3OYPA

Hcv ns3/4a in complex with ligand 3
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
174
structure length
174
Chain Sequence
PITAYSQQTRGLLGCIITSLTGRDKNQVDGEVQVLSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWPAPPGARSMTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHVVGIFRAAVCTRGVAKAVDFIPVESM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine protease NS3
publication title Selective irreversible inhibition of a protease by targeting a noncatalytic cysteine.
pubmed doi rcsb
source organism Hepatitis c virus (isolate japanese)
molecule tags Hydrolase/hydrolase inhibitor
total genus 38
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3oypA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3oypA01
1P06A 3E6PH 1G32B 2JKHA 2ZO3H 2ZFTA 1ETRH 4B76A 2ZFFH 1DS2E 4GCHG 4JZIA 1TFXA 2PSXA 1C5OH 1Y3UA 1GBDA 1GI3A 1Z1JA 1FDPA 1AGJA 3DUXH 1N6XA 3G01A 4DW2U 5A8XA 2J38A 1GJ4H 5HGGA 3A8AA 2PR3A 4O9VA 3UR6A 4MQAA 5EQQA 4INLA 4MPWA 4X8TH 3BEUA 1IOEA 1BIOA 1LHEH 1PJPA 1RD3B 3RXAA 3PV5A 2VNTA 2WPIS 1C1PA 2TBSA 1A3EH 4CHAB 1SB1H 2TGAA 1S0QA 5C5NA 2JH6D 1GG6B 1QIXB 4K1SA 4Y79A 2UWLA 3UOPA 1NU9A 1HAZB 4WMEA 1FPHH 1GJ8B 1ZRBA 3T62A 3BTEE 4B6EA 3ZYDA 1WBGB 5AF9H 3BTGE 3LGVA 4XSKU 1GHAF 1J14A 1K21H 1O5AB 1W0ZU 3VB4A 2A31A 3TK6A 2GZ7A 2WV5A 1VITH 5HXFA 2EI6A 4A1XA 1AE8H 1P8VC 3NCLA 2UUKB 1TX7A 3LONA 3M3VA 5B6LA 1ZMNA 3KNXA 4HGCA 5CHAB 4TPYA 3RXQA 1T32A 1OYQA 3E91A 4Y7BA 1J8AA 3RMNH 1DFPA 1BQYA 1T31A 1EZSC 4CR5A 2RCEA 2FS9A 1ETSH 3U8OH 7GCHF 1P9UA 1F0RA 2Z9LA 1UHBB 2AIQA 1HAPH 4NIVA 4R8TB 4GHQA 3M5MA 3KCGH 1L4ZA 1P11E 5DKMA 4ABFA 1NN6A 2Z6BD 1IAUA 4X2XA 2BVXH 3RMOH 2O8WA 2A7CA 1FZZA 5BPEA 2ZTZA 3RXCA 1KLIH 1TPAE 3LGWA 1A2CH 2BXUH 1ZTKA 4BTUB 1UJ1A 4FUFA 1LO6A 1W8BH 2A4OA 3MO3A 2PTNA 1DE7H 1QTFA 1HAYB 3TU7H 3EE0B 1RFNA 4YLQH 1EATA 3OY6U 3E3TA 4KKDA 4FUEA 1TABE 1GBJA 1T8LA 1KDQA 1RGQA 1N1LA 1O3AA 1SQOA 1G2LA 2J94A 2XCFA 1DUEA 3SJ8A 4ABJA 3KF2A 1MKXK 5FX5A 2P3FH 4RN6A 1NROH 2Z3EA 3H09A 1F92A 2PW8H 3GICB 1YPMH 2G52A 3MNXA 2ZTYA 3RXMA 1DLEA 1ZSLA 2FOFA 1FIZA 2BD9A 2FTLE 1T7CA 7ESTE 5LPEA 3SUDA 1MTVA 3JZ1B 1O2PA 2ZP0H 1ZMLA 4JK6A 3HKIB 2WUBA 2ZTXA 3KEEA 3RUOA 1BBRE 1S81A 1JBUH 3VPKA 1TRYA 2ZFRH 1BT7A 3UNQA 2V3OH 5ESBA 1O3GA 4KGAA 1K1PA 1TBZH 2ZDVH 2QF0A 3QX5H 4J2YB 4UDWH 3SI3H 2VIWA 1KXCA 2A2XH 3H7TA 2FOBA 3M36A 3E90B 1A0HB 2Y80A 3AW1A 1QQ4A 1DOJA 2HNTF 3S9AA 2OC1A 1O2OA 1SLVB 1W11U 2C3SA 1LPGB 8KME2 1LPZB 1ZR0A 1KTSB 1QRWA 1GI5A 1YPJH 3RXRA 3KQEA 8GCHF 3RXOA 4SGBE 1QBOA 2WPMS 1GBIA 1WTGH 3ZZ9A 1SGEE 4TWYA 3S9BA 1LVOA 1NFWA 5E0HA 3RLYH 1BZXE 3PMJA 3ATMA 4VGCB 2ZECA 1IQFA 2NU1E 3SHAH 1C1WH 5SGAE 1FUJA 1QA7A 1YF4A 1XKBC 2ZHDA 5L2ZH 1C9TA 1FPCH 1NRPH 3GDUA 2BYAX 2BY8X 2BD7A 3SV2H 1Y5UT 4INKA 1ZZZA 1J16A 1O3LA 1RJXB 1RTLA 1DY9A 2PGQB 1OSSA 5C1YA 5GCHG 5K7RA 2A7JA 4AN7A 2GV6A 1C5QA 1WAYB 2ZKSA 4NZQA 2FYQA 1UK2A 3RXGA 1WUNH 2G4TA 1GMCG 2BY6X 3ESTA 2B8OH 4AB8A 2G55A 4ZKOU 1ARBA 4FVBA 2SNVA 1O0DH 2YNAA 4ISLA 3W95A 3W94A 1ZLRA 1O31A 2JETC 1V2JT 1VGCB 2BTCE 3ATWA 5FHTA 1HLTH 4I8GA 3WY8A 1GBHA 4Y8XA 1MKXH 5FPTA 3VFEA 1MTUA 2WZQA 2Y82A 2BZ6H 3NPSA 2VIQA 5EXLA 1VCPA 3Q3KA 1IQEA 1WSSH 2AERH 2TGPZ 2OQUA 4XDEA 4CH8B 4B71A 1SGTA 4AFUA 2CJIA 2BD3A 2STBE 2WPLS 5G4BA 4NA8A 3T29A 3TK9A 2C90B 1P10A 2QIQA 1K2I1 4OGYA 1B5GH 1CT0E 1SGFG 1SOZA 1TNHA 1CA0C 1LVYA 4OGXA 1A0JA 4R0IA 2FI5E 3RXFA 3UNRA 1BITA 4GVUA 3VB3A 4ABHA 1BRUP 1EP6A 3UIRA 3TLOA 1O34A 2XWAA 3URCA 4B2CA 2O8UA 1ZSKA 2BD8A 3ATLA 1NFUA 5L6NH 1LKBA 1BMAA 1RS0A 5JYIA 4FXGH 2A4GA 1A7SA 1P3EA 2H5CA 1TYNA 1XUFA 2P93A 4UEHH 2VGCB 3T5FH 1UVSH 1NRSH 2HOBA 1UTMA 4B74A 2YOLA 1SGCA 1W3CA 2ZDKA 4NA7A 4Y0ZE 1UTJA 1H9LB 1AQ7A 2C8XB 1GJAB 4B2AA 5FCKA 1DT2A 5EXNA 2OLGA 2XC0A 4UFDH 3A7ZA 4J1YA 1GMDG 2FMJA 3UWJH 1DSUA 5C20A 4IBLH 1FV9A 3RC5A 4XBBA 4Y11E 2I6SA 3BTME 2FI3E 4KTSA 1FMGA 1ELGA 4XBDA 2CF9H 8ESTE 4ZKNU 1HAVA 5ABWA 3U8RH 2OC7A 4YZUA 2W26A 2OK5A 3RXSA 4Y0YE 3ZZ7A 2XCNA 2FS8A 4ZXYH 4FU8A 1AU8A 3R3GB 3BEIB 2GP9B 4AGJA 1DY8A 5F6MA 1AUJA 4JYVH 1EASA 3LU9B 4UFGH 2TRMA 2F9PA 4BAQB 3RXLA 4GAWA 1G9IE 1GCTB 4NG9H 4WMFA 1K1NA 4ZHLU 3BTHE 1EZQA 2WV4A 1BTWA 3PO1C 1UTNA 1AKSA 1QA0A 4X2VA 2GTBA 1PPFE 1A3BH 1AVWA 2FOMB 1DUAA 3GY7A 1KXFA 4TWWA 3VB7A 1C1RA 1QCPA 3F6UH 3BEFB 1C2JA 2BOHB 2QYIA 1FAXA 1AWHB 2GCHF 2HRVA 1GI9B 1F5KU 1SI5H 1DLKB 2JH0D 2SGPE 1EOJA 1CA0B 1K9OE 1OWHA 2XBWA 5FBIA 5EODA 3RXDA 1S6FA 4WY3A 1OWEA 1C5NH 1P12E 1YLCA 1ESBA 4X6NA 2FOAA 3UUZA 1ZRKA 2BQ7B 1P03A 3A7WA 1O2GH 4AGKA 3AK5A 1XM1A 1UK4A 4Y76A 4MDSA 2G51A 1C2LA 2OTVA 4Q7ZA 4IMZA 5EOKA 1GDNA 3GDSA 1TPPA 1F7ZA 1KLJH 2QXGA 4JMYA 1CU1A 4IC6A 1D6WA 4ISOA 4AX9H 2ILNA 3LJJA 1TALA 5J4QA 3SO3A 1YP9A 1SHYA 1G3CA 2OQ5A 2STAE 1GI1A 1XXFA 4ABIA 1ESTA 1IQHA 4OS1A 4ZUHA 4TY7A 1V2VT 2UUJB 3MNCA 4DG4A 1FNIA 1OX1A 1SGPE 1W10U 4Q7XA 1PPGE 5CMXH 1C5PA 4B73A 2Y7XA 3M7UA 1CGJE 4WJG2 4AG2A 3RMMH 1NS3A 4ZXXH 1C5WB 4BAKB 1DXPA 2WPHS 3FP7E 4I8KA 1ELFA 1QL7A 1L1NA 1DWEH 3O8RA 4GSOA 1H1BA 2P3TB 5TCAA 1YPGH 1SG8B 4IS5A 2BDIA 5I46H 2G4UA 5EQSA 1TA6A 1TGCA 3MYWA 1SC8U 5GNDA 2YNBA 3TJUA 2V0BA 1NTPA 3FP8E 2H6MA 1NRRH 4RSPA 3HATH 4AFQA 1BHXF 3FFGA 4MLFB 1TAWA 4MNYA 4WXVA 4KP0A 1MTNC 2ZGJA 3I78A 5C5OA 4AG1A 1W7XH 1EB1H 2AFQB 4RKJB 3A85A 5C1XA 1FQ3A 2FODA 3ZVDA 1O37A 2ZU2A 1SFIA 2VU8E 1U6QA 3KHVA 4FUCA 3Q76A 1TNLA 4BOHA 1AB9C 4ABBA 1GHWH 2BQWB 1ELCA 1S82A 3M61U 5L2YH 5TCCA 4AZ2B 4K69A 5JBAS 2Z3DA 3MU4A 4A1TA 4AYYB 2BLOA 1UVPA 1LVBA 2XRCA 2RDLA 3MO9A 2BLQA 4K1TA 2F83A 3LC5A 4I31A 4XE4A 1G37A 1RXPA 4ISNA 2CN0H 1EP5A 1AFEH 4DIHH 1ETTH 1GI7B 2B0FA 1W14U 2PUXB 1ZTLA 1HFDA 5LH8A 1ELDE 3EA9A 2FOGA 1H9IE 3A8BA 1BRCE 1O3KA 1FONA 1B7XB 2ZFPH 3U9AH 1PPHE 1XVOA 3GCHB 4CRDA 3JZ2B 3BG4C 2J9NA 3K6YA 5DPAA 1BRBE 1AWFH 1UMAH 1T8OA 4MPUA 3A7YA 1LHGH 2ZEBA 1HAOH 1HIAA 1XUJA 1O33A 2VINA 4U01A 1FAKH 5ESTE 2V3HH 1J17T 1IHSH 1H4WA 3SNEA 4WH8A 1XMNB 5T6FA 1SHHB 2A5KA 3V12A 1BTUA 1ZYOA 6GCHF 4AFZA 1W12U 2V6NA 1Z6EA 4JK5A 1TLDA 1UVTH 3PWCA 4ABEA 2G00A 1MZDA 5T6DA 5HYOA 3SV7A 1GI4A 1XUHA 5EPYA 1GJ7B 1A4WH 2ZQ2A 4YLUA 4MNXA 3SV8A 1CT2E 1GHAG 1NRQH 1PYTD 4Y6DA 4X8SH 2QAAA 3PB1E 1HGTH 4FUBA 6ESTA 3F9EA 4X8UH 3HGPA 3VXEH 3RXUA 1RIWB 1SGIB 4D9QA 3PLPA 1K1OA 1ZHMA 1SL3A 4HI3A 1V2TT 1MTNB 2CGAA 1ZPBA 1C2EA 1K1IA 1MAYA 2BDAA 1MUEB 2BM2A 3PMHB 2SNWA 2HALA 1EQ9A 3MU8A 1GWAA 1C2KA 5JB8S 3M7QA 4I33A 5EQRA 1QJ1B 1HBTH 2ZI2H 4H4FA 5GXPA 7GCHG 2W3IA 1T4UH 2O9QA 2Z9IA 3FZZA 4BXWA 2RG3A 1GL1A 2QN5T 3QTVH 6CHAC 3QZRA 1WCZA 1AVXA 2UWPA 1NFXA 1WQSA 4MTBA 4Y8YA 5FCRA 4E06H 4X2YA 3ATIA 3DHKH 1HPGA 5EPNA 3S69A 2WHXA 3ZVCA 4ZHAA 4YT6H 1P2KA 5JPMH 2SGEE 2Z7FE 1FXYA 3B8JA 2OBOA 2Y5GA 1M9UA 1JMOH 2FZZA 2THFB 1O2SA 1CE5A 1NESE 1AFQC 4UD9H 2ZIQH 1HV7A 1OWDA 1THRH 4RKOB 4H6TA 3BG4B 1EAIA 1A46H 1CGIE 1ZOMA 5DP6A 5E2OA 2NU4E 1OWJA 3ENSB 2SGAA 4NSYA 2Y5HA 3MWIU 2SGQE 3RM2H 4IW4E 3SJKA 3R0FA 1YPKH 1Q31A 2FO9A 1ZJKA 2XC5A 1O30A 1O2XA 3PM3A 4DVAU 4Q7YA 1VJ9U 5FPYA 1MMJN 1O5EH 2XWBI 1UK3A 3A87A 1J15A 3ZZ8A 3BSQA 1E37B 1PYTC 1SGRE 3RC6A 5DJ7A 4A5TS 2QY0B 1GJDB 1PQ7A 3SJOA 1V2ST 1Z8IB 3A7TA 1SSXA 1CHOG 1GMHG 3QTOH 4GCHF 5CE1A 2ZCLP 3SNDA 1KY9A 5IDKA 2CV3A 2FLRH 1NU7B 1LDTT 3K2UA 1V3XA 3VEQB 3RMLH 4E7NA 2NU2E 3QGJA 4IN2A 3RDZA 1O2RA 4CRCA 3DD2H 2ODPA 4LK4A 3SU3A 2XBXA 3MH4A 3SW2B 3MH7A 4MNVA 2Q6GA 2GMTC 4ZMAH 3M37A 2PLXA 4Z6AH 3ZZCA 1F2SE 8GCHG 2ASUB 3VXFH 1V2LT 1PPEE 3NK8A 1KSNA 1C2HA 5A0BA 1PQ8A 4DURA 2IJOB 1J9CH 1LHCH 1GBAA 1GJ9B 3RXBA 3S0NA 1UO6A 1TA2A 1LCYA 1X7AC 1T4VH 2OXSA 1TQ0B 2W3KA 3HKJB 1C1UH 4H6SB 1GGDC 1IQGA 1QRXA 2OP9A 2SFAA 1L2EA 4ABDA 4O3TA 2ALVA 3F9GA 1EXFA 1BDAA 2AH4X 1MKWK 1TQ7B 2BDBA 1OP8A 3OU0A 3P8NA 4OM9A 2EI7A 2ZF0H 1OP0A 2ZDNA 4JYUH 3A7XA 2Y6TA 1GHYH 4HFPB 2R9PA 3STJA 1LTOA 4ZKSU 2AGIX 3IWMA 2ZU4A 3SQEE 1O2HA 5HM2A 3N7OA 1O3HA 2BOKA 3HGNA 3P95A 4KELA 1BTXA 3UQOA 3RM0H 3L6PA 4LZ4B 1P2IA 3TITA 2NWNA 4H42U 3ZV8A 1TOMH 3ELAH 3T25A 3SHCH 1XX9A 5DP8A 3QN7A 1C5XB 1KXBA 3BTWE 1Z1IA 3D49H 3UWIA 4D7GA 1HJAC 3M3SA 3ZV9A 1QB1A 1TNGA 3T2NA 3H7OA 3LPRA 1GDQA 1Y59T 3SGQE 4DIIH 4RI0A 2VVVA 4ISIH 3EQ0H 1CO7E 1YPHC 3KN2A 1AUTC 1TIOA 1VITF 1O36A 4BAMB 3TGKE 3ATKA 1PQAA 1GVZA 3M3TA 1UHBA 1C4Y2 1HNEE 2J34A 2PV9B 3NZIA 3IITA 1GHBF 3GYMA 3A86A 5DG6A 3NKKA 1Z71A 2H1UA 2GGVB 4E05H 2ZFSA 1C1TA 4JYTA 3GCNA 3TNTA 4ABAA 1O2IA 2P8OC 3KQDA 2ZDAH 2Q6FA 3QUMP 1SOTA 3MFJA 1AMHA 4WH6A 4D7FA 1FY8E 2TGDA 1P3CA 3RXKA 2GDDA 3VB5A 1PQ5A 3QDZB 1AZ8A 7LPRA 1N6YA 1SLWB 1GVKB 1ELBA 2VWLA 3VGCC 1K22H 4GPGA 5E2PA 1FY4A 5TJXA 1CT4E 3SU4A 4DCDA 4UFEH 2C4FH 2A7HA 3MH6A 4YOGA 3RXTA 1GGDB 2PKAB 2PFEA 1BMMH 4D9RA 1EPTC 1SQAA 2GCTC 5DK1A 1O2KA 1UTLM 3GCTF 1SLXB 2FXRA 2A1DB 1F0TA 2OCVB 3C1KA 1VZQH 2P59A 2XBYA 1O3PB 2BHGA 1EAWA 3HK3B 1LVMA 3Q3XA 1IQKA 1ZGIA 2VIDA 1WXRA 3KQCA 1MZAA 1TGTA 2HPPH 1ABJH 3P92A 3CENA 3TH4H 1MKWH 2V35A 1IHTH 1HJ9A 5PTPA 2AYWA 7KMEH 3OTPA 2A5IA 1DICA 4A92A 2ZZUH 1YCPK 3AW0A 4NGAH 2ZGXH 1QJ6B 2BZAA 4OS6A 1GBCA 1YKTA 1O2TA 5EW1H 4DJZB 1D6RA 2AEIH 2QA9E 2I6QA 3BV9B 2A2QH 1ARCA 1O2JA 1N8OC 3F9HA 4B75A 1H8DH 4DGJA 3QK1A 5T1VA 1UCYK 2EI8A 4GLYA 3MI4A 3SNBA 2H9HA 2AMPA 2ZCKP 1OPHB 1C5UA 5HM9A 5EU8A 2P94A 2GCHG 1P2MA 3K6ZA 3M5OA 4O03A 2R3YA 1ZHPA 3RXJA 2KAIB 3F1SB 1DWDH 4NWLA 2ZHFH 4CRAA 3S7KB 4ZHMU 5C2ZA 2VVCA 3TPIZ 1NFYA 3PMBB 2D8WA 3V0XA 4FUGA 1O2ZA 2XBVA 1L1GA 5EXMA 3ZVGA 1HDTH 1OP2A 1S6HA 4UE7H 2Y81A 4CBOA 3MOCA 5DO4H 2VJ1A 2VWNA 1QFKH 2PWXA 1LHDH 1K1JA 6LPRA 1JRTA 1ELVA 1XVMA 1ZSJA 4TYDA 3EAJA 3KL6A 3SU2A 4ISHH 2CXVA 2JETB 2OBQA 2QGRA 4MPXA 1GL0E 1AN1E 4M7GA 3ZZ5A 3ZZ6A 1GJBB 2TGTA 1OS8A 1FN8A 2WYGA 1XXDA 2O8MA 3PYHA 1T8NA 1MQ5A 2EC9H 3DFLA 4X6OA 3P6ZB 5L30H 1EPTB 5ETXA 4GHTA 2W5EA 1O2LA 1CQQA 3SU6A 1MTSA 2UUYA 4K8YA 3AASA 2ZCHP 4OS2A 1DANH 3MO6A 3BG8A 3DA9B 1C4U2 2VIPA 1BOQA 3A80A 5A0AE 2F91A 3E8LA 2F4LA 4WMDA 4X1PU 2QV1A 2ZQ1A 4FUJA 3KIDU 3E16B 4K5ZA 1AVGH 1HCGA 1CSOE 1YCPH 1JXPA 1N8OB 2AGGX 4FUHA 4TY6A 4MVNA 1EKBB 3MMGA 4INHA 1DPOA 1C4V2 2ANMH 1AY6H 1IQLA 3NXPA 4YOJA 1NPMA 3ZVFA 1MU6B 5DP3A 2F9NA 4JZFH 2C8YB 2G5VA 2H5DA 2GZ8A 3NUMA 1D3TB 1F5LA 3T27A 4NCYA 3MH5A 5EGMA 1YGCH 1HAIH 1O35A 2ZPRA 4BAOB 2WPJS 3TJOA 1GBFA 1JWTA 4I8HA 4YESB 1AHTH 1YBWA 5LPRA 1QURH 1ANBA 5C67A 1RRKA 3GY6A 2O8LA 1W0YH 2ZU5A 3MU0A 2BB4A 1Y5AT 3CP7A 1WTHD 4NFFA 1F5RA 4IMQA 3QGNB 2Z3CA 1VJAU 1JIRA 5DP5A 1C1VH 1SR5C 5F8XA 1FN6A 1GHXH 2ULLA 1IQJA 9LPRA 3I77A 1RTKA 4NA9H 3K65B 1EX3A 3PO1B 1C2MA 1GCDA 3EYDA 5DGJA 2GD4B 1E38B 1ID5H 2UUFB 3RU4T 3A7VA 3A81A 3MNBA 4ABGA 1EZXC 2AMQA 1O2YA 3LJOA 1S5SA 3TNSA 2VWMA 2AGEX 2CHAC 3FANA 5A0CA 5F03A 1EAXA 6GCHG 3A8DA 1HXFH 1P2JA 1B0FA 4LXBH 1D3PB 5GJ4B 4CH2B 1IQMA 1GI6A 3ZZAA 4B6FA 2ANWA 1DX5M 2WUCA 3A82A 4X2WA 2R3UA 2QF3A 4DY7B 4NZLA 3LKWA 1BMLA 3UOUA 2Q6DA 4F4OC 2AIPA 1O2MA 1OWIA 1EJMA 2R2WU 1GI2A 4MNWA 3SU5A 4AFSA 5LGOA 4GUXA 1TB6H 2ZWLH 2PTCE 1BMNH 4U32A 3GDVA 4M9FA 2FOCA 3MU1A 1TNJA 3UQVA 2TIOA 3C27B 3BTKE 1NT1A 4OS4A 1TNKA 4YM9A 4UFFH 1H9HE 1GHZA 3U8TH 1G30B 2AS9A 2BX3A 2ZPQA 2GVFA 2A45B 4BTTB 2HNTC 1GJ5H 1TOCB 1V2OT 1V6DA 1QHRB 4Q2KA 1V2QT 4CHAC 1FJSA 5C3NA 3LGUA 4X1NU 1GPZA 1GG6C 2ODYB 2PSYA 1BB0B 1P05A 2B9LA 1VCWA 3CS0A 4HTCH 2TPIZ 2GX4A 1QRZA 2H9TH 1CA8B 1E0FD 1YM0A 3B9FH 2FM2A 1WV7H 2G81E 2VIVA 2IPHA 1L0ZA 1A5GH 1AZZA 3EA7A 5F8TA 3AVZA 1ZPCA 3B23B 1S85A 2BVSH 3SU1A 1TMTH 2B7DH 2LPRA 4NIXA 1TX6A 3PROA 2FWWA 1TPSA 2HVXA 3S7HB 5CHAC 3KGPA 3NWUA 2NU0E 2OC0A 3RXVA 1WU1A 5JBTA 5EW2H 1NY22 1Z7KA 1OOKB 2ANYA 1IQIA 1BJVA 1O2QA 3GOVB 1PPCE 2BDGA 3RXPA 1C1MA 1P2QA 3UNSA 4ZROA 3LIWA 3SV6A 1C2FA 2ZC9H 2K1QA 3P17H 3EDXB 2CHAB 1BA8B 5T3HA 1MH0A 4ZAEA 3OX7U 4BTIB 1AB9B 2PKSC 1FLEE 1V2WT 3PWBA 2A5AA 2OINA 3MHWU 2RA0A 1MTWA 1K28D 2A0QB 1UTKA 3K9XB 3FP6E 1HYLA 1O3JA 2ODQA 1ABIH 1O3EA 3SNCA 2FX6A 1C1NA 1KDQB 1XUGA 1INCA 3LC3A 1F0SA 2FOEA 1Z8GA 2FYRA 5A8YA 2FPZA 2BXTH 3TH2H 1TPOA 1YPHE 4A1VA 2C8WB 4QT8C 4K60A 1MBQA 1GVLA 1O2WA 1O3NA 1ZHRA 4FUDA 2XW9A 1QGFA 2JH5D 1O3FA 3TK5A 1Z8RA 2ZHEH 1O5BB 3TGIE 2QXIA 3RC4A 3PTNA 2B5TB 3TIUA 1Z6JH 3SN8A 3D62A 1BTHH 2BD5A 3RU4D 4K1EA 1D3QB 3A89A 1KXDA 1V2NT 2A4QA 2O8TA 1LHFH 1C2GA 1C5RA 2PHBA 3FVFB 1GI8B 3BTDE 1JRSA 5GIBA 1BTPA 1C5VA 1TRNA 2G5NA 1UVOA 2VH6A 1V2KT 4WWYA 2BDYA 2QCYA 4LOYH 1DWCH 1ELEE 1G3BA 1P57B 3DT0H 3LGIA 1HAGE 1O2NA 3PTBA 3SYJA 1EJNA 4K8BA 3SJ9A 1E34B 2FP7B 3L33A 3BTTE 1SMFE 3SJIA 1VCQA 2QC2A 3EGKH 1V2UT 3AAUA 4LZ1H 2XC4A 2FIRH 1BUIA 4JCNA 1C2DA 3SZNA 4O97A 1A0LA 3P70B 3TJNA 3SZEA 3UY9A 1L1JA 1O3CA 2XXLA 2IOTA 2ZU3A 4TPIZ 3FZDA 4VGCC 2SGFE 1Y3WA 4OS7A 1SFQB 2PKSB 3ZVBA 3RXIA 5DP4A 4U2WA 1ZTJA 1DXWA 1EOLA 4FU9A 3U1JB 5FPSA 3CS7A 3M35A 1Q3XA 2VWOA 2BY9X 1D9IA 4B2BA 6CHAB 1VITG 4X1QU 3SU0A 1P04A 1ELTA 1OYTH 1T8MA 1UCYE 4YT7H 1GHBG 3HK6B 5C1UA 4ZKRU 1D4PB 1O5DH 4D8NA 3H5CB 3ZVEA 2ZU1A 1O3DA 2BMGB 1WQVH 1TX8A 2F9BH 4D76A 1G36A 2Z9JA 3ZZDA 2ZG0H 1KTTB 1AFQB 1VGCC 3M5NA 2F9OA 1SPJA 2GKVE 3TH3H 1MD7A 1C9PA 1MQ6A 2GT7A 1VR1H 1AO5A 5E0JA 2ZDLA 5FX6A 2ESTE 5DP9A 2W7UA 4NWKA 1XUIA 4ASHA 4AYVB 4KTUA 1DM4B 2BQ6B 3U1IB 3QO6A 1XKAC 1EJAA 5JBBS 4Y8ZA 2XYAA 2ZGCA 1P2OA 1YYY1 2D2DA 9ESTA 1CHOF 1GMHF 1SLUB 5H4IB 1EUFA 2SGDE 1W7GH 1V2MT 2BX4A 3GCTG 1O39A 1P2NA 3Q00A 1BCUH 1WYKA 1C5LH 3BTFE 2P3UB 1ACBE 3GISB 3SUEA 3LH3A 1K1LA 3HPTB 1G3DA 1Q2WA 1TMUH 1GJCB 1A1RA 2FOHA 2M5TA 2VGCC 1QL9A 3UPEA 2BDCA 4YO9A 2AMDA 1P09A 3GCOA 1TNIA 4AB9A 1UTOA 1FY5A 4XOJA 1NM6A 3OY5U 2VB0A 2RA3A 5AVDA 2UWOA 1E36B 4XFQA 2VIOA 4DT7B 1PFXC 5A8ZA 3A8CA 1LKAA 4FUIA 2BLWA 1O32A 4XBCA 3I29A 3TGJE 1PPZA 3URDA 2GMTB 4I8JA 2FEQH 1C1QA 3SUFA 4A6LA 1HAVB 1C1OA 1IQNA 4BNRA 1TGBA 1KXAA 2GZ9A 2ZA5A 2BY5X 4MG3A 4ESTE 4X1SU 2C8ZB 3A88A 1Y3XA 4I32A 1GBEA 4X6PA 5FXLA 1DVAH 4K2YA 4OS5A 1BRAA 2VH0A 1UVUH 3F68H 4ZH8A 4Q80A 1O3BA 1O38A 2FDAA 3BIVH 1WOFA 2BD2A 5GWZA 2J4IA 2F9UA 3GY3A 1CGHA 1MCTA 1GCTC 1AKSB 2Q1JA 2FTMA 1GDUA 2LNCA 4I8LA 1QR3E 2HPQH 2VBCA 1YCPM 4YOIA 2OD3B 1SVPA 2FESH 1DDJA 4NIWA 2XTTB 4BANB 1CVWH 2PUQH 5JDUB 2ALPA 1QNJA 5E0GA 1ZPZA 3A83A 1TBRH 3GY8A 3SOSA 2J2UA 3SORA 4JZEH 4CREA 2R0LA 1QB6A 1O3IA 1P02A 1HJAB 5AHGH 3BIUH 4Y7AA 2ZHQH 1DWBH 1QL8A 3U98H 1KIGH 5LPFA 3SV9A 1GBKA 3GY2A 2ZHWH 3V3MA 1SGYE 2G8TA 1YPEH 1QBNA 3OYPA 3E1XB 1YLDA 2F9VA 2H2ZA 2XNIA 1V2PT 3ODFA 3SNAA 1EB2A 1NO9H 3M7TA 3F9FA 2EEKA 4MPVA 3OTJE 5FBEA 5GCHF 2BLVA 1ANCA 1QB9A 1GJ6A 3RXHA 4UONA 3P8OA 1C5ZB 2R0KA 3LT3A 3LH1A 3O8CA 3E0NB 1UTPA 1HUTH 3SBKA 1A5IA 3ZZ3A 5HMAA 2WINI 1GBBA 2A32A 1BTZA 1GMCF 1LQEA 1SGFA 1UTQA 3L3TA 4FVDA 2DUCA 2P8OB 1AI8H 3MU5A 1BHXB 2P95A 3SI4H 4E7RG 1FY3A 2Z9GA 4WF8A 1BBRK 1NRNH 5A09A 3D23A 3UFAA 3MNSA 3UR9A 1ZMJA 1GBMA 3T26A 3IG6B 5DP7A 2BDHA 2DE9A 2IN2A 2WV9A 3VGCB 3TVJB 2GT8A 1AD8H 2BVRH 4JZ1A 3V13A 3RLWH 3D65E 4B1TA 3ODDA 3LOXA 1ORFA 5GPIB 1E35B 1ELAA 2HNTE 1HB0B 1A5HA 1SBWA 1MAXA 1B0EA 4CBNA 2CF8H 3Q77A 2GCTB 4Y71A 1ZGVA 1ZJDA 3FAOA 2W7SA 2J92A 2PKAA 1O3OA 4X8VH 2ZNKH 3M5LA 5J4SA 3OSYA 5F8ZA 1THSH 1TE0A 4CRGA 2Y7ZA 1Y3VA 3ITIA 1S83A 4AORA 4YTAA 3AAVA 1HAXB 1ANDA 3Q3YA 3T28A 3MTYA 1NZQH 1TONA 1GMDF 3U69H 1TWXB 1C2IA 1QBVH 1O5CB 1JOUB 1A61H 2HLCA 1O2VA 2F3CE 3A84A 3LDXH 2ZGHA 2QXHA 2HWLB 3P8FA 1FY1A 4IGDA 4CRBA 3S9CA 2FI4E 1UCYH 3PV2A 1SGQE 4THNH 1ESAA 1EZUC 1P01A 1Y8TA 1C5TA 1OXGA 1TRMA 4A7IB 1CBWC 1Z8JB 2HGTH 5E8EH 2NU3E 1MCVA 1TBQH 4PROA 2Y5FA 2KAIA 1LMWB 1GBLA 3EA8A 5K0HA 1KXEA 2VVUA 3GCHC 4BAHB 8LPRA 2WPKS 1MBMA 1HIAB 4F49A 3QWCH 1TGSZ 2FX4A 2J95A 1PPBH 1NC6A 5JBCS 1KYNA 4NSVA 1D3DB 3ZYEA 1TMBH 4I7YH 1K1MA 1BBRH 1L4DA 1W13U 4Y10E 1C1SA 3GYLB 2DE8A 1S0RA 3GY5A 5T6GA 5A2MH 1S84A 1F0UA 2OC8A 2WYJA 1FI8A 1YPLH 3QZQA 4X1RU 1C5MD 1FIWA 1RTFB 3SUGA 3QLPH 5IYTA 5JB9S 1W2KH 1V2RT 2Z9KA 2ZGBH 1XUKA 4NFEA 1KLTA 4JZDH 3PMAB 1OKXA 1EPTA 2A4RA 3KQBA 4U30A 4FU7A 1RIWC 4X0WU 2ZPSA 4Z0KA 5I25A 5EG4A 1HAHH 2ZDMA 4DOQA 3ZZBA 1C5YB 5BRRE 4AOQA 3PLKA 1O5FH 2QXJA 1P9SA 2P16A 3P8GA 1OWKA 1G3EA 2D26C 3O8BA 1Y3YA 1CHGA 1C5SA 3BF6H 3RXEA 4K3JA 2FLBH 3BN9A 2ZFQH 3ZVAA 1O5GH 3GY4A 1DITH 3ZZ4A 2C93B 4KTCA 3TJVA 2EA3A 1BJUA 4CR9A 3RP2A 4IC5A 1HJ8A 3V7TA 1MU8B 3O8DA 3PLBA 1GBTA 1LQDB 5AFZH 1Y5BT 1ANEA 5FAHA 1CBWB 3UTUH 4CRFA 1P0SH 1GHVH 4HZHA 3SGAE 1TGNA 2OUAA 1LPKB 1QY6A 2BY7X 3VB6A 1AE5A 3BTQE 2PGBB 1QJ7B 4SGAE 1O3MA 4X6MA 5AFYH 1GI0A 2Z94A 3DFJA 1HXEH 2R2MB 3SGBE 2GDEH 3LGTA 2GV7A 3LGYA 5GDSH 2D1JA 1SQTA 4WXIA 1O2UA 1SGDE 4O3UA 4IN1A 4BXSA 1BTYA 2ANKH 3STIA 1QQUA 1YC0A 1THPB 1DSTA 4WVPE 2CMYA 1JIMA 4NIYA 1G2MA 1SGNE 3PV4A 3SQHE 1H8IH 1EAUA 2IJD1 1HRTH 3RU4E 2BD4A 1AIXH 5B6OA 2H9EH 3E0PB 3UREA 1MD8A
chains in the Genus database with same CATH superfamily
1P06A 3E6PH 1G32B 2JKHA 2ZO3H 2ZFTA 1ETRH 4B76A 2ZFFH 1DS2E 4GCHG 4JZIA 1TFXA 2PSXA 1C5OH 1Y3UA 1GBDA 1GI3A 1Z1JA 1FDPA 1AGJA 3DUXH 1N6XA 3G01A 4DW2U 5A8XA 2J38A 1GJ4H 5HGGA 3A8AA 2PR3A 4O9VA 3UR6A 4MQAA 5EQQA 4INLA 4MPWA 4X8TH 3BEUA 1IOEA 1BIOA 1LHEH 1PJPA 1RD3B 3PV5A 3RXAA 2VNTA 2WPIS 1C1PA 2TBSA 1A3EH 4CHAB 1SB1H 2TGAA 1S0QA 5HIYA 5C5NA 2JH6D 1GG6B 1QIXB 4K1SA 4Y79A 2UWLA 3UOPA 1NU9A 1HAZB 4WMEA 1FPHH 1GJ8B 1ZRBA 3T62A 3BTEE 4B6EA 3ZYDA 1WBGB 5AF9H 3BTGE 3LGVA 4XSKU 1GHAF 1J14A 1K21H 1O5AB 1W0ZU 3VB4A 2A31A 3TK6A 2GZ7A 2WV5A 1VITH 5HXFA 2EI6A 4A1XA 1AE8H 1P8VC 3NCLA 2UUKB 1TX7A 3LONA 3M3VA 5B6LA 1ZMNA 3KNXA 4HGCA 5CHAB 4TPYA 3RXQA 1T32A 4FOUC 1OYQA 3E91A 4Y7BA 1J8AA 3RMNH 1DFPA 1BQYA 1T31A 1EZSC 4CR5A 2RCEA 2FS9A 1ETSH 3U8OH 7GCHF 1P9UA 1F0RA 2Z9LA 1UHBB 2AIQA 1HAPH 3KYGA 4NIVA 4R8TB 4GHQA 3M5MA 3KCGH 1L4ZA 1P11E 5DKMA 4ABFA 1NN6A 2Z6BD 1IAUA 4X2XA 2BVXH 4I86A 2O8WA 3RMOH 2A7CA 1FZZA 5BPEA 2ZTZA 3OAAD 3RXCA 1KLIH 1TPAE 3LGWA 1A2CH 2BXUH 1ZTKA 4BTUB 1UJ1A 4FUFA 1K0HA 1LO6A 1W8BH 2A4OA 3MO3A 2PTNA 1DE7H 1QTFA 1HAYB 3TU7H 3EE0B 1RFNA 4YLQH 1EATA 3OY6U 3E3TA 4KKDA 3OE7D 4FUEA 1TABE 1GBJA 1T8LA 1KDQA 1RGQA 1N1LA 3W1EA 1O3AA 1SQOA 1G2LA 2J94A 2XCFA 1DUEA 3SJ8A 4ABJA 2IPQX 3KF2A 1MKXK 5FX5A 2P3FH 4RN6A 1NROH 2Z3EA 3H09A 3DSOA 1F92A 2PW8H 3GICB 1YPMH 2G52A 1E1RD 3MNXA 2ZTYA 3RXMA 1DLEA 1ZSLA 2FOFA 1FIZA 2BD9A 2FTLE 1T7CA 4FETA 7ESTE 5LPEA 3SUDA 1MTVA 3JZ1B 1O2PA 2ZP0H 1ZMLA 4JK6A 3HKIB 2WUBA 2ZTXA 3KEEA 3RUOA 1BBRE 1S81A 1JBUH 3VPKA 1TRYA 2ZFRH 1BT7A 3UNQA 2V3OH 5ESBA 1O3GA 4KGAA 1K1PA 1TBZH 2ZDVH 4P00A 2QF0A 3QX5H 4J2YB 4UDWH 3SI3H 2VIWA 1KXCA 2A2XH 3H7TA 5HIZA 2FOBA 3M36A 3E90B 1A0HB 2Y80A 3AW1A 1QQ4A 1DOJA 2HNTF 3S9AA 2OC1A 1O2OA 1SLVB 1W11U 2C3SA 1LPGB 8KME2 1LPZB 1ZR0A 1KTSB 1QRWA 1COWD 1GI5A 1YPJH 3RXRA 3KQEA 8GCHF 3RXOA 4SGBE 1QBOA 2WPMS 1GBIA 1WTGH 3ZZ9A 1SGEE 4TWYA 3S9BA 1LVOA 1NFWA 5E0HA 3RLYH 1BZXE 3PMJA 3ATMA 4VGCB 2ZECA 1IQFA 2NU1E 3SHAH 1C1WH 5SGAE 1FUJA 1QA7A 1YF4A 1YLNA 1XKBC 2ZHDA 5L2ZH 1C9TA 1FPCH 1OHHD 1NRPH 3GDUA 2BYAX 2BY8X 2BD7A 3SV2H 1Y5UT 4INKA 1ZZZA 1J16A 1O3LA 1RJXB 1RTLA 1DY9A 2PGQB 1OSSA 5C1YA 3DSPA 5GCHG 5K7RA 2A7JA 4AN7A 2GV6A 1C5QA 1WAYB 2ZKSA 4NZQA 2FYQA 1UK2A 3RXGA 1WUNH 2G4TA 1GMCG 2BY6X 3ESTA 2B8OH 4AB8A 2G55A 4ZKOU 1ARBA 4FVBA 2SNVA 1O0DH 2YNAA 4ISLA 3W95A 3W94A 1ZLRA 1O31A 2JETC 1V2JT 1VGCB 2BTCE 3ATWA 5FHTA 1HLTH 4I8GA 3WY8A 1GBHA 4Y8XA 1MKXH 5FPTA 3VFEA 1MTUA 2WZQA 2Y82A 2BZ6H 3NPSA 2VIQA 5EXLA 1VCPA 3Q3KA 1IQEA 1WSSH 2AERH 2TGPZ 2OQUA 4XDEA 4CH8B 4B71A 1SGTA 4AFUA 2CJIA 2BD3A 2STBE 2WPLS 5G4BA 4NA8A 3T29A 3TK9A 5KECA 2C90B 1P10A 2QIQA 1K2I1 4OGYA 1B5GH 1CT0E 1SGFG 1SOZA 1TNHA 2PP6A 1CA0C 1LVYA 4OGXA 1A0JA 4R0IA 2FI5E 3RXFA 3UNRA 1BITA 4GVUA 3VB3A 4ABHA 1BRUP 1EP6A 3UIRA 3TLOA 1O34A 2XWAA 3URCA 4B2CA 2O8UA 1ZSKA 2BD8A 3ATLA 1NFUA 3N99A 1LKBA 5L6NH 1BMAA 1RS0A 5JYIA 4FXGH 3VG8A 2A4GA 2K0QA 1A7SA 1P3EA 1TYNA 1XUFA 2H5CA 2P93A 2VGCB 4UEHH 3T5FH 1UVSH 1NRSH 2HOBA 1UTMA 4B74A 2YOLA 1SGCA 1W3CA 2ZDKA 4NA7A 4Y0ZE 1UTJA 1H9LB 1AQ7A 2C8XB 1GJAB 4B2AA 5FCKA 1DT2A 5EXNA 2OLGA 2XC0A 4UFDH 3A7ZA 4J1YA 1GMDG 2FMJA 3UWJH 1DSUA 5C20A 4IBLH 1FV9A 3RC5A 4XBBA 4Y11E 2I6SA 3BTME 2FI3E 4KTSA 1FMGA 3FO8D 1ELGA 4XBDA 2CF9H 8ESTE 4ZKNU 1HAVA 5ABWA 3U8RH 2OC7A 5C17A 3FOAA 3F3BA 4YZUA 2W26A 2OK5A 1E79D 3RXSA 4Y0YE 3ZZ7A 2XCNA 4YXWD 2FS8A 4ZXYH 4FU8A 1AU8A 3R3GB 3BEIB 2GP9B 4AGJA 1DY8A 5F6MA 1AUJA 4JYVH 1EASA 3LU9B 4UFGH 2TRMA 2F9PA 4BAQB 3RXLA 4GAWA 1G9IE 1GCTB 4NG9H 4WMFA 1K1NA 4ZHLU 3BTHE 1EZQA 2WV4A 1BTWA 2JIZD 3PO1C 5CHBA 1UTNA 1AKSA 1QA0A 4X2VA 2GTBA 1PPFE 1A3BH 1AVWA 2FOMB 1DUAA 3GY7A 1KXFA 4TWWA 3VB7A 1C1RA 1QCPA 3F6UH 3BEFB 1C2JA 2BOHB 2QYIA 1FAXA 1AWHB 2GCHF 2HRVA 1GI9B 1F5KU 1SI5H 1DLKB 2JH0D 2SGPE 1EOJA 1CA0B 1K9OE 1OWHA 2XBWA 5FBIA 5EODA 3RXDA 1S6FA 4WY3A 1OWEA 1C5NH 1P12E 1YLCA 1ESBA 4X6NA 2FOAA 3UUZA 1ZRKA 2BQ7B 1FX0B 2F43B 1P03A 3A7WA 1O2GH 4AGKA 3AK5A 1XM1A 1UK4A 4Y76A 4MDSA 2G51A 1C2LA 2OTVA 2XOKD 4Q7ZA 4IMZA 5EOKA 1GDNA 3GDSA 1TPPA 1F7ZA 1KLJH 2QXGA 4JMYA 5EJLA 1CU1A 4IC6A 1D6WA 3N7DA 4ISOA 4AX9H 2ILNA 3LJJA 2GJGA 1TALA 5J4QA 3SO3A 1YP9A 1SHYA 1G3CA 2OQ5A 2STAE 1GI1A 1XXFA 3FKSD 1ESTA 1IQHA 4ABIA 4OS1A 4ZUHA 4TY7A 1V2VT 2UUJB 3MNCA 4DG4A 1FNIA 2EY4C 1OX1A 1SGPE 1W10U 4Q7XA 1PPGE 5CMXH 1C5PA 4B73A 2Y7XA 3M7UA 1CGJE 4WJG2 4AG2A 3RMMH 1NS3A 4ZXXH 1C5WB 4BAKB 1DXPA 2WPHS 3FP7E 4I8KA 1ELFA 1QL7A 1L1NA 1DWEH 3O8RA 4GSOA 1H1BA 2P3TB 5TCAA 1YPGH 1SG8B 4P02A 4IS5A 2BDIA 5I46H 2G4UA 5EQSA 1TA6A 1TGCA 3MYWA 1SC8U 5GNDA 2YNBA 3TJUA 2V0BA 1NTPA 3FP8E 2H6MA 1NRRH 4RSPA 3HATH 4AFQA 1BHXF 3FFGA 4MLFB 1TAWA 4MNYA 4WXVA 4KP0A 1MTNC 2ZGJA 3I78A 5C5OA 4AG1A 1W7XH 1EB1H 2AFQB 4RKJB 3A85A 5C1XA 2HVYB 1FQ3A 2FODA 3ZVDA 1O37A 1UW7A 2ZU2A 1SFIA 2VU8E 1U6QA 3KHVA 4FUCA 3Q76A 1TNLA 2W6JD 1AB9C 4BOHA 4ABBA 1GHWH 2BQWB 1ELCA 1S82A 3M61U 5L2YH 5F53A 5TCCA 4AZ2B 4K69A 5JBAS 2Z3DA 3MU4A 4A1TA 4AYYB 2BLOA 1UVPA 1LVBA 2XRCA 2RDLA 3MO9A 2BLQA 4K1TA 2F83A 3LC5A 4I31A 4XE4A 1G37A 1RXPA 2L74A 4ISNA 2CN0H 1EP5A 2EQNA 1AFEH 4DIHH 1ETTH 1GI7B 2B0FA 1W14U 2PUXB 1ZTLA 1HFDA 5LH8A 1ELDE 3EA9A 2FOGA 1H9IE 3A8BA 1BRCE 1O3KA 1FONA 1B7XB 2ZFPH 3U9AH 1PPHE 1WDIA 1XVOA 3GCHB 4CRDA 3JZ2B 3BG4C 2J9NA 3K6YA 5DPAA 1BRBE 1AWFH 1UMAH 1T8OA 4MPUA 3A7YA 1LHGH 2ZEBA 1HAOH 1HIAA 1XUJA 2QF5A 1O33A 2VINA 2HLDD 4U01A 1FAKH 5ESTE 2V3HH 1J17T 1IHSH 1H4WA 3SNEA 4WH8A 1XMNB 5T6FA 1SHHB 2A5KA 3V12A 1BTUA 1ZYOA 6GCHF 4AFZA 1W12U 2V6NA 1Z6EA 4JK5A 1TLDA 1UVTH 3PWCA 4ABEA 2G00A 1MZDA 5T6DA 5HYOA 3SV7A 1GI4A 1XUHA 5EPYA 1GJ7B 1A4WH 2ZQ2A 4YLUA 4MNXA 3SV8A 1CT2E 1GHAG 1NRQH 1PYTD 4Y6DA 4X8SH 2QAAA 3PB1E 4ACBA 1HGTH 4FUBA 6ESTA 3F9EA 3N7EA 5C0TA 4X8UH 3HGPA 3VXEH 3RXUA 1RIWB 1SGIB 4D9QA 3PLPA 1K1OA 1ZHMA 1SL3A 2J98A 4HI3A 1V2TT 1MTNB 2CGAA 1ZPBA 1C2EA 1K1IA 2YMSB 1MAYA 2BDAA 1MUEB 2BM2A 3PMHB 2SNWA 2HALA 1EQ9A 3MU8A 1GWAA 1C2KA 5JB8S 3M7QA 4I33A 5EQRA 1QJ1B 1HBTH 2ZI2H 4H4FA 5GXPA 7GCHG 2W3IA 1T4UH 2O9QA 2Z9IA 3FZZA 4BXWA 2RG3A 1GL1A 2QN5T 3QTVH 6CHAC 3QZRA 1WCZA 1AVXA 2UWPA 1NFXA 1WQSA 4MTBA 4Y8YA 5FCRA 4E06H 5C0UA 4X2YA 3ATIA 3DHKH 1HPGA 5EPNA 2WHXA 3S69A 3ZVCA 4ZHAA 4YT6H 1P2KA 5JPMH 2SGEE 2Z7FE 1FXYA 3B8JA 2OBOA 3UAIC 2Y5GA 5HKKD 1M9UA 1JMOH 2FZZA 2THFB 1O2SA 1CE5A 2WPDD 1NESE 1AFQC 4UD9H 2ZIQH 1HV7A 1OWDA 5CDFE 1THRH 4RKOB 4H6TA 3BG4B 1EAIA 1A46H 1CGIE 1ZOMA 5DP6A 5E2OA 2NU4E 1OWJA 3ENSB 2SGAA 4NSYA 2Y5HA 3MWIU 2SGQE 3RM2H 4IW4E 3SJKA 2QF4A 3R0FA 1YPKH 1Q31A 2FO9A 1ZJKA 3OEHD 2XC5A 1O30A 1O2XA 3PM3A 4DVAU 4Q7YA 1VJ9U 5FPYA 1MMJN 1O5EH 2XWBI 1UK3A 3A87A 1J15A 3ZZ8A 3BSQA 1E37B 1PYTC 1SGRE 3RC6A 1W0JD 5DJ7A 4A5TS 2QY0B 1GJDB 1PQ7A 3SJOA 1V2ST 1Z8IB 3A7TA 1SSXA 1CHOG 1GMHG 3QTOH 4GCHF 5CE1A 2ZCLP 3SNDA 1KY9A 5IDKA 2CV3A 2FLRH 3U28C 1NU7B 1LDTT 3K2UA 1V3XA 3VEQB 3RMLH 4E7NA 2NU2E 3QGJA 4IN2A 3RDZA 1O2RA 4CRCA 3DD2H 2ODPA 4LK4A 3SU3A 2XBXA 3MH4A 3SW2B 3MH7A 4MNVA 2Q6GA 2GMTC 2J97A 4ZMAH 3M37A 2PLXA 4Z6AH 3ZZCA 1F2SE 8GCHG 2ASUB 3VXFH 1V2LT 1PPEE 3NK8A 1KSNA 1C2HA 5A0BA 1PQ8A 4DURA 2IJOB 1J9CH 1LHCH 1GBAA 1GJ9B 3RXBA 3S0NA 1UO6A 1TA2A 1LCYA 1X7AC 1T4VH 2OXSA 1TQ0B 2W3KA 3HKJB 1C1UH 4H6SB 1GGDC 1IQGA 1QRXA 2OP9A 2SFAA 1L2EA 4ABDA 4O3TA 2ALVA 3F9GA 1EXFA 1BDAA 2AH4X 1MKWK 1TQ7B 2BDBA 1OP8A 3OU0A 3P8NA 4OM9A 2EI7A 2ZF0H 1OP0A 2ZDNA 4JYUH 3A7XA 2Y6TA 1GHYH 4HFPB 2R9PA 3STJA 1LTOA 4ZKSU 2AGIX 3IWMA 2ZU4A 3SQEE 1O2HA 5HM2A 3N7OA 1O3HA 2BOKA 3HGNA 3P95A 4KELA 1BTXA 3UQOA 3RM0H 3L6PA 4LZ4B 1P2IA 3TITA 2NWNA 4H42U 3ZV8A 1TOMH 2WSSD 3ELAH 3T25A 3SHCH 1XX9A 5DP8A 3QN7A 1C5XB 1KXBA 3BTWE 1Z1IA 3D49H 3UWIA 4D7GA 1HJAC 3M3SA 3ZV9A 1QB1A 1TNGA 3T2NA 3H7OA 3LPRA 1GDQA 1Y59T 4RI0A 3SGQE 4DIIH 2VVVA 2XNDD 4ISIH 3EQ0H 2M2AA 1CO7E 1YPHC 3KN2A 1AUTC 1TIOA 1VITF 1O36A 4BAMB 3TGKE 3ATKA 1PQAA 1GVZA 3M3TA 1UHBA 1C4Y2 1HNEE 2J34A 2PV9B 3NZIA 3IITA 1GHBF 3GYMA 3A86A 5DG6A 3NKKA 1Z71A 2H1UA 5C94A 2GGVB 4E05H 2ZFSA 1C1TA 4JYTA 3GCNA 3TNTA 4ABAA 2KX4A 1O2IA 2P8OC 3KQDA 2ZDAH 2Q6FA 3QUMP 1SOTA 3MFJA 1AMHA 4WH6A 4D7FA 1FY8E 2TGDA 1P3CA 3RXKA 2GDDA 3VB5A 3WWBA 1PQ5A 3QDZB 1AZ8A 7LPRA 1N6YA 1SLWB 1GVKB 1ELBA 2VWLA 3VGCC 1K22H 4GPGA 5E2PA 1FY4A 5TJXA 1CT4E 3SU4A 4DCDA 4UFEH 2C4FH 2A7HA 3MH6A 4YOGA 3RXTA 1GGDB 2PKAB 2PFEA 1BMMH 4D9RA 1EPTC 1SQAA 2GCTC 5DK1A 1O2KA 1UTLM 3GCTF 1SLXB 2FXRA 2A1DB 1F0TA 2OCVB 3C1KA 1VZQH 2P59A 2XBYA 1O3PB 2BHGA 1EAWA 3HK3B 1LVMA 3Q3XA 1IQKA 1ZGIA 2VIDA 1WXRA 3KQCA 1MZAA 1TGTA 2HPPH 1ABJH 3P92A 3CENA 3TH4H 1MKWH 2V35A 1IHTH 1HJ9A 3OTPA 2AYWA 5PTPA 7KMEH 2A5IA 1DICA 4A92A 2ZZUH 1YCPK 3AW0A 4NGAH 2KR7A 2ZGXH 1QJ6B 2BZAA 4OS6A 1GBCA 1YKTA 1O2TA 5EW1H 4DJZB 1D6RA 2AEIH 5KGOA 2QA9E 2I6QA 3BV9B 2A2QH 1ARCA 1O2JA 1N8OC 3F9HA 4B75A 1H8DH 4DGJA 3QK1A 5T1VA 1UCYK 2EI8A 4GLYA 3MI4A 3SNBA 2H9HA 2JJ1D 2AMPA 2ZCKP 1OPHB 1C5UA 5HM9A 5EU8A 2P94A 2GCHG 1P2MA 3K6ZA 3M5OA 4O03A 2QE7D 2R3YA 1ZHPA 3RXJA 3UB0A 2KAIB 3F1SB 1DWDH 4NWLA 2ZHFH 4CRAA 3S7KB 4ZHMU 5C2ZA 4HG6A 2VVCA 3TPIZ 1NFYA 3PMBB 2D8WA 3V0XA 4FUGA 1O2ZA 2XBVA 1L1GA 1SKYE 4TT3D 5EXMA 3ZVGA 1HDTH 1OP2A 1S6HA 4UE7H 2Y81A 4CBOA 3MOCA 5DO4H 2VJ1A 2VWNA 1QFKH 2PWXA 1LHDH 1K1JA 6LPRA 1JRTA 1ELVA 1XVMA 1ZSJA 1NBMD 4TYDA 3EAJA 3KL6A 3SU2A 4ISHH 2CXVA 2JETB 2OBQA 2QGRA 4MPXA 1GL0E 1AN1E 4TSFD 4M7GA 3ZZ5A 3ZZ6A 1GJBB 2TGTA 1OS8A 1FN8A 2WYGA 1XXDA 2O8MA 3PYHA 1T8NA 1MQ5A 2EC9H 3DFLA 4X6OA 3P6ZB 5L30H 1EPTB 5ETXA 4GHTA 2W5EA 1O2LA 1CQQA 3SU6A 1MTSA 2UUYA 3EE7A 3AASA 4K8YA 2ZCHP 1EFRD 4OS2A 1DANH 3MO6A 3BG8A 3DA9B 3F2HA 1C4U2 2VIPA 1BOQA 3A80A 5A0AE 2F91A 3E8LA 2F4LA 1W0KD 5EJ1A 4WMDA 4X1PU 2QV1A 2ZQ1A 2V3MA 4FUJA 3KIDU 3E16B 4K5ZA 1AVGH 1HCGA 4Z1MD 1CSOE 1YCPH 1JXPA 1N8OB 3KYFA 2AGGX 4FUHA 4TY6A 4MVNA 1EKBB 3MMGA 4INHA 1DPOA 1C4V2 2ANMH 1AY6H 1IQLA 3NXPA 4YOJA 1NPMA 3ZVFA 1MU6B 5DP3A 2F9NA 4JZFH 2C8YB 2G5VA 2H5DA 2GZ8A 3NUMA 1D3TB 1F5LA 3T27A 4NCYA 3MH5A 5EGMA 1YY3A 1YGCH 1BMFD 1HAIH 1O35A 2ZPRA 4BAOB 2WPJS 3TJOA 1GBFA 1JWTA 4I8HA 4YESB 1AHTH 1YBWA 5LPRA 1QURH 1ANBA 5C67A 1RRKA 3GY6A 2O8LA 1W0YH 2ZU5A 3MU0A 2BB4A 1Y5AT 3CP7A 1WTHD 4NFFA 1F5RA 4IMQA 3QGNB 2Z3CA 1VJAU 1JIRA 5DP5A 1C1VH 1SR5C 5F8XA 1FN6A 1GHXH 2ULLA 3OEED 1IQJA 9LPRA 3I77A 1RTKA 4NA9H 3K65B 1EX3A 3PO1B 1C2MA 1GCDA 3EYDA 5DGJA 2GD4B 1E38B 1ID5H 2UUFB 3RU4T 3A7VA 3A81A 3MNBA 4ABGA 1EZXC 2AMQA 1O2YA 3LJOA 1S5SA 3TNSA 2VWMA 2AGEX 2CHAC 3FANA 5A0CA 5F03A 1EAXA 6GCHG 3A8DA 1HXFH 1P2JA 1B0FA 4LXBH 1D3PB 5GJ4B 4CH2B 1IQMA 1GI6A 3ZZAA 4B6FA 2ANWA 1DX5M 2WUCA 3A82A 4X2WA 2R3UA 2QF3A 4DY7B 4NZLA 3LKWA 1BMLA 3UOUA 2Q6DA 4F4OC 2AIPA 2KM0A 1O2MA 1OWIA 1EJMA 2R2WU 1GI2A 4MNWA 3SU5A 4AFSA 5LGOA 4GUXA 1TB6H 2ZWLH 2PTCE 1BMNH 4U32A 3GDVA 4M9FA 2FOCA 3MU1A 1TNJA 3UQVA 2TIOA 3C27B 3BTKE 1NT1A 4OS4A 1TNKA 4YM9A 4UFFH 1H9HE 1GHZA 3U8TH 4ASUD 3GS9A 1G30B 2AS9A 2BX3A 2ZPQA 2GVFA 2A45B 4BTTB 2HNTC 1GJ5H 1TOCB 1V2OT 1V6DA 1QHRB 4Q2KA 1V2QT 4CHAC 1FJSA 5C3NA 3LGUA 4X1NU 1GPZA 1GG6C 2ODYB 1S6LA 2PSYA 1BB0B 1P05A 2B9LA 1VCWA 3CS0A 4HTCH 2TPIZ 2GX4A 4Q4LA 1QRZA 2H9TH 1CA8B 1E0FD 1YM0A 3B9FH 2JDID 2KCPA 1WV7H 2FM2A 2G81E 2VIVA 2IPHA 1L0ZA 3WWFA 1A5GH 1AZZA 3EA7A 5F8TA 3AVZA 1ZPCA 3B23B 1S85A 2BVSH 3SU1A 4F55A 1TMTH 2B7DH 2LPRA 4NIXA 1TX6A 3PROA 2FWWA 1TPSA 2HVXA 3S7HB 5DN6D 5CHAC 3KGPA 3NWUA 2NU0E 2OC0A 3RXVA 1WU1A 5JBTA 5EW2H 1NY22 1Z7KA 1OOKB 2ANYA 1IQIA 1MABB 1BJVA 1O2QA 3GOVB 1PPCE 2BDGA 3RXPA 1C1MA 1P2QA 3UNSA 4ZROA 3LIWA 3SV6A 1C2FA 2ZC9H 2K1QA 3P17H 3EDXB 2CHAB 1BA8B 5T3HA 1MH0A 3NRLA 3OX7U 4ZAEA 4BTIB 1AB9B 2PKSC 1FLEE 1V2WT 3PWBA 2A5AA 2OINA 3MHWU 2RA0A 1MTWA 1K28D 2A0QB 1UTKA 3K9XB 3FP6E 1HYLA 1O3JA 1ABIH 1O3EA 2ODQA 3SNCA 4AC9A 2FX6A 1C1NA 1KDQB 1XUGA 1INCA 3LC3A 1F0SA 2KCOA 2FOEA 1Z8GA 2FYRA 2KCAA 5A8YA 2FPZA 2BXTH 3TH2H 1TPOA 1YPHE 4A1VA 2C8WB 4QT8C 4K60A 1MBQA 1GVLA 1O2WA 1O3NA 1ZHRA 2J5UA 4FUDA 2XW9A 1QGFA 2JH5D 1O3FA 3TK5A 1Z8RA 2ZHEH 1O5BB 3TGIE 2QXIA 3RC4A 3PTNA 2B5TB 3TIUA 1Z6JH 3SN8A 3D62A 1BTHH 2BD5A 3RU4D 4K1EA 1D3QB 3A89A 1KXDA 1V2NT 2A4QA 2O8TA 1LHFH 1C2GA 1C5RA 2PHBA 3FVFB 1GI8B 3BTDE 1JRSA 5GIBA 1BTPA 1C5VA 1TRNA 2G5NA 1UVOA 2VH6A 1V2KT 4WWYA 4ZCNA 2BDYA 2QCYA 4LOYH 1DWCH 1ELEE 1G3BA 1P57B 3DT0H 3LGIA 1HAGE 1O2NA 3PTBA 3SYJA 1EJNA 4K8BA 3SJ9A 1E34B 2FP7B 3L33A 3BTTE 1SMFE 3SJIA 1VCQA 2QC2A 3EGKH 1V2UT 3AAUA 4LZ1H 2XC4A 2FIRH 1BUIA 4JCNA 1C2DA 3SZNA 4O97A 1A0LA 3P70B 3TJNA 3SZEA 3UY9A 1L1JA 1O3CA 5EJZA 2XXLA 4DT4A 2IOTA 2ZU3A 4TPIZ 3FZDA 4VGCC 2SGFE 1Y3WA 4OS7A 1SFQB 2PKSB 3ZVBA 3RXIA 5DP4A 4U2WA 1ZTJA 2RFKC 3F2FA 1DXWA 1EOLA 4FU9A 3U1JB 5FPSA 3CS7A 3M35A 1Q3XA 2VWOA 2BY9X 1D9IA 4B2BA 6CHAB 1VITG 4X1QU 3SU0A 1P04A 1ELTA 1OYTH 1T8MA 1UCYE 4YT7H 1GHBG 3HK6B 5C1UA 4XRNA 4ZKRU 1D4PB 1O5DH 4D8NA 3H5CB 3ZVEA 2ZU1A 1O3DA 2BMGB 1WQVH 1TX8A 2F9BH 4D76A 1G36A 2Z9JA 3ZZDA 2ZG0H 1KTTB 1AFQB 1VGCC 3M5NA 2F9OA 1SPJA 2GKVE 4RT0A 3TH3H 1MD7A 1C9PA 1MQ6A 2GT7A 1VR1H 1AO5A 5E0JA 2ZDLA 5FX6A 2ESTE 5DP9A 2W7UA 4NWKA 1XUIA 4ASHA 4AYVB 4KTUA 2KCYA 1DM4B 2BQ6B 3F0OA 3U1IB 3QO6A 1XKAC 1EJAA 5JBBS 4Y8ZA 2XYAA 2ZGCA 1P2OA 1YYY1 2D2DA 9ESTA 1CHOF 1GMHF 1SLUB 5H4IB 1EUFA 2SGDE 1W7GH 1E1QD 1V2MT 2BX4A 3GCTG 1O39A 1P2NA 3Q00A 1BCUH 1WYKA 1C5LH 3BTFE 2P3UB 1ACBE 3GISB 3SUEA 3LH3A 1K1LA 3HPTB 1G3DA 1Q2WA 1TMUH 1GJCB 1A1RA 2FOHA 2M5TA 2VGCC 1QL9A 3UPEA 2BDCA 4YO9A 2AMDA 1P09A 3GCOA 1TNIA 4AB9A 1UTOA 1FY5A 2KFWA 4XOJA 1NM6A 3OY5U 2VB0A 2RA3A 5AVDA 2UWOA 3PRBA 1E36B 4XFQA 2VIOA 4DT7B 1PFXC 5A8ZA 3A8CA 1LKAA 4FUIA 2BLWA 1O32A 4XBCA 3I29A 3TGJE 1PPZA 3URDA 2GMTB 4I8JA 2FEQH 1C1QA 3SUFA 4A6LA 1HAVB 1C1OA 1VKYA 1IQNA 4BNRA 1TGBA 3KQ5A 1KXAA 2GZ9A 2ZA5A 1H8HD 2BY5X 4MG3A 4ESTE 4X1SU 2C8ZB 3A88A 1Y3XA 4I32A 1GBEA 4X6PA 5FXLA 1DVAH 4K2YA 4OS5A 1BRAA 2VH0A 1UVUH 3F68H 4ZH8A 4Q80A 1O3BA 1O38A 2FDAA 3BIVH 1WOFA 2BD2A 5GWZA 5EIYA 2J4IA 2F9UA 3GY3A 1QZ8A 1CGHA 1MCTA 1GCTC 1AKSB 2Q1JA 2FTMA 1GDUA 2LNCA 4I8LA 1QR3E 2HPQH 1H8ED 2VBCA 1YCPM 4YOIA 2OD3B 1SVPA 2FESH 1DDJA 3CNRA 4NIWA 2XTTB 3F0PA 4BANB 1CVWH 2PUQH 3OFND 2ALPA 1QNJA 5E0GA 5JDUB 1ZPZA 3A83A 1TBRH 3GY8A 3SOSA 2J2UA 3SORA 4JZEH 4CREA 2R0LA 1QB6A 1O3IA 1P02A 1HJAB 1NBME 5AHGH 3BIUH 4Y7AA 2ZHQH 1DWBH 1QL8A 3U98H 1KIGH 5LPFA 3SV9A 1GBKA 5IK2D 3GY2A 2ZHWH 3V3MA 1SGYE 2G8TA 1YPEH 1QBNA 3OYPA 3E1XB 1YLDA 3PRDA 2F9VA 2H2ZA 2XNIA 1V2PT 3ODFA 3SNAA 1EB2A 1NO9H 3M7TA 3F9FA 2EEKA 4MPVA 3OTJE 5FBEA 5GCHF 2BLVA 1ANCA 1QB9A 1GJ6A 3RXHA 4UONA 3P8OA 1C5ZB 2R0KA 3LT3A 3LH1A 3O8CA 3E0NB 1UTPA 1HUTH 3SBKA 1A5IA 3ZZ3A 5HMAA 2WINI 1GBBA 2AHME 2A32A 1BTZA 1GMCF 1LQEA 1SGFA 1UTQA 3L3TA 4FVDA 2DUCA 2P8OB 1AI8H 3MU5A 1BHXB 2P95A 3SI4H 3DSGA 4E7RG 1FY3A 2Z9GA 4WF8A 1BBRK 1NRNH 5A09A 3D23A 3UFAA 3MNSA 3UR9A 1ZMJA 1GBMA 3T26A 3IG6B 2WV9A 2BDHA 2DE9A 2IN2A 5DP7A 3VGCB 3TVJB 2GT8A 1AD8H 2BVRH 4JZ1A 3V13A 3RLWH 3D65E 4B1TA 3ODDA 3LOXA 1ORFA 5GPIB 1E35B 1ELAA 2HNTE 1HB0B 1A5HA 5FL7D 1SBWA 1MAXA 1B0EA 4CBNA 2CF8H 3Q77A 2GCTB 4ACAA 4Y71A 1ZGVA 1ZJDA 3FAOA 2W7SA 2J92A 2PKAA 1O3OA 4X8VH 3DCLA 2ZNKH 3M5LA 5J4SA 3OSYA 3WW7A 5F8ZA 1THSH 1TE0A 4CRGA 2Y7ZA 1Y3VA 3ITIA 1S83A 2YMSD 4AORA 4YTAA 3AAVA 1HAXB 1ANDA 2RDEA 3Q3YA 3T28A 3MTYA 1NZQH 1TONA 1GMDF 3U69H 1TWXB 1C2IA 1QBVH 1O5CB 1JOUB 1A61H 2HLCA 1O2VA 2F3CE 2LP6A 3A84A 3LDXH 2ZGHA 4RT1A 2QXHA 2HWLB 3P8FA 1FY1A 4IGDA 3PV2A 4CRBA 2FI4E 1UCYH 3S9CA 1SGQE 4THNH 1ESAA 1EZUC 1P01A 1Y8TA 1C5TA 1OXGA 1TRMA 4A7IB 1CBWC 1Z8JB 2HGTH 5E8EH 2NU3E 1MCVA 1TBQH 4PROA 2Y5FA 2KAIA 1LMWB 1GBLA 3EA8A 5K0HA 1KXEA 4F48B 2VVUA 3GCHC 4BAHB 2LELA 8LPRA 2WPKS 1MBMA 1HIAB 4F49A 3QWCH 1TGSZ 3F2GA 2FX4A 2J95A 1PPBH 1NC6A 5JBCS 1KYNA 4NSVA 1D3DB 3ZYEA 1TMBH 4I7YH 1K1MA 1BBRH 1L4DA 1W13U 2W6ID 4Y10E 1C1SA 4XD7D 3GYLB 2DE8A 1S0RA 3GY5A 5T6GA 5A2MH 1S84A 1F0UA 2OC8A 2WYJA 1FI8A 1YPLH 3QZQA 4X1RU 1C5MD 1FIWA 1RTFB 3SUGA 2K8IA 2L6OA 3ZIAD 3QLPH 5IYTA 5JB9S 3FN8A 1W2KH 2JJ2D 1V2RT 2Z9KA 2ZGBH 1XUKA 1KMHB 4NFEA 1KLTA 4JZDH 2J98B 3PMAB 1OKXA 1EPTA 2A4RA 3KQBA 4U30A 4FU7A 1RIWC 4X0WU 2ZPSA 4Z0KA 5I25A 5EG4A 1HAHH 2ZDMA 4DOQA 3ZZBA 1C5YB 5BRRE 4AOQA 3PLKA 1O5FH 2QXJA 1P9SA 1YWUA 2P16A 2YMSC 3P8GA 1OWKA 1G3EA 2D26C 3O8BA 1Y3YA 1CHGA 1C5SA 3BF6H 3RXEA 4K3JA 2FLBH 3BN9A 2ZFQH 3ZVAA 1O5GH 3GY4A 1DITH 3ZZ4A 2C93B 4KTCA 3TJVA 2EA3A 1BJUA 4CR9A 3RP2A 4IC5A 1HJ8A 3V7TA 1MU8B 3O8DA 3PLBA 1GBTA 1LQDB 5AFZH 1Y5BT 1ANEA 5FAHA 1CBWB 5KEDA 3UTUH 4CRFA 1P0SH 1GHVH 4HZHA 3SGAE 1TGNA 2OUAA 2KZ4A 1LPKB 1QY6A 2BY7X 3VB6A 1AE5A 3BTQE 2PGBB 1QJ7B 4SGAE 1O3MA 4X6MA 1SQRA 5AFYH 1GI0A 2Z94A 3DFJA 1HXEH 2R2MB 3SGBE 2GDEH 3LGTA 2GV7A 3LGYA 5GDSH 2D1JA 1SQTA 4WXIA 1O2UA 4Q63A 1SGDE 4O3UA 4IN1A 4BXSA 1BTYA 2ANKH 3STIA 1QQUA 1YC0A 1THPB 1DSTA 4WVPE 2CMYA 1JIMA 4NIYA 5DSFA 1G2MA 3MQKC 1SGNE 3PV4A 2V7QD 2CK3D 3SQHE 1H8IH 1EAUA 2IJD1 1HRTH 3RU4E 2BD4A 1AIXH 5B6OA 2H9EH 3E0PB 3UREA 1MD8A
chains in the Genus database with same CATH topology
1P06A 3E6PH 1G32B 2JKHA 2ZO3H 2ZFTA 1ETRH 4B76A 2ZFFH 1DS2E 4GCHG 4JZIA 1TFXA 2PSXA 1C5OH 1Y3UA 1GBDA 1GI3A 1Z1JA 1FDPA 1AGJA 3DUXH 1N6XA 3G01A 4DW2U 5A8XA 2J38A 1GJ4H 5HGGA 3A8AA 2PR3A 4O9VA 3UR6A 4MQAA 5EQQA 4INLA 4MPWA 4X8TH 3BEUA 1IOEA 1BIOA 1LHEH 1PJPA 1RD3B 3RXAA 3PV5A 2VNTA 2WPIS 1C1PA 2TBSA 1A3EH 4CHAB 1SB1H 2TGAA 1S0QA 5C5NA 2JH6D 1GG6B 1QIXB 4K1SA 4Y79A 2UWLA 3UOPA 1NU9A 1HAZB 4WMEA 1FPHH 1GJ8B 1ZRBA 3T62A 3BTEE 4B6EA 3ZYDA 1WBGB 5AF9H 3BTGE 3LGVA 4XSKU 1GHAF 1J14A 1K21H 1O5AB 1W0ZU 3VB4A 2A31A 3TK6A 2GZ7A 2WV5A 1VITH 5HXFA 2EI6A 4A1XA 1AE8H 1P8VC 3NCLA 2UUKB 1TX7A 3LONA 3M3VA 5B6LA 1ZMNA 3KNXA 4HGCA 5CHAB 4TPYA 3RXQA 1T32A 1OYQA 3E91A 4Y7BA 1J8AA 3RMNH 1DFPA 1BQYA 1T31A 1EZSC 4CR5A 2RCEA 2FS9A 1ETSH 3U8OH 7GCHF 1P9UA 1F0RA 2Z9LA 1UHBB 2AIQA 1HAPH 4NIVA 4R8TB 4GHQA 3M5MA 3KCGH 1L4ZA 1P11E 5DKMA 4ABFA 1NN6A 2Z6BD 1IAUA 4X2XA 2BVXH 3RMOH 2O8WA 2A7CA 1FZZA 5BPEA 2ZTZA 3OAAD 3RXCA 1KLIH 1TPAE 3LGWA 1A2CH 2BXUH 1ZTKA 4BTUB 1UJ1A 4FUFA 1LO6A 1W8BH 2A4OA 3MO3A 2PTNA 1DE7H 1QTFA 1HAYB 3TU7H 3EE0B 1RFNA 4YLQH 1EATA 3OY6U 3E3TA 4KKDA 3OE7D 4FUEA 1TABE 1GBJA 1T8LA 1KDQA 1RGQA 1N1LA 3W1EA 1O3AA 1SQOA 1G2LA 2J94A 2XCFA 1DUEA 3SJ8A 4ABJA 3KF2A 1MKXK 5FX5A 2P3FH 4RN6A 1NROH 2Z3EA 3H09A 3DSOA 1F92A 2PW8H 3GICB 1YPMH 2G52A 1E1RD 3MNXA 2ZTYA 3RXMA 1DLEA 1ZSLA 2FOFA 1FIZA 2BD9A 2FTLE 1T7CA 7ESTE 5LPEA 4FETA 3SUDA 1MTVA 3JZ1B 1O2PA 2ZP0H 1ZMLA 4JK6A 3HKIB 2WUBA 2ZTXA 3KEEA 3RUOA 1BBRE 1S81A 1JBUH 3VPKA 1TRYA 2ZFRH 1BT7A 3UNQA 2V3OH 5ESBA 1O3GA 4KGAA 1K1PA 1TBZH 2ZDVH 2QF0A 3QX5H 4J2YB 4UDWH 3SI3H 2VIWA 1KXCA 2A2XH 3H7TA 2FOBA 3M36A 3E90B 1A0HB 2Y80A 3AW1A 1QQ4A 1DOJA 2HNTF 3S9AA 2OC1A 1O2OA 1SLVB 1W11U 2C3SA 1LPGB 8KME2 1LPZB 1ZR0A 1KTSB 1QRWA 1GI5A 1COWD 1YPJH 3RXRA 3KQEA 8GCHF 3RXOA 4SGBE 1QBOA 2WPMS 1GBIA 1WTGH 3ZZ9A 1SGEE 4TWYA 3S9BA 1LVOA 1NFWA 5E0HA 3RLYH 1BZXE 3PMJA 3ATMA 4VGCB 2ZECA 1IQFA 2NU1E 3SHAH 1C1WH 5SGAE 1FUJA 1QA7A 1YF4A 1XKBC 2ZHDA 5L2ZH 1C9TA 1FPCH 1OHHD 1NRPH 3GDUA 2BYAX 2BY8X 2BD7A 3SV2H 1Y5UT 4INKA 1ZZZA 1J16A 1O3LA 1RJXB 1RTLA 1DY9A 2PGQB 1OSSA 5C1YA 3DSPA 5GCHG 5K7RA 2A7JA 4AN7A 2GV6A 1C5QA 1WAYB 2ZKSA 4NZQA 2FYQA 1UK2A 3RXGA 1WUNH 2G4TA 1GMCG 2BY6X 3ESTA 2B8OH 4AB8A 2G55A 4ZKOU 1ARBA 4FVBA 2SNVA 1O0DH 2YNAA 4ISLA 3W95A 3W94A 1ZLRA 1O31A 2JETC 1V2JT 1VGCB 2BTCE 3ATWA 5FHTA 1HLTH 4I8GA 3WY8A 1GBHA 4Y8XA 1MKXH 5FPTA 3VFEA 1MTUA 2WZQA 2Y82A 2BZ6H 3NPSA 2VIQA 5EXLA 1VCPA 3Q3KA 1IQEA 1WSSH 2AERH 2TGPZ 2OQUA 4XDEA 4CH8B 4B71A 1SGTA 4AFUA 2CJIA 2BD3A 2STBE 2WPLS 5G4BA 4NA8A 3T29A 3TK9A 2C90B 1P10A 2QIQA 1K2I1 4OGYA 1B5GH 1CT0E 1SGFG 1SOZA 1TNHA 1CA0C 1LVYA 4OGXA 1A0JA 4R0IA 2FI5E 3RXFA 3UNRA 1BITA 4GVUA 3VB3A 4ABHA 1BRUP 1EP6A 3UIRA 3TLOA 1O34A 2XWAA 3URCA 4B2CA 2O8UA 1ZSKA 2BD8A 3ATLA 1NFUA 5L6NH 1LKBA 3N99A 1BMAA 1RS0A 5JYIA 4FXGH 3VG8A 2A4GA 1A7SA 1P3EA 2H5CA 1TYNA 1XUFA 2P93A 4UEHH 2VGCB 2K0QA 3T5FH 1UVSH 1NRSH 2HOBA 1UTMA 4B74A 2YOLA 1SGCA 1W3CA 2ZDKA 4NA7A 4Y0ZE 1UTJA 1H9LB 1AQ7A 2C8XB 1GJAB 4B2AA 5FCKA 1DT2A 5EXNA 2OLGA 2XC0A 4UFDH 3A7ZA 4J1YA 1GMDG 2FMJA 3UWJH 1DSUA 5C20A 4IBLH 1FV9A 3RC5A 4XBBA 4Y11E 2I6SA 3BTME 2FI3E 4KTSA 1FMGA 3FO8D 1ELGA 4XBDA 2CF9H 8ESTE 4ZKNU 1HAVA 5ABWA 3U8RH 2OC7A 5C17A 3FOAA 4YZUA 3F3BA 2W26A 2OK5A 1E79D 3RXSA 4Y0YE 3ZZ7A 2XCNA 4YXWD 2FS8A 4ZXYH 4FU8A 1AU8A 3R3GB 3BEIB 2GP9B 4AGJA 1DY8A 5F6MA 1AUJA 4JYVH 1EASA 3LU9B 4UFGH 2TRMA 2F9PA 4BAQB 3RXLA 4GAWA 1G9IE 1GCTB 4NG9H 4WMFA 1K1NA 4ZHLU 3BTHE 1EZQA 2WV4A 1BTWA 2JIZD 3PO1C 5CHBA 1UTNA 1AKSA 1QA0A 4X2VA 2GTBA 1PPFE 1A3BH 1AVWA 2FOMB 1DUAA 3GY7A 1KXFA 4TWWA 3VB7A 1C1RA 1QCPA 3F6UH 3BEFB 1C2JA 2BOHB 2QYIA 1FAXA 1AWHB 2GCHF 2HRVA 1GI9B 1F5KU 1SI5H 1DLKB 2JH0D 2SGPE 1EOJA 1CA0B 1K9OE 1OWHA 2XBWA 5FBIA 5EODA 3RXDA 1S6FA 4WY3A 1OWEA 1C5NH 1P12E 1YLCA 1ESBA 4X6NA 2FOAA 3UUZA 1ZRKA 2BQ7B 1FX0B 2F43B 1P03A 3A7WA 1O2GH 4AGKA 3AK5A 1XM1A 1UK4A 4Y76A 4MDSA 2G51A 1C2LA 2OTVA 2XOKD 4Q7ZA 4IMZA 5EOKA 1GDNA 3GDSA 1TPPA 1F7ZA 1KLJH 2QXGA 4JMYA 1CU1A 4IC6A 1D6WA 3N7DA 4ISOA 4AX9H 2ILNA 3LJJA 1TALA 5J4QA 3SO3A 1YP9A 1SHYA 1G3CA 2OQ5A 2STAE 1GI1A 1XXFA 4ABIA 1ESTA 1IQHA 3FKSD 4OS1A 4ZUHA 4TY7A 1V2VT 2UUJB 3MNCA 4DG4A 1FNIA 1OX1A 1SGPE 1W10U 4Q7XA 1PPGE 5CMXH 1C5PA 4B73A 2Y7XA 3M7UA 1CGJE 4WJG2 4AG2A 3RMMH 1NS3A 4ZXXH 1C5WB 4BAKB 1DXPA 2WPHS 3FP7E 4I8KA 1ELFA 1QL7A 1L1NA 1DWEH 3O8RA 4GSOA 1H1BA 2P3TB 5TCAA 1YPGH 1SG8B 4IS5A 2BDIA 5I46H 2G4UA 5EQSA 1TA6A 1TGCA 3MYWA 1SC8U 5GNDA 2YNBA 3TJUA 2V0BA 1NTPA 3FP8E 2H6MA 1NRRH 4RSPA 3HATH 4AFQA 1BHXF 3FFGA 4MLFB 1TAWA 4MNYA 4WXVA 4KP0A 1MTNC 2ZGJA 3I78A 5C5OA 4AG1A 1W7XH 1EB1H 2AFQB 4RKJB 3A85A 5C1XA 1FQ3A 2FODA 3ZVDA 1O37A 2ZU2A 1SFIA 2VU8E 1U6QA 3KHVA 4FUCA 3Q76A 1TNLA 4BOHA 1AB9C 2W6JD 4ABBA 1GHWH 2BQWB 1ELCA 1S82A 3M61U 5L2YH 5TCCA 5F53A 4AZ2B 4K69A 5JBAS 2Z3DA 3MU4A 4A1TA 4AYYB 2BLOA 1UVPA 1LVBA 2XRCA 2RDLA 3MO9A 2BLQA 4K1TA 2F83A 3LC5A 4I31A 4XE4A 1G37A 1RXPA 4ISNA 2CN0H 1EP5A 1AFEH 4DIHH 1ETTH 1GI7B 2B0FA 1W14U 2PUXB 1ZTLA 1HFDA 5LH8A 1ELDE 3EA9A 2FOGA 1H9IE 3A8BA 1BRCE 1O3KA 1FONA 1B7XB 2ZFPH 3U9AH 1PPHE 1XVOA 3GCHB 4CRDA 3JZ2B 3BG4C 2J9NA 3K6YA 5DPAA 1BRBE 1AWFH 1UMAH 1T8OA 4MPUA 3A7YA 1LHGH 2ZEBA 1HAOH 1HIAA 1XUJA 2QF5A 1O33A 2VINA 2HLDD 4U01A 1FAKH 5ESTE 2V3HH 1J17T 1IHSH 1H4WA 3SNEA 4WH8A 1XMNB 5T6FA 1SHHB 2A5KA 3V12A 1BTUA 1ZYOA 6GCHF 4AFZA 1W12U 2V6NA 1Z6EA 4JK5A 1TLDA 1UVTH 3PWCA 4ABEA 2G00A 1MZDA 5T6DA 5HYOA 3SV7A 1GI4A 1XUHA 5EPYA 1GJ7B 1A4WH 2ZQ2A 4YLUA 4MNXA 3SV8A 1CT2E 1GHAG 1NRQH 1PYTD 4Y6DA 4X8SH 2QAAA 3PB1E 1HGTH 4FUBA 6ESTA 3F9EA 3N7EA 5C0TA 4X8UH 3HGPA 3VXEH 3RXUA 1RIWB 1SGIB 4D9QA 3PLPA 1K1OA 1ZHMA 1SL3A 4HI3A 1V2TT 1MTNB 2CGAA 1ZPBA 1C2EA 1K1IA 2YMSB 1MAYA 2BDAA 1MUEB 2BM2A 3PMHB 2SNWA 2HALA 1EQ9A 3MU8A 1GWAA 1C2KA 5JB8S 3M7QA 4I33A 5EQRA 1QJ1B 1HBTH 2ZI2H 4H4FA 5GXPA 7GCHG 2W3IA 1T4UH 2O9QA 2Z9IA 3FZZA 4BXWA 2RG3A 1GL1A 2QN5T 3QTVH 6CHAC 3QZRA 1WCZA 1AVXA 2UWPA 1NFXA 1WQSA 4MTBA 4Y8YA 5FCRA 4E06H 5C0UA 4X2YA 3ATIA 3DHKH 1HPGA 5EPNA 3S69A 2WHXA 3ZVCA 4ZHAA 4YT6H 1P2KA 5JPMH 2SGEE 2Z7FE 1FXYA 3B8JA 2OBOA 5HKKD 2Y5GA 1M9UA 1JMOH 2FZZA 2THFB 1O2SA 1CE5A 2WPDD 1NESE 1AFQC 4UD9H 2ZIQH 1HV7A 1OWDA 5CDFE 1THRH 4RKOB 4H6TA 3BG4B 1EAIA 1A46H 1CGIE 1ZOMA 5DP6A 5E2OA 2NU4E 1OWJA 3ENSB 2SGAA 4NSYA 2Y5HA 3MWIU 2SGQE 3RM2H 4IW4E 3SJKA 3R0FA 2QF4A 1YPKH 1Q31A 2FO9A 1ZJKA 3OEHD 2XC5A 1O30A 1O2XA 3PM3A 4DVAU 4Q7YA 1VJ9U 5FPYA 1MMJN 1O5EH 2XWBI 1UK3A 3A87A 1J15A 3ZZ8A 3BSQA 1E37B 1PYTC 1SGRE 3RC6A 1W0JD 5DJ7A 4A5TS 2QY0B 1GJDB 1PQ7A 3SJOA 1V2ST 1Z8IB 3A7TA 1SSXA 1CHOG 1GMHG 3QTOH 4GCHF 5CE1A 2ZCLP 3SNDA 1KY9A 5IDKA 2CV3A 2FLRH 1NU7B 1LDTT 3K2UA 1V3XA 3VEQB 3RMLH 4E7NA 2NU2E 3QGJA 4IN2A 3RDZA 1O2RA 4CRCA 3DD2H 2ODPA 4LK4A 3SU3A 2XBXA 3MH4A 3SW2B 3MH7A 4MNVA 2Q6GA 2GMTC 4ZMAH 3M37A 2PLXA 4Z6AH 3ZZCA 1F2SE 8GCHG 2ASUB 3VXFH 1V2LT 1PPEE 3NK8A 1KSNA 1C2HA 5A0BA 1PQ8A 4DURA 2IJOB 1J9CH 1LHCH 1GBAA 1GJ9B 3RXBA 3S0NA 1UO6A 1TA2A 1LCYA 1X7AC 1T4VH 2OXSA 1TQ0B 2W3KA 3HKJB 1C1UH 4H6SB 1GGDC 1IQGA 1QRXA 2OP9A 2SFAA 1L2EA 4ABDA 4O3TA 2ALVA 3F9GA 1EXFA 1BDAA 2AH4X 1MKWK 1TQ7B 2BDBA 1OP8A 3OU0A 3P8NA 4OM9A 2EI7A 2ZF0H 1OP0A 2ZDNA 4JYUH 3A7XA 2Y6TA 1GHYH 4HFPB 2R9PA 3STJA 1LTOA 4ZKSU 2AGIX 3IWMA 2ZU4A 3SQEE 1O2HA 5HM2A 3N7OA 1O3HA 2BOKA 3HGNA 3P95A 4KELA 1BTXA 3UQOA 3RM0H 3L6PA 4LZ4B 1P2IA 3TITA 2NWNA 4H42U 3ZV8A 1TOMH 3ELAH 2WSSD 3T25A 3SHCH 1XX9A 5DP8A 3QN7A 1C5XB 1KXBA 3BTWE 1Z1IA 3D49H 3UWIA 4D7GA 1HJAC 3M3SA 3ZV9A 1QB1A 1TNGA 3T2NA 3H7OA 3LPRA 1GDQA 1Y59T 3SGQE 4DIIH 4RI0A 2VVVA 2XNDD 4ISIH 3EQ0H 2M2AA 1CO7E 1YPHC 3KN2A 1AUTC 1TIOA 1VITF 1O36A 4BAMB 3TGKE 3ATKA 1PQAA 1GVZA 3M3TA 1UHBA 1C4Y2 1HNEE 2J34A 2PV9B 3NZIA 3IITA 1GHBF 3GYMA 3A86A 5DG6A 3NKKA 1Z71A 2H1UA 2GGVB 4E05H 2ZFSA 1C1TA 4JYTA