 3A8CA 3VG8A 3RXAA 2JDID 1AFQB 2ZDKA 3OTPA 1A1RA 1GI8B 2Z3CA 5AF9H 1F0TA 3E3TA 1SI5H 5DN6D 1UK3A 4CRCA 4ZH8A 3V3MA 2FODA 4B74A 4B6FA 1H9IE 1O3JA 1XUHA 4GCHG 3OSYA 1NFWA 3TITA 1BMLA 3FP7E 4ZKNU 1O5CB 3VB5A 2NWNA 2BDGA 3BTKE 1E37B 1O3CA 1GBHA 3GICB 4MDSA 3RLWH 4CRFA 3PLBA 1GDQA 1ZPCA 4X8TH 2W5EA 2VB0A 2CMYA 4ZROA 3SNDA 2G4TA 1IHTH 2AGIX 3NWUA 5EW1H 2ZGBH 1GDUA 1YPLH 2VVVA 1P04A 1GI9B 5ESTE 1GL1A 1TNIA 3SU3A 3LIWA 1ZJDA 4A92A 4D9QA 1V2QT 3HK6B 3TIUA 1GJDB 4Z1MD 1QJ6B 5IK2D 1BZXE 3W94A 1SL3A 2ZCHP 5DP7A 2YMSC 5FXLA 3MTYA 1BBRE 1IQKA 3P17H 2YNAA 1F5LA 5C1XA 1DY9A 4A6LA 4E06H 3TPIZ 2JH5D 2GZ8A 3H09A 3VB3A 4LK4A 2FS8A 3B9FH 4X8SH 1WYKA 2TGDA 2VVCA 3EA8A 1AFQC 1BHXF 1TA6A 4J2YB 4UDWH 1AU8A 1UO6A 4RN6A 4Y7BA 3UR6A 1W0ZU 4FETA 4AORA 4JZFH 2BY5X 1DPOA 1INCA 3EYDA 2W3KA 1NFYA 2EI7A 3PMJA 3PWBA 3GY4A 3LT3A 1ZGVA 3Q3KA 4XSKU 1OP0A 3Q76A 1XUGA 4WJG2 4FUHA 2L6OA 3EAJA 2AYWA 1HAGE 3EA9A 1O31A 1C5VA 4MPWA 3SUDA 1NC6A 3K65B 4Y11E 1QQUA 2FWWA 1UVPA 4IBLH 5L2YH 1AMHA 1UTMA 1D3DB 4U32A 3ODFA 5DP9A 5F8XA 2IPHA 1E34B 1QB1A 3BTEE 1O30A 4O9VA 1MTNB 4O3UA 5FPYA 4DY7B 1MTUA 1JBUH 2CF9H 2PUQH 3E91A 1TAWA 4ABHA 4BTTB 1MTWA 2WV5A 4B6EA 1TNHA 2SGFE 4AN7A 4TPIZ 4YT6H 3P8FA 2YOLA 2FZZA 3KQBA 2GT7A 3L3TA 4RSPA 1EP6A 3VXEH 2KM0A 1TQ7B 2A5KA 3LGWA 1HPGA 7GCHF 2IN2A 3DHKH 3TK9A 2CK3D 4FVDA 3RXBA 5FPSA 1ZYOA 1GBLA 1WV7H 1GGDB 2WYGA 3SGQE 3E0NB 1T8LA 1DSUA 2BVRH 3LGYA 1O2GH 1HAPH 1AI8H 1RJXB 1D3QB 1LPGB 1ANEA 2FYQA 1E0FD 2VIPA 1QQ4A 4YLQH 4DOQA 1PQAA 2XWBI 4YESB 1D6RA 2DE9A 4ABEA 2PSYA 3P70B 1V2UT 1SGQE 3LPRA 2Y7XA 3U9AH 1MU8B 1ETTH 1GJ4H 2ZU2A 4NA7A 3ZZBA 4Q63A 1HIAB 1SOTA 2VGCC 2SNVA 1RFNA 1TNLA 2KCAA 4UD9H 3GCTF 4NA9H 3N99A 1PFXC 1Y3UA 6ESTA 4NSYA 1S6LA 3RM0H 2R0KA 3V13A 3P92A 1C1TA 2BLVA 1C4Y2 3SU0A 4A5TS 1BIOA 3SGBE 1YCPH 4AFZA 1CO7E 1CA0B 5H4IB 1DOJA 1RTKA 2EEKA 3LOXA 3PROA 1GJBB 1P2IA 2GMTC 4ABBA 2DUCA 2ALPA 1YLDA 4DURA 3M61U 1GI6A 2R2MB 2P94A 4JZEH 3T27A 1FONA 5A0BA 4X2YA 2HNTF 4WF8A 3U8TH 1S0RA 1PPBH 3BG4C 3BTWE 1XX9A 4Y6DA 1OHHD 1L0ZA 3U69H 2HWLB 1N1LA 2XTTB 4XFQA 3E8LA 2EI8A 4CBOA 3QDZB 1TRNA 2TRMA 4IGDA 1IQNA 1OWJA 3U1IB 3SU1A 1AGJA 3RXEA 1W0JD 1Y3YA 1C1UH 1GHAF 3SJKA 1DUEA 5GIBA 2C3SA 1Y5UT 3A87A 2AMDA 4AX9H 3FP6E 1EASA 2C90B 4A1TA 2WPKS 2FOMB 2F9NA 1XM1A 3PO1C 3SU5A 3F6UH 1WOFA 2JJ1D 1A3BH 1TB6H 3LC5A 1EZQA 1BA8B 1YP9A 2AIPA 2QF3A 4SGBE 1GL0E 1L1JA 2FS9A 2ZDVH 4B73A 3RXGA 1GI2A 1HAZB 1VGCC 1MKWH 1CBWC 1KXAA 3VB4A 1O37A 2C8YB 3AASA 1S82A 1DXPA 1K22H 4UFDH 4NA8A 1ELGA 1OPHB 4MQAA 4WH6A 3ELAH 1G3CA 1BMMH 4JK6A 2ZP0H 6LPRA 1N6XA 3IG6B 1ELVA 1ANDA 2O8TA 4FUBA 4U30A 3VPKA 3W95A 3GCNA 1SG8B 4WMDA 1FI8A 2ZPQA 2VIWA 3SV6A 3HGNA 2J95A 3MO3A 4AB8A 2W3IA 1WQSA 4TY7A 5PTPA 1IAUA 1NM6A 1THRH 1KTTB 3RU4D 5CHBA 1ORFA 1AFEH 3A7YA 1PPCE 1B5GH 1NFXA 4CRGA 1MBMA 3LKWA 3WWFA 2UWOA 4KTUA 3RXRA 1FNIA 4DT7B 1TNKA 3DUXH 2B8OH 2FEQH 1J14A 5HM2A 3BF6H 3MO9A 2AMPA 3I77A 1C5XB 1AE5A 4K5ZA 4BNRA 5A0CA 1V2OT 2OQUA 3ATIA 2QAAA 4CHAC 5AVDA 1P10A 3M7TA 3TJUA 1UMAH 1G32B 1SGCA 1ZTLA 3M7QA 2THFB 4AFSA 1V6DA 2PGBB 1MTVA 2W7SA 1NS3A 3TNSA 4JZIA 1GI5A 2ZG0H 3S7HB 2ODPA 2HVXA 2CHAC 3MOCA 3ZVDA 1P09A 1E79D 8LPRA 3SU6A 4IC5A 1C1VH 3O8BA 2WV9A 4WMFA 4OM9A 5C1YA 1O39A 3RM2H 2ZQ2A 4KGAA 1B0FA 3DFJA 3GDVA 3CS0A 4X6PA 3ZZDA 2OXSA 1ELTA 1AQ7A 2G00A 3M36A 3SV9A 1C2DA 2PKSC 4AB9A 2FPZA 4H42U 4FUFA 5EGMA 1GI7B 1CVWH 3QO6A 1Q3XA 3OEED 1EFRD 1P2JA 3M37A 1BRCE 3FO8D 1HYLA 2QN5T 1FLEE 3BEIB 4TWYA 5A8YA 1AHTH 1O2XA 6GCHF 1FY8E 1CGJE 3PV5A 3UWJH 1SMFE 2FTMA 1EPTB 1THSH 1SC8U 3ZZ4A 3QGNB 4D8NA 4ABJA 1DSTA 1A3EH 2O8LA 3MU5A 3RMOH 3DSOA 2QF5A 5GJ4B 2PTCE 3TU7H 1FIWA 1Y3WA 4FU7A 1P3EA 3RXOA 2FLRH 2F9OA 3QZQA 4VGCC 3GY2A 2BLOA 2ZFRH 3FP8E 1VCWA 2LPRA 2JH0D 1C9TA 3A7ZA 5C2ZA 4B76A 1ETSH 1ABJH 8GCHG 1N8OC 3P8OA 3F2HA 2ZWLH 1HAIH 1HNEE 1ZRBA 2Y7ZA 3C1KA 2VJ1A 5EXLA 1O3KA 1SB1H 4I8GA 1V2LT 1KLJH 3S0NA 3TGJE 5LPRA 2D1JA 4UE7H 2SGPE 1OX1A 2ZGCA 1TOMH 1NT1A 4TWWA 1J9CH 4X6MA 1EAUA 1SHHB 1DXWA 1C2GA 1NRSH 1Y5AT 1T7CA 2P95A 1J15A 4AOQA 1LPKB 1CHOG 1COWD 3VB7A 4CRBA 4MNWA 5TCAA 4ABDA 1W0YH 1JIMA 1TOCB 2FI4E 2YNBA 2GCHG 2OLGA 1QB6A 2Y80A 1T4VH 3OY6U 1WUNH 3E1XB 1KIGH 3EQ0H 1NU9A 2CF8H 2ZEBA 1LVOA 2VIVA 1WQVH 2OTVA 1KLTA 2HOBA 4OS6A 5ESBA 1OOKB 3KQCA 4R0IA 1HUTH 2FI5E 1ZSLA 4K2YA 1F0UA 2HNTE 2GDDA 3ZVBA 2KCYA 2BLWA 2GT8A 1MBQA 1VITH 1AN1E 1BDAA 1A5HA 2FOFA 3SV2H 5L6NH 1QL9A 2RCEA 1K1PA 1GBIA 1ELBA 2ZFPH 4BTUB 1LKAA 3LGVA 1XUIA 1TX8A 3ZVCA 3PLKA 4FUGA 1SPJA 4FUJA 3ZZ6A 4IC6A 4WWYA 4CH2B 1ELAA 2QCYA 3F68H 3OTJE 1GBBA 1O32A 3OYPA 3TGIE 2JJ2D 3D62A 2TBSA 3RXSA 1UCYH 1O3MA 3BSQA 5A8ZA 1N6YA 3FOAA 5JBTA 4YLUA 1EZXC 2G55A 5J4SA 1ZSJA 4FXGH 4DIIH 2H5CA 3A80A 5AHGH 5DGJA 1B0EA 2ANYA 3FAOA 3BTTE 1O3AA 1KXEA 1P57B 3ZZ3A 4OS4A 2P3TB 3M5LA 5EPNA 1SGIB 2ILNA 3V0XA 1UK4A 5CMXH 1ZOMA 4H6SB 3OAAD 1PPEE 4GSOA 3D23A 1O2KA 2BDIA 4IW4E 1NZQH 1VITG 1WCZA 1YPGH 2KAIA 5JPMH 1ZPBA 3V7TA 2M2AA 1O3GA 1SLUB 1LVYA 1CE5A 1DWCH 3SUFA 4MLFB 2BY9X 1UTLM 1W7GH 3M35A 2OCVB 1YCPM 1L2EA 1XUJA 3S7KB 3BTME 2IJD1 2SGDE 1GG6B 4TY6A 4OS5A 1MTSA 1VCQA 1BRUP 2ZNKH 1OKXA 1Q31A 3KHVA 3SOSA 4M7GA 1GMCG 3A85A 5E0HA 1HAVA 2PR3A 1P01A 2Z9GA 4ISIH 5EPYA 2IJOB 2P8OC 2PV9B 3IWMA 1K1NA 5DSFA 2KZ4A 1P9SA 1AB9B 4Y0YE 3UUZA 4Y79A 1BRBE 1O2TA 1E36B 3UNSA 1GHVH 2VH0A 2SGEE 1Z1JA 3SBKA 5GXPA 5HGGA 1MKXH 3PLPA 2I6SA 3ATMA 2OC0A 4R8TB 1Z7KA 1HBTH 4DIHH 2ZDLA 1AZ8A 1O2IA 3A88A 3SU4A 1QCPA 4X1NU 1P12E 4Q2KA 1XUFA 1TGBA 3TH3H 1MQ5A 5E0GA 4Z6AH 1YYY1 1EJNA 2BXUH 2BOHB 1GBFA 3B8JA 4Q7YA 1NBMD 2SGAA 2UUJB 5ETXA 1TMBH 1XKAC 4I31A 1P2OA 4K1SA 2H9EH 3SV7A 3JZ1B 4LZ4B 1A61H 1GG6C 1O2SA 4HTCH 3RUOA 2ZO3H 3SJ8A 3SU2A 2VBCA 1A46H 1BBRH 1QIXB 3A7TA 3PMAB 4FUDA 4WMEA 2ZGHA 1DX5M 1LHGH 3F2GA 4BAKB 4MPVA 3UQVA 5E0JA 2SFAA 3SNCA 1GJ5H 3I78A 2O9QA 4I8KA 1O2OA 1NFUA 3GS9A 1CQQA 3F9EA 3WY8A 2ZF0H 1NU7B 2J9NA 1LVMA 2PFEA 1QRXA 4X2VA 2VH6A 1RIWB 3ZZAA 4WY3A 2W6JD 4TT3D 3NCLA 4GUXA 2WPIS 1GVLA 5GDSH 1TBQH 5HKKD 1AB9C 4GPGA 1V2ST 3GISB 1DLEA 1LHCH 1EPTA 1VCPA 3FFGA 2WHXA 1PPGE 1C1WH 3VGCB 1ZHPA 2TGTA 4Q7ZA 2GGVB 3M5MA 1TMUH 2Y5GA 1CGIE 1BTUA 1J8AA 1EB1H 1SLXB 1W3CA 2AH4X 3HGPA 3T25A 1RXPA 3B23B 4UFGH 1LTOA 1ELCA 2XCFA 4K8YA 2BHGA 1BITA 1O3PB 1MAXA 3RXTA 4ZXXH 2K8IA 4AG2A 1C5NH 2OBQA 1B7XB 2EA3A 3UREA 4YTAA 1A0HB 1IQIA 1F5RA 1GBMA 5GCHF 2XRCA 1GMDG 2ZCLP 1DVAH 2XYAA 1ID5H 1TBRH 1NPMA 1PYTD 1YM0A 4KELA 1T8MA 2VIDA 1RIWC 4MTBA 5C1UA 1O2WA 4ZCNA 1QGFA 1NROH 4Y8ZA 4YOGA 1ZLRA 4IN2A 1FY3A 4GHQA 1TE0A 2H6MA 3SQEE 2F91A 5E8EH 3ENSB 1ZMNA 4HI3A 3ZV8A 1RTLA 2QYIA 2W6ID 4F49A 2K1QA 3MNCA 2GZ7A 4XD7D 1WBGB 1XXDA 2F9PA 2XBXA 5FX6A 2RDLA 1C5YB 1S83A 1FN8A 1YPHC 1GJ9B 2ZECA 3MYWA 2W26A 1O5DH 2HGTH 1QURH 3KL6A 1BCUH 2Z9KA 1DICA 1A0JA 1JMOH 1HAYB 1O3OA 9LPRA 4INKA 2A32A 3SORA 4NIWA 3VB6A 1L4ZA 2OUAA 1A4WH 1BQYA 3RP2A 2A7HA 2ZI2H 4FUCA 4X8UH 1F5KU 1EB2A 2HPQH 4ZXYH 5DK1A 4U2WA 3IITA 1TGCA 4ZKRU 2D8WA 1X7AC 4LXBH 2TGPZ 1MTNC 1ZHRA 1GMHF 2FOBA 1GDNA 2P59A 1SGDE 3A8BA 2V0BA 3RXCA 4BXSA 1YKTA 3ZZ5A 1GHXH 1NY22 1W8BH 4O97A 1GJ8B