3OYPA

Hcv ns3/4a in complex with ligand 3
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
174
structure length
174
Chain Sequence
PITAYSQQTRGLLGCIITSLTGRDKNQVDGEVQVLSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWPAPPGARSMTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHVVGIFRAAVCTRGVAKAVDFIPVESM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Serine protease NS3
publication title Selective irreversible inhibition of a protease by targeting a noncatalytic cysteine.
pubmed doi rcsb
source organism Hepatitis c virus (isolate japanese)
total genus 38
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3oypA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3oypA01
3STIA 5DGJA 2FEQH 3MI4A 1PPEE 2ZQ1A 2J94A 3PMJA 1OPHB 5C1YA 1BRAA 3MNSA 2G4UA 1O3PB 2QYIA 2VWOA 3ESTA 3RXHA 1HJAC 2P3TB 3W94A 4ZH8A 4UE7H 2CF9H 6CHAC 4TPYA 4ZKOU 1GGDB 3RXOA 1WUNH 1BBRH 2EEKA 4IBLH 3Q77A 2Z9GA 2H9TH 1KY9A 3ZZ4A 4I7YH 3K65B 1HAVA 2ZECA 2O8WA 2R0LA 4NIVA 1TNIA 3UR6A 2QF0A 1YLCA 5A0BA 1O38A 2UUYA 1C2KA 1WQVH 3PO1C 2FOHA 2CN0H 1HDTH 2GDDA 3RM2H 2FYQA 4D76A 2NWNA 1HAHH 1K28D 3SHAH 2QV1A 2PTNA 3RXKA 1LVBA 1GMCG 3RC4A 4AZ2B 1AVWA 1YPKH 4B6FA 2BD2A 2KAIA 1IHTH 4X2YA 3RU4T 1MAYA 1LQEA 1A7SA 1K21H 3DT0H 1C1SA 1O5CB 3BTHE 3PB1E 3SV7A 3SW2B 3LGWA 3TGJE 4OM9A 3QUMP 3ENSB 3O8RA 2H6MA 3MO6A 3BTKE 1W14U 8ESTE 1FY4A 3E8LA 2XC4A 1EXFA 4Y11E 3SZEA 1GGDC 1SR5C 1UTLM 2Z3EA 1AO5A 3ATKA 3GY8A 2C8WB 2ZG0H 3BIUH 3RC5A 3CS7A 1F0SA 3V13A 1A0HB 3CS0A 3SYJA 1DUEA 1TA2A 2XC5A 2NU0E 3BN9A 1TGCA 3EA8A 3SU0A 5IDKA 3TJNA 1O5DH 1JRSA 1FAKH 2GTBA 1O5BB 1C2JA 1PYTC 1BDAA 1F7ZA 1TNKA 7ESTE 4X6MA 1N1LA 1F5RA 4NIYA 1LDTT 3LGVA 4TWYA 3TK5A 3EYDA 3ZYDA 2BLOA 2O9QA 3RXAA 2Z9LA 1KLTA 2VBCA 4I8JA 5HYOA 2CV3A 3UOPA 3BTQE 1FXYA 1H9IE 1O3FA 1ZGVA 1YP9A 5C20A 3U8RH 1GHWH 2AGGX 4WH6A 2J9NA 4X6OA 4DURA 2B5TB 1CA8B 1FY8E 1FN8A 2G8TA 1A5GH 4CRCA 2D8WA 2XTTB 5J4QA 2A2QH 1HAZB 2WV9A 1C2DA 4FU8A 1OWDA 2DUCA 1ZTKA 2H9HA 1XUJA 3KGPA 4VGCB 2BLQA 3ZZBA 1G9IE 3UOUA 2TGAA 1GI5A 1XUGA 2OP9A 4WWYA 3E0NB 3NKKA 2A4QA 1D3QB 3HATH 4JK5A 1MKWH 1UMAH 2ANMH 3QO6A 4K69A 4RKOB 1ZYOA 1G32B 2VB0A 4ABIA 2PKAA 3LONA 1BRCE 2ZFTA 1GJCB 1O2OA 1JMOH 4BXWA 1ELEE 1VJ9U 3RP2A 2CXVA 2A4GA 4BAHB 1GI0A 4K3JA 2ZDKA 1V2MT 1H9LB 2WPMS 3HK6B 3T5FH 1HXEH 4JYTA 4B75A 3IITA 3SGBE 3U1IB 2GX4A 5LPRA 3QN7A 3Q3YA 3F9GA 4WJG2 3TJUA 2QXIA 3HGNA 1RIWB 1C5PA 3V0XA 4A1TA 1QNJA 3SJOA 3AW1A 3NWUA 4ABAA 3O8CA 2BVXH 3QK1A 2CF8H 4ZHAA 1GJ8B 4X8UH 1OX1A 1EX3A 4VGCC 2GT7A 2ODQA 1OP8A 3GCNA 2ZDVH 1GVKB 2V35A 1YPMH 1F5LA 3U98H 1MZAA 2ZC9H 1V2VT 1OYQA 2FOBA 3QGNB 1ELDE 3BEIB 1KIGH 1MTUA 1RRKA 1DUAA 1O34A 1SOZA 2C8XB 4QT8C 2NU1E 2PV9B 3KN2A 3P95A 4GAWA 1QL7A 4B2BA 2QXHA 5DK1A 1K1OA 4D7FA 1IQEA 4K1SA 1FUJA 1D4PB 2ZDMA 2QY0B 1GL0E 1YGCH 5EU8A 1UCYE 1A5IA 1BTZA 4BOHA 3I78A 1FAXA 2G55A 2JKHA 1BTPA 1V2OT 1O2LA 5CMXH 3LDXH 4CRDA 2IPHA 5T1VA 1TQ7B 5ABWA 1TX8A 1TAWA 4FUBA 1GDUA 5I46H 1LVYA 1NU7B 1PJPA 1RIWC 3PV4A 1GBAA 2Z9IA 1P2JA 2SGEE 1TBQH 1K9OE 1C5OH 4JZIA 3Q76A 1P03A 4YESB 5ESTE 1J14A 2OQUA 3M5MA 1TNJA 1C5MD 1GJ7B 4OGXA 5JPMH 1GI4A 4MTBA 2AS9A 1LHGH 2JH5D 2Z9KA 3SU4A 1VZQH 1WBGB 2XCNA 1CO7E 3FANA 2AMQA 3OYPA 1NFXA 2QIQA 1G3BA 4KTUA 5A8ZA 1A46H 1EP6A 2ZCKP 1QA7A 2BDCA 1SGNE 1ANEA 1XMNB 1RD3B 1W10U 2BX3A 5FCRA 2ZGHA 1VITF 2AMPA 1YLDA 3SI4H 1S85A 1NS3A 1GG6B 1C5NH 1M9UA 1W8BH 3EGKH 2ZPSA 1HAOH 3RMOH 1Q2WA 2EI8A 2R2MB 1QBOA 4X0WU 1EPTA 3A84A 3M3SA 3EA7A 3MH7A 4MPXA 2Z7FE 5E0HA 1MBMA 3FVFB 4E06H 2EA3A 5DP5A 1JWTA 2VINA 3BTDE 4LOYH 3CENA 2WV4A 4ZKRU 3MNCA 5DP3A 1BRUP 5K7RA 4UEHH 1YCPH 1QL9A 1EZXC 4DW2U 5A2MH 4K5ZA 3PTBA 1MKXH 4MNXA 1MUEB 3ZV9A 2BD8A 1FNIA 2GVFA 3IG6B 4OS5A 1L1GA 4YTAA 3SU3A 1AWFH 2Q6DA 2F83A 3RMNH 3MU0A 1LPGB 2QC2A 2JETB 2PHBA 3K9XB 4TY6A 4E05H 1A5HA 1OYTH 2M5TA 1O2MA 4R0IA 4K1TA 1ELTA 2BOKA 1GG6C 5F8ZA 1Z71A 1C9TA 1T8OA 2Y6TA 1ZJKA 2WPJS 1MQ6A 4PROA 1VITG 1YPEH 1V2RT 1ZRBA 1EKBB 2A5IA 4Q7ZA 1W12U 1E34B 1PPGE 1TWXB 1ZR0A 2HPPH 2ZGBH 1YF4A 2FOEA 2PWXA 4I31A 3F68H 1EQ9A 3RXRA 1TGNA 3K6ZA 1EB1H 3L33A 1O2ZA 1UCYH 1NT1A 4DT7B 1TBRH 4FUJA 1T31A 6LPRA 1O2JA 2CMYA 1NFUA 1O3CA 2EI6A 4Y10E 1W7GH 1FMGA 4A7IB 1AGJA 1W0ZU 1ZPBA 1T8LA 2JETC 4AFZA 2WPIS 1HAVB 2V3OH 3VXFH 1RTLA 1O2WA 5B6LA 1CGIE 4MNWA 4INLA 1Z1JA 1UHBA 1KDQA 4JZDH 3U69H 2QN5T 5EXMA 2A4RA 1GHAF 1ARBA 4HZHA 4D9RA 2VIWA 2XWBI 3RXCA 1O3AA 1DT2A 5EODA 1O5AB 5A8YA 1EAIA 1SOTA 1C1UH 1HRTH 1ZSKA 4IS5A 2C3SA 1IQIA 4X2VA 1XM1A 3ZZ7A 2QAAA 1DWDH 1GBIA 1MMJN 3OSYA 4IC5A 1SGTA 1CHOF 4KGAA 1V2KT 3A7TA 4KTCA 3SJ8A 3SU5A 2FOFA 5DP4A 1WCZA 2STAE 1Y8TA 2BDIA 2BDAA 1MTVA 3WY8A 2IN2A 2H1UA 3P6ZB 3KQDA 3OY6U 3TITA 1AWHB 3GISB 2G5VA 1V6DA 1QL8A 2ZTYA 1EAXA 4CBNA 3DFLA 3PWBA 4GPGA 4YO9A 1NFYA 3A7YA 4CH8B 1C2EA 1C5XB 1O5FH 1SLUB 1BBRE 3FP6E 2F91A 1DLKB 3M61U 1GHAG 4AB8A 3B23B 1O2SA 1TX6A 1EJMA 4DCDA 1GBMA 3URDA 2QXJA 2DE9A 2UUKB 5JBCS 3KQCA 2Y80A 3F9FA 4A6LA 2FMJA 1HLTH 4H6SB 4RKJB 3BV9B 2BDGA 1GBJA 1EAWA 1BHXB 1TFXA 2J4IA 5C1XA 1CA0B 1FPHH 3HGPA 1CHOG 1OS8A 3OTJE 1B0EA 1VCQA 1W11U 1TX7A 1K1JA 1G37A 2OTVA 3E3TA 4UFFH 5FXLA 1O2TA 1EAUA 4AYYB 2Q1JA 1XX9A 1MTNB 3VFEA 2Z94A 3MYWA 4XFQA 2R3UA 2YNBA 3F6UH 5FPSA 4Y71A 1C1WH 4AGKA 1OWEA 2ZNKH 2G51A 1FONA 2FIRH 1E36B 4X8SH 5T6FA 3CP7A 1QRWA 1V2PT 5EPNA 3SHCH 4Q7XA 2BVRH 1MD7A 4CHAB 3A8DA 3MFJA 1C5RA 2GZ8A 3SZNA 1BTHH 2SGFE 4Y0ZE 4Z0KA 2XBVA 1CA0C 1AU8A 4B74A 1P8VC 4JK6A 1WTGH 2HNTC 2ALPA 4A92A 2GGVB 2O8LA 4FVBA 1GI8B 4IC6A 1HIAA 5F03A 1F92A 1XXDA 4ABEA 2FLBH 1HJ9A 3A82A 1THRH 1MKXK 3SI3H 2PUXB 1MTNC 2A7JA 1QJ1B 3ZZ8A 1V2JT 5JBTA 2XCFA 4WXIA 4FUIA 4MLFB 2Y5GA 4D9QA 3KL6A 1C5ZB 3UIRA 2ZFRH 1QRXA 2W3IA 5E0GA 2A7HA 2FX4A 2RCEA 5GXPA 1A61H 1S84A 1IQKA 2BD3A 1XKAC 2ZGCA 1BCUH 2ZTXA 1V2UT 1UK3A 1A2CH 1GPZA 3B9FH 1PQ5A 3T28A 2PUQH 3NK8A 1VCWA 2OUAA 1J9CH 4GLYA 2VGCB 3SNEA 5T3HA 1C2IA 1VCPA 1ELGA 1SGCA 1P10A 4Q2KA 5EXLA 3W95A 4XBBA 1QTFA 3BEUA 5FPTA 1SBWA 4WF8A 4U01A 4CHAC 3TIUA 7LPRA 4X1SU 4ZKNU 3A83A 4OS6A 3LH1A 3MOCA 4X1NU 3STJA 3M7UA 1GI3A 1GVLA 1O5GH 3UFAA 1AE8H 1SLWB 4K1EA 5EPYA 1DFPA 1QJ6B 3UY9A 3PYHA 3TGIE 1QY6A 3SJKA 1DWBH 1KXBA 1UCYK 4UFGH 2ZHDA 1TMTH 2BVSH 3SQHE 4ISHH 3KNXA 2VU8E 4JZFH 1AUJA 2VWMA 1NESE 3KF2A 2GP9B 2ZU4A 1O2KA 1O2XA 1CBWB 3A7ZA 4ABJA 3QZRA 1GJ5H 2XC0A 1BTWA 1GJ6A 2BY9X 3PMBB 5FX5A 2Y82A 2Z9JA 1HXFH 2VGCC 3ATLA 1TRYA 1GJ9B 1DSUA 4CREA 2ODPA 4DOQA 1K1NA 3FP8E 5HGGA 1OWKA 5F6MA 2SGPE 3K2UA 1TPAE 2FOCA 5FPYA 3UREA 1AZ8A 1IAUA 1QURH 4B71A 1Z8JB 1GHXH 1S83A 4TYDA 1HUTH 3AK5A 2ZHFH 1AKSA 2FI3E 5DP7A 4YT7H 2ZWLH 4Q80A 1O2HA 4FXGH 1XUFA 1FY5A 1GI2A 2AGEX 3RU4D 1O3GA 1ZGIA 4INHA 1WOFA 1NRQH 1EP5A 2BQ6B 2Y7XA 5A8XA 5LPEA 5EW1H 3URCA 1P2IA 4D7GA 5FX6A 1Y5BT 1LVOA 1BA8B 1THSH 3DD2H 1EB2A 1DDJA 1PQ8A 1T8MA 1C2FA 1CBWC 4GUXA 2BD7A 1C1QA 1O2PA 3B8JA 2I6QA 2QA9E 3A85A 3U8TH 1EASA 2VWNA 2WINI 2F3CE 5DPAA 1O2NA 2QXGA 4GCHF 1NFWA 3RXPA 4HFPB 3ZZ3A 2A7CA 2PR3A 4WH8A 1ZMNA 2AEIH 1XUKA 4CR9A 1QB1A 1P06A 1BITA 2WYJA 2ALVA 4I8HA 4OS1A 2F9BH 1C1NA 1K2I1 3UTUH 4AFUA 1G3EA 1ZZZA 1QQ4A 4A5TS 4XBDA 1MD8A 3TPIZ 4H42U 1CQQA 3RXBA 4NWKA 2WPLS 2O8TA 4K8YA 1P04A 4BANB 1D3DB 1CGHA 2FX6A 3N7OA 1KXCA 1QIXB 3OX7U 1LO6A 1GBCA 4HTCH 3SJ9A 1PQ7A 3ZVDA 1GCTB 3MHWU 5H4IB 1FIWA 1F0UA 2TBSA 3PTNA 3P70B 3T62A 1O3IA 1EJAA 1SVPA 1Y5UT 3E6PH 4KP0A 1QRZA 1GJ4H 3S69A 4AX9H 1BB0B 1TPOA 2Z3DA 3UNQA 2GMTB 4LK4A 1KXDA 4GCHG 3RXJA 1DPOA 2VVCA 1TQ0B 2Y7ZA 2FODA 5CE1A 1C1MA 3IWMA 4AN7A 5C3NA 2AFQB 5DJ7A 4MPVA 4AFQA 1TNLA 2J2UA 4BXSA 1QB6A 3HK3B 2C8YB 1ETRH 1H4WA 2BDYA 1UTQA 1P2NA 2H9EH 2Z6BD 1QFKH 1ORFA 5EXNA 4Y7BA 4AORA 2NU2E 1AVGH 4R8TB 1FY3A 3D23A 1C5TA 2A0QB 2BDHA 1P2OA 3A8AA 1GCTC 1XUHA 1C5YB 2FXRA 1SI5H 4JYUH 2CGAA 1UVSH 4FUCA 1KLJH 3SJIA 1YBWA 1SGQE 1GMHF 1H9HE 3MU5A 3E16B 1YPHC 4A1XA 3M5NA 5JYIA 2GMTC 1L4DA 3VB6A 1QHRB 1Z6JH 1UTOA 1IQGA 2VIVA 3TU7H 1O3HA 1W13U 1JIMA 2ODYB 1PQAA 2SGDE 3DFJA 4B2CA 1L1NA 2ZHQH 1GBDA 4ISOA 4BTTB 3L6PA 1LMWB 4OGYA 1A0JA 2C4FH 3SGQE 4JCNA 1GBKA 2ZFFH 4TPIZ 4RI0A 2GV7A 3NZIA 1UO6A 1D9IA 3GICB 3ZZ6A 1ELVA 1DITH 4INKA 1A3EH 1BBRK 4JZ1A 1HGTH 4U2WA 1DICA 2OBQA 1AVXA 1G3DA 1O2UA 1IOEA 4XDEA 3U9AH 2NU3E 2WYGA 1D3PB 1C5VA 1XXFA 1JOUB 1NPMA 1GMHG 4AG1A 4MPUA 1WV7H 2BD4A 2FOAA 4GSOA 4ISNA 4I8KA 5C5OA 4B6EA 5JDUB 3GDSA 3MU8A 1TABE 2AIQA 3K6YA 1GBHA 4NSYA 3ELAH 3MO3A 4U30A 2F9PA 5F8XA 1ESTA 2BB4A 2GKVE 1SGRE 2ZP0H 1G2LA 2F9NA 2Y5FA 1T4VH 3Q3KA 1TMUH 1AI8H 1IQJA 1KXEA 1S0QA 1GVZA 3ZVBA 1UVTH 1BOQA 2OQ5A 1YC0A 2PTCE 1UTMA 3LGIA 1H8IH 7KMEH 2UUFB 3AVZA 3GDUA 1HAPH 2ZDLA 3MNBA 1HPGA 4IN2A 1C1OA 3SO3A 1KTTB 2BYAX 4JZEH 4NZQA 3AASA 1GBTA 2B9LA 4UONA 5JBAS 3QTVH 1IQLA 3R3GB 4D8NA 2UWOA 2P16A 2R0KA 3I77A 1NU9A 2OINA 3A86A 1C2LA 1FJSA 1FDPA 4ZXXH 2CJIA 2OBOA 1O5EH 4NA9H 1DOJA 1ACBE 1DY9A 1MU8B 2O8MA 1ETTH 1VR1H 2ZO3H 2ZQ2A 1BJUA 1Q3XA 3GY6A 3D65E 2HOBA 2VIQA 3TH4H 3NPSA 2FWWA 1FV9A 2V6NA 4YZUA 5GJ4B 5C67A 1DWCH 1O3EA 2VIOA 1Z1IA 3TJVA 3VB3A 1MQ5A 3BTFE 3RXLA 1E35B 3F9HA 2BY5X 1LKBA 3TJOA 3UNSA 1SGYE 4B73A 3P8OA 1SHHB 4XSKU 4B2AA 2GCTB 4ZROA 2G5NA 4Y8XA 1GDQA 2RA3A 2ZA5A 2EI7A 2FI5E 1Z7KA 1Y3UA 1NTPA 2ANWA 1BQYA 3SGAE 1MTWA 2Q6GA 3A89A 3A7VA 2PKSB 3A7XA 3U8OH 2OC8A 3SUGA 2RDLA 1OXGA 1TONA 5ESBA 3TH3H 1S6HA 2FS9A 1C9PA 2UWLA 4UDWH 4NFEA 2BXTH 3BF6H 2ASUB 2W7SA 1DX5M 2ZHEH 2BTCE 4XOJA 2VWLA 1EZUC 3RXUA 2ZZUH 1MKWK 3HPTB 5EW2H 4K8BA 2PGQB 1HBTH 1V2QT 1ZHRA 3FZZA 2J34A 2ZGJA 3RDZA 1O2QA 1DWEH 3A87A 1J16A 2J38A 1O2RA 5T6GA 1H8DH 3H5CB 2AERH 1K1LA 4Z6AH 2EC9H 1Y3YA 2XWAA 1CHGA 1OP2A 5I25A 2KAIB 1UTNA 4AOQA 2R3YA 2GCTC 4X1QU 1UTJA 1C5LH 1GDNA 2W5EA 4LZ1H 2W26A 1RTFB 1TLDA 2H5CA 1GHBF 1RXPA 4IW4E 1P02A 2P3UB 3FZDA 4FUGA 2C8ZB 4YLUA 1SB1H 1C1TA 5BPEA 5EQRA 1P3CA 3NXPA 2PKSC 1B5GH 1W0YH 2ZCHP 2ZU1A 2G00A 1LPKB 3T27A 2F9VA 2W7UA 5LPFA 3UWJH 4OS4A 3P8NA 3T26A 4X2WA 1LCYA 2P93A 1BZXE 1CE5A 3GY3A 1FQ3A 3H7OA 3LT3A 1C2HA 1O35A 3LU9B 2PSYA 1V3XA 2OC1A 5L30H 4WY3A 1VJAU 1NRRH 3RC6A 3ZZAA 5JB8S 1AD8H 2ILNA 3EQ0H 3M37A 2ZHWH 2G4TA 5E2OA 6GCHF 1TNGA 3ZV8A 2CHAB 1TGSZ 2WUCA 2BD5A 1OOKB 4K60A 4NA7A 4NIXA 1UK2A 2P94A 1A1RA 2TIOA 1ZSLA 1RJXB 3RUOA 2DE8A 3BTEE 2VIPA 4WXVA 2VH6A 4AG2A 1GHBG 3ZZDA 1XVOA 1TALA 3A8BA 2V3HH 2A2XH 1XUIA 2I6SA 1ABJH 4Y0YE 4GHQA 1O30A 3FAOA 1ZPCA 1P11E 2IOTA 1ZHPA 3PV2A 3TNSA 3C1KA 3VGCB 1FIZA 2FESH 1UJ1A 5GPIB 1HB0B 2PGBB 3SU1A 2OC7A 3BG8A 5EQSA 4LXBH 2FTMA 4TWWA 1KXFA 1KYNA 1O33A 4M9FA 2XXLA 3GOVB 1YPLH 2ZU5A 3QZQA 3OU0A 1FN6A 1OKXA 3TK9A 2CHAC 3ZVEA 3FFGA 1JXPA 4X1PU 4I8LA 2GT8A 1ANDA 2AYWA 3SBKA 3SUFA 1KLIH 1C5UA 1Q31A 2SFAA 2FS8A 1LHDH 2QGRA 4ZKSU 1AFEH 4BAKB 4IMZA 4E7NA 6GCHG 2LNCA 2PKAB 3RXVA 2VVUA 1O32A 2HRVA 1BTYA 1MH0A 1C1VH 1Z8RA 3H09A 1YCPK 2ZDAH 1YYY1 2TGPZ 4J2YB 2W3KA 1L2EA 2A4OA 3E90B 5HM2A 1SLVB 1AY6H 2JH6D 3EAJA 5J4SA 1CVWH 1TGTA 1BHXF 4B1TA 2HNTE 2STBE 1KSNA 1N8OB 1GBFA 2ZIQH 4X6NA 3ODDA 3VGCC 1Z8GA 4JYVH 1C4Y2 1K1MA 2FTLE 1WXRA 3LPRA 1ELFA 4KELA 1KXAA 4UD9H 5AHGH 5F8TA 4O97A 2FPZA 3F1SB 2OD3B 4O03A 1ESBA 2OK5A 2A5KA 2BY6X 1G2MA 2B0FA 1P9SA 4FVDA 1ELCA 1ID5H 1JBUH 3RXTA 1DXPA 4ISLA 2ZTZA 1ZMLA 3PLBA 1SGIB 5EQQA 4AYVB 2WPHS 4FUHA 1AZZA 5GWZA 3AAVA 1TNHA 1ZHMA 5FAHA 4YOIA 4CH2B 2OCVB 4NGAH 1GHYH 2WPKS 1J15A 2WV5A 4F49A 2A1DB 4DVAU 3S9AA 2WHXA 1QBVH 2GV6A 2GZ7A 3L3TA 1T8NA 1N8OC 5C2ZA 1XKBC 4XE4A 1W7XH 5AFYH 9ESTA 4IN1A 1BMNH 1AMHA 4J1YA 4NIWA 3QTOH 3PLKA 1YKTA 4BAOB 3E1XB 3LC3A 1O3DA 1C2MA 4GHTA 1P12E 3ZZ5A 4CRAA 1UVUH 4NFFA 1O3JA 3RMMH 3E0PB 3GDVA 1UTKA 1EJNA 4MNYA 4AGJA 1LQDB 1TA6A 2YNAA 3SNDA 4MG3A 1ARCA 1SGPE 3PWCA 2ZDNA 1CT0E 2SGQE 2ZU2A 2H2ZA 4RN6A 2FLRH 2O8UA 4CRGA 3E91A 5L6NH 4AFSA 3RXGA 1O0DH 5DO4H 1YPGH 2WUBA 3SQEE 1O2GH 1SSXA 2H5DA 4DGJA 1HV7A 1K1PA 1T32A 3LH3A 1DXWA 1PPFE 3EA9A 1GI9B 4O3TA 3RLYH 2FOGA 1V2TT 1GBLA 3KQBA 3SU6A 3ATMA 1TGBA 4NCYA 1EPTB 3RLWH 4AB9A 1AHTH 1GBEA 2F9UA 2WZQA 3KIDU 3P8GA 3RXDA 3HKIB 2F9OA 5BRRE 1V2NT 2ANKH 3UUZA 3MNXA 1MZDA 3M3TA 1OWIA 3ODFA 1GI6A 1UK4A 3QX5H 4F4OC 5A0AE 1O37A 2AIPA 3M36A 4KTSA 1PPBH 1QQUA 2HGTH 5L2ZH 1RTKA 5E8EH 4GVUA 1TBZH 2VVVA 1SG8B 1H1BA 3GCTF 1QCPA 2D2DA 2YOLA 5PTPA 1HAXB 1LHFH 1KTSB 3SNAA 1CT4E 1MCTA 4UFDH 1S5SA 1DM4B 3LJJA 5FBEA 1FY1A 3JZ1B 3SV2H 1EZQA 2VIDA 1S6FA 1SPJA 2BMGB 3BTME 4WMDA 1MU6B 1QJ7B 3ZYEA 1EPTC 2GZ9A 2RA0A 1CSOE 3V3MA 1WTHD 1SGFG 3QWCH 1OP0A 1D6WA 5TCAA 2HWLB 1CT2E 4DG4A 5FHTA 1N6YA 3FP7E 4UFEH 1V2LT 2Z3CA 5GNDA 2XBYA 1AQ7A 5CHAB 5FCKA 3SU2A 3SUEA 2BQ7B 1JIRA 1PPHE 2G81E 2GD4B 2BM2A 1GHZA 2SGAA 5AFZH 2XBWA 3SV8A 1O3OA 2A32A 5FBIA 2VH0A 3PMHB 3PMAB 2A31A 1TB6H 1ANBA 1FZZA 1HYLA 1EATA 1IQFA 1QBNA 3AW0A 1MBQA 1LPZB 1J8AA 4X1RU 3GCTG 4ZAEA 2QF3A 1DE7H 3BTGE 3LJOA 3V7TA 3OY5U 4ZHLU 3UQOA 1EOJA 1EUFA 1DANH 1UHBB 5DP8A 1KDQB 2ULLA 2FYRA 2TGTA 5T6DA 1AN1E 1J17T 2ZU3A 3M5OA 2P3FH 1IHSH 1TOCB 3R0FA 4Y79A 3RXSA 2A45B 5CHAC 1EOLA 4BAMB 2PSXA 3GYLB 2XYAA 1V2ST 1WAYB 3LGYA 4CRBA 1C5SA 2BX4A 1SGEE 3H7TA 3VB7A 2NU4E 1YPHE 2PW8H 4YOGA 1FI8A 2HALA 1LHEH 4OS2A 1WSSH 5A09A 3SUDA 2K1QA 3M7QA 5C1UA 3P92A 3V12A 2PFEA 2VNTA 1ZPZA 1P01A 1LVMA 1O2IA 2FOMB 4FU7A 2P95A 5GDSH 4FU9A 3TK6A 3M35A 5GCHF 2ZCLP 4ZXYH 1ETSH 1SQTA 1TMBH 1Y3VA 1O31A 2IJD1 2BOHB 4LZ4B 2FZZA 3UR9A 1E38B 2FP7B 1HAYB 4NA8A 3GYMA 1SGFA 4ABGA 4DJZB 4M7GA 5A0CA 3ZZCA 1U6QA 1THPB 1ANCA 3QLPH 5AF9H 3I29A 1WYKA 2ZFQH 3D62A 3VXEH 3ATWA 2BXUH 1RGQA 3MH4A 1X7AC 5GIBA 5LGOA 4THNH 1E0FD 3GCHB 5HM9A 5EOKA 1SHYA 4O9VA 1BRBE 1C5WB 4U32A 5AVDA 4BNRA 4Y76A 4ABBA 1P9UA 2TRMA 1AIXH 1ZTLA 4ABDA 3ZVCA 1NRPH 2XW9A 5EG4A 1A4WH 2Y5HA 3RMLH 2FO9A 1HNEE 1LHCH 3SV6A 3QGJA 2Q6FA 3GCOA 1Z6EA 4MDSA 4Y8ZA 5DG6A 1DY8A 3EDXB 3LKWA 1K1IA 5HXFA 1NZQH 4ZUHA 3MWIU 3MO9A 3UPEA 1SFIA 2SNVA 5GCHG 3KQEA 2BD9A 4ISIH 4CRFA 1QA0A 1TRMA 1NY22 2BHGA 3D49H 1DS2E 2BLVA 3RXMA 1E37B 3VPKA 2AH4X 2XRCA 3AAUA 4X6PA 4CR5A 1QR3E 1D6RA 1D3TB 3GY4A 5SGAE 1LKAA 2XNIA 4DIIH 1TIOA 5DP6A 1GL1A 3T2NA 1GJAB 4O3UA 4ZMAH 1MTSA 3GCHC 4ZHMU 1C2GA 3MH6A 3ZVAA 1C5QA 1HCGA 3A8CA 1T4UH 1W3CA 2AMDA 3LC5A 1L0ZA 1YM0A 1GI1A 1HFDA 3PM3A 4TY7A 2ZFPH 1QB9A 3SV9A 3ZVFA 1HIAB 1G30B 2IJOB 4NSVA 3GY2A 4YOJA 1O3BA 3S7HB 2ANYA 1TPPA 3MH5A 3GY5A 1LTOA 1O36A 1QGFA 5HMAA 3BG4B 1BIOA 3BTTE 5TCCA 3RM0H 1MCVA 3S9BA 1N6XA 1ZMJA 3ATIA 1B7XB 3RXIA 2OC0A 3RU4E 1Z8IB 1GBBA 1F0TA 1T7CA 1UVOA 3ITIA 1GWAA 3UQVA 2Y81A 1NO9H 1NN6A 1O2VA 1AUTC 1JRTA 1A0LA 2OLGA 4WMEA 3M7TA 1SGDE 3ZZ9A 5C5NA 1BTXA 2AGIX 3KEEA 1SLXB 4ESTE 1GCDA 2ZPRA 4Y8YA 1ZLRA 1O3MA 3KCGH 1HJ8A 3A88A 3PROA 5IYTA 1C1PA 2ZFSA 2BQWB 3LGUA 4SGAE 7GCHF 2SNWA 3MU1A 4OS7A 1S0RA 1XVMA 3S9CA 1DSTA 2ZKSA 2ZPQA 2BDBA 5L2YH 1ELBA 1ZRKA 1UTPA 4HGCA 3G01A 4IGDA 3VB4A 3JZ2B 3BG4C 3NUMA 4X2XA 1DLEA 2OXSA 4YT6H 2RG3A 1O3LA 2BY8X 1IQHA 1NRNH 2R9PA 8LPRA 1TPSA 2G52A 1YCPM 3T25A 1P3EA 1NRSH 8KME2 2LPRA 2B8OH 3DHKH 1BJVA 1BUIA 4NG9H 1ABIH 1NM6A 4JMYA 1SFQB 2ESTE 1AE5A 2VJ1A 1K22H 1S81A 5B6OA 4Q7YA 2HPQH 1NC6A 1ZSJA 1GJDB 1L1JA 2ZEBA 1FLEE 3A7WA 3O8DA 1NROH 5LH8A 1AKSB 3Q00A 1SMFE 3LOXA 2ZF0H 5JB9S 5DP9A 3MU4A 3TVJB 1WQSA 1Y59T 4BTIB 1O2YA 1SQOA 3LIWA 3HKJB 5DKMA 1CU1A 3DUXH 4CBOA 7GCHG 3PLPA 1C1RA 1PYTD 1VITH 1Y3XA 2UWPA 4K2YA 3MTYA 4BAQB 4NZLA 1YPJH 2BZAA 2HVXA 4KKDA 1UVPA 3S7KB 1O3KA 4I8GA 1G36A 1FPCH 4E7RG 1ZJDA 1INCA 3UWIA 1ESAA 1B0FA 3DA9B 4B76A 2TGDA 2PLXA 4MPWA 2QCYA 5ETXA 3RXFA 3GY7A 1EZSC 3BTWE 1MAXA 2C93B 4ASHA 3SOSA 3M3VA 1AB9B 1Y5AT 1F2SE 1ZTJA 1DVAH 2P8OB 4Y6DA 1CGJE 3U1JB 4MVNA 1SL3A 2B7DH 2UUJB 3T29A 2BY7X 4ABFA 1ELAA 2P59A 2ZI2H 5EGMA 1GJBB 3QDZB 2HLCA 4FUDA 3RXQA 6ESTA 2GCHF 1C4V2 3KHVA 3SN8A 1C4U2 5JBBS 1GHVH 4YLQH 1F0RA 1VGCB 3EE0B 2FDAA 3SORA 2R2WU 3Q3XA 5K0HA 1PPZA 5G4BA 4BTUB 4DY7B 2XBXA 4I33A 2J92A 1GMDF 8GCHF 1BT7A 5TJXA 3BSQA 1A3BH 3M5LA 1AFQB 1V2WT 2D1JA 1BMMH 4H6TA 1AB9C 4H4FA 3OTPA 1O39A 1P05A 2P8OC 1PPCE 1HAGE 2C90B 1OWJA 3BEFB 3S0NA 3RXEA 4DIHH 1RS0A 3P8FA 4X8VH 1W2KH 3BIVH 1ZOMA 1TRNA 1O3NA 1IQMA 4FUEA 3LGTA 1BTUA 3TH2H 3A80A 1VGCC 2BLWA 3NCLA 1L4ZA 1Y3WA 1SQAA 4A1VA 2GCHG 4YM9A 4MNVA 2FM2A 4XBCA 1TYNA 4RSPA 2GDEH 1TOMH 1P2KA 2HNTF 3TNTA 1TE0A 2F4LA 1P09A 1G3CA 1HJAB 2V0BA 4I32A 1SC8U 3TGKE 5E2PA 6CHAB 1AFQC 2JH0D 1RFNA 3MMGA 1HAIH 3ZVGA 3VEQB 1GMDG 3SNBA 4HI3A 1WU1A 3TLOA 8GCHG 1IQNA 1P57B 2ZGXH 1F5KU 1P2MA 3UNRA 3SNCA 3P17H 3A81A 4X8TH 4IMQA 3VB5A 1OWHA 3F9EA 1GI7B 1P2QA 1GMCF 1P0SH 3PO1B 4MQAA 1S82A 3PV5A 1PFXC 1BMAA 2TPIZ 9LPRA 2D26C 4WMFA 2FI4E 4NWLA 4WVPE 3O8BA 2THFB 4FUFA 1OSSA 1BMLA 2BZ6H 2A5AA 2J95A 4Y7AA 4ABHA 3C27B 5E0JA 4SGBE
chains in the Genus database with same CATH superfamily
5EIYA 3STIA 5DGJA 2FEQH 3MI4A 1PPEE 2ZQ1A 2J94A 3PMJA 1OPHB 5C1YA 1BRAA 3MNSA 2G4UA 1O3PB 2QYIA 2VWOA 3ESTA 3RXHA 1HJAC 2P3TB 3W94A 4ZH8A 4UE7H 2CF9H 6CHAC 4TPYA 4Z1MD 4ZKOU 1GGDB 2YMSC 3RXOA 1WUNH 1BBRH 2EEKA 4IBLH 3Q77A 2Z9GA 2H9TH 1KY9A 3ZZ4A 4I7YH 3K65B 1HAVA 2ZECA 2O8WA 2R0LA 4NIVA 1TNIA 3UR6A 2QF0A 1YLCA 2HLDD 5A0BA 1O38A 2UUYA 1C2KA 1WQVH 3PO1C 2FOHA 2CN0H 1HDTH 1KMHB 2GDDA 2FYQA 3RM2H 2NWNA 4D76A 1HAHH 1K28D 4XRNA 3SHAH 2QV1A 2PTNA 3RXKA 1LVBA 1GMCG 3RC4A 1SKYE 4AZ2B 1AVWA 1YPKH 4B6FA 2BD2A 2KAIA 1IHTH 4X2YA 3RU4T 1MAYA 1LQEA 1A7SA 1K21H 3DT0H 1C1SA 1O5CB 3BTHE 3PB1E 3SV7A 3SW2B 3LGWA 3TGJE 4OM9A 3QUMP 3ENSB 3O8RA 2H6MA 3MO6A 3BTKE 1W14U 8ESTE 1FY4A 3E8LA 2XC4A 1EXFA 4Y11E 3SZEA 1GGDC 1SR5C 1UTLM 2Z3EA 3UB0A 1AO5A 3ATKA 1H8ED 3GY8A 2C8WB 2ZG0H 3BIUH 3RC5A 3CS7A 1F0SA 3V13A 1A0HB 3CS0A 3SYJA 1DUEA 1TA2A 2XC5A 2NU0E 3BN9A 1TGCA 3EA8A 3SU0A 5IDKA 3TJNA 1O5DH 1JRSA 1FAKH 2GTBA 1O5BB 1C2JA 1PYTC 1BDAA 1F7ZA 5DSFA 1TNKA 7ESTE 4X6MA 1N1LA 1F5RA 4NIYA 1LDTT 3LGVA 4TWYA 3TK5A 3EYDA 3ZYDA 2BLOA 2O9QA 3RXAA 2Z9LA 1KLTA 2VBCA 4I8JA 5HYOA 2CV3A 3UOPA 3BTQE 1FXYA 2LELA 1H9IE 1O3FA 4YXWD 1ZGVA 1YP9A 5C20A 3U8RH 1GHWH 2AGGX 4WH6A 3F2GA 2J9NA 4X6OA 4DURA 2B5TB 1CA8B 1FY8E 1FN8A 2G8TA 1A5GH 4P02A 4CRCA 2D8WA 2K8IA 2XTTB 5J4QA 2AHME 2A2QH 1HAZB 2WV9A 1C2DA 4FU8A 1OWDA 2DUCA 1ZTKA 2KCPA 2H9HA 1XUJA 3KGPA 4VGCB 2BLQA 3ZZBA 1G9IE 3UOUA 2TGAA 1GI5A 1XUGA 2OP9A 4WWYA 3E0NB 3NKKA 2A4QA 1D3QB 3HATH 4JK5A 1MKWH 1UMAH 2ANMH 3QO6A 4K69A 4RKOB 1ZYOA 1G32B 2VB0A 4ABIA 2PKAA 3LONA 1BRCE 2ZFTA 1GJCB 1O2OA 1JMOH 4BXWA 1ELEE 1VJ9U 3RP2A 5C17A 2CXVA 2A4GA 4BAHB 1GI0A 4K3JA 2ZDKA 1V2MT 1H9LB 2WPMS 3HK6B 3T5FH 1HXEH 4JYTA 4B75A 3IITA 3SGBE 3U1IB 2GX4A 5LPRA 3QN7A 3Q3YA 3F9GA 4WJG2 3TJUA 2QXIA 3HGNA 1RIWB 1C5PA 3V0XA 4A1TA 1QNJA 3SJOA 3AW1A 3NWUA 4ABAA 3O8CA 2BVXH 3QK1A 2CF8H 4ZHAA 1GJ8B 4X8UH 1OX1A 1EX3A 4VGCC 2GT7A 2ODQA 1OP8A 1WDIA 3GCNA 2ZDVH 1GVKB 2V35A 1YPMH 1F5LA 3U98H 1MZAA 2ZC9H 1V2VT 2XOKD 1OYQA 2FOBA 3QGNB 1ELDE 3BEIB 4Q4LA 1KIGH 1MTUA 1RRKA 1DUAA 1O34A 1SOZA 2C8XB 4QT8C 2NU1E 2PV9B 3KN2A 3P95A 4GAWA 1QL7A 4B2BA 2QXHA 5DK1A 1K1OA 4D7FA 1IQEA 4K1SA 1FUJA 1D4PB 2ZDMA 2IPQX 3CNRA 2QY0B 1GL0E 1YGCH 5EU8A 1UCYE 1A5IA 1BTZA 2EY4C 3I78A 1FAXA 4BOHA 2G55A 2JKHA 1BTPA 1V2OT 1O2LA 5CMXH 3LDXH 4CRDA 2IPHA 5T1VA 1TQ7B 5ABWA 1TX8A 1TAWA 4FUBA 1GDUA 5I46H 1LVYA 1NU7B 1PJPA 1RIWC 3PV4A 1GBAA 2Z9IA 1P2JA 2SGEE 1TBQH 1K9OE 1C5OH 4JZIA 3Q76A 1P03A 4YESB 5ESTE 1J14A 2OQUA 3M5MA 4ZCNA 1TNJA 1C5MD 1GJ7B 4OGXA 5JPMH 2QF4A 1GI4A 4MTBA 2AS9A 1LHGH 2JH5D 2Z9KA 3SU4A 1VZQH 1WBGB 2XCNA 1CO7E 3FANA 2AMQA 3OYPA 1NFXA 2QIQA 1G3BA 4KTUA 5A8ZA 1A46H 1EP6A 2ZCKP 1QA7A 3FOAA 2BDCA 1SGNE 1ANEA 1XMNB 1RD3B 1W10U 2BX3A 5FCRA 2ZGHA 1VITF 2AMPA 1H8HD 1YLDA 3SI4H 1S85A 1NS3A 1GG6B 1C5NH 1M9UA 1W8BH 3EGKH 2ZPSA 1HAOH 3RMOH 1Q2WA 2EI8A 2R2MB 1QBOA 4X0WU 1EPTA 3A84A 3M3SA 3EA7A 3MH7A 4MPXA 2Z7FE 5E0HA 1MBMA 3FVFB 4E06H 2EA3A 5DP5A 1JWTA 2VINA 3BTDE 4LOYH 3CENA 3WWFA 2WV4A 4ZKRU 3MNCA 5DP3A 1BRUP 5K7RA 4UEHH 1YCPH 1QL9A 2V7QD 1EZXC 4DW2U 5A2MH 4K5ZA 3PTBA 1MKXH 4MNXA 1MUEB 3ZV9A 2BD8A 1FNIA 2GVFA 3IG6B 4OS5A 1L1GA 4YTAA 3SU3A 1AWFH 2Q6DA 2F83A 3RMNH 3MU0A 1LPGB 2QC2A 2JETB 2PHBA 3K9XB 3VG8A 4TY6A 4E05H 1A5HA 1OYTH 2M5TA 1O2MA 4R0IA 4K1TA 1ELTA 2BOKA 1GG6C 5F8ZA 1Z71A 1C9TA 1T8OA 2Y6TA 1ZJKA 2WPJS 1MQ6A 3N99A 4PROA 1VITG 1YPEH 1V2RT 1ZRBA 1EKBB 2A5IA 4Q7ZA 1W12U 1E34B 1PPGE 1TWXB 1ZR0A 2HPPH 2ZGBH 1YF4A 2FOEA 2PWXA 4I31A 3F68H 1EQ9A 3RXRA 1TGNA 3K6ZA 1EB1H 3L33A 1O2ZA 2W6ID 1UCYH 1NT1A 4DT7B 1TBRH 4FUJA 1T31A 6LPRA 1O2JA 2CMYA 1NFUA 1O3CA 2EI6A 4Y10E 1W7GH 1FMGA 4A7IB 1AGJA 1W0ZU 1ZPBA 1T8LA 2JETC 4AFZA 2WPIS 1HAVB 2V3OH 3VXFH 1RTLA 1O2WA 3N7DA 3F3BA 5B6LA 1CGIE 4MNWA 4INLA 1Z1JA 1UHBA 5FL7D 1KDQA 4JZDH 3U69H 2QN5T 5EXMA 1QZ8A 2A4RA 1GHAF 1ARBA 4HZHA 4D9RA 2VIWA 2XWBI 3RXCA 1O3AA 5KECA 1DT2A 5EODA 1O5AB 5A8YA 1EAIA 1SOTA 5EJLA 1C1UH 1HRTH 1ZSKA 4IS5A 2C3SA 1IQIA 4X2VA 2WPDD 1XM1A 3ZZ7A 2QAAA 1DWDH 1GBIA 1MMJN 3OSYA 4IC5A 1SGTA 3EE7A 1CHOF 4KGAA 1V2KT 3A7TA 4KTCA 3SJ8A 3SU5A 2FOFA 5DP4A 1WCZA 2STAE 1Y8TA 2BDIA 2BDAA 3DSGA 3WW7A 1MTVA 3WY8A 2M2AA 2IN2A 2H1UA 3P6ZB 2JJ1D 2L74A 3KQDA 4HG6A 3OY6U 3TITA 1AWHB 3GISB 2G5VA 1V6DA 1QL8A 2ZTYA 1EAXA 4CBNA 3DFLA 3PWBA 4GPGA 4YO9A 1NFYA 3A7YA 4CH8B 1C2EA 1C5XB 1O5FH 1SLUB 1BBRE 3FP6E 2F91A 1DLKB 3M61U 1GHAG 4AB8A 1YY3A 3B23B 1O2SA 1TX6A 1EJMA 4DCDA 1GBMA 3URDA 2J98A 2QXJA 2DE9A 2UUKB 5JBCS 3KQCA 2Y80A 3F9FA 4A6LA 2FMJA 1HLTH 4H6SB 4RKJB 3BV9B 2BDGA 1GBJA 1EAWA 1BHXB 1TFXA 2J4IA 5C1XA 1CA0B 1FPHH 3HGPA 1CHOG 1OS8A 3OTJE 1B0EA 1VCQA 1W11U 1TX7A 1K1JA 1G37A 2OTVA 3E3TA 4UFFH 5FXLA 1O2TA 1EAUA 4AYYB 2Q1JA 1XX9A 1MTNB 3VFEA 2Z94A 3MYWA 4XFQA 2R3UA 2YNBA 3F6UH 5FPSA 4Y71A 1C1WH 4AGKA 1OWEA 2ZNKH 2G51A 1FONA 2FIRH 1E36B 4X8SH 5T6FA 3CP7A 1QRWA 1V2PT 3FKSD 5EPNA 3SHCH 2QE7D 4Q7XA 2BVRH 3DSOA 1MD7A 4CHAB 3A8DA 4ACBA 3MFJA 1C5RA 2GZ8A 3N7EA 3SZNA 1BTHH 2SGFE 4Y0ZE 4Z0KA 2XBVA 1W0JD 1CA0C 1AU8A 4B74A 1P8VC 4JK6A 1WTGH 2HNTC 2ALPA 4A92A 2GGVB 2O8LA 4FVBA 1GI8B 4IC6A 1HIAA 5F03A 1F92A 1XXDA 4ABEA 2FLBH 1HJ9A 3A82A 4FOUC 1THRH 1MKXK 3SI3H 2PUXB 1MTNC 2A7JA 1QJ1B 3ZZ8A 1V2JT 5JBTA 2XCFA 4WXIA 4FUIA 4MLFB 2Y5GA 4D9QA 3KL6A 1C5ZB 3UIRA 2ZFRH 1QRXA 2W3IA 5E0GA 2A7HA 2FX4A 2RCEA 5GXPA 1A61H 1S84A 1IQKA 2BD3A 1XKAC 2ZGCA 1BCUH 2ZTXA 1V2UT 1UK3A 1A2CH 1GPZA 3B9FH 1PQ5A 3T28A 2PUQH 3NK8A 1VCWA 2OUAA 1J9CH 4GLYA 2VGCB 3SNEA 5T3HA 1C2IA 1VCPA 1ELGA 1SGCA 1P10A 4Q2KA 5EXLA 3W95A 4XBBA 1QTFA 3BEUA 5FPTA 1SBWA 4WF8A 4U01A 4CHAC 3TIUA 7LPRA 4X1SU 4ZKNU 3A83A 4OS6A 3F0OA 3LH1A 3MOCA 4X1NU 3STJA 3M7UA 1GI3A 1GVLA 1O5GH 3UFAA 1AE8H 2WSSD 1SLWB 4K1EA 5EPYA 1DFPA 1QJ6B 3UY9A 3PYHA 3TGIE 1QY6A 3SJKA 1DWBH 1KXBA 1UCYK 4UFGH 2ZHDA 1TMTH 2BVSH 3SQHE 5F53A 4ISHH 3KNXA 2VU8E 4JZFH 1AUJA 2VWMA 1NESE 3KF2A 2GP9B 2ZU4A 1O2KA 1O2XA 1CBWB 3A7ZA 4ABJA 3QZRA 1GJ5H 2XC0A 1BTWA 1GJ6A 2BY9X 3PMBB 5FX5A 2Y82A 2Z9JA 1HXFH 2VGCC 3ATLA 1TRYA 1GJ9B 1DSUA 4CREA 2ODPA 4DOQA 1K1NA 3FP8E 5HGGA 1OWKA 5F6MA 2SGPE 3K2UA 1TPAE 2FOCA 1BMFD 5FPYA 3UREA 1AZ8A 1IAUA 1QURH 4B71A 1Z8JB 1GHXH 1S83A 4TYDA 1HUTH 3AK5A 2ZHFH 1AKSA 2FI3E 5DP7A 4YT7H 2ZWLH 4Q80A 1O2HA 4FXGH 1XUFA 1FY5A 1GI2A 2AGEX 3RU4D 1O3GA 1ZGIA 4INHA 1WOFA 1NRQH 1EP5A 2BQ6B 2Y7XA 5A8XA 5LPEA 5EW1H 3URCA 1P2IA 4D7GA 5FX6A 1Y5BT 1LVOA 1BA8B 1THSH 3DD2H 1EB2A 1DDJA 1PQ8A 1T8MA 1C2FA 1CBWC 4GUXA 2BD7A 1C1QA 1O2PA 2RDEA 3B8JA 2I6QA 2QA9E 3A85A 3U8TH 1EASA 2VWNA 2WINI 2F3CE 5DPAA 1O2NA 2QXGA 2J5UA 1NFWA 4GCHF 3RXPA 4HFPB 3ZZ3A 2A7CA 2PR3A 4WH8A 1ZMNA 2AEIH 1XUKA 4CR9A 1QB1A 1P06A 1BITA 2WYJA 2ALVA 4I8HA 4OS1A 2F9BH 1C1NA 1K2I1 2QF5A 3UTUH 4AFUA 1G3EA 1ZZZA 2V3MA 1QQ4A 4A5TS 4XBDA 1MD8A 3TPIZ 4H42U 1CQQA 3RXBA 4NWKA 2WPLS 2O8TA 4K8YA 1P04A 4BANB 1D3DB 1CGHA 2FX6A 3N7OA 1KXCA 1QIXB 3OX7U 1LO6A 1GBCA 4HTCH 3SJ9A 1PQ7A 2LP6A 3ZVDA 1GCTB 3MHWU 5H4IB 1FIWA 1F0UA 2TBSA 3PTNA 3P70B 3T62A 1O3IA 1EJAA 1NBMD 1SVPA 1Y5UT 3E6PH 4KP0A 1QRZA 1GJ4H 3S69A 4AX9H 1BB0B 1TPOA 2Z3DA 3UNQA 2GMTB 4LK4A 1KXDA 4GCHG 4XD7D 3RXJA 1DPOA 2VVCA 1TQ0B 2Y7ZA 2FODA 5CE1A 1C1MA 3IWMA 4AN7A 5C3NA 2AFQB 5DJ7A 4MPVA 4AFQA 1TNLA 2J2UA 4BXSA 1QB6A 3HK3B 2C8YB 1ETRH 1H4WA 2BDYA 1UTQA 1P2NA 2H9EH 2Z6BD 1QFKH 1ORFA 5EXNA 4Y7BA 4AORA 2NU2E 1AVGH 4R8TB 1FY3A 3D23A 1C5TA 2A0QB 2BDHA 1P2OA 3A8AA 1GCTC 1XUHA 1C5YB 2FXRA 1SI5H 4JYUH 2CGAA 1UVSH 1UW7A 4FUCA 1KLJH 3SJIA 1YBWA 1SGQE 1GMHF 1H9HE 3MU5A 3E16B 1YPHC 4A1XA 3FN8A 3M5NA 5JYIA 2GMTC 1L4DA 2JJ2D 3VB6A 1QHRB 1Z6JH 1UTOA 1IQGA 2VIVA 3TU7H 1O3HA 1W13U 1JIMA 2ODYB 2KCAA 1PQAA 2SGDE 3DFJA 4B2CA 1L1NA 2ZHQH 1GBDA 4ISOA 4BTTB 3L6PA 1LMWB 4OGYA 3MQKC 1A0JA 2C4FH 3SGQE 4JCNA 1GBKA 2ZFFH 4TPIZ 4RI0A 2GV7A 3NZIA 1UO6A 1D9IA 3GICB 3ZZ6A 1ELVA 1DITH 4INKA 1A3EH 1BBRK 4JZ1A 1HGTH 4U2WA 1DICA 5IK2D 3PRBA 2OBQA 1AVXA 1G3DA 1O2UA 1IOEA 4XDEA 3U9AH 2NU3E 2WYGA 1D3PB 1C5VA 1XXFA 1JOUB 1NPMA 1GMHG 4AG1A 4MPUA 1WV7H 2BD4A 2FOAA 4GSOA 4ISNA 4I8KA 5C5OA 4B6EA 5JDUB 3GDSA 3MU8A 1TABE 2AIQA 3K6YA 5HIZA 2W6JD 1GBHA 4NSYA 3ELAH 3MO3A 4U30A 2F9PA 5F8XA 1ESTA 4I86A 2BB4A 2GKVE 1SGRE 2ZP0H 1G2LA 2F9NA 2Y5FA 1T4VH 3Q3KA 1TMUH 1AI8H 1IQJA 1KXEA 1S0QA 1GVZA 3ZVBA 1UVTH 1BOQA 2OQ5A 1E79D 1YC0A 2PTCE 1UTMA 3LGIA 1H8IH 7KMEH 2UUFB 1W0KD 3AVZA 3GDUA 1HAPH 2ZDLA 3MNBA 1HPGA 4IN2A 1C1OA 3SO3A 1KTTB 2BYAX 4JZEH 4NZQA 5KGOA 3AASA 1GBTA 2B9LA 4UONA 5JBAS 3QTVH 1IQLA 3R3GB 4D8NA 2UWOA 2P16A 2R0KA 3I77A 1NU9A 2OINA 3A86A 1C2LA 1FJSA 1FDPA 4ZXXH 2CJIA 2OBOA 3WWBA 1O5EH 4NA9H 1DOJA 1ACBE 1DY9A 1MU8B 2O8MA 3UAIC 1ETTH 1VR1H 2ZO3H 2ZQ2A 1BJUA 1Q3XA 3GY6A 3D65E 2HOBA 2VIQA 3TH4H 3NPSA 2FWWA 1FV9A 2V6NA 4YZUA 5GJ4B 5C67A 1DWCH 1O3EA 3PRDA 2VIOA 1Z1IA 3TJVA 4P00A 3VB3A 1MQ5A 3BTFE 3RXLA 1E35B 3F9HA 2BY5X 1LKBA 3TJOA 3UNSA 1SGYE 4B73A 2YMSD 3P8OA 1SHHB 2L6OA 4XSKU 4B2AA 2GCTB 4ZROA 2G5NA 4Y8XA 1GDQA 2RA3A 2ZA5A 2EI7A 2FI5E 3KQ5A 1Z7KA 3DCLA 1Y3UA 1NTPA 2ANWA 1BQYA 3SGAE 1MTWA 2KZ4A 2Q6GA 3A89A 3A7VA 2PKSB 3A7XA 3U8OH 2OC8A 3SUGA 2RDLA 1OXGA 1TONA 3KYGA 5ESBA 3TH3H 1S6HA 2FS9A 1C9PA 2UWLA 4UDWH 4NFEA 2BXTH 3BF6H 2ASUB 2W7SA 1DX5M 2ZHEH 2BTCE 4XOJA 2VWLA 1EZUC 3RXUA 2ZZUH 1MKWK 3HPTB 5EW2H 4K8BA 2PGQB 1HBTH 1V2QT 1ZHRA 3FZZA 2J34A 2ZGJA 3RDZA 1O2QA 1DWEH 3A87A 1J16A 2J38A 1O2RA 5T6GA 1H8DH 3H5CB 2AERH 1K1LA 4Z6AH 2EC9H 1Y3YA 2XWAA 1CHGA 1OP2A 5I25A 2KAIB 1UTNA 4AOQA 2R3YA 2GCTC 4X1QU 1UTJA 1C5LH 1GDNA 2W5EA 4LZ1H 2W26A 1RTFB 1TLDA 2H5CA 1GHBF 1RXPA 4IW4E 1P02A 2P3UB 3FZDA 4FUGA 2C8ZB 4YLUA 1SB1H 1C1TA 5BPEA 5EQRA 1P3CA 3NXPA 2PKSC 1B5GH 1W0YH 2ZCHP 2ZU1A 2G00A 1LPKB 3OEHD 3T27A 2F9VA 2W7UA 5LPFA 3UWJH 4OS4A 3P8NA 3T26A 4X2WA 1LCYA 2P93A 1BZXE 1CE5A 3GY3A 1FQ3A 3H7OA 3LT3A 1C2HA 1O35A 3LU9B 2PSYA 1V3XA 4RT1A 2OC1A 5L30H 4WY3A 1VJAU 1NRRH 3RC6A 5HKKD 3ZZAA 5JB8S 1AD8H 2ILNA 3EQ0H 3M37A 2ZHWH 2G4TA 5E2OA 6GCHF 1TNGA 3ZV8A 2CHAB 1TGSZ 2WUCA 2BD5A 2RFKC 1OOKB 4K60A 4NA7A 4NIXA 1UK2A 1A1RA 2P94A 2TIOA 1ZSLA 1RJXB 3RUOA 2DE8A 3BTEE 2VIPA 4WXVA 2VH6A 5C94A 4AG2A 1GHBG 3ZZDA 1XVOA 1TALA 3A8BA 2V3HH 2A2XH 1XUIA 2I6SA 1ABJH 4Y0YE 4GHQA 1O30A 3FAOA 1ZPCA 1P11E 2IOTA 1ZHPA 3PV2A 3TNSA 3C1KA 3VGCB 1FIZA 2FESH 1UJ1A 5GPIB 1HB0B 2PGBB 3SU1A 2OC7A 3BG8A 5EQSA 4LXBH 2FTMA 4TWWA 1KXFA 1KYNA 1O33A 4M9FA 2XXLA 5CDFE 3GOVB 1YPLH 2ZU5A 3QZQA 3OU0A 1FN6A 1OKXA 3TK9A 2CHAC 3ZVEA 3FFGA 1JXPA 4X1PU 4I8LA 2GT8A 1ANDA 2AYWA 3SBKA 3SUFA 1KLIH 1C5UA 1Q31A 2SFAA 2FS8A 2KCOA 1LHDH 2QGRA 4ZKSU 1AFEH 4BAKB 4IMZA 4E7NA 6GCHG 2LNCA 2PKAB 3RXVA 2VVUA 1O32A 2HRVA 1BTYA 1MH0A 1C1VH 1Z8RA 3H09A 1YCPK 2ZDAH 1YYY1 2TGPZ 4J2YB 2W3KA 1L2EA 2A4OA 3E90B 5HM2A 1SLVB 1AY6H 2JH6D 3EAJA 5J4SA 1CVWH 1TGTA 1BHXF 4B1TA 2HNTE 2STBE 1KSNA 1N8OB 1GBFA 2ZIQH 4X6NA 3ODDA 3VGCC 3OEED 1Z8GA 4JYVH 1C4Y2 1K1MA 2FTLE 1WXRA 3LPRA 1ELFA 4KELA 1KXAA 4UD9H 5AHGH 5F8TA 4O97A 2FPZA 1EFRD 1YWUA 3F1SB 2OD3B 4O03A 1ESBA 2OK5A 2A5KA 2BY6X 1G2MA 2B0FA 1P9SA 4FVDA 4ACAA 1ELCA 1ID5H 1JBUH 3F0PA 3RXTA 1DXPA 4ISLA 2ZTZA 1ZMLA 3PLBA 1SGIB 5EQQA 4AYVB 2WPHS 4FUHA 1AZZA 5GWZA 3AAVA 1TNHA 1ZHMA 5FAHA 4YOIA 4CH2B 2OCVB 4NGAH 1GHYH 2WPKS 3GS9A 1J15A 2WV5A 4F49A 2A1DB 4DVAU 3S9AA 2WHXA 1QBVH 2GV6A 2GZ7A 1YLNA 3L3TA 1T8NA 1N8OC 5C2ZA 1XKBC 4XE4A 1W7XH 5AFYH 9ESTA 4IN1A 1BMNH 1AMHA 4J1YA 5HIYA 4NIWA 3QTOH 3PLKA 1YKTA 4BAOB 3E1XB 3LC3A 1O3DA 1C2MA 4GHTA 1P12E 3ZZ5A 4CRAA 1UVUH 4NFFA 1O3JA 3RMMH 3E0PB 3GDVA 1UTKA 1EJNA 4MNYA 4AGJA 1LQDB 1TA6A 2YNAA 3SNDA 4MG3A 4DT4A 1ARCA 1SGPE 3PWCA 2ZDNA 1CT0E 2SGQE 2ZU2A 2H2ZA 2PP6A 4RN6A 2FLRH 2O8UA 4CRGA 3E91A 5L6NH 4AFSA 3RXGA 1O0DH 5DO4H 1YPGH 2WUBA 3SQEE 1O2GH 1SSXA 2H5DA 4DGJA 1HV7A 1K1PA 1T32A 3LH3A 1DXWA 1PPFE 3EA9A 1GI9B 4O3TA 3RLYH 2FOGA 1V2TT 1GBLA 3KQBA 3SU6A 3ATMA 1TGBA 4NCYA 1EPTB 3RLWH 4AB9A 1AHTH 1GBEA 2F9UA 2JDID 2WZQA 3KIDU 3P8GA 3RXDA 3HKIB 2F9OA 5BRRE 1V2NT 2ANKH 3UUZA 3MNXA 1MZDA 3M3TA 1OWIA 5C0TA 3ODFA 1GI6A 1UK4A 3QX5H 4F4OC 5A0AE 1O37A 2AIPA 5CHBA 3M36A 4KTSA 1PPBH 1QQUA 2HGTH 5L2ZH 1RTKA 5E8EH 4GVUA 1TBZH 2VVVA 1SG8B 1H1BA 3GCTF 1QCPA 2D2DA 3OFND 2YOLA 5PTPA 1HAXB 1LHFH 2CK3D 1KTSB 3SNAA 1CT4E 1MCTA 4UFDH 1S5SA 1DM4B 3LJJA 5FBEA 1FY1A 3JZ1B 3SV2H 1EZQA 2VIDA 1S6FA 1SPJA 2BMGB 3BTME 4WMDA 1MU6B 1QJ7B 3ZYEA 1EPTC 2GZ9A 2RA0A 1CSOE 3V3MA 1WTHD 1SGFG 3QWCH 1OP0A 1D6WA 5TCAA 2HWLB 1E1QD 1CT2E 4DG4A 5FHTA 1N6YA 3FP7E 4UFEH 1V2LT 2Z3CA 5GNDA 2XBYA 1AQ7A 5CHAB 5FCKA 3SU2A 3SUEA 2BQ7B 1JIRA 1PPHE 2G81E 2GD4B 2BM2A 4ASUD 1GHZA 2SGAA 5AFZH 2XBWA 3SV8A 1O3OA 2A32A 5FBIA 2VH0A 3PMHB 3PMAB 4F48B 2A31A 1TB6H 1ANBA 1FZZA 1HYLA 1EATA 1IQFA 1QBNA 3AW0A 1MBQA 3ZIAD 1LPZB 1J8AA 4X1RU 3GCTG 4ZAEA 2QF3A 4TT3D 1DE7H 3BTGE 3LJOA 3V7TA 3OY5U 4ZHLU 3UQOA 1EOJA 1EUFA 1DANH 1UHBB 5DP8A 1KDQB 2ULLA 2FYRA 2TGTA 5T6DA 1AN1E 1J17T 2ZU3A 3M5OA 2P3FH 1IHSH 1TOCB 3R0FA 4Y79A 3RXSA 2A45B 1FX0B 5CHAC 1EOLA 4BAMB 2PSXA 3GYLB 1E1RD 2XYAA 1V2ST 1WAYB 3LGYA 4CRBA 1C5SA 2BX4A 1SGEE 3H7TA 3VB7A 2NU4E 1YPHE 2PW8H 4YOGA 1FI8A 2HALA 1LHEH 4OS2A 1WSSH 5A09A 3SUDA 2K1QA 3M7QA 5C1UA 3P92A 3V12A 2PFEA 2VNTA 1ZPZA 1P01A 1LVMA 1O2IA 2FOMB 4FU7A 2P95A 5GDSH 4FU9A 3TK6A 3M35A 5GCHF 2ZCLP 4ZXYH 1ETSH 1SQTA 1TMBH 1Y3VA 1O31A 2IJD1 2BOHB 4LZ4B 2FZZA 3UR9A 1E38B 2FP7B 1HAYB 4NA8A 3GYMA 3OAAD 1SGFA 4ABGA 5EJ1A 3W1EA 4M7GA 4DJZB 5A0CA 3ZZCA 5C0UA 1U6QA 1THPB 1ANCA 3QLPH 5AF9H 3I29A 1WYKA 2ZFQH 3D62A 3VXEH 2J98B 3ATWA 2BXUH 1RGQA 3MH4A 1X7AC 5GIBA 5LGOA 4THNH 1E0FD 3GCHB 1K0HA 5HM9A 5EOKA 3F2FA 4TSFD 1SHYA 4O9VA 1BRBE 1C5WB 4U32A 5AVDA 4BNRA 4Y76A 4ABBA 1P9UA 2TRMA 1AIXH 1ZTLA 3KYFA 4ABDA 3ZVCA 1NRPH 2XW9A 5EG4A 1A4WH 5KEDA 2Y5HA 3RMLH 2FO9A 1HNEE 1LHCH 3SV6A 3QGJA 2Q6FA 3GCOA 1Z6EA 4MDSA 4Y8ZA 5DG6A 2XNDD 2KFWA 1DY8A 3EDXB 3LKWA 1K1IA 5HXFA 1NZQH 4ZUHA 3MWIU 3MO9A 3UPEA 1SFIA 2SNVA 5GCHG 3KQEA 2BD9A 4ISIH 4CRFA 1QA0A 1TRMA 1NY22 2BHGA 3D49H 1DS2E 2BLVA 3RXMA 1E37B 3VPKA 2AH4X 2XRCA 3AAUA 4X6PA 4CR5A 1QR3E 1D6RA 1D3TB 3GY4A 5SGAE 1LKAA 2XNIA 4DIIH 1TIOA 5DP6A 1GL1A 3T2NA 1GJAB 4O3UA 4ZMAH 1MTSA 3GCHC 1S6LA 4ZHMU 1C2GA 3MH6A 3ZVAA 1C5QA 1HCGA 1SQRA 3A8CA 1T4UH 1W3CA 2AMDA 3LC5A 1L0ZA 4F55A 1YM0A 1GI1A 1HFDA 3PM3A 4TY7A 2JIZD 2ZFPH 1QB9A 3SV9A 3ZVFA 1HIAB 1G30B 2IJOB 3FO8D 4NSVA 3GY2A 4YOJA 1O3BA 3S7HB 2ANYA 1TPPA 3MH5A 3GY5A 1LTOA 1O36A 1QGFA 5HMAA 3BG4B 1BIOA 3BTTE 5TCCA 3RM0H 1MCVA 3S9BA 1N6XA 1ZMJA 3ATIA 1B7XB 3RXIA 2OC0A 3RU4E 1Z8IB 1GBBA 1F0TA 2KR7A 1T7CA 1UVOA 3ITIA 1GWAA 3UQVA 2Y81A 1NO9H 1NN6A 1O2VA 1AUTC 1JRTA 1A0LA 2OLGA 4WMEA 3M7TA 1SGDE 3ZZ9A 5C5NA 1BTXA 2AGIX 3KEEA 1SLXB 3U28C 4ESTE 1GCDA 2K0QA 2ZPRA 4Y8YA 1ZLRA 1O3MA 3KCGH 3NRLA 1HJ8A 3A88A 3PROA 5IYTA 1C1PA 2ZFSA 2BQWB 3LGUA 4SGAE 7GCHF 2SNWA 3MU1A 4OS7A 1S0RA 1XVMA 3S9CA 1DSTA 2ZKSA 2ZPQA 2BDBA 5L2YH 1ELBA 1ZRKA 1UTPA 4HGCA 3G01A 4IGDA 3VB4A 3JZ2B 3BG4C 3NUMA 4X2XA 1DLEA 2OXSA 4YT6H 2RG3A 1O3LA 2BY8X 1IQHA 1NRNH 2R9PA 8LPRA 1TPSA 2G52A 1YCPM 3T25A 1P3EA 1NRSH 2J97A 8KME2 2LPRA 2B8OH 3DHKH 1BJVA 1BUIA 4NG9H 2F43B 1ABIH 1NM6A 4JMYA 1SFQB 2ESTE 1AE5A 1VKYA 2VJ1A 1K22H 1S81A 5B6OA 4Q7YA 2HPQH 1NC6A 1ZSJA 1GJDB 1L1JA 2ZEBA 1FLEE 3A7WA 3O8DA 1NROH 4FETA 5LH8A 1NBME 1AKSB 3Q00A 1SMFE 2KX4A 3LOXA 2ZF0H 5JB9S 5DP9A 3MU4A 3TVJB 1WQSA 5DN6D 1Y59T 4BTIB 1O2YA 1SQOA 3LIWA 3HKJB 5DKMA 1CU1A 3DUXH 4CBOA 7GCHG 3PLPA 1C1RA 1PYTD 1VITH 1Y3XA 2UWPA 4K2YA 3MTYA 4BAQB 4NZLA 1YPJH 2BZAA 2HVXA 4KKDA 1UVPA 3S7KB 2EQNA 1O3KA 4I8GA 1G36A 1FPCH 4E7RG 1ZJDA 1INCA 3UWIA 1ESAA 1B0FA 3DA9B 4B76A 2TGDA 2PLXA 4MPWA 2QCYA 5ETXA 3RXFA 3GY7A 1EZSC 3BTWE 1MAXA 2C93B 4ASHA 3SOSA 1MABB 3M3VA 1AB9B 1Y5AT 1F2SE 1ZTJA 1DVAH 2P8OB 4Y6DA 1CGJE 3U1JB 4MVNA 1SL3A 2B7DH 2UUJB 3T29A 2BY7X 4ABFA 1ELAA 2P59A 2ZI2H 5EGMA 1GJBB 3QDZB 2HLCA 4FUDA 3RXQA 6ESTA 2GCHF 1C4V2 3KHVA 3SN8A 1C4U2 5JBBS 1GHVH 4YLQH 1F0RA 1VGCB 3EE0B 2KCYA 2FDAA 3SORA 2KM0A 2R2WU 3Q3XA 5K0HA 1PPZA 5G4BA 4BTUB 4DY7B 2XBXA 4I33A 2J92A 4AC9A 1GMDF 5EJZA 8GCHF 1BT7A 4Q63A 5TJXA 2HVYB 3BSQA 1A3BH 3M5LA 1AFQB 1V2WT 4RT0A 2GJGA 2D1JA 1BMMH 4H6TA 1AB9C 4H4FA 3OTPA 1O39A 1P05A 2P8OC 1PPCE 1HAGE 3DSPA 2C90B 1OWJA 3BEFB 3S0NA 3RXEA 4DIHH 1RS0A 3P8FA 4X8VH 1W2KH 3BIVH 1ZOMA 1TRNA 1O3NA 1IQMA 4FUEA 3LGTA 1BTUA 3TH2H 3A80A 1VGCC 2BLWA 3NCLA 1L4ZA 1Y3WA 1SQAA 4A1VA 3OE7D 2GCHG 4YM9A 4MNVA 2FM2A 4XBCA 1TYNA 4RSPA 2GDEH 1TOMH 1P2KA 2HNTF 3TNTA 1TE0A 2F4LA 1P09A 1G3CA 1HJAB 2V0BA 4I32A 1SC8U 3TGKE 5E2PA 6CHAB 1AFQC 2JH0D 1RFNA 3MMGA 1HAIH 3ZVGA 3VEQB 2YMSB 1GMDG 3SNBA 4HI3A 1WU1A 3TLOA 8GCHG 1IQNA 1OHHD 1P57B 2ZGXH 1F5KU 1P2MA 3UNRA 3SNCA 3P17H 3A81A 4X8TH 4IMQA 3VB5A 1OWHA 3F9EA 1GI7B 1P2QA 1GMCF 1P0SH 3PO1B 4MQAA 1S82A 3PV5A 1PFXC 1BMAA 2TPIZ 9LPRA 2D26C 4WMFA 2FI4E 4NWLA 4WVPE 3O8BA 2THFB 4FUFA 3F2HA 1COWD 1OSSA 1BMLA 2BZ6H 2A5AA 2J95A 4Y7AA 4ABHA 3C27B 5E0JA 4SGBE
chains in the Genus database with same CATH topology
3STIA 5DGJA 2FEQH 3MI4A 1PPEE 2ZQ1A 2J94A 3PMJA 1OPHB 5C1YA 1BRAA 3MNSA 2G4UA 1O3PB 2QYIA 2VWOA 3ESTA 3RXHA 1HJAC 2P3TB 3W94A 4ZH8A 4UE7H 2CF9H 6CHAC 4TPYA 4Z1MD 4ZKOU 1GGDB 3RXOA 2YMSC 1WUNH 1BBRH 2EEKA 4IBLH 3Q77A 2Z9GA 2H9TH 1KY9A 3ZZ4A 4I7YH 3K65B 1HAVA 2ZECA 2O8WA 2R0LA 4NIVA 1TNIA 3UR6A 2QF0A 1YLCA 2HLDD 5A0BA 1O38A 2UUYA 1C2KA 1WQVH 3PO1C 2FOHA 2CN0H 1HDTH 2GDDA 3RM2H 2FYQA 4D76A 2NWNA 1KMHB 1HAHH 1K28D 3SHAH 2QV1A 2PTNA 3RXKA 1LVBA 1GMCG 3RC4A 4AZ2B 1SKYE 1AVWA 1YPKH 4B6FA 2BD2A 2KAIA 1IHTH 4X2YA 3RU4T 1MAYA 1LQEA 1A7SA 1K21H 3DT0H 1C1SA 1O5CB 3BTHE 3PB1E 3SV7A 3SW2B 3LGWA 3TGJE 4OM9A 3QUMP 3ENSB 3O8RA 2H6MA 3MO6A 3BTKE 1W14U 8ESTE 1FY4A 3E8LA 2XC4A 1EXFA 4Y11E 3SZEA 1GGDC 1SR5C 1UTLM 2Z3EA 3UB0A 1AO5A 3ATKA 1H8ED 3GY8A 2C8WB 2ZG0H 3BIUH 3RC5A 3CS7A 1F0SA 3V13A 1A0HB 3CS0A 3SYJA 1DUEA 1TA2A 2XC5A 2NU0E 3BN9A 1TGCA 3EA8A 3SU0A 5IDKA 3TJNA 1O5DH 1JRSA 1FAKH 2GTBA 1O5BB 1C2JA 1PYTC 1BDAA 1F7ZA 5DSFA 1TNKA 7ESTE 4X6MA 1N1LA 1F5RA 4NIYA 1LDTT 3LGVA 4TWYA 3TK5A 3EYDA 3ZYDA 2BLOA 2O9QA 3RXAA 2Z9LA 1KLTA 2VBCA 4I8JA 5HYOA 2CV3A 3UOPA 3BTQE 1FXYA 2LELA 1H9IE 1O3FA 4YXWD 1ZGVA 1YP9A 5C20A 3U8RH 1GHWH 2AGGX 4WH6A 3F2GA 2J9NA 4X6OA 4DURA 2B5TB 1CA8B 1FY8E 1FN8A 2G8TA 1A5GH 4CRCA 2D8WA 2K8IA 2XTTB 5J4QA 2AHME 2A2QH 1HAZB 2WV9A 1C2DA 4FU8A 1OWDA 2DUCA 1ZTKA 2KCPA 2H9HA 1XUJA 3KGPA 4VGCB 2BLQA 3ZZBA 1G9IE 3UOUA 2TGAA 1GI5A 1XUGA 2OP9A 4WWYA 3E0NB 3NKKA 2A4QA 1D3QB 3HATH 4JK5A 1MKWH 1UMAH 2ANMH 3QO6A 4K69A 4RKOB 1ZYOA 1G32B 2VB0A 4ABIA 2PKAA 3LONA 1BRCE 2ZFTA 1GJCB 1O2OA 1JMOH 4BXWA 1ELEE 1VJ9U 3RP2A 5C17A 2CXVA 2A4GA 4BAHB 1GI0A 4K3JA 2ZDKA 1V2MT 1H9LB 2WPMS 3HK6B 3T5FH 1HXEH 4JYTA 4B75A 3IITA 3SGBE 3U1IB 2GX4A 5LPRA 3QN7A 3Q3YA 3F9GA 4WJG2 3TJUA 2QXIA 3HGNA 1RIWB 1C5PA 3V0XA 4A1TA 1QNJA 3SJOA 3AW1A 3NWUA 4ABAA 3O8CA 2BVXH 3QK1A 2CF8H 4ZHAA 1GJ8B 4X8UH 1OX1A 1EX3A 4VGCC 2GT7A 2ODQA 1OP8A 3GCNA 2ZDVH 1GVKB 2V35A 1YPMH 1F5LA 3U98H 1MZAA 2ZC9H 1V2VT 2XOKD 1OYQA 2FOBA 3QGNB 1ELDE 3BEIB 4Q4LA 1KIGH 1MTUA 1RRKA 1DUAA 1O34A 1SOZA 2C8XB 4QT8C 2NU1E 2PV9B 3KN2A 3P95A 4GAWA 1QL7A 4B2BA 2QXHA 5DK1A 1K1OA 4D7FA 1IQEA 4K1SA 1FUJA 1D4PB 2ZDMA 2QY0B 1GL0E 1YGCH 5EU8A 1UCYE 1A5IA 1BTZA 4BOHA 3I78A 1FAXA 2G55A 2JKHA 1BTPA 1V2OT 1O2LA 5CMXH 3LDXH 4CRDA 2IPHA 5T1VA 1TQ7B 5ABWA 1TX8A 1TAWA 4FUBA 1GDUA 5I46H 1LVYA 1NU7B 1PJPA 1RIWC 3PV4A 1GBAA 2Z9IA 1P2JA 2SGEE 1TBQH 1K9OE 1C5OH 4JZIA 3Q76A 1P03A 4YESB 5ESTE 1J14A 2OQUA 3M5MA 4ZCNA 1TNJA 1C5MD 1GJ7B 4OGXA 5JPMH 2QF4A 1GI4A 4MTBA 2AS9A 1LHGH 2JH5D 2Z9KA 3SU4A 1VZQH 1WBGB 2XCNA 1CO7E 3FANA 2AMQA 3OYPA 1NFXA 2QIQA 1G3BA 4KTUA 5A8ZA 1A46H 1EP6A 2ZCKP 1QA7A 3FOAA 2BDCA 1SGNE 1ANEA 1XMNB 1RD3B 1W10U 2BX3A 5FCRA 2ZGHA 1VITF 2AMPA 1H8HD 1YLDA 3SI4H 1S85A 1NS3A 1GG6B 1C5NH 1M9UA 1W8BH 3EGKH 2ZPSA 1HAOH 3RMOH 1Q2WA 2EI8A 2R2MB 1QBOA 4X0WU 1EPTA 3A84A 3M3SA 3EA7A 3MH7A 4MPXA 2Z7FE 5E0HA 1MBMA 3FVFB 4E06H 2EA3A 5DP5A 1JWTA 2VINA 3BTDE 4LOYH 3CENA 3WWFA 2WV4A 4ZKRU 3MNCA 5DP3A 1BRUP 5K7RA 4UEHH 1YCPH 1QL9A 2V7QD 1EZXC 4DW2U 5A2MH 4K5ZA 3PTBA 1MKXH 4MNXA 1MUEB 3ZV9A 2BD8A 1FNIA 2GVFA 3IG6B 4OS5A 1L1GA 4YTAA 3SU3A 1AWFH 2Q6DA 2F83A 3RMNH 3MU0A 1LPGB 2QC2A 2JETB 2PHBA 3K9XB 3VG8A 4TY6A 4E05H 1A5HA 1OYTH 2M5TA 1O2MA 4R0IA 4K1TA 1ELTA 2BOKA 1GG6C 5F8ZA 1Z71A 1C9TA 1T8OA 2Y6TA 1ZJKA 2WPJS 1MQ6A 4PROA 3N99A 1VITG 1YPEH 1V2RT 1ZRBA 1EKBB 2A5IA 4Q7ZA 1W12U 1E34B 1PPGE 1TWXB 1ZR0A 2HPPH 2ZGBH 1YF4A 2FOEA 2PWXA 4I31A 3F68H 1EQ9A 3RXRA 1TGNA 3K6ZA 1EB1H 3L33A 1O2ZA 2W6ID 1UCYH 1NT1A 4DT7B 1TBRH 4FUJA 1T31A 6LPRA 1O2JA 2CMYA 1NFUA 1O3CA 2EI6A 4Y10E 1W7GH 1FMGA 4A7IB 1AGJA 1W0ZU 1ZPBA 1T8LA 2JETC 4AFZA 2WPIS 1HAVB 2V3OH 3VXFH 1RTLA 1O2WA 3N7DA 3F3BA 5B6LA 1CGIE 4MNWA 4INLA 1Z1JA 1UHBA 5FL7D 1KDQA 4JZDH 3U69H 2QN5T 5EXMA 2A4RA 1GHAF 1ARBA 4HZHA 4D9RA 2VIWA 2XWBI 3RXCA 1O3AA 1DT2A 5EODA 1O5AB 5A8YA 1EAIA 1SOTA 1C1UH 1HRTH 1ZSKA 4IS5A 2C3SA 1IQIA 4X2VA 2WPDD 1XM1A 3ZZ7A 2QAAA 1DWDH 1GBIA 1MMJN 3OSYA 4IC5A 1SGTA 1CHOF 4KGAA 1V2KT 3A7TA 4KTCA 3SJ8A 3SU5A 2FOFA 5DP4A 1WCZA 2STAE 1Y8TA 2BDIA 2BDAA 3WW7A 1MTVA 3WY8A 2M2AA 2IN2A 2H1UA 3P6ZB 2JJ1D 3KQDA 3OY6U 3TITA 1AWHB 3GISB 2G5VA 1V6DA 1QL8A 2ZTYA 1EAXA 4CBNA 3DFLA 3PWBA 4GPGA 4YO9A 1NFYA 3A7YA 4CH8B 1C2EA 1C5XB 1O5FH 1SLUB 1BBRE 3FP6E 2F91A 1DLKB 3M61U 1GHAG 4AB8A 3B23B 1O2SA 1TX6A 1EJMA 4DCDA 1GBMA 3URDA 2QXJA 2DE9A 2UUKB 5JBCS 3KQCA 2Y80A 3F9FA 4A6LA 2FMJA 1HLTH 4H6SB 4RKJB 3BV9B 2BDGA 1GBJA 1EAWA 1BHXB 1TFXA 2J4IA 5C1XA 1CA0B 1FPHH 3HGPA 1CHOG 1OS8A 3OTJE 1B0EA 1VCQA 1W11U 1TX7A 1K1JA 1G37A 2OTVA 3E3TA 4UFFH 5FXLA 1O2TA 1EAUA 4AYYB 2Q1JA 1XX9A 1MTNB 3VFEA 2Z94A 3MYWA 4XFQA 2R3UA 2YNBA 3F6UH 5FPSA 4Y71A 1C1WH 4AGKA 1OWEA 2ZNKH 2G51A 1FONA 2FIRH 1E36B 4X8SH 5T6FA 3CP7A 1QRWA 1V2PT 3FKSD 5EPNA 3SHCH 4Q7XA 2QE7D 2BVRH 3DSOA 1MD7A 4CHAB 3A8DA 3MFJA 1C5RA 2GZ8A 3N7EA 3SZNA 1BTHH 2SGFE 4Y0ZE 4Z0KA 2XBVA 1W0JD 1CA0C 1AU8A 4B74A 1P8VC 4JK6A 1WTGH 2HNTC 2ALPA 4A92A 2GGVB 2O8LA 4FVBA 1GI8B 4IC6A 1HIAA 5F03A 1F92A 1XXDA 4ABEA 2FLBH 1HJ9A 3A82A 1THRH 1MKXK 3SI3H 2PUXB 1MTNC 2A7JA 1QJ1B 3ZZ8A 1V2JT 5JBTA 2XCFA 4WXIA 4FUIA 4MLFB 2Y5GA 4D9QA 3KL6A 1C5ZB 3UIRA 2ZFRH 1QRXA 2W3IA 5E0GA 2A7HA 2FX4A 2RCEA 5GXPA 1A61H 1S84A 1IQKA 2BD3A 1XKAC 2ZGCA 1BCUH 2ZTXA 1V2UT 1UK3A 1A2CH 1GPZA 3B9FH 1PQ5A 3T28A 2PUQH 3NK8A 1VCWA 2OUAA 1J9CH 4GLYA 2VGCB 3SNEA 5T3HA 1C2IA 1VCPA 1ELGA 1SGCA 1P10A 4Q2KA 5EXLA 3W95A 4XBBA 1QTFA 3BEUA 5FPTA 1SBWA 4WF8A 4U01A 4CHAC 3TIUA 7LPRA 4X1SU 4ZKNU 3A83A 4OS6A 3F0OA 3LH1A 3MOCA 4X1NU 3STJA 3M7UA 1GI3A 1GVLA 1O5GH 3UFAA 1AE8H 2WSSD 1SLWB 4K1EA 5EPYA 1DFPA 1QJ6B 3UY9A 3PYHA 3TGIE 1QY6A 3SJKA 1DWBH 1KXBA 1UCYK 4UFGH 2ZHDA 1TMTH 2BVSH 3SQHE 5F53A 4ISHH 3KNXA 2VU8E 4JZFH 1AUJA 2VWMA 1NESE 3KF2A 2GP9B 2ZU4A 1O2KA 1O2XA 1CBWB 3A7ZA 4ABJA 3QZRA 1GJ5H 2XC0A 1BTWA 1GJ6A 2BY9X 3PMBB 5FX5A 2Y82A 2Z9JA 1HXFH 2VGCC 3ATLA 1TRYA 1GJ9B 1DSUA 4CREA 2ODPA 4DOQA 1K1NA 3FP8E 5HGGA 1OWKA 5F6MA 2SGPE 3K2UA 1TPAE 2FOCA 5FPYA 1BMFD 3UREA 1AZ8A 1IAUA 1QURH 4B71A 1Z8JB 1GHXH 1S83A 4TYDA 1HUTH 3AK5A 2ZHFH 1AKSA 2FI3E 5DP7A 4YT7H 2ZWLH 4Q80A 1O2HA 4FXGH 1XUFA 1FY5A 1GI2A 2AGEX 3RU4D 1O3GA 1ZGIA 4INHA 1WOFA 1NRQH 1EP5A 2BQ6B 2Y7XA 5A8XA 5LPEA 5EW1H 3URCA 1P2IA 4D7GA 5FX6A 1Y5BT 1LVOA 1BA8B 1THSH 3DD2H 1EB2A 1DDJA 1PQ8A 1T8MA 1C2FA 1CBWC 4GUXA 2BD7A 1C1QA 1O2PA 3B8JA 2I6QA 2QA9E 3A85A 3U8TH 1EASA 2VWNA 2WINI 2F3CE 5DPAA 1O2NA 2QXGA 4GCHF 1NFWA 2J5UA 3RXPA 4HFPB 3ZZ3A 2A7CA 2PR3A 4WH8A 1ZMNA 2AEIH 1XUKA 4CR9A 1QB1A 1P06A 1BITA 2WYJA 2ALVA 4I8HA 4OS1A 2F9BH 1C1NA 1K2I1 2QF5A 3UTUH 4AFUA 1G3EA 1ZZZA 1QQ4A 4A5TS 4XBDA 1MD8A 3TPIZ 4H42U 1CQQA 3RXBA 4NWKA 2WPLS 2O8TA 4K8YA 1P04A 4BANB 1D3DB 1CGHA 2FX6A 3N7OA 1KXCA 1QIXB 3OX7U 1LO6A 1GBCA 4HTCH 3SJ9A 1PQ7A 3ZVDA 1GCTB 3MHWU 5H4IB 1FIWA 1F0UA 2TBSA 3PTNA 3P70B 3T62A 1O3IA 1EJAA 1NBMD 1SVPA 1Y5UT 3E6PH 4KP0A 1QRZA 1GJ4H 3S69A 4AX9H 1BB0B 1TPOA 2Z3DA 3UNQA 2GMTB 4LK4A 1KXDA 4GCHG 4XD7D 3RXJA 1DPOA 2VVCA 1TQ0B 2Y7ZA 2FODA 5CE1A 1C1MA 3IWMA 4AN7A 5C3NA 2AFQB 5DJ7A 4MPVA 4AFQA 1TNLA 2J2UA 4BXSA 1QB6A 3HK3B 2C8YB 1ETRH 1H4WA 2BDYA 1UTQA 1P2NA 2H9EH 2Z6BD 1QFKH 1ORFA 5EXNA 4Y7BA 4AORA 2NU2E 1AVGH 4R8TB 1FY3A 3D23A 1C5TA 2A0QB 2BDHA 1P2OA 3A8AA 1GCTC 1XUHA 1C5YB 2FXRA 1SI5H 4JYUH 2CGAA 1UVSH 4FUCA 1KLJH 3SJIA 1YBWA 1SGQE 1GMHF 1H9HE 3MU5A 3E16B 1YPHC 4A1XA 3FN8A 3M5NA 5JYIA 2GMTC 1L4DA 2JJ2D 3VB6A 1QHRB 1Z6JH 1UTOA 1IQGA 2VIVA 3TU7H 1O3HA 1W13U 1JIMA 2ODYB 2KCAA 1PQAA 2SGDE 3DFJA 4B2CA 1L1NA 2ZHQH 1GBDA 4ISOA 4BTTB 3L6PA 1LMWB 4OGYA 1A0JA 2C4FH 3SGQE 4JCNA 1GBKA 2ZFFH 4TPIZ 4RI0A 2GV7A 3NZIA 1UO6A 1D9IA 3GICB 3ZZ6A 1ELVA 1DITH 4INKA 1A3EH 1BBRK 4JZ1A 1HGTH 4U2WA 1DICA 5IK2D 3PRBA 2OBQA 1AVXA 1G3DA 1O2UA 1IOEA 4XDEA 3U9AH 2NU3E 2WYGA 1D3PB 1C5VA 1XXFA</